5I6WA

Crystal structure of staphylococcal nuclease variant delta+phs a58d at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEDSAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS A58D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i6wA00
5EKKA 4NP5A 1EYAA 2F0IA 3D8GA 5C6AA 4K5VA 1F2YA 3QOLA 5CV7A 2F0QA 3MZ5A 3MXPA 3MEHA 1SNCA 2EY1A 1A3UA 1KABA 2EYHA 2KHSA 2HQEA 3PMFA 4WORA 2F3VA 4EQPA 3SR1A 2SNSA 3NUCA 5I9OA 3HZXA 1KAAA 3NXWA 4KHVA 4NKLA 2EYPA 1STGA 2EYOA 4ZQ3A 3TP6A 4DF7A 5C3XA 1JOQA 1EY9A 1TR5A 1SNDA 3OMGA 5CC4A 5EGTA 1SNQA 4ODGA 2F0EA 3C1EA 3OWFA 2SOBA 2O4XA 1SNMA 1EZ8A 1SNPA 3LX0A 4K2KA 4PMCA 1EY4A 3E5SA 2PW7A 3NQTA 3SHLA 5J22A 3ITPA 3D4WA 3EJIA 5ISRA 1EY0A 3DMUA 5DAUA 5IGFA 4K8JA 2F0SA 4QMGA 4NMZA 4N9PA 4J6HA 4ZUJA 1AEXA 2RBMA 1NUCA 1KDBA 1EY8A 3QB3A 2EYFA 5IOCA 2EYLA 4PNYA 5I6YA 2WACA 3C1FA 2F0PA 2F0WA 4RKBA 3TMEA 5KGUA 5CV4A 4K14A 1EY5A 1RKNA 3P75A 3SK8A 4HTHA 5C5LA 4B9WA 4E6IA 3OSOA 2F3WA 3T16A 1SYFA 2F0LA 3NP8A 3SK4A 3SXHA 4IUNA 1A3TA 3BDCA 4R8NA 1STHA 5E3FA 5CV9A 2M00A 4KY6A 3P1HA 3R3OA 5C5MA 1EZ6A 3HEJA 2PZTA 4QB4A 5NUCA 4DU9A 1SYBA 4KD4A 4S3SA 3VA5A 5HURA 4KY7A 4KJOA 3RUZA 4LAAA 5KYIA 5C3WA 1TT2A 2EY5A 1SNOA 3BDLA 2RKSA 3SK5A 4TRDA 4EVOA 5KEEA 2F0JA 4KTAA 5CV5A 4WRDA 1KDAA 4YIJA 1A2TA 4RKLA 2F0NA 1U9RA 2OF1A 2KQ3A 2F0HA 4B9XA 5C4ZA 1F2MA 4QF4A 4ZUIA 3TP8A 2NUCA 5E1FA 2EY6A 1A3VA 5IGCA 5JOBA 5IODA 4F8MA 1STYA 1EQVA 2EYMA 2PYKA 3SK6A 2LKVA 2PZUA 3D6CA 2RDFA 4I65A 1SYDA 4K8IA 4OL7A 5I6WA 3NK9A 4ME5A 1SYGA 2F0TA 1A2UA 2PQEA 1JOKA 4KJNA 1ENAA 1EYDA 4HMIA 3EROA 4KV6A 2PZWA 5DEHA 4EQNA 4KD3A 3NHHA 5IGGA 2OXPA 1SYEA 2F0VA 4PMBA 5CV6A 5J1ZA 4K6DA 4DGZA 5IIFA 5M9OA 2OEOA 5IGEA 2F0KA 5CV8A 5KRUA 1TQOA 1STNA 2EXZA 1KDCA 5CGKA 5I9PA 1SYCA 2F0DA 2F0FA 2SNMA 4IZ8A 4F7XA 3T13A 5IGBA 5C4HA 4H7BA 2EY2A 5CR3A 2F0UA 4HMJA 3TP7A 4IALA 1II3A 5IGDA 5J39A 3ERQA 1EYCA 4G57A 5EKLA 3U9OA 4MIUA 5KYLA 2ENBA 3V2TA 3DHQA 1F2ZA 3EVQA 3H6MA 5KIXA 3MHBA 4K5XA 1JORA 5F2DA 5K5PA 2F0GA 3QOJA 3OMCA 4ID6A 4K5WA 4N9TA 3S9WA 4K2LA 1JOOA 1STBA 4EQOA 1ENCA 2EYJA 2QDBA 4J1MA 1EY7A 1EY6A 3D4DA 3MVVA 2F0OA 5HGTA 5JAVA 4KY5A 1NSNS 4DFAA 2F0MA 1IHZA 3TP5A 1STAA 4NDXA 2PW5A
chains in the Genus database with same CATH superfamily
4HIDA 2HIVA 3S16B 3QOLA 4R4IA 1IYUA 1PH9A 1Q81C 3GTPB 2UXBL 3C3LA 4TSSA 3H3VH 3H09A 3PIOA 4DUYL 2D0PA 2H1EA 4DV6L 1TVXA 4IUQA 1Y1VH 1I3QB 2O4XA 3RN5A 4FXGC 3TQYA 4BBRG 2UXBQ 1K28A 3C46A 1EQRA 4DUYQ 1TWHH 4DV6Q 1NUCA 4C3HH 5JJZA 1JJ2A 4PNYA 2F0WA 2V4DA 1PTOD 4OGQC 1B3QA 1YZ6A 2FJ2A 2K5DA 1MGSA 4WJWA 2ZJRA 1VQDA 3SXHA 2PI2A 1Q1BA 1ESRA 3PIO3 3CCRA 1NBWA 4DN4M 4ZKCB 1QVGA 2PZTA 4QJFA 1Q12A 1XPRA 2VS1A 1H9JA 4UP7A 1LTAD 2K05A 4BY7H 3HKSA 1TY2A 1RTNA 4RWSC 4ZKBB 3OPOA 2EJGC 1XPOA 3CHBD 1E2ZA 2XSCA 4DV7Q 3CCQA 4CKCA 2NN6G 3VR4A 1LTGD 2HIXA 5CMDA 1PH2A 5C4XG 1BCPF 1I50H 3SK6A 4X64L 1AE3A 2WKCA 3H3VC 1SMYC 1N36L 1N34L 1JOKA 1VQLA 2FMMA 4A3KH 2JA5B 2K28A 4BXXG 5IYBH 4LFBL 3HGBA 1STNA 3DXJC 4ALPA 3IL8A 2SNMA 4X64Q 2PI2E 4B3RL 3ND8A 4LF4L 1N36Q 5EJWA 1N34Q 5CR3A 2VW9A 1D7QA 2DJFC 2AQ1B 2EXDA 2X6GA 3HOYH 4XQNA 2CCZA 1WTHA 1EEID 3NBHB 3HOXH 3M3YB 3HKZE 5F2DA 4LFBQ 1VDZA 1P8LA 1TWAB 3I91A 4H44C 1DZ1A 4B3RQ 2Y0SB 4LF4Q 3OIPA 3RLOA 1VMPA 3IFTA 1HXYD 2ICEC 4NW2A 1EYAA 1D1KA 1A62A 3HOUH 1Y1VG 1U4MA 2E2HB 2EY1A 2XGTA 1L1OA 2K1BA 3NELA 3UI2A 1NJIC 3K6OA 3PO2B 1STGA 4RFBA 1KNEA 4HEDA 4RG1A 2R92B 4IN3A 2VUMB 4K0KL 4C3HG 4M8AA 1X3EA 3JAME 2PW7A 3FEWX 3J81E 3D4WA 2AHOB 4DV1L 4JK1C 2RCFA 1Y1WB 2JA7B 4NMZA 3CC4A 1KIXA 3OTOQ 1AEXA 2HCCA 1ENFA 1HZBA 2I5HA 1HZ9A 3VR5A 3D31A 4K0KQ 4J15A 2BH8A 2F0PA 2BOSA 4A3DH 4DV1Q 2H5XA 3KLSA 5LL6X 5CBAE 1KD1C 4OELB 1KC8C 2I5MX 1PH4A 1W6KA 5E7NA 2C9OA 1LO5D 4KY6A 3TBIB 2PMZB 4KN7C 1KLGD 1N33L 4RGOS 1NY4A 2BE5C 1CK1A 1NMFA 4KMUC 3CP0A 1LTTD 1D1IA 3NBHA 3KJOA 1VQOA 4MZ9A 1TWGH 3I4NB 5EPKA 4A3KG 1VQPA 4IURA 4MHEA 1IW7C 3RNUA 1N33Q 5IYBG 1Y8NB 3NEMA 4X65L 3KLWA 4AYBB 1PRTB 1AN8A 1YHAA 1EQQA 5GADC 4QUFA 1WCMG 5C44H 1KL9A 4ULLA 4U673 4O42A 5DEHA 1K9MC 4YWKA 3HOYG 2XVSA 1SLJA 4GLXA 4I7AA 3HOXG 1CQFA 2DNEA 5CGKA 1SEBD 4JOIC 4F7XA 4AQYL 4YWMA 4X65Q 1TY0A 4H7BA 3Q0AA 2D0OA 3D4RA 5EPJA 4L5RC 1F2ZA 3HOUG 1MBYA 4JBWA 3BG3A 4AQYQ 2KECA 4A3BH 5JAVA 3GTKH 2NVYB 5M5XB 2Y0SE 3P20A 1YBYA 4POFA 2L11A 4POGA 5C6AA 2VY3A 5HGQA 5GAHC 2B2UA 4Y7NB 1WTPA 3MXPA 4GLVB 1A63A 2B2TA 1K83H 3HOZB 4EQPA 4JPBW 5I9OA 5C0XI 1JMCA 3NXWA 3J81i 3TZUA 1MHWC 2QKIC 1XTDA 1T9HA 3I4MB 1PTOF 1CZWA 4CDDC 5CC4A 2F52A 1GHKA 3VYRA 1MJCA 3TSSA 3OW2A 2ZXPA 4A3DG 1F9RA 1BXTA 2QILA 2K5NA 4K8JA 2NZ1D 2Q2IA 1SFOH 2J7ZA 1RD9D 2KOLA 4X3TA 4EX5A 1CKOA 3QB3A 2AQ3B 3MXGA 3CCMA 2UU9L 2MFIA 2IJ0A 3W3AA 2CWAA 1O80A 2JA6H 5FOBB 1FGBD 3HOWB 2FXQA 3RR5A 4A3IH 2RHQB 3K0YA 1FR3A 1IKMA 1S40A 2QEJC 2UU9Q 3E9HA 2PMZE 1SNOA 3SGIA 3ULJA 1HA6A 1AZQA 3OW7A 2OF1A 5C44G 1RIPA 3AFQA 1K8GA 2JA9A 1E0BA 1WI5A 4UY8C 4FNFA 1EQVA 4IPCA 3F1ZA 4WJ3M 3D3RA 1NR2A 4NXML 1CHQD 4C3JH 2E8GA 1SBBB 2K7VA 1UAPA 3LWEA 2O5JC 5FLXL 1SMYD 4AYBE 2WP8J 1BDOA 4C2MB 1UWVA 2OEOA 5IE8A 5KRUA 4HJAA 1BCPB 3NQIA 2Q2UA 1IYJB 4XTCS 4RGMA 4NXMQ 1S3OA 1DD2A 4A3GH 4HMJA 2C5CA 3K80C 4IALA 1X32A 3NENA 5M5WB 1Q86C 3VR6A 2LSSA 4LNQA 3URYA 3OWEB 4HCEA 1FJGL 3DEOA 4DV3Q 1ML0D 1RHPA 3H0GH 1NMGA 2RSNA 4DR4L 2B8FA 3PO3B 5EKKA 4DAYA 1G6PA 1FGUA 4BWGB 2RSOA 2VXWA 1FJGQ 4ME3A 1K0SA 4OO1G 2Z6BA 3HP3A 1R9TH 5CORA 4LF5L 1HHVA 2K5WA 4PG3A 3NUCA 4GNXC 2DUDA 2VB2X 1HNXL 1BVSA 5M3MG 1SE2A 3A8IE 2UUCL 1Q8KA 2MGSA 3EN2A 3CMEA 1V8QA 4HJ5A 4P74A 3I8ZA 4LF5Q 2K04A 3GV6A 5BN5A 3ICEA 2JA6G 4ZAIA 1GXDC 2WAQB 1HNXQ 4AIMA 3CQZB 3T4AC 2EYLA 4A3IG 1UUPA 3S1NH 2UUCQ 4PZ7A 4YHHL 1EY5A 2H4OA 4E6IA 1HTLD 2YTYA 4A3MH 4B9WA 1DGSA 1J8IA 5C4JH 2A5HA 3FRPB 4IUNA 3CRKC 1WTXA 1A15A 3S15H 3CW2C 1F77A 3OHXC 4QCLA 4KD4A 1C7YA 2WKDA 1Y69U 3S14H 4YHHQ 3PUVA 4UHVA 1HNWL 2RQXA 2YU9B 5KEEA 4WRDA 4C3JG 4LFAL 1QNKA 3F2DA 3GTQB 2LS01 1SN8A 1G6ZA 5JOBA 3U4VA 4HJ9A 1STYA 4GN4B 1LTRD 3A0JA 3CPFA 5I2XA 4YY3L 1HNWQ 1IW7D 4HIMA 1UNSA 4JVZA 3NK9A 3FVQA 1A2UA 3Q22A 2B2VA 2HHHL 1VQMA 4LFAQ 1NTGA 4A3GG 1IBKL 1VF5C 3FKIB 5J1ZA 2F0VA 2Z0SA 2IT1A 3EQLC 2HCIA 4MNOA 1XWEA 2EXZA 2QGQA 4A3EB 4RGNA 3S17B 2N55A 4A3FB 1SE3A 4R4OA 2G9HD 1TWCH 2HHHQ 1OXUA 3JC66 4X3UA 5KIXA 1YEZA 2FFKB 4JI4L 2M2LA 1PFNA 4HJ7A 4YCVA 3GTLH 4DR7L 1KRTA 5FO8B 1X3GA 4NDXA 3WOFA 2CKZB 2VNUD 3AEVA 4NP5A 3A5UA 3CRLC 2O2LD 4IPDA 3BZCA 1PYWD 2MNAA 4DNTB 3MEHA 4JI4Q 2R6GA 5C3EH 4LF6L 3PCOB 3EA6A 3A56A 2R7ZB 4DR7Q 2VQFL 3BZDB 3KK7A 3MFGA 4CHTB 1EY9A 3FPPA 1YITA 2R7FA 1HR0L 4JI6L 3VA7A 1TS3A 2F0EA 1HQRD 1SNPA 4LF6Q 4LF9L 1T5XD 3S16H 5JJLA 3TEHB 2YTVA 4A3MG 3S2DB 2JYOA 1SJED 1VCIA 1HR0Q 4CDFC 4JI6Q 1IKLA 4AH6A 2QA4A 1CA6A 5I6YA 2JEAI 4LF9Q 2WAQE 3P75A 3P7JA 1QJOA 4JBJA 4EQ5A 4UAIA 1BR9A 2M00A 5ELFA 5NUCA 5M5YB 1U0LA 1BO0A 3J7ZC 4ZLTF 2SEBD 3OOCA 3E0JA 5HY6A 5CV5A 2ZTCA 1ZKOA 4BA2I 1K8OA 4RA8A 4RMFA 2QW7A 4UPAA 1RCVD 4JC0A 1I4RA 5E1FA 2KHJA 3MXUA 1CKMA 1HPCA 3PIPA 3D6CA 2RDFA 5JVG3 4IFDI 4ME5A 5LMUL 1EYDA 3K58A 1Q82C 3NHHA 4JBKA 5CV8A 1KNAA 3KLRA 5I9PA 4IQZA 5LMUQ 3J80E 2K03A 2F0UA 3TP7A 1XXGA 3J81j 3ERQA 3U9OA 5K5PA 1X3FA 3DM1A 5ELBA 1Q3LA 1JCKB 5C3EG 3VR3A 1CKNA 1F2LA 3MVVA 5LMNQ 1ICFB 2F0OA 4DK6C 3J7AF 3PIP3 3EIVA 2GVBA 2F0MA 2K5QA 5M3FB 1G91A 4LFCL 2F0IA 3D8GA 2NVQB 5E4WC 3M3YH 2XIWA 3S1QB 1IXRA 3MZ5A 1E1OA 1L2FA 4BBSB 2SDFA 3D6WA 1TWAH 1V1OA 3NSWA 1MJEA 4LUZA 4DF7A 4GOPA 2IWHA 2O5IC 3OMGA 4LFCQ 1PH8A 3GDEA 4RH6A 1VQAA 1EY4A 1XMOL 1K0RA 2E2HH 2CH4W 3D0FA 5IGFA 3GTMH 1PH1A 4G7OC 2CVRA 3VDYA 4J6HA 1I4PA 1PFBA 2RBMA 1SSOA 4DV5L 1JR0D 2ZT9C 1K8AC 2KVMA 2XNAC 4RKBA 4A3JB 2VUMH 3TDQA 2I07B 2KCMA 4L5QA 2KUMA 4P75A 3SK8A 1XMOQ 5C5LA 3BJUA 3T16A 5LL6S 2CFMA 2EZVA 1JB7A 3RMHA 1SRUA 4CJ0B 1Y1WH 4OHJA 1LV9A 2L5TA 3W1BA 2EPBA 2JA7H 4DV5Q 5C5MA 2Z4IA 1RJTA 1QUQB 2PCFB 1O78A 1Z7TA 2E2JH 3K57A 1B2TA 1HFGA 1CFMA 5JJIA 3KYHC 2FHTA 1WVLA 1A0IA 1X3PA 3W1GA 1VQNA 1LM0A 1UE6A 1QG7A 3H15A 3I4LA 3L0OA 1SYGA 1L1OB 2L1BA 2LY7A 4WFN3 1YJNA 3S1RB 1M8AA 1L0YB 3J80i 5CV6A 4DNRB 1K8MA 4JI0L 3K7UC 3I4NH 1HFNA 2HQLA 2IHFA 4B3TL 1KHIA 2Z9HA 1NCVA 2ASBA 1OXTA 5FLXc 2CWPA 2MQHA 1E3PA 4HSVA 1CZGA 2ENBA 4JI0Q 4GN5A 3BYYB 5D65A 3GV3A 4B3TQ 5AJ3L 3OMCA 2UUBQ 3OYYA 5BR8L 4P71A 4C1NK 4EQOA 2UXDL 1EY7A 2Q2TA 1YI2A 3E6ZX 3K0XA 2Y0SG 1GUGA 1GO3E 4UDUC 1D5ZC 3S1MB 3X3MA 4K5VA 5AJ3Q 1I6HH 2KJXA 1BOSA 3RD4A 1B1ZA 2KCTA 5BR8Q 2FMCA 2NWGA 2KHSA 1WCMH 1VQ7A 3HZXA 4NKLA 4LMQD 2B2UC 1VQJA 5EAYA 1QUQA 4A93B 1WD0A 2Q8RE 2B2TC 4G7ZC 2JE6I 1UEAB 2OWOA 