5HURA

Crystal structure of staphylococcal nuclease variant delta+phs l25t/i92k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKTMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYKYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25T/I92K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5hurA00
3D4DA 1STGA 4I65A 5C5LA 1SYBA 3TP5A 1EYCA 3SK4A 1ENCA 2EXZA 1EY8A 1KDBA 2F0GA 2O4XA 3BDCA 2RBMA 4K5WA 3OMCA 3SR1A 5I6WA 2F0MA 2EY5A 2RKSA 3SHLA 4PMBA 4ZUIA 2F0LA 2PZTA 3EJIA 4K5XA 4TRDA 5C3XA 2HQEA 3NHHA 5CGKA 3OWFA 1JORA 1KABA 4F7XA 5KYIA 4NMZA 1SNQA 1SYGA 1SYEA 3QB3A 2F0QA 1RKNA 1EYAA 3C1FA 2F0OA 4KD4A 3NP8A 2SNSA 3EVQA 3VA5A 4EVOA 5C3WA 2EYFA 4B9XA 1EZ8A 1SYCA 5IGEA 3ITPA 1EY0A 5I9PA 2PQEA 5KGUA 1F2ZA 2EYPA 5IGFA 2PW7A 5CV8A 2ENBA 2OXPA 1ENAA 2PZUA 4K8IA 2LKVA 4ODGA 5IGBA 5KRUA 2KHSA 4DGZA 3R3OA 3HEJA 5ISRA 5CV5A 5J1ZA 4KJNA 1SNOA 4IALA 4NP5A 5CV7A 1A2UA 3H6MA 3TP7A 3SK8A 2F0IA 4K14A 1SNMA 4ME5A 4N9PA 1STAA 3OMGA 4HMIA 4KY7A 3NK9A 4QF4A 3T13A 4DF7A 2F0KA 3C1EA 5CC4A 1II3A 4N9TA 5C4HA 4LAAA 1EY4A 4K5VA 3LX0A 3U9OA 3TP8A 4J6HA 5IGDA 4G57A 3QOJA 1EQVA 2SOBA 4IZ8A 4RKBA 3T16A 1SYFA 5IIFA 5KIXA 1KDCA 5CV9A 2F0TA 4YIJA 5I9OA 5JOBA 2F3VA 1KDAA 2EY6A 2F0DA 5JAVA 3V2TA 4WRDA 5IGGA 4KJOA 3SK6A 2F0WA 3E5SA 5EGTA 3PMFA 2EYOA 5E1FA 4HMJA 3TMEA 4DFAA 5M9OA 3D6CA 4HTHA 5DEHA 2QDBA 5KYLA 2F0HA 3HZXA 1TT2A 4MIUA 4S3SA 1NSNS 2EYJA 1IHZA 1EZ6A 4DU9A 1STBA 4EQOA 4OL7A 5DAUA 5KEEA 1STNA 2F0JA 2NUCA 2EYHA 4NKLA 1SNPA 3SXHA 5C6AA 1EY5A 2EYLA 5IODA 3MEHA 3EROA 2F0FA 3D8GA 5J22A 1EY9A 4ZUJA 4QMGA 4KV6A 5HGTA 3MVVA 3NUCA 4ID6A 4ZQ3A 5K5PA 1SNCA 4B9WA 3DMUA 4KTAA 1AEXA 2RDFA 4KY6A 4R8NA 5CV4A 4K6DA 4EQNA 1JOOA 3OSOA 5CR3A 5EKKA 1A3VA 1SNDA 5I6YA 4QB4A 3BDLA 2F0PA 2F0SA 1F2MA 1JOKA 2F0VA 1TQOA 4PNYA 4RKLA 3P1HA 4PMCA 4K2KA 1SYDA 1EY6A 1EYDA 2F3WA 3ERQA 3MZ5A 5HURA 1F2YA 5IOCA 4J1MA 4NDXA 5C5MA 1KAAA 4KD3A 2F0EA 3S9WA 1STHA 1STYA 2F0NA 1U9RA 3MXPA 2M00A 5J39A 4K8JA 4E6IA 3MHBA 4KHVA 2KQ3A 3D4WA 4K2LA 2EY1A 5C4ZA 4WORA 2PW5A 1A3UA 1A3TA 1A2TA 2PYKA 2SNMA 1TR5A 2WACA 3DHQA 2EYMA 2EY2A 3QOLA 1EY7A 5IGCA 4KY5A 4IUNA 3NQTA 5E3FA 4F8MA 2F0UA 3RUZA 1JOQA 2PZWA 2OEOA 5F2DA 1NUCA 2OF1A 5NUCA 3NXWA 3P75A 3TP6A 5CV6A 5EKLA 4EQPA 3SK5A 4H7BA
chains in the Genus database with same CATH superfamily
3CF5A 1QCBD 4RGTA 1EYCA 2EXZA 1XPRA 2VXWA 3HOYG 2B2WA 4JI0L 3GTOB 3GD7A 4P74A 4ZCKA 1X3FA 4UY8C 1HTLD 1JORA 3M4OB 2E2HH 1FNVA 3C1FA 3LWUA 1SMXA 1IBMQ 2A6HC 4OWTB 5IGEA 3H0GH 1U0LA 3CCLA 2M9VA 1BCPF 3RD4A 2K01A 2XNAC 1Z6HA 4C1NI 2Q2IA 3GQBA 1UEAB 2A73B 4KJNA 2ZJRA 2EJGC 2K5QA 4A3KH 5M3MB 4GS3A 4N9TA 4RGOS 4KI0A 1KNAA 2O5JC 2A68C 4YCVA 3STBD 5I2YA 2BE5C 1XYIA 1BO0A 2JA7B 5CORA 3UDIA 1PH5A 1JE4A 4JC0A 4DV2Q 3RZOB 1QNKA 2K28A 4HMJA 1S72A 4EX5A 1IL8A 1TWHH 1F2LA 5KYLA 3S14B 1TT2A 4X65Q 1XPUA 4DV1Q 1WCMB 3SE0A 2Z6KC 4LFAQ 4A3EB 3FPUB 2VQEL 1R4PB 1SFOH 3MVVA 2F1MA 5IP9G 5E4WC 3PF5A 2ZXPA 3K7AH 1QWYA 1EL0A 1JOOA 4IFDI 2UUAL 1VQ9A 5ELEA 5EKKA 4DR1L 2WB1B 4DV6Q 5K36H 1FNUA 3QG1A 2F0PA 2F0SA 1TQOA 2DN8A 1SYDA 3BDOA 3NPPA 5IYCG 5D65A 3NE5B 4XQNA 2EJMA 5GAHC 2F0NA 1ZKOA 3I91A 1KRTA 4DK0A 1MBYA 1JT8A 4AIMA 2EIFA 4KN4C 1BXTA 4FDBA 4ZLTF 1I4RA 4JI3Q 1D6EC 4KK7A 2JA5G 2PNHA 2HHHL 1HJPA 1PTOB 3DM3A 2I5MX 3RZDB 1KRSA 1UEBA 3QR8A 3HOVB 3TP6A 1TWGH 4DR6Q 3TP5A 1AE3A 3PUVA 3U4ZA 1KDBA 3R93A 3MEFA 2F0MA 1IL2A 3Q22A 4TRDA 4Q0FA 1IZ6A 1WTHA 3FKIH 1K83B 1K0RA 5JJKA 1SNQA 1JWMD 3HOXB 2F0QA 1HRJA 1HZBA 4BXXH 4BY7H 3ITPA 4DXFA 3GTQB 4GNXC 4AQYQ 2R61A 2NN6H 2CWAA 5LL6X 1MJCA 2L4NA 2OXPA 3HOWH 2PZUA 1GM5A 2I5HA 4POGA 2Q2HA 3H6MA 2OQ0A 1CKNB 3OMGA 4HMIA 3S17H 3CAMA 1PDQA 5LHY1 2N3SA 2UXBQ 4JI2Q 1AH9A 1GUWA 1O78A 4OIJA 3FP9A 5M3MG 4POFA 1WYDA 1S5DD 3KYHC 1RIPA 3KOJA 3A8JE 2HQLA 1B70B 5IE8A 3TP7A 2F52A 4LFCQ 2MJ8A 1NY4A 4X3UA 1VQ4A 1E24A 1D5MC 5ELBA 1GVPA 3AFQA 4IPGA 3BVGA 5BR8L 5ELFA 1TWCH 2B2WC 1IKMA 4LWCA 3W1BA 1I6HB 4JI0Q 3S15B 3NEMA 4L6TB 1AFPA 1R9TH 1PHJA 3J81L 1WCMG 4LF6L 1K0SA 3QJYA 2NVYB 2RSOA 4Y52H 4A3EG 2E8GA 2D0PA 1VQGA 4A3CG 3NSWA 1TS3A 1G51A 3M7NA 4XYQA 1YJWA 1DM0B 1YBYA 1IYJB 3X3MA 3FRPB 3MXUA 3VR6A 2F4VL 2F3WA 2QEJC 4HCEA 4J1MA 3VYRA 3S9WA 3DEOA 2WB1G 5ELCA 5E7NA 5JVH3 4DV0L 3F8TA 4DR5L 4JI6L 2ES2A 3VA7A 3Q24A 2A6HD 2EOTA 1HA6A 5NUCA 1E1TA 5JVG3 2C35B 3JAML 3I56A 5EKLA 2VB3X 3TBIB 2A74C 5C5LA 2B2VC 5BN5A 4A3DB 1U4LA 4XDXA 4V190 4K5XA 1EIHA 4XIGS 3HOVG 5IYBH 2ZXRA 1ONLA 2EE1A 3RMHA 1NJIC 1GUSA 1W6JA 2PI2A 4B3RL 4UDUC 1EQRA 2A68D 3H09A 4QL5A 1B3QA 1BOSA 1EZ8A 1SYCA 2BE5D 3I4NH 1HUMA 2K32A 2VQEQ 3K6OA 5KGUA 2PNRC 5FLXE 2QF7A 3HOXG 1XPOA 3E0EA 4U673 2H4OA 3KDFB 1EU4A 3L3OC 1PH6A 2UUAQ 2K50A 4DR1Q 4DF7A 3S1RH 1Q1EA 5CC4A 3J7AV 4X3KA 2NVXH 1EQVA 4A3KB 5IIFA 3FEWX 1WJJA 4ZK9B 1M90C 5FLXc 3KF8A 1Q82C 4ZAIA 1YIJA 1QILA 1XMQL 5FLMH 4FXKC 2HHHQ 3HZXA 5ELNA 2AWOA 1GHJA 1B7YB 1PMRA 1TWHB 1SLJA 5KEEA 3PV0A 3MEHA 1SE4A 5CBEE 4ZRZA 3IL8A 4ZKBB 2UUBL 1VQHA 1AEXA 3OPOA 1SFOB 2KBNA 1QUQB 1SE8A 4HIKA 3H3VH 1A3VA 4YHHL 2GA4B 1JR0D 3K7AB 4L5RC 1NNXA 2F0VA 4PMCA 3ERQA 4H0LC 3CU7A 5C0XH 3D31A 1HZAA 1H9RA 4KD3A 1PTOF 1STYA 1W6KA 3CPFA 4E6IA 2IJ0A 3TDQA 2L0CA 4OXPA 1I94L 1MHWC 1A62A 2CKZB 1LT4D 4OO1H 4KY5A 1ZEQX 5EKIA 1IXRA 4A75A 3M4PA 4RAUC 4A3LH 1Y8PB 3D4DA 2LMCB 3G48A 4IPCA 2EDGA 2O4XA 1BCPC 4K5WA 1CFMA 2RKSA 4CJ1B 1TWGB 3PO3H 4ZUIA 4ZKCB 1VF5C 3NHHA 4C3JH 1TS2A 3KLRA 3M85A 5J3BA 1PZJD 4A4IA 5BR8Q 4FF4A 1T5EA 2PPBC 4A3DG 2IWHA 3I73A 2HIXA 1DOMA 4JBKA 3TSSA 4B3SL 4HJ9A 4BY7B 4L63B 2B63B 2R92H 1D5ZC 5CV7A 4KHZA 2SDFA 4YCWA 1B1ZA 4X62L 3CCMA 3DM1A 1NBWA 5M3FH 3C1EA 2JXMB 1FR3A 4CKEA 2N49A 1VQ7A 2F4VQ 2QEXA 4P71A 3T16A 3S17B 4A3FH 4WJ3M 2NBFA 2F0TA 2HIVA 5I9OA 4LFBL 5JOBA 4GZYC 2ZM6L 4DV0Q 4G7HC 3C2PA 2AWNA 3I70A 4DR5Q 1TY2A 4JI6Q 1R4QB 4A3KG 1V43A 3KUPA 4RGNA 3ZJYC 2RHSB 1VQ6A 4X3SA 2C5CA 3HG9A 1PRTF 5LMNL 1IYVA 3CRLC 2BDNA 1HFNA 4QQBX 2FHTA 4BBSH 3S2DH 4KKSA 3A5UA 1LTBD 1TWCB 2AUJD 1EIYB 5TSSA 5C3EB 2EZVA 1GD7A 1VMCA 4R4IA 5LMNW 4B3RQ 1R9TB 4WFN3 4KKUA 2H5XA 3HRZC 1HNZL 4FF2A 4QJFA 2B2YA 3BDLA 1TWAH 3S1QH 1JOKA 1BKBA 1HXYD 1EYDA 5EBCA 3NWSA 1SE2A 3CRKC 1Q86C 4GOPB 2HT1A 4K2LA 2PW5A 1H9SA 5K36G 1HHVA 3CQZH 3H3VI 4NXML 5F2DA 3I4MG 1QVCA 3R2TA 4CJ0B 4I7AA 1Q8KA 1YNXA 2ICEC 3S16B 1QVGA 1XMQQ 1UAPA 3SHLA 3URYA 1Q7YC 2R7DA 2K1BA 5C3XA 2MHVA 1GKHA 3U9SA 4YWLA 2Y0SE 2KOLA 2AMCB 5IGFA 1WOCA 3PQIA 3L7ZC 4L8JA 4DUZL 2UUBQ 3I4NB 1A63A 2B29A 4A3BB 3BZCA 3R3OA 3M4YA 1BR9A 4P75A 2E74C 2LXJA 4K14A 4BXXG 2YYZA 4RMFA 4BY7G 4YHHQ 2RQXA 2EPBA 3V96A 1ET9A 3TP8A 2KCNA 2NN6G 1M4VA 5DNFA 2B63G 3A5ZB 4Y7NH 3S1RB 4RKBA 3GTPB 2G9DA 5LL6S 3S1MH 3C3LA 1B4OA 2NVXB 1I94Q 1RTOA 1TU2B 3WDNA 3OOCA 4DR3L 3HP3A 2I46A 3E5SA 4WJWA 2FMMA 1CKNA 2KECA 1I6VC 4DV7L 4R8IA 3VR3A 2K05A 2R7ZH 3HOZH 1BVSA 2VW9A 3BVZA 3MTSA 3A74A 3RLFA 2ALYB 3SVMA 3L2PA 5G3LD 3CCVA 4GN4B 1OXVA 3GTKB 3J7A5 5EPLA 4QIWB 3NUCA 4ULLA 4GKJL 1PFNA 2B2TC 4C3HH 4YCUA 4BY1H 3SGIA 1YHBA 2YU9B 3VR2A 5BN4A 4GKKL 4JI7L 3PUWA 5C3EG 1OXXK 4B3SQ 4HIDA 3MZ5A 4M8AA 3QO2A 4IFDH 2L12A 3H91A 1KAAA 1PYWD 2OWOA 3G4SA 2M00A 2JA6H 1JB7A 4HIOA 3JC66 4X62Q 2EY1A 1PYSB 4JI8L 2LSSA 1X9NA 4RWSC 1JJGA 2AQ2B 3HKSA 3TREA 4RFBA 4F8MA 4LFBQ 2ZM6Q 5CV6A 2ZTCA 4HSPA 1J5EL 3QIAA 1LLRD 2NVQH 1B8AA 2G5DA 4FP5D 1S3OA 4CKCA 1FL0A 4ZYSA 2HQEA 3PGZA 5CGKA 2MPMA 5LMNQ 1DOLA 1I5FA 2MFIA 3PO3B 1LTRD 4NMZA 4JI5L 1SYEA 3EN2A 4KKTA 4C3JB 1T9HA 4H44C 4C3IH 1UE6A 4N8X1 1MJEA 1DCZA 2A5HA 1U5KA 2CQOA 4APVA 4ODGA 1BBWA 4CDCC 4OX9L 4PV1C 5CV5A 2OCEA 5J1ZA 1L0XB 3PUXA 3SK8A 4DPGA 4QCLA 4N9PA 1J6QA 1STAA 1HNZQ 1EIFA 2B2YC 4H02A 2K52A 1GUGA 4OELB 3L0OA 1CKOA 1JJCB 1II3A 2KHIA 3AB9A 5I2XA 4A3BG 3N52A 2OT2A 5M3FB 3FPPA 2RHQB 2F3VA 3HKZB 2HD3A 4CBVA 5JAVA 1ESRA 3NBHB 4MHEA 4A3FB 1EQQA 2BCOA 3D6CA 3KDFA 2F3IA 4NXMQ 2EYJA 5KNDA 1S5ED 3IFTA 3MXNB 3TS2A 3NBIA 3X3NA 5FKAC 1F77A 1S5FD 1N32L 2YTXA 2IHFA 4O2DA 4JBMA 4LF5L 1K9MC 2I07B 1EY9A 4ZUJA 4BBSB 2XN9C 3OTOL 3S2DB 2JYOA 3DLLA 3E0JA 3WWVA 3K0YA 3Q8DA 3T1HL 1RODA 2E5LL 2AQ3B 4DKAC 1A15A 2K04A 1FD7D 2O2LD 1E2WA 1CQFA 1LTTD 2Z9HA 3U58A 4R4TA 1JB3A 1F2MA 4DUZQ 3ULPA 1WD0A 4RKLA 3P1HA 2WKCA 4OGQC 1I4QA 3S1QB 1CSQA 1EWHA 5AFWA 3MHBA 2AKWB 3D4WA 1HR0L 2SNMA 1VQOA 4F88A 3KJOA 4AYBE 2OF1A 5C0XG 3CQZB 3W3AA 1Y8OB 1N36L 4DR3Q 1SMYC 4A3JB 3EIVA 4JCVE 1Y8NB 1CZWA 3OIPA 3J80c 3A54A 2EJFC 2K33A 4CKBA 2PZTA 3M4QA 4OO1G 3D6WA 4DV7Q 5M5XH 3NTKA 2KCCA 1B9MA 5FO9B 2R93B 1KL9A 5KYIA 3NELA 2BA1A 4IN3A 5ISRA 1XWEA 4K0KL 4DXGA 1LTGD 1EYAA 2JEBI 4P72A 4TSSA 1LT6D 5C4JH 1K8AC 4A3LG 1L0YB 