5HGTA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92t at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYTYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92T at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5hgtA00
1SYFA 1EYCA 2EY1A 4F7XA 2F0TA 2SNSA 4ME5A 2NUCA 5CR3A 2OF1A 4HMJA 3U9OA 3EJIA 5EKLA 3T13A 2EXZA 1EY9A 2F0VA 2F0WA 2F0PA 4K8IA 1JORA 4EQOA 4K8JA 3SHLA 2F0LA 2EY2A 2EYLA 3ERQA 3MZ5A 2F0MA 1SYBA 4K5VA 3SXHA 3MXPA 1JOOA 5DAUA 3V2TA 2PW7A 1SNDA 5IOCA 5CV9A 5EGTA 1ENCA 3QB3A 1EY5A 4H7BA 4IALA 4ZQ3A 1SNMA 3DHQA 4IUNA 4PMCA 5C3WA 3EROA 1U9RA 3C1EA 2RDFA 1IHZA 3D8GA 2F0DA 2F0OA 2F0SA 4NDXA 1JOQA 1STAA 1EZ6A 2F0UA 4KTAA 1ENAA 5IGCA 5KEEA 1TQOA 4ID6A 4QB4A 1A2UA 1F2YA 5KYLA 4TRDA 1EQVA 5C6AA 4ZUJA 5C4ZA 1SNPA 2PZTA 4QMGA 5C5LA 1KABA 1STGA 1SYEA 2F0JA 4KJOA 4J1MA 4EVOA 1SNCA 1EZ8A 4KY5A 1SYDA 3HEJA 2F0GA 5CV5A 5IGEA 3RUZA 1SYGA 3TP5A 3MHBA 2EYFA 5M9OA 2PYKA 4DFAA 4ODGA 4DU9A 3PMFA 3NK9A 2WACA 4J6HA 5I6YA 5IODA 2PQEA 4YIJA 3SK4A 5J39A 4OL7A 3OWFA 1STHA 2F3WA 1A3TA 4ZUIA 4DF7A 4F8MA 2EYJA 2ENBA 2F3VA 2M00A 4DGZA 4KD4A 1A3VA 3R3OA 4KJNA 5KIXA 1SNQA 3ITPA 4K2KA 2HQEA 4KV6A 5JAVA 2F0QA 5CV8A 3OMGA 2F0NA 3TP6A 1EY6A 3VA5A 2QDBA 2F0IA 3BDLA 4N9TA 4K6DA 3NUCA 5EKKA 5CGKA 5CV6A 5CV4A 1SYCA 1F2MA 2KHSA 4QF4A 5E3FA 1AEXA 4I65A 1KDCA 4KY7A 5F2DA 3SK8A 5KGUA 5IGBA 5JOBA 5KRUA 5J22A 1II3A 4LAAA 4G57A 2EYMA 2EYHA 1EY4A 3NXWA 2EYPA 4R8NA 3S9WA 5CV7A 3D6CA 4PMBA 5C4HA 2F0KA 3NP8A 5HURA 3MEHA 4S3SA 4K5WA 5C3XA 2PZUA 5NUCA 5IIFA 3SR1A 5IGDA 1NSNS 2F0EA 2SNMA 1KDBA 4B9WA 2EYOA 3E5SA 3EVQA 2KQ3A 3D4DA 4RKLA 2EY6A 4KY6A 4RKBA 2PW5A 2RBMA 4KD3A 1NUCA 5DEHA 3LX0A 5C5MA 3NQTA 1TT2A 3P1HA 4HMIA 3T16A 3NHHA 3QOJA 4WRDA 4B9XA 2LKVA 1EY7A 1SNOA 2RKSA 5I6WA 2F0FA 4NKLA 1STNA 2PZWA 5ISRA 1KAAA 1JOKA 4E6IA 3H6MA 3TP7A 5IGFA 3HZXA 3OSOA 4K14A 3TP8A 1EYDA 4MIUA 1EY8A 1KDAA 1EY0A 1RKNA 5J1ZA 1F2ZA 2OEOA 3OMCA 4IZ8A 4HTHA 4K5XA 4EQPA 5CC4A 3TMEA 5I9PA 4PNYA 3BDCA 1A3UA 1TR5A 3C1FA 3QOLA 4EQNA 5IGGA 5HGTA 5K5PA 4K2LA 1STBA 1EYAA 1STYA 2F0HA 2O4XA 2SOBA 3D4WA 3DMUA 4NMZA 3SK5A 2EY5A 4NP5A 4WORA 3SK6A 3P75A 5I9OA 5KYIA 3MVVA 4KHVA 4N9PA 2OXPA 1A2TA 5E1FA
chains in the Genus database with same CATH superfamily
4JI0Q 1I4XA 4ME5A 1EIFA 1I3QB 1WFQA 4AQYL 1B3AA 1EU4A 2Q2IA 3SVMA 2BDOA 4Q0FA 3SXHA 5C3EH 5GADC 1LTAD 1K8AC 1RF2D 4O1NA 1E2ZA 1K83H 5JEAG 3UI2A 2HUGA 3A7LA 1D5XC 4XT3B 3Q0AA 3ONAB 1PYSB 1WTHA 1V1PA 5CORA 3WOEA 2K4KA 1XNQQ 1A2UA 2KBNA 3HOVB 5AJ3Q 5C6AA 1JE5A 1LT6D 4LF9Q 1O7LA 3PUVA 2KEDA 1PXUA 2I5MX 5E4WC 2R92B 2YU9B 1CSPA 4OX9L 3AB9A 2PYKA 3D6WA 2YV5A 4HJ8A 1DXMA 4BBSH 3OWFA 4FNFA 4OO1I 4RFBA 2I5HA 3BS1A 3E0JA 4C3JG 4GOPC 3ITPA 2CW0D 1SJHD 1Y1WB 4DV1Q 3TP6A 1EY6A 3M4OB 3BDLA 4JI2L 3CC4A 2LSSA 2Y0SE 2NVXB 4GLXA 2JJQA 3G4SA 2L4NA 1KDCA 5F2DA 2IX3A 4K0KL 5JEAH 1II3A 4LAAA 4FO2A 4XQJA 4R8IA 1SAPA 2ES2A 2F0KA 1GD7A 4IPGA 1CK1A 2QA4A 4X64Q 5NUCA 2K03A 1EWHA 1B1ZA 2EYOA 4Y7NH 4AYBE 4ABNA 5I6WA 4DV2Q 4X62Q 5IGFA 4JI3L 2FINB 4N8X1 4C3JH 3E9IA 1STEA 3FDTA 1EOTA 1S5FD 3GTGH 1LTRD 3CKIB 3MFGA 2DNEA 3DXJC 3S1MH 3NBIA 3P75A 5KYIA 1E24A 1JQYD 1PH2A 1EYCA 3KLWA 4DR4L 4QGUA 4DV7L 1LACA 4WFN3 4IURA 4XYQA 2F0PA 4C2MB 4YCWA 1I4PA 5IT9c 2R7ZG 3ERQA 3X3NA 3QJYA 5IWAQ 3MXPA 1HPCA 4I7AA 2DUDA 1FJGQ 1O80A 1JCKB 4FVMA 2E2HH 5EBCA 1JE4A 2RDFA 3CHBD 1L1OB 1A6XA 2KECA 2F0SA 1YNNC 3L0OA 3QIAA 3GTMB 4LF8L 1VMCA 1PVOA 3CQZH 1SYDA 3HEJA 3HP3A 1BKBA 1NNXA 5GAEC 4RGMA 4CKEA 3WOFA 3DWQA 4YIJA 1I4GA 2A6HC 2LS01 1IBMQ 1STHA 2VS1A 3PSIA 3TS2A 2L5TA 3I73A 1K3BC 2M00A 4HN7A 1CTMA 1RODA 4RGOS 4DUZQ 4RA8A 1ET6A 1K83B 5M5XH 1CUKA 1HNXL 3KYHC 5CGKA 1BVSA 2C5CA 2R7ZH 2OCEA 2JN4A 5I2YA 3UDGA 2D2CC 4L6TB 1U4PA 2NYZD 3CAMA 1MBYA 1GJXA 1VQIA 3GTJH 3CW2C 3E9HA 3KLRA 2IW3A 3NXWA 2EYPA 2RVLA 2RCFA 2EJMA 3S17B 3RMHA 2I07B 1ONLA 1Z9FA 2ZXPA 1Q90A 2EDGA 1TWHH 4BBSB 1NR2A 3AU7A 3D4DA 1IKMA 2LXJA 4AYBB 4JBKA 2G9DA 3I4MG 3EFXD 1VQHA 2SEBD 3JAMc 4RWSC 2JA6G 1B3QA 3I91A 3J81i 1JOKA 3GTOH 3OW2A 1CQFA 4DR1Q 3K0YA 3N6RA 5C0XJ 4DNTB 4CJ0B 3TMEA 2GN5A 4X6AH 1NR4A 4JI7L 2KENA 4EQNA 1PRTD 2QGQA 3H94A 4K2LA 5JEAJ 3T16A 5C4JB 4HJ5A 3RZDB 1Z7TA 2EY5A 2Z0SA 3FVQA 4F7XA 4DV0Q 1SROA 2EY1A 3K80C 2F0TA 1MIUA 2B3GA 1VQJA 3A0JA 5K36G 1B44D 3AYHB 3IAYA 4L5TA 3CMEA 1TWCB 1GUGA 4Y7NB 2VQEQ 4GNXC 1TU2B 3MZ5A 1SYBA 2RCNA 1YBYA 4FF3A 1EY5A 4IALA 5FOBB 1PDQA 3OW7A 4POFA 2MNAA 1FNUA 4ZKCB 4C3JB 1EZ6A 1BDOA 1BNZA 5DM73 1Y8OB 1QB5D 2JA6H 1CI3M 4JI6Q 2CVRA 2EJFC 3I8ZA 2EXDA 1KABA 1HXYD 3S1MB 4EVOA 4GLAC 3ND8A 2R7FA 1SMYC 1X65A 3CPFA 2EYFA 4GKJQ 2PQEA 4FF1A 3L7ZC 3AFQA 4ZUIA 1YHBA 4DXGA 1L0YB 4XTCS 4HJ7A 5K36H 3GTQH 4X66L 4LFBL 3KOJA 2E2HB 3NPPA 3HOYG 5M3FB 1RL2A 3D0FA 1Q46A 3U4VA 2L55A 2OQKA 4IQZA 3BG3A 2JA8G 2GA4B 4LUZA 1OXXK 1S5BD 1V1PB 2V1CC 4KI0A 3CQZB 2N8NA 1CFMA 3KBGA 3MEHA 4WJWA 2ICIA 4OIKA 4P72A 5IGDA 2K05A 4IN3A 2N88A 1PHJA 4CDEC 5KEEA 1G6ZA 4DR2L 4WJ4A 1SJED 1A15A 1QNKA 3NQTA 1HA5A 3RR5A 1OXVA 1KAAA 5ELFA 1LT5D 3TP7A 3VYRA 2K50A 3MXNA 5M5XB 1LTBD 4K14A 4R1JA 2OQ0A 4CHTB 1A62A 3CCJA 2K32A 2KCCA 2DJGC 3W5OA 2A68D 2D62A 1X3GA 2K14A 1BCPB 4NMZA 3HOYH 4RCOA 3PIPA 5CBEE 1VQBA 1JC7A 4PZ7A 2SDFA 2LMCB 2Z8LA 5E1FA 2JA8H 5CR3A 1E1TA 2CWAA 1H9KA 3D3RA 4IUPA 3KUPA 3OWEB 1SE2A 1TWHB 2EOTA 1XPOA 4AH6A 1A8VA 2RHQB 1VQKA 2HDMA 2VY3A 1I94Q 2IWHA 2ZT9C 4GZYC 4IPCA 4RAUC 3K81C 3GTOB 1KNAA 5EPLA 1KIXA 1WCMB 3Q24A 1D6EC 1ENAA 1VQPA 1V1OA 4QY7A 2VQFL 4ZUJA 1LTSD 4DK6C 2ID0A 2AQ1B 4KHPQ 2D0OA 2GVBA 2FMCA 5EQ0A 3A56A 1PH5A 3RUZA 2K5HA 2UUCL 5M9OA 4JCVE 1KXLA 2E2DC 2L12A 3OOCA 1W6KA 1VQFA 1N36L 1OTCA 1H9JA 1SFOH 2ENBA 1VQOA 1SN8A 3MC0B 2BE5D 1Z47A 3R3OA 1R9TH 1AE3A 3KLSX 3F2CA 2XWJB 3HOZG 5CV8A 4YY3Q 4DKAC 4K6DA 3ULPA 1KLGD 4LF7Q 2KUMA 1E2WA 2AWNA 1S4ZA 3KF6A 2JA6B 3PCOB 3VYTA 2UUAL 3FRPB 3J81E 4KLKA 1EY4A 2RSOA 4R4CA 4B3RL 3D6CA 1EIGA 1MJCA 3MXGA 3NELA 3NEMA 5LMUQ 2UXCL 3RN2A 1D5MC 5IIFA 1YEZA 3TEHB 1JR0D 5JJZA 4L63B 1DOMA 1CHQD 2UUBL 1EY7A 1QG7A 4ZKBB 3HS0C 3GTQB 3FKIG 1EQTA 4R4QA 5FJ8G 4LF4Q 5LL6S 1JICA 2J4XA 4QUCA 3HOZH 4DV6L 3BVMA 1QCBD 4TSSA 4M1UB 1I3QH 3DWPA 4HJAA 3S1NB 3A8KE 4J15A 4HIKA 2NUCA 2CKZB 3CCMA 1IW7D 4G7OC 4LFAL 1ET9A 1G291 3X3MA 4JI5Q 1Y1VB 3K57A 2CQOA 3PF4A 1EWCA 1LUZA 4B08A 1XJVA 5BN3A 4CKBA 5EGTA 3I56A 1VQMA 4DV3Q 4ME3A 4X65L 3T1YL 1PTOC 4LFCQ 4PQXA 4P75A 1F2LA 2JK8A 3FKIH 3R2TA 1PTOH 2IX1A 1BUVT 3AEVA 5FJ8H 3R8BA 3QWNA 5T1IA 2JA8B 3A8JE 4OWWB 2A69D 3PMFA 3SEBA 4GKKQ 5I6YA 2R3ZA 1BQQT 2EE1A 1VQ4A 4JI8Q 4BXXG 3M4OH 2NZOA 2Q8IB 4JI4L 4QJFA 2HIVA 4KJNA 1YI2A 5LMNL 2GVAA 2P5ZX 2HQEA 2A5HA 5IT9L 3VR4A 3OMGA 4A3DB 1JJCB 3PO3B 4RGTA 1DONA 4DV5Q 4JV5Q 3CRLC 3H3VH 3PV0A 1J6QA 4GS3A 1PZKD 4DAYA 4DV4Q 4QCLA 2RHSB 4YHHQ 3I7FA 3KF8A 2NTSA 2HCIA 3CF5A 1TY0A 2A74C 1IL8A 3Q8DA 2AQ3B 4DR3L 4B3SL 1J5EQ 3STBC 1J9OA 5IYBH 4JI1Q 3J81L 3BVGA 1QUQA 2EVBA 1SFOB 4KN4C 1B9MA 2VNUD 5ELBA 1X3QA 3NHHA 2A6ED 2MO0A 1G2SA 3M7GA 4HIOA 2HDLA 3KK7A 3W1BA 1W2BA 4BXXH 3SGIA 4C1NI 3M4YA 1D2BA 4IUUA 1UNSA 3LWEA 3MTSA 2MO1A 1EYAA 2MUYA 1IBKQ 2QF7A 4GN4B 1HNWQ 1V9PA 5C4HA 4C2MH 3GTPB 3CCVA 2Y0SG 1L1OC 1SE4A 4IO9A 2XGTA 4PG3A 1VMPA 3HKSA 4F88A 2KCMA 5M5YH 1OXUA 3DHQA 2FFKB 4IUNA 4UP7A 4DPGA 5C3WA 3C1EA 1QNUA 1XMOQ 4H02A 4BA2I 1K0RA 2E2IH 3F8TA 1E2VA 3HOZB 3MXNB 5E7NA 1GO3E 4AYBG 3NWSA 1TS2A 1EQQA 2HQLA 3OTOL 4DN4M 4IJLA 4BY7G 1Q8IA 1CA5A 1F9PA 4NB3A 4UP8A 1H9SA 2H1EA 2E8GA 1S5CD 1SYGA 1Q86C 4U68A 1PLFA 5HGQA 1KRSA 4OL7A 1BO0A 1U4LA 1E7ZA 1G6PA 1OXSC 4AQYQ 2N78A 4F8MA 5KNDA 4DUYL 4N8FA 2AMCB 2Z4IA 4KD4A 2C9OA 3FPPA 1L0XB 2F0QA 2HIXA 3OIQA 2BA1A 1EWIA 5JVG3 2EQSA 2M9VA 3S15H 2K5VA 3KDFA 1PH6A 2Q2HA 5IGBA 1JWSD 3E3XA 1XNQL 3FKIB 5J22A 1Y69U 1PTOB 3S24A 3S17H 2NZ1D 3VDYA 3FEWX 4G4KA 1M90C 2ATWA 4LF9L 4OO1G 4YCUA 3KBXA 4OX9Q 4QUFA 4UP9A 2F4VL 4BY7H 3RN5A 1S40A 1D8LA 1E3PA 4CJ2C 4WRDA 2CW0C 5T1GA 1YZ6A 3T53B 3CCSA 3T56B 1GUSA 3V05A 4ZK9B 4DV1L 4JI2Q 5C4JH 2A1AA 2IX0A 3RZDH 1JORA 1JB3A 1CKNA 1ZYRC 1X9NA 4HAEA 3QOLA 5C44G 5HGTA 4K0KQ 2L0CA 3BU2A 1CZWA 2KVMA 1HQMC 4X3UA 1TWCH 1G8ZD 2A8VA 2UXBL 2EPBA 4HMJA 5M3FG 1IL2A 1LABA 2XN9C 1Y8NB 2Z6BA 1PH4A 1AFPA 2F0WA 4DK1A 1H9RA 1JJGA 3T51B 4OO1H 1SR3A 5JJKA 3F2BA 1UEBA 2PW7A 3NTKA 3HG9A 4H7BA 1U0LA 4JK1C 2PPBC 4KN7C 4LF5L 3I90A 3PQIA 3M3YH 1STAA 3C3LA 1B9NA 4A4IA 3K5NA 3S2HB 4LWCA 1VQ7A 1EIYB 1HTLD 2F0JA 4KJOA 5BR8L 2B29A 4KY5A 2ZJRA 3GTKB 4K6LA 5IGEA 4MTKA 2WAQE 4L5RC 1GXDC 5C44H 2WACA 3HGBA 1ESRA 3CD6A 4DR4Q 3UE0A 3A5UA 3MXUA 4DV7Q 1LT3D 2EYJA 1F9QA 5M3FH 5M5YB 3CCQA 2ZJQA 3VA5A 1VQNA 