3J7AV 1SNMA 3R2IA 2R92G 1YVCA 2LXJA 1Q1EA 2VUMG 1GUWA 1NR4A 3FHWA 2RHSB 2RVLA 1Y1WG 4QL5A 2KENA 2JA7G 1KDBA 3AYHB 1DOKA 3G7LA 3L3OC 3I2ZA 1TS2A 5KGUA 3HOVH 1ASZA 1XJVA 4OX9L 3AQQA 1LTLA 1TXYA 3G4SA 4B3SL 2N49A 4QUCA 2WIIB 1PRTC 1UE5A 4IOCA 3GTJB 1QZHA 3T56B 1E2VA 3CAMA 2ATWA 1EFID 4OIJA 1QNUA 1SR3A 4FF2A 3KLSX 4OWXB 4OX9Q 3SK5A 3T51B 2YV5A 4B3SQ 5FKAC 4DA2A 4GKJL 5EBDA 1IL2A 3GTGB 4QF4A 4JI2L 1OTCA 1PYBA 2E2IH 4GN3B 3I4NG 2X69A 3ULPA 3M9BA 2L15A 2R3ZA 4JW0A 4OL7A 4GKJQ 4TVAB 1LTBD 4KJNA 1D6EC 2A19A 4A75A 4QY7A 3EFXD 3PUXA 4XT3B 4EQNA 1N8RC 1YJ9A 5FK9C 4JI2Q 1TS4A 2IL8A 4FF3A 1BBUA 1O7LA 1G2SA 2F0FA 3U58A 3T13A 5IGBA 1X65A 2EY2A 1EYGA 4B3ML 4C3HB 1D5MC 2K14A 4KKUA 2NVTB 1ENCA 3N52A 4B3MQ 2V1CC 1W2BA 3M7GA 5M5WH 4DR6L 3FDTA 4DR3L 2IY5B 1MIUA 2CH4A 5CV7A 2NZOA 1A3UA 4BY7B 3G48A 1EWIA 3PMFA 4ZCKA 1WTRA 2EQSA 1TU2B 5FLMH 1IYVA 2EYOA 2HDLA 4P73A 1S5DD 3PO3H 3HOZG 1B9MA 3KUPA 3KBGA 4DR6Q 4KN4C 1SNQA 4DR3Q 1EZ8A 4CKEA 3HOVG 1CQVA 1ZYRC 3VYUA 1I4HA 3QWNA 4HJ8A 5LMNW 3BDOA 1RTOA 4DXGA 5EQ0A 2I0QA 3J81L 4X3KA 5CV4A 4K14A 3JAMi 3VYSA 2F3WA 2C35B 3LNNA 1GUTA 5J3BA 1B7YB 1A3TA 3K5NA 5JVH3 4OO1H 3HOXB 3UE1A 4A4IA 1AW7A 3VA5A 4KY7A 1Q8IA 2F4IA 4NPSA 4X3SA 3VYTA 2BDNA 3FMCA 1BUVT 5ELEA 5A2QL 1QOHA 5M3MH 4DAYB 2Q8TA 2K52A 4Z9CB 1YNJC 2Z6KA 2WV6D 2JA8H 2P5ZX 2PZWA 3CMAA 1JE4A 4PMBA 5M9OA 1HZCA 4DGZA 1PV4A 3M4OB 1S5ED 2OQKA 4KHPL 3R2TA 2M9VA 1SE4A 2GN5A 4PZ8A 1DCZA 2K01A 1X3QA 1LTSD 3Q8DA 3FKIH 2A69C 3QOJA 4LUOA 4KHPQ 2XTIA 3I4OA 2IW3A 4A3EH 2QDBA 3D4DA 4LUVA 4A3FH 2WFWA 4JI1L 1R4QB 5A35A 1NSNS 4C1NI 5FLMG 3W5OA 4WJ4A 5K36G 3MWYW 4HAEA 3PO3G 4KI0A 4NXNL 1GUNA 5G3LD 2ZTDA 1SNCA 1B3AA 2JEBI 1BBWA 2Q2HA 2WB1G 4JI1Q 4ZQ3A 1TWGB 4DPGA 2IX3A 3K7AB 5IYCH 2RA4A 1WTQA 3KF8B 5EGTA 4NXNQ 1EIFA 2FINB 5CBEE 3C1EA 1AP0A 3LGJA 2NN6I 3EJIA 1GOZA 3GTOH 2WINB 1B44D 5GQOA 5C44B 2R7ZH 1HH2P 1VQBA 2K6AA 1I5FA 4BY1B 1E7ZA 3SDZA 1Q46A 3TZDA 1GKHA 1C0AA 1LT6D 2E76C 3LWUA 2NZHA 4LJZC 4DR4Q 5JEAH 1GHJA 2PNRC 4R4QA 1I4GA 2E74C 1L0XB 3BDCA 2K33A 1H9KA 4N8FA 3A54A 4JOIA 2RF4A 3CD6A 1PZKD 3H94A 3ND9A 1IZ6A 1SYBA 1PRTD 4RAUC 2B63B 2R93B 1U4RA 5E4XA 4HN7A 3M4QA 5IT9L 4EVOA 4A3BB 1DJRD 2CQAA 1I4XA 3ZYYX 4IJHA 1A2TA 2JA8G 3MAQA 1NNXA 3H3VI 1B70B 3E9IA 3I90A 5IGCA 1AE2A 4DAPA 5M5YH 1Z9FA 2HDMA 2VQEL 2A74C 3NPPA 1K3RA 1ENAA 1ET9A 2ZM6L 1UEBA 2E75C 1ET6A 1GUOA 4DK1A 4KKSA 4KKTA 2L12A 1TS5A 3FKIG 1JICA 1BF4A 3RZDH 1LUZA 1LABA 2VQEQ 4A3EG 3KF8A 3PV0A 2ZM6Q 4A3FG 5J39A 1II3A 3UDIA 1C4QA 1SFOB 5EKLA 4MIUA 1X9NA 2G5DA 3K59A 3G71A 1CM9A 4K5WA 3GD7A 3R93A 2EYJA 2KA7A 4FF4A 2EDGA 3CU7A 1IHZA 4OEMB 3A74A 5IYCG 4YY3Q 1V43A 3I72A 2K75A 2HQEA 2F3VA 1T5EA 1IBKQ 1KAAA 4KHVA 2EYPA 2G9DA 5IP7H 4G4KA 2AUKA 2R7ZG 1SNDA 5M3FH 3DWPA 4TQUS 3R8BA 1F9PA 1YJWA 4IPGA 1EIYB 1FVIA 1S4ZA 2OT2A 4RHRA 5JEAG 1C8CA 3DM3A 2JN4A 2B2WC 4QMGA 4BBSH 5JJKA 2LXKA 1RL2A 1ZYRD 4JV5L 1LT3D 4MTKA 3ONAB 3V96A 2B2YA 2HD3A 3S2HB 1HUMA 1Z6HA 5ELNA 2X6LA 2NYZD 3PGZA 4RGTA 4HTHA 1Q7YC 2XRSD 1ILPA 2D2CC 5EPLA 4JV5Q 1QWYA 4IUTA 3F8TA 3HEJA 3KJPA 4DV4L 4Q5VA 1FD7D 1V1PA 5GAEC 3H0GB 4IOAA 1DONA 3L2PA 2A68C 4A3JH 3NTHA 2VQFQ 1CHPD 3GTPH 2QEXA 4TRDA 3HS0C 3NTKA 3QO2A 1KDAA 1PTOB 1CKNB 3BYTB 4RKLA 2B29A 2KQ3A 2F0HA 1VQ8A 5C4ZA 3KOJA 4DV4Q 5C0XH 1I3QH 1EU3A 1R9TB 2EE1A 1U5KA 2LKVA 3S24A 2CHBD 4KLKA 2PQEA 1HRJA 1GUSA 1YNJD 1CTMA 3UE0A 1F9QA 4I7ZC 4GOPB 1DOMA 2AKWB 4CKBA 4DR1L 2BA0A 3DEPA 5C4HA 1CA5A 1IBLL 3AFPA 3U50C 4DR2L 1I4QA 1IBML 5G3LF 3DWAA 1JE5A 1HNZL 2PO4A 3S1NB 2F0GA 5I4DA 4DR1Q 2ICIA 1AZPA 2A69D 4DAMA 4J1MA 1IBLQ 5C4JB 1VQ4A 3PF5A 1PZID 4DR2Q 3S15B 1STAA 1IBMQ 2PW5A 5IP7G 1HNZQ 5M3FG 2DY7A 4N8X1 2F0QA 1KAWA 2Z1CA 1EIGA 2KCNA 1R4PB 3AMUA 4WORA 1KRSA 3SR1A 1PA6A 1JB3A 4BBSG 4HCSA 1M4VA 3FP9A 4L8JA 4RCNA 3HKZG 1FNWA 1TR5A 2JA5H 2RCNA 3T1YL 3PUYA 3QR8A 4R8IA 1Y8PB 3NBIA 2F4VL 3WDNA 1GD7A 4H02A 2ZXRA 3DMUA 3B6YA 4V0BA 1PRTF 1H9SB 2XN9C 3PQIA 3TN2A 5C0XJ 2CW0C 2NVXB 3T1YQ 2HT1A 3A8JE 4GLAC 3C1FA 4A93H 1B53A 1EOTA 2JSOA 2F4VQ 1RKNA 2PQAA 4KHZA 4FO2A 3GO5A 4A3JG 3M7NA 1E24A 1TWCB 3NP8A 5IY0A 3J81c 1STHA 1WOCA 2KBNA 1S5CD 4FP5D 1NAPA 1L1OC 1XYIA 1MKHA 3ZJYC 1DOLA 3MFYA 3I3CA 4U68A 5C0XG 2DJGC 3PUZA 4LAAA 5C3WA 1XNRL 2RKSA 2RDHA 3KBXA 5I2YA 4ZYSA 4QIWB 3PO2H 3U4ZA 1CI3M 1SE8A 4YCUA 2R92H 2HUGA 3IKJA 3GTJH 1SAPA 1EWCA 1PYSB 1VQKA 1A8VA 1G291 4NB3A 1XNRQ 3QJYA 3TRZA 1X6OA 1I94L 4X6AH 1SYDA 4C3IB 4DV2L 3EROA 4FYDA 2MPMA 1V1QA 4KD3A 2B39A 3MC0B 3TS2A 4IUPA 1ASYA 3HFZB 1OXXK 3GTGH 3NTIA 1VQGA 2JK8A 1SROA 4XDXA 3QIAA 2QF7A 4L63B 4HIKA 1I94Q 4GKKL 3A5ZB 4DV2Q 4XIGS 4O0AA 1EYCA 1MI2A 1S5BD 2AMCB 1J6QA 3MHBA 1EOVA 2JP1A 3UDFA 4N9TA 1YIJA 3J80L 4C56C 1AFPA 3L7ZC 4GKKQ 1H9SA 2EJFC 3K81C 5GROA 5HGTA 4CBVA 3TP5A 2E2DC 2A1AA 1LACA 3CCLA 1F2YA 2JA5G 2BH2A 2ES2A 2EVBA 2EYHA 2NVTH 3CCSA 3K5OA 2SNSA 4X66L 2IX0A 1F9SA 5IP9G 3DUZA 1JOQA 1TKWB 4DV7L 3F2BA 4BBRB 3RZOB 4RHSA 4K2KA 4UP8A 4R1JA 1VQ6A 1VF7A 1STEA 5D3IB 4A93G 4DAVA 4DNIA 4EGVA 2KCCA 4LW1A 1EY0A 5DAUA 4X66Q 1HZAA 1ESFA 1B9NA 1G2TA 2A6EC 5ELCA 1QE6A 3UDGA 4G7HC 2UXDQ 4OWTB 1PVOA 4FF1A 3OSOA 1SYFA 4GZYC 1IL8A 4R8NA 2NVYH 5CV9A 5M5XH 1TWFB 5CYUA 3PO2G 3OIQA 3R3OA 1WTWA 4Y7NH 5KYIA 1AH9A 2EY5A 3BDLA 4LWCA 5D3DA 4KTAA 3HOZH 2EOTA 2DGYA 2A68D 3RLFA 2L4NA 2D9UA 1Y8OB 5C4XB 1YHQA 3I4MH 4CDEC 4HSPA 4B9XA 1K3BC 2MHVA 2MO0A 4QIWE 2VB3X 5IT9c 2JXMB 1CSPA 2EY6A 4DUZL 1YNXA 2QDLA 1OO9B 3G6JB 2LFNA 4L6TB 5DNFA 2PZUA 2AWNA 4MN3A 2Z8LA 2NTTA 4HMIA 3H91A 1X56A 3N6RA 4K6DA 3BVMA 1LTID 3PF4A 5IGEA 2Z6KC 4DUZQ 1TQOA 2LMCB 4IZ8A 4A3CH 4PQXA 3GTMB 3M4PA 3FPUB 1U4PA 1VQ5A 1HR0W 4DK0A 5KYLA 3RLNA 3DHQA 3HOWH 3H6MA 1MSGA 3OTOL 1JORA 4IUUA 5ELOA 1QILA 2A8VA 3K5MA 2K5VA 4ID6A 3S9WA 4YWLA 4L5SA 2AQ2B 4K2LA 2DN8A 3M4OH 1WFQA 2DNCA 4DR5L 1LT5D 4AYBG 2BCOA 3PUWA 1Y1VB 1X54A 1I6VC 1D5XC 3SVMA 3I56A 4H13C 4JBMA 2J0TD 2N78A 2E2JB 1GJXA 1HTPA 4DR5Q 1E2WA 1TWHB 4PMWA 5BN3A 4BY7G 3AU7A 1KLUD 1C9OA 4IFDH 4C2MH 5JPMC 5A2QE 3CCVA 3E5SA 3UDXA 4ABNA 3ITPA 1KQSA 2MP1A 2F0SA 3ERSX 4ZUJA 1J9OA 3MXNB 1YNNC 1VMCA 4BA1I 3K8AA 3K7AH 1WYDA 2CW0D 4CDCC 5IYDH 3MEFA 4TKOB 4M1UB 2IHEA 5K36H 4R4CA 4B08A 2F0LA 1K73C 3SK4A 2A73B 3O13A 4QGUA 2IX1A 3I4MG 1I50B 1D8LA 1VQHA 5HURA 3IFDA 4BY1H 3RUZA 2VL6A 4XYQA 3IAYA 4A3KB 4OXPA 4LK1C 3JAML 1U9RA 1PMRA 2UXCL 2ZJQA 3HRZC 1I6HB 4ZUIA 5FLXE 3A7AB 3WWVA 3G6EA 2B3GA 4F8MA 2B63H 1PH5A 3E3XA 2QCPX 1WCMB 2R93H 1O7YA 5I6WA 1VQ9A 1JQYD 4A3CG 4O1NA 1QCBD 3HOYB 4PV1C 3CKIB 4F88A 2UXCQ 4FXDA 3ULLA 1HUNA 2OXPA 1SYEA 1PFMA 3CQZH 3HOWG 4Y52H 1XPUA 2PNHA 3J7YW 1BCPC 2BDOA 2F1MA 2F0DA 4ZRZA 1CSQA 4R4TA 3CPWA 2F3IA 1JC7A 4IFDJ 3HOUB 3STBC 1CUKA 1H9RA 3KF6B 3HOVB 2D5DA 2K32A 2KEDA 2GVAA 1H95A 2YU9H 1TIID 3MXNA 1JJCB 1EY6A 3I73A 2NTSA 3W2DA 4KY5A 1VQFA 1EUJA 5IGDA 4ILWA 3V2TA 3BS1A 3J7A5 2KHIA 4YCWA 3DLLA 3GTQH 2CQOA 4FVMA 4IFDG 2B2VC 5DLQE 2NB0A 1XTCD 1KABA 3BVZA 5KNDA 2MUYA 1V9PA 5TSSA 5C3XA 2Q8IB 5IT9E 4KK7A 1KXLA 4A3DB 4ODGA 2E2IB 3IRBA 3LX0A 3SHLA 5J22A 1WD1A 3S17H 5IYDG 3TS0A 2RDGA 3E0EA 4IUVA 5DM63 4JYAL 1MSHA 1ILQA 3X3NA 2WACA 1D2BA 2ZTEA 1O7IA 5L37A 5KNBA 1XX8A 1FNUA 2MJ8A 2A6ED 4BY1G 1BKBA 1VQIA 1XMQL 1N32L 2B2YC 2L0CA 4PZ6A 4JYAQ 3P1HA 2A6HC 2DY8A 3A8KE 3RN2A 2IPKD 2JJQA 1M1KC 3VR2A 4XQQA 1NE3A 4DV3L 2OTLA 3S2HH 4ZK9B 2N88A 2B63G 2F0JA 2R93G 1XMQQ 1OXSC 1J5EL 3KF6A 1N32Q 3KDFB 3BU2A 4A3BG 2XRQD 1EEFD 2N8NA 2WAQG 4FXKC 5IWAL 3CC2A 1ZXTA 5T1IA 3V05A 1E1TA 4P2CB 4CGYB 1UE7A 2K4KA 1RODA 4BS9A 1J5EQ 3S2DH 1PTOH 2N3SA 1DM0B 5T1GA 1SJHD 5IWAQ 1GM5A 4A76A 1KDCA 2WB1B 3GTKB 1LYLA 2ZJPA 1SXTA 1UE1A 2EIFA 4DK3C 5FJ8H 2R61A 5EBCA 2MO1A 3BVGA 1W6JA 5FO7B 3F2UA 5H1SE 2ALYB 3HG9A 1QVCA 1K83B 5AFWA 1O7ZA 2OTJA 1P16A 2B8GA 2J4XA 2TSSA 2OCEA 3J80c 4DV0L 1G51A 3K5LA 1B4OA 3ER0A 4V190 4XQJA 3CF5A 4O2DA 1MD2D 1V1PB 1BQQT 1LT4D 1HCZA 1Y14B 5M3MB 3Q24A 1KTKA 1A6XA 2Z4HA 4DV0Q 2D62A 3TREA 3NQTA 4FDBA 4APVA 3I7FA 5ELDA 3KDFA 2JA6B 1ONLA 3M85A 1PFSA 5EKIA 2JA8B 4A3IB 1X55A 2BE5D 5JEAJ 1PTOC 1EY8A 5IOCA 2E5LL 1EIHA 4CJ2C 1YNND 2OQ0A 4MTNA 4GNXB 1PH7A 3NWTA 1OXVA 3CCJA 3WOEA 4CJ1B 3NWSA 3Q6SA 3BZKA 1EFWA 1VS0A 2E5LQ 2YTXA 1FL0A 1C48A 2AWOA 2NVQH 4S3SA 2NVXH 1G8ZD 3DWQA 4GOPC 4KJOA 1M90C 1QVFA 1S72A 3S1QH 4C3JB 1TT2A 1HJPA 1CT1D 3H0GG 2L9HA 4YIJA 2F03A 2F0NA 1JWUD 1XNQL 4LF8L 1F2MA 2TMPA 3QG1A 3TP8A 1Z47A 3CC7A 5GAGC 1A3VA 1S5FD 4XT1B 3M4YA 5IODA 3CCUA 4LF7L 2PYKA 2JQOA 4I65A 4GS3A 4A3GB 2GA4B 2F0TA 4KV6A 2BA1A 2ID0A 4QQBX 3I55A 1XNQQ 4RCOA 4LF8Q 1U4LA 4L5TA 4OONA 5FJ8G 1PLFA 1VQEA 4LF7Q 1JJGA 1L0WA 1SYCA 3GP7A 1PH3A 3GTOB 1BCPD 4A3LH 2WB1E 2L55A 4C3IH 1DYQA 3CXCA 3PSIA 4G57A 4F87A 4IPHA 2I46A 4X62L 1YHBA 3EVQA 1FNVA 4JG2A 4K5XA 1BBXC 1ICWA 3STBD 1HQMC 3MA2B 4XYOA 1STBA 3A55A 1SDFA 2PQAB 3AB9A 4OIKA 3A7LA 4R9WA 2PPBC 4X62Q 1EQTA 4GNXA 3KFUA 3NE5B 3MTSA 4XXEA 4K6LA 2XWBB 1N9WA 4P72A 4DKAC 4JI8L 3TP6A 3S1RH 1PHJA 3L9AX 2UUAL 1H9MA 3OWFA 4PMCA 2SOBA 4A3MB 4HR7B 4JI5L 1SMXA 5LHY1 2KEEA 1E22A 1ZEQX 5ISRA 1WTVA 2AUJD 4IO9A 5DM73 4JI8Q 4N9PA 2I5LX 1QZGA 4JCVE 1PH6A 2UUAQ 3C2PA 4J8QA 3U9SA 3S14B 1W3SA 2EYFA 3TMEA 4JI5Q 4BBRH 2K5HA 3RZOH 4JI7L 3RZDB 3I70A 1JWSD 1B50A 2YYZA 5E3FA 1EU4A 3F2CA 1WJJA 1QB5D 1EZ6A 1JWMD 4HIOA 4DU9A 4QB4A 3S1MH 4JI7Q 1PZJD 2A6HD 4DXFA 2ZXOA 5IP9H 2EJMA 1HA5A 1EWHA 5LMNL 2XWJB 1PDQA 3GQBA 1TWFH 2NUCA 1GVPA 2R7DA 4H0LC 2EYMA 3JAMc 4K8IA 4IJLA 4UP9A 1BNZA 5KNCA 1Q90A 2NN6H 5BN4A 4A3LG 4C3IG 5IGGA 4OWWB 1WTOA 5IIFA 5C4XH 3SEBA 2F0KA 2NBFA 2VZAA 4Q0FA 5D14A 1FYCA 1VQCA 3SE0A 1B8AA 3GTLB 3T1HL 1RDPD 3CCEA 3HKZB 3EBEA 4JI3L 2UUBL 4BXXH 2B2WA 2K50A 5COYA 1PXUA 5C3EB 1LLRD 3T53B 1DXMA 5JPNC 1EL0A 1JOOA 3T1HQ 1JT8A 4OO1I 3Q23A 4JI3Q 4DFAA 1RF2D 5FO9B