1CHPD 2L5TA 4BBRH 3PO3G 4A3MB 3EQLC 1DD2A 1SJED 2IX0A 5IP7H 5KRUA 4GKJQ 1HQMC 2DGYA 4P73A 1ILQA 4G7OC 1KXLA 2MGSA 1Y1VH 3GTGH 4GKKQ 3OW2A 4JI7Q 1YNNC 4DUYL 1L0WA 1B2TA 4G57A 3EA6A 2SOBA 2IT1A 1PRTC 3BZDB 1PH7A 4KN7C 4HN7A 3CC7A 2EY6A 5D3DA 3V2TA 1Q81C 4JI8Q 3S1MB 5FJ8H 3Q6SA 5M3FG 3J80i 2A1AA 1CUKA 2NWGA 3VR4A 3HKZG 4MIUA 5D3IB 4A3FG 1MGSA 1EFWA 2NVTH 3F2DA 1STBA 4HIMA 1J5EQ 3SXHA 5C6AA 4X6AH 1OXTA 4FO2A 3EROA 3G6JB 4QIWE 1LTSD 1VQLA 3D8GA 2D0OA 1VQAA 2KA7A 4A3IH 2E2DC 3GTJH 1E0BA 2QW7A 1I3QH 4JI5Q 1LUZA 1TS4A 4DAYB 5A2QE 4BBSG 1CKMA 5IT9c 1SNDA 4C3HB 3TQYA 4BY1B 4OX9Q 2RVLA 1WD1A 4CHTB 2JA7G 1CSPA 3HFZB 2FJ2A 1N34L 1KD1C 3K7UC 3CKIB 4K8JA 1ZYRD 2VNUD 3UE0A 3B6YA 4IO9A 2QCPX 2CCZA 4L5SA 2JA6B 2WFWA 5JPNC 4RCNA 1CHQD 5E3FA 5M5YH 4YWKA 4LF9L 3PO2H 1GO3E 1MSHA 2ASBA 4DK6C 3TZDA 4UP7A 3J81c 3BS1A 1QOHA 1VQ5A 4MTKA 1RHPA 1ZXTA 1NMGA 3OMCA 3EBEA 4GOPA 4EQ5A 2NVQB 4DV5L 4A3JG 2IY5B 5C0XJ 2Q2UA 4LF8L 5T1IA 3UI2A 2YTYA 1PH8A 1N32Q 3ER0A 5I9PA 4LF5Q 3HOUH 5IWAL 2R93G 4GLXA 2EYPA 2R3ZA 3OTOQ 1XNRL 3KK7A 1HZ9A 2ATWA 1TWFB 3DXJC 3T1HQ 2ZTEA 2PQAB 1N9WA 2E5LQ 4A3MG 1EQTA 4QF4A 2JA8H 2K4KA 1WTVA 5C4HA 4DR7L 4BA2I 1RCVD 4J6HA 2WV6D 3HKZE 2JQOA 1V1QA 2KHJA 2E2HB 3J81i 3CC2A 1HR0Q 1PLFA 2Y0SB 3GO5A 3H0GB 2KVMA 4GN5A 2G9HD 4DR2L 3CXCA 3ULLA 1N36Q 3TN2A 1K73C 1YHAA 1QNUA 2OTLA 3A55A 2MNAA 4DR4L 1ML0D 2F0FA 1JCKB 1GUNA 4RG1A 5J22A 3BVMA 3R2IA 1PZKD 4ID6A 4ZQ3A 5K5PA 4K0KQ 5D14A 4HSVA 4R8NA 4BWGB 5IYDG 3Q0AA 4DV4L 1VQFA 2D2CC 1I50H 1XMOL 1GUTA 3JAMi 1FGBD 1YNJC 3CMAA 3S24A 2WIIB 1SMYD 1CI3M 1S4ZA 2KCTA 3T1YL 2MP1A 3AMUA 2ID0A 5FLXL 5J39A 4C3HG 5GAEC 1H9MA 4BY1G 4DUYQ 1A3UA 1A2TA 1I4HA 4A76A 1RL2A 1U4PA 1V9PA 1Y14B 3QOLA 4O42A 2D9UA 1DZ1A 2JN4A 3P75A 1BBUA 2KENA 4OIKA 4JI4L 2JA6G 2CFMA 4DNRB 5HURA 3SR1A 3KFUA 2K5HA 5AJ3L 4PMBA 2NZOA 1KQSA 3DWQA 1YNND 3NTHA 4C2MH 1UE5A 2F0OA 3K8AA 1FVIA 2JE6I 2EYFA 1X6OA 1VQBA 5M5XB 1V1OA 1PRTD 2N78A 2PQEA 1SDFA 4MZ9A 4J8QA 5C4JB 4FYDA 1D2BA 2K6AA 1M8AA 1Q3LA 2LKVA 3KLSX 4MNOA 5KNCA 4BBRB 4IUQA 4IURA 1Z7TA 1HH2P 3CW2C 4JI1L 2FMCA 1O7ZA 2K5WA 2DNEA 1Q90A 1DOKA 1MD2D 4HJ7A 1EY4A 2K5DA 4CDEC 1Y1VB 3GTGB 3L9AX 3E9IA 3ZYYX 2Q8RE 3GTLH 3ONAB 1WTWA 5IYCH 1N34Q 3ND9A 3FKIB 2L9HA 2DY8A 2DNCA 4ME3A 1JQYD 3TMEA 4OONA 2F0HA 5EAYA 3CMEA 2E2IH 4B08A 4LF9Q 3VDYA 4S3SA 1STEA 3AEVA 2K75A 3HOWB 2IPKD 3IRBA 4CDDC 3PIPA 2Y0SG 4LF4L 3PUZA 2X6GA 3H0GG 5DM63 1KC8C 2KEDA 2NVTB 4KLKA 3G71A 2QA4A 1HPCA 4IUVA 2EQSA 4R4CA 1V1PB 4FF3A 2A6EC 1PH2A 2ICIA 3K5MA 4DV5Q 5HGTA 4A3IB 4CGYB 2A19A 3GTJB 4LF8Q 3J7AF 2PO4A 4JV5L 1RD9D 4OEMB 1G8ZD 1I3QB 3MXNA 1D1IA 3CP0A 4JOIA 5IWAQ 3PIO3 1XXGA 4RCOA 1ASYA 1XNRQ 3BJUA 2XWJB 4K2KA 4Q5VA 3U4VA 2B39A 1QE6A 3O13A 1U9RA 3MXPA 3RN2A 2N8NA 3DHQA 4DR7Q 2EY2A 5GQOA 1O7YA 5IGCA 4JG2A 4IPDA 1NUCA 5M3MH 1EWIA 3UE1A 5M5YB 3CCSA 4IQZA 1SYBA 3SK4A 2J0TD 4JBWA 2F0GA 3BDCA 3RR5A 4OWXB 1EYGA 4DR2Q 2E75C 1AZPA 2JJQA 5GADC 4IFDJ 1KHIA 5C4XH 3WOFA 1F9QA 4IJHA 3LNNA 5C3WA 2E2JH 5GROA 1FNWA 2FXQA 2HCCA 1BUVT 4DR4Q 3BYTB 1F2ZA 1E3PA 3W5OA 1YJNA 2K14A 1MIUA 2OTJA 1X54A 1WCMH 3HOUB 4DGZA 2RSNA 1K28A 2GVAA 1VQ8A 3VYUA 4AYBB 4DV4Q 1NTGA 1CK1A 3T13A 4A3CH 4KY7A 3NK9A 1XMOQ 2KCMA 1WTQA 2FFKB 5IGDA 4BBRG 1G6PA 1LO5D 3T1YQ 3K81C 1SYFA 5L37A 2JA8B 4HJAA 4ABNA 3E3XA 1KIXA 2ZJQA 2F0DA 1ASZA 1EEID 2EYOA 1NE3A 1OO9B 1H9JA 3A8IE 3DWAA 3P20A 1G2TA 5FK9C 3FKIG 2BA0A 1QG7A 3K5NA 4R9WA 1Q8IA 1YNJD 4JI4Q 1STNA 4P2CB 3ICEA 1W3SA 1JE5A 2EYLA 5FJ8G 1XNQQ 5AJ3Q 1G6ZA 3HOWG 3W2DA 1GOZA 4FF1A 5CYUA 1PH4A 2VUMH 4UPAA 4KY6A 3CCRA 2NZ1D 3OSOA 5CR3A 1X3QA 1C8CA 1LTID 1WFQA 5CMDA 2ZT9C 4QY7A 5I4DA 2IX1A 3S2HH 4ALPA 4FXDA 1K83H 3KBGA 3IFDA 1EY6A 2XWBB 3RN5A 3PF4A 1YITA 4JI1Q 1HA5A 3GTQH 2VL6A 1LV9A 3QWNA 4IUUA 4XYOA 2PYKA 2QGQA 3CPWA 1SSOA 3I7FA 4DAYA 4JK1C 1JOQA 3VYTA 1QVFA 2Q8IB 2OEOA 2Q8TA 2VB2X 5JJIA 4HJ5A 3KF8B 4EQPA 1A0IA 3NQIA 4PZ6A 1F9RA 2RBMA 2B3GA 3EJIA 4B3TL 3BU2A 1BCPD 1LABA 1C48A 2CW0C 4F7XA 1SYGA 4LF4Q 3S1NH 2MUYA 2JP1A 1NMFA 3TRZA 5DM73 1L1OB 3AFPA 1C7YA 2LS01 4JVZA 2UXDL 1KAWA 4NXNL 4ILWA 3I8ZA 4IALA 1HZCA 5EPJA 4UP9A 4JV5Q 4JOIC 1PH9A 3K5LA 2I5LX 4X64L 3OHXC 2JA9A 4RA8A 3HOUG 4K5VA 3U9OA 2K5VA 2Z4HA 4AYBG 4UAIA 5CV9A 2A69C 4XXEA 4PG3A 1KDAA 2A6ED 1B53A 5JEAH 3TS0A 5EBDA 3RLNA 1G291 5E1FA 2JA8G 5C44H 4UP8A 5IYBG 3SDZA 3A8KE 2R6GA 3GTMH 1XJVA 3DWPA 1AW7A 3BG3A 4AH6A 2E2IB 4JW0A 1HUNA 2NUCA 3I4NG 1N8RC 2R92B 1PVOA 3T56B 3V05A 1QJOA 1G2SA 2N55A 1XTDA 3U50C 4CDFC 1SNCA 1B44D 2TSSA 4A3DH 5EQ0A 2B8FA 4K6DA 1VQKA 1MKHA 3EFXD 5M5WH 1I4GA 1NR2A 3CCQA 1G91A 4PNYA 1VQCA 1RTNA 5C5MA 5GAGC 1EOTA 3KBXA 2ZTDA 2NYZD 3ERSX 2KQ3A 1QB5D 1VQPA 3F1ZA 4GLAC 1CZGA 2WACA 1K8OA 2MO0A 3OWEB 5FLMG 1TVXA 1PFMA 1PTOC 2F0UA 3RUZA 1OTCA 2UU9L 4HJ8A 1EUJA 2KJXA 3UDFA 1LT5D 2XVSA 2XGTA 1FYCA 1BBXC 3E9HA 1X3GA 3RLOA 3IAYA 1EY8A 4L5TA 5I6WA 3J80E 4LUVA 1BDOA 4XQQA 1TWAB 2E76C 1SRUA 2HDMA 3KF6B 1E2ZA 1L2FA 1PA6A 2SNSA 3OIQA 4HR7B 1GUOA 2P5ZX 1QUQA 2F03A 5C4XB 1ICWA 2E2JB 2ENBA 2B2VA 4C56C 3I4LA 1A8VA 1VMPA 4NP5A 1SAPA 1A2UA 3K57A 1HR0W 1SNMA 3N6RA 3K58A 1X3EA 3RNUA 3FVQA 1PH1A 1WVLA 1AP0A 1CA6A 3A7LA 2JSOA 3NENA 4FNFA 4YY3L 1DGSA 5JPMC 1DJRD 1S5BD 2D62A 1H9SB 3J80L 1WTPA 5LMUL 4KJOA 3VYSA 2LFNA 1JICA 1UWVA 4C3JG 1YJ9A 5H1SE 3G6EA 2XSCA 2YTVA 1PZID 3T53B 4R4OA 4EQOA 1YZ6A 3I4MH 1WTOA 1FGUA 5DAUA 2PI2E 5HGQA 2Q2TA 1X56A 1O7IA 4KV6A 4B3TQ 3GV3A 4LW1A 2R92G 1TY0A 4Y7NB 2UUCL 3A0JA 2VUMB 5IT9E 2RF4A 4QB4A 2WKDA 2Z0SA 2RA4A 2UXDQ 3MXGA 3CC4A 4NXNQ 1N33L 3S2HB 4J15A 1V1PA 4NDXA 2F0EA 1STHA 2R7ZB 3HOZB 1E7ZA 1I4PA 1C9OA 1X3PA 2CW0D 4X64Q 2DUDA 1EY7A 1P8LA 2WINB 2B63H 5HY6A 2N88A 1LM0A 4PMWA 3OW7A 2XRSD 3SK5A 2FINB 4H7BA 4IZ8A 3J81E 1STGA 1PFBA 4DAMA 1Q46A 2HUGA 2Z4IA 1TIID 2XRQD 3MA2B 3C46A 1BNZA 3A7AB 3OWFA 4IPHA 3CCEA 4GLVB 5EGTA 5IT9L 2AUKA 4HCSA 3SEBA 3K80C 2DJGC 1RF2D 3K0XA 4X66L 2A69D 2SEBD 1B50A 4DK3C 2K7VA 2AQ1B 1K3RA 3S1NB 1S5CD 2XIWA 4NW2A 1ENAA 1Y1WH 3H15A 2NTSA 5IGBA 4RGMA 3HEJA 3I3CA 1HFGA 1SNOA 1P16A 3E6ZX 5C4XG 1MSGA 2PMZE 2AHOB 2F0IA 5KNBA 1JWUD 4X3TA 5CBAE 4K6LA 1W2BA 2IL8A 3JAME 4OWWB 5C3EH 3AYHB 1IW7C 3VR5A 5A2QL 1PRTB 3PCOB 1YHQA 2MQHA 4A93H 1SR3A 5ELOA 4A3GH 4GNXB 1VF7A 4BS9A 5M9OA 4C3IB 1UE1A 2BH8A 4DAPA 1J8IA 1CT1D 2CQAA 2UU9Q 1IYUA 3I2ZA 5C44B 1F9SA 2JEAI 4R4QA 1FJGL 3JAMc 5IODA 3GTMB 1VDZA 3FDTA 4B3ML 3CHBD 1U4MA 3ND8A 1Q1BA 4QMGA 1GHKA 4QUCA 1SEBD 1B9NA 3UDXA 3HGBA 3R8BA 2CH4W 4N8FA 5JJLA 3S16H 3UDGA 3W1GA 1LYLA 2VS1A 1PTOD 2DJFC 4EGVA 2KUMA 1H9KA 1D1KA 2BH2A 4PQXA 2PCFB 3D0FA 5IOCA 5M5WB 4O0AA 4IUPA 4IOAA 2VUMG 4M1UB 3IKJA 3K5OA 5C4ZA 5T1GA 3HOYH 4I7ZC 4HEDA 4A3BH 2Z6BA 2EVBA 2EXDA 1K8GA 3DEPA 2J7ZA 1JC7A 1XX8A 2L15A 2WP8J 4YY3Q 1LT3D 1UNSA 5IY0A 3HOZG 2R7ZG 3MWYW 4H13C 3J81j 5LMUQ 4MTNA 4I65A 4YWMA 5BN3A 1VCIA 1I4XA 4G4KA 3GTPH 2EY5A 1CA5A 2NN6I 1EEFD 1YVCA 4KD4A 1RKNA 3LWEA 2X69A 3NP8A 4EVOA 2NZHA 3EVQA 3VA5A 4B9XA 1VQEA 5A35A 3J7ZC 1VS0A 2V4DA 3PIOA 4CJ2C 4JBJA 2PW7A 4C1NK 3MFYA 1KNEA 4IFDG 2KHSA 2L11A 3AU7A 1CTMA 1NCVA 2L55A 4PZ8A 3J7YW 2UUCQ 1T5XD 3GTKH 3T51B 5DLQE 4DAVA 1XNQL 1NR4A 2CVRA 3DUZA 3QOJA 1L1OA 3KLWA 4WJ4A 2Z1CA 1N33Q 2RCFA 1NAPA 2CH4A 4YIJA 1BQQT 4QGUA 2YU9H 2WB1E 3F2CA 3CCJA 2KEEA 2GN5A 3D4RA 1AN8A 1HNWL 3G7LA 5DEHA 3KJPA 2RDGA 4JYAL 3M3YH 3M9BA 1NSNS 4R1JA 5IP9H 4NPSA 1Y69U 1PFSA 3H94A 4OL7A 1VQNA 2F0JA 2EYHA 4C3IG 1SNPA 5JEAG 3I4MB 1O7LA 3NWTA 5C44G 1BF4A 1TKWB 4KHPL 2Z8LA 1O80A 2I0QA 4LF7L 4LMQD 2RCNA 1AE2A 3DMUA 4KTAA 2L1BA 2RDFA 4EQNA 2MO1A 1V8QA 4F87A 2BDOA 4X66Q 1E22A 4KMUC 1ENFA 2JA5H 2ZJPA 4MN3A 1VQJA 3GV6A 1E2VA 4JPBW 4Z9CB 4GOPC 1LTAD 4WORA 4XTCS 2B2TA 1SXTA 3NBHA 2EYMA 1WTRA 4HAEA 1IBKL 4XT3B 1GXDC 1SJHD 4QUFA 4DV3L 3LGJA 1Q12A 3MAQA 4LF6Q 3D3RA 3BYYB 3NXWA 3GTOH 2UXCL 1H95A 3ULJA 1ENCA 2GVBA 3M4OH 3I55A 1M1KC 2WAQB 1IBLL 1WTXA 2B2UA 1CM9A 1KTKA 1D7QA 3HS0C 2J4XA 3QB3A 1AZQA 1IW7D 1FJGQ 4B3MQ 2LXKA 2YV5A 1EY0A 1E1OA 3PSIA 1K8MA 4DNTB 4K8IA 2RDHA 2D5DA 3PO2B 2VQFL 1HNXL 1BCPB 1Y1WB 1B3AA 4ME5A 4UHVA 3KF6A 2F0KA 5E4XA 1TS5A 3LX0A 1U4RA 2ZXOA 4RHRA 2OQKA 5KIXA 1KDCA 2JA7H 1YEZA 3I72A 3RZOH 2A8VA 4DN4M 1LACA 2QDLA 3I4OA 3S14H 1UUPA 1OXSC 3SK6A 4DFAA 4A93B 2QDBA 4A3GB 1GJXA 4LUZA 1HTPA 2CWPA 4IUTA 4A3EH 4RH6A 1IHZA 4DU9A 1X65A 3STBC 1C0AA 1C4QA 4NKLA 1HQRD 1EU3A 1IBML 3WOEA 3TEHB 1SBBB 1RDPD 2VZAA 2O5IC 3CCUA 5IP7G 1CQVA 1EWCA 4A3JH 3P7JA 1Y1VG 5CV4A 3MFGA 5C0XI 3F2BA 5JEAJ 5FO7B 2B8GA 1EFID 1D5XC 2V1CC 2R93H 4L5QA 1XTCD 2IX3A 5EJWA 4IJLA 3H3VC 1F2YA 4OO1I 4GN3B 1J9OA 2QILA 4KHVA 2C9OA 4DK1A 3PIP3 1VQDA 1PTOH 3RZDH 4A3MH 2LY7A 1QZGA 1ET6A 4DV2L 1TR5A 1X55A 2JK8A 1L1OC 3TZUA 3HOVH 1A6XA 4NB3A 1PXUA 3HOYB 4X65L 1EOVA 3MC0B 1EIGA 4FXGC 1IKLA 4DV1L 4LFAL 1K3BC 3A56A 2Z6KA 4A3IG 1HNWQ 3F2UA 2K03A 3OYYA 4JYAQ 1LTLA 1I50B 2F0LA 3HOXH 2CHBD 3M7GA 3BZKA 1KABA 5FO8B 1RJTA 2M2LA 2DY7A 2WAQG 4LNQA 1VQMA 4DV6L 1Z9FA 3FMCA 3FHWA 5CV8A 1JMCA 1S40A 4KHPQ 4LUOA 1ESFA 4LF7Q 2HDLA 3CD6A 1PYBA 4O1NA 2K5NA 3KLSA 2R7FA 4V0BA 5IYDH 4PZ7A 5FOBB 2NTTA 4JI3L 4LAAA 1QZHA 2TMPA 1ILPA 1UE7A 3PO2G 3PUYA 4TQUS 2VY3A 1Y1WG 3NTIA 2HCIA 1DXMA 1HCZA 5IGGA 1SROA 4WRDA 3K59A 1SE3A 4C2MB 4DR6L 2F0WA 3PMFA 1F9PA 1IBKQ 4HTHA 1YI2A 4XT1B 4DV3Q 3GDEA 4XQJA 1WI5A 4G7ZC 1I6HH 2UXCQ 2QKIC 1EZ6A 3S15H 2NB0A 4IOCA 4U68A 3M3YB 4A93G 1EY5A 4LK1C 4A3GG 4LJZC 2H1EA 2PMZB 4OHJA 5EPKA 2X6LA 2B2UC 4AQYL 1IBLQ 2NVYH 1KLGD 4RHSA 2IW3A 4FVMA 4BA1I 4GNXA 1ICFB 1SN8A 1TXYA 1JJ2A 4TKOB 4B9WA 3GTLB 3I90A 1D8LA 1JWSD 3GP7A 4DA2A 1VQIA 2PQAA 5I6YA 5COYA 2UXBL 2F4IA 4JI2L 1DYQA 1ZYRC 1X32A 2IHEA 1Z47A 2JA5B 1KLUD 2VQFQ 1HNXQ 5JJZA 2BOSA 4TVAB 1OXUA 1A3TA 1MI2A 3AQQA 1TWFH 4LFCL 2XTIA 5ELDA 4DNIA 4IUNA 3NQTA 2PZWA 5G3LF 3Q23A 1PH3A 1PV4A 3T4AC 1DONA 2WAQE
