5I9OA

Crystal structure of staphylococcal nuclease variant delta+phs l36k l103k at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRKLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAKVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36K L103K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i9oA00
2KQ3A 4DU9A 3SK4A 2RKSA 5KYIA 2EYFA 2EYMA 1EZ6A 2PZUA 4NMZA 3S9WA 2EY2A 2EY5A 1SNMA 1EY5A 2F0QA 2HQEA 4RKLA 1AEXA 4E6IA 3P1HA 4N9TA 3D8GA 1A3VA 3SXHA 2F0IA 2F0HA 2OXPA 1A3UA 2F0UA 4K5WA 2EY6A 4ID6A 1EY0A 4KY6A 3OMGA 4R8NA 5EGTA 1EQVA 3V2TA 5I6YA 4KTAA 4IUNA 4ZQ3A 4G57A 4K8JA 5F2DA 3T16A 1TQOA 3ERQA 5HURA 1EY6A 1STYA 5IGEA 3NP8A 1EYDA 3MEHA 3NUCA 2LKVA 5IOCA 1SNQA 1KABA 2PW5A 4K8IA 2EY1A 3D4WA 4KY7A 1SYEA 3LX0A 4WORA 1EY8A 4EQOA 2PW7A 3RUZA 5IODA 5J22A 2NUCA 5DEHA 4KJOA 2SNMA 1JOQA 4N9PA 3DHQA 3SK8A 5KEEA 3TP7A 3OMCA 1STNA 5M9OA 4LAAA 4EVOA 1STHA 1SYFA 1SNOA 5JAVA 1A2UA 2F0TA 4K6DA 5IGDA 1JOOA 2PYKA 3OWFA 5IGCA 5CV5A 5KIXA 2F0LA 4HMJA 2F0KA 4ZUIA 3U9OA 3TP6A 5J39A 3MXPA 4QMGA 3EROA 4RKBA 2EYOA 5DAUA 1A3TA 4QB4A 2PZTA 3D6CA 4H7BA 1NUCA 1SYCA 1TT2A 2EXZA 2F0VA 2F0FA 3C1EA 3HZXA 4KD3A 3MZ5A 4HTHA 4NP5A 5E3FA 4B9XA 5C3XA 4I65A 3SK5A 5J1ZA 3BDCA 2F0OA 2SOBA 1SYDA 4KV6A 1SNDA 4OL7A 2F0DA 1SNCA 2F0JA 5CV8A 5NUCA 2OEOA 4HMIA 5KYLA 1TR5A 4IZ8A 1F2ZA 3D4DA 1KDAA 1KDBA 3OSOA 5C4ZA 2F0GA 1EYCA 3QOLA 4DGZA 5CR3A 1EZ8A 2PQEA 1STAA 4S3SA 2PZWA 4YIJA 4K5VA 2ENBA 3QB3A 5I9PA 1JORA 1F2YA 5CV9A 4QF4A 1U9RA 5HGTA 1IHZA 4J1MA 4KHVA 5C5LA 1ENCA 2EYHA 4K2LA 3SK6A 4PMBA 2QDBA 1KAAA 5IGGA 5CGKA 4KY5A 5CC4A 1EYAA 5C5MA 1F2MA 1II3A 4KD4A 4KJNA 3R3OA 5JOBA 3T13A 5KRUA 4K14A 3H6MA 3NXWA 4J6HA 4NKLA 2SNSA 4IALA 2F0EA 5E1FA 4ZUJA 1EY9A 5KGUA 3P75A 5I9OA 5C4HA 3TP8A 3NHHA 3SHLA 3MVVA 1SNPA 1NSNS 3ITPA 5C6AA 5CV4A 3PMFA 4NDXA 3E5SA 1SYBA 3HEJA 5I6WA 1ENAA 3VA5A 1EY4A 1A2TA 2RDFA 3EVQA 2M00A 5CV6A 4B9WA 2O4XA 