chains in the Genus database with same CATH topology
3S16B 3QOLA 1IYUA 3GTPB 3C3LA 4TSSA 3H09A 2H1EA 1TVXA 4IUQA 1I3QB 2O4XA 4FXGC 3C46A 1NUCA 5JJZA 4PNYA 2F0WA 2V4DA 1PTOD 4OGQC 2FJ2A 2K5DA 1MGSA 4WJWA 3SXHA 1Q1BA 1ESRA 3PIO3 4DN4M 4ZKCB 2PZTA 1Q12A 1H9JA 1LTAD 2K05A 1TY2A 1RTNA 4RWSC 4ZKBB 3OPOA 2EJGC 3CHBD 1E2ZA 2XSCA 4CKCA 2NN6G 3VR4A 1LTGD 5CMDA 1BCPF 3SK6A 2WKCA 3H3VC 1SMYC 1JOKA 2FMMA 2JA5B 2K28A 3HGBA 1STNA 3DXJC 3IL8A 2SNMA 3ND8A 5EJWA 5CR3A 2AQ1B 2X6GA 4XQNA 3M3YB 1EEID 5F2DA 1VDZA 1TWAB 3I91A 4H44C 1DZ1A 2Y0SB 3OIPA 1VMPA 3IFTA 1HXYD 2ICEC 4NW2A 1EYAA 1D1KA 1U4MA 2E2HB 2EY1A 2K1BA 3UI2A 3K6OA 3PO2B 1STGA 4RFBA 1KNEA 4HEDA 2R92B 4IN3A 2VUMB 4C3HG 4M8AA 3JAME 2PW7A 3FEWX 3J81E 3D4WA 4JK1C 1Y1WB 2JA7B 4NMZA 1AEXA 2HCCA 1ENFA 3VR5A 3D31A 2F0PA 2BOSA 3KLSA 5LL6X 5CBAE 1W6KA 2C9OA 1LO5D 4KY6A 3TBIB 2PMZB 4KN7C 1KLGD 4RGOS 2BE5C 1CK1A 4KMUC 1LTTD 1D1IA 3NBHA 3I4NB 5EPKA 4IURA 4MHEA 1IW7C 1Y8NB 4AYBB 1PRTB 1AN8A 4QUFA 4U673 4ULLA 4O42A 5DEHA 2XVSA 1CQFA 2DNEA 5CGKA 1SEBD 4F7XA 1TY0A 4H7BA 3Q0AA 3D4RA 5EPJA 1F2ZA 1MBYA 4JBWA 3BG3A 2KECA 5JAVA 2NVYB 5M5XB 3P20A 2L11A 5C6AA 2B2UA 4Y7NB 1WTPA 3MXPA 2B2TA 3HOZB 4EQPA 5I9OA 5C0XI 3NXWA 3TZUA 2QKIC 3I4MB 1PTOF 1CZWA 5CC4A 1GHKA 3VYRA 3TSSA 2ZXPA 1F9RA 1BXTA 2QILA 4K8JA 2NZ1D 2J7ZA 1RD9D 2KOLA 4X3TA 3QB3A 2AQ3B 3MXGA 2IJ0A 3W3AA 1O80A 5FOBB 1FGBD 1RF2D 3HOWB 3K0YA 1FR3A 1IKMA 2QEJC 1SNOA 1HA6A 1AZQA 3OW7A 2OF1A 1E0BA 4FNFA 1EQVA 3D3RA 1NR2A 1CHQD 1SBBB 2K7VA 1UAPA 3LWEA 2O5JC 5FLXL 1SMYD 2WP8J 1BDOA 4C2MB 2OEOA 5KRUA 1BCPB 3NQIA 4XTCS 4RGMA 1DD2A 4HMJA 2C5CA 4IALA 1X32A 5M5WB 3VR6A 3URYA 3OWEB 4HCEA 3DEOA 1ML0D 1RHPA 2RSNA 2B8FA 3PO3B 5EKKA 4DAYA 4BWGB 2RSOA 2VXWA 4OO1G 3HP3A 5CORA 1HHVA 2K5WA 3NUCA 2VB2X 1SE2A 3A8IE 2MGSA 1V8QA 3I8ZA 2K04A 3GV6A 5BN5A 4ZAIA 1GXDC 2WAQB 3CQZB 3T4AC 2EYLA 1UUPA 1EY5A 2H4OA 4E6IA 1HTLD 4B9WA 1J8IA 2A5HA 3FRPB 4IUNA 3CRKC 1WTXA 1A15A 1F77A 3OHXC 4QCLA 4KD4A 2WKDA 1Y69U 3PUVA 2RQXA 2YU9B 5KEEA 4WRDA 4C3JG 1QNKA 3GTQB 2LS01 1G6ZA 5JOBA 1STYA 5I2XA 1LTRD 1IW7D 1UNSA 3NK9A 3FVQA 1A2UA 3Q22A 2B2VA 1VF5C 3FKIB 5J1ZA 2F0VA 3EQLC 2IT1A 2HCIA 1XWEA 2EXZA 4A3EB 4RGNA 3S17B 2N55A 4A3FB 1SE3A 2G9HD 1OXUA 4X3UA 5KIXA 2FFKB 2M2LA 1PFNA 5FO8B 4NDXA 3WOFA 2VNUD 4NP5A 3CRLC 2O2LD 1PYWD 4DNTB 3MEHA 2R6GA 3EA6A 3A56A 2R7ZB 3BZDB 3KK7A 3MFGA 4CHTB 1EY9A 3FPPA 3VA7A 1TS3A 2F0EA 1HQRD 1SNPA 1T5XD 3S2DB 2JYOA 1SJED 1VCIA 1IKLA 1CA6A 5I6YA 2JEAI 3P75A 3P7JA 1QJOA 4UAIA 1BR9A 2M00A 5ELFA 5NUCA 5M5YB 1BO0A 4ZLTF 2SEBD 3OOCA 3E0JA 5CV5A 1ZKOA 4BA2I 1K8OA 4RA8A 1RCVD 1I4RA 5E1FA 3MXUA 1HPCA 3D6CA 2RDFA 5JVG3 4IFDI 4ME5A 1EYDA 3K58A 3NHHA 5CV8A 1KNAA 3KLRA 5I9PA 4IQZA 3J80E 2K03A 2F0UA 3TP7A 1XXGA 3ERQA 3U9OA 5K5PA 3DM1A 5ELBA 1Q3LA 1JCKB 3VR3A 1F2LA 3MVVA 3J7AF 2F0OA 3PIP3 5M3FB 2F0MA 2K5QA 1G91A 2F0IA 3D8GA 2NVQB 5E4WC 2XIWA 3S1QB 3MZ5A 4BBSB 2SDFA 3D6WA 1V1OA 3NSWA 4DF7A 2IWHA 2O5IC 3OMGA 4RH6A 1EY4A 5IGFA 4G7OC 2CVRA 4J6HA 1I4PA 1PFBA 2RBMA 1SSOA 1JR0D 2ZT9C 2KVMA 2XNAC 4RKBA 4A3JB 3TDQA 2I07B 2KUMA 3SK8A 5C5LA 3T16A 5LL6S 2EZVA 3RMHA 4CJ0B 4OHJA 2L5TA 2EPBA 5C5MA 2Z4IA 1RJTA 2PCFB 1O78A 1Z7TA 3K57A 1B2TA 1HFGA 1CFMA 2FHTA 1WVLA 1X3PA 1QG7A 3I4LA 1SYGA 2L1BA 2LY7A 4WFN3 3S1RB 1M8AA 1L0YB 5CV6A 4DNRB 1K8MA 1HFNA 1NCVA 1OXTA 4HSVA 1CZGA 2ENBA 3BYYB 5D65A 3GV3A 3OMCA 4C1NK 4EQOA 1EY7A 3E6ZX 1GUGA 4UDUC 1D5ZC 3S1MB 3X3MA 4K5VA 2KJXA 1BOSA 3RD4A 1B1ZA 2FMCA 2NWGA 2KHSA 3HZXA 4NKLA 4LMQD 2B2UC 4A93B 1WD0A 2Q8RE 2B2TC 4G7ZC 2JE6I 1UEAB 3J7AV 1SNMA 3R2IA 1Q1EA 1GUWA 1NR4A 2RVLA 1KDBA 1DOKA 3G7LA 3L3OC 1TS2A 5KGUA 4QUCA 2WIIB 1PRTC 3GTJB 3T56B 1E2VA 1EFID 4OIJA 1QNUA 4FF2A 3KLSX 3SK5A 3T51B 5FKAC 4DA2A 5EBDA 3GTGB 4QF4A 2X69A 2R3ZA 4OL7A 1LTBD 4KJNA 1D6EC 4EQNA 3EFXD 3PUXA 4XT3B 5FK9C 1TS4A 2IL8A 4FF3A 1O7LA 1G2SA 2F0FA 3T13A 5IGBA 2EY2A 4C3HB 1D5MC 4KKUA 2NVTB 1ENCA 3N52A 3M7GA 3FDTA 5CV7A 1A3UA 4BY7B 3PMFA 1WTRA 1TU2B 1IYVA 2EYOA 2HDLA 1S5DD 1B9MA 3KUPA 3KBGA 4KN4C 1SNQA 1EZ8A 4CKEA 1CQVA 1ZYRC 3VYUA 1I4HA 3QWNA 3BDOA 1RTOA 4DXGA 5EQ0A 3J81L 4X3KA 5CV4A 4K14A 3VYSA 2F3WA 3LNNA 1GUTA 1A3TA 3K5NA 5JVH3 4OO1H 3HOXB 1AW7A 3VA5A 4KY7A 1Q8IA 2F4IA 4X3SA 3VYTA 2BDNA 3FMCA 1BUVT 5ELEA 5A2QL 1QOHA 2Q8TA 4Z9CB 1YNJC 2WV6D 2PZWA 1JE4A 4PMBA 5M9OA 4DGZA 3M4OB 1S5ED 3R2TA 2M9VA 1SE4A 1DCZA 2K01A 1X3QA 1LTSD 2A69C 3QOJA 2IW3A 2QDBA 3D4DA 1R4QB 5A35A 1NSNS 4C1NI 5K36G 3MWYW 4HAEA 4KI0A 1GUNA 5G3LD 1SNCA 1B3AA 2JEBI 4ZQ3A 1TWGB 2IX3A 3K7AB 2RA4A 1WTQA 5EGTA 2FINB 5CBEE 3C1EA 1AP0A 2NN6I 3EJIA 1GOZA 2WINB 1B44D 5C44B 2K6AA 4BY1B 3SDZA 3TZDA 1LT6D 2E76C 3LWUA 4LJZC 5JEAH 1GHJA 2PNRC 1I4GA 2E74C 1L0XB 3BDCA 2K33A 1H9KA 3A54A 1PZKD 3H94A 3ND9A 1SYBA 1PRTD 4RAUC 2B63B 2R93B 1U4RA 5E4XA 4HN7A 5IT9L 4EVOA 4A3BB 1DJRD 2CQAA 1I4XA 3ZYYX 1A2TA 3MAQA 3I90A 5IGCA 4DAPA 2HDMA 2A74C 3NPPA 1ENAA 1ET9A 2E75C 1ET6A 1GUOA 4DK1A 4KKSA 4KKTA 2L12A 1TS5A 1JICA 1BF4A 1LABA 3KF8A 3PV0A 5J39A 1II3A 1C4QA 1SFOB 5EKLA 4MIUA 3K59A 1CM9A 4K5WA 3GD7A 3R93A 2EYJA 2KA7A 4FF4A 2EDGA 3CU7A 1IHZA 1V43A 3I72A 2HQEA 2F3VA 1T5EA 1KAAA 4KHVA 2EYPA 2G9DA 4G4KA 2AUKA 1SNDA 3DWPA 4TQUS 3R8BA 1F9PA 1S4ZA 2OT2A 4RHRA 5JEAG 1C8CA 2B2WC 4QMGA 1ZYRD 1LT3D 3ONAB 3V96A 2B2YA 3S2HB 1HUMA 1Z6HA 2X6LA 2NYZD 4RGTA 4HTHA 2XRSD 1ILPA 2D2CC 5EPLA 1QWYA 4IUTA 3HEJA 4Q5VA 1FD7D 1V1PA 3H0GB 1DONA 2A68C 3NTHA 1CHPD 4TRDA 3HS0C 3NTKA 3QO2A 1KDAA 1PTOB 3BYTB 4RKLA 2KQ3A 2F0HA 5C4ZA 5C0XH 1EU3A 1R9TB 2EE1A 2LKVA 2CHBD 2PQEA 1HRJA 1GUSA 1YNJD 1CTMA 1F9QA 4I7ZC 1DOMA 4CKBA 2BA0A 3DEPA 5C4HA 1CA5A 1I4QA 5G3LF 3DWAA 2PO4A 3S1NB 2F0GA 5I4DA 2ICIA 1AZPA 2A69D 4J1MA 5C4JB 1PZID 3S15B 1STAA 2PW5A 2DY7A 2F0QA 2KCNA 2Z1CA 1EIGA 1R4PB 3AMUA 4WORA 3SR1A 1JB3A 4HCSA 1M4VA 4L8JA 4RCNA 1FNWA 1TR5A 3PUYA 4R8IA 1Y8PB 3NBIA 3WDNA 2ZXRA 3DMUA 4V0BA 1PRTF 1H9SB 2XN9C 3TN2A 5C0XJ 2CW0C 2NVXB 3A8JE 3C1FA 1B53A 1EOTA 2JSOA 1RKNA 4KHZA 4FO2A 3GO5A 3M7NA 1TWCB 3NP8A 1STHA 1S5CD 4FP5D 1NAPA 1XYIA 1DOLA 3MFYA 3I3CA 4U68A 5C0XG 3PUZA 4LAAA 5C3WA 2RKSA 2RDHA 3KBXA 5I2YA 4ZYSA 4QIWB 1CI3M 2HUGA 3IKJA 1SAPA 1EWCA 1G291 3QJYA 1SYDA 4C3IB 3EROA 4FYDA 2MPMA 4KD3A 2B39A 3MC0B 4IUPA 1OXXK 3NTIA 4XDXA 3QIAA 2QF7A 4L63B 4XIGS 1EYCA 1MI2A 1S5BD 3MHBA 2JP1A 4N9TA 3J80L 4C56C 1AFPA 3L7ZC 1H9SA 2EJFC 5HGTA 4CBVA 3TP5A 2E2DC 1LACA 1F2YA 2EVBA 2EYHA 3K5OA 2SNSA 2IX0A 1F9SA 3DUZA 1JOQA 1TKWB 4BBRB 3RZOB 4RHSA 4K2KA 1VF7A 1STEA 5D3IB 4DAVA 4EGVA 2KCCA 1EY0A 5DAUA 1ESFA 1B9NA 1G2TA 2A6EC 5ELCA 1QE6A 4G7HC 4FF1A 3OSOA 1SYFA 4GZYC 1IL8A 4R8NA 5CV9A 1TWFB 5CYUA 3OIQA 3R3OA 1WTWA 5KYIA 2EY5A 3BDLA 5D3DA 4KTAA 2EOTA 2A68D 3RLFA 2L4NA 2D9UA 1Y8OB 5C4XB 4HSPA 4B9XA 2MHVA 2VB3X 2JXMB 2EY6A 1OO9B 3G6JB 2LFNA 4L6TB 5DNFA 2PZUA 2AWNA 4MN3A 2Z8LA 2NTTA 4HMIA 3H91A 3N6RA 4K6DA 3BVMA 1LTID 5IGEA 1TQOA 2LMCB 4IZ8A 4PQXA 3GTMB 3FPUB 1U4PA 4DK0A 5KYLA 3DHQA 3H6MA 1MSGA 1JORA 4IUUA 1QILA 3K5MA 4ID6A 3S9WA 2AQ2B 4K2LA 2DN8A 2DNCA 1LT5D 2BCOA 3PUWA 1Y1VB 1I6VC 1D5XC 3SVMA 4H13C 2J0TD 2E2JB 1GJXA 1HTPA 1E2WA 1TWHB 4PMWA 5BN3A 3AU7A 1KLUD 4IFDH 5JPMC 5A2QE 3E5SA 4ABNA 3ITPA 2MP1A 2F0SA 4ZUJA 1J9OA 1YNNC 1VMCA 4BA1I 2CW0D 4TKOB 4M1UB 5K36H 4B08A 2F0LA 3SK4A 2A73B 3O13A 2IX1A 1I50B 5HURA 3IFDA 3RUZA 4XYQA 3IAYA 4A3KB 4LK1C 3JAML 1U9RA 1PMRA 3HRZC 1I6HB 4ZUIA 5FLXE 3A7AB 4F8MA 2QCPX 1WCMB 1O7YA 5I6WA 1JQYD 4O1NA 1QCBD 3HOYB 4PV1C 3CKIB 4F88A 4FXDA 1HUNA 2OXPA 