chains in the Genus database with same CATH topology
1QCBD 4RGTA 1EYCA 2EXZA 2VXWA 2B2WA 3GTOB 3GD7A 1HTLD 1JORA 3M4OB 1FNVA 3C1FA 3LWUA 2A6HC 5IGEA 2M9VA 1BCPF 3RD4A 2K01A 2XNAC 1Z6HA 4C1NI 3GQBA 1UEAB 2A73B 4KJNA 2EJGC 2K5QA 5M3MB 4N9TA 4RGOS 4KI0A 1KNAA 2O5JC 2A68C 5I2YA 2BE5C 1XYIA 1BO0A 2JA7B 5CORA 3RZOB 1JE4A 1QNKA 2K28A 4HMJA 1IL8A 1F2LA 5KYLA 3S14B 1TT2A 1WCMB 3SE0A 4A3EB 3FPUB 1R4PB 3MVVA 2F1MA 5E4WC 2ZXPA 1QWYA 1EL0A 1JOOA 4IFDI 5ELEA 5EKKA 2WB1B 5K36H 1FNUA 3QG1A 2F0PA 2F0SA 1TQOA 2DN8A 1SYDA 3BDOA 3NPPA 5D65A 3NE5B 4XQNA 2EJMA 2F0NA 1ZKOA 3I91A 4DK0A 1MBYA 4KN4C 1BXTA 4ZLTF 1I4RA 1D6EC 4KK7A 1PTOB 3RZDB 3HOVB 3TP6A 3TP5A 3PUVA 1KDBA 3R93A 2F0MA 3Q22A 4TRDA 4Q0FA 1K83B 1SNQA 1JWMD 3HOXB 2F0QA 1HRJA 3ITPA 4DXFA 3GTQB 2R61A 2NN6H 5LL6X 2L4NA 2OXPA 2PZUA 3H6MA 3OMGA 4HMIA 1PDQA 5LHY1 1GUWA 1O78A 4OIJA 1S5DD 3A8JE 3TP7A 2MJ8A 4X3UA 1D5MC 5ELBA 3BVGA 5ELFA 2B2WC 1IKMA 1I6HB 3S15B 4L6TB 1AFPA 3J81L 3QJYA 2NVYB 2RSOA 3NSWA 1TS3A 3M7NA 4XYQA 1DM0B 3X3MA 3FRPB 3MXUA 3VR6A 2F3WA 2QEJC 4HCEA 4J1MA 3VYRA 3S9WA 3DEOA 5ELCA 5JVH3 3VA7A 3Q24A 2A6HD 2EOTA 1HA6A 5NUCA 5JVG3 3JAML 5EKLA 2VB3X 3TBIB 2A74C 5C5LA 2B2VC 5BN5A 4A3DB 1U4LA 4XDXA 4V190 4K5XA 1EIHA 4XIGS 2ZXRA 1ONLA 2EE1A 3RMHA 1GUSA 1W6JA 4UDUC 2A68D 3H09A 1BOSA 1EZ8A 1SYCA 2BE5D 1HUMA 2K32A 3K6OA 5KGUA 2PNRC 5FLXE 2QF7A 4U673 2H4OA 1EU4A 3L3OC 4DF7A 1Q1EA 5CC4A 3J7AV 4X3KA 1EQVA 4A3KB 5IIFA 3FEWX 4ZK9B 3KF8A 4ZAIA 1QILA 4FXKC 3HZXA 2AWOA 1GHJA 1PMRA 1TWHB 5KEEA 3PV0A 3MEHA 1SE4A 5CBEE 4ZRZA 3IL8A 4ZKBB 1AEXA 3OPOA 1SFOB 1A3VA 2GA4B 1JR0D 3K7AB 2F0VA 4PMCA 3ERQA 4H0LC 3CU7A 5C0XH 3D31A 1H9RA 4KD3A 1PTOF 1STYA 1W6KA 4E6IA 2IJ0A 3TDQA 2L0CA 1LT4D 4OO1H 4KY5A 1ZEQX 5EKIA 4RAUC 1Y8PB 3D4DA 2LMCB 2EDGA 2O4XA 1BCPC 4K5WA 1CFMA 2RKSA 4CJ1B 1TWGB 4ZUIA 4ZKCB 1VF5C 3NHHA 1TS2A 3KLRA 3M85A 1PZJD 4FF4A 1T5EA 2PPBC 2IWHA 3I73A 1DOMA 3TSSA 4BY7B 4L63B 2B63B 1D5ZC 5CV7A 4KHZA 2SDFA 1B1ZA 3DM1A 3C1EA 2JXMB 1FR3A 4CKEA 3T16A 3S17B 2NBFA 2F0TA 5I9OA 5JOBA 4GZYC 4G7HC 3C2PA 2AWNA 3I70A 1TY2A 1R4QB 1V43A 3KUPA 4RGNA 4X3SA 2C5CA 3HG9A 1PRTF 1IYVA 3CRLC 2BDNA 1HFNA 2FHTA 4KKSA 1LTBD 1TWCB 2AUJD 5TSSA 5C3EB 2EZVA 1VMCA 1R9TB 4WFN3 4KKUA 3HRZC 4FF2A 2B2YA 3BDLA 1JOKA 1HXYD 5EBCA 1EYDA 3NWSA 1SE2A 3CRKC 4K2LA 2PW5A 1H9SA 5K36G 1HHVA 5F2DA 3R2TA 4CJ0B 2ICEC 3S16B 1UAPA 3SHLA 3URYA 2K1BA 5C3XA 2MHVA 3U9SA 2KOLA 5IGFA 3L7ZC 4L8JA 3I4NB 4A3BB 3R3OA 3M4YA 1BR9A 2E74C 4K14A 2YYZA 2RQXA 2EPBA 3V96A 1ET9A 3TP8A 2KCNA 2NN6G 1M4VA 5DNFA 3S1RB 4RKBA 3GTPB 2G9DA 5LL6S 3C3LA 1B4OA 2NVXB 1RTOA 1TU2B 3WDNA 3OOCA 3HP3A 2I46A 3E5SA 4WJWA 2FMMA 2KECA 1I6VC 4R8IA 3VR3A 2K05A 3BVZA 3MTSA 3RLFA 3SVMA 5G3LD 1OXVA 3GTKB 5EPLA 4QIWB 3NUCA 4ULLA 1PFNA 2B2TC 2YU9B 3VR2A 5BN4A 3PUWA 1OXXK 3MZ5A 4M8AA 3QO2A 4IFDH 2L12A 3H91A 1KAAA 1PYWD 2M00A 2EY1A 4RWSC 2AQ2B 4F8MA 4RFBA 5CV6A 4HSPA 3QIAA 1LLRD 4FP5D 4CKCA 4ZYSA 2HQEA 5CGKA 2MPMA 1DOLA 3PO3B 1LTRD 4NMZA 1SYEA 4KKTA 4C3JB 4H44C 1DCZA 2A5HA 4ODGA 4PV1C 5CV5A 5J1ZA 1L0XB 3PUXA 3SK8A 4QCLA 4N9PA 1STAA 2B2YC 1GUGA 5I2XA 3AB9A 1II3A 3N52A 2OT2A 5M3FB 3FPPA 2F3VA 3HKZB 4CBVA 5JAVA 1ESRA 4MHEA 4A3FB 2BCOA 3D6CA 2EYJA 5KNDA 1S5ED 3IFTA 3NBIA 3X3NA 5FKAC 1F77A 1S5FD 2I07B 1EY9A 4ZUJA 4BBSB 2XN9C 3S2DB 2JYOA 3E0JA 3K0YA 1RODA 2AQ3B 1A15A 2K04A 1FD7D 2O2LD 1E2WA 1CQFA 1LTTD 1JB3A 1F2MA 1WD0A 4RKLA 3P1HA 2WKCA 4OGQC 1I4QA 3S1QB 1EWHA 5AFWA 3MHBA 3D4WA 2SNMA 4F88A 2OF1A 5C0XG 3CQZB 3W3AA 1Y8OB 4A3JB 1SMYC 1Y8NB 1CZWA 3OIPA 3A54A 2EJFC 2K33A 4CKBA 2PZTA 4OO1G 3D6WA 2KCCA 3NTKA 1B9MA 5FO9B 2R93B 5KYIA 2BA1A 4IN3A 5ISRA 1XWEA 4DXGA 1LTGD 1EYAA 2JEBI 4TSSA 1LT6D 1L0YB 1CHPD 2L5TA 4A3MB 3EQLC 1DD2A 1SJED 2IX0A 5KRUA 1HQMC 1ILQA 4G7OC 2MGSA 1YNNC 1B2TA 4G57A 3EA6A 2SOBA 2IT1A 1PRTC 3BZDB 4KN7C 4HN7A 2EY6A 5D3DA 3V2TA 3S1MB 3Q6SA 2NWGA 3VR4A 4MIUA 5D3IB 1MGSA 1STBA 3SXHA 5C6AA 1OXTA 4FO2A 3EROA 3G6JB 1LTSD 3D8GA 2KA7A 2E2DC 1E0BA 1TS4A 5A2QE 1SNDA 4C3HB 4BY1B 2RVLA 1WD1A 4CHTB 2FJ2A 3CKIB 4K8JA 1ZYRD 2VNUD 2QCPX 2JA6B 5JPNC 4RCNA 1CHQD 5E3FA 1MSHA 3TZDA 3BS1A 1QOHA 1RHPA 1ZXTA 3OMCA 2NVQB 5C0XJ 5T1IA 3UI2A 5I9PA 2EYPA 2R3ZA 3KK7A 1TWFB 3DXJC 1EQTA 4QF4A 1WTVA 5C4HA 4BA2I 1RCVD 4J6HA 2WV6D 2E2HB 1PLFA 2Y0SB 3GO5A 3H0GB 2KVMA 2G9HD 3TN2A 1QNUA 3A55A 1ML0D 2F0FA 1JCKB 1GUNA 5J22A 3BVMA 3R2IA 1PZKD 4ID6A 4ZQ3A 5K5PA 5D14A 4HSVA 4R8NA 4BWGB 3Q0AA 2D2CC 1GUTA 1FGBD 1YNJC 2WIIB 1SMYD 1CI3M 1S4ZA 2MP1A 3AMUA 2ID0A 5FLXL 5J39A 4C3HG 1H9MA 1A3UA 1A2TA 1I4HA 1U4PA 3QOLA 4O42A 2D9UA 1DZ1A 3P75A 4OIKA 5HURA 4DNRB 3SR1A 4PMBA 3DWQA 1YNND 3NTHA 2F0OA 5M5XB 2JE6I 2EYFA 1V1OA 1PRTD 2PQEA 1SDFA 4J8QA 5C4JB 4FYDA 1D2BA 2K6AA 1M8AA 1Q3LA 2LKVA 3KLSX 5KNCA 4BBRB 4IUQA 4IURA 1Z7TA 2FMCA 1O7ZA 2K5WA 2DNEA 1Q90A 1DOKA 1MD2D 1EY4A 2K5DA 1Y1VB 3GTGB 3L9AX 3ZYYX 2Q8RE 3ONAB 1WTWA 3ND9A 3FKIB 2L9HA 2DY8A 2DNCA 3TMEA 2F0HA 4B08A 4S3SA 1STEA 3HOWB 2IPKD 3PUZA 2X6GA 5DM63 2KEDA 2NVTB 1HPCA 4IUVA 1V1PB 4FF3A 2A6EC 2ICIA 3K5MA 5HGTA 4A3IB 4CGYB 3J7AF 3GTJB 2PO4A 1RD9D 1G8ZD 1I3QB 3MXNA 1D1IA 3PIO3 1XXGA 4RCOA 2XWJB 4K2KA 4Q5VA 2B39A 1QE6A 3O13A 1U9RA 3MXPA 3DHQA 2EY2A 1O7YA 5IGCA 1NUCA 5M5YB 4IQZA 1SYBA 3SK4A 2J0TD 4JBWA 2F0GA 3BDCA 2E75C 1AZPA 4IFDJ 3WOFA 1F9QA 5C3WA 3LNNA 1FNWA 2HCCA 1BUVT 3BYTB 1F2ZA 3HOUB 4DGZA 2RSNA 3VYUA 4AYBB 1CK1A 3T13A 4KY7A 3NK9A 1WTQA 2FFKB 5IGDA 1LO5D 1SYFA 2JA8B 4ABNA 2F0DA 1EEID 2EYOA 1OO9B 1H9JA 3A8IE 3DWAA 3P20A 1G2TA 5FK9C 2BA0A 1QG7A 3K5NA 4R9WA 1Q8IA 1YNJD 1STNA 4P2CB 2EYLA 1G6ZA 3W2DA 1GOZA 4FF1A 5CYUA 4KY6A 2NZ1D 3OSOA 5CR3A 1X3QA 1C8CA 1LTID 5CMDA 2ZT9C 5I4DA 2IX1A 4FXDA 3KBGA 3IFDA 1EY6A 2XWBB 1HA5A 1LV9A 3QWNA 4IUUA 4XYOA 2PYKA 1SSOA 4DAYA 4JK1C 1JOQA 3VYTA 2Q8IB 2OEOA 2Q8TA 2VB2X 4EQPA 3NQIA 1F9RA 2RBMA 3EJIA 1BCPD 1LABA 1C48A 2CW0C 4F7XA 1SYGA 2MUYA 2JP1A 5DM73 2LS01 4ILWA 3I8ZA 4IALA 5EPJA 3K5LA 3OHXC 4RA8A 4K5VA 3U9OA 2Z4HA 4UAIA 5CV9A 2A69C 4XXEA 1KDAA 2A6ED 1B53A 5JEAH 5EBDA 1G291 5E1FA 3SDZA 3A8KE 2R6GA 3DWPA 1AW7A 3BG3A 2E2IB 1HUNA 2NUCA 2R92B 3T56B 3V05A 1QJOA 1G2SA 2N55A 1SNCA 1B44D 2TSSA 5EQ0A 2B8FA 4K6DA 3EFXD 1I4GA 1NR2A 1G91A 4PNYA 1RTNA 5C5MA 1EOTA 3KBXA 2NYZD 2KQ3A 1QB5D 1CZGA 2WACA 1K8OA 3OWEB 1TVXA 1PFMA 1PTOC 2F0UA 3RUZA 2KJXA 1LT5D 2XVSA 1FYCA 1BBXC 3IAYA 1EY8A 5I6WA 3J80E 1BDOA 4XQQA 1TWAB 2E76C 2HDMA 1E2ZA 2SNSA 3OIQA 4HR7B 1GUOA 2F03A 5C4XB 1ICWA 2E2JB 2ENBA 2B2VA 4C56C 3I4LA 1VMPA 4NP5A 1SAPA 1A2UA 3K57A 1SNMA 3N6RA 3K58A 3FVQA 1WVLA 1AP0A 1CA6A 3A7LA 2JSOA 4FNFA 5JPMC 1DJRD 1S5BD 2D62A 1H9SB 3J80L 1WTPA 4KJOA 3VYSA 2LFNA 1JICA 4C3JG 2XSCA 3T53B 1PZID 4EQOA 1WTOA 5DAUA 4KV6A 3GV3A 1TY0A 4Y7NB 2VUMB 5IT9E 4QB4A 2WKDA 2RA4A 3MXGA 3S2HB 4NDXA 1V1PA 2F0EA 1STHA 2R7ZB 3HOZB 1I4PA 1X3PA 2CW0D 1EY7A 2WINB 2N88A 4PMWA 3OW7A 2XRSD 3SK5A 4IZ8A 4H7BA 2FINB 3J81E 1STGA 1PFBA 2HUGA 2Z4IA 1TIID 2XRQD 3MA2B 3C46A 1BNZA 3A7AB 3OWFA 5EGTA 5IT9L 2AUKA 4HCSA 3SEBA 1RF2D 2A69D 2SEBD 1B50A 2K7VA 2AQ1B 3S1NB 1S5CD 2XIWA 4NW2A 1ENAA 2NTSA 5IGBA 4RGMA 3HEJA 3I3CA 1HFGA 1SNOA 3E6ZX 1MSGA 2F0IA 5KNBA 1JWUD 4X3TA 5CBAE 4K6LA 2IL8A 3JAME 1IW7C 3VR5A 5A2QL 1PRTB 1VF7A 4BS9A 5M9OA 4C3IB 1J8IA 4DAPA 1CT1D 2CQAA 1IYUA 5C44B 1F9SA 2JEAI 5IODA 3GTMB 1VDZA 3FDTA 3CHBD 1U4MA 3ND8A 1Q1BA 4QMGA 1GHKA 4QUCA 1SEBD 1B9NA 3HGBA 3R8BA 1PTOD 4EGVA 2KUMA 1H9KA 1D1KA 4PQXA 2PCFB 5IOCA 5M5WB 4IUPA 