4TRDA 5IGBA 3BDLA 3QOJA 3SR1A 2EYJA 4EQPA 1KDCA 2EYLA 4PNYA 5C3WA 5EKLA 2F0MA 2RBMA 3NQTA 1RKNA 4DF7A 3TP5A 3NK9A 1STBA 4MIUA 4WRDA 4ODGA 1JOKA 2F0PA 3C1FA 1STGA 5CV7A 3TMEA 2F3VA 2F3WA 2WACA 3DMUA 1EY7A 4K5XA 4F7XA 2KHSA 5IIFA 2F0WA 4DFAA 4K2KA 5IGFA 5ISRA 2EYPA 5EKKA 2F0NA 4EQNA 4ME5A 5K5PA 2OF1A 2F0SA 3MHBA 4F8MA 1SYGA 3EJIA 4PMCA
chains in the Genus database with same CATH superfamily
2KQ3A 3SDZA 1M4VA 3R2IA 4KHZA 1QUQB 1O7IA 1BF4A 1EY5A 1VMPA 1E7ZA 3TRZA 4A3LH 1K9MC 3K7AB 1BCPB 1A3VA 2B2TA 3CCQA 1TWHB 2EY6A 3OMGA 5IP9G 1E24A 1WCMG 3PSIA 3BDOA 1HQRD 3G6EA 4IFDI 1B7YB 2B8GA 4R8IA 4GN3B 4CJ0B 2LKVA 2AWNA 1L1OC 2ZTDA 3D4WA 4OGQC 2OQ0A 4YCUA 1V8QA 4DR3L 4GNXA 2CQOA 1B9NA 1PH1A 3Q22A 4A3FH 4JI4L 2CWPA 5IT9c 1H9KA 3NQIA 4GKKQ 4TSSA 4QMGA 2VUMG 2FFKB 1GHKA 2B2UA 2Z9HA 3S1QB 2K5DA 1J5EQ 4FYDA 2XTIA 2IJ0A 4APVA 1A0IA 1K8OA 2JP1A 4KN4C 1SNDA 2AUKA 1SNCA 5D14A 3ONAB 1UE7A 2RQXA 2JYOA 1A6XA 1BKBA 1I6HH 1XMOL 3S17H 5IT9L 1GUNA 2Z6BA 1U4LA 2L1BA 3HOVB 5KNBA 1G6PA 1UE6A 2KENA 2NVXB 1GUSA 2F0EA 3K81C 3PO3H 4C3IG 1GO3E 3J81E 2NZHA 1V1QA 2AHOB 2EJMA 1EFID 2A74C 1ENAA 3S15H 2JN4A 2M00A 2K52A 3WWVA 1PH6A 5A2QL 3A55A 2L11A 2J0TD 4BBSB 4ILWA 1IZ6A 3AMUA 2RHSB 2C35B 3L0OA 4LF8L 3TMEA 2ZJRA 3IRBA 4H44C 1VMCA 1E1OA 4LF4L 4RGNA 4V190 3WDNA 5D3IB 2F4VL 4A3DH 3J80i 3SK4A 4B3RQ 2B39A 4MTKA 4IPGA 2EYMA 3KLSA 3PIO3 5EPLA 1T5EA 2JQOA 3BZDB 2L9HA 4OWXB 3R93A 2D0OA 2ZXPA 2YU9B 2F0UA 3BVZA 4ZCKA 1C7YA 4J8QA 1C48A 3CCLA 1WFQA 3UI2A 1BO0A 2QA4A 3A7LA 1TQOA 3I91A 5FLMG 5GROA 2IX0A 1JE5A 1ASZA 5IGEA 3NP8A 4DV5L 1XMQQ 1DXMA 1PTOF 1B4OA 3GTLB 1SYEA 2K33A 3GTPB 4A75A 3H3VC 4H0LC 2E2JH 2UXDL 1K8GA 4XQJA 1S4ZA 3VR4A 1EOVA 5IGDA 1TKWB 4O0AA 2CKZB 1GHJA 3HOUG 2AQ3B 1BCPC 1HA5A 3TREA 3EROA 3RZDB 1A3TA 4KKSA 1NTGA 2ZJQA 2DNCA 4JI5L 3NTHA 3GQBA 5J1ZA 4OL7A 1CA6A 2OEOA 5FOBB 1KDAA 3T1HQ 2Q8IB 1U5KA 3VYRA 4BBRG 4DR5Q 3QB3A 1YNND 1YNJC 