1SYEA 1PFMA 3J7YW 1BCPC 2BDOA 2F1MA 2F0DA 4ZRZA 1JC7A 4IFDJ 3HOUB 1H9RA 3HOVB 2D5DA 2K32A 2KEDA 1TIID 3MXNA 1EY6A 3I73A 2NTSA 3W2DA 4KY5A 5IGDA 4ILWA 3V2TA 3BS1A 4FVMA 4IFDG 2B2VC 2NB0A 1XTCD 1KABA 3BVZA 5KNDA 2MUYA 5TSSA 5C3XA 2Q8IB 5IT9E 4KK7A 4A3DB 4ODGA 2E2IB 3LX0A 3SHLA 5J22A 1WD1A 2RDGA 4IUVA 5DM63 1MSHA 1ILQA 3X3NA 2WACA 1D2BA 5KNBA 1XX8A 1FNUA 2MJ8A 2A6ED 2B2YC 2L0CA 3P1HA 2A6HC 2DY8A 3A8KE 2IPKD 3VR2A 4XQQA 4ZK9B 2N88A 2F0JA 1OXSC 2XRQD 1EEFD 4FXKC 1ZXTA 5T1IA 3V05A 4P2CB 4CGYB 1RODA 4BS9A 1PTOH 1DM0B 5T1GA 1SJHD 1KDCA 2WB1B 3GTKB 1SXTA 2R61A 5EBCA 3BVGA 1W6JA 5FO7B 3F2UA 3HG9A 1K83B 5AFWA 1O7ZA 2B8GA 2J4XA 2TSSA 3K5LA 1B4OA 4V190 4XQJA 1MD2D 1V1PB 1BQQT 1LT4D 1HCZA 5M3MB 3Q24A 1KTKA 1A6XA 2Z4HA 2D62A 3NQTA 5ELDA 2JA6B 1ONLA 3M85A 5EKIA 2JA8B 4A3IB 2BE5D 5JEAJ 1PTOC 1EY8A 5IOCA 1EIHA 4CJ2C 1YNND 3NWTA 1OXVA 3WOEA 4CJ1B 3NWSA 3Q6SA 1C48A 2AWOA 4S3SA 1G8ZD 3DWQA 4KJOA 4C3JB 1TT2A 1CT1D 2L9HA 4YIJA 2F03A 2F0NA 1JWUD 1F2MA 2TMPA 3QG1A 3TP8A 1Z47A 1A3VA 1S5FD 4XT1B 3M4YA 5IODA 2PYKA 4I65A 4A3GB 2GA4B 2F0TA 4KV6A 2BA1A 2ID0A 4RCOA 1U4LA 1PLFA 1SYCA 3GP7A 3GTOB 1BCPD 2L55A 1DYQA 4G57A 4F87A 2I46A 3EVQA 1FNVA 4K5XA 1BBXC 1ICWA 1HQMC 3MA2B 4XYOA 1STBA 3A55A 1SDFA 3AB9A 4OIKA 3A7LA 4R9WA 2PPBC 1EQTA 3NE5B 3MTSA 4XXEA 4K6LA 2XWBB 3TP6A 3L9AX 1H9MA 3OWFA 4PMCA 2SOBA 4A3MB 4HR7B 5LHY1 2KEEA 1ZEQX 5ISRA 1WTVA 2AUJD 5DM73 4N9PA 3C2PA 4J8QA 3U9SA 3S14B 2EYFA 3TMEA 3RZDB 3I70A 1JWSD 1B50A 2YYZA 5E3FA 1EU4A 1QB5D 1EZ6A 1JWMD 4DU9A 4QB4A 1PZJD 2A6HD 4DXFA 2ZXOA 2EJMA 1HA5A 1EWHA 2XWJB 1PDQA 3GQBA 2NUCA 4H0LC 2EYMA 4K8IA 1BNZA 5KNCA 1Q90A 2NN6H 5BN4A 4C3IG 5IGGA 1WTOA 5IIFA 3SEBA 2F0KA 2NBFA 4Q0FA 5D14A 1FYCA 3SE0A 3GTLB 1RDPD 3HKZB 2B2WA 5COYA 1PXUA 5C3EB 1LLRD 3T53B 1DXMA 5JPNC 1EL0A 1JOOA 4OO1I 3Q23A 4DFAA 1LV9A 5FO9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EKK A;  4NP5 A;  1EYA A;  2F0I A;  3D8G A;  5C6A A;  4K5V A;  1F2Y A;  3QOL A;  5CV7 A;  2F0Q A;  3MZ5 A;  3MXP A;  3MEH A;  1SNC A;  2EY1 A;  1A3U A;  1KAB A;  2EYH A;  2KHS A;  2HQE A;  3PMF A;  4WOR A;  2F3V A;  4EQP A;  3SR1 A;  2SNS A;  3NUC A;  5I9O A;  3HZX A;  1KAA A;  3NXW A;  4KHV A;  4NKL A;  2EYP A;  1STG A;  2EYO A;  4ZQ3 A;  3TP6 A;  4DF7 A;  5C3X A;  1JOQ A;  1EY9 A;  1TR5 A;  1SND A;  3OMG A;  5CC4 A;  5EGT A;  1SNQ A;  4ODG A;  2F0E A;  3C1E A;  3OWF A;  2SOB A;  2O4X A;  1SNM A;  1EZ8 A;  1SNP A;  3LX0 A;  4K2K A;  4PMC A;  1EY4 A;  3E5S A;  2PW7 A;  3NQT A;  3SHL A;  5J22 A;  3ITP A;  3D4W A;  3EJI A;  5ISR A;  1EY0 A;  3DMU A;  5DAU A;  5IGF A;  4K8J A;  2F0S A;  4QMG A;  4NMZ A;  4N9P A;  4J6H A;  4ZUJ A;  1AEX A;  2RBM A;  1NUC A;  1KDB A;  1EY8 A;  3QB3 A;  2EYF A;  5IOC A;  2EYL A;  4PNY A;  5I6Y A;  2WAC A;  3C1F A;  2F0P A;  2F0W A;  4RKB A;  3TME A;  5KGU A;  5CV4 A;  4K14 A;  1EY5 A;  1RKN A;  3P75 A;  3SK8 A;  4HTH A;  5C5L A;  4B9W A;  4E6I A;  3OSO A;  2F3W A;  3T16 A;  1SYF A;  2F0L A;  3NP8 A;  3SK4 A;  3SXH A;  4IUN A;  1A3T A;  3BDC A;  4R8N A;  1STH A;  5E3F A;  5CV9 A;  2M00 A;  4KY6 A;  3P1H A;  3R3O A;  5C5M A;  1EZ6 A;  3HEJ A;  2PZT A;  4QB4 A;  5NUC A;  4DU9 A;  1SYB A;  4KD4 A;  4S3S A;  3VA5 A;  5HUR A;  4KY7 A;  4KJO A;  3RUZ A;  4LAA A;  5KYI A;  5C3W A;  1TT2 A;  2EY5 A;  1SNO A;  3BDL A;  2RKS A;  3SK5 A;  4TRD A;  4EVO A;  5KEE A;  2F0J A;  4KTA A;  5CV5 A;  4WRD A;  1KDA A;  4YIJ A;  1A2T A;  4RKL A;  2F0N A;  1U9R A;  2OF1 A;  2KQ3 A;  2F0H A;  4B9X A;  5C4Z A;  1F2M A;  4QF4 A;  4ZUI A;  3TP8 A;  2NUC A;  5E1F A;  2EY6 A;  1A3V A;  5IGC A;  5JOB A;  5IOD A;  4F8M A;  1STY A;  1EQV A;  2EYM A;  2PYK A;  3SK6 A;  2LKV A;  2PZU A;  3D6C A;  2RDF A;  4I65 A;  1SYD A;  4K8I A;  4OL7 A;  5I6W A;  3NK9 A;  4ME5 A;  1SYG A;  2F0T A;  1A2U A;  2PQE A;  1JOK A;  4KJN A;  1ENA A;  1EYD A;  4HMI A;  3ERO A;  4KV6 A;  2PZW A;  5DEH A;  4EQN A;  4KD3 A;  3NHH A;  5IGG A;  2OXP A;  1SYE A;  2F0V A;  4PMB A;  5CV6 A;  5J1Z A;  4K6D A;  4DGZ A;  5IIF A;  5M9O A;  2OEO A;  5IGE A;  2F0K A;  5CV8 A;  5KRU A;  1TQO A;  1STN A;  2EXZ A;  1KDC A;  5CGK A;  5I9P A;  1SYC A;  2F0D A;  2F0F A;  2SNM A;  4IZ8 A;  4F7X A;  3T13 A;  5IGB A;  5C4H A;  4H7B A;  2EY2 A;  5CR3 A;  2F0U A;  4HMJ A;  3TP7 A;  4IAL A;  1II3 A;  5IGD A;  5J39 A;  3ERQ A;  1EYC A;  4G57 A;  5EKL A;  3U9O A;  4MIU A;  5KYL A;  2ENB A;  3V2T A;  3DHQ A;  1F2Z A;  3EVQ A;  3H6M A;  5KIX A;  3MHB A;  4K5X A;  1JOR A;  5F2D A;  5K5P A;  2F0G A;  3QOJ A;  3OMC A;  4ID6 A;  4K5W A;  4N9T A;  3S9W A;  4K2L A;  1JOO A;  1STB A;  4EQO A;  1ENC A;  2EYJ A;  2QDB A;  4J1M A;  1EY7 A;  1EY6 A;  3D4D A;  3MVV A;  2F0O A;  5HGT A;  5JAV A;  4KY5 A;  1NSN S;  4DFA A;  2F0M A;  1IHZ A;  3TP5 A;  1STA A;  4NDX A;  2PW5 A; 
#chains in the Genus database with same CATH topology
 4HID A;  2HIV A;  3S16 B;  3QOL A;  4R4I A;  1IYU A;  1PH9 A;  1Q81 C;  3GTP B;  2UXB L;  3C3L A;  4TSS A;  3H3V H;  3H09 A;  3PIO A;  4DUY L;  2D0P A;  2H1E A;  4DV6 L;  1TVX A;  4IUQ A;  1Y1V H;  1I3Q B;  2O4X A;  3RN5 A;  4FXG C;  3TQY A;  4BBR G;  2UXB Q;  1K28 A;  3C46 A;  1EQR A;  4DUY Q;  1TWH H;  4DV6 Q;  1NUC A;  4C3H H;  5JJZ A;  1JJ2 A;  4PNY A;  2F0W A;  2V4D A;  1PTO D;  4OGQ C;  1B3Q A;  1YZ6 A;  2FJ2 A;  2K5D A;  1MGS A;  4WJW A;  2ZJR A;  1VQD A;  3SXH A;  2PI2 A;  1Q1B A;  1ESR A;  3PIO 3;  3CCR A;  1NBW A;  4DN4 M;  4ZKC B;  1QVG A;  2PZT A;  4QJF A;  1Q12 A;  1XPR A;  2VS1 A;  1H9J A;  4UP7 A;  1LTA D;  2K05 A;  4BY7 H;  3HKS A;  1TY2 A;  1RTN A;  4RWS C;  4ZKB B;  3OPO A;  2EJG C;  1XPO A;  3CHB D;  1E2Z A;  2XSC A;  4DV7 Q;  3CCQ A;  4CKC A;  2NN6 G;  3VR4 A;  1LTG D;  2HIX A;  5CMD A;  1PH2 A;  5C4X G;  1BCP F;  1I50 H;  3SK6 A;  4X64 L;  1AE3 A;  2WKC A;  3H3V C;  1SMY C;  1N36 L;  1N34 L;  1JOK A;  1VQL A;  2FMM A;  4A3K H;  2JA5 B;  2K28 A;  4BXX G;  5IYB H;  4LFB L;  3HGB A;  1STN A;  3DXJ C;  4ALP A;  3IL8 A;  2SNM A;  4X64 Q;  2PI2 E;  4B3R L;  3ND8 A;  4LF4 L;  1N36 Q;  5EJW A;  1N34 Q;  5CR3 A;  2VW9 A;  1D7Q A;  2DJF C;  2AQ1 B;  2EXD A;  2X6G A;  3HOY H;  4XQN A;  2CCZ A;  1WTH A;  1EEI D;  3NBH B;  3HOX H;  3M3Y B;  3HKZ E;  5F2D A;  4LFB Q;  1VDZ A;  1P8L A;  1TWA B;  3I91 A;  4H44 C;  1DZ1 A;  4B3R Q;  2Y0S B;  4LF4 Q;  3OIP A;  3RLO A;  1VMP A;  3IFT A;  1HXY D;  2ICE C;  4NW2 A;  1EYA A;  1D1K A;  1A62 A;  3HOU H;  1Y1V G;  1U4M A;  2E2H B;  2EY1 A;  2XGT A;  1L1O A;  2K1B A;  3NEL A;  3UI2 A;  1NJI C;  3K6O A;  3PO2 B;  1STG A;  4RFB A;  1KNE A;  4HED A;  4RG1 A;  2R92 B;  4IN3 A;  2VUM B;  4K0K L;  4C3H G;  4M8A A;  1X3E A;  3JAM E;  2PW7 A;  3FEW X;  3J81 E;  3D4W A;  2AHO B;  4DV1 L;  4JK1 C;  2RCF A;  1Y1W B;  2JA7 B;  4NMZ A;  3CC4 A;  1KIX A;  3OTO Q;  1AEX A;  2HCC A;  1ENF A;  1HZB A;  2I5H A;  1HZ9 A;  3VR5 A;  3D31 A;  4K0K Q;  4J15 A;  2BH8 A;  2F0P A;  2BOS A;  4A3D H;  4DV1 Q;  2H5X A;  3KLS A;  5LL6 X;  5CBA E;  1KD1 C;  4OEL B;  1KC8 C;  2I5M X;  1PH4 A;  1W6K A;  5E7N A;  2C9O A;  1LO5 D;  4KY6 A;  3TBI B;  2PMZ B;  4KN7 C;  1KLG D;  1N33 L;  4RGO S;  1NY4 A;  2BE5 C;  1CK1 A;  1NMF A;  4KMU C;  3CP0 A;  1LTT D;  1D1I A;  3NBH A;  3KJO A;  1VQO A;  4MZ9 A;  1TWG H;  3I4N B;  5EPK A;  4A3K G;  1VQP A;  4IUR A;  4MHE A;  1IW7 C;  3RNU A;  1N33 Q;  5IYB G;  1Y8N B;  3NEM A;  4X65 L;  3KLW A;  4AYB B;  1PRT B;  1AN8 A;  1YHA A;  1EQQ A;  5GAD C;  4QUF A;  1WCM G;  5C44 H;  1KL9 A;  4ULL A;  4U67 3;  4O42 A;  5DEH A;  1K9M C;  4YWK A;  3HOY G;  2XVS A;  1SLJ A;  4GLX A;  4I7A A;  3HOX G;  1CQF A;  2DNE A;  5CGK A;  1SEB D;  4JOI C;  4F7X A;  4AQY L;  4YWM A;  4X65 Q;  1TY0 A;  4H7B A;  3Q0A A;  2D0O A;  3D4R A;  5EPJ A;  4L5R C;  1F2Z A;  3HOU G;  1MBY A;  4JBW A;  3BG3 A;  4AQY Q;  2KEC A;  4A3B H;  5JAV A;  3GTK H;  2NVY B;  5M5X B;  2Y0S E;  3P20 A;  1YBY A;  4POF A;  2L11 A;  4POG A;  5C6A A;  2VY3 A;  5HGQ A;  5GAH C;  2B2U A;  4Y7N B;  1WTP A;  3MXP A;  4GLV B;  1A63 A;  2B2T A;  1K83 H;  3HOZ B;  4EQP A;  4JPB W;  5I9O A;  5C0X I;  1JMC A;  3NXW A;  3J81 i;  3TZU A;  1MHW C;  2QKI C;  1XTD A;  1T9H A;  3I4M B;  1PTO F;  1CZW A;  4CDD C;  5CC4 A;  2F52 A;  1GHK A;  3VYR A;  1MJC A;  3TSS A;  3OW2 A;  2ZXP A;  4A3D G;  1F9R A;  1BXT A;  2QIL A;  2K5N A;  4K8J A;  2NZ1 D;  2Q2I A;  1SFO H;  2J7Z A;  1RD9 D;  2KOL A;  4X3T A;  4EX5 A;  1CKO A;  3QB3 A;  2AQ3 B;  3MXG A;  3CCM A;  2UU9 L;  2MFI A;  2IJ0 A;  3W3A A;  2CWA A;  1O80 