4M1UB 3IKJA 3K5OA 5C4ZA 5T1GA 4I7ZC 4HEDA 2EVBA 3DEPA 2J7ZA 1JC7A 1XX8A 2WP8J 1LT3D 1UNSA 3MWYW 4H13C 4I65A 5BN3A 1VCIA 1I4XA 4G4KA 2EY5A 1CA5A 1EEFD 2NN6I 4KD4A 1RKNA 3LWEA 2X69A 3NP8A 4EVOA 3EVQA 3VA5A 4B9XA 5A35A 2V4DA 4CJ2C 2PW7A 4C1NK 3MFYA 1KNEA 4IFDG 2KHSA 2L11A 3AU7A 1CTMA 1NCVA 2L55A 3J7YW 1T5XD 3T51B 4DAVA 1NR4A 2CVRA 3DUZA 3QOJA 2Z1CA 1NAPA 4YIJA 1BQQT 2KEEA 3D4RA 1AN8A 3G7LA 5DEHA 2RDGA 1NSNS 1Y69U 3H94A 4OL7A 2F0JA 2EYHA 4C3IG 1SNPA 5JEAG 3I4MB 1O7LA 3NWTA 1BF4A 1TKWB 2Z8LA 1O80A 4LMQD 3DMUA 4KTAA 2L1BA 2RDFA 4EQNA 1V8QA 4F87A 2BDOA 4KMUC 1ENFA 4MN3A 3GV6A 1E2VA 4Z9CB 1LTAD 4WORA 4XTCS 2B2TA 1SXTA 3NBHA 2EYMA 1WTRA 4HAEA 4XT3B 1GXDC 1SJHD 4QUFA 1Q12A 3MAQA 3D3RA 3BYYB 3NXWA 1ENCA 2WAQB 1WTXA 2B2UA 1CM9A 1KTKA 3HS0C 2J4XA 3QB3A 1AZQA 1IW7D 1EY0A 1K8MA 4DNTB 4K8IA 2RDHA 2D5DA 3PO2B 1BCPB 1Y1WB 1B3AA 4ME5A 2F0KA 5E4XA 1TS5A 3LX0A 1U4RA 2ZXOA 4RHRA 5KIXA 1KDCA 3I72A 4DN4M 1LACA 1UUPA 1OXSC 3SK6A 4DFAA 4A93B 2QDBA 4A3GB 1GJXA 1HTPA 4IUTA 4RH6A 1IHZA 4DU9A 1C4QA 4NKLA 1HQRD 1EU3A 3WOEA 1SBBB 1RDPD 2O5IC 1CQVA 1EWCA 3P7JA 5CV4A 3MFGA 5C0XI 5JEAJ 5FO7B 2B8GA 1EFID 1D5XC 1XTCD 2IX3A 5EJWA 3H3VC 1F2YA 4OO1I 1J9OA 2QILA 4KHVA 2C9OA 4DK1A 3PIP3 1PTOH 2LY7A 1ET6A 1TR5A 3TZUA 1A6XA 1PXUA 3HOYB 3MC0B 1EIGA 4FXGC 1IKLA 3A56A 3F2UA 2K03A 2F0LA 1I50B 2CHBD 3M7GA 1KABA 5FO8B 1RJTA 2M2LA 2DY7A 3FMCA 5CV8A 1ESFA 2HDLA 4O1NA 3KLSA 4V0BA 5FOBB 2NTTA 4LAAA 2TMPA 1ILPA 3PUYA 4TQUS 3NTIA 2HCIA 1DXMA 1HCZA 5IGGA 4WRDA 3K59A 1SE3A 4C2MB 2F0WA 3PMFA 1F9PA 4HTHA 4XT1B 4XQJA 4G7ZC 2QKIC 1EZ6A 2NB0A 4U68A 3M3YB 1EY5A 4LK1C 4LJZC 2H1EA 2PMZB 4OHJA 5EPKA 2B2UC 2X6LA 1KLGD 4RHSA 2IW3A 4FVMA 4BA1I 4TKOB 4B9WA 3GTLB 3I90A 1JWSD 3GP7A 4DA2A 5I6YA 5COYA 2F4IA 1DYQA 1ZYRC 1X32A 1Z47A 2JA5B 1KLUD 5JJZA 2BOSA 1OXUA 1A3TA 1MI2A 5ELDA 4IUNA 3NQTA 2PZWA 5G3LF 3Q23A 3T4AC 1DONA 1JQYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D4D A;  1STG A;  4I65 A;  5C5L A;  1SYB A;  3TP5 A;  1EYC A;  3SK4 A;  1ENC A;  2EXZ A;  1EY8 A;  1KDB A;  2F0G A;  2O4X A;  3BDC A;  2RBM A;  4K5W A;  3OMC A;  3SR1 A;  5I6W A;  2F0M A;  2EY5 A;  2RKS A;  3SHL A;  4PMB A;  4ZUI A;  2F0L A;  2PZT A;  3EJI A;  4K5X A;  4TRD A;  5C3X A;  2HQE A;  3NHH A;  5CGK A;  3OWF A;  1JOR A;  1KAB A;  4F7X A;  5KYI A;  4NMZ A;  1SNQ A;  1SYG A;  1SYE A;  3QB3 A;  2F0Q A;  1RKN A;  1EYA A;  3C1F A;  2F0O A;  4KD4 A;  3NP8 A;  2SNS A;  3EVQ A;  3VA5 A;  4EVO A;  5C3W A;  2EYF A;  4B9X A;  1EZ8 A;  1SYC A;  5IGE A;  3ITP A;  1EY0 A;  5I9P A;  2PQE A;  5KGU A;  1F2Z A;  2EYP A;  5IGF A;  2PW7 A;  5CV8 A;  2ENB A;  2OXP A;  1ENA A;  2PZU A;  4K8I A;  2LKV A;  4ODG A;  5IGB A;  5KRU A;  2KHS A;  4DGZ A;  3R3O A;  3HEJ A;  5ISR A;  5CV5 A;  5J1Z A;  4KJN A;  1SNO A;  4IAL A;  4NP5 A;  5CV7 A;  1A2U A;  3H6M A;  3TP7 A;  3SK8 A;  2F0I A;  4K14 A;  1SNM A;  4ME5 A;  4N9P A;  1STA A;  3OMG A;  4HMI A;  4KY7 A;  3NK9 A;  4QF4 A;  3T13 A;  4DF7 A;  2F0K A;  3C1E A;  5CC4 A;  1II3 A;  4N9T A;  5C4H A;  4LAA A;  1EY4 A;  4K5V A;  3LX0 A;  3U9O A;  3TP8 A;  4J6H A;  5IGD A;  4G57 A;  3QOJ A;  1EQV A;  2SOB A;  4IZ8 A;  4RKB A;  3T16 A;  1SYF A;  5IIF A;  5KIX A;  1KDC A;  5CV9 A;  2F0T A;  4YIJ A;  5I9O A;  5JOB A;  2F3V A;  1KDA A;  2EY6 A;  2F0D A;  5JAV A;  3V2T A;  4WRD A;  5IGG A;  4KJO A;  3SK6 A;  2F0W A;  3E5S A;  5EGT A;  3PMF A;  2EYO A;  5E1F A;  4HMJ A;  3TME A;  4DFA A;  5M9O A;  3D6C A;  4HTH A;  5DEH A;  2QDB A;  5KYL A;  2F0H A;  3HZX A;  1TT2 A;  4MIU A;  4S3S A;  1NSN S;  2EYJ A;  1IHZ A;  1EZ6 A;  4DU9 A;  1STB A;  4EQO A;  4OL7 A;  5DAU A;  5KEE A;  1STN A;  2F0J A;  2NUC A;  2EYH A;  4NKL A;  1SNP A;  3SXH A;  5C6A A;  1EY5 A;  2EYL A;  5IOD A;  3MEH A;  3ERO A;  2F0F A;  3D8G A;  5J22 A;  1EY9 A;  4ZUJ A;  4QMG A;  4KV6 A;  5HGT A;  3MVV A;  3NUC A;  4ID6 A;  4ZQ3 A;  5K5P A;  1SNC A;  4B9W A;  3DMU A;  4KTA A;  1AEX A;  2RDF A;  4KY6 A;  4R8N A;  5CV4 A;  4K6D A;  4EQN A;  1JOO A;  3OSO A;  5CR3 A;  5EKK A;  1A3V A;  1SND A;  5I6Y A;  4QB4 A;  3BDL A;  2F0P A;  2F0S A;  1F2M A;  1JOK A;  2F0V A;  1TQO A;  4PNY A;  4RKL A;  3P1H A;  4PMC A;  4K2K A;  1SYD A;  1EY6 A;  1EYD A;  2F3W A;  3ERQ A;  3MZ5 A;  5HUR A;  1F2Y A;  5IOC A;  4J1M A;  4NDX A;  5C5M A;  1KAA A;  4KD3 A;  2F0E A;  3S9W A;  1STH A;  1STY A;  2F0N A;  1U9R A;  3MXP A;  2M00 A;  5J39 A;  4K8J A;  4E6I A;  3MHB A;  4KHV A;  2KQ3 A;  3D4W A;  4K2L A;  2EY1 A;  5C4Z A;  4WOR A;  2PW5 A;  1A3U A;  1A3T A;  1A2T A;  2PYK A;  2SNM A;  1TR5 A;  2WAC A;  3DHQ A;  2EYM A;  2EY2 A;  3QOL A;  1EY7 A;  5IGC A;  4KY5 A;  4IUN A;  3NQT A;  5E3F A;  4F8M A;  2F0U A;  3RUZ A;  1JOQ A;  2PZW A;  2OEO A;  5F2D A;  1NUC A;  2OF1 A;  5NUC A;  3NXW A;  3P75 A;  3TP6 A;  5CV6 A;  5EKL A;  4EQP A;  3SK5 A;  4H7B A; 
#chains in the Genus database with same CATH topology
 3CF5 A;  1QCB D;  4RGT A;  1EYC A;  2EXZ A;  1XPR A;  2VXW A;  3HOY G;  2B2W A;  4JI0 L;  3GTO B;  3GD7 A;  4P74 A;  4ZCK A;  1X3F A;  4UY8 C;  1HTL D;  1JOR A;  3M4O B;  2E2H H;  1FNV A;  3C1F A;  3LWU A;  1SMX A;  1IBM Q;  2A6H C;  4OWT B;  5IGE A;  3H0G H;  1U0L A;  3CCL A;  2M9V A;  1BCP F;  3RD4 A;  2K01 A;  2XNA C;  1Z6H A;  4C1N I;  2Q2I A;  3GQB A;  1UEA B;  2A73 B;  4KJN A;  2ZJR A;  2EJG C;  2K5Q A;  4A3K H;  5M3M B;  4GS3 A;  4N9T A;  4RGO S;  4KI0 A;  1KNA A;  2O5J C;  2A68 C;  4YCV A;  3STB D;  5I2Y A;  2BE5 C;  1XYI A;  1BO0 A;  2JA7 B;  5COR A;  3UDI A;  1PH5 A;  1JE4 A;  4JC0 A;  4DV2 Q;  3RZO B;  1QNK A;  2K28 A;  4HMJ A;  1S72 A;  4EX5 A;  1IL8 A;  1TWH H;  1F2L A;  5KYL A;  3S14 B;  1TT2 A;  4X65 Q;  1XPU A;  4DV1 Q;  1WCM B;  3SE0 A;  2Z6K C;  4LFA Q;  4A3E B;  3FPU B;  2VQE L;  1R4P B;  1SFO H;  3MVV A;  2F1M A;  5IP9 G;  5E4W C;  3PF5 A;  2ZXP A;  3K7A H;  1QWY A;  1EL0 A;  1JOO A;  4IFD I;  2UUA L;  1VQ9 A;  5ELE A;  5EKK A;  4DR1 L;  2WB1 B;  4DV6 Q;  5K36 H;  1FNU A;  3QG1 A;  2F0P A;  2F0S A;  1TQO A;  2DN8 A;  1SYD A;  3BDO A;  3NPP A;  5IYC G;  5D65 A;  3NE5 B;  4XQN A;  2EJM A;  5GAH C;  2F0N A;  1ZKO A;  3I91 A;  1KRT A;  4DK0 A;  1MBY A;  1JT8 A;  4AIM A;  2EIF A;  4KN4 C;  1BXT A;  4FDB A;  4ZLT F;  1I4R A;  4JI3 Q;  1D6E C;  4KK7 A;  2JA5 G;  2PNH A;  2HHH L;  1HJP A;  1PTO B;  3DM3 A;  2I5M X;  3RZD B;  1KRS A;  1UEB A;  3QR8 A;  3HOV B;  3TP6 A;  1TWG H;  4DR6 Q;  3TP5 A;  1AE3 A;  3PUV A;  3U4Z A;  1KDB A;  3R93 A;  3MEF A;  2F0M A;  1IL2 A;  3Q22 A;  4TRD A;  4Q0F A;  1IZ6 A;  1WTH A;  3FKI H;  1K83 B;  1K0R A;  5JJK A;  1SNQ A;  1JWM D;  3HOX B;  2F0Q A;  1HRJ A;  1HZB A;  4BXX H;  4BY7 H;  3ITP A;  4DXF A;  3GTQ B;  4GNX C;  4AQY Q;  2R61 A;  2NN6 H;  2CWA A;  5LL6 X;  1MJC A;  2L4N A;  2OXP A;  3HOW H;  2PZU A;  1GM5 A;  2I5H A;  4POG A;  2Q2H A;  3H6M A;  2OQ0 A;  1CKN B;  3OMG A;  4HMI A;  3S17 H;  3CAM A;  1PDQ A;  5LHY 1;  2N3S A;  2UXB Q;  4JI2 Q;  1AH9 A;  1GUW A;  1O78 A;  4OIJ A;  3FP9 A;  5M3M G;  4POF A;  1WYD A;  1S5D D;  3KYH C;  1RIP A;  3KOJ A;  3A8J E;  2HQL A;  1B70 B;  5IE8 A;  3TP7 A;  2F52 A;  4LFC Q;  2MJ8 A;  1NY4 A;  4X3U A;  1VQ4 A;  1E24 A;  1D5M C;  5ELB A;  1GVP A;  3AFQ A;  4IPG A;  3BVG A;  5BR8 L;  5ELF A;  1TWC H;  2B2W C;  1IKM A;  4LWC A;  3W1B A;  1I6H B;  4JI0 Q;  3S15 B;  3NEM A;  4L6T B;  1AFP A;  1R9T H;  1PHJ A;  3J81 L;  1WCM G;  4LF6 L;  1K0S A;  3QJY A;  2NVY B;  2RSO A;  4Y52 H;  4A3E G;  2E8G A;  2D0P A;  1VQG A;  4A3C G;  3NSW A;  1TS3 A;  1G51 A;  3M7N A;  4XYQ A;  1YJW A;  1DM0 B;  1YBY A;  1IYJ B;  3X3M A;  3FRP B;  3MXU A;  3VR6 A;  2F4V L;  2F3W A;  2QEJ C;  4HCE A;  4J1M A;  3VYR A;  3S9W A;  3DEO A;  2WB1 G;  5ELC A;  5E7N A;  5JVH 3;  4DV0 L;  3F8T A;  4DR5 L;  4JI6 L;  2ES2 A;  3VA7 A;  3Q24 A;  2A6H D;  2EOT A;  1HA6 A;  5NUC A;  1E1T A;  5JVG 3;  2C35 B;  3JAM L;  3I56 A;  5EKL A;  2VB3 X;  3TBI B;  2A74 C;  5C5L A;  2B2V C;  5BN5 A;  4A3D B;  1U4L A;  4XDX A;  4V19 0;  4K5X A;  1EIH A;  4XIG S;  3HOV G;  5IYB H;  2ZXR A;  1ONL A;  2EE1 A;  3RMH A;  1NJI C;  1GUS A;  1W6J A;  2PI2 A;  4B3R L;  4UDU C;  1EQR A;  2A68 D;  3H09 A;  4QL5 A;  1B3Q A;  1BOS A;  1EZ8 A;  1SYC A;  2BE5 D;  3I4N H;  1HUM A;  2K32 A;  2VQE Q;  3K6O A;  5KGU A;  2PNR C;  5FLX E;  2QF7 A;  3HOX G;  1XPO A;  3E0E A;  4U67 3;  2H4O A;  3KDF B;  1EU4 A;  3L3O C;  1PH6 A;  2UUA Q;  2K50 A;  4DR1 Q;  4DF7 A;  3S1R H;  1Q1E A;  5CC4 A;  3J7A V;  4X3K A;  2NVX H;  1EQV A;  4A3K B;  5IIF A;  3FEW