3CCEA 3DEPA 1FJGL 4C56C 4DXFA 1YHAA 4GNXA 1XNRQ 1TXYA 4A3BG 1C48A 1DOLA 1LT4D 2E2IB 1HRJA 1I4HA 5KGUA 1WTQA 1EL0A 3J81c 2XVSA 1ILQA 2R93H 2PMZE 4A3JG 5CMDA 2I46A 1UEAB 4A93B 2DNCA 4DNIA 3PUYA 3NTHA 1WCMG 2HHHL 4R4IA 1YNXA 1KDBA 2QW7A 3ZJYC 3E5SA 1NY4A 2KQ3A 3GV6A 4RKBA 4OELB 4RCNA 3TS0A 3FHWA 4HMIA 1U4RA 2ZTDA 3JC66 2D5DA 2RKSA 4EX5A 2KHJA 2A6HD 1BCPC 2Y0SB 3ERSX 1I6HH 1NMFA 5FLXE 3J80i 3DWAA 3HZXA 4A3FB 2BH8A 1HNXQ 1VS0A 2B39A 5D65A 1K8OA 3S15B 2PNRC 4K5XA 1MI2A 1UUPA 4DR7L 2SOBA 2F0HA 4BA1I 4NP5A 5GAGC 1E1OA 4R8NA 4A3BH 3A55A 1TWAH 1SYFA 2H4OA 4DAYB 1JB7A 3U9OA 3GDEA 4BY7B 2CWPA 2IPKD 4CDFC 3G6EA 4EQOA 4A3JH 2F0LA 4HR7B 4TKOB 3S2DH 3VR5A 1C9OA 3NBHB 1WCMH 5DAUA 1JT8A 4YWMA 3BDOA 1IHZA 2RSNA 2F0UA 1H9MA 1I4RA 1BBXC 1PRTC 3K5OA 4DR1L 2TSSA 1SNPA 2PZTA 3OYYA 4JI7Q 3M7NA 1BBWA 2PO4A 1DCZA 2Z9HA 2NTTA 5CV5A 4JYAL 3K7AB 3TP5A 2Z6KA 2BCOA 2K5QA 3BVZA 1GUNA 1NBWA 2XSCA 3IKJA 1H95A 2UU9L 4CDCC 4IPHA 1X56A 2F3VA 2N55A 4OHJA 1ENFA 4R4TA 4DAMA 2QCPX 1Q1BA 3U4ZA 4HIMA 1UE6A 5E4XA 1GUOA 4N9TA 3M3YB 3G48A 4J8QA 3SE0A 3CC2A 1EIHA 2KHSA 2XIWA 1Y1VG 4KY7A 2KCTA 4XXEA 1HA6A 3UE1A 2WB1E 3I3CA 5L37A 1F9SA 2CH4W 3G71A 4G7HC 2PMZB 2JEBI 3TBIB 4QL5A 5C44B 3I2ZA 3LWUA 4KKTA 1IYJB 2VL6A 5FO8B 1DM0B 2QILA 1BR9A 2WKDA 1N33L 5EAYA 1Q82C 4FDBA 2JXMB 4P71A 5FO7B 4NXNL 1HCZA 2N3SA 4X66Q 1GHJA 1A0IA 3GV3A 4LFBQ 2E2JB 4LF6L 5J1ZA 4HTHA 5I9PA 4L5QA 3S1NH 2J0TD 4C3IB 2X6GA 3D4WA 1D1IA 5JAVA 5JPMC 5FLXL 5C4XB 2PNHA 1GUTA 3KDFB 3SK5A 4A76A 2FJ2A 4UHVA 2R93B 4A3DG 2SNMA 3KJPA 1Y1VH 3CXCA 3PO3G 1IBLL 1F77A 1EEID 2OTJA 1S72A 2L15A 3BJUA 1SMXA 1PFMA 1PH3A 4B3TL 3O13A 4DR2Q 4A3KG 2N49A 2ZM6Q 2B2TA 1QOHA 2B2YA 5CV9A 1YVCA 3HOUG 1GUWA 2LFNA 1I6HB 3PO2B 1MGSA 2F0DA 3I4NG 4XQNA 4NDXA 1JOQA 4IFDI 2R6GA 1F2YA 1UE1A 5KYLA 1EQVA 2MHVA 2F03A 1QWYA 3I4OA 1VCIA 3RD4A 4A3BB 2D0PA 3PUZA 1TWAB 4DR6L 1L2FA 2E5LL 1BCPF 1ML0D 3GO5A 1C0AA 1SLJA 3NK9A 5IODA 5J39A 3K5LA 3S1QH 2VB2X 1X32A 2NN6I 4DF7A 3TDQA 4A3DH 4A3JB 2Q2TA 2OWOA 3PO3H 3S2DB 1PH1A 4KV6A 1GKHA 2QDBA 3CP0A 2JA7B 1KHIA 4A3KH 2B8FA 4APVA 5CV6A 1Q3LA 3PUWA 4I65A 1SE8A 4A3IG 1XMQL 3HOUH 4OIJA 1DGSA 4BWGB 2YTXA 2WB1B 2VQFQ 1N32L 1GHKA 1C8CA 3I4NH 3J80E 1PRTB 3J7AF 1D1KA 1N34L 5I2XA 1WJJA 4ILWA 3DM3A 1HNZL 1VF5C 1BOSA 4KMUC 1Q12A 2RBMA 1FR3A 2BE5C 5C5MA 3LX0A 1JWMD 1SEBD 3TREA 1TT2A 5C3XA 5IE8A 1PH8A 1SNOA 4CGYB 3T1HL 1STNA 2R7DA 1E22A 3W1GA 1Y14B 4HCSA 3M9BA 1K0SA 1Q81C 3E0EA 1D5ZC 4YY3L 3GTLB 5CC4A 1ICWA 2E74C 3BDCA 1C7YA 4FXKC 2UUAQ 4A3MG 3DMUA 3GTPH 2Q2UA 4H13C 2CQAA 2KEEA 5GQOA 4A3IH 4B3RQ 3M4PA 3MA2B 4LW1A 2UXCQ 5J3BA 3PIO3 2Z1CA 5EKLA 1TVXA 4DK3C 2YYZA 2MJ8A 1KTKA 2EY2A 3BZKA 2YTVA 2UUBQ 5LMNW 1HZCA 2VUMG 2Q8RE 1ZKOA 1U9RA 3J81j 4CBVA 3G7LA 2B2VC 1VDZA 4ID6A 4QB4A 2NVYB 4MHEA 4MTNA 2FXQA 4QMGA 1SYEA 4JOIA 2PCFB 4RHRA 4Z9CB 1TS4A 3HKZE 2KOLA 3M4QA 4B3ML 4R4OA 1LV9A 2K75A 3CCLA 5FO9B 3S14B 4A3MH 1YIJA 3J7YW 4LFAQ 3CCRA 3OPOA 4JI5L 1EQRA 2WIIB 3ZYYX 4A75A 4DA2A 3VA7A 1L1OA 3HFZB 1HR0L 1DYQA 4X65Q 1HFGA 4HSPA 5IYBG 3T1YQ 1ICFB 4WJ3M 1AEXA 1RTNA 4JBWA 2VUMH 4CDDC 3R93A 3SK8A 2WP8J 4LFCL 2MQHA 1MKHA 1K28A 2EYHA 5JJLA 5CV7A 4PMBA 1RCVD 1EUJA 1XYIA 3RZOH 4POGA 4IOCA 1KLUD 3S1QB 2BH2A 2EY6A 1SRUA 3TN2A 4HSVA 3DLLA 2UXDL 3H3VC 3E6ZX 1NAPA 4JI4Q 4IPDA 5LMNQ 1PZJD 2J7ZA 5FLXc 3HOXB 1QJOA 3H6MA 3CU7A 1ZEQX 3J7A5 4A3KB 4P74A 2ASBA 1BBUA 1JMCA 1YNJC 2XTIA 4EQPA 2B2UC 3HOUB 1A3UA 1RIPA 5JVH3 4JV5L 3PUXA 1STBA 3I4NB 2WFWA 4JBMA 4JC0A 1NE3A 4LUOA 3MVVA 1CQVA 3L3OC 1RJTA 4YHHL 4B3SQ 4DR3Q 2NVTH 3I4LA 2BOSA 1DD2A 4L5SA 4K8IA 1YJ9A 4JI1L 3ER0A 2RDGA 4K8JA 3CMAA 2A6EC 4K5VA 1T5EA 5ELCA 3STBD 2IY5B 3IFDA 4A3EG 2CHBD 2B2WC 4TVAB 3F2DA 4GOPA 1X55A 4A93G 3S2HH 2F3IA 4UY8C 2PI2A 1Z6HA 2F0OA 4KTAA 3L2PA 2F52A 3RLOA 3GTKH 1PYBA 1QZGA 4OONA 1QE6A 1C4QA 3VYSA 1KNEA 4DR5L 1CHPD 4A3IB 3MHBA 3N52A 1IBKL 2IL8A 2AQ2B 1AZQA 4A3FG 5EJWA 5BN5A 2EZVA 4O0AA 2JP1A 1M1KC 1VQLA 5ELNA 2K01A 2X69A 2H5XA 2L11A 4NXML 1ZXTA 4FP5D 1CZGA 5GAHC 2A73B 4L8JA 5IYDG 4PZ8A 5CV4A 1HJPA 2K5WA 4A3EH 3W2DA 3M85A 1NTGA 1FNVA 4BY1B 5KRUA 2LY7A 5M5WH 1F9RA 4A93H 2EYMA 1HHVA 2Q8TA 1HZ9A 3OTOQ 3EBEA 4JI0L 1WOCA 1XTCD 1RHPA 3TRZA 3KJOA 1AH9A 2JYOA 1FYCA 3SR1A 1NSNS 4A3MB 3EVQA 4KY6A 1VQDA 1PH9A 4LUVA 5DEHA 1B2TA 1QILA 4A3FH 4DUYQ 1W3SA 3BZDB 3DM1A 2WAQG 1AP0A 1O7ZA 4BBRG 5C0XI 5C0XG 1HTPA 2K7VA 1KDAA 5AJ3L 2IT1A 1F2ZA 1PZID 1K8MA 1QVFA 2VUMB 4OEMB 1TWFH 3Q22A 3C1FA 3UDXA 3TZDA 4HIDA 3S1RB 5IYDH 3FP9A 3SK6A 4CKCA 2B63G 2MGSA 1VQAA 1X3EA 1WTPA 3URYA 2K5NA 1PTOF 2NB0A 1G91A 1NMGA 4ZLTF 3RZOB 3PF5A 4IUTA 3T13A 1PA6A 1EY9A 2I0QA 2F0VA 2F4VQ 2ZTEA 1SBBB 1SDFA 3S16B 3SHLA 1AW7A 1WTXA 1PH7A 4BS9A 1W6JA 5G3LF 1SE3A 1X6OA 4X3SA 3EROA 4C3HG 1WTWA 3EN2A 4DAPA 2CH4A 3AQQA 1RDPD 5FK9C 5IGCA 2JA9A 2KA7A 3KF6B 3A8IE 3K7AH 5C4ZA 3K59A 5C0XH 4BBRH 5JPNC 1G51A 5DNFA 4J1MA 4OWXB 2F0GA 1T9HA 1ZYRD 4X64L 4ODGA 2NVTB 2UXBQ 3SK4A 1ASYA 1KRTA 2XNAC 2C35B 1Y8PB 4EQ5A 3A74A 3SDZA 2B63H 3NTIA 4DV2L 4C3IG 2NWGA 4DGZA 4PV1C 3IFTA 2IHFA 5C4XG 4X62L 2JE6I 4JI3Q 4K2KA 1TWGB 1EEFD 1I5FA 2R93G 1S3OA 1WTOA 4QIWE 2ICEC 3NUCA 4EGVA 4LF5Q 4JG2A 1K73C 4C3HH 2PI2E 1LYLA 1UWVA 5D14A 3J80c 1HZAA 1CT1D 1Q1EA 2E76C 1B4OA 2L9HA 1IYUA 5BR8Q 3PO2G 1AZPA 1PFSA 3H09A 4OXPA 1BF4A 1IXRA 2CCZA 4RHSA 3C2PA 5IWAL 2QEJC 1TS3A 4TQUS 3MAQA 3P1HA 2OTLA 1XXGA 5DLQE 1O78A 2E2JH 3LNNA 2PZWA 5KNCA 3GP7A 3TSSA 3OSOA 3Q23A 4MZ9A 4C3IH 3FPUB 5KNBA 5IP9G 4MN3A 5C4XH 4Q5VA 5ISRA 4LF8Q 3OHXC 1KL9A 1YNND 4A3EB 4PNYA 1PFNA 1XNRL 1HQRD 1I6VC 5M5WB 3I55A 3KLSA 5ELDA 5I9OA 4KHVA 1AN8A 2MP1A 1WD1A 4LJZC 2K6AA 2JA7G 4GN3B 2B8GA 4DAVA 2OF1A 4ZAIA 5EKIA 1IBML 3EJIA 2HHHQ 1CM9A 4A3GB 1X3PA 1LTTD 3PO2H 2WB1G 2F0MA 4AIMA 5K5PA 4DUZL 2HT1A 3A5ZB 3QB3A 3D8GA 1EFWA 5C3EB 1G2TA 5IY0A 1XTDA 1BCPD 4KKUA 1MD2D 3VR2A 2FHTA 1TWFB 3MWYW 1LTID 5ELOA 1CKOA 1AE2A 4DR7Q 1UE5A 5IP9H 5IYCG 5D3DA 1HUMA 3KF8B 2JA5G 4P2CB 1NJIC 1QUQB 2IJ0A 1VQ5A 5H1SE 2ZJPA 2QDLA 2K1BA 1U5KA 2JA7H 4FF4A 2BDNA 2XRQD 3UDFA 3ULJA 1ASZA 3W3AA 3H91A 5EBDA 3H15A 2DY8A 4UPAA 5EKKA 1PYWD 4QIWB 3GD7A 1SYCA 3TZUA 4GOPB 3F1ZA 2IHEA 4P73A 5JOBA 2AKWB 2EIFA 2WAQB 4G57A 4BBRB 3D31A 4DV0L 4C1NK 3NP8A 1UAPA 4K5WA 4JYAQ 2PZUA 2KHIA 3U50C 3RLFA 2VQEL 2AHOB 1OO9B 4RKLA 2TMPA 3VR6A 5IYCH 4KD3A 2G9HD 3C46A 2B63B 3LGJA 2JA5H 2UU9Q 1Q7YC 4B9XA 3K7UC 4KHZA 3PIOA 4LNQA 3GTLH 4JBJA 4ULLA 4E6IA 3A54A 1EYDA 2RA4A 4JI6L 3AFPA 4G7ZC 3I4MH 5TSSA 3U9SA 4C3HB 1N8RC 4YWKA 1MSHA 2HCCA 1H9SB 3EA6A 3GTGB 1KQSA 3BZCA 4ZCKA 4GKJL 2Z4HA 1SMYD 3U58A 1JJ2A 3JAMi 2O2LD 1UE7A 4XIGS 4HEDA 1VQ9A 3CPWA 1CA6A 1KAWA 2EXZA 4MNOA 3EIVA 3VYUA 4FYDA 3IL8A 2DJFC 3V2TA 5IOCA 5KIXA 1N33Q 1SNDA 3ND9A 1WVLA 2NVYH 1B8AA 1K3RA 2XWBB 4NXNQ 3H0GG 3I72A 4FXDA 4LF6Q 1IZ6A 2JEAI 4JPBW 5AFWA 5C5LA 1P8LA 1GM5A 2AUJD 4ZYSA 3S14H 1SNCA 3KFUA 2WV6D 3HOXG 1ESFA 3EQLC 1B53A 5M3MG 5LHY1 4JVZA 4RH6A 2JQOA 1IBLQ 1EFID 3HOWG 2F3WA 1A3TA 1FL0A 4B3TQ 3RNUA 3NE5B 4ALPA 2ZTCA 3BYTB 1B7YB 2DGYA 4FF2A 2PQAA 2ZM6L 4IFDG 4RMFA 2EJGC 4XDXA 2ZXRA 2A68C 2F0IA 2VXWA 1VQ6A 3NQIA 3UDIA 1MJEA 2F1MA 2VZAA 1IKLA 1CKNB 3P7JA 1Q8KA 2R7ZB 3NWTA 2Z6KC 2HD3A 3H0GH 2B2VA 3TQYA 2K5DA 5HURA 1L0WA 3GTJB 2NN6G 5BN4A 1XPRA 1DJRD 4DR6Q 2ZXOA 2E5LQ 4ZRZA 2K33A 1V1QA 3HOXH 1NUCA 3BYYB 1I94L 5M3MH 3QOJA 1VF7A 5A2QE 2K04A 2F0FA 1M4VA 1WYDA 2WINB 1O7YA 3HKZG 4IUVA 1KC8C 3HOWH 2A19A 2K52A 1BXTA 4O42A 1RD9D 4MIUA 1E0BA 1RKNA 1EY0A 2OEOA 3WWVA 4IFDH 1WTVA 2DN8A 1XMQQ 4KHPL 1ILPA 1TY2A 3OIPA 3J7ZC 2O4XA 2UUCQ 1STYA 1N32Q 1HZBA 1B50A 1N36Q 3G6JB 1N34Q 2MPMA 2SNSA 2NVQH 4KKSA 5EPKA 5LL6X 1PRTF 1SSOA 2QKIC 1HNZQ 4BY1G 1R4PB 1YITA 2JA5B 1QVCA 2NN6H 4I7ZC 5IT9E 3K8AA 1JOOA 3GQBA 1EU3A 2CFMA 4YCVA 5FKAC 1SNMA 3T1HQ 1S5ED 4LF7L 2M2LA 3F2UA 1HR0W 3B6YA 4FXGC 5FLMG 1WI5A 2R61A 1CKMA 4GNXB 2YTYA 1WD0A 3AMUA 4A3LG 1DZ1A 3I4MB 2QEXA 1I50H 4U673 5COYA 3K6OA 5LMUL 2RQXA 4DFAA 1R4QB 2B2UA 4YWLA 1LLRD 4DU9A 5IP7G 1J8IA 2B2TC 4IOAA 5I4DA 1V8QA 2B2YC 3Q6SA 4OWTB 1TKWB 4RGNA 1MHWC 4CJ1B 1I4QA 3T4AC 3K5MA 2F4IA 2FMMA 3HOVG 1NCVA 4IUQA 4O2DA 4H0LC 4XT1B 5DM63 4LF4L 5A35A 4BY1H 4LK1C 4DV6Q 1F2MA 1VQGA 2R92G 4DK0A 1YJWA 1LTLA 4OGQC 1V43A 2NZHA 1VQ8A 2B2WA 1IW7C 1P16A 3HRZC 1PMRA 5FLMH 4PMWA 4A3LH 4V0BA 3K58A 4B3MQ 1PV4A 1T5XD 2XRSD 4V190 2F0EA 1Y1WG 4B9WA 1OXTA 3L9AX 1MSGA 1M8AA 1EOVA 1FNWA 1GVPA 4NKLA 5IP7H 4DV3L 1YJNA 3JAME 4HJ9A 3J7AV 4XQQA 1A63A 1HFNA 3TP8A 3ULLA 3S1RH 3H3VI 1HR0Q 3DEOA 3CCUA 5A2QL 3OMCA 1PTOD 3HOVH 5ELEA 1TR5A 2A69C 2RDHA 1VQCA 2KJXA 1XWEA 5CYUA 4WORA 1WTRA 3PGZA 1N9WA 3H0GB 2YU9H 2R92H 4N9PA 3WDNA 1VQEA 2OXPA 1FVIA 1IYVA 3J80L 1GOZA 4GKKL 3S16H 4M8AA 5G3LD 2LXKA 3HOYB 1S5DD 1D7QA 1JWUD 4JI8L 4A3CG 2DY7A 1X54A 3VR3A 3K0XA 1U4MA 2EYLA 5M3MB 2O5JC 2UXDQ 1ENCA 1Y1WH 4PZ6A 4X3TA 1PFBA 4ZQ3A 4PMCA 4RG1A 1QZHA 2E75C 3V96A 3HOWB 4DV5L 3P20A 4QQBX 3PIP3 1KD1C 2D9UA 2NVXH 1TQOA 3MEFA 4UDUC 4TRDA 1CSQA 3DUZA 4DV4L 5CBAE 4R9WA 3NSWA 4IFDJ 2BA0A 1K9MC 1STGA 2L1BA 2VB3X 3A7AB 4Y52H 1XX8A 1K8GA 1EZ8A 1YNJD 4NPSA 1QVGA 1J5EL 1O7IA 2NVQB 4J6HA 1LO5D 3CC7A 1TWGH 2G5DA 4GLVB 4IJHA 3NENA 2X6LA 1TIID 2JSOA 3NBHA 3ICEA 1A3VA 2K28A 1HUNA 3CRKC 1SNQA 3QR8A 3D4RA 4A3CH 2F0NA 2OT2A 4H44C 2AWOA 4NW2A 2WKCA 1R9TB 3QG1A 1HH2P 4QF4A 5E3FA 1TS5A 4X3KA 2I5LX 4A3GG 4JOIC 3FMCA 4UAIA 3HKZB 3R2IA 4JW0A 3RLNA 2VW9A 1I50B 1HNWL 4DNRB 3S9WA 1DOKA 2MFIA 1X3FA 2V4DA 2NBFA 4S3SA 5C3EG 4DR5Q 1EYGA 3I70A 2KCNA 1B70B 1LTGD 2PW5A 5EPJA 1FGUA 1RTOA 1FD7D 5JJIA 1FGBD 2RF4A 2LKVA 4GN5A 1XMOL 3MFYA 1YHQA 4F87A 4NXMQ 5HY6A 2ALYB 4HCEA 1EY8A 4KK7A 2PQAB 1LM0A 2AUKA 4IZ8A 3GTMH 4XYOA 5GROA 3JAML 5IGGA 5D3IB 4BBSG 1XPUA 4LMQD 2O5IC 3QO2A 3IRBA 1SXTA 1A2TA 4A3GH