A;  2JA6 H;  5FOB B;  1FGB D;  3HOW B;  2FXQ A;  3RR5 A;  4A3I H;  2RHQ B;  3K0Y A;  1FR3 A;  1IKM A;  1S40 A;  2QEJ C;  2UU9 Q;  3E9H A;  2PMZ E;  1SNO A;  3SGI A;  3ULJ A;  1HA6 A;  1AZQ A;  3OW7 A;  2OF1 A;  5C44 G;  1RIP A;  3AFQ A;  1K8G A;  2JA9 A;  1E0B A;  1WI5 A;  4UY8 C;  4FNF A;  1EQV A;  4IPC A;  3F1Z A;  4WJ3 M;  3D3R A;  1NR2 A;  4NXM L;  1CHQ D;  4C3J H;  2E8G A;  1SBB B;  2K7V A;  1UAP A;  3LWE A;  2O5J C;  5FLX L;  1SMY D;  4AYB E;  2WP8 J;  1BDO A;  4C2M B;  1UWV A;  2OEO A;  5IE8 A;  5KRU A;  4HJA A;  1BCP B;  3NQI A;  2Q2U A;  1IYJ B;  4XTC S;  4RGM A;  4NXM Q;  1S3O A;  1DD2 A;  4A3G H;  4HMJ A;  2C5C A;  3K80 C;  4IAL A;  1X32 A;  3NEN A;  5M5W B;  1Q86 C;  3VR6 A;  2LSS A;  4LNQ A;  3URY A;  3OWE B;  4HCE A;  1FJG L;  3DEO A;  4DV3 Q;  1ML0 D;  1RHP A;  3H0G H;  1NMG A;  2RSN A;  4DR4 L;  2B8F A;  3PO3 B;  5EKK A;  4DAY A;  1G6P A;  1FGU A;  4BWG B;  2RSO A;  2VXW A;  1FJG Q;  4ME3 A;  1K0S A;  4OO1 G;  2Z6B A;  3HP3 A;  1R9T H;  5COR A;  4LF5 L;  1HHV A;  2K5W A;  4PG3 A;  3NUC A;  4GNX C;  2DUD A;  2VB2 X;  1HNX L;  1BVS A;  5M3M G;  1SE2 A;  3A8I E;  2UUC L;  1Q8K A;  2MGS A;  3EN2 A;  3CME A;  1V8Q A;  4HJ5 A;  4P74 A;  3I8Z A;  4LF5 Q;  2K04 A;  3GV6 A;  5BN5 A;  3ICE A;  2JA6 G;  4ZAI A;  1GXD C;  2WAQ B;  1HNX Q;  4AIM A;  3CQZ B;  3T4A C;  2EYL A;  4A3I G;  1UUP A;  3S1N H;  2UUC Q;  4PZ7 A;  4YHH L;  1EY5 A;  2H4O A;  4E6I A;  1HTL D;  2YTY A;  4A3M H;  4B9W A;  1DGS A;  1J8I A;  5C4J H;  2A5H A;  3FRP B;  4IUN A;  3CRK C;  1WTX A;  1A15 A;  3S15 H;  3CW2 C;  1F77 A;  3OHX C;  4QCL A;  4KD4 A;  1C7Y A;  2WKD A;  1Y69 U;  3S14 H;  4YHH Q;  3PUV A;  4UHV A;  1HNW L;  2RQX A;  2YU9 B;  5KEE A;  4WRD A;  4C3J G;  4LFA L;  1QNK A;  3F2D A;  3GTQ B;  2LS0 1;  1SN8 A;  1G6Z A;  5JOB A;  3U4V A;  4HJ9 A;  1STY A;  4GN4 B;  1LTR D;  3A0J A;  3CPF A;  5I2X A;  4YY3 L;  1HNW Q;  1IW7 D;  4HIM A;  1UNS A;  4JVZ A;  3NK9 A;  3FVQ A;  1A2U A;  3Q22 A;  2B2V A;  2HHH L;  1VQM A;  4LFA Q;  1NTG A;  4A3G G;  1IBK L;  1VF5 C;  3FKI B;  5J1Z A;  2F0V A;  2Z0S A;  2IT1 A;  3EQL C;  2HCI A;  4MNO A;  1XWE A;  2EXZ A;  2QGQ A;  4A3E B;  4RGN A;  3S17 B;  2N55 A;  4A3F B;  1SE3 A;  4R4O A;  2G9H D;  1TWC H;  2HHH Q;  1OXU A;  3JC6 6;  4X3U A;  5KIX A;  1YEZ A;  2FFK B;  4JI4 L;  2M2L A;  1PFN A;  4HJ7 A;  4YCV A;  3GTL H;  4DR7 L;  1KRT A;  5FO8 B;  1X3G A;  4NDX A;  3WOF A;  2CKZ B;  2VNU D;  3AEV A;  4NP5 A;  3A5U A;  3CRL C;  2O2L D;  4IPD A;  3BZC A;  1PYW D;  2MNA A;  4DNT B;  3MEH A;  4JI4 Q;  2R6G A;  5C3E H;  4LF6 L;  3PCO B;  3EA6 A;  3A56 A;  2R7Z B;  4DR7 Q;  2VQF L;  3BZD B;  3KK7 A;  3MFG A;  4CHT B;  1EY9 A;  3FPP A;  1YIT A;  2R7F A;  1HR0 L;  4JI6 L;  3VA7 A;  1TS3 A;  2F0E A;  1HQR D;  1SNP A;  4LF6 Q;  4LF9 L;  1T5X D;  3S16 H;  5JJL A;  3TEH B;  2YTV A;  4A3M G;  3S2D B;  2JYO A;  1SJE D;  1VCI A;  1HR0 Q;  4CDF C;  4JI6 Q;  1IKL A;  4AH6 A;  2QA4 A;  1CA6 A;  5I6Y A;  2JEA I;  4LF9 Q;  2WAQ E;  3P75 A;  3P7J A;  1QJO A;  4JBJ A;  4EQ5 A;  4UAI A;  1BR9 A;  2M00 A;  5ELF A;  5NUC A;  5M5Y B;  1U0L A;  1BO0 A;  3J7Z C;  4ZLT F;  2SEB D;  3OOC A;  3E0J A;  5HY6 A;  5CV5 A;  2ZTC A;  1ZKO A;  4BA2 I;  1K8O A;  4RA8 A;  4RMF A;  2QW7 A;  4UPA A;  1RCV D;  4JC0 A;  1I4R A;  5E1F A;  2KHJ A;  3MXU A;  1CKM A;  1HPC A;  3PIP A;  3D6C A;  2RDF A;  5JVG 3;  4IFD I;  4ME5 A;  5LMU L;  1EYD A;  3K58 A;  1Q82 C;  3NHH A;  4JBK A;  5CV8 A;  1KNA A;  3KLR A;  5I9P A;  4IQZ A;  5LMU Q;  3J80 E;  2K03 A;  2F0U A;  3TP7 A;  1XXG A;  3J81 j;  3ERQ A;  3U9O A;  5K5P A;  1X3F A;  3DM1 A;  5ELB A;  1Q3L A;  1JCK B;  5C3E G;  3VR3 A;  1CKN A;  1F2L A;  3MVV A;  5LMN Q;  1ICF B;  2F0O A;  4DK6 C;  3J7A F;  3PIP 3;  3EIV A;  2GVB A;  2F0M A;  2K5Q A;  5M3F B;  1G91 A;  4LFC L;  2F0I A;  3D8G A;  2NVQ B;  5E4W C;  3M3Y H;  2XIW A;  3S1Q B;  1IXR A;  3MZ5 A;  1E1O A;  1L2F A;  4BBS B;  2SDF A;  3D6W A;  1TWA H;  1V1O A;  3NSW A;  1MJE A;  4LUZ A;  4DF7 A;  4GOP A;  2IWH A;  2O5I C;  3OMG A;  4LFC Q;  1PH8 A;  3GDE A;  4RH6 A;  1VQA A;  1EY4 A;  1XMO L;  1K0R A;  2E2H H;  2CH4 W;  3D0F A;  5IGF A;  3GTM H;  1PH1 A;  4G7O C;  2CVR A;  3VDY A;  4J6H A;  1I4P A;  1PFB A;  2RBM A;  1SSO A;  4DV5 L;  1JR0 D;  2ZT9 C;  1K8A C;  2KVM A;  2XNA C;  4RKB A;  4A3J B;  2VUM H;  3TDQ A;  2I07 B;  2KCM A;  4L5Q A;  2KUM A;  4P75 A;  3SK8 A;  1XMO Q;  5C5L A;  3BJU A;  3T16 A;  5LL6 S;  2CFM A;  2EZV A;  1JB7 A;  3RMH A;  1SRU A;  4CJ0 B;  1Y1W H;  4OHJ A;  1LV9 A;  2L5T A;  3W1B A;  2EPB A;  2JA7 H;  4DV5 Q;  5C5M A;  2Z4I A;  1RJT A;  1QUQ B;  2PCF B;  1O78 A;  1Z7T A;  2E2J H;  3K57 A;  1B2T A;  1HFG A;  1CFM A;  5JJI A;  3KYH C;  2FHT A;  1WVL A;  1A0I A;  1X3P A;  3W1G A;  1VQN A;  1LM0 A;  1UE6 A;  1QG7 A;  3H15 A;  3I4L A;  3L0O A;  1SYG A;  1L1O B;  2L1B A;  2LY7 A;  4WFN 3;  1YJN A;  3S1R B;  1M8A A;  1L0Y B;  3J80 i;  5CV6 A;  4DNR B;  1K8M A;  4JI0 L;  3K7U C;  3I4N H;  1HFN A;  2HQL A;  2IHF A;  4B3T L;  1KHI A;  2Z9H A;  1NCV A;  2ASB A;  1OXT A;  5FLX c;  2CWP A;  2MQH A;  1E3P A;  4HSV A;  1CZG A;  2ENB A;  4JI0 Q;  4GN5 A;  3BYY B;  5D65 A;  3GV3 A;  4B3T Q;  5AJ3 L;  3OMC A;  2UUB Q;  3OYY A;  5BR8 L;  4P71 A;  4C1N K;  4EQO A;  2UXD L;  1EY7 A;  2Q2T A;  1YI2 A;  3E6Z X;  3K0X A;  2Y0S G;  1GUG A;  1GO3 E;  4UDU C;  1D5Z C;  3S1M B;  3X3M A;  4K5V A;  5AJ3 Q;  1I6H H;  2KJX A;  1BOS A;  3RD4 A;  1B1Z A;  2KCT A;  5BR8 Q;  2FMC A;  2NWG A;  2KHS A;  1WCM H;  1VQ7 A;  3HZX A;  4NKL A;  4LMQ D;  2B2U C;  1VQJ A;  5EAY A;  1QUQ A;  4A93 B;  1WD0 A;  2Q8R E;  2B2T C;  4G7Z C;  2JE6 I;  1UEA B;  2OWO A;  3J7A V;  1SNM A;  3R2I A;  2R92 G;  1YVC A;  2LXJ A;  1Q1E A;  2VUM G;  1GUW A;  1NR4 A;  3FHW A;  2RHS B;  2RVL A;  1Y1W G;  4QL5 A;  2KEN A;  2JA7 G;  1KDB A;  3AYH B;  1DOK A;  3G7L A;  3L3O C;  3I2Z A;  1TS2 A;  5KGU A;  3HOV H;  1ASZ A;  1XJV A;  4OX9 L;  3AQQ A;  1LTL A;  1TXY A;  3G4S A;  4B3S L;  2N49 A;  4QUC A;  2WII B;  1PRT C;  1UE5 A;  4IOC A;  3GTJ B;  1QZH A;  3T56 B;  1E2V A;  3CAM A;  2ATW A;  1EFI D;  4OIJ A;  1QNU A;  1SR3 A;  4FF2 A;  3KLS X;  4OWX B;  4OX9 Q;  3SK5 A;  3T51 B;  2YV5 A;  4B3S Q;  5FKA C;  4DA2 A;  4GKJ L;  5EBD A;  1IL2 A;  3GTG B;  4QF4 A;  4JI2 L;  1OTC A;  1PYB A;  2E2I H;  4GN3 B;  3I4N G;  2X69 A;  3ULP A;  3M9B A;  2L15 A;  2R3Z A;  4JW0 A;  4OL7 A;  4GKJ Q;  4TVA B;  1LTB D;  4KJN A;  1D6E C;  2A19 A;  4A75 A;  4QY7 A;  3EFX D;  3PUX A;  4XT3 B;  4EQN A;  1N8R C;  1YJ9 A;  5FK9 C;  4JI2 Q;  1TS4 A;  2IL8 A;  4FF3 A;  1BBU A;  1O7L A;  1G2S A;  2F0F A;  3U58 A;  3T13 A;  5IGB A;  1X65 A;  2EY2 A;  1EYG A;  4B3M L;  4C3H B;  1D5M C;  2K14 A;  4KKU A;  2NVT B;  1ENC A;  3N52 A;  4B3M Q;  2V1C C;  1W2B A;  3M7G A;  5M5W H;  4DR6 L;  3FDT A;  4DR3 L;  2IY5 B;  1MIU A;  2CH4 A;  5CV7 A;  2NZO A;  1A3U A;  4BY7 B;  3G48 A;  1EWI A;  3PMF A;  4ZCK A;  1WTR A;  2EQS A;  1TU2 B;  5FLM H;  1IYV A;  2EYO A;  2HDL A;  4P73 A;  1S5D D;  3PO3 H;  3HOZ G;  1B9M A;  3KUP A;  3KBG A;  4DR6 Q;  4KN4 C;  1SNQ A;  4DR3 Q;  1EZ8 A;  4CKE A;  3HOV G;  1CQV A;  1ZYR C;  3VYU A;  1I4H A;  3QWN A;  4HJ8 A;  5LMN W;  3BDO A;  1RTO A;  4DXG A;  5EQ0 A;  2I0Q A;  3J81 L;  4X3K A;  5CV4 A;  4K14 A;  3JAM i;  3VYS A;  2F3W A;  2C35 B;  3LNN A;  1GUT A;  5J3B A;  1B7Y B;  1A3T A;  3K5N A;  5JVH 3;  4OO1 H;  3HOX B;  3UE1 A;  4A4I A;  1AW7 A;  3VA5 A;  4KY7 A;  1Q8I A;  2F4I A;  4NPS A;  4X3S A;  3VYT A;  2BDN A;  3FMC A;  1BUV T;  5ELE A;  5A2Q L;  1QOH A;  5M3M H;  4DAY B;  2Q8T A;  2K52 A;  4Z9C B;  1YNJ C;  2Z6K A;  2WV6 D;  2JA8 H;  2P5Z X;  2PZW A;  3CMA A;  1JE4 A;  4PMB A;  5M9O A;  1HZC A;  4DGZ A;  1PV4 A;  3M4O B;  1S5E D;  2OQK A;  4KHP L;  3R2T A;  2M9V A;  1SE4 A;  2GN5 A;  4PZ8 A;  1DCZ A;  2K01 A;  1X3Q A;  1LTS D;  3Q8D A;  3FKI H;  2A69 C;  3QOJ A;  4LUO A;  4KHP Q;  2XTI A;  3I4O A;  2IW3 A;  4A3E H;  2QDB A;  3D4D A;  4LUV A;  4A3F H;  2WFW A;  4JI1 L;  1R4Q B;  5A35 A;  1NSN S;  4C1N I;  5FLM G;  3W5O A;  4WJ4 A;  5K36 G;  3MWY W;  4HAE A;  3PO3 G;  4KI0 A;  4NXN L;  1GUN A;  5G3L D;  2ZTD A;  1SNC A;  1B3A A;  2JEB I;  1BBW A;  2Q2H A;  2WB1 G;  4JI1 Q;  4ZQ3 A;  1TWG B;  4DPG A;  2IX3 A;  3K7A B;  5IYC H;  2RA4 A;  1WTQ A;  3KF8 B;  5EGT A;  4NXN Q;  1EIF A;  2FIN B;  5CBE E;  3C1E A;  1AP0 A;  3LGJ A;  2NN6 I;  3EJI A;  1GOZ A;  3GTO H;  2WIN B;  1B44 D;  5GQO