X;  1WJJ A;  4ZK9 B;  1M90 C;  5FLX c;  3KF8 A;  1Q82 C;  4ZAI A;  1YIJ A;  1QIL A;  1XMQ L;  5FLM H;  4FXK C;  2HHH Q;  3HZX A;  5ELN A;  2AWO A;  1GHJ A;  1B7Y B;  1PMR A;  1TWH B;  1SLJ A;  5KEE A;  3PV0 A;  3MEH A;  1SE4 A;  5CBE E;  4ZRZ A;  3IL8 A;  4ZKB B;  2UUB L;  1VQH A;  1AEX A;  3OPO A;  1SFO B;  2KBN A;  1QUQ B;  1SE8 A;  4HIK A;  3H3V H;  1A3V A;  4YHH L;  2GA4 B;  1JR0 D;  3K7A B;  4L5R C;  1NNX A;  2F0V A;  4PMC A;  3ERQ A;  4H0L C;  3CU7 A;  5C0X H;  3D31 A;  1HZA A;  1H9R A;  4KD3 A;  1PTO F;  1STY A;  1W6K A;  3CPF A;  4E6I A;  2IJ0 A;  3TDQ A;  2L0C A;  4OXP A;  1I94 L;  1MHW C;  1A62 A;  2CKZ B;  1LT4 D;  4OO1 H;  4KY5 A;  1ZEQ X;  5EKI A;  1IXR A;  4A75 A;  3M4P A;  4RAU C;  4A3L H;  1Y8P B;  3D4D A;  2LMC B;  3G48 A;  4IPC A;  2EDG A;  2O4X A;  1BCP C;  4K5W A;  1CFM A;  2RKS A;  4CJ1 B;  1TWG B;  3PO3 H;  4ZUI A;  4ZKC B;  1VF5 C;  3NHH A;  4C3J H;  1TS2 A;  3KLR A;  3M85 A;  5J3B A;  1PZJ D;  4A4I A;  5BR8 Q;  4FF4 A;  1T5E A;  2PPB C;  4A3D G;  2IWH A;  3I73 A;  2HIX A;  1DOM A;  4JBK A;  3TSS A;  4B3S L;  4HJ9 A;  4BY7 B;  4L63 B;  2B63 B;  2R92 H;  1D5Z C;  5CV7 A;  4KHZ A;  2SDF A;  4YCW A;  1B1Z A;  4X62 L;  3CCM A;  3DM1 A;  1NBW A;  5M3F H;  3C1E A;  2JXM B;  1FR3 A;  4CKE A;  2N49 A;  1VQ7 A;  2F4V Q;  2QEX A;  4P71 A;  3T16 A;  3S17 B;  4A3F H;  4WJ3 M;  2NBF A;  2F0T A;  2HIV A;  5I9O A;  4LFB L;  5JOB A;  4GZY C;  2ZM6 L;  4DV0 Q;  4G7H C;  3C2P A;  2AWN A;  3I70 A;  4DR5 Q;  1TY2 A;  4JI6 Q;  1R4Q B;  4A3K G;  1V43 A;  3KUP A;  4RGN A;  3ZJY C;  2RHS B;  1VQ6 A;  4X3S A;  2C5C A;  3HG9 A;  1PRT F;  5LMN L;  1IYV A;  3CRL C;  2BDN A;  1HFN A;  4QQB X;  2FHT A;  4BBS H;  3S2D H;  4KKS A;  3A5U A;  1LTB D;  1TWC B;  2AUJ D;  1EIY B;  5TSS A;  5C3E B;  2EZV A;  1GD7 A;  1VMC A;  4R4I A;  5LMN W;  4B3R Q;  1R9T B;  4WFN 3;  4KKU A;  2H5X A;  3HRZ C;  1HNZ L;  4FF2 A;  4QJF A;  2B2Y A;  3BDL A;  1TWA H;  3S1Q H;  1JOK A;  1BKB A;  1HXY D;  1EYD A;  5EBC A;  3NWS A;  1SE2 A;  3CRK C;  1Q86 C;  4GOP B;  2HT1 A;  4K2L A;  2PW5 A;  1H9S A;  5K36 G;  1HHV A;  3CQZ H;  3H3V I;  4NXM L;  5F2D A;  3I4M G;  1QVC A;  3R2T A;  4CJ0 B;  4I7A A;  1Q8K A;  1YNX A;  2ICE C;  3S16 B;  1QVG A;  1XMQ Q;  1UAP A;  3SHL A;  3URY A;  1Q7Y C;  2R7D A;  2K1B A;  5C3X A;  2MHV A;  1GKH A;  3U9S A;  4YWL A;  2Y0S E;  2KOL A;  2AMC B;  5IGF A;  1WOC A;  3PQI A;  3L7Z C;  4L8J A;  4DUZ L;  2UUB Q;  3I4N B;  1A63 A;  2B29 A;  4A3B B;  3BZC A;  3R3O A;  3M4Y A;  1BR9 A;  4P75 A;  2E74 C;  2LXJ A;  4K14 A;  4BXX G;  2YYZ A;  4RMF A;  4BY7 G;  4YHH Q;  2RQX A;  2EPB A;  3V96 A;  1ET9 A;  3TP8 A;  2KCN A;  2NN6 G;  1M4V A;  5DNF A;  2B63 G;  3A5Z B;  4Y7N H;  3S1R B;  4RKB A;  3GTP B;  2G9D A;  5LL6 S;  3S1M H;  3C3L A;  1B4O A;  2NVX B;  1I94 Q;  1RTO A;  1TU2 B;  3WDN A;  3OOC A;  4DR3 L;  3HP3 A;  2I46 A;  3E5S A;  4WJW A;  2FMM A;  1CKN A;  2KEC A;  1I6V C;  4DV7 L;  4R8I A;  3VR3 A;  2K05 A;  2R7Z H;  3HOZ H;  1BVS A;  2VW9 A;  3BVZ A;  3MTS A;  3A74 A;  3RLF A;  2ALY B;  3SVM A;  3L2P A;  5G3L D;  3CCV A;  4GN4 B;  1OXV A;  3GTK B;  3J7A 5;  5EPL A;  4QIW B;  3NUC A;  4ULL A;  4GKJ L;  1PFN A;  2B2T C;  4C3H H;  4YCU A;  4BY1 H;  3SGI A;  1YHB A;  2YU9 B;  3VR2 A;  5BN4 A;  4GKK L;  4JI7 L;  3PUW A;  5C3E G;  1OXX K;  4B3S Q;  4HID A;  3MZ5 A;  4M8A A;  3QO2 A;  4IFD H;  2L12 A;  3H91 A;  1KAA A;  1PYW D;  2OWO A;  3G4S A;  2M00 A;  2JA6 H;  1JB7 A;  4HIO A;  3JC6 6;  4X62 Q;  2EY1 A;  1PYS B;  4JI8 L;  2LSS A;  1X9N A;  4RWS C;  1JJG A;  2AQ2 B;  3HKS A;  3TRE A;  4RFB A;  4F8M A;  4LFB Q;  2ZM6 Q;  5CV6 A;  2ZTC A;  4HSP A;  1J5E L;  3QIA A;  1LLR D;  2NVQ H;  1B8A A;  2G5D A;  4FP5 D;  1S3O A;  4CKC A;  1FL0 A;  4ZYS A;  2HQE A;  3PGZ A;  5CGK A;  2MPM A;  5LMN Q;  1DOL A;  1I5F A;  2MFI A;  3PO3 B;  1LTR D;  4NMZ A;  4JI5 L;  1SYE A;  3EN2 A;  4KKT A;  4C3J B;  1T9H A;  4H44 C;  4C3I H;  1UE6 A;  4N8X 1;  1MJE A;  1DCZ A;  2A5H A;  1U5K A;  2CQO A;  4APV A;  4ODG A;  1BBW A;  4CDC C;  4OX9 L;  4PV1 C;  5CV5 A;  2OCE A;  5J1Z A;  1L0X B;  3PUX A;  3SK8 A;  4DPG A;  4QCL A;  4N9P A;  1J6Q A;  1STA A;  1HNZ Q;  1EIF A;  2B2Y C;  4H02 A;  2K52 A;  1GUG A;  4OEL B;  3L0O A;  1CKO A;  1JJC B;  1II3 A;  2KHI A;  3AB9 A;  5I2X A;  4A3B G;  3N52 A;  2OT2 A;  5M3F B;  3FPP A;  2RHQ B;  2F3V A;  3HKZ B;  2HD3 A;  4CBV A;  5JAV A;  1ESR A;  3NBH B;  4MHE A;  4A3F B;  1EQQ A;  2BCO A;  3D6C A;  3KDF A;  2F3I A;  4NXM Q;  2EYJ A;  5KND A;  1S5E D;  3IFT A;  3MXN B;  3TS2 A;  3NBI A;  3X3N A;  5FKA C;  1F77 A;  1S5F D;  1N32 L;  2YTX A;  2IHF A;  4O2D A;  4JBM A;  4LF5 L;  1K9M C;  2I07 B;  1EY9 A;  4ZUJ A;  4BBS B;  2XN9 C;  3OTO L;  3S2D B;  2JYO A;  3DLL A;  3E0J A;  3WWV A;  3K0Y A;  3Q8D A;  3T1H L;  1ROD A;  2E5L L;  2AQ3 B;  4DKA C;  1A15 A;  2K04 A;  1FD7 D;  2O2L D;  1E2W A;  1CQF A;  1LTT D;  2Z9H A;  3U58 A;  4R4T A;  1JB3 A;  1F2M A;  4DUZ Q;  3ULP A;  1WD0 A;  4RKL A;  3P1H A;  2WKC A;  4OGQ C;  1I4Q A;  3S1Q B;  1CSQ A;  1EWH A;  5AFW A;  3MHB A;  2AKW B;  3D4W A;  1HR0 L;  2SNM A;  1VQO A;  4F88 A;  3KJO A;  4AYB E;  2OF1 A;  5C0X G;  3CQZ B;  3W3A A;  1Y8O B;  1N36 L;  4DR3 Q;  1SMY C;  4A3J B;  3EIV A;  4JCV E;  1Y8N B;  1CZW A;  3OIP A;  3J80 c;  3A54 A;  2EJF C;  2K33 A;  4CKB A;  2PZT A;  3M4Q A;  4OO1 G;  3D6W A;  4DV7 Q;  5M5X H;  3NTK A;  2KCC A;  1B9M A;  5FO9 B;  2R93 B;  1KL9 A;  5KYI A;  3NEL A;  2BA1 A;  4IN3 A;  5ISR A;  1XWE A;  4K0K L;  4DXG A;  1LTG D;  1EYA A;  2JEB I;  4P72 A;  4TSS A;  1LT6 D;  5C4J H;  1K8A C;  4A3L G;  1L0Y B;  1CHP D;  2L5T A;  4BBR H;  3PO3 G;  4A3M B;  3EQL C;  1DD2 A;  1SJE D;  2IX0 A;  5IP7 H;  5KRU A;  4GKJ Q;  1HQM C;  2DGY A;  4P73 A;  1ILQ A;  4G7O C;  1KXL A;  2MGS A;  1Y1V H;  3GTG H;  4GKK Q;  3OW2 A;  4JI7 Q;  1YNN C;  4DUY L;  1L0W A;  1B2T A;  4G57 A;  3EA6 A;  2SOB A;  2IT1 A;  1PRT C;  3BZD B;  1PH7 A;  4KN7 C;  4HN7 A;  3CC7 A;  2EY6 A;  5D3D A;  3V2T A;  1Q81 C;  4JI8 Q;  3S1M B;  5FJ8 H;  3Q6S A;  5M3F G;  3J80 i;  2A1A A;  1CUK A;  2NWG A;  3VR4 A;  3HKZ G;  4MIU A;  5D3I B;  4A3F G;  1MGS A;  1EFW A;  2NVT H;  3F2D A;  1STB A;  4HIM A;  1J5E Q;  3SXH A;  5C6A A;  4X6A H;  1OXT A;  4FO2 A;  3ERO A;  3G6J B;  4QIW E;  1LTS D;  1VQL A;  3D8G A;  2D0O A;  1VQA A;  2KA7 A;  4A3I H;  2E2D C;  3GTJ H;  1E0B A;  2QW7 A;  1I3Q H;  4JI5 Q;  1LUZ A;  1TS4 A;  4DAY B;  5A2Q E;  4BBS G;  1CKM A;  5IT9 c;  1SND A;  4C3H B;  3TQY A;  4BY1 B;  4OX9 Q;  2RVL A;  1WD1 A;  4CHT B;  2JA7 G;  1CSP A;  3HFZ B;  2FJ2 A;  1N34 L;  1KD1 C;  3K7U C;  3CKI B;  4K8J A;  1ZYR D;  2VNU D;  3UE0 A;  3B6Y A;  4IO9 A;  2QCP X;  2CCZ A;  4L5S A;  2JA6 B;  2WFW A;  5JPN C;  4RCN A;  1CHQ D;  5E3F A;  5M5Y H;  4YWK A;  4LF9 L;  3PO2 H;  1GO3 E;  1MSH A;  2ASB A;  4DK6 C;  3TZD A;  4UP7 A;  3J81 c;  3BS1 A;  1QOH A;  1VQ5 A;  4MTK A;  1RHP A;  1ZXT A;  1NMG A;  3OMC A;  3EBE A;  4GOP A;  4EQ5 A;  2NVQ B;  4DV5 L;  4A3J G;  2IY5 B;  5C0X J;  2Q2U A;  4LF8 L;  5T1I A;  3UI2 A;  2YTY A;  1PH8 A;  1N32 Q;  3ER0 A;  5I9P A;  4LF5 Q;  3HOU H;  5IWA L;  2R93 G;  4GLX A;  2EYP A;  2R3Z A;  3OTO Q;  1XNR L;  3KK7 A;  1HZ9 A;  2ATW A;  1TWF B;  3DXJ C;  3T1H Q;  2ZTE A;  2PQA B;  1N9W A;  2E5L Q;  4A3M G;  1EQT A;  4QF4 A;  2JA8 H;  2K4K A;  1WTV A;  5C4H A;  4DR7 L;  4BA2 I;  1RCV D;  4J6H A;  2WV6 D;  3HKZ E;  2JQO A;  1V1Q A;  2KHJ A;  2E2H B;  3J81 i;  3CC2 A;  1HR0 Q;  1PLF A;  2Y0S B;  3GO5 A;  3H0G B;  2KVM A;  4GN5 A;  2G9H D;  4DR2 L;  3CXC A;  3ULL A;  1N36 Q;  3TN2 A;  1K73 C;  1YHA A;  1QNU A;  2OTL A;  3A55 A;  2MNA A;  4DR4 L;  1ML0 D;  2F0F A;  1JCK B;  1GUN A;  4RG1 A;  5J22 A;  3BVM A;  3R2I A;  1PZK D;  4ID6 A;  4ZQ3 A;  5K5P A;  4K0K Q;  5D14 A;  4HSV A;  4R8N A;  4BWG B;  5IYD G;  3Q0A A;  4DV4 L;  1VQF A;  2D2C C;  1I50 H;  1XMO L;  1GUT A;  3JAM i;  1FGB D;  1YNJ C;  3CMA A;  3S24 A;  2WII B;  1SMY D;  1CI3 M;  1S4Z A;  2KCT A;  3T1Y L;  2MP1 A;  3AMU A;  2ID0 A;  5FLX L;  5J39 A;  4C3H G;  5GAE C;  1H9M A;  4BY1 G;  4DUY Q;  1A3U A;  1A2T A;  1I4H A;  4A76 A;  1RL2 A;  1U4P A;  1V9P A;  1Y14 B;  3QOL A;  4O42 A;  2D9U A;  1DZ1 A;  2JN4 A;  3P75 A;  1BBU A;  2KEN A;  4OIK A;  4JI4 L;  2JA6 G;  2CFM A;  4DNR B;  5HUR A;  3SR1 A;  3KFU A;  2K5H A;  5AJ3 L;  4PMB A;  2NZO A;  1KQS A;  3DWQ A;  1YNN D;  3NTH A;  4C2M H;  1UE5 A;  2F0O A;  3K8A A;  1FVI A;  