5CV9A 2XNAC 3EA6A 1HA6A 3R3OA 5IYCH 5KGUA 1PFMA 1Y1WH 2Q2UA 1ENFA 3J7YW 3ITPA 2R7ZB 5CV4A 3ZYYX 3CU7A 4LUOA 1K0SA 1PMRA 1NR4A 3I4MH 1X54A 1VQMA 5CV6A 2NVQH 5IGBA 3PO3G 4JI5Q 2MGSA 4C3IB 2IX3A 3A54A 1I94Q 2K5QA 3PUVA 2IPKD 1GM5A 3S1NH 2F4IA 3H09A 3G71A 2F3VA 1T9HA 1G91A 3V05A 3MHBA 3EJIA 4DU9A 4PMCA 4XTCS 2VQFL 4C1NK 3J81i 3KYHC 1EZ6A 2EY2A 2UU9L 4O42A 2CH4A 2I5HA 4BY1H 2A69D 1PFSA 1VQ8A 4A3DG 4OELB 1SE4A 4X62Q 1B8AA 3K57A 3TEHB 3DWPA 4LMQD 1EIGA 2XGTA 2KVMA 3ERQA 2MUYA 3G48A 3S2HH 1ASYA 5E7NA 5GAHC 1KABA 2K32A 4JI2Q 1JICA 3CP0A 3F8TA 3BS1A 4IQZA 1PRTD 1K28A 4XYQA 1IL8A 1Q12A 2MQHA 1LTLA 1L0XB 1VS0A 3KF6A 3G7LA 1YBYA 2NN6H 2UU9Q 4ZUIA 3U9OA 4F88A 1M8AA 1I4HA 1EWIA 4A3GH 2LY7A 1HUNA 2KEDA 2IL8A 1WI5A 3MZ5A 4GLAC 2HDMA 2MJ8A 5NUCA 5M3FH 4A3FB 4HMIA 5M3MH 4LF7Q 5BN4A 5E4WC 1HNXL 2RVLA 1VCIA 4JI8L 1JORA 2L5TA 3I56A 1VQIA 3S1MH 3SK6A 1II3A 1IYUA 2QCPX 4R1JA 1EQTA 1IYVA 1NY4A 1PHJA 1W6KA 3PMFA 3CQZH 3S17B 3S14H 4Q5VA 5IYCG 4DR1L 1A2TA 3PF5A 5C3EH 2Q2IA 5IWAL 1XPUA 2IWHA 2RBMA 3NQTA 2XIWA 5GQOA 2RDGA 4C1NI 3K58A 1PH8A 1D1KA 4A3EH 3CRKC 4X3KA 4JV5L 2WACA 5FJ8G 3PO3B 3DM1A 4QIWB 2BH8A 2VL6A 3BYYB 5EKKA 4EQNA 4ME5A 3I4NH 1YJWA 3S15B 4KN7C 3HOZG 2M9VA 3QWNA 4R4IA 3HRZC 1HZ9A 3T56B 4U68A 4PZ8A 1RF2D 3FDTA 3IFDA 4N9TA 2B8FA 3SXHA 2K5HA 2KJXA 2D9UA 2WFWA 5DLQE 3Q0AA 4FP5D 3J7A5 4BY1G 4G57A 1EQRA 1YHBA 1LUZA 2JA7H 1YITA 4A3DB 1Q86C 1GUGA 3MEHA 4QIWE 2PW5A 4KY7A 3CF5A 1QVFA 1Q81C 2K50A 3CPFA 4WORA 3TBIB 4EQOA 2HUGA 4RG1A 4DV4L 2QGQA 4ZYSA 3I7FA 1HNZQ 2JA6G 3MXGA 3KJOA 4WJWA 3RLNA 4DXGA 4XIGS 4B3MQ 5J39A 1WTRA 2DGYA 2ICEC 2EXZA 2NN6G 4O1NA 2UXBL 1F9SA 3BDCA 2E2JB 1YHAA 1SJED 2F0DA 4P75A 4OO1I 1FGUA 1F2ZA 1AH9A 2QDLA 4DGZA 2YV5A 1L2FA 4ZKBB 1XPRA 1X3GA 1GKHA 2DJGC 5M3FG 2RCFA 4DV2L 1E3PA 4K2LA 3A8IE 2QDBA 1KAAA 5CBEE 4EX5A 4IFDH 4DV4Q 1AFPA 3PUYA 3H15A 4YWMA 1EY9A 4JI0Q 3BG3A 4OIKA 4DK6C 4JI6Q 1SN8A 3VR3A 1X32A 