A;  5C44 B;  2R7Z H;  1HH2 P;  1VQB A;  2K6A A;  1I5F A;  4BY1 B;  1E7Z A;  3SDZ A;  1Q46 A;  3TZD A;  1GKH A;  1C0A A;  1LT6 D;  2E76 C;  3LWU A;  2NZH A;  4LJZ C;  4DR4 Q;  5JEA H;  1GHJ A;  2PNR C;  4R4Q A;  1I4G A;  2E74 C;  1L0X B;  3BDC A;  2K33 A;  1H9K A;  4N8F A;  3A54 A;  4JOI A;  2RF4 A;  3CD6 A;  1PZK D;  3H94 A;  3ND9 A;  1IZ6 A;  1SYB A;  1PRT D;  4RAU C;  2B63 B;  2R93 B;  1U4R A;  5E4X A;  4HN7 A;  3M4Q A;  5IT9 L;  4EVO A;  4A3B B;  1DJR D;  2CQA A;  1I4X A;  3ZYY X;  4IJH A;  1A2T A;  2JA8 G;  3MAQ A;  1NNX A;  3H3V I;  1B70 B;  3E9I A;  3I90 A;  5IGC A;  1AE2 A;  4DAP A;  5M5Y H;  1Z9F A;  2HDM A;  2VQE L;  2A74 C;  3NPP A;  1K3R A;  1ENA A;  1ET9 A;  2ZM6 L;  1UEB A;  2E75 C;  1ET6 A;  1GUO A;  4DK1 A;  4KKS A;  4KKT A;  2L12 A;  1TS5 A;  3FKI G;  1JIC A;  1BF4 A;  3RZD H;  1LUZ A;  1LAB A;  2VQE Q;  4A3E G;  3KF8 A;  3PV0 A;  2ZM6 Q;  4A3F G;  5J39 A;  1II3 A;  3UDI A;  1C4Q A;  1SFO B;  5EKL A;  4MIU A;  1X9N A;  2G5D A;  3K59 A;  3G71 A;  1CM9 A;  4K5W A;  3GD7 A;  3R93 A;  2EYJ A;  2KA7 A;  4FF4 A;  2EDG A;  3CU7 A;  1IHZ A;  4OEM B;  3A74 A;  5IYC G;  4YY3 Q;  1V43 A;  3I72 A;  2K75 A;  2HQE A;  2F3V A;  1T5E A;  1IBK Q;  1KAA A;  4KHV A;  2EYP A;  2G9D A;  5IP7 H;  4G4K A;  2AUK A;  2R7Z G;  1SND A;  5M3F H;  3DWP A;  4TQU S;  3R8B A;  1F9P A;  1YJW A;  4IPG A;  1EIY B;  1FVI A;  1S4Z A;  2OT2 A;  4RHR A;  5JEA G;  1C8C A;  3DM3 A;  2JN4 A;  2B2W C;  4QMG A;  4BBS H;  5JJK A;  2LXK A;  1RL2 A;  1ZYR D;  4JV5 L;  1LT3 D;  4MTK A;  3ONA B;  3V96 A;  2B2Y A;  2HD3 A;  3S2H B;  1HUM A;  1Z6H A;  5ELN A;  2X6L A;  2NYZ D;  3PGZ A;  4RGT A;  4HTH A;  1Q7Y C;  2XRS D;  1ILP A;  2D2C C;  5EPL A;  4JV5 Q;  1QWY A;  4IUT A;  3F8T A;  3HEJ A;  3KJP A;  4DV4 L;  4Q5V A;  1FD7 D;  1V1P A;  5GAE C;  3H0G B;  4IOA A;  1DON A;  3L2P A;  2A68 C;  4A3J H;  3NTH A;  2VQF Q;  1CHP D;  3GTP H;  2QEX A;  4TRD A;  3HS0 C;  3NTK A;  3QO2 A;  1KDA A;  1PTO B;  1CKN B;  3BYT B;  4RKL A;  2B29 A;  2KQ3 A;  2F0H A;  1VQ8 A;  5C4Z A;  3KOJ A;  4DV4 Q;  5C0X H;  1I3Q H;  1EU3 A;  1R9T B;  2EE1 A;  1U5K A;  2LKV A;  3S24 A;  2CHB D;  4KLK A;  2PQE A;  1HRJ A;  1GUS A;  1YNJ D;  1CTM A;  3UE0 A;  1F9Q A;  4I7Z C;  4GOP B;  1DOM A;  2AKW B;  4CKB A;  4DR1 L;  2BA0 A;  3DEP A;  5C4H A;  1CA5 A;  1IBL L;  3AFP A;  3U50 C;  4DR2 L;  1I4Q A;  1IBM L;  5G3L F;  3DWA A;  1JE5 A;  1HNZ L;  2PO4 A;  3S1N B;  2F0G A;  5I4D A;  4DR1 Q;  2ICI A;  1AZP A;  2A69 D;  4DAM A;  4J1M A;  1IBL Q;  5C4J B;  1VQ4 A;  3PF5 A;  1PZI D;  4DR2 Q;  3S15 B;  1STA A;  1IBM Q;  2PW5 A;  5IP7 G;  1HNZ Q;  5M3F G;  2DY7 A;  4N8X 1;  2F0Q A;  1KAW A;  2Z1C A;  1EIG A;  2KCN A;  1R4P B;  3AMU A;  4WOR A;  1KRS A;  3SR1 A;  1PA6 A;  1JB3 A;  4BBS G;  4HCS A;  1M4V A;  3FP9 A;  4L8J A;  4RCN A;  3HKZ G;  1FNW A;  1TR5 A;  2JA5 H;  2RCN A;  3T1Y L;  3PUY A;  3QR8 A;  4R8I A;  1Y8P B;  3NBI A;  2F4V L;  3WDN A;  1GD7 A;  4H02 A;  2ZXR A;  3DMU A;  3B6Y A;  4V0B A;  1PRT F;  1H9S B;  2XN9 C;  3PQI A;  3TN2 A;  5C0X J;  2CW0 C;  2NVX B;  3T1Y Q;  2HT1 A;  3A8J E;  4GLA C;  3C1F A;  4A93 H;  1B53 A;  1EOT A;  2JSO A;  2F4V Q;  1RKN A;  2PQA A;  4KHZ A;  4FO2 A;  3GO5 A;  4A3J G;  3M7N A;  1E24 A;  1TWC B;  3NP8 A;  5IY0 A;  3J81 c;  1STH A;  1WOC A;  2KBN A;  1S5C D;  4FP5 D;  1NAP A;  1L1O C;  1XYI A;  1MKH A;  3ZJY C;  1DOL A;  3MFY A;  3I3C A;  4U68 A;  5C0X G;  2DJG C;  3PUZ A;  4LAA A;  5C3W A;  1XNR L;  2RKS A;  2RDH A;  3KBX A;  5I2Y A;  4ZYS A;  4QIW B;  3PO2 H;  3U4Z A;  1CI3 M;  1SE8 A;  4YCU A;  2R92 H;  2HUG A;  3IKJ A;  3GTJ H;  1SAP A;  1EWC A;  1PYS B;  1VQK A;  1A8V A;  1G29 1;  4NB3 A;  1XNR Q;  3QJY A;  3TRZ A;  1X6O A;  1I94 L;  4X6A H;  1SYD A;  4C3I B;  4DV2 L;  3ERO A;  4FYD A;  2MPM A;  1V1Q A;  4KD3 A;  2B39 A;  3MC0 B;  3TS2 A;  4IUP A;  1ASY A;  3HFZ B;  1OXX K;  3GTG H;  3NTI A;  1VQG A;  2JK8 A;  1SRO A;  4XDX A;  3QIA A;  2QF7 A;  4L63 B;  4HIK A;  1I94 Q;  4GKK L;  3A5Z B;  4DV2 Q;  4XIG S;  4O0A A;  1EYC A;  1MI2 A;  1S5B D;  2AMC B;  1J6Q A;  3MHB A;  1EOV A;  2JP1 A;  3UDF A;  4N9T A;  1YIJ A;  3J80 L;  4C56 C;  1AFP A;  3L7Z C;  4GKK Q;  1H9S A;  2EJF C;  3K81 C;  5GRO A;  5HGT A;  4CBV A;  3TP5 A;  2E2D C;  2A1A A;  1LAC A;  3CCL A;  1F2Y A;  2JA5 G;  2BH2 A;  2ES2 A;  2EVB A;  2EYH A;  2NVT H;  3CCS A;  3K5O A;  2SNS A;  4X66 L;  2IX0 A;  1F9S A;  5IP9 G;  3DUZ A;  1JOQ A;  1TKW B;  4DV7 L;  3F2B A;  4BBR B;  3RZO B;  4RHS A;  4K2K A;  4UP8 A;  4R1J A;  1VQ6 A;  1VF7 A;  1STE A;  5D3I B;  4A93 G;  4DAV A;  4DNI A;  4EGV A;  2KCC A;  4LW1 A;  1EY0 A;  5DAU A;  4X66 Q;  1HZA A;  1ESF A;  1B9N A;  1G2T A;  2A6E C;  5ELC A;  1QE6 A;  3UDG A;  4G7H C;  2UXD Q;  4OWT B;  1PVO A;  4FF1 A;  3OSO A;  1SYF A;  4GZY C;  1IL8 A;  4R8N A;  2NVY H;  5CV9 A;  5M5X H;  1TWF B;  5CYU A;  3PO2 G;  3OIQ A;  3R3O A;  1WTW A;  4Y7N H;  5KYI A;  1AH9 A;  2EY5 A;  3BDL A;  4LWC A;  5D3D A;  4KTA A;  3HOZ H;  2EOT A;  2DGY A;  2A68 D;  3RLF A;  2L4N A;  2D9U A;  1Y8O B;  5C4X B;  1YHQ A;  3I4M H;  4CDE C;  4HSP A;  4B9X A;  1K3B C;  2MHV A;  2MO0 A;  4QIW E;  2VB3 X;  5IT9 c;  2JXM B;  1CSP A;  2EY6 A;  4DUZ L;  1YNX A;  2QDL A;  1OO9 B;  3G6J B;  2LFN A;  4L6T B;  5DNF A;  2PZU A;  2AWN A;  4MN3 A;  2Z8L A;  2NTT A;  4HMI A;  3H91 A;  1X56 A;  3N6R A;  4K6D A;  3BVM A;  1LTI D;  3PF4 A;  5IGE A;  2Z6K C;  4DUZ Q;  1TQO A;  2LMC B;  4IZ8 A;  4A3C H;  4PQX A;  3GTM B;  3M4P A;  3FPU B;  1U4P A;  1VQ5 A;  1HR0 W;  4DK0 A;  5KYL A;  3RLN A;  3DHQ A;  3HOW H;  3H6M A;  1MSG A;  3OTO L;  1JOR A;  4IUU A;  5ELO A;  1QIL A;  2A8V A;  3K5M A;  2K5V A;  4ID6 A;  3S9W A;  4YWL A;  4L5S A;  2AQ2 B;  4K2L A;  2DN8 A;  3M4O H;  1WFQ A;  2DNC A;  4DR5 L;  1LT5 D;  4AYB G;  2BCO A;  3PUW A;  1Y1V B;  1X54 A;  1I6V C;  1D5X C;  3SVM A;  3I56 A;  4H13 C;  4JBM A;  2J0T D;  2N78 A;  2E2J B;  1GJX A;  1HTP A;  4DR5 Q;  1E2W A;  1TWH B;  4PMW A;  5BN3 A;  4BY7 G;  3AU7 A;  1KLU D;  1C9O A;  4IFD H;  4C2M H;  5JPM C;  5A2Q E;  3CCV A;  3E5S A;  3UDX A;  4ABN A;  3ITP A;  1KQS A;  2MP1 A;  2F0S A;  3ERS X;  4ZUJ A;  1J9O A;  3MXN B;  1YNN C;  1VMC A;  4BA1 I;  3K8A A;  3K7A H;  1WYD A;  2CW0 D;  4CDC C;  5IYD H;  3MEF A;  4TKO B;  4M1U B;  2IHE A;  5K36 H;  4R4C A;  4B08 A;  2F0L A;  1K73 C;  3SK4 A;  2A73 B;  3O13 A;  4QGU A;  2IX1 A;  3I4M G;  1I50 B;  1D8L A;  1VQH A;  5HUR A;  3IFD A;  4BY1 H;  3RUZ A;  2VL6 A;  4XYQ A;  3IAY A;  4A3K B;  4OXP A;  4LK1 C;  3JAM L;  1U9R A;  1PMR A;  2UXC L;  2ZJQ A;  3HRZ C;  1I6H B;  4ZUI A;  5FLX E;  3A7A B;  3WWV A;  3G6E A;  2B3G A;  4F8M A;  2B63 H;  1PH5 A;  3E3X A;  2QCP X;  1WCM B;  2R93 H;  1O7Y A;  5I6W A;  1VQ9 A;  1JQY D;  4A3C G;  4O1N A;  1QCB D;  3HOY B;  4PV1 C;  3CKI B;  4F88 A;  2UXC Q;  4FXD A;  3ULL A;  1HUN A;  2OXP A;  1SYE A;  1PFM A;  3CQZ H;  3HOW G;  4Y52 H;  1XPU A;  2PNH A;  3J7Y W;  1BCP C;  2BDO A;  2F1M A;  2F0D A;  4ZRZ A;  1CSQ A;  4R4T A;  3CPW A;  2F3I A;  1JC7 A;  4IFD J;  3HOU B;  3STB C;  1CUK A;  1H9R A;  3KF6 B;  3HOV B;  2D5D A;  2K32 A;  2KED A;  2GVA A;  1H95 A;  2YU9 H;  1TII D;  3MXN A;  1JJC B;  1EY6 A;  3I73 A;  2NTS A;  3W2D A;  4KY5 A;  1VQF A;  1EUJ A;  5IGD A;  4ILW A;  3V2T A;  3BS1 A;  3J7A 5;  2KHI A;  4YCW A;  3DLL A;  3GTQ H;  2CQO A;  4FVM A;  4IFD G;  2B2V C;  5DLQ E;  2NB0 A;  1XTC D;  1KAB A;  3BVZ A;  5KND A;  2MUY A;  1V9P A;  5TSS A;  5C3X A;  2Q8I B;  5IT9 E;  4KK7 A;  1KXL A;  4A3D B;  4ODG A;  2E2I B;  3IRB A;  3LX0 A;  3SHL A;  5J22 A;  1WD1 A;  3S17 H;  5IYD G;  3TS0 A;  2RDG A;  3E0E A;  4IUV A;  5DM6 3;  4JYA L;  1MSH A;  1ILQ A;  3X3N A;  2WAC A;  1D2B A;  2ZTE A;  1O7I A;  5L37 A;  5KNB A;  1XX8 A;  1FNU A;  2MJ8 A;  2A6E D;  4BY1 G;  1BKB A;  1VQI A;  1XMQ L;  1N32 L;  2B2Y C;  2L0C A;  4PZ6 A;  4JYA Q;  3P1H A;  2A6H C;  2DY8 A;  3A8K E;  3RN2 A;  2IPK D;  2JJQ A;  1M1K C;  3VR2 A;  4XQQ A;  1NE3 A;  4DV3 L;  2OTL A;  3S2H H;  4ZK9 B;  2N88 A;  2B63 G;  2F0J A;  2R93 G;  1XMQ Q;  1OXS C;  1J5E L;  3KF6 A;  1N32 Q;  3KDF B;  3BU2 A;  4A3B G;  2XRQ D;  1EEF D;  2N8N A;  2WAQ G;  4FXK C;  5IWA L;  3CC2 A;  1ZXT A;  5T1I A;  3V05 A;  1E1T A;  4P2C B;  4CGY B;  1UE7 A;  2K4K A;  1ROD A;  4BS9 A;  1J5E Q;  3S2D H;  1PTO H;  2N3S A;  1DM0 B;  5T1G A;  1SJH D;  5IWA Q;  1GM5 A;  4A76 A;  1KDC A;  2WB1 B;  3GTK B;  1LYL A;  2ZJP A;  1SXT A;  1UE1 