2JE6 I;  2EYF A;  1X6O A;  1VQB A;  5M5X B;  1V1O A;  1PRT D;  2N78 A;  2PQE A;  1SDF A;  4MZ9 A;  4J8Q A;  5C4J B;  4FYD A;  1D2B A;  2K6A A;  1M8A A;  1Q3L A;  2LKV A;  3KLS X;  4MNO A;  5KNC A;  4BBR B;  4IUQ A;  4IUR A;  1Z7T A;  1HH2 P;  3CW2 C;  4JI1 L;  2FMC A;  1O7Z A;  2K5W A;  2DNE A;  1Q90 A;  1DOK A;  1MD2 D;  4HJ7 A;  1EY4 A;  2K5D A;  4CDE C;  1Y1V B;  3GTG B;  3L9A X;  3E9I A;  3ZYY X;  2Q8R E;  3GTL H;  3ONA B;  1WTW A;  5IYC H;  1N34 Q;  3ND9 A;  3FKI B;  2L9H A;  2DY8 A;  2DNC A;  4ME3 A;  1JQY D;  3TME A;  4OON A;  2F0H A;  5EAY A;  3CME A;  2E2I H;  4B08 A;  4LF9 Q;  3VDY A;  4S3S A;  1STE A;  3AEV A;  2K75 A;  3HOW B;  2IPK D;  3IRB A;  4CDD C;  3PIP A;  2Y0S G;  4LF4 L;  3PUZ A;  2X6G A;  3H0G G;  5DM6 3;  1KC8 C;  2KED A;  2NVT B;  4KLK A;  3G71 A;  2QA4 A;  1HPC A;  4IUV A;  2EQS A;  4R4C A;  1V1P B;  4FF3 A;  2A6E C;  1PH2 A;  2ICI A;  3K5M A;  4DV5 Q;  5HGT A;  4A3I B;  4CGY B;  2A19 A;  3GTJ B;  4LF8 Q;  3J7A F;  2PO4 A;  4JV5 L;  1RD9 D;  4OEM B;  1G8Z D;  1I3Q B;  3MXN A;  1D1I A;  3CP0 A;  4JOI A;  5IWA Q;  3PIO 3;  1XXG A;  4RCO A;  1ASY A;  1XNR Q;  3BJU A;  2XWJ B;  4K2K A;  4Q5V A;  3U4V A;  2B39 A;  1QE6 A;  3O13 A;  1U9R A;  3MXP A;  3RN2 A;  2N8N A;  3DHQ A;  4DR7 Q;  2EY2 A;  5GQO A;  1O7Y A;  5IGC A;  4JG2 A;  4IPD A;  1NUC A;  5M3M H;  1EWI A;  3UE1 A;  5M5Y B;  3CCS A;  4IQZ A;  1SYB A;  3SK4 A;  2J0T D;  4JBW A;  2F0G A;  3BDC A;  3RR5 A;  4OWX B;  1EYG A;  4DR2 Q;  2E75 C;  1AZP A;  2JJQ A;  5GAD C;  4IFD J;  1KHI A;  5C4X H;  3WOF A;  1F9Q A;  4IJH A;  3LNN A;  5C3W A;  2E2J H;  5GRO A;  1FNW A;  2FXQ A;  2HCC A;  1BUV T;  4DR4 Q;  3BYT B;  1F2Z A;  1E3P A;  3W5O A;  1YJN A;  2K14 A;  1MIU A;  2OTJ A;  1X54 A;  1WCM H;  3HOU B;  4DGZ A;  2RSN A;  1K28 A;  2GVA A;  1VQ8 A;  3VYU A;  4AYB B;  4DV4 Q;  1NTG A;  1CK1 A;  3T13 A;  4A3C H;  4KY7 A;  3NK9 A;  1XMO Q;  2KCM A;  1WTQ A;  2FFK B;  5IGD A;  4BBR G;  1G6P A;  1LO5 D;  3T1Y Q;  3K81 C;  1SYF A;  5L37 A;  2JA8 B;  4HJA A;  4ABN A;  3E3X A;  1KIX A;  2ZJQ A;  2F0D A;  1ASZ A;  1EEI D;  2EYO A;  1NE3 A;  1OO9 B;  1H9J A;  3A8I E;  3DWA A;  3P20 A;  1G2T A;  5FK9 C;  3FKI G;  2BA0 A;  1QG7 A;  3K5N A;  4R9W A;  1Q8I A;  1YNJ D;  4JI4 Q;  1STN A;  4P2C B;  3ICE A;  1W3S A;  1JE5 A;  2EYL A;  5FJ8 G;  1XNQ Q;  5AJ3 Q;  1G6Z A;  3HOW G;  3W2D A;  1GOZ A;  4FF1 A;  5CYU A;  1PH4 A;  2VUM H;  4UPA A;  4KY6 A;  3CCR A;  2NZ1 D;  3OSO A;  5CR3 A;  1X3Q A;  1C8C A;  1LTI D;  1WFQ A;  5CMD A;  2ZT9 C;  4QY7 A;  5I4D A;  2IX1 A;  3S2H H;  4ALP A;  4FXD A;  1K83 H;  3KBG A;  3IFD A;  1EY6 A;  2XWB B;  3RN5 A;  3PF4 A;  1YIT A;  4JI1 Q;  1HA5 A;  3GTQ H;  2VL6 A;  1LV9 A;  3QWN A;  4IUU A;  4XYO A;  2PYK A;  2QGQ A;  3CPW A;  1SSO A;  3I7F A;  4DAY A;  4JK1 C;  1JOQ A;  3VYT A;  1QVF A;  2Q8I B;  2OEO A;  2Q8T A;  2VB2 X;  5JJI A;  4HJ5 A;  3KF8 B;  4EQP A;  1A0I A;  3NQI A;  4PZ6 A;  1F9R A;  2RBM A;  2B3G A;  3EJI A;  4B3T L;  3BU2 A;  1BCP D;  1LAB A;  1C48 A;  2CW0 C;  4F7X A;  1SYG A;  4LF4 Q;  3S1N H;  2MUY A;  2JP1 A;  1NMF A;  3TRZ A;  5DM7 3;  1L1O B;  3AFP A;  1C7Y A;  2LS0 1;  4JVZ A;  2UXD L;  1KAW A;  4NXN L;  4ILW A;  3I8Z A;  4IAL A;  1HZC A;  5EPJ A;  4UP9 A;  4JV5 Q;  4JOI C;  1PH9 A;  3K5L A;  2I5L X;  4X64 L;  3OHX C;  2JA9 A;  4RA8 A;  3HOU G;  4K5V A;  3U9O A;  2K5V A;  2Z4H A;  4AYB G;  4UAI A;  5CV9 A;  2A69 C;  4XXE A;  4PG3 A;  1KDA A;  2A6E D;  1B53 A;  5JEA H;  3TS0 A;  5EBD A;  3RLN A;  1G29 1;  5E1F A;  2JA8 G;  5C44 H;  4UP8 A;  5IYB G;  3SDZ A;  3A8K E;  2R6G A;  3GTM H;  1XJV A;  3DWP A;  1AW7 A;  3BG3 A;  4AH6 A;  2E2I B;  4JW0 A;  1HUN A;  2NUC A;  3I4N G;  1N8R C;  2R92 B;  1PVO A;  3T56 B;  3V05 A;  1QJO A;  1G2S A;  2N55 A;  1XTD A;  3U50 C;  4CDF C;  1SNC A;  1B44 D;  2TSS A;  4A3D H;  5EQ0 A;  2B8F A;  4K6D A;  1VQK A;  1MKH A;  3EFX D;  5M5W H;  1I4G A;  1NR2 A;  3CCQ A;  1G91 A;  4PNY A;  1VQC A;  1RTN A;  5C5M A;  5GAG C;  1EOT A;  3KBX A;  2ZTD A;  2NYZ D;  3ERS X;  2KQ3 A;  1QB5 D;  1VQP A;  3F1Z A;  4GLA C;  1CZG A;  2WAC A;  1K8O A;  2MO0 A;  3OWE B;  5FLM G;  1TVX A;  1PFM A;  1PTO C;  2F0U A;  3RUZ A;  1OTC A;  2UU9 L;  4HJ8 A;  1EUJ A;  2KJX A;  3UDF A;  1LT5 D;  2XVS A;  2XGT A;  1FYC A;  1BBX C;  3E9H A;  1X3G A;  3RLO A;  3IAY A;  1EY8 A;  4L5T A;  5I6W A;  3J80 E;  4LUV A;  1BDO A;  4XQQ A;  1TWA B;  2E76 C;  1SRU A;  2HDM A;  3KF6 B;  1E2Z A;  1L2F A;  1PA6 A;  2SNS A;  3OIQ A;  4HR7 B;  1GUO A;  2P5Z X;  1QUQ A;  2F03 A;  5C4X B;  1ICW A;  2E2J B;  2ENB A;  2B2V A;  4C56 C;  3I4L A;  1A8V A;  1VMP A;  4NP5 A;  1SAP A;  1A2U A;  3K57 A;  1HR0 W;  1SNM A;  3N6R A;  3K58 A;  1X3E A;  3RNU A;  3FVQ A;  1PH1 A;  1WVL A;  1AP0 A;  1CA6 A;  3A7L A;  2JSO A;  3NEN A;  4FNF A;  4YY3 L;  1DGS A;  5JPM C;  1DJR D;  1S5B D;  2D62 A;  1H9S B;  3J80 L;  1WTP A;  5LMU L;  4KJO A;  3VYS A;  2LFN A;  1JIC A;  1UWV A;  4C3J G;  1YJ9 A;  5H1S E;  3G6E A;  2XSC A;  2YTV A;  1PZI D;  3T53 B;  4R4O A;  4EQO A;  1YZ6 A;  3I4M H;  1WTO A;  1FGU A;  5DAU A;  2PI2 E;  5HGQ A;  2Q2T A;  1X56 A;  1O7I A;  4KV6 A;  4B3T Q;  3GV3 A;  4LW1 A;  2R92 G;  1TY0 A;  4Y7N B;  2UUC L;  3A0J A;  2VUM B;  5IT9 E;  2RF4 A;  4QB4 A;  2WKD A;  2Z0S A;  2RA4 A;  2UXD Q;  3MXG A;  3CC4 A;  4NXN Q;  1N33 L;  3S2H B;  4J15 A;  1V1P A;  4NDX A;  2F0E A;  1STH A;  2R7Z B;  3HOZ B;  1E7Z A;  1I4P A;  1C9O A;  1X3P A;  2CW0 D;  4X64 Q;  2DUD A;  1EY7 A;  1P8L A;  2WIN B;  2B63 H;  5HY6 A;  2N88 A;  1LM0 A;  4PMW A;  3OW7 A;  2XRS D;  3SK5 A;  2FIN B;  4H7B A;  4IZ8 A;  3J81 E;  1STG A;  1PFB A;  4DAM A;  1Q46 A;  2HUG A;  2Z4I A;  1TII D;  2XRQ D;  3MA2 B;  3C46 A;  1BNZ A;  3A7A B;  3OWF A;  4IPH A;  3CCE A;  4GLV B;  5EGT A;  5IT9 L;  2AUK A;  4HCS A;  3SEB A;  3K80 C;  2DJG C;  1RF2 D;  3K0X A;  4X66 L;  2A69 D;  2SEB D;  1B50 A;  4DK3 C;  2K7V A;  2AQ1 B;  1K3R A;  3S1N B;  1S5C D;  2XIW A;  4NW2 A;  1ENA A;  1Y1W H;  3H15 A;  2NTS A;  5IGB A;  4RGM A;  3HEJ A;  3I3C A;  1HFG A;  1SNO A;  1P16 A;  3E6Z X;  5C4X G;  1MSG A;  2PMZ E;  2AHO B;  2F0I A;  5KNB A;  1JWU D;  4X3T A;  5CBA E;  4K6L A;  1W2B A;  2IL8 A;  3JAM E;  4OWW B;  5C3E H;  3AYH B;  1IW7 C;  3VR5 A;  5A2Q L;  1PRT B;  3PCO B;  1YHQ A;  2MQH A;  4A93 H;  1SR3 A;  5ELO A;  4A3G H;  4GNX B;  1VF7 A;  4BS9 A;  5M9O A;  4C3I B;  1UE1 A;  2BH8 A;  4DAP A;  1J8I A;  1CT1 D;  2CQA A;  2UU9 Q;  1IYU A;  3I2Z A;  5C44 B;  1F9S A;  2JEA I;  4R4Q A;  1FJG L;  3JAM c;  5IOD A;  3GTM B;  1VDZ A;  3FDT A;  4B3M L;  3CHB D;  1U4M A;  3ND8 A;  1Q1B A;  4QMG A;  1GHK A;  4QUC A;  1SEB D;  1B9N A;  3UDX A;  3HGB A;  3R8B A;  2CH4 W;  4N8F A;  5JJL A;  3S16 H;  3UDG A;  3W1G A;  1LYL A;  2VS1 A;  1PTO D;  2DJF C;  4EGV A;  2KUM A;  1H9K A;  1D1K A;  2BH2 A;  4PQX A;  2PCF B;  3D0F A;  5IOC A;  5M5W B;  4O0A A;  4IUP A;  4IOA A;  2VUM G;  4M1U B;  3IKJ A;  3K5O A;  5C4Z A;  5T1G A;  3HOY H;  4I7Z C;  4HED A;  4A3B H;  2Z6B A;  2EVB A;  2EXD A;  1K8G A;  3DEP A;  2J7Z A;  1JC7 A;  1XX8 A;  2L15 A;  2WP8 J;  4YY3 Q;  1LT3 D;  1UNS A;  5IY0 A;  3HOZ G;  2R7Z G;  3MWY W;  4H13 C;  3J81 j;  5LMU Q;  4MTN A;  4I65 A;  4YWM A;  5BN3 A;  1VCI A;  1I4X A;  4G4K A;  3GTP H;  2EY5 A;  1CA5 A;  2NN6 I;  1EEF D;  1YVC A;  4KD4 A;  1RKN A;  3LWE A;  2X69 A;  3NP8 A;  4EVO A;  2NZH A;  3EVQ A;  3VA5 A;  4B9X A;  1VQE A;  5A35 A;  3J7Z C;  1VS0 A;  2V4D A;  3PIO A;  4CJ2 C;  4JBJ A;  2PW7 A;  4C1N K;  3MFY A;  1KNE A;  4IFD G;  2KHS A;  2L11 A;  3AU7 A;  1CTM A;  1NCV A;  2L55 A;  4PZ8 A;  3J7Y W;  2UUC Q;  1T5X D;  3GTK H;  3T51 B;  5DLQ E;  4DAV A;  1XNQ L;  1NR4 A;  2CVR A;  3DUZ A;  3QOJ A;  1L1O A;  3KLW A;  4WJ4 A;  2Z1C A;  1N33 Q;  2RCF A;  1NAP A;  2CH4 A;  4YIJ A;  1BQQ T;  4QGU A;  2YU9 H;  2WB1 E;  3F2C A;  3CCJ A;  2KEE A;  2GN5 A;  3D4R A;  1AN8 A;  1HNW L;  3G7L A;  5DEH A;  3KJP A;  2RDG A;  4JYA L;  3M3Y H;  3M9B A;  1NSN S;  4R1J A;  5IP9 H;  4NPS A;  1Y69 U;  1PFS A;  3H94 A;  4OL7 A;  1VQN A;  2F0J A;  2EYH A;  4C3I G;  1SNP A;  5JEA G;  3I4M B;  1O7L A;  3NWT A;  5C44 G;  1BF4 A;  1TKW B;  4KHP L;  2Z8L A;  1O80 A;  2I0Q A;  4LF7 L;  4LMQ D;  2RCN A;  1AE2 A;  3DMU A;  4KTA A;  2L1B A;  2RDF A;  4EQN A;  2MO1 A;  1V8Q A;  4F87 A;  2BDO A;  4X66 Q;  1E22 A;  4KMU C;  1ENF A;  2JA5 H;  2ZJP A;  4MN3 A;  1VQJ A;  3GV6 A;  1E2V A;  4JPB W;  4Z9C B;  4GOP C;  1LTA D;  