chains in the Genus database with same CATH topology
1I4XA 4ME5A 1I3QB 1B3AA 1EU4A 3SVMA 2BDOA 4Q0FA 3SXHA 1LTAD 1RF2D 4O1NA 1E2ZA 5JEAG 3UI2A 2HUGA 3A7LA 1D5XC 4XT3B 3Q0AA 3ONAB 1V1PA 5CORA 3WOEA 1A2UA 3HOVB 5C6AA 1LT6D 1O7LA 3PUVA 2KEDA 1PXUA 5E4WC 2R92B 2YU9B 3AB9A 2PYKA 3D6WA 1DXMA 3OWFA 4FNFA 4OO1I 4RFBA 3BS1A 3E0JA 4C3JG 3ITPA 2CW0D 1SJHD 1Y1WB 3TP6A 1EY6A 3M4OB 3BDLA 2NVXB 2L4NA 1KDCA 5F2DA 2IX3A 5JEAH 1II3A 4LAAA 4FO2A 4XQJA 4R8IA 1SAPA 2F0KA 1CK1A 5NUCA 2K03A 1EWHA 1B1ZA 2EYOA 4ABNA 5I6WA 5IGFA 2FINB 1STEA 3FDTA 1EOTA 1S5FD 1LTRD 3CKIB 3MFGA 2DNEA 3DXJC 3NBIA 3P75A 5KYIA 1JQYD 1EYCA 1LACA 4WFN3 4IURA 4XYQA 2F0PA 4C2MB 1I4PA 3ERQA 3X3NA 3QJYA 3MXPA 1HPCA 1O80A 1JCKB 4FVMA 5EBCA 1JE4A 2RDFA 3CHBD 1A6XA 2KECA 2F0SA 1YNNC 3QIAA 3GTMB 1VMCA 1SYDA 3HEJA 3HP3A 4RGMA 4CKEA 3WOFA 3DWQA 4YIJA 1I4GA 2A6HC 2LS01 1STHA 2L5TA 3I73A 2M00A 4HN7A 1CTMA 1RODA 4RGOS 4RA8A 1ET6A 1K83B 5CGKA 2C5CA 5I2YA 2D2CC 4L6TB 1U4PA 2NYZD 1MBYA 1GJXA 3KLRA 2IW3A 3NXWA 2EYPA 2RVLA 2EJMA 3S17B 3RMHA 2I07B 1ONLA 2ZXPA 1Q90A 2EDGA 4BBSB 1NR2A 3AU7A 3D4DA 1IKMA 4AYBB 2G9DA 3EFXD 2SEBD 4RWSC 3I91A 1JOKA 1CQFA 3K0YA 3N6RA 5C0XJ 4DNTB 4CJ0B 3TMEA 1NR4A 4EQNA 1PRTD 3H94A 4K2LA 5JEAJ 3T16A 5C4JB 3RZDB 1Z7TA 2EY5A 3FVQA 4F7XA 2EY1A 2F0TA 5K36G 1B44D 3IAYA 1TWCB 1GUGA 4Y7NB 1TU2B 3MZ5A 1SYBA 4FF3A 1EY5A 4IALA 5FOBB 1PDQA 3OW7A 1FNUA 4ZKCB 4C3JB 1EZ6A 1BDOA 1BNZA 5DM73 1Y8OB 1QB5D 1CI3M 2CVRA 2EJFC 3I8ZA 1KABA 1HXYD 3S1MB 4EVOA 3ND8A 1SMYC 2EYFA 2PQEA 4FF1A 3L7ZC 4ZUIA 4DXGA 1L0YB 4XTCS 5K36H 2E2HB 3NPPA 5M3FB 2L55A 4IQZA 3BG3A 2GA4B 1OXXK 1S5BD 1V1PB 4KI0A 3CQZB 1CFMA 3KBGA 3MEHA 4WJWA 2ICIA 4OIKA 5IGDA 2K05A 4IN3A 2N88A 5KEEA 1G6ZA 1SJED 1A15A 1QNKA 3NQTA 1HA5A 1OXVA 1KAAA 5ELFA 1LT5D 3TP7A 3VYRA 3MXNA 5M5XB 1LTBD 4K14A 4CHTB 2K32A 2KCCA 2A68D 2D62A 1BCPB 4NMZA 4RCOA 5CBEE 1JC7A 2SDFA 2LMCB 2Z8LA 5E1FA 5CR3A 1H9KA 3D3RA 4IUPA 3KUPA 3OWEB 1SE2A 1TWHB 2EOTA 2HDMA 2IWHA 2ZT9C 4GZYC 4RAUC 3GTOB 1KNAA 5EPLA 1WCMB 3Q24A 1D6EC 1ENAA 1V1OA 4ZUJA 1LTSD 2ID0A 2AQ1B 2FMCA 5EQ0A 3A56A 3RUZA 5M9OA 2E2DC 2L12A 3OOCA 1W6KA 1H9JA 2ENBA 3MC0B 2BE5D 1Z47A 3R3OA 3KLSX 2XWJB 5CV8A 4K6DA 1KLGD 2KUMA 1E2WA 2AWNA 1S4ZA 2JA6B 3VYTA 3FRPB 3J81E 1EY4A 2RSOA 3D6CA 1EIGA 3MXGA 1D5MC 5IIFA 1JR0D 5JJZA 4L63B 1DOMA 1CHQD 1EY7A 1QG7A 4ZKBB 3HS0C 3GTQB 1EQTA 5LL6S 1JICA 2J4XA 4QUCA 3BVMA 1QCBD 4TSSA 4M1UB 3DWPA 3S1NB 3A8KE 2NUCA 1IW7D 4G7OC 1ET9A 1G291 3X3MA 1Y1VB 3K57A 1EWCA 4B08A 5BN3A 4CKBA 5EGTA 1PTOC 4PQXA 1F2LA 3R2TA 1PTOH 2IX1A 1BUVT 3R8BA 3QWNA 5T1IA 2JA8B 3A8JE 2A69D 3PMFA 3SEBA 5I6YA 2R3ZA 1BQQT 2EE1A 2Q8IB 4KJNA 2HQEA 2A5HA 5IT9L 3VR4A 3OMGA 4A3DB 3PO3B 4RGTA 1DONA 3CRLC 3PV0A 1PZKD 4DAYA 4QCLA 3KF8A 2NTSA 2HCIA 1TY0A 2A74C 1IL8A 2AQ3B 1J9OA 3J81L 3BVGA 2EVBA 1SFOB 4KN4C 1B9MA 2VNUD 5ELBA 1X3QA 3NHHA 2A6ED 1G2SA 3M7GA 2HDLA 3KK7A 4C1NI 3M4YA 1D2BA 4IUUA 1UNSA 3LWEA 3MTSA 1EYAA 2MUYA 2QF7A 5C4HA 3GTPB 1SE4A 1VMPA 4F88A 1OXUA 3DHQA 2FFKB 4IUNA 5C3WA 3C1EA 1QNUA 4BA2I 1E2VA 3HOZB 3NWSA 1TS2A 4DN4M 1Q8IA 1CA5A 1F9PA 1H9SA 2H1EA 1S5CD 1SYGA 4U68A 1PLFA 4OL7A 1BO0A 1U4LA 1OXSC 5KNDA 4F8MA 2Z4IA 4KD4A 2C9OA 3FPPA 1L0XB 2F0QA 3OIQA 2BA1A 5JVG3 2M9VA 5IGBA 1JWSD 3FKIB 5J22A 1Y69U 1PTOB 2NZ1D 3FEWX 4G4KA 4OO1G 3KBXA 4QUFA 4CJ2C 4WRDA 2CW0C 5T1GA 3T53B 3T56B 1GUSA 3V05A 4ZK9B 2IX0A 1JORA 1JB3A 1ZYRC 4HAEA 3QOLA 5HGTA 2L0CA 1CZWA 2KVMA 1HQMC 4X3UA 1G8ZD 2EPBA 4HMJA 1LABA 2XN9C 1Y8NB 1AFPA 2F0WA 4DK1A 1H9RA 3T51B 4OO1H 2PW7A 3NTKA 3HG9A 4H7BA 4JK1C 2PPBC 4KN7C 3I90A 1STAA 3C3LA 1B9NA 3K5NA 3S2HB 1HTLD 2F0JA 4KJOA 4KY5A 3GTKB 4K6LA 5IGEA 1GXDC 2WACA 3HGBA 1ESRA 3MXUA 1LT3D 2EYJA 1F9QA 5M5YB 3VA5A 3DEPA 4C56C 4DXFA 1C48A 1DOLA 1LT4D 2E2IB 1HRJA 1I4HA 5KGUA 1WTQA 1EL0A 2XVSA 1ILQA 5CMDA 2I46A 1UEAB 4A93B 2DNCA 3PUYA 3NTHA 1KDBA 3E5SA 3GV6A 2KQ3A 4RKBA 4RCNA 4HMIA 1U4RA 2D5DA 2RKSA 2A6HD 1BCPC 2Y0SB 5FLXE 3DWAA 3HZXA 4A3FB 5D65A 2B39A 1K8OA 3S15B 2PNRC 4K5XA 1MI2A 1UUPA 2SOBA 2F0HA 4BA1I 4NP5A 4R8NA 3A55A 1SYFA 2H4OA 3U9OA 4BY7B 2IPKD 4EQOA 2F0LA 4HR7B 4TKOB 3VR5A 5DAUA 3BDOA 1IHZA 2RSNA 2F0UA 1H9MA 1I4RA 1BBXC 1PRTC 3K5OA 2TSSA 1SNPA 2PZTA 3M7NA 2PO4A 1DCZA 5CV5A 2NTTA 3K7AB 3TP5A 2BCOA 2K5QA 3BVZA 1GUNA 2XSCA 3IKJA 4OHJA 2F3VA 2N55A 1ENFA 2QCPX 1Q1BA 5E4XA 1GUOA 4N9TA 3M3YB 1EIHA 4J8QA 3SE0A 2KHSA 2XIWA 4KY7A 4XXEA 1HA6A 3I3CA 1F9SA 4G7HC 2PMZB 2JEBI 3TBIB 5C44B 3LWUA 4KKTA 5FO8B 1DM0B 2QILA 1BR9A 2WKDA 2JXMB 5FO7B 1HCZA 1GHJA 3GV3A 2E2JB 5J1ZA 4HTHA 5I9PA 2J0TD 4C3IB 2X6GA 5JPMC 3D4WA 1D1IA 5JAVA 5FLXL 5C4XB 3SK5A 1GUTA 2FJ2A 2R93B 2SNMA 1F77A 1EEID 1PFMA 3O13A 2B2TA 1QOHA 2B2YA 5CV9A 1GUWA 2LFNA 1I6HB 3PO2B 1MGSA 2F0DA 4XQNA 4NDXA 1JOQA 4IFDI 2R6GA 1F2YA 5KYLA 1EQVA 2MHVA 2F03A 1QWYA 1VCIA 3RD4A 4A3BB 3PUZA 1TWAB 1BCPF 1ML0D 3GO5A 3NK9A 5IODA 5J39A 3K5LA 2VB2X 1X32A 2NN6I 4DF7A 3TDQA 4A3JB 3S2DB 4KV6A 2QDBA 2JA7B 2B8FA 5CV6A 1Q3LA 3PUWA 4I65A 4OIJA 4BWGB 2WB1B 1GHKA 1C8CA 3J80E 1PRTB 3J7AF 1D1KA 5I2XA 4ILWA 1VF5C 1BOSA 4KMUC 1Q12A 2RBMA 1FR3A 2BE5C 5C5MA 3LX0A 1JWMD 1SEBD 1TT2A 5C3XA 1SNOA 4CGYB 1STNA 4HCSA 1D5ZC 3GTLB 5CC4A 1ICWA 2E74C 3BDCA 4FXKC 3DMUA 4H13C 2CQAA 2KEEA 3MA2B 3PIO3 2Z1CA 5EKLA 1TVXA 2YYZA 2MJ8A 1KTKA 2EY2A 2Q8RE 1ZKOA 1U9RA 4CBVA 3G7LA 2B2VC 1VDZA 4ID6A 4QB4A 2NVYB 4MHEA 4QMGA 1SYEA 2PCFB 4RHRA 4Z9CB 1TS4A 2KOLA 1LV9A 5FO9B 3S14B 3J7YW 3OPOA 2WIIB 3ZYYX 4DA2A 3VA7A 1DYQA 1HFGA 4HSPA 1AEXA 1RTNA 4JBWA 3R93A 3SK8A 2WP8J 2EYHA 5CV7A 4PMBA 1RCVD 1XYIA 1KLUD 3S1QB 2EY6A 3TN2A 4HSVA 3H3VC 3E6ZX 1NAPA 1PZJD 2J7ZA 3HOXB 1QJOA 3H6MA 3CU7A 1ZEQX 4A3KB 1YNJC 4EQPA 2B2UC 3HOUB 1A3UA 5JVH3 3PUXA 1STBA 3I4NB 3MVVA 1CQVA 3L3OC 1RJTA 3I4LA 2BOSA 1DD2A 4K8IA 4K8JA 2RDGA 2A6EC 4K5VA 1T5EA 5ELCA 3IFDA 2CHBD 2B2WC 1Z6HA 2F0OA 4KTAA 1QE6A 1C4QA 3VYSA 1KNEA 1CHPD 4A3IB 3MHBA 3N52A 2IL8A 2AQ2B 1AZQA 5EJWA 5BN5A 2EZVA 2JP1A 2K01A 2X69A 2L11A 1ZXTA 4FP5D 1CZGA 2A73B 4L8JA 5CV4A 2K5WA 3W2DA 3M85A 1FNVA 4BY1B 5KRUA 2LY7A 1F9RA 2EYMA 1HHVA 2Q8TA 1XTCD 1RHPA 2JYOA 1FYCA 3SR1A 1NSNS 4A3MB 3EVQA 4KY6A 5DEHA 1B2TA 1QILA 3DM1A 3BZDB 1AP0A 1O7ZA 5C0XI 5C0XG 1HTPA 2K7VA 1KDAA 2IT1A 1F2ZA 1PZID 1K8MA 2VUMB 3Q22A 3C1FA 3TZDA 3S1RB 3SK6A 4CKCA 2MGSA 1WTPA 3URYA 2NB0A 1PTOF 1G91A 3RZOB 4ZLTF 4IUTA 3T13A 1EY9A 2F0VA 1SBBB 1SDFA 3S16B 3SHLA 1AW7A 1WTXA 4BS9A 1W6JA 5G3LF 1SE3A 4X3SA 3EROA 4C3HG 1WTWA 4DAPA 1RDPD 5FK9C 5IGCA 2KA7A 3A8IE 5C4ZA 3K59A 5C0XH 5JPNC 5DNFA 4J1MA 2F0GA 1ZYRD 4ODGA 2NVTB 3SK4A 2XNAC 1Y8PB 3SDZA 3NTIA 4C3IG 4DGZA 2NWGA 4PV1C 3IFTA 2JE6I 4K2KA 1TWGB 1EEFD 1WTOA 2ICEC 3NUCA 4EGVA 5D14A 1CT1D 1Q1EA 2E76C 1B4OA 2L9HA 1IYUA 1AZPA 3H09A 1BF4A 4RHSA 3C2PA 2QEJC 1TS3A 4TQUS 3MAQA 3P1HA 1XXGA 1O78A 3LNNA 2PZWA 5KNCA 3GP7A 3TSSA 3OSOA 3Q23A 3FPUB 5KNBA 4MN3A 4Q5VA 5ISRA 3OHXC 1YNND 4A3EB 4PNYA 1PFNA 1HQRD 1I6VC 5M5WB 3KLSA 5ELDA 5I9OA 4KHVA 1AN8A 2MP1A 1WD1A 4LJZC 2K6AA 2B8GA 4DAVA 2OF1A 4ZAIA 5EKIA 3EJIA 1CM9A 4A3GB 1X3PA 1LTTD 2F0MA 5K5PA 3QB3A 3D8GA 5C3EB 1G2TA 1BCPD 4KKUA 1MD2D 3VR2A 2FHTA 1TWFB 3MWYW 1LTID 5D3DA 1HUMA 4P2CB 2IJ0A 2K1BA 4FF4A 2BDNA 2XRQD 3W3AA 3H91A 5EBDA 2DY8A 5EKKA 1PYWD 4QIWB 3GD7A 1SYCA 3TZUA 5JOBA 2WAQB 4G57A 4BBRB 3D31A 4C1NK 3NP8A 1UAPA 4K5WA 2PZUA 3RLFA 1OO9B 4RKLA 2TMPA 3VR6A 4KD3A 2G9HD 3C46A 2B63B 4B9XA 4KHZA 4ULLA 4E6IA 3A54A 1EYDA 2RA4A 4G7ZC 5TSSA 3U9SA 4C3HB 1MSHA 2HCCA 1H9SB 3EA6A 3GTGB 2Z4HA 1SMYD 2O2LD 