A;  2EIF A;  4DK3 C;  5FJ8 H;  2R61 A;  5EBC A;  2MO1 A;  3BVG A;  1W6J A;  5FO7 B;  3F2U A;  5H1S E;  2ALY B;  3HG9 A;  1QVC A;  1K83 B;  5AFW A;  1O7Z A;  2OTJ A;  1P16 A;  2B8G A;  2J4X A;  2TSS A;  2OCE A;  3J80 c;  4DV0 L;  1G51 A;  3K5L A;  1B4O A;  3ER0 A;  4V19 0;  4XQJ A;  3CF5 A;  4O2D A;  1MD2 D;  1V1P B;  1BQQ T;  1LT4 D;  1HCZ A;  1Y14 B;  5M3M B;  3Q24 A;  1KTK A;  1A6X A;  2Z4H A;  4DV0 Q;  2D62 A;  3TRE A;  3NQT A;  4FDB A;  4APV A;  3I7F A;  5ELD A;  3KDF A;  2JA6 B;  1ONL A;  3M85 A;  1PFS A;  5EKI A;  2JA8 B;  4A3I B;  1X55 A;  2BE5 D;  5JEA J;  1PTO C;  1EY8 A;  5IOC A;  2E5L L;  1EIH A;  4CJ2 C;  1YNN D;  2OQ0 A;  4MTN A;  4GNX B;  1PH7 A;  3NWT A;  1OXV A;  3CCJ A;  3WOE A;  4CJ1 B;  3NWS A;  3Q6S A;  3BZK A;  1EFW A;  1VS0 A;  2E5L Q;  2YTX A;  1FL0 A;  1C48 A;  2AWO A;  2NVQ H;  4S3S A;  2NVX H;  1G8Z D;  3DWQ A;  4GOP C;  4KJO A;  1M90 C;  1QVF A;  1S72 A;  3S1Q H;  4C3J B;  1TT2 A;  1HJP A;  1CT1 D;  3H0G G;  2L9H A;  4YIJ A;  2F03 A;  2F0N A;  1JWU D;  1XNQ L;  4LF8 L;  1F2M A;  2TMP A;  3QG1 A;  3TP8 A;  1Z47 A;  3CC7 A;  5GAG C;  1A3V A;  1S5F D;  4XT1 B;  3M4Y A;  5IOD A;  3CCU A;  4LF7 L;  2PYK A;  2JQO A;  4I65 A;  4GS3 A;  4A3G B;  2GA4 B;  2F0T A;  4KV6 A;  2BA1 A;  2ID0 A;  4QQB X;  3I55 A;  1XNQ Q;  4RCO A;  4LF8 Q;  1U4L A;  4L5T A;  4OON A;  5FJ8 G;  1PLF A;  1VQE A;  4LF7 Q;  1JJG A;  1L0W A;  1SYC A;  3GP7 A;  1PH3 A;  3GTO B;  1BCP D;  4A3L H;  2WB1 E;  2L55 A;  4C3I H;  1DYQ A;  3CXC A;  3PSI A;  4G57 A;  4F87 A;  4IPH A;  2I46 A;  4X62 L;  1YHB A;  3EVQ A;  1FNV A;  4JG2 A;  4K5X A;  1BBX C;  1ICW A;  3STB D;  1HQM C;  3MA2 B;  4XYO A;  1STB A;  3A55 A;  1SDF A;  2PQA B;  3AB9 A;  4OIK A;  3A7L A;  4R9W A;  2PPB C;  4X62 Q;  1EQT A;  4GNX A;  3KFU A;  3NE5 B;  3MTS A;  4XXE A;  4K6L A;  2XWB B;  1N9W A;  4P72 A;  4DKA C;  4JI8 L;  3TP6 A;  3S1R H;  1PHJ A;  3L9A X;  2UUA L;  1H9M A;  3OWF A;  4PMC A;  2SOB A;  4A3M B;  4HR7 B;  4JI5 L;  1SMX A;  5LHY 1;  2KEE A;  1E22 A;  1ZEQ X;  5ISR A;  1WTV A;  2AUJ D;  4IO9 A;  5DM7 3;  4JI8 Q;  4N9P A;  2I5L X;  1QZG A;  4JCV E;  1PH6 A;  2UUA Q;  3C2P A;  4J8Q A;  3U9S A;  3S14 B;  1W3S A;  2EYF A;  3TME A;  4JI5 Q;  4BBR H;  2K5H A;  3RZO H;  4JI7 L;  3RZD B;  3I70 A;  1JWS D;  1B50 A;  2YYZ A;  5E3F A;  1EU4 A;  3F2C A;  1WJJ A;  1QB5 D;  1EZ6 A;  1JWM D;  4HIO A;  4DU9 A;  4QB4 A;  3S1M H;  4JI7 Q;  1PZJ D;  2A6H D;  4DXF A;  2ZXO A;  5IP9 H;  2EJM A;  1HA5 A;  1EWH A;  5LMN L;  2XWJ B;  1PDQ A;  3GQB A;  1TWF H;  2NUC A;  1GVP A;  2R7D A;  4H0L C;  2EYM A;  3JAM c;  4K8I A;  4IJL A;  4UP9 A;  1BNZ A;  5KNC A;  1Q90 A;  2NN6 H;  5BN4 A;  4A3L G;  4C3I G;  5IGG A;  4OWW B;  1WTO A;  5IIF A;  5C4X H;  3SEB A;  2F0K A;  2NBF A;  2VZA A;  4Q0F A;  5D14 A;  1FYC A;  1VQC A;  3SE0 A;  1B8A A;  3GTL B;  3T1H L;  1RDP D;  3CCE A;  3HKZ B;  3EBE A;  4JI3 L;  2UUB L;  4BXX H;  2B2W A;  2K50 A;  5COY A;  1PXU A;  5C3E B;  1LLR D;  3T53 B;  1DXM A;  5JPN C;  1EL0 A;  1JOO A;  3T1H Q;  1JT8 A;  4OO1 I;  3Q23 A;  4JI3 Q;  4DFA A;  1RF2 D;  5FO9 B; 
#chains in the Genus database with same CATH homology
 3S16 B;  3QOL A;  1IYU A;  3GTP B;  3C3L A;  4TSS A;  3H09 A;  2H1E A;  1TVX A;  4IUQ A;  1I3Q B;  2O4X A;  4FXG C;  3C46 A;  1NUC A;  5JJZ A;  4PNY A;  2F0W A;  2V4D A;  1PTO D;  4OGQ C;  2FJ2 A;  2K5D A;  1MGS A;  4WJW A;  3SXH A;  1Q1B A;  1ESR A;  3PIO 3;  4DN4 M;  4ZKC B;  2PZT A;  1Q12 A;  1H9J A;  1LTA D;  2K05 A;  1TY2 A;  1RTN A;  4RWS C;  4ZKB B;  3OPO A;  2EJG C;  3CHB D;  1E2Z A;  2XSC A;  4CKC A;  2NN6 G;  3VR4 A;  1LTG D;  5CMD A;  1BCP F;  3SK6 A;  2WKC A;  3H3V C;  1SMY C;  1JOK A;  2FMM A;  2JA5 B;  2K28 A;  3HGB A;  1STN A;  3DXJ C;  3IL8 A;  2SNM A;  3ND8 A;  5EJW A;  5CR3 A;  2AQ1 B;  2X6G A;  4XQN A;  3M3Y B;  1EEI D;  5F2D A;  1VDZ A;  1TWA B;  3I91 A;  4H44 C;  1DZ1 A;  2Y0S B;  3OIP A;  1VMP A;  3IFT A;  1HXY D;  2ICE C;  4NW2 A;  1EYA A;  1D1K A;  1U4M A;  2E2H B;  2EY1 A;  2K1B A;  3UI2 A;  3K6O A;  3PO2 B;  1STG A;  4RFB A;  1KNE A;  4HED A;  2R92 B;  4IN3 A;  2VUM B;  4C3H G;  4M8A A;  3JAM E;  2PW7 A;  3FEW X;  3J81 E;  3D4W A;  4JK1 C;  1Y1W B;  2JA7 B;  4NMZ A;  1AEX A;  2HCC A;  1ENF A;  3VR5 A;  3D31 A;  2F0P A;  2BOS A;  3KLS A;  5LL6 X;  5CBA E;  1W6K A;  2C9O A;  1LO5 D;  4KY6 A;  3TBI B;  2PMZ B;  4KN7 C;  1KLG D;  4RGO S;  2BE5 C;  1CK1 A;  4KMU C;  1LTT D;  1D1I A;  3NBH A;  3I4N B;  5EPK A;  4IUR A;  4MHE A;  1IW7 C;  1Y8N B;  4AYB B;  1PRT B;  1AN8 A;  4QUF A;  4U67 3;  4ULL A;  4O42 A;  5DEH A;  2XVS A;  1CQF A;  2DNE A;  5CGK A;  1SEB D;  4F7X A;  1TY0 A;  4H7B A;  3Q0A A;  3D4R A;  5EPJ A;  1F2Z A;  1MBY A;  4JBW A;  3BG3 A;  2KEC A;  5JAV A;  2NVY B;  5M5X B;  3P20 A;  2L11 A;  5C6A A;  2B2U A;  4Y7N B;  1WTP A;  3MXP A;  2B2T A;  3HOZ B;  4EQP A;  5I9O A;  5C0X I;  3NXW A;  3TZU A;  2QKI C;  3I4M B;  1PTO F;  1CZW A;  5CC4 A;  1GHK A;  3VYR A;  3TSS A;  2ZXP A;  1F9R A;  1BXT A;  2QIL A;  4K8J A;  2NZ1 D;  2J7Z A;  1RD9 D;  2KOL A;  4X3T A;  3QB3 A;  2AQ3 B;  3MXG A;  2IJ0 A;  3W3A A;  1O80 A;  5FOB B;  1FGB D;  1RF2 D;  3HOW B;  3K0Y A;  1FR3 A;  1IKM A;  2QEJ C;  1SNO A;  1HA6 A;  1AZQ A;  3OW7 A;  2OF1 A;  1E0B A;  4FNF A;  1EQV A;  3D3R A;  1NR2 A;  1CHQ D;  1SBB B;  2K7V A;  1UAP A;  3LWE A;  2O5J C;  5FLX L;  1SMY D;  2WP8 J;  1BDO A;  4C2M B;  2OEO A;  5KRU A;  1BCP B;  3NQI A;  4XTC S;  4RGM A;  1DD2 A;  4HMJ A;  2C5C A;  4IAL A;  1X32 A;  5M5W B;  3VR6 A;  3URY A;  3OWE B;  4HCE A;  3DEO A;  1ML0 D;  1RHP A;  2RSN A;  2B8F A;  3PO3 B;  5EKK A;  4DAY A;  4BWG B;  2RSO A;  2VXW A;  4OO1 G;  3HP3 A;  5COR A;  1HHV A;  2K5W A;  3NUC A;  2VB2 X;  1SE2 A;  3A8I E;  2MGS A;  1V8Q A;  3I8Z A;  2K04 A;  3GV6 A;  5BN5 A;  4ZAI A;  1GXD C;  2WAQ B;  3CQZ B;  3T4A C;  2EYL A;  1UUP A;  1EY5 A;  2H4O A;  4E6I A;  1HTL D;  4B9W A;  1J8I A;  2A5H A;  3FRP B;  4IUN A;  3CRK C;  1WTX A;  1A15 A;  1F77 A;  3OHX C;  4QCL A;  4KD4 A;  2WKD A;  1Y69 U;  3PUV A;  2RQX A;  2YU9 B;  5KEE A;  4WRD A;  4C3J G;  1QNK A;  3GTQ B;  2LS0 1;  1G6Z A;  5JOB A;  1STY A;  5I2X A;  1LTR D;  1IW7 D;  1UNS A;  3NK9 A;  3FVQ A;  1A2U A;  3Q22 A;  2B2V A;  1VF5 C;  3FKI B;  5J1Z A;  2F0V A;  3EQL C;  2IT1 A;  2HCI A;  1XWE A;  2EXZ A;  4A3E B;  4RGN A;  3S17 B;  2N55 A;  4A3F B;  1SE3 A;  2G9H D;  1OXU A;  4X3U A;  5KIX A;  2FFK B;  2M2L A;  1PFN A;  5FO8 B;  4NDX A;  3WOF A;  2VNU D;  4NP5 A;  3CRL C;  2O2L D;  1PYW D;  4DNT B;  3MEH A;  2R6G A;  3EA6 A;  3A56 A;  2R7Z B;  3BZD B;  3KK7 A;  3MFG A;  4CHT B;  1EY9 A;  3FPP A;  3VA7 A;  1TS3 A;  2F0E A;  1HQR D;  1SNP A;  1T5X D;  3S2D B;  2JYO A;  1SJE D;  1VCI A;  1IKL A;  1CA6 A;  5I6Y A;  2JEA I;  3P75 A;  3P7J A;  1QJO A;  4UAI A;  1BR9 A;  2M00 A;  5ELF A;  5NUC A;  5M5Y B;  1BO0 A;  4ZLT F;  2SEB D;  3OOC A;  3E0J A;  5CV5 A;  1ZKO A;  4BA2 I;  1K8O A;  4RA8 A;  1RCV D;  1I4R A;  5E1F A;  3MXU A;  1HPC A;  3D6C A;  2RDF A;  5JVG 3;  4IFD I;  4ME5 A;  1EYD A;  3K58 A;  3NHH A;  5CV8 A;  1KNA A;  3KLR A;  5I9P A;  4IQZ A;  3J80 E;  2K03 A;  2F0U A;  3TP7 A;  1XXG A;  3ERQ A;  3U9O A;  5K5P A;  3DM1 A;  5ELB A;  1Q3L A;  1JCK B;  3VR3 A;  1F2L A;  3MVV A;  3J7A F;  2F0O A;  3PIP 3;  5M3F B;  2F0M A;  2K5Q A;  1G91 A;  2F0I A;  3D8G A;  2NVQ B;  5E4W C;  2XIW A;  3S1Q B;  3MZ5 A;  4BBS B;  2SDF A;  3D6W A;  1V1O A;  3NSW A;  4DF7 A;  2IWH A;  2O5I C;  3OMG A;  4RH6 A;  1EY4 A;  5IGF A;  4G7O C;  2CVR A;  4J6H A;  1I4P A;  1PFB A;  2RBM A;  1SSO A;  1JR0 D;  2ZT9 C;  2KVM A;  2XNA C;  4RKB A;  4A3J B;  3TDQ A;  2I07 B;  2KUM A;  3SK8 A;  5C5L A;  3T16 A;  5LL6 S;  2EZV A;  3RMH A;  4CJ0 B;  4OHJ A;  2L5T A;  2EPB A;  5C5M A;  2Z4I A;  1RJT A;  2PCF B;  1O78 A;  1Z7T A;  3K57 A;  1B2T A;  1HFG A;  1CFM A;  2FHT A;  1WVL A;  1X3P A;  1QG7 A;  3I4L A;  1SYG A;  2L1B A;  2LY7 A;  4WFN 3;  3S1R B;  1M8A A;  1L0Y B;  5CV6 A;  4DNR B;  1K8M A;  1HFN A;  1NCV A;  1OXT A;  4HSV A;  1CZG A;  2ENB A;  3BYY B;  5D65 A;  3GV3 A;  3OMC A;  4C1N K;  4EQO A;  1EY7 A;  3E6Z X;  1GUG A;  4UDU C;  1D5Z C;  3S1M B;  3X3M A;  4K5V A;  2KJX A;  1BOS A;  3RD4 A;  1B1Z A;  2FMC A;  2NWG A;  2KHS A;  3HZX A;  4NKL A;  4LMQ D;  2B2U C;  4A93 B;  1WD0 A;  2Q8R E;  2B2T C;  4G7Z C;  2JE6 I;  1UEA B;  3J7A V;  1SNM A;  3R2I A;  1Q1E A;  1GUW A;  1NR4 A;  2RVL A;  1KDB A;  1DOK A;  3G7L