4WOR A;  4XTC S;  2B2T A;  1SXT A;  3NBH A;  2EYM A;  1WTR A;  4HAE A;  1IBK L;  4XT3 B;  1GXD C;  1SJH D;  4QUF A;  4DV3 L;  3LGJ A;  1Q12 A;  3MAQ A;  4LF6 Q;  3D3R A;  3BYY B;  3NXW A;  3GTO H;  2UXC L;  1H95 A;  3ULJ A;  1ENC A;  2GVB A;  3M4O H;  3I55 A;  1M1K C;  2WAQ B;  1IBL L;  1WTX A;  2B2U A;  1CM9 A;  1KTK A;  1D7Q A;  3HS0 C;  2J4X A;  3QB3 A;  1AZQ A;  1IW7 D;  1FJG Q;  4B3M Q;  2LXK A;  2YV5 A;  1EY0 A;  1E1O A;  3PSI A;  1K8M A;  4DNT B;  4K8I A;  2RDH A;  2D5D A;  3PO2 B;  2VQF L;  1HNX L;  1BCP B;  1Y1W B;  1B3A A;  4ME5 A;  4UHV A;  3KF6 A;  2F0K A;  5E4X A;  1TS5 A;  3LX0 A;  1U4R A;  2ZXO A;  4RHR A;  2OQK A;  5KIX A;  1KDC A;  2JA7 H;  1YEZ A;  3I72 A;  3RZO H;  2A8V A;  4DN4 M;  1LAC A;  2QDL A;  3I4O A;  3S14 H;  1UUP A;  1OXS C;  3SK6 A;  4DFA A;  4A93 B;  2QDB A;  4A3G B;  1GJX A;  4LUZ A;  1HTP A;  2CWP A;  4IUT A;  4A3E H;  4RH6 A;  1IHZ A;  4DU9 A;  1X65 A;  3STB C;  1C0A A;  1C4Q A;  4NKL A;  1HQR D;  1EU3 A;  1IBM L;  3WOE A;  3TEH B;  1SBB B;  1RDP D;  2VZA A;  2O5I C;  3CCU A;  5IP7 G;  1CQV A;  1EWC A;  4A3J H;  3P7J A;  1Y1V G;  5CV4 A;  3MFG A;  5C0X I;  3F2B A;  5JEA J;  5FO7 B;  2B8G A;  1EFI D;  1D5X C;  2V1C C;  2R93 H;  4L5Q A;  1XTC D;  2IX3 A;  5EJW A;  4IJL A;  3H3V C;  1F2Y A;  4OO1 I;  4GN3 B;  1J9O A;  2QIL A;  4KHV A;  2C9O A;  4DK1 A;  3PIP 3;  1VQD A;  1PTO H;  3RZD H;  4A3M H;  2LY7 A;  1QZG A;  1ET6 A;  4DV2 L;  1TR5 A;  1X55 A;  2JK8 A;  1L1O C;  3TZU A;  3HOV H;  1A6X A;  4NB3 A;  1PXU A;  3HOY B;  4X65 L;  1EOV A;  3MC0 B;  1EIG A;  4FXG C;  1IKL A;  4DV1 L;  4LFA L;  1K3B C;  3A56 A;  2Z6K A;  4A3I G;  1HNW Q;  3F2U A;  2K03 A;  3OYY A;  4JYA Q;  1LTL A;  1I50 B;  2F0L A;  3HOX H;  2CHB D;  3M7G A;  3BZK A;  1KAB A;  5FO8 B;  1RJT A;  2M2L A;  2DY7 A;  2WAQ G;  4LNQ A;  1VQM A;  4DV6 L;  1Z9F A;  3FMC A;  3FHW A;  5CV8 A;  1JMC A;  1S40 A;  4KHP Q;  4LUO A;  1ESF A;  4LF7 Q;  2HDL A;  3CD6 A;  1PYB A;  4O1N A;  2K5N A;  3KLS A;  2R7F A;  4V0B A;  5IYD H;  4PZ7 A;  5FOB B;  2NTT A;  4JI3 L;  4LAA A;  1QZH A;  2TMP A;  1ILP A;  1UE7 A;  3PO2 G;  3PUY A;  4TQU S;  2VY3 A;  1Y1W G;  3NTI A;  2HCI A;  1DXM A;  1HCZ A;  5IGG A;  1SRO A;  4WRD A;  3K59 A;  1SE3 A;  4C2M B;  4DR6 L;  2F0W A;  3PMF A;  1F9P A;  1IBK Q;  4HTH A;  1YI2 A;  4XT1 B;  4DV3 Q;  3GDE A;  4XQJ A;  1WI5 A;  4G7Z C;  1I6H H;  2UXC Q;  2QKI C;  1EZ6 A;  3S15 H;  2NB0 A;  4IOC A;  4U68 A;  3M3Y B;  4A93 G;  1EY5 A;  4LK1 C;  4A3G G;  4LJZ C;  2H1E A;  2PMZ B;  4OHJ A;  5EPK A;  2X6L A;  2B2U C;  4AQY L;  1IBL Q;  2NVY H;  1KLG D;  4RHS A;  2IW3 A;  4FVM A;  4BA1 I;  4GNX A;  1ICF B;  1SN8 A;  1TXY A;  1JJ2 A;  4TKO B;  4B9W A;  3GTL B;  3I90 A;  1D8L A;  1JWS D;  3GP7 A;  4DA2 A;  1VQI A;  2PQA A;  5I6Y A;  5COY A;  2UXB L;  2F4I A;  4JI2 L;  1DYQ A;  1ZYR C;  1X32 A;  2IHE A;  1Z47 A;  2JA5 B;  1KLU D;  2VQF Q;  1HNX Q;  5JJZ A;  2BOS A;  4TVA B;  1OXU A;  1A3T A;  1MI2 A;  3AQQ A;  1TWF H;  4LFC L;  2XTI A;  5ELD A;  4DNI A;  4IUN A;  3NQT A;  2PZW A;  5G3L F;  3Q23 A;  1PH3 A;  1PV4 A;  3T4A C;  1DON A;  2WAQ E; 
#chains in the Genus database with same CATH homology
 1QCB D;  4RGT A;  1EYC A;  2EXZ A;  2VXW A;  2B2W A;  3GTO B;  3GD7 A;  1HTL D;  1JOR A;  3M4O B;  1FNV A;  3C1F A;  3LWU A;  2A6H C;  5IGE A;  2M9V A;  1BCP F;  3RD4 A;  2K01 A;  2XNA C;  1Z6H A;  4C1N I;  3GQB A;  1UEA B;  2A73 B;  4KJN A;  2EJG C;  2K5Q A;  5M3M B;  4N9T A;  4RGO S;  4KI0 A;  1KNA A;  2O5J C;  2A68 C;  5I2Y A;  2BE5 C;  1XYI A;  1BO0 A;  2JA7 B;  5COR A;  3RZO B;  1JE4 A;  1QNK A;  2K28 A;  4HMJ A;  1IL8 A;  1F2L A;  5KYL A;  3S14 B;  1TT2 A;  1WCM B;  3SE0 A;  4A3E B;  3FPU B;  1R4P B;  3MVV A;  2F1M A;  5E4W C;  2ZXP A;  1QWY A;  1EL0 A;  1JOO A;  4IFD I;  5ELE A;  5EKK A;  2WB1 B;  5K36 H;  1FNU A;  3QG1 A;  2F0P A;  2F0S A;  1TQO A;  2DN8 A;  1SYD A;  3BDO A;  3NPP A;  5D65 A;  3NE5 B;  4XQN A;  2EJM A;  2F0N A;  1ZKO A;  3I91 A;  4DK0 A;  1MBY A;  4KN4 C;  1BXT A;  4ZLT F;  1I4R A;  1D6E C;  4KK7 A;  1PTO B;  3RZD B;  3HOV B;  3TP6 A;  3TP5 A;  3PUV A;  1KDB A;  3R93 A;  2F0M A;  3Q22 A;  4TRD A;  4Q0F A;  1K83 B;  1SNQ A;  1JWM D;  3HOX B;  2F0Q A;  1HRJ A;  3ITP A;  4DXF A;  3GTQ B;  2R61 A;  2NN6 H;  5LL6 X;  2L4N A;  2OXP A;  2PZU A;  3H6M A;  3OMG A;  4HMI A;  1PDQ A;  5LHY 1;  1GUW A;  1O78 A;  4OIJ A;  1S5D D;  3A8J E;  3TP7 A;  2MJ8 A;  4X3U A;  1D5M C;  5ELB A;  3BVG A;  5ELF A;  2B2W C;  1IKM A;  1I6H B;  3S15 B;  4L6T B;  1AFP A;  3J81 L;  3QJY A;  2NVY B;  2RSO A;  3NSW A;  1TS3 A;  3M7N A;  4XYQ A;  1DM0 B;  3X3M A;  3FRP B;  3MXU A;  3VR6 A;  2F3W A;  2QEJ C;  4HCE A;  4J1M A;  3VYR A;  3S9W A;  3DEO A;  5ELC A;  5JVH 3;  3VA7 A;  3Q24 A;  2A6H D;  2EOT A;  1HA6 A;  5NUC A;  5JVG 3;  3JAM L;  5EKL A;  2VB3 X;  3TBI B;  2A74 C;  5C5L A;  2B2V C;  5BN5 A;  4A3D B;  1U4L A;  4XDX A;  4V19 0;  4K5X A;  1EIH A;  4XIG S;  2ZXR A;  1ONL A;  2EE1 A;  3RMH A;  1GUS A;  1W6J A;  4UDU C;  2A68 D;  3H09 A;  1BOS A;  1EZ8 A;  1SYC A;  2BE5 D;  1HUM A;  2K32 A;  3K6O A;  5KGU A;  2PNR C;  5FLX E;  2QF7 A;  4U67 3;  2H4O A;  1EU4 A;  3L3O C;  4DF7 A;  1Q1E A;  5CC4 A;  3J7A V;  4X3K A;  1EQV A;  4A3K B;  5IIF A;  3FEW X;  4ZK9 B;  3KF8 A;  4ZAI A;  1QIL A;  4FXK C;  3HZX A;  2AWO A;  1GHJ A;  1PMR A;  1TWH B;  5KEE A;  3PV0 A;  3MEH A;  1SE4 A;  5CBE E;  4ZRZ A;  3IL8 A;  4ZKB B;  1AEX A;  3OPO A;  1SFO B;  1A3V A;  2GA4 B;  1JR0 D;  3K7A B;  2F0V A;  4PMC A;  3ERQ A;  4H0L C;  3CU7 A;  5C0X H;  3D31 A;  1H9R A;  4KD3 A;  1PTO F;  1STY A;  1W6K A;  4E6I A;  2IJ0 A;  3TDQ A;  2L0C A;  1LT4 D;  4OO1 H;  4KY5 A;  1ZEQ X;  5EKI A;  4RAU C;  1Y8P B;  3D4D A;  2LMC B;  2EDG A;  2O4X A;  1BCP C;  4K5W A;  1CFM A;  2RKS A;  4CJ1 B;  1TWG B;  4ZUI A;  4ZKC B;  1VF5 C;  3NHH A;  1TS2 A;  3KLR A;  3M85 A;  1PZJ D;  4FF4 A;  1T5E A;  2PPB C;  2IWH A;  3I73 A;  1DOM A;  3TSS A;  4BY7 B;  4L63 B;  2B63 B;  1D5Z C;  5CV7 A;  4KHZ A;  2SDF A;  1B1Z A;  3DM1 A;  3C1E A;  2JXM B;  1FR3 A;  4CKE A;  3T16 A;  3S17 B;  2NBF A;  2F0T A;  5I9O A;  5JOB A;  4GZY C;  4G7H C;  3C2P A;  2AWN A;  3I70 A;  1TY2 A;  1R4Q B;  1V43 A;  3KUP A;  4RGN A;  4X3S A;  2C5C A;  3HG9 A;  1PRT F;  1IYV A;  3CRL C;  2BDN A;  1HFN A;  2FHT A;  4KKS A;  1LTB D;  1TWC B;  2AUJ D;  5TSS A;  5C3E B;  2EZV A;  1VMC A;  1R9T B;  4WFN 3;  4KKU A;  3HRZ C;  4FF2 A;  2B2Y A;  3BDL A;  1JOK A;  1HXY D;  5EBC A;  1EYD A;  3NWS A;  1SE2 A;  3CRK C;  4K2L A;  2PW5 A;  1H9S A;  5K36 G;  1HHV A;  5F2D A;  3R2T A;  4CJ0 B;  2ICE C;  3S16 B;  1UAP A;  3SHL A;  3URY A;  2K1B A;  5C3X A;  2MHV A;  3U9S A;  2KOL A;  5IGF A;  3L7Z C;  4L8J A;  3I4N B;  4A3B B;  3R3O A;  3M4Y A;  1BR9 A;  2E74 C;  4K14 A;  2YYZ A;  2RQX A;  2EPB A;  3V96 A;  1ET9 A;  3TP8 A;  2KCN A;  2NN6 G;  1M4V A;  5DNF A;  3S1R B;  4RKB A;  3GTP B;  2G9D A;  5LL6 S;  3C3L A;  1B4O A;  2NVX B;  1RTO A;  1TU2 B;  3WDN A;  3OOC A;  3HP3 A;  2I46 A;  3E5S A;  4WJW A;  2FMM A;  2KEC A;  1I6V C;  4R8I A;  3VR3 A;  2K05 A;  3BVZ A;  3MTS A;  3RLF A;  3SVM A;  5G3L D;  1OXV A;  3GTK B;  5EPL A;  4QIW B;  3NUC A;  4ULL A;  1PFN A;  2B2T C;  2YU9 B;  3VR2 A;  5BN4 A;  3PUW A;  1OXX K;  3MZ5 A;  4M8A A;  3QO2 A;  4IFD H;  2L12 A;  3H91 A;  1KAA A;  1PYW D;  2M00 A;  2EY1 A;  4RWS C;  2AQ2 B;  4F8M A;  4RFB A;  5CV6 A;  4HSP A;  3QIA A;  1LLR D;  4FP5 D;  4CKC A;  4ZYS A;  2HQE A;  5CGK A;  2MPM A;  1DOL A;  3PO3 B;  1LTR D;  4NMZ A;  1SYE A;  4KKT A;  4C3J B;  4H44 C;  1DCZ A;  2A5H A;  4ODG A;  4PV1 C;  5CV5 A;  5J1Z A;  1L0X B;  3PUX A;  3SK8 A;  4QCL A;  4N9P A;  1STA A;  2B2Y C;  1GUG A;  5I2X A;  3AB9 A;  1II3 A;  3N52 A;  2OT2 A;  5M3F B;  3FPP A;  2F3V A;  3HKZ B;  4CBV A;  5JAV A;  1ESR A;  4MHE A;  4A3F B;  2BCO A;  3D6C A;  2EYJ A;  5KND A;  1S5E D;  3IFT A;  3NBI A;  3X3N A;  5FKA C;  1F77 A;  1S5F D;  2I07 B;  1EY9 A;  4ZUJ A;  4BBS B;  2XN9 C;  3S2D B;  2JYO A;  3E0J A;  3K0Y A;  1ROD A;  2AQ3 B;  1A15 A;  2K04 A;  1FD7 D;  2O2L D;  1E2W A;  1CQF A;  1LTT D;  1JB3 A;  1F2M A;  1WD0 A;  4RKL A;  3P1H A;  2WKC A;  4OGQ C;  1I4Q A;  3S1Q B;  1EWH A;  5AFW A;  3MHB A;  3D4W A;  2SNM A;  4F88 A;  2OF1 A;  5C0X G;  3CQZ B;  3W3A A;  1Y8O B;  4A3J B;  1SMY C;  1Y8N B;  1CZW A;  3OIP A;  3A54 A;  2EJF C;  2K33 A;  4CKB A;  2PZT A;  4OO1 G;  3D6W A;  2KCC A;  3NTK A;  1B9M A;  5FO9 B;  2R93 B;  