4XIGS 4HEDA 1CA6A 2EXZA 3VYUA 4FYDA 3IL8A 5KIXA 3V2TA 5IOCA 1SNDA 3ND9A 1WVLA 2XWBB 3I72A 4FXDA 2JEAI 5AFWA 5C5LA 2AUJD 4ZYSA 1SNCA 2WV6D 1ESFA 3EQLC 1B53A 5LHY1 4RH6A 1EFID 2F3WA 1A3TA 3NE5B 3BYTB 4FF2A 4IFDG 4XDXA 2EJGC 2ZXRA 2A68C 2F0IA 2VXWA 3NQIA 2F1MA 1IKLA 3P7JA 2R7ZB 3NWTA 2B2VA 2K5DA 5HURA 3GTJB 2NN6G 5BN4A 1DJRD 2ZXOA 4ZRZA 2K33A 1NUCA 3BYYB 3QOJA 1VF7A 5A2QE 2K04A 2F0FA 1M4VA 2WINB 1O7YA 4IUVA 1BXTA 4O42A 1RD9D 4MIUA 1E0BA 1RKNA 1EY0A 2OEOA 4IFDH 1WTVA 2DN8A 1ILPA 1TY2A 3OIPA 2O4XA 1STYA 1B50A 3G6JB 2MPMA 2SNSA 4KKSA 5EPKA 5LL6X 1PRTF 1SSOA 2QKIC 1R4PB 2JA5B 2NN6H 4I7ZC 5IT9E 1JOOA 3GQBA 1EU3A 5FKAC 1SNMA 1S5ED 2M2LA 3F2UA 4FXGC 3AMUA 2R61A 1WD0A 1DZ1A 3I4MB 4U673 5COYA 3K6OA 2RQXA 4DFAA 1R4QB 2B2UA 4DU9A 1LLRD 1J8IA 2B2TC 5I4DA 1V8QA 2B2YC 3Q6SA 1TKWB 4RGNA 4CJ1B 1I4QA 3T4AC 3K5MA 2F4IA 2FMMA 1NCVA 4IUQA 4H0LC 4XT1B 5DM63 5A35A 4LK1C 1F2MA 4DK0A 4OGQC 1V43A 2B2WA 1IW7C 3HRZC 1PMRA 4PMWA 4V0BA 3K58A 1T5XD 2XRSD 4V190 2F0EA 4B9WA 1OXTA 3L9AX 1MSGA 1M8AA 1FNWA 4NKLA 3JAME 3J7AV 4XQQA 1HFNA 3TP8A 3DEOA 5A2QL 3OMCA 1PTOD 5ELEA 1TR5A 2A69C 2RDHA 2KJXA 1XWEA 5CYUA 4WORA 1WTRA 3H0GB 1IYVA 4N9PA 3WDNA 2OXPA 3J80L 1GOZA 4M8AA 5G3LD 3HOYB 1S5DD 1JWUD 2DY7A 3VR3A 1U4MA 2EYLA 5M3MB 2O5JC 1ENCA 4X3TA 1PFBA 4ZQ3A 4PMCA 3HOWB 2E75C 3V96A 3P20A 3PIP3 2D9UA 1TQOA 4UDUC 4TRDA 3DUZA 5CBAE 4R9WA 3NSWA 4IFDJ 2BA0A 1STGA 2L1BA 2VB3X 3A7AB 1XX8A 1EZ8A 1YNJD 2NVQB 4J6HA 1LO5D 2X6LA 1TIID 2JSOA 3NBHA 1A3VA 2K28A 1HUNA 3CRKC 1SNQA 3D4RA 2F0NA 2OT2A 4H44C 2AWOA 4NW2A 2WKCA 1R9TB 3QG1A 4QF4A 5E3FA 1TS5A 4X3KA 3FMCA 4UAIA 3HKZB 3R2IA 1I50B 4DNRB 3S9WA 1DOKA 2V4DA 2NBFA 4S3SA 3I70A 2KCNA 1LTGD 2PW5A 5EPJA 1RTOA 1FD7D 1FGBD 2LKVA 3MFYA 4F87A 4HCEA 1EY8A 4KK7A 4IZ8A 2AUKA 4XYOA 3JAML 5IGGA 5D3IB 4LMQD 2O5IC 3QO2A 1SXTA 1A2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYF A;  1EYC A;  2EY1 A;  4F7X A;  2F0T A;  2SNS A;  4ME5 A;  2NUC A;  5CR3 A;  2OF1 A;  4HMJ A;  3U9O A;  3EJI A;  5EKL A;  3T13 A;  2EXZ A;  1EY9 A;  2F0V A;  2F0W A;  2F0P A;  4K8I A;  1JOR A;  4EQO A;  4K8J A;  3SHL A;  2F0L A;  2EY2 A;  2EYL A;  3ERQ A;  3MZ5 A;  2F0M A;  1SYB A;  4K5V A;  3SXH A;  3MXP A;  1JOO A;  5DAU A;  3V2T A;  2PW7 A;  1SND A;  5IOC A;  5CV9 A;  5EGT A;  1ENC A;  3QB3 A;  1EY5 A;  4H7B A;  4IAL A;  4ZQ3 A;  1SNM A;  3DHQ A;  4IUN A;  4PMC A;  5C3W A;  3ERO A;  1U9R A;  3C1E A;  2RDF A;  1IHZ A;  3D8G A;  2F0D A;  2F0O A;  2F0S A;  4NDX A;  1JOQ A;  1STA A;  1EZ6 A;  2F0U A;  4KTA A;  1ENA A;  5IGC A;  5KEE A;  1TQO A;  4ID6 A;  4QB4 A;  1A2U A;  1F2Y A;  5KYL A;  4TRD A;  1EQV A;  5C6A A;  4ZUJ A;  5C4Z A;  1SNP A;  2PZT A;  4QMG A;  5C5L A;  1KAB A;  1STG A;  1SYE A;  2F0J A;  4KJO A;  4J1M A;  4EVO A;  1SNC A;  1EZ8 A;  4KY5 A;  1SYD A;  3HEJ A;  2F0G A;  5CV5 A;  5IGE A;  3RUZ A;  1SYG A;  3TP5 A;  3MHB A;  2EYF A;  5M9O A;  2PYK A;  4DFA A;  4ODG A;  4DU9 A;  3PMF A;  3NK9 A;  2WAC A;  4J6H A;  5I6Y A;  5IOD A;  2PQE A;  4YIJ A;  3SK4 A;  5J39 A;  4OL7 A;  3OWF A;  1STH A;  2F3W A;  1A3T A;  4ZUI A;  4DF7 A;  4F8M A;  2EYJ A;  2ENB A;  2F3V A;  2M00 A;  4DGZ A;  4KD4 A;  1A3V A;  3R3O A;  4KJN A;  5KIX A;  1SNQ A;  3ITP A;  4K2K A;  2HQE A;  4KV6 A;  5JAV A;  2F0Q A;  5CV8 A;  3OMG A;  2F0N A;  3TP6 A;  1EY6 A;  3VA5 A;  2QDB A;  2F0I A;  3BDL A;  4N9T A;  4K6D A;  3NUC A;  5EKK A;  5CGK A;  5CV6 A;  5CV4 A;  1SYC A;  1F2M A;  2KHS A;  4QF4 A;  5E3F A;  1AEX A;  4I65 A;  1KDC A;  4KY7 A;  5F2D A;  3SK8 A;  5KGU A;  5IGB A;  5JOB A;  5KRU A;  5J22 A;  1II3 A;  4LAA A;  4G57 A;  2EYM A;  2EYH A;  1EY4 A;  3NXW A;  2EYP A;  4R8N A;  3S9W A;  5CV7 A;  3D6C A;  4PMB A;  5C4H A;  2F0K A;  3NP8 A;  5HUR A;  3MEH A;  4S3S A;  4K5W A;  5C3X A;  2PZU A;  5NUC A;  5IIF A;  3SR1 A;  5IGD A;  1NSN S;  2F0E A;  2SNM A;  1KDB A;  4B9W A;  2EYO A;  3E5S A;  3EVQ A;  2KQ3 A;  3D4D A;  4RKL A;  2EY6 A;  4KY6 A;  4RKB A;  2PW5 A;  2RBM A;  4KD3 A;  1NUC A;  5DEH A;  3LX0 A;  5C5M A;  3NQT A;  1TT2 A;  3P1H A;  4HMI A;  3T16 A;  3NHH A;  3QOJ A;  4WRD A;  4B9X A;  2LKV A;  1EY7 A;  1SNO A;  2RKS A;  5I6W A;  2F0F A;  4NKL A;  1STN A;  2PZW A;  5ISR A;  1KAA A;  1JOK A;  4E6I A;  3H6M A;  3TP7 A;  5IGF A;  3HZX A;  3OSO A;  4K14 A;  3TP8 A;  1EYD A;  4MIU A;  1EY8 A;  1KDA A;  1EY0 A;  1RKN A;  5J1Z A;  1F2Z A;  2OEO A;  3OMC A;  4IZ8 A;  4HTH A;  4K5X A;  4EQP A;  5CC4 A;  3TME A;  5I9P A;  4PNY A;  3BDC A;  1A3U A;  1TR5 A;  3C1F A;  3QOL A;  4EQN A;  5IGG A;  5HGT A;  5K5P A;  4K2L A;  1STB A;  1EYA A;  1STY A;  2F0H A;  2O4X A;  2SOB A;  3D4W A;  3DMU A;  4NMZ A;  3SK5 A;  2EY5 A;  4NP5 A;  4WOR A;  3SK6 A;  3P75 A;  5I9O A;  5KYI A;  3MVV A;  4KHV A;  4N9P A;  2OXP A;  1A2T A;  5E1F A; 
#chains in the Genus database with same CATH topology
 4JI0 Q;  1I4X A;  4ME5 A;  1EIF A;  1I3Q B;  1WFQ A;  4AQY L;  1B3A A;  1EU4 A;  2Q2I A;  3SVM A;  2BDO A;  4Q0F A;  3SXH A;  5C3E H;  5GAD C;  1LTA D;  1K8A C;  1RF2 D;  4O1N A;  1E2Z A;  1K83 H;  5JEA G;  3UI2 A;  2HUG A;  3A7L A;  1D5X C;  4XT3 B;  3Q0A A;  3ONA B;  1PYS B;  1WTH A;  1V1P A;  5COR A;  3WOE A;  2K4K A;  1XNQ Q;  1A2U A;  2KBN A;  3HOV B;  5AJ3 Q;  5C6A A;  1JE5 A;  1LT6 D;  4LF9 Q;  1O7L A;  3PUV A;  2KED A;  1PXU A;  2I5M X;  5E4W C;  2R92 B;  2YU9 B;  1CSP A;  4OX9 L;  3AB9 A;  2PYK A;  3D6W A;  2YV5 A;  4HJ8 A;  1DXM A;  4BBS H;  3OWF A;  4FNF A;  4OO1 I;  4RFB A;  2I5H A;  3BS1 A;  3E0J A;  4C3J G;  4GOP C;  3ITP A;  2CW0 D;  1SJH D;  1Y1W B;  4DV1 Q;  3TP6 A;  1EY6 A;  3M4O B;  3BDL A;  4JI2 L;  3CC4 A;  2LSS A;  2Y0S E;  2NVX B;  4GLX A;  2JJQ A;  3G4S A;  2L4N A;  1KDC A;  5F2D A;  2IX3 A;  4K0K L;  5JEA H;  1II3 A;  4LAA A;  4FO2 A;  4XQJ A;  4R8I A;  1SAP A;  2ES2 A;  2F0K A;  1GD7 A;  4IPG A;  1CK1 A;  2QA4 A;  4X64 Q;  5NUC A;  2K03 A;  1EWH A;  1B1Z A;  2EYO A;  4Y7N H;  4AYB E;  4ABN A;  5I6W A;  4DV2 Q;  4X62 Q;  5IGF A;  4JI3 L;  2FIN B;  4N8X 1;  4C3J H;  3E9I A;  1STE A;  3FDT A;  1EOT A;  1S5F D;  3GTG H;  1LTR D;  3CKI B;  3MFG A;  2DNE A;  3DXJ C;  3S1M H;  3NBI A;  3P75 A;  5KYI A;  1E24 A;  1JQY D;  1PH2 A;  1EYC A;  3KLW A;  4DR4 L;  4QGU A;  4DV7 L;  1LAC A;  4WFN 3;  4IUR A;  4XYQ A;  2F0P A;  4C2M B;  4YCW A;  1I4P A;  5IT9 c;  2R7Z G;  3ERQ A;  3X3N A;  3QJY A;  5IWA Q;  3MXP A;  1HPC A;  4I7A A;  2DUD A;  1FJG Q;  1O80 A;  1JCK B;  4FVM A;  2E2H H;  5EBC A;  1JE4 A;  2RDF A;  3CHB D;  1L1O B;  1A6X A;  2KEC A;  2F0S A;  1YNN C;  3L0O A;  3QIA A;  3GTM B;  4LF8 L;  1VMC A;  1PVO A;  3CQZ H;  1SYD A;  3HEJ A;  3HP3 A;  1BKB A;  1NNX A;  5GAE C;  4RGM A;  4CKE A;  3WOF A;  3DWQ A;  4YIJ A;  1I4G A;  2A6H C;  2LS0 1;  1IBM Q;  1STH A;  2VS1 A;  3PSI A;  3TS2 A;  2L5T A;  3I73 A;  1K3B C;  2M00 A;  4HN7 A;  1CTM A;  1ROD A;  4RGO S;  4DUZ Q;  4RA8 A;  1ET6 A;  1K83 B;  5M5X H;  1CUK A;  1HNX L;  3KYH C;  5CGK A;  1BVS A;  2C5C A;  2R7Z H;  2OCE A;  2JN4 A;  5I2Y A;  3UDG A;  2D2C C;  4L6T B;  1U4P A;  2NYZ D;  3CAM A;  1MBY A;  1GJX A;  1VQI A;  3GTJ H;  3CW2 C;  3E9H A;  3KLR A;  2IW3 A;  3NXW A;  2EYP A;  2RVL A;  2RCF A;  2EJM A;  3S17 B;  3RMH A;  2I07 B;  1ONL A;  1Z9F A;  2ZXP A;  1Q90 A;  2EDG A;  1TWH H;  4BBS B;  1NR2 A;  3AU7 A;  3D4D A;  1IKM A;  2LXJ A;  4AYB B;  4JBK A;  2G9D A;  3I4M G;  3EFX D;  1VQH A;  2SEB D;  3JAM c;  4RWS C;  2JA6 G;  1B3Q A;  3I91 A;  3J81 i;  1JOK A;  3GTO H;  3OW2 A;  1CQF A;  4DR1 Q;  3K0Y A;  3N6R A;  5C0X J;  4DNT B;  4CJ0 B;  3TME A;  2GN5 A;  4X6A H;  1NR4 A;  4JI7 L;  2KEN A;  4EQN A;  1PRT D;  2QGQ A;  3H94 A;  4K2L A;  5JEA J;  3T16 A;  5C4J B;  4HJ5 A;  3RZD B;  1Z7T A;  2EY5 A;  2Z0S A;  3FVQ A;  4F7X A;  4DV0 Q;  1SRO A;  2EY1 A;  3K80 C;  2F0T A;  1MIU A;  2B3G A;  1VQJ A;  3A0J A;  5K36 G;  1B44 D;  3AYH B;  3IAY A;  4L5T A;  3CME A;  1TWC B;  1GUG A;  4Y7N B;  2VQE Q;  4GNX C;  1TU2 B;  3MZ5 A;  1SYB A;  2RCN A;  1YBY A;  4FF3 A;  1EY5 A;  4IAL A;  5FOB B;  1PDQ A;  3OW7 A;  4POF A;  2MNA A;  1FNU A;  4ZKC B;  4C3J B;  1EZ6 A;  1BDO A;  1BNZ A;  5DM7 3;  1Y8O B;  1QB5 D;  2JA6 H;  1CI3 M;  4JI6 Q;  2CVR A;  2EJF C;  3I8Z A;  2EXD A;  1KAB A;  1HXY D;  3S1M B;  4EVO A;  4GLA C;  3ND8 A;  2R7F A;  1SMY C;  1X65 A;  3CPF A;  2EYF A;  4GKJ Q;  2PQE A;  4FF1 A;  3L7Z C;  3AFQ A;  4ZUI A;  1YHB A;  4DXG A;  1L0Y B;  4XTC S;  4HJ7 A;  5K36 H;  3GTQ H;  4X66 L;  4LFB L;  3KOJ A;  2E2H B;  3NPP A;  3HOY