2UUAL 2A5HA 1VQNA 4DV3L 1XXGA 1NMFA 4L5TA 2UXBQ 2K01A 2K6AA 2QF7A 4IPCA 3OIQA 2D62A 1K0RA 2F0PA 3I4OA 4DR2L 2FMMA 1Y1WB 1E1TA 1MHWC 4XT3B 4B3SL 2ZTEA 3J81j 4LJZC 4YHHQ 3CCJA 1TS4A 3I4MB 3I8ZA 4RMFA 2NVQB 3DM3A 4DR6Q 3UDGA 4N8FA 1O78A 1Y14B 1X3PA 3NELA 3I4NG 3RR5A 4L5SA 1S72A 4PV1C 3S1NB 2E2DC 4DV3Q 3HOXH 1NMGA 4AH6A 5FLXE 3CC4A 2K7VA 2WIIB 4PZ6A 3V2TA 1MBYA 4OHJA 3N6RA 4BWGB 2HHHQ 3ULLA 2YU9H 2IX1A 5JJKA 3URYA 3M9BA 1N36Q 2A6EC 1STYA 3KBXA 3ND8A 5G3LD 4DR2Q 2EY1A 3SEBA 3OTOQ 1KD1C 1CHPD 3RZOH 1V43A 4JVZA 1EY8A 4UAIA 3RUZA 4BY1B 4MHEA 1QILA 2QEXA 4R4QA 2JA9A 1QNKA 1KNEA 4LAAA 5EQ0A 3UDXA 3CC7A 4JPBW 1WTWA 1A63A 4YY3L 1DJRD 3OWFA 1QG7A 4DAYA 2R61A 5M5WH 5KNDA 1PH7A 4X6AH 3PUWA 3TP6A 3S2HB 1EWCA 1GOZA 1TT2A 1CSQA 1D5MC 1DOMA 1WD0A 1BBXC 3IFTA 1SYDA 5CV8A 2N55A 1I6VC 1HZBA 1SLJA 4QCLA 1FJGL 5A2QE 1GD7A 1EZ8A 3C3LA 2G9HD 1YHQA 2E8GA 3DWQA 2A6HD 2PQAB 1H9RA 4IUPA 4KHVA 2ZXRA 3W1GA 2K5VA 5EBCA 4HIDA 2UUCL 4A3GB 2I5LX 5CGKA 3CHBD 2UUBL 4ULLA 4K0KL 1RJTA 1IL2A 4K14A 3NXWA 2SNSA 1N34Q 5M3FB 5M3MB 4UP9A 3LWEA 1E22A 1VQ6A 3HOVG 3DUZA 1ICWA 3EIVA 1BCPF 2MO1A 4FDBA 4X64L 3S1MB 3UDIA 2OWOA 4Q0FA 5T1GA 3U58A 4HCEA 3TP5A 4DV6L 4NW2A 4BS9A 2Z4HA 2K05A 4K2KA 4OX9Q 1RD9D 1C9OA 5DM63 3CQZB 3S14B 2UUCQ 2XRQD 4EGVA 2VW9A 1DD2A 5JVH3 2Z4IA 1BUVT 5C3EB 4K0KQ 3F2CA 1I50H 2ICIA 2F0QA 1AEXA 1SFOB 3P1HA 4A3EB 1TY2A 1DZ1A 3RNUA 4QQBX 5C0XI 1NJIC 4X64Q 1Z6HA 1QCBD 3I4NB 1PXUA 4JCVE 3Q23A 1B50A 4DV6Q 2B2YA 5GADC 2R3ZA 3NE5B 1CQFA 1TS5A 2K1BA 4Y7NH 5IYBG 5LL6X 2GVBA 4AYBB 3TN2A 1O7YA 2CWAA 4MN3A 1Q8KA 1RDPD 2L12A 5J3BA 1CUKA 4GKKL 1SYFA 2F03A 2D0PA 4K6DA 1HR0Q 1J5EL 2JA7B 2OTLA 1DOLA 1J6QA 3EFXD 5FLXc 3I4LA 4V0BA 1LT6D 2N78A 1Q1BA 4B9XA 4LFCQ 1JC7A 1H95A 4XQNA 1TR5A 4IZ8A 4Y52H 3NPPA 1PTOD 1KRTA 4S3SA 2PZWA 2BE5C 1G51A 5I9PA 5HGTA 4QF4A 1VQ7A 5FLXL 2R92H 1KC8C 5HGQA 5I2YA 2YTXA 2J7ZA 2Z1CA 3T13A 1SBBB 1LTTD 2R6GA 1IKMA 