A;  3L3O C;  1TS2 A;  5KGU A;  4QUC A;  2WII B;  1PRT C;  3GTJ B;  3T56 B;  1E2V A;  1EFI D;  4OIJ A;  1QNU A;  4FF2 A;  3KLS X;  3SK5 A;  3T51 B;  5FKA C;  4DA2 A;  5EBD A;  3GTG B;  4QF4 A;  2X69 A;  2R3Z A;  4OL7 A;  1LTB D;  4KJN A;  1D6E C;  4EQN A;  3EFX D;  3PUX A;  4XT3 B;  5FK9 C;  1TS4 A;  2IL8 A;  4FF3 A;  1O7L A;  1G2S A;  2F0F A;  3T13 A;  5IGB A;  2EY2 A;  4C3H B;  1D5M C;  4KKU A;  2NVT B;  1ENC A;  3N52 A;  3M7G A;  3FDT A;  5CV7 A;  1A3U A;  4BY7 B;  3PMF A;  1WTR A;  1TU2 B;  1IYV A;  2EYO A;  2HDL A;  1S5D D;  1B9M A;  3KUP A;  3KBG A;  4KN4 C;  1SNQ A;  1EZ8 A;  4CKE A;  1CQV A;  1ZYR C;  3VYU A;  1I4H A;  3QWN A;  3BDO A;  1RTO A;  4DXG A;  5EQ0 A;  3J81 L;  4X3K A;  5CV4 A;  4K14 A;  3VYS A;  2F3W A;  3LNN A;  1GUT A;  1A3T A;  3K5N A;  5JVH 3;  4OO1 H;  3HOX B;  1AW7 A;  3VA5 A;  4KY7 A;  1Q8I A;  2F4I A;  4X3S A;  3VYT A;  2BDN A;  3FMC A;  1BUV T;  5ELE A;  5A2Q L;  1QOH A;  2Q8T A;  4Z9C B;  1YNJ C;  2WV6 D;  2PZW A;  1JE4 A;  4PMB A;  5M9O A;  4DGZ A;  3M4O B;  1S5E D;  3R2T A;  2M9V A;  1SE4 A;  1DCZ A;  2K01 A;  1X3Q A;  1LTS D;  2A69 C;  3QOJ A;  2IW3 A;  2QDB A;  3D4D A;  1R4Q B;  5A35 A;  1NSN S;  4C1N I;  5K36 G;  3MWY W;  4HAE A;  4KI0 A;  1GUN A;  5G3L D;  1SNC A;  1B3A A;  2JEB I;  4ZQ3 A;  1TWG B;  2IX3 A;  3K7A B;  2RA4 A;  1WTQ A;  5EGT A;  2FIN B;  5CBE E;  3C1E A;  1AP0 A;  2NN6 I;  3EJI A;  1GOZ A;  2WIN B;  1B44 D;  5C44 B;  2K6A A;  4BY1 B;  3SDZ A;  3TZD A;  1LT6 D;  2E76 C;  3LWU A;  4LJZ C;  5JEA H;  1GHJ A;  2PNR C;  1I4G A;  2E74 C;  1L0X B;  3BDC A;  2K33 A;  1H9K A;  3A54 A;  1PZK D;  3H94 A;  3ND9 A;  1SYB A;  1PRT D;  4RAU C;  2B63 B;  2R93 B;  1U4R A;  5E4X A;  4HN7 A;  5IT9 L;  4EVO A;  4A3B B;  1DJR D;  2CQA A;  1I4X A;  3ZYY X;  1A2T A;  3MAQ A;  3I90 A;  5IGC A;  4DAP A;  2HDM A;  2A74 C;  3NPP A;  1ENA A;  1ET9 A;  2E75 C;  1ET6 A;  1GUO A;  4DK1 A;  4KKS A;  4KKT A;  2L12 A;  1TS5 A;  1JIC A;  1BF4 A;  1LAB A;  3KF8 A;  3PV0 A;  5J39 A;  1II3 A;  1C4Q A;  1SFO B;  5EKL A;  4MIU A;  3K59 A;  1CM9 A;  4K5W A;  3GD7 A;  3R93 A;  2EYJ A;  2KA7 A;  4FF4 A;  2EDG A;  3CU7 A;  1IHZ A;  1V43 A;  3I72 A;  2HQE A;  2F3V A;  1T5E A;  1KAA A;  4KHV A;  2EYP A;  2G9D A;  4G4K A;  2AUK A;  1SND A;  3DWP A;  4TQU S;  3R8B A;  1F9P A;  1S4Z A;  2OT2 A;  4RHR A;  5JEA G;  1C8C A;  2B2W C;  4QMG A;  1ZYR D;  1LT3 D;  3ONA B;  3V96 A;  2B2Y A;  3S2H B;  1HUM A;  1Z6H A;  2X6L A;  2NYZ D;  4RGT A;  4HTH A;  2XRS D;  1ILP A;  2D2C C;  5EPL A;  1QWY A;  4IUT A;  3HEJ A;  4Q5V A;  1FD7 D;  1V1P A;  3H0G B;  1DON A;  2A68 C;  3NTH A;  1CHP D;  4TRD A;  3HS0 C;  3NTK A;  3QO2 A;  1KDA A;  1PTO B;  3BYT B;  4RKL A;  2KQ3 A;  2F0H A;  5C4Z A;  5C0X H;  1EU3 A;  1R9T B;  2EE1 A;  2LKV A;  2CHB D;  2PQE A;  1HRJ A;  1GUS A;  1YNJ D;  1CTM A;  1F9Q A;  4I7Z C;  1DOM A;  4CKB A;  2BA0 A;  3DEP A;  5C4H A;  1CA5 A;  1I4Q A;  5G3L F;  3DWA A;  2PO4 A;  3S1N B;  2F0G A;  5I4D A;  2ICI A;  1AZP A;  2A69 D;  4J1M A;  5C4J B;  1PZI D;  3S15 B;  1STA A;  2PW5 A;  2DY7 A;  2F0Q A;  2KCN A;  2Z1C A;  1EIG A;  1R4P B;  3AMU A;  4WOR A;  3SR1 A;  1JB3 A;  4HCS A;  1M4V A;  4L8J A;  4RCN A;  1FNW A;  1TR5 A;  3PUY A;  4R8I A;  1Y8P B;  3NBI A;  3WDN A;  2ZXR A;  3DMU A;  4V0B A;  1PRT F;  1H9S B;  2XN9 C;  3TN2 A;  5C0X J;  2CW0 C;  2NVX B;  3A8J E;  3C1F A;  1B53 A;  1EOT A;  2JSO A;  1RKN A;  4KHZ A;  4FO2 A;  3GO5 A;  3M7N A;  1TWC B;  3NP8 A;  1STH A;  1S5C D;  4FP5 D;  1NAP A;  1XYI A;  1DOL A;  3MFY A;  3I3C A;  4U68 A;  5C0X G;  3PUZ A;  4LAA A;  5C3W A;  2RKS A;  2RDH A;  3KBX A;  5I2Y A;  4ZYS A;  4QIW B;  1CI3 M;  2HUG A;  3IKJ A;  1SAP A;  1EWC A;  1G29 1;  3QJY A;  1SYD A;  4C3I B;  3ERO A;  4FYD A;  2MPM A;  4KD3 A;  2B39 A;  3MC0 B;  4IUP A;  1OXX K;  3NTI A;  4XDX A;  3QIA A;  2QF7 A;  4L63 B;  4XIG S;  1EYC A;  1MI2 A;  1S5B D;  3MHB A;  2JP1 A;  4N9T A;  3J80 L;  4C56 C;  1AFP A;  3L7Z C;  1H9S A;  2EJF C;  5HGT A;  4CBV A;  3TP5 A;  2E2D C;  1LAC A;  1F2Y A;  2EVB A;  2EYH A;  3K5O A;  2SNS A;  2IX0 A;  1F9S A;  3DUZ A;  1JOQ A;  1TKW B;  4BBR B;  3RZO B;  4RHS A;  4K2K A;  1VF7 A;  1STE A;  5D3I B;  4DAV A;  4EGV A;  2KCC A;  1EY0 A;  5DAU A;  1ESF A;  1B9N A;  1G2T A;  2A6E C;  5ELC A;  1QE6 A;  4G7H C;  4FF1 A;  3OSO A;  1SYF A;  4GZY C;  1IL8 A;  4R8N A;  5CV9 A;  1TWF B;  5CYU A;  3OIQ A;  3R3O A;  1WTW A;  5KYI A;  2EY5 A;  3BDL A;  5D3D A;  4KTA A;  2EOT A;  2A68 D;  3RLF A;  2L4N A;  2D9U A;  1Y8O B;  5C4X B;  4HSP A;  4B9X A;  2MHV A;  2VB3 X;  2JXM B;  2EY6 A;  1OO9 B;  3G6J B;  2LFN A;  4L6T B;  5DNF A;  2PZU A;  2AWN A;  4MN3 A;  2Z8L A;  2NTT A;  4HMI A;  3H91 A;  3N6R A;  4K6D A;  3BVM A;  1LTI D;  5IGE A;  1TQO A;  2LMC B;  4IZ8 A;  4PQX A;  3GTM B;  3FPU B;  1U4P A;  4DK0 A;  5KYL A;  3DHQ A;  3H6M A;  1MSG A;  1JOR A;  4IUU A;  1QIL A;  3K5M A;  4ID6 A;  3S9W A;  2AQ2 B;  4K2L A;  2DN8 A;  2DNC A;  1LT5 D;  2BCO A;  3PUW A;  1Y1V B;  1I6V C;  1D5X C;  3SVM A;  4H13 C;  2J0T D;  2E2J B;  1GJX A;  1HTP A;  1E2W A;  1TWH B;  4PMW A;  5BN3 A;  3AU7 A;  1KLU D;  4IFD H;  5JPM C;  5A2Q E;  3E5S A;  4ABN A;  3ITP A;  2MP1 A;  2F0S A;  4ZUJ A;  1J9O A;  1YNN C;  1VMC A;  4BA1 I;  2CW0 D;  4TKO B;  4M1U B;  5K36 H;  4B08 A;  2F0L A;  3SK4 A;  2A73 B;  3O13 A;  2IX1 A;  1I50 B;  5HUR A;  3IFD A;  3RUZ A;  4XYQ A;  3IAY A;  4A3K B;  4LK1 C;  3JAM L;  1U9R A;  1PMR A;  3HRZ C;  1I6H B;  4ZUI A;  5FLX E;  3A7A B;  4F8M A;  2QCP X;  1WCM B;  1O7Y A;  5I6W A;  1JQY D;  4O1N A;  1QCB D;  3HOY B;  4PV1 C;  3CKI B;  4F88 A;  4FXD A;  1HUN A;  2OXP A;  1SYE A;  1PFM A;  3J7Y W;  1BCP C;  2BDO A;  2F1M A;  2F0D A;  4ZRZ A;  1JC7 A;  4IFD J;  3HOU B;  1H9R A;  3HOV B;  2D5D A;  2K32 A;  2KED A;  1TII D;  3MXN A;  1EY6 A;  3I73 A;  2NTS A;  3W2D A;  4KY5 A;  5IGD A;  4ILW A;  3V2T A;  3BS1 A;  4FVM A;  4IFD G;  2B2V C;  2NB0 A;  1XTC D;  1KAB A;  3BVZ A;  5KND A;  2MUY A;  5TSS A;  5C3X A;  2Q8I B;  5IT9 E;  4KK7 A;  4A3D B;  4ODG A;  2E2I B;  3LX0 A;  3SHL A;  5J22 A;  1WD1 A;  2RDG A;  4IUV A;  5DM6 3;  1MSH A;  1ILQ A;  3X3N A;  2WAC A;  1D2B A;  5KNB A;  1XX8 A;  1FNU A;  2MJ8 A;  2A6E D;  2B2Y C;  2L0C A;  3P1H A;  2A6H C;  2DY8 A;  3A8K E;  2IPK D;  3VR2 A;  4XQQ A;  4ZK9 B;  2N88 A;  2F0J A;  1OXS C;  2XRQ D;  1EEF D;  4FXK C;  1ZXT A;  5T1I A;  3V05 A;  4P2C B;  4CGY B;  1ROD A;  4BS9 A;  1PTO H;  1DM0 B;  5T1G A;  1SJH D;  1KDC A;  2WB1 B;  3GTK B;  1SXT A;  2R61 A;  5EBC A;  3BVG A;  1W6J A;  5FO7 B;  3F2U A;  3HG9 A;  1K83 B;  5AFW A;  1O7Z A;  2B8G A;  2J4X A;  2TSS A;  3K5L A;  1B4O A;  4V19 0;  4XQJ A;  1MD2 D;  1V1P B;  1BQQ T;  1LT4 D;  1HCZ A;  5M3M B;  3Q24 A;  1KTK A;  1A6X A;  2Z4H A;  2D62 A;  3NQT A;  5ELD A;  2JA6 B;  1ONL A;  3M85 A;  5EKI A;  2JA8 B;  4A3I B;  2BE5 D;  5JEA J;  1PTO C;  1EY8 A;  5IOC A;  1EIH A;  4CJ2 C;  1YNN D;  3NWT A;  1OXV A;  3WOE A;  4CJ1 B;  3NWS A;  3Q6S A;  1C48 A;  2AWO A;  4S3S A;  1G8Z D;  3DWQ A;  4KJO A;  4C3J B;  1TT2 A;  1CT1 D;  2L9H A;  4YIJ A;  2F03 A;  2F0N A;  1JWU D;  1F2M A;  2TMP A;  3QG1 A;  3TP8 A;  1Z47 A;  1A3V A;  1S5F D;  4XT1 B;  3M4Y A;  5IOD A;  2PYK A;  4I65 A;  4A3G B;  2GA4 B;  2F0T A;  4KV6 A;  2BA1 A;  2ID0 A;  4RCO A;  1U4L A;  1PLF A;  1SYC A;  3GP7 A;  3GTO B;  1BCP D;  2L55 A;  1DYQ A;  4G57 A;  4F87 A;  2I46 A;  3EVQ A;  1FNV A;  4K5X A;  1BBX C;  1ICW A;  1HQM C;  3MA2 B;  4XYO A;  1STB A;  3A55 A;  1SDF A;  3AB9 A;  4OIK A;  3A7L A;  4R9W A;  2PPB C;  1EQT A;  3NE5 B;  3MTS A;  4XXE A;  4K6L A;  2XWB B;  3TP6 A;  3L9A X;  1H9M A;  3OWF A;  4PMC A;  2SOB A;  4A3M B;  4HR7 B;  5LHY 1;  2KEE A;  1ZEQ X;  5ISR A;  1WTV A;  2AUJ D;  5DM7 3;  4N9P A;  3C2P A;  4J8Q A;  3U9S A;  3S14 B;  2EYF A;  3TME A;  3RZD B;  3I70 A;  1JWS D;  1B50 A;  2YYZ A;  5E3F A;  1EU4 A;  1QB5 D;  1EZ6 A;  1JWM D;  4DU9 A;  4QB4 A;  1PZJ D;  2A6H D;  4DXF A;  2ZXO A;  2EJM A;  1HA5 A;  1EWH A;  2XWJ B;  1PDQ A;  3GQB A;  2NUC A;  4H0L C;  2EYM A;  4K8I A;  1BNZ A;  5KNC A;  1Q90 A;  2NN6 H;  5BN4 A;  4C3I G;  5IGG A;  1WTO A;  5IIF A;  3SEB A;  2F0K A;  2NBF A;  4Q0F A;  5D14 A;  1FYC A;  3SE0 A;  3GTL B;  1RDP D;  3HKZ B;  2B2W A;  5COY A;  1PXU A;  5C3E B;  1LLR D;  3T53 B;  1DXM A;  5JPN C;  1EL0 A;  1JOO A;  4OO1 I;  3Q23 A;  4DFA A;  1LV9 A;  5FO9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...