G;  5M3F B;  1RL2 A;  3D0F A;  1Q46 A;  3U4V A;  2L55 A;  2OQK A;  4IQZ A;  3BG3 A;  2JA8 G;  2GA4 B;  4LUZ A;  1OXX K;  1S5B D;  1V1P B;  2V1C C;  4KI0 A;  3CQZ B;  2N8N A;  1CFM A;  3KBG A;  3MEH A;  4WJW A;  2ICI A;  4OIK A;  4P72 A;  5IGD A;  2K05 A;  4IN3 A;  2N88 A;  1PHJ A;  4CDE C;  5KEE A;  1G6Z A;  4DR2 L;  4WJ4 A;  1SJE D;  1A15 A;  1QNK A;  3NQT A;  1HA5 A;  3RR5 A;  1OXV A;  1KAA A;  5ELF A;  1LT5 D;  3TP7 A;  3VYR A;  2K50 A;  3MXN A;  5M5X B;  1LTB D;  4K14 A;  4R1J A;  2OQ0 A;  4CHT B;  1A62 A;  3CCJ A;  2K32 A;  2KCC A;  2DJG C;  3W5O A;  2A68 D;  2D62 A;  1X3G A;  2K14 A;  1BCP B;  4NMZ A;  3HOY H;  4RCO A;  3PIP A;  5CBE E;  1VQB A;  1JC7 A;  4PZ7 A;  2SDF A;  2LMC B;  2Z8L A;  5E1F A;  2JA8 H;  5CR3 A;  1E1T A;  2CWA A;  1H9K A;  3D3R A;  4IUP A;  3KUP A;  3OWE B;  1SE2 A;  1TWH B;  2EOT A;  1XPO A;  4AH6 A;  1A8V A;  2RHQ B;  1VQK A;  2HDM A;  2VY3 A;  1I94 Q;  2IWH A;  2ZT9 C;  4GZY C;  4IPC A;  4RAU C;  3K81 C;  3GTO B;  1KNA A;  5EPL A;  1KIX A;  1WCM B;  3Q24 A;  1D6E C;  1ENA A;  1VQP A;  1V1O A;  4QY7 A;  2VQF L;  4ZUJ A;  1LTS D;  4DK6 C;  2ID0 A;  2AQ1 B;  4KHP Q;  2D0O A;  2GVB A;  2FMC A;  5EQ0 A;  3A56 A;  1PH5 A;  3RUZ A;  2K5H A;  2UUC L;  5M9O A;  4JCV E;  1KXL A;  2E2D C;  2L12 A;  3OOC A;  1W6K A;  1VQF A;  1N36 L;  1OTC A;  1H9J A;  1SFO H;  2ENB A;  1VQO A;  1SN8 A;  3MC0 B;  2BE5 D;  1Z47 A;  3R3O A;  1R9T H;  1AE3 A;  3KLS X;  3F2C A;  2XWJ B;  3HOZ G;  5CV8 A;  4YY3 Q;  4DKA C;  4K6D A;  3ULP A;  1KLG D;  4LF7 Q;  2KUM A;  1E2W A;  2AWN A;  1S4Z A;  3KF6 A;  2JA6 B;  3PCO B;  3VYT A;  2UUA L;  3FRP B;  3J81 E;  4KLK A;  1EY4 A;  2RSO A;  4R4C A;  4B3R L;  3D6C A;  1EIG A;  1MJC A;  3MXG A;  3NEL A;  3NEM A;  5LMU Q;  2UXC L;  3RN2 A;  1D5M C;  5IIF A;  1YEZ A;  3TEH B;  1JR0 D;  5JJZ A;  4L63 B;  1DOM A;  1CHQ D;  2UUB L;  1EY7 A;  1QG7 A;  4ZKB B;  3HS0 C;  3GTQ B;  3FKI G;  1EQT A;  4R4Q A;  5FJ8 G;  4LF4 Q;  5LL6 S;  1JIC A;  2J4X A;  4QUC A;  3HOZ H;  4DV6 L;  3BVM A;  1QCB D;  4TSS A;  4M1U B;  1I3Q H;  3DWP A;  4HJA A;  3S1N B;  3A8K E;  4J15 A;  4HIK A;  2NUC A;  2CKZ B;  3CCM A;  1IW7 D;  4G7O C;  4LFA L;  1ET9 A;  1G29 1;  3X3M A;  4JI5 Q;  1Y1V B;  3K57 A;  2CQO A;  3PF4 A;  1EWC A;  1LUZ A;  4B08 A;  1XJV A;  5BN3 A;  4CKB A;  5EGT A;  3I56 A;  1VQM A;  4DV3 Q;  4ME3 A;  4X65 L;  3T1Y L;  1PTO C;  4LFC Q;  4PQX A;  4P75 A;  1F2L A;  2JK8 A;  3FKI H;  3R2T A;  1PTO H;  2IX1 A;  1BUV T;  3AEV A;  5FJ8 H;  3R8B A;  3QWN A;  5T1I A;  2JA8 B;  3A8J E;  4OWW B;  2A69 D;  3PMF A;  3SEB A;  4GKK Q;  5I6Y A;  2R3Z A;  1BQQ T;  2EE1 A;  1VQ4 A;  4JI8 Q;  4BXX G;  3M4O H;  2NZO A;  2Q8I B;  4JI4 L;  4QJF A;  2HIV A;  4KJN A;  1YI2 A;  5LMN L;  2GVA A;  2P5Z X;  2HQE A;  2A5H A;  5IT9 L;  3VR4 A;  3OMG A;  4A3D B;  1JJC B;  3PO3 B;  4RGT A;  1DON A;  4DV5 Q;  4JV5 Q;  3CRL C;  3H3V H;  3PV0 A;  1J6Q A;  4GS3 A;  1PZK D;  4DAY A;  4DV4 Q;  4QCL A;  2RHS B;  4YHH Q;  3I7F A;  3KF8 A;  2NTS A;  2HCI A;  3CF5 A;  1TY0 A;  2A74 C;  1IL8 A;  3Q8D A;  2AQ3 B;  4DR3 L;  4B3S L;  1J5E Q;  3STB C;  1J9O A;  5IYB H;  4JI1 Q;  3J81 L;  3BVG A;  1QUQ A;  2EVB A;  1SFO B;  4KN4 C;  1B9M A;  2VNU D;  5ELB A;  1X3Q A;  3NHH A;  2A6E D;  2MO0 A;  1G2S A;  3M7G A;  4HIO A;  2HDL A;  3KK7 A;  3W1B A;  1W2B A;  4BXX H;  3SGI A;  4C1N I;  3M4Y A;  1D2B A;  4IUU A;  1UNS A;  3LWE A;  3MTS A;  2MO1 A;  1EYA A;  2MUY A;  1IBK Q;  2QF7 A;  4GN4 B;  1HNW Q;  1V9P A;  5C4H A;  4C2M H;  3GTP B;  3CCV A;  2Y0S G;  1L1O C;  1SE4 A;  4IO9 A;  2XGT A;  4PG3 A;  1VMP A;  3HKS A;  4F88 A;  2KCM A;  5M5Y H;  1OXU A;  3DHQ A;  2FFK B;  4IUN A;  4UP7 A;  4DPG A;  5C3W A;  3C1E A;  1QNU A;  1XMO Q;  4H02 A;  4BA2 I;  1K0R A;  2E2I H;  3F8T A;  1E2V A;  3HOZ B;  3MXN B;  5E7N A;  1GO3 E;  4AYB G;  3NWS A;  1TS2 A;  1EQQ A;  2HQL A;  3OTO L;  4DN4 M;  4IJL A;  4BY7 G;  1Q8I A;  1CA5 A;  1F9P A;  4NB3 A;  4UP8 A;  1H9S A;  2H1E A;  2E8G A;  1S5C D;  1SYG A;  1Q86 C;  4U68 A;  1PLF A;  5HGQ A;  1KRS A;  4OL7 A;  1BO0 A;  1U4L A;  1E7Z A;  1G6P A;  1OXS C;  4AQY Q;  2N78 A;  4F8M A;  5KND A;  4DUY L;  4N8F A;  2AMC B;  2Z4I A;  4KD4 A;  2C9O A;  3FPP A;  1L0X B;  2F0Q A;  2HIX A;  3OIQ A;  2BA1 A;  1EWI A;  5JVG 3;  2EQS A;  2M9V A;  3S15 H;  2K5V A;  3KDF A;  1PH6 A;  2Q2H A;  5IGB A;  1JWS D;  3E3X A;  1XNQ L;  3FKI B;  5J22 A;  1Y69 U;  1PTO B;  3S24 A;  3S17 H;  2NZ1 D;  3VDY A;  3FEW X;  4G4K A;  1M90 C;  2ATW A;  4LF9 L;  4OO1 G;  4YCU A;  3KBX A;  4OX9 Q;  4QUF A;  4UP9 A;  2F4V L;  4BY7 H;  3RN5 A;  1S40 A;  1D8L A;  1E3P A;  4CJ2 C;  4WRD A;  2CW0 C;  5T1G A;  1YZ6 A;  3T53 B;  3CCS A;  3T56 B;  1GUS A;  3V05 A;  4ZK9 B;  4DV1 L;  4JI2 Q;  5C4J H;  2A1A A;  2IX0 A;  3RZD H;  1JOR A;  1JB3 A;  1CKN A;  1ZYR C;  1X9N A;  4HAE A;  3QOL A;  5C44 G;  5HGT A;  4K0K Q;  2L0C A;  3BU2 A;  1CZW A;  2KVM A;  1HQM C;  4X3U A;  1TWC H;  1G8Z D;  2A8V A;  2UXB L;  2EPB A;  4HMJ A;  5M3F G;  1IL2 A;  1LAB A;  2XN9 C;  1Y8N B;  2Z6B A;  1PH4 A;  1AFP A;  2F0W A;  4DK1 A;  1H9R A;  1JJG A;  3T51 B;  4OO1 H;  1SR3 A;  5JJK A;  3F2B A;  1UEB A;  2PW7 A;  3NTK A;  3HG9 A;  4H7B A;  1U0L A;  4JK1 C;  2PPB C;  4KN7 C;  4LF5 L;  3I90 A;  3PQI A;  3M3Y H;  1STA A;  3C3L A;  1B9N A;  4A4I A;  3K5N A;  3S2H B;  4LWC A;  1VQ7 A;  1EIY B;  1HTL D;  2F0J A;  4KJO A;  5BR8 L;  2B29 A;  4KY5 A;  2ZJR A;  3GTK B;  4K6L A;  5IGE A;  4MTK A;  2WAQ E;  4L5R C;  1GXD C;  5C44 H;  2WAC A;  3HGB A;  1ESR A;  3CD6 A;  4DR4 Q;  3UE0 A;  3A5U A;  3MXU A;  4DV7 Q;  1LT3 D;  2EYJ A;  1F9Q A;  5M3F H;  5M5Y B;  3CCQ A;  2ZJQ A;  3VA5 A;  1VQN A;  3CCE A;  3DEP A;  1FJG L;  4C56 C;  4DXF A;  1YHA A;  4GNX A;  1XNR Q;  1TXY A;  4A3B G;  1C48 A;  1DOL A;  1LT4 D;  2E2I B;  1HRJ A;  1I4H A;  5KGU A;  1WTQ A;  1EL0 A;  3J81 c;  2XVS A;  1ILQ A;  2R93 H;  2PMZ E;  4A3J G;  5CMD A;  2I46 A;  1UEA B;  4A93 B;  2DNC A;  4DNI A;  3PUY A;  3NTH A;  1WCM G;  2HHH L;  4R4I A;  1YNX A;  1KDB A;  2QW7 A;  3ZJY C;  3E5S A;  1NY4 A;  2KQ3 A;  3GV6 A;  4RKB A;  4OEL B;  4RCN A;  3TS0 A;  3FHW A;  4HMI A;  1U4R A;  2ZTD A;  3JC6 6;  2D5D A;  2RKS A;  4EX5 A;  2KHJ A;  2A6H D;  1BCP C;  2Y0S B;  3ERS X;  1I6H H;  1NMF A;  5FLX E;  3J80 i;  3DWA A;  3HZX A;  4A3F B;  2BH8 A;  1HNX Q;  1VS0 A;  2B39 A;  5D65 A;  1K8O A;  3S15 B;  2PNR C;  4K5X A;  1MI2 A;  1UUP A;  4DR7 L;  2SOB A;  2F0H A;  4BA1 I;  4NP5 A;  5GAG C;  1E1O A;  4R8N A;  4A3B H;  3A55 A;  1TWA H;  1SYF A;  2H4O A;  4DAY B;  1JB7 A;  3U9O A;  3GDE A;  4BY7 B;  2CWP A;  2IPK D;  4CDF C;  3G6E A;  4EQO A;  4A3J H;  2F0L A;  4HR7 B;  4TKO B;  3S2D H;  3VR5 A;  1C9O A;  3NBH B;  1WCM H;  5DAU A;  1JT8 A;  4YWM A;  3BDO A;  1IHZ A;  2RSN A;  2F0U A;  1H9M A;  1I4R A;  1BBX C;  1PRT C;  3K5O A;  4DR1 L;  2TSS A;  1SNP A;  2PZT A;  3OYY A;  4JI7 Q;  3M7N A;  1BBW A;  2PO4 A;  1DCZ A;  2Z9H A;  2NTT A;  5CV5 A;  4JYA L;  3K7A B;  3TP5 A;  2Z6K A;  2BCO A;  2K5Q A;  3BVZ A;  1GUN A;  1NBW A;  2XSC A;  3IKJ A;  1H95 A;  2UU9 L;  4CDC C;  4IPH A;  1X56 A;  2F3V A;  2N55 A;  4OHJ A;  1ENF A;  4R4T A;  4DAM A;  2QCP X;  1Q1B A;  3U4Z A;  4HIM A;  1UE6 A;  5E4X A;  1GUO A;  4N9T A;  3M3Y B;  3G48 A;  4J8Q A;  3SE0 A;  3CC2 A;  1EIH A;  2KHS A;  2XIW A;  1Y1V G;  4KY7 A;  2KCT A;  4XXE A;  1HA6 A;  3UE1 A;  2WB1 E;  3I3C A;  5L37 A;  1F9S A;  2CH4 W;  3G71 A;  4G7H C;  2PMZ B;  2JEB I;  3TBI B;  4QL5 A;  5C44 B;  3I2Z A;  3LWU A;  4KKT A;  1IYJ B;  2VL6 A;  5FO8 B;  1DM0 B;  2QIL A;  1BR9 A;  2WKD A;  1N33 L;  5EAY A;  1Q82 C;  4FDB A;  2JXM B;  4P71 A;  5FO7 B;  4NXN L;  1HCZ A;  2N3S A;  4X66 Q;  1GHJ A;  1A0I A;  3GV3 A;  4LFB Q;  2E2J B;  4LF6 L;  5J1Z A;  4HTH A;  5I9P A;  4L5Q A;  3S1N H;  2J0T D;  4C3I B;  2X6G A;  3D4W A;  1D1I A;  5JAV A;  5JPM C;  5FLX L;  5C4X B;  2PNH A;  1GUT A;  3KDF B;  3SK5 A;  4A76 A;  2FJ2 A;  4UHV A;  2R93 B;  4A3D G;  2SNM A;  3KJP A;  1Y1V H;  3CXC A;  3PO3 G;  1IBL L;  1F77 A;  1EEI D;  2OTJ A;  1S72 A;  2L15 A;  3BJU A;  1SMX A;  1PFM A;  1PH3 A;  4B3T L;  3O13 A;  4DR2 Q;  4A3K G;  2N49 A;  2ZM6 Q;  2B2T A;  1QOH A;  2B2Y A;  5CV9 A;  1YVC A;  3HOU G;  1GUW A;  2LFN A;  1I6H B;  3PO2 B;  1MGS A;  2F0D A;  3I4N G;  4XQN A;  4NDX A;  1JOQ A;  4IFD I;  2R6G A;  1F2Y A;  1UE1 A;  5KYL A;  1EQV A;  2MHV A;  2F03 A;  1QWY A;  3I4O A;  1VCI A;  3RD4 A;  4A3B B;  2D0P