5KYI A;  2BA1 A;  4IN3 A;  5ISR A;  1XWE A;  4DXG A;  1LTG D;  1EYA A;  2JEB I;  4TSS A;  1LT6 D;  1L0Y B;  1CHP D;  2L5T A;  4A3M B;  3EQL C;  1DD2 A;  1SJE D;  2IX0 A;  5KRU A;  1HQM C;  1ILQ A;  4G7O C;  2MGS A;  1YNN C;  1B2T A;  4G57 A;  3EA6 A;  2SOB A;  2IT1 A;  1PRT C;  3BZD B;  4KN7 C;  4HN7 A;  2EY6 A;  5D3D A;  3V2T A;  3S1M B;  3Q6S A;  2NWG A;  3VR4 A;  4MIU A;  5D3I B;  1MGS A;  1STB A;  3SXH A;  5C6A A;  1OXT A;  4FO2 A;  3ERO A;  3G6J B;  1LTS D;  3D8G A;  2KA7 A;  2E2D C;  1E0B A;  1TS4 A;  5A2Q E;  1SND A;  4C3H B;  4BY1 B;  2RVL A;  1WD1 A;  4CHT B;  2FJ2 A;  3CKI B;  4K8J A;  1ZYR D;  2VNU D;  2QCP X;  2JA6 B;  5JPN C;  4RCN A;  1CHQ D;  5E3F A;  1MSH A;  3TZD A;  3BS1 A;  1QOH A;  1RHP A;  1ZXT A;  3OMC A;  2NVQ B;  5C0X J;  5T1I A;  3UI2 A;  5I9P A;  2EYP A;  2R3Z A;  3KK7 A;  1TWF B;  3DXJ C;  1EQT A;  4QF4 A;  1WTV A;  5C4H A;  4BA2 I;  1RCV D;  4J6H A;  2WV6 D;  2E2H B;  1PLF A;  2Y0S B;  3GO5 A;  3H0G B;  2KVM A;  2G9H D;  3TN2 A;  1QNU A;  3A55 A;  1ML0 D;  2F0F A;  1JCK B;  1GUN A;  5J22 A;  3BVM A;  3R2I A;  1PZK D;  4ID6 A;  4ZQ3 A;  5K5P A;  5D14 A;  4HSV A;  4R8N A;  4BWG B;  3Q0A A;  2D2C C;  1GUT A;  1FGB D;  1YNJ C;  2WII B;  1SMY D;  1CI3 M;  1S4Z A;  2MP1 A;  3AMU A;  2ID0 A;  5FLX L;  5J39 A;  4C3H G;  1H9M A;  1A3U A;  1A2T A;  1I4H A;  1U4P A;  3QOL A;  4O42 A;  2D9U A;  1DZ1 A;  3P75 A;  4OIK A;  5HUR A;  4DNR B;  3SR1 A;  4PMB A;  3DWQ A;  1YNN D;  3NTH A;  2F0O A;  5M5X B;  2JE6 I;  2EYF A;  1V1O A;  1PRT D;  2PQE A;  1SDF A;  4J8Q A;  5C4J B;  4FYD A;  1D2B A;  2K6A A;  1M8A A;  1Q3L A;  2LKV A;  3KLS X;  5KNC A;  4BBR B;  4IUQ A;  4IUR A;  1Z7T A;  2FMC A;  1O7Z A;  2K5W A;  2DNE A;  1Q90 A;  1DOK A;  1MD2 D;  1EY4 A;  2K5D A;  1Y1V B;  3GTG B;  3L9A X;  3ZYY X;  2Q8R E;  3ONA B;  1WTW A;  3ND9 A;  3FKI B;  2L9H A;  2DY8 A;  2DNC A;  3TME A;  2F0H A;  4B08 A;  4S3S A;  1STE A;  3HOW B;  2IPK D;  3PUZ A;  2X6G A;  5DM6 3;  2KED A;  2NVT B;  1HPC A;  4IUV A;  1V1P B;  4FF3 A;  2A6E C;  2ICI A;  3K5M A;  5HGT A;  4A3I B;  4CGY B;  3J7A F;  3GTJ B;  2PO4 A;  1RD9 D;  1G8Z D;  1I3Q B;  3MXN A;  1D1I A;  3PIO 3;  1XXG A;  4RCO A;  2XWJ B;  4K2K A;  4Q5V A;  2B39 A;  1QE6 A;  3O13 A;  1U9R A;  3MXP A;  3DHQ A;  2EY2 A;  1O7Y A;  5IGC A;  1NUC A;  5M5Y B;  4IQZ A;  1SYB A;  3SK4 A;  2J0T D;  4JBW A;  2F0G A;  3BDC A;  2E75 C;  1AZP A;  4IFD J;  3WOF A;  1F9Q A;  5C3W A;  3LNN A;  1FNW A;  2HCC A;  1BUV T;  3BYT B;  1F2Z A;  3HOU B;  4DGZ A;  2RSN A;  3VYU A;  4AYB B;  1CK1 A;  3T13 A;  4KY7 A;  3NK9 A;  1WTQ A;  2FFK B;  5IGD A;  1LO5 D;  1SYF A;  2JA8 B;  4ABN A;  2F0D A;  1EEI D;  2EYO A;  1OO9 B;  1H9J A;  3A8I E;  3DWA A;  3P20 A;  1G2T A;  5FK9 C;  2BA0 A;  1QG7 A;  3K5N A;  4R9W A;  1Q8I A;  1YNJ D;  1STN A;  4P2C B;  2EYL A;  1G6Z A;  3W2D A;  1GOZ A;  4FF1 A;  5CYU A;  4KY6 A;  2NZ1 D;  3OSO A;  5CR3 A;  1X3Q A;  1C8C A;  1LTI D;  5CMD A;  2ZT9 C;  5I4D A;  2IX1 A;  4FXD A;  3KBG A;  3IFD A;  1EY6 A;  2XWB B;  1HA5 A;  1LV9 A;  3QWN A;  4IUU A;  4XYO A;  2PYK A;  1SSO A;  4DAY A;  4JK1 C;  1JOQ A;  3VYT A;  2Q8I B;  2OEO A;  2Q8T A;  2VB2 X;  4EQP A;  3NQI A;  1F9R A;  2RBM A;  3EJI A;  1BCP D;  1LAB A;  1C48 A;  2CW0 C;  4F7X A;  1SYG A;  2MUY A;  2JP1 A;  5DM7 3;  2LS0 1;  4ILW A;  3I8Z A;  4IAL A;  5EPJ A;  3K5L A;  3OHX C;  4RA8 A;  4K5V A;  3U9O A;  2Z4H A;  4UAI A;  5CV9 A;  2A69 C;  4XXE A;  1KDA A;  2A6E D;  1B53 A;  5JEA H;  5EBD A;  1G29 1;  5E1F A;  3SDZ A;  3A8K E;  2R6G A;  3DWP A;  1AW7 A;  3BG3 A;  2E2I B;  1HUN A;  2NUC A;  2R92 B;  3T56 B;  3V05 A;  1QJO A;  1G2S A;  2N55 A;  1SNC A;  1B44 D;  2TSS A;  5EQ0 A;  2B8F A;  4K6D A;  3EFX D;  1I4G A;  1NR2 A;  1G91 A;  4PNY A;  1RTN A;  5C5M A;  1EOT A;  3KBX A;  2NYZ D;  2KQ3 A;  1QB5 D;  1CZG A;  2WAC A;  1K8O A;  3OWE B;  1TVX A;  1PFM A;  1PTO C;  2F0U A;  3RUZ A;  2KJX A;  1LT5 D;  2XVS A;  1FYC A;  1BBX C;  3IAY A;  1EY8 A;  5I6W A;  3J80 E;  1BDO A;  4XQQ A;  1TWA B;  2E76 C;  2HDM A;  1E2Z A;  2SNS A;  3OIQ A;  4HR7 B;  1GUO A;  2F03 A;  5C4X B;  1ICW A;  2E2J B;  2ENB A;  2B2V A;  4C56 C;  3I4L A;  1VMP A;  4NP5 A;  1SAP A;  1A2U A;  3K57 A;  1SNM A;  3N6R A;  3K58 A;  3FVQ A;  1WVL A;  1AP0 A;  1CA6 A;  3A7L A;  2JSO A;  4FNF A;  5JPM C;  1DJR D;  1S5B D;  2D62 A;  1H9S B;  3J80 L;  1WTP A;  4KJO A;  3VYS A;  2LFN A;  1JIC A;  4C3J G;  2XSC A;  3T53 B;  1PZI D;  4EQO A;  1WTO A;  5DAU A;  4KV6 A;  3GV3 A;  1TY0 A;  4Y7N B;  2VUM B;  5IT9 E;  4QB4 A;  2WKD A;  2RA4 A;  3MXG A;  3S2H B;  4NDX A;  1V1P A;  2F0E A;  1STH A;  2R7Z B;  3HOZ B;  1I4P A;  1X3P A;  2CW0 D;  1EY7 A;  2WIN B;  2N88 A;  4PMW A;  3OW7 A;  2XRS D;  3SK5 A;  4IZ8 A;  4H7B A;  2FIN B;  3J81 E;  1STG A;  1PFB A;  2HUG A;  2Z4I A;  1TII D;  2XRQ D;  3MA2 B;  3C46 A;  1BNZ A;  3A7A B;  3OWF A;  5EGT A;  5IT9 L;  2AUK A;  4HCS A;  3SEB A;  1RF2 D;  2A69 D;  2SEB D;  1B50 A;  2K7V A;  2AQ1 B;  3S1N B;  1S5C D;  2XIW A;  4NW2 A;  1ENA A;  2NTS A;  5IGB A;  4RGM A;  3HEJ A;  3I3C A;  1HFG A;  1SNO A;  3E6Z X;  1MSG A;  2F0I A;  5KNB A;  1JWU D;  4X3T A;  5CBA E;  4K6L A;  2IL8 A;  3JAM E;  1IW7 C;  3VR5 A;  5A2Q L;  1PRT B;  1VF7 A;  4BS9 A;  5M9O A;  4C3I B;  1J8I A;  4DAP A;  1CT1 D;  2CQA A;  1IYU A;  5C44 B;  1F9S A;  2JEA I;  5IOD A;  3GTM B;  1VDZ A;  3FDT A;  3CHB D;  1U4M A;  3ND8 A;  1Q1B A;  4QMG A;  1GHK A;  4QUC A;  1SEB D;  1B9N A;  3HGB A;  3R8B A;  1PTO D;  4EGV A;  2KUM A;  1H9K A;  1D1K A;  4PQX A;  2PCF B;  5IOC A;  5M5W B;  4IUP A;  4M1U B;  3IKJ A;  3K5O A;  5C4Z A;  5T1G A;  4I7Z C;  4HED A;  2EVB A;  3DEP A;  2J7Z A;  1JC7 A;  1XX8 A;  2WP8 J;  1LT3 D;  1UNS A;  3MWY W;  4H13 C;  4I65 A;  5BN3 A;  1VCI A;  1I4X A;  4G4K A;  2EY5 A;  1CA5 A;  1EEF D;  2NN6 I;  4KD4 A;  1RKN A;  3LWE A;  2X69 A;  3NP8 A;  4EVO A;  3EVQ A;  3VA5 A;  4B9X A;  5A35 A;  2V4D A;  4CJ2 C;  2PW7 A;  4C1N K;  3MFY A;  1KNE A;  4IFD G;  2KHS A;  2L11 A;  3AU7 A;  1CTM A;  1NCV A;  2L55 A;  3J7Y W;  1T5X D;  3T51 B;  4DAV A;  1NR4 A;  2CVR A;  3DUZ A;  3QOJ A;  2Z1C A;  1NAP A;  4YIJ A;  1BQQ T;  2KEE A;  3D4R A;  1AN8 A;  3G7L A;  5DEH A;  2RDG A;  1NSN S;  1Y69 U;  3H94 A;  4OL7 A;  2F0J A;  2EYH A;  4C3I G;  1SNP A;  5JEA G;  3I4M B;  1O7L A;  3NWT A;  1BF4 A;  1TKW B;  2Z8L A;  1O80 A;  4LMQ D;  3DMU A;  4KTA A;  2L1B A;  2RDF A;  4EQN A;  1V8Q A;  4F87 A;  2BDO A;  4KMU C;  1ENF A;  4MN3 A;  3GV6 A;  1E2V A;  4Z9C B;  1LTA D;  4WOR A;  4XTC S;  2B2T A;  1SXT A;  3NBH A;  2EYM A;  1WTR A;  4HAE A;  4XT3 B;  1GXD C;  1SJH D;  4QUF A;  1Q12 A;  3MAQ A;  3D3R A;  3BYY B;  3NXW A;  1ENC A;  2WAQ B;  1WTX A;  2B2U A;  1CM9 A;  1KTK A;  3HS0 C;  2J4X A;  3QB3 A;  1AZQ A;  1IW7 D;  1EY0 A;  1K8M A;  4DNT B;  4K8I A;  2RDH A;  2D5D A;  3PO2 B;  1BCP B;  1Y1W B;  1B3A A;  4ME5 A;  2F0K A;  5E4X A;  1TS5 A;  3LX0 A;  1U4R A;  2ZXO A;  4RHR A;  5KIX A;  1KDC A;  3I72 A;  4DN4 M;  1LAC A;  1UUP A;  1OXS C;  3SK6 A;  4DFA A;  4A93 B;  2QDB A;  4A3G B;  1GJX A;  1HTP A;  4IUT A;  4RH6 A;  1IHZ A;  4DU9 A;  1C4Q A;  4NKL A;  1HQR D;  1EU3 A;  3WOE A;  1SBB B;  1RDP D;  2O5I C;  1CQV A;  1EWC A;  3P7J A;  5CV4 A;  3MFG A;  5C0X I;  5JEA J;  5FO7 B;  2B8G A;  1EFI D;  1D5X C;  1XTC D;  2IX3 A;  5EJW A;  3H3V C;  1F2Y A;  4OO1 I;  1J9O A;  2QIL A;  4KHV A;  2C9O A;  4DK1 A;  3PIP 3;  1PTO H;  2LY7 A;  1ET6 A;  1TR5 A;  3TZU A;  1A6X A;  1PXU A;  3HOY B;  3MC0 B;  1EIG A;  4FXG C;  1IKL A;  3A56 A;  3F2U A;  2K03 A;  2F0L A;  1I50 B;  2CHB D;  3M7G A;  1KAB A;  5FO8 B;  1RJT A;  2M2L A;  2DY7 A;  3FMC A;  5CV8 A;  1ESF A;  2HDL A;  4O1N A;  3KLS A;  4V0B A;  5FOB B;  2NTT A;  4LAA A;  2TMP A;  1ILP A;  3PUY A;  4TQU S;  3NTI A;  2HCI A;  1DXM A;  1HCZ A;  5IGG A;  4WRD A;  3K59 A;  1SE3 A;  4C2M B;  2F0W A;  3PMF A;  1F9P A;  4HTH A;  4XT1 B;  4XQJ A;  4G7Z C;  2QKI C;  1EZ6 A;  2NB0 A;  4U68 A;  3M3Y B;  1EY5 A;  4LK1 C;  4LJZ C;  2H1E A;  2PMZ B;  4OHJ A;  5EPK A;  2B2U C;  2X6L A;  1KLG D;  4RHS A;  2IW3 A;  4FVM A;  4BA1 I;  4TKO B;  4B9W A;  3GTL B;  3I90 A;  1JWS D;  3GP7 A;  4DA2 A;  5I6Y A;  5COY A;  2F4I A;  1DYQ A;  1ZYR C;  1X32 A;  1Z47 A;  2JA5 B;  1KLU D;  5JJZ A;  2BOS A;  1OXU A;  1A3T A;  1MI2 A;  5ELD A;  4IUN A;  3NQT A;  2PZW A;  5G3L F;  3Q23 A;  3T4A C;  1DON A;  1JQY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...