A;  3PUZ A;  1TWA B;  4DR6 L;  1L2F A;  2E5L L;  1BCP F;  1ML0 D;  3GO5 A;  1C0A A;  1SLJ A;  3NK9 A;  5IOD A;  5J39 A;  3K5L A;  3S1Q H;  2VB2 X;  1X32 A;  2NN6 I;  4DF7 A;  3TDQ A;  4A3D H;  4A3J B;  2Q2T A;  2OWO A;  3PO3 H;  3S2D B;  1PH1 A;  4KV6 A;  1GKH A;  2QDB A;  3CP0 A;  2JA7 B;  1KHI A;  4A3K H;  2B8F A;  4APV A;  5CV6 A;  1Q3L A;  3PUW A;  4I65 A;  1SE8 A;  4A3I G;  1XMQ L;  3HOU H;  4OIJ A;  1DGS A;  4BWG B;  2YTX A;  2WB1 B;  2VQF Q;  1N32 L;  1GHK A;  1C8C A;  3I4N H;  3J80 E;  1PRT B;  3J7A F;  1D1K A;  1N34 L;  5I2X A;  1WJJ A;  4ILW A;  3DM3 A;  1HNZ L;  1VF5 C;  1BOS A;  4KMU C;  1Q12 A;  2RBM A;  1FR3 A;  2BE5 C;  5C5M A;  3LX0 A;  1JWM D;  1SEB D;  3TRE A;  1TT2 A;  5C3X A;  5IE8 A;  1PH8 A;  1SNO A;  4CGY B;  3T1H L;  1STN A;  2R7D A;  1E22 A;  3W1G A;  1Y14 B;  4HCS A;  3M9B A;  1K0S A;  1Q81 C;  3E0E A;  1D5Z C;  4YY3 L;  3GTL B;  5CC4 A;  1ICW A;  2E74 C;  3BDC A;  1C7Y A;  4FXK C;  2UUA Q;  4A3M G;  3DMU A;  3GTP H;  2Q2U A;  4H13 C;  2CQA A;  2KEE A;  5GQO A;  4A3I H;  4B3R Q;  3M4P A;  3MA2 B;  4LW1 A;  2UXC Q;  5J3B A;  3PIO 3;  2Z1C A;  5EKL A;  1TVX A;  4DK3 C;  2YYZ A;  2MJ8 A;  1KTK A;  2EY2 A;  3BZK A;  2YTV A;  2UUB Q;  5LMN W;  1HZC A;  2VUM G;  2Q8R E;  1ZKO A;  1U9R A;  3J81 j;  4CBV A;  3G7L A;  2B2V C;  1VDZ A;  4ID6 A;  4QB4 A;  2NVY B;  4MHE A;  4MTN A;  2FXQ A;  4QMG A;  1SYE A;  4JOI A;  2PCF B;  4RHR A;  4Z9C B;  1TS4 A;  3HKZ E;  2KOL A;  3M4Q A;  4B3M L;  4R4O A;  1LV9 A;  2K75 A;  3CCL A;  5FO9 B;  3S14 B;  4A3M H;  1YIJ A;  3J7Y W;  4LFA Q;  3CCR A;  3OPO A;  4JI5 L;  1EQR A;  2WII B;  3ZYY X;  4A75 A;  4DA2 A;  3VA7 A;  1L1O A;  3HFZ B;  1HR0 L;  1DYQ A;  4X65 Q;  1HFG A;  4HSP A;  5IYB G;  3T1Y Q;  1ICF B;  4WJ3 M;  1AEX A;  1RTN A;  4JBW A;  2VUM H;  4CDD C;  3R93 A;  3SK8 A;  2WP8 J;  4LFC L;  2MQH A;  1MKH A;  1K28 A;  2EYH A;  5JJL A;  5CV7 A;  4PMB A;  1RCV D;  1EUJ A;  1XYI A;  3RZO H;  4POG A;  4IOC A;  1KLU D;  3S1Q B;  2BH2 A;  2EY6 A;  1SRU A;  3TN2 A;  4HSV A;  3DLL A;  2UXD L;  3H3V C;  3E6Z X;  1NAP A;  4JI4 Q;  4IPD A;  5LMN Q;  1PZJ D;  2J7Z A;  5FLX c;  3HOX B;  1QJO A;  3H6M A;  3CU7 A;  1ZEQ X;  3J7A 5;  4A3K B;  4P74 A;  2ASB A;  1BBU A;  1JMC A;  1YNJ C;  2XTI A;  4EQP A;  2B2U C;  3HOU B;  1A3U A;  1RIP A;  5JVH 3;  4JV5 L;  3PUX A;  1STB A;  3I4N B;  2WFW A;  4JBM A;  4JC0 A;  1NE3 A;  4LUO A;  3MVV A;  1CQV A;  3L3O C;  1RJT A;  4YHH L;  4B3S Q;  4DR3 Q;  2NVT H;  3I4L A;  2BOS A;  1DD2 A;  4L5S A;  4K8I A;  1YJ9 A;  4JI1 L;  3ER0 A;  2RDG A;  4K8J A;  3CMA A;  2A6E C;  4K5V A;  1T5E A;  5ELC A;  3STB D;  2IY5 B;  3IFD A;  4A3E G;  2CHB D;  2B2W C;  4TVA B;  3F2D A;  4GOP A;  1X55 A;  4A93 G;  3S2H H;  2F3I A;  4UY8 C;  2PI2 A;  1Z6H A;  2F0O A;  4KTA A;  3L2P A;  2F52 A;  3RLO A;  3GTK H;  1PYB A;  1QZG A;  4OON A;  1QE6 A;  1C4Q A;  3VYS A;  1KNE A;  4DR5 L;  1CHP D;  4A3I B;  3MHB A;  3N52 A;  1IBK L;  2IL8 A;  2AQ2 B;  1AZQ A;  4A3F G;  5EJW A;  5BN5 A;  2EZV A;  4O0A A;  2JP1 A;  1M1K C;  1VQL A;  5ELN A;  2K01 A;  2X69 A;  2H5X A;  2L11 A;  4NXM L;  1ZXT A;  4FP5 D;  1CZG A;  5GAH C;  2A73 B;  4L8J A;  5IYD G;  4PZ8 A;  5CV4 A;  1HJP A;  2K5W A;  4A3E H;  3W2D A;  3M85 A;  1NTG A;  1FNV A;  4BY1 B;  5KRU A;  2LY7 A;  5M5W H;  1F9R A;  4A93 H;  2EYM A;  1HHV A;  2Q8T A;  1HZ9 A;  3OTO Q;  3EBE A;  4JI0 L;  1WOC A;  1XTC D;  1RHP A;  3TRZ A;  3KJO A;  1AH9 A;  2JYO A;  1FYC A;  3SR1 A;  1NSN S;  4A3M B;  3EVQ A;  4KY6 A;  1VQD A;  1PH9 A;  4LUV A;  5DEH A;  1B2T A;  1QIL A;  4A3F H;  4DUY Q;  1W3S A;  3BZD B;  3DM1 A;  2WAQ G;  1AP0 A;  1O7Z A;  4BBR G;  5C0X I;  5C0X G;  1HTP A;  2K7V A;  1KDA A;  5AJ3 L;  2IT1 A;  1F2Z A;  1PZI D;  1K8M A;  1QVF A;  2VUM B;  4OEM B;  1TWF H;  3Q22 A;  3C1F A;  3UDX A;  3TZD A;  4HID A;  3S1R B;  5IYD H;  3FP9 A;  3SK6 A;  4CKC A;  2B63 G;  2MGS A;  1VQA A;  1X3E A;  1WTP A;  3URY A;  2K5N A;  1PTO F;  2NB0 A;  1G91 A;  1NMG A;  4ZLT F;  3RZO B;  3PF5 A;  4IUT A;  3T13 A;  1PA6 A;  1EY9 A;  2I0Q A;  2F0V A;  2F4V Q;  2ZTE A;  1SBB B;  1SDF A;  3S16 B;  3SHL A;  1AW7 A;  1WTX A;  1PH7 A;  4BS9 A;  1W6J A;  5G3L F;  1SE3 A;  1X6O A;  4X3S A;  3ERO A;  4C3H G;  1WTW A;  3EN2 A;  4DAP A;  2CH4 A;  3AQQ A;  1RDP D;  5FK9 C;  5IGC A;  2JA9 A;  2KA7 A;  3KF6 B;  3A8I E;  3K7A H;  5C4Z A;  3K59 A;  5C0X H;  4BBR H;  5JPN C;  1G51 A;  5DNF A;  4J1M A;  4OWX B;  2F0G A;  1T9H A;  1ZYR D;  4X64 L;  4ODG A;  2NVT B;  2UXB Q;  3SK4 A;  1ASY A;  1KRT A;  2XNA C;  2C35 B;  1Y8P B;  4EQ5 A;  3A74 A;  3SDZ A;  2B63 H;  3NTI A;  4DV2 L;  4C3I G;  2NWG A;  4DGZ A;  4PV1 C;  3IFT A;  2IHF A;  5C4X G;  4X62 L;  2JE6 I;  4JI3 Q;  4K2K A;  1TWG B;  1EEF D;  1I5F A;  2R93 G;  1S3O A;  1WTO A;  4QIW E;  2ICE C;  3NUC A;  4EGV A;  4LF5 Q;  4JG2 A;  1K73 C;  4C3H H;  2PI2 E;  1LYL A;  1UWV A;  5D14 A;  3J80 c;  1HZA A;  1CT1 D;  1Q1E A;  2E76 C;  1B4O A;  2L9H A;  1IYU A;  5BR8 Q;  3PO2 G;  1AZP A;  1PFS A;  3H09 A;  4OXP A;  1BF4 A;  1IXR A;  2CCZ A;  4RHS A;  3C2P A;  5IWA L;  2QEJ C;  1TS3 A;  4TQU S;  3MAQ A;  3P1H A;  2OTL A;  1XXG A;  5DLQ E;  1O78 A;  2E2J H;  3LNN A;  2PZW A;  5KNC A;  3GP7 A;  3TSS A;  3OSO A;  3Q23 A;  4MZ9 A;  4C3I H;  3FPU B;  5KNB A;  5IP9 G;  4MN3 A;  5C4X H;  4Q5V A;  5ISR A;  4LF8 Q;  3OHX C;  1KL9 A;  1YNN D;  4A3E B;  4PNY A;  1PFN A;  1XNR L;  1HQR D;  1I6V C;  5M5W B;  3I55 A;  3KLS A;  5ELD A;  5I9O A;  4KHV A;  1AN8 A;  2MP1 A;  1WD1 A;  4LJZ C;  2K6A A;  2JA7 G;  4GN3 B;  2B8G A;  4DAV A;  2OF1 A;  4ZAI A;  5EKI A;  1IBM L;  3EJI A;  2HHH Q;  1CM9 A;  4A3G B;  1X3P A;  1LTT D;  3PO2 H;  2WB1 G;  2F0M A;  4AIM A;  5K5P A;  4DUZ L;  2HT1 A;  3A5Z B;  3QB3 A;  3D8G A;  1EFW A;  5C3E B;  1G2T A;  5IY0 A;  1XTD A;  1BCP D;  4KKU A;  1MD2 D;  3VR2 A;  2FHT A;  1TWF B;  3MWY W;  1LTI D;  5ELO A;  1CKO A;  1AE2 A;  4DR7 Q;  1UE5 A;  5IP9 H;  5IYC G;  5D3D A;  1HUM A;  3KF8 B;  2JA5 G;  4P2C B;  1NJI C;  1QUQ B;  2IJ0 A;  1VQ5 A;  5H1S E;  2ZJP A;  2QDL A;  2K1B A;  1U5K A;  2JA7 H;  4FF4 A;  2BDN A;  2XRQ D;  3UDF A;  3ULJ A;  1ASZ A;  3W3A A;  3H91 A;  5EBD A;  3H15 A;  2DY8 A;  4UPA A;  5EKK A;  1PYW D;  4QIW B;  3GD7 A;  1SYC A;  3TZU A;  4GOP B;  3F1Z A;  2IHE A;  4P73 A;  5JOB A;  2AKW B;  2EIF A;  2WAQ B;  4G57 A;  4BBR B;  3D31 A;  4DV0 L;  4C1N K;  3NP8 A;  1UAP A;  4K5W A;  4JYA Q;  2PZU A;  2KHI A;  3U50 C;  3RLF A;  2VQE L;  2AHO B;  1OO9 B;  4RKL A;  2TMP A;  3VR6 A;  5IYC H;  4KD3 A;  2G9H D;  3C46 A;  2B63 B;  3LGJ A;  2JA5 H;  2UU9 Q;  1Q7Y C;  4B9X A;  3K7U C;  4KHZ A;  3PIO A;  4LNQ A;  3GTL H;  4JBJ A;  4ULL A;  4E6I A;  3A54 A;  1EYD A;  2RA4 A;  4JI6 L;  3AFP A;  4G7Z C;  3I4M H;  5TSS A;  3U9S A;  4C3H B;  1N8R C;  4YWK A;  1MSH A;  2HCC A;  1H9S B;  3EA6 A;  3GTG B;  1KQS A;  3BZC A;  4ZCK A;  4GKJ L;  2Z4H A;  1SMY D;  3U58 A;  1JJ2 A;  3JAM i;  2O2L D;  1UE7 A;  4XIG S;  4HED A;  1VQ9 A;  3CPW A;  1CA6 A;  1KAW A;  2EXZ A;  4MNO A;  3EIV A;  3VYU A;  4FYD A;  3IL8 A;  2DJF C;  3V2T A;  5IOC A;  5KIX A;  1N33 Q;  1SND A;  3ND9 A;  1WVL A;  2NVY H;  1B8A A;  1K3R A;  2XWB B;  4NXN Q;  3H0G G;  3I72 A;  4FXD A;  4LF6 Q;  1IZ6 A;  2JEA I;  4JPB W;  5AFW A;  5C5L A;  1P8L A;  1GM5 A;  2AUJ D;  4ZYS A;  3S14 H;  1SNC A;  3KFU A;  2WV6 D;  3HOX G;  1ESF A;  3EQL C;  1B53 A;  5M3M G;  5LHY 1;  4JVZ A;  4RH6 A;  2JQO A;  1IBL Q;  1EFI D;  3HOW G;  2F3W A;  1A3T A;  1FL0 A;  4B3T Q;  3RNU A;  3NE5 B;  4ALP A;  2ZTC A;  3BYT B;  1B7Y B;  2DGY A;  4FF2 A;  2PQA A;  2ZM6 L;  4IFD G;  4RMF A;  2EJG C;  4XDX A;  2ZXR A;  2A68 C;  2F0I A;  2VXW A;  1VQ6 A;  3NQI A;  3UDI A;  1MJE A;  2F1M A;  2VZA A;  1IKL A;  1CKN B;  3P7J A;  1Q8K A;  2R7Z B;  3NWT A;  2Z6K C;  2HD3 A;  3H0G H;  2B2V A;  3TQY A;  2K5D A;  5HUR A;  1L0W A;  3GTJ B;  2NN6 G;  5BN4 A;  1XPR A;  1DJR D;  4DR6 Q;  2ZXO A;  2E5L Q;  4ZRZ A;  2K33 A;  1V1Q A;  3HOX H;  1NUC A;  3BYY B;  1I94 L;  5M3M H;  3QOJ A;  1VF7 A;  5A2Q E;  2K04 A;  2F0F A;  1M4V A;  1WYD A;  2WIN B;  1O7Y A;  3HKZ G;  4IUV A;  1KC8 C;  3HOW H;  2A19 A;  2K52 A;  1BXT A;  4O42 A;  1RD9 D;  4MIU A;  1E0B A;  1RKN A;  1EY0 A;  2OEO A;  3WWV A;  4IFD H;  1WTV A;  2DN8 A;  1XMQ Q;  4KHP L;  1ILP A;  1TY2 A;  3OIP A;  3J7Z C;  2O4X A;  2UUC Q;  1STY A;  1N32 Q;  1HZB A;  1B50 A;  1N36 Q;  3G6J B;  1N34 Q;  2MPM A;  2SNS A;  2NVQ H;  4KKS A;  5EPK A;  5LL6 X;  1PRT F;  1SSO A;  2QKI C;  1HNZ Q;  4BY1 G;  1R4P B;  1YIT A;  2JA5 B;  1QVC A;  2NN6 H;  4I7Z C;  5IT9 E;  3K8A A;  1JOO A;  3GQB A;  1EU3 A;  2CFM A;  4YCV A;  5FKA C;  1SNM A;  3T1H Q;  1S5E D;  4LF7 L;  2M2L A;  3F2U A;  1HR0 W;  3B6Y A;  4FXG C;  5FLM G;  1WI5 A;  2R61 A;  1CKM A;  4GNX B;  2YTY A;  1WD0 A;  3AMU A;  4A3L G;  1DZ1 A;  3I4M B;  2QEX A;  1I50 H;  4U67 3;  5COY A;  3K6O A;  5LMU L;  2RQX A;  4DFA A;  1R4Q B;  2B2U A;  4YWL A;  1LLR D;  4DU9 A;  5IP7 G;  1J8I A;  2B2T C;  4IOA A;  5I4D A;  1V8Q A;  2B2Y C;  3Q6S A;  4OWT B;  1TKW B;  4RGN A;  1MHW C;  4CJ1 B;  1I4Q A;  3T4A C;  3K5M A;  2F4I A;  2FMM A;  3HOV G;  1NCV A;  4IUQ A;  4O2D A;  4H0L C;  4XT1 B;  5DM6 3;  4LF4 L;  5A35 A;  4BY1 H;  4LK1 C;  4DV6 Q;  1F2M A;  1VQG A;  2R92 G;  4DK0 A;  1YJW A;  1LTL A;  4OGQ C;  1V43 A;  2NZH A;  1VQ8 A;  2B2W A;  1IW7 C;  1P16 A;  3HRZ C;  1PMR A;  5FLM H;  4PMW A;  4A3L H;  4V0B A;  3K58 A;  4B3M Q;  1PV4 A;  1T5X D;  2XRS D;  4V19 0;  2F0E A;  1Y1W G;  4B9W A;  1OXT A;  3L9A X;  1MSG A;  1M8A A;  1EOV A;  1FNW A;  1GVP A;  4NKL A;  5IP7 H;  4DV3 L;  1YJN A;  3JAM E;  4HJ9 A;  3J7A V;  4XQQ A;  1A63 A;  1HFN A;  3TP8 A;  3ULL A;  3S1R H;  3H3V I;  1HR0 Q;  3DEO A;  3CCU A;  5A2Q L;  3OMC A;  1PTO D;  3HOV H;  5ELE A;  1TR5 A;  2A69 C;  2RDH A;  1VQC A;  2KJX A;  1XWE A;  5CYU A;  4WOR A;  1WTR A;  3PGZ A;  1N9W A;  3H0G B;  2YU9 H;  2R92 H;  4N9P A;  3WDN A;  1VQE A;  2OXP A;  1FVI A;  1IYV A;  3J80 L;  1GOZ A;  4GKK L;  3S16 H;  4M8A A;  5G3L D;  2LXK A;  3HOY B;  1S5D D;  1D7Q A;  1JWU D;  4JI8 L;  4A3C G;  2DY7 A;  1X54 A;  3VR3 A;  3K0X A;  1U4M A;  2EYL A;  5M3M B;  2O5J C;  2UXD Q;  1ENC A;  1Y1W H;  4PZ6 A;  4X3T A;  1PFB A;  4ZQ3 A;  4PMC A;  4RG1 A;  1QZH A;  2E75 C;  3V96 A;  3HOW B;  4DV5 L;  3P20 A;  4QQB X;  3PIP 3;  1KD1 C;  2D9U A;  2NVX H;  1TQO A;  3MEF A;  4UDU C;  4TRD A;  1CSQ A;  3DUZ A;  4DV4 L;  5CBA E;  4R9W A;  3NSW A;  4IFD J;  2BA0 A;  1K9M C;  1STG A;  2L1B A;  2VB3 X;  3A7A B;  4Y52 H;  1XX8 A;  1K8G A;  1EZ8 A;  1YNJ D;  4NPS A;  1QVG A;  1J5E L;  1O7I A;  2NVQ B;  4J6H A;  1LO5 D;  3CC7 A;  1TWG H;  2G5D A;  4GLV B;  4IJH A;  3NEN A;  2X6L A;  1TII D;  2JSO A;  3NBH A;  3ICE A;  1A3V A;  2K28 A;  1HUN A;  3CRK C;  1SNQ A;  3QR8 A;  3D4R A;  4A3C H;  2F0N A;  2OT2 A;  4H44 C;  2AWO A;  4NW2 A;  2WKC A;  1R9T B;  3QG1 A;  1HH2 P;  4QF4 A;  5E3F A;  1TS5 A;  4X3K A;  2I5L X;  4A3G G;  4JOI C;  3FMC A;  4UAI A;  3HKZ B;  3R2I A;  4JW0 A;  3RLN A;  2VW9 A;  1I50 B;  1HNW L;  4DNR B;  3S9W A;  1DOK A;  2MFI A;  1X3F A;  2V4D A;  2NBF A;  4S3S A;  5C3E G;  4DR5 Q;  1EYG A;  3I70 A;  2KCN A;  1B70 B;  1LTG D;  2PW5 A;  5EPJ A;  1FGU A;  1RTO A;  1FD7 D;  5JJI A;  1FGB D;  2RF4 A;  2LKV A;  4GN5 A;  1XMO L;  3MFY A;  1YHQ A;  4F87 A;  4NXM Q;  5HY6 A;  2ALY B;  4HCE A;  1EY8 A;  4KK7 A;  2PQA B;  1LM0 A;  2AUK A;  4IZ8 A;  3GTM H;  4XYO A;  5GRO A;  3JAM L;  5IGG A;  5D3I B;  4BBS G;  1XPU A;  4LMQ D;  2O5I C;  3QO2 A;  3IRB A;  1SXT A;  1A2T A;  4A3G H; 
#chains in the Genus database with same CATH homology
 1I4X A;  4ME5 A;  1I3Q B;  1B3A A;  1EU4 A;  3SVM A;  2BDO A;  4Q0F A;  3SXH A;  1LTA D;  1RF2 D;  4O1N A;  1E2Z A;  5JEA G;  3UI2 A;  2HUG A;  3A7L A;  1D5X C;  4XT3 B;  3Q0A A;  3ONA B;  1V1P A;  5COR A;  3WOE A;  1A2U A;  3HOV B;  5C6A A;  1LT6 D;  1O7L A;  3PUV A;  2KED A;  1PXU A;  5E4W C;  2R92 B;  2YU9 B;  3AB9 A;  2PYK A;  3D6W A;  1DXM A;  3OWF A;  4FNF A;  4OO1 I;  4RFB A;  3BS1 A;  3E0J A;  4C3J G;  3ITP A;  2CW0 D;  1SJH D;  1Y1W B;  3TP6 A;  1EY6 A;  3M4O B;  3BDL A;  2NVX B;  2L4N A;  1KDC A;  5F2D A;  2IX3 A;  5JEA H;  1II3 A;  4LAA A;  4FO2 A;  4XQJ A;  4R8I A;  1SAP A;  2F0K A;  1CK1 A;  5NUC A;  2K03 A;  1EWH A;  1B1Z A;  2EYO A;  4ABN A;  5I6W A;  5IGF A;  2FIN B;  1STE A;  3FDT A;  1EOT A;  1S5F D;  1LTR D;  3CKI B;  3MFG A;  2DNE A;  3DXJ C;  3NBI A;  3P75 A;  5KYI A;  1JQY D;  1EYC A;  1LAC A;  4WFN 3;  4IUR A;  4XYQ A;  2F0P A;  4C2M B;  1I4P A;  3ERQ A;  3X3N A;  3QJY A;  3MXP A;  1HPC A;  1O80 A;  1JCK B;  4FVM A;  5EBC A;  1JE4 A;  2RDF A;  3CHB D;  1A6X A;  2KEC A;  2F0S A;  1YNN C;  3QIA A;  3GTM B;  1VMC A;  1SYD A;  3HEJ A;  3HP3 A;  4RGM A;  4CKE A;  3WOF A;  3DWQ A;  4YIJ A;  1I4G A;  2A6H C;  2LS0 1;  1STH A;  2L5T A;  3I73 A;  2M00 A;  4HN7 A;  1CTM A;  1ROD A;  4RGO S;  4RA8 A;  1ET6 A;  1K83 B;  5CGK A;  2C5C A;  5I2Y A;  2D2C C;  4L6T B;  1U4P A;  2NYZ D;  1MBY A;  1GJX A;  3KLR A;  2IW3 A;  3NXW A;  2EYP A;  2RVL A;  2EJM A;  3S17 B;  3RMH A;  2I07 B;  1ONL A;  2ZXP A;  1Q90 A;  2EDG A;  4BBS B;  1NR2 A;  3AU7 A;  3D4D A;  1IKM A;  4AYB B;  2G9D A;  3EFX D;  2SEB D;  4RWS C;  3I91 A;  1JOK A;  1CQF A;  3K0Y A;  3N6R A;  5C0X J;  4DNT B;  4CJ0 B;  3TME A;  1NR4 A;  4EQN A;  1PRT D;  3H94 A;  4K2L A;  5JEA J;  3T16 A;  5C4J B;  3RZD B;  1Z7T A;  2EY5 A;  3FVQ A;  4F7X A;  2EY1 A;  2F0T A;  5K36 G;  1B44 D;  3IAY A;  1TWC B;  1GUG A;  4Y7N B;  1TU2 B;  3MZ5 A;  1SYB A;  4FF3 A;  1EY5 A;  4IAL A;  5FOB B;  1PDQ A;  3OW7 A;  1FNU A;  4ZKC B;  4C3J B;  1EZ6 A;  1BDO A;  1BNZ A;  5DM7 3;  1Y8O B;  1QB5 D;  1CI3 M;  2CVR A;  2EJF C;  3I8Z A;  1KAB A;  1HXY D;  3S1M B;  4EVO A;  3ND8 A;  1SMY C;  2EYF A;  2PQE A;  4FF1 A;  3L7Z C;  4ZUI A;  4DXG A;  1L0Y B;  4XTC S;  5K36 H;  2E2H B;  3NPP A;  5M3F B;  2L55 A;  4IQZ A;  3BG3 A;  2GA4 B;  1OXX K;  1S5B D;  1V1P B;  4KI0 A;  3CQZ B;  1CFM A;  3KBG A;  3MEH A;  4WJW A;  2ICI A;  4OIK A;  5IGD A;  2K05 A;  4IN3 A;  2N88 A;  5KEE A;  1G6Z A;  1SJE D;  1A15 A;  1QNK A;  3NQT A;  1HA5 A;  1OXV A;  1KAA A;  5ELF A;  1LT5 D;  3TP7 A;  3VYR A;  3MXN A;  5M5X B;  1LTB D;  4K14 A;  4CHT B;  2K32 A;  2KCC A;  2A68 D;  2D62 A;  1BCP B;  4NMZ A;  4RCO A;  5CBE E;  1JC7 A;  2SDF A;  2LMC B;  2Z8L A;  5E1F A;  5CR3 A;  1H9K A;  3D3R A;  4IUP A;  3KUP A;  3OWE B;  1SE2 A;  1TWH B;  2EOT A;  2HDM A;  2IWH A;  2ZT9 C;  4GZY C;  4RAU C;  3GTO B;  1KNA A;  5EPL A;  1WCM B;  3Q24 A;  1D6E C;  1ENA A;  1V1O A;  4ZUJ A;  1LTS D;  2ID0 A;  2AQ1 B;  2FMC A;  5EQ0 A;  3A56 A;  3RUZ A;  5M9O A;  2E2D C;  2L12 A;  3OOC A;  1W6K A;  1H9J A;  2ENB A;  3MC0 B;  2BE5 D;  1Z47 A;  3R3O A;  3KLS X;  2XWJ B;  5CV8 A;  4K6D A;  1KLG D;  2KUM A;  1E2W A;  2AWN A;  1S4Z A;  2JA6 B;  3VYT A;  3FRP B;  3J81 E;  1EY4 A;  2RSO A;  3D6C A;  1EIG A;  3MXG A;  1D5M C;  5IIF A;  1JR0 D;  5JJZ A;  4L63 B;  1DOM A;  1CHQ D;  1EY7 A;  1QG7 A;  4ZKB B;  3HS0 C;  3GTQ B;  1EQT A;  5LL6 S;  1JIC A;  2J4X A;  4QUC A;  3BVM A;  1QCB D;  4TSS A;  4M1U B;  3DWP A;  3S1N B;  3A8K E;  2NUC A;  1IW7 D;  4G7O C;  1ET9 A;  1G29 1;  3X3M A;  1Y1V B;  3K57 A;  1EWC A;  4B08 A;  5BN3 A;  4CKB A;  5EGT A;  1PTO C;  4PQX A;  1F2L A;  3R2T A;  1PTO H;  2IX1 A;  1BUV T;  3R8B A;  3QWN A;  5T1I A;  2JA8 B;  3A8J E;  2A69 D;  3PMF A;  3SEB A;  5I6Y A;  2R3Z A;  1BQQ T;  2EE1 A;  2Q8I B;  4KJN A;  2HQE A;  2A5H A;  5IT9 L;  3VR4 A;  3OMG A;  4A3D B;  3PO3 B;  4RGT A;  1DON A;  3CRL C;  3PV0 A;  1PZK D;  4DAY A;  4QCL A;  3KF8 A;  2NTS A;  2HCI A;  1TY0 A;  2A74 C;  1IL8 A;  2AQ3 B;  1J9O A;  3J81 L;  3BVG A;  2EVB A;  1SFO B;  4KN4 C;  1B9M A;  2VNU D;  5ELB A;  1X3Q A;  3NHH A;  2A6E D;  1G2S A;  3M7G A;  2HDL A;  3KK7 A;  4C1N I;  3M4Y A;  1D2B A;  4IUU A;  1UNS A;  3LWE A;  3MTS A;  1EYA A;  2MUY A;  2QF7 A;  5C4H A;  3GTP B;  1SE4 A;  1VMP A;  4F88 A;  1OXU A;  3DHQ A;  2FFK B;  4IUN A;  5C3W A;  3C1E A;  1QNU A;  4BA2 I;  1E2V A;  3HOZ B;  3NWS A;  1TS2 A;  4DN4 M;  1Q8I A;  1CA5 A;  1F9P A;  1H9S A;  2H1E A;  1S5C D;  1SYG A;  4U68 A;  1PLF A;  4OL7 A;  1BO0 A;  1U4L A;  1OXS C;  5KND A;  4F8M A;  2Z4I A;  4KD4 A;  2C9O A;  3FPP A;  1L0X B;  2F0Q A;  3OIQ A;  2BA1 A;  5JVG 3;  2M9V A;  5IGB A;  1JWS D;  3FKI B;  5J22 A;  1Y69 U;  1PTO B;  2NZ1 D;  3FEW X;  4G4K A;  4OO1 G;  3KBX A;  4QUF A;  4CJ2 C;  4WRD A;  2CW0 C;  5T1G A;  3T53 B;  3T56 B;  1GUS A;  3V05 A;  4ZK9 B;  2IX0 A;  1JOR A;  1JB3 A;  1ZYR C;  4HAE A;  3QOL A;  5HGT A;  2L0C A;  1CZW A;  2KVM A;  1HQM C;  4X3U A;  1G8Z D;  2EPB A;  4HMJ A;  1LAB A;  2XN9 C;  1Y8N B;  1AFP A;  2F0W A;  4DK1 A;  1H9R A;  3T51 B;  4OO1 H;  2PW7 A;  3NTK A;  3HG9 A;  4H7B A;  4JK1 C;  2PPB C;  4KN7 C;  3I90 A;  1STA A;  3C3L A;  1B9N A;  3K5N A;  3S2H B;  1HTL D;  2F0J A;  4KJO A;  4KY5 A;  3GTK B;  4K6L A;  5IGE A;  1GXD C;  2WAC A;  3HGB A;  1ESR A;  3MXU A;  1LT3 D;  2EYJ A;  1F9Q A;  5M5Y B;  3VA5 A;  3DEP A;  4C56 C;  4DXF A;  1C48 A;  1DOL A;  1LT4 D;  2E2I B;  1HRJ A;  1I4H A;  5KGU A;  1WTQ A;  1EL0 A;  2XVS A;  1ILQ A;  5CMD A;  2I46 A;  1UEA B;  4A93 B;  2DNC A;  3PUY A;  3NTH A;  1KDB A;  3E5S A;  3GV6 A;  2KQ3 A;  4RKB A;  4RCN A;  4HMI A;  1U4R A;  2D5D A;  2RKS A;  2A6H D;  1BCP C;  2Y0S B;  5FLX E;  3DWA A;  3HZX A;  4A3F B;  5D65 A;  2B39 A;  1K8O A;  3S15 B;  2PNR C;  4K5X A;  1MI2 A;  1UUP A;  2SOB A;  2F0H A;  4BA1 I;  4NP5 A;  4R8N A;  3A55 A;  1SYF A;  2H4O A;  3U9O A;  4BY7 B;  2IPK D;  4EQO A;  2F0L A;  4HR7 B;  4TKO B;  3VR5 A;  5DAU A;  3BDO A;  1IHZ A;  2RSN A;  2F0U A;  1H9M A;  1I4R A;  1BBX C;  1PRT C;  3K5O A;  2TSS A;  1SNP A;  2PZT A;  3M7N A;  2PO4 A;  1DCZ A;  5CV5 A;  2NTT A;  3K7A B;  3TP5 A;  2BCO A;  2K5Q A;  3BVZ A;  1GUN A;  2XSC A;  3IKJ A;  4OHJ A;  2F3V A;  2N55 A;  1ENF A;  2QCP X;  1Q1B A;  5E4X A;  1GUO A;  4N9T A;  3M3Y B;  1EIH A;  4J8Q A;  3SE0 A;  2KHS A;  2XIW A;  4KY7 A;  4XXE A;  1HA6 A;  3I3C A;  1F9S A;  4G7H C;  2PMZ B;  2JEB I;  3TBI B;  5C44 B;  3LWU A;  4KKT A;  5FO8 B;  1DM0 B;  2QIL A;  1BR9 A;  2WKD A;  2JXM B;  5FO7 B;  1HCZ A;  1GHJ A;  3GV3 A;  2E2J B;  5J1Z A;  4HTH A;  5I9P A;  2J0T D;  4C3I B;  2X6G A;  5JPM C;  3D4W A;  1D1I A;  5JAV A;  5FLX L;  5C4X B;  3SK5 A;  1GUT A;  2FJ2 A;  2R93 B;  2SNM A;  1F77 A;  1EEI D;  1PFM A;  3O13 A;  2B2T A;  1QOH A;  2B2Y A;  5CV9 A;  1GUW A;  2LFN A;  1I6H B;  3PO2 B;  1MGS A;  2F0D A;  4XQN A;  4NDX A;  1JOQ A;  4IFD I;  2R6G A;  1F2Y A;  5KYL A;  1EQV A;  2MHV A;  2F03 A;  1QWY A;  1VCI A;  3RD4 A;  4A3B B;  3PUZ A;  1TWA B;  1BCP F;  1ML0 D;  3GO5 A;  3NK9 A;  5IOD A;  5J39 A;  3K5L A;  2VB2 X;  1X32 A;  2NN6 I;  4DF7 A;  3TDQ A;  4A3J B;  3S2D B;  4KV6 A;  2QDB A;  2JA7 B;  2B8F A;  5CV6 A;  1Q3L A;  3PUW A;  4I65 A;  4OIJ A;  4BWG B;  2WB1 B;  1GHK A;  1C8C A;  3J80 E;  1PRT B;  3J7A F;  1D1K A;  5I2X A;  4ILW A;  1VF5 C;  1BOS A;  4KMU C;  1Q12 A;  2RBM A;  1FR3 A;  2BE5 C;  5C5M A;  3LX0 A;  1JWM D;  1SEB D;  1TT2 A;  5C3X A;  1SNO A;  4CGY B;  1STN A;  4HCS A;  1D5Z C;  3GTL B;  5CC4 A;  1ICW A;  2E74 C;  3BDC A;  4FXK C;  3DMU A;  4H13 C;  2CQA A;  2KEE A;  3MA2 B;  3PIO 3;  2Z1C A;  5EKL A;  1TVX A;  2YYZ A;  2MJ8 A;  1KTK A;  2EY2 A;  2Q8R E;  1ZKO A;  1U9R A;  4CBV A;  3G7L A;  2B2V C;  1VDZ A;  4ID6 A;  4QB4 A;  2NVY B;  4MHE A;  4QMG A;  1SYE A;  2PCF B;  4RHR A;  4Z9C B;  1TS4 A;  2KOL A;  1LV9 A;  5FO9 B;  3S14 B;  3J7Y W;  3OPO A;  2WII B;  3ZYY X;  4DA2 A;  3VA7 A;  1DYQ A;  1HFG A;  4HSP A;  1AEX A;  1RTN A;  4JBW A;  3R93 A;  3SK8 A;  2WP8 J;  2EYH A;  5CV7 A;  4PMB A;  1RCV D;  1XYI A;  1KLU D;  3S1Q B;  2EY6 A;  3TN2 A;  4HSV A;  3H3V C;  3E6Z X;  1NAP A;  1PZJ D;  2J7Z A;  3HOX B;  1QJO A;  3H6M A;  3CU7 A;  1ZEQ X;  4A3K B;  1YNJ C;  4EQP A;  2B2U C;  3HOU B;  1A3U A;  5JVH 3;  3PUX A;  1STB A;  3I4N B;  3MVV A;  1CQV A;  3L3O C;  1RJT A;  3I4L A;  2BOS A;  1DD2 A;  4K8I A;  4K8J A;  2RDG A;  2A6E C;  4K5V A;  1T5E A;  5ELC A;  3IFD A;  2CHB D;  2B2W C;  1Z6H A;  2F0O A;  4KTA A;  1QE6 A;  1C4Q A;  3VYS A;  1KNE A;  1CHP D;  4A3I B;  3MHB A;  3N52 A;  2IL8 A;  2AQ2 B;  1AZQ A;  5EJW A;  5BN5 A;  2EZV A;  2JP1 A;  2K01 A;  2X69 A;  2L11 A;  1ZXT A;  4FP5 D;  1CZG A;  2A73 B;  4L8J A;  5CV4 A;  2K5W A;  3W2D A;  3M85 A;  1FNV A;  4BY1 B;  5KRU A;  2LY7 A;  1F9R A;  2EYM A;  1HHV A;  2Q8T A;  1XTC D;  1RHP A;  2JYO A;  1FYC A;  3SR1 A;  1NSN S;  4A3M B;  3EVQ A;  4KY6 A;  5DEH A;  1B2T A;  1QIL A;  3DM1 A;  3BZD B;  1AP0 A;  1O7Z A;  5C0X I;  5C0X G;  1HTP A;  2K7V A;  1KDA A;  2IT1 A;  1F2Z A;  1PZI D;  1K8M A;  2VUM B;  3Q22 A;  3C1F A;  3TZD A;  3S1R B;  3SK6 A;  4CKC A;  2MGS A;  1WTP A;  3URY A;  2NB0 A;  1PTO F;  1G91 A;  3RZO B;  4ZLT F;  4IUT A;  3T13 A;  1EY9 A;  2F0V A;  1SBB B;  1SDF A;  3S16 B;  3SHL A;  1AW7 A;  1WTX A;  4BS9 A;  1W6J A;  5G3L F;  1SE3 A;  4X3S A;  3ERO A;  4C3H G;  1WTW A;  4DAP A;  1RDP D;  5FK9 C;  5IGC A;  2KA7 A;  3A8I E;  5C4Z A;  3K59 A;  5C0X H;  5JPN C;  5DNF A;  4J1M A;  2F0G A;  1ZYR D;  4ODG A;  2NVT B;  3SK4 A;  2XNA C;  1Y8P B;  3SDZ A;  3NTI A;  4C3I G;  4DGZ A;  2NWG A;  4PV1 C;  3IFT A;  2JE6 I;  4K2K A;  1TWG B;  1EEF D;  1WTO A;  2ICE C;  3NUC A;  4EGV A;  5D14 A;  1CT1 D;  1Q1E A;  2E76 C;  1B4O A;  2L9H A;  1IYU A;  1AZP A;  3H09 A;  1BF4 A;  4RHS A;  3C2P A;  2QEJ C;  1TS3 A;  4TQU S;  3MAQ A;  3P1H A;  1XXG A;  1O78 A;  3LNN A;  2PZW A;  5KNC A;  3GP7 A;  3TSS A;  3OSO A;  3Q23 A;  3FPU B;  5KNB A;  4MN3 A;  4Q5V A;  5ISR A;  3OHX C;  1YNN D;  4A3E B;  4PNY A;  1PFN A;  1HQR D;  1I6V C;  5M5W B;  3KLS A;  5ELD A;  5I9O A;  4KHV A;  1AN8 A;  2MP1 A;  1WD1 A;  4LJZ C;  2K6A A;  2B8G A;  4DAV A;  2OF1 A;  4ZAI A;  5EKI A;  3EJI A;  1CM9 A;  4A3G B;  1X3P A;  1LTT D;  2F0M A;  5K5P A;  3QB3 A;  3D8G A;  5C3E B;  1G2T A;  1BCP D;  4KKU A;  1MD2 D;  3VR2 A;  2FHT A;  1TWF B;  3MWY W;  1LTI D;  5D3D A;  1HUM A;  4P2C B;  2IJ0 A;  2K1B A;  4FF4 A;  2BDN A;  2XRQ D;  3W3A A;  3H91 A;  5EBD A;  2DY8 A;  5EKK A;  1PYW D;  4QIW B;  3GD7 A;  1SYC A;  3TZU A;  5JOB A;  2WAQ B;  4G57 A;  4BBR B;  3D31 A;  4C1N K;  3NP8 A;  1UAP A;  4K5W A;  2PZU A;  3RLF A;  1OO9 B;  4RKL A;  2TMP A;  3VR6 A;  4KD3 A;  2G9H D;  3C46 A;  2B63 B;  4B9X A;  4KHZ A;  4ULL A;  4E6I A;  3A54 A;  1EYD A;  2RA4 A;  4G7Z C;  5TSS A;  3U9S A;  4C3H B;  1MSH A;  2HCC A;  1H9S B;  3EA6 A;  3GTG B;  2Z4H A;  1SMY D;  2O2L D;  4XIG S;  4HED A;  1CA6 A;  2EXZ A;  3VYU A;  4FYD A;  3IL8 A;  5KIX A;  3V2T A;  5IOC A;  1SND A;  3ND9 A;  1WVL A;  2XWB B;  3I72 A;  4FXD A;  2JEA I;  5AFW A;  5C5L A;  2AUJ D;  4ZYS A;  1SNC A;  2WV6 D;  1ESF A;  3EQL C;  1B53 A;  5LHY 1;  4RH6 A;  1EFI D;  2F3W A;  1A3T A;  3NE5 B;  3BYT B;  4FF2 A;  4IFD G;  4XDX A;  2EJG C;  2ZXR A;  2A68 C;  2F0I A;  2VXW A;  3NQI A;  2F1M A;  1IKL A;  3P7J A;  2R7Z B;  3NWT A;  2B2V A;  2K5D A;  5HUR A;  3GTJ B;  2NN6 G;  5BN4 A;  1DJR D;  2ZXO A;  4ZRZ A;  2K33 A;  1NUC A;  3BYY B;  3QOJ A;  1VF7 A;  5A2Q E;  2K04 A;  2F0F A;  1M4V A;  2WIN B;  1O7Y A;  4IUV A;  1BXT A;  4O42 A;  1RD9 D;  4MIU A;  1E0B A;  1RKN A;  1EY0 A;  2OEO A;  4IFD H;  1WTV A;  2DN8 A;  1ILP A;  1TY2 A;  3OIP A;  2O4X A;  1STY A;  1B50 A;  3G6J B;  2MPM A;  2SNS A;  4KKS A;  5EPK A;  5LL6 X;  1PRT F;  1SSO A;  2QKI C;  1R4P B;  2JA5 B;  2NN6 H;  4I7Z C;  5IT9 E;  1JOO A;  3GQB A;  1EU3 A;  5FKA C;  1SNM A;  1S5E D;  2M2L A;  3F2U A;  4FXG C;  3AMU A;  2R61 A;  1WD0 A;  1DZ1 A;  3I4M B;  4U67 3;  5COY A;  3K6O A;  2RQX A;  4DFA A;  1R4Q B;  2B2U A;  4DU9 A;  1LLR D;  1J8I A;  2B2T C;  5I4D A;  1V8Q A;  2B2Y C;  3Q6S A;  1TKW B;  4RGN A;  4CJ1 B;  1I4Q A;  3T4A C;  3K5M A;  2F4I A;  2FMM A;  1NCV A;  4IUQ A;  4H0L C;  4XT1 B;  5DM6 3;  5A35 A;  4LK1 C;  1F2M A;  4DK0 A;  4OGQ C;  1V43 A;  2B2W A;  1IW7 C;  3HRZ C;  1PMR A;  4PMW A;  4V0B A;  3K58 A;  1T5X D;  2XRS D;  4V19 0;  2F0E A;  4B9W A;  1OXT A;  3L9A X;  1MSG A;  1M8A A;  1FNW A;  4NKL A;  3JAM E;  3J7A V;  4XQQ A;  1HFN A;  3TP8 A;  3DEO A;  5A2Q L;  3OMC A;  1PTO D;  5ELE A;  1TR5 A;  2A69 C;  2RDH A;  2KJX A;  1XWE A;  5CYU A;  4WOR A;  1WTR A;  3H0G B;  1IYV A;  4N9P A;  3WDN A;  2OXP A;  3J80 L;  1GOZ A;  4M8A A;  5G3L D;  3HOY B;  1S5D D;  1JWU D;  2DY7 A;  3VR3 A;  1U4M A;  2EYL A;  5M3M B;  2O5J C;  1ENC A;  4X3T A;  1PFB A;  4ZQ3 A;  4PMC A;  3HOW B;  2E75 C;  3V96 A;  3P20 A;  3PIP 3;  2D9U A;  1TQO A;  4UDU C;  4TRD A;  3DUZ A;  5CBA E;  4R9W A;  3NSW A;  4IFD J;  2BA0 A;  1STG A;  2L1B A;  2VB3 X;  3A7A B;  1XX8 A;  1EZ8 A;  1YNJ D;  2NVQ B;  4J6H A;  1LO5 D;  2X6L A;  1TII D;  2JSO A;  3NBH A;  1A3V A;  2K28 A;  1HUN A;  3CRK C;  1SNQ A;  3D4R A;  2F0N A;  2OT2 A;  4H44 C;  2AWO A;  4NW2 A;  2WKC A;  1R9T B;  3QG1 A;  4QF4 A;  5E3F A;  1TS5 A;  4X3K A;  3FMC A;  4UAI A;  3HKZ B;  3R2I A;  1I50 B;  4DNR B;  3S9W A;  1DOK A;  2V4D A;  2NBF A;  4S3S A;  3I70 A;  2KCN A;  1LTG D;  2PW5 A;  5EPJ A;  1RTO A;  1FD7 D;  1FGB D;  2LKV A;  3MFY A;  4F87 A;  4HCE A;  1EY8 A;  4KK7 A;  4IZ8 A;  2AUK A;  4XYO A;  3JAM L;  5IGG A;  5D3I B;  4LMQ D;  2O5I C;  3QO2 A;  1SXT A;  1A2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...