1HR0W 3CCEA 2FMCA 5I9OA 5C4HA 3NTIA 1L0YB 4LUZA 1X9NA 3TSSA 1YI2A 3H91A 5BN3A 1E2ZA 1ML0D 1KDCA 2F1MA 4PNYA 1TS2A 3OOCA 2JE6I 5FO7B 3H0GH 3M4OH 1B70B 4CKCA 2R7ZG 2VQEQ 1AE2A 3JAME 3ULPA 1IXRA 1OXTA 4B3RL 1DM0B 3E9IA 4DA2A 3HKZG 2F0NA 2Z0SA 1W2BA 3PIP3 4RWSC 2HIXA 1O7ZA 3I2ZA 4DUZQ 1KLUD 5CYUA 3MFYA 2MP1A 5EJWA 3T4AC 1R4PB 3T1YQ 1K3RA 3CAMA 1ZYRD 3SGIA 5ELOA 3L9AX 4K5WA 4KK7A 4OEMB 5EGTA 3HOWH 3FKIH 2H4OA 1L0WA 5M5XH 1XMQL 3J7AV 2FHTA 2ID0A 1I4QA 3R8BA 4IJLA 3T16A 4X66Q 3KOJA 1EY6A 3T51B 1RTOA 3D31A 4HIMA 4IO9A 1YVCA 5DM73 4BXXH 2WB1B 4LF9Q 4IUTA 3SK8A 3HOXB 4GS3A 1STEA 3OYYA 4BA1I 2G9DA 4A3BH 4XDXA 1SMYC 1TS3A 4X3SA 1NNXA 1WTPA 1PH3A 1MGSA 5KIXA 1QOHA 1XTDA 1OXXK 3M4QA 4H13C 1D5XC 4OXPA 4A3LG 3NBIA 1PYBA 2N8NA 3NENA 4H7BA 1NUCA 1SYCA 4NP5A 3RZOB 1VQJA 3T1HL 2I5MX 4WJ3M 4KV6A 2KCNA 4DR5L 2E2HH 1S40A 4BA2I 1HFGA 3BZCA 2J4XA 3D4DA 3R2TA 3I55A 1G2TA 1CZGA 2QKIC 3CCMA 5CR3A 2EJGC 2WB1E 1PH9A 5M5WB 3MEFA 4DAPA 1E2WA 4P74A 4RCOA 5IP7H 3M7NA 2R7FA 2YYZA 2CW0C 4A3FG 4L63B 1CKOA 5KRUA 1HJPA 1TIID 3RN2A 1CQVA 2MPMA 2R92G 1HZCA 4B08A 3MVVA 1F2LA 3OW7A 3CCSA 4B3TQ 1I94L 4X3UA 3UE1A 1MSHA 1SMXA 4NB3A 4DF7A 1QE6A 1HZAA 2C9OA 1AZPA 2WKCA 4I7AA 3X3MA 4RGMA 1B3QA 2DY7A 2F3WA 2WV6D 1D7QA 2UXCQ 2EYPA 5L37A 4FXKC 4WFN3 3CC2A 2OF1A 4OO1H 3Q8DA 2IW3A 1EEID 3J7ZC 2RKSA 1H9MA 4X62L 2PZUA 3ER0A 2TSSA 3A0JA 2VNUD 4RKLA 2ALYB 3HKZB 1VQGA 3HP3A 4HCSA 1N32L 2Z8LA 4JYAQ 1EY0A 1QJOA 2B2VA 4C2MH 1EQVA 4ZQ3A 3TZDA 3JAMi 4A3CH 1HH2P 3JAMc 4GOPB 1KAWA 5CORA 4JI2L 2H1EA 1CKNA 1WTXA 1EYDA 2Q8RE 1KNAA 5IOCA 1CA5A 2K5NA 2JA8H 1I50B 3M4YA 3FPPA 1MKHA 4JI3L 1G8ZD 2B2YC 1STNA 2G5DA 1Q7YC 3C2PA 5M5YB 3HKZE 1CK1A 5IGCA 4DV0Q 1V1OA 1LTRD 1NCVA 2KEEA 2NTSA 1EIHA 2F0LA 2F0KA 3JAML 1ZXTA 1PV4A 5IYDH 4Y7NB 1UEBA 1N32Q 4LF7L 5C3XA 2MHVA 3NEMA 3TS2A 3F2UA 3KF8B 3W2DA 4DR7Q 1I3QH 5IY0A 1F9QA 4I7ZC 1PFBA 1F2YA 4JI3Q 4DV7L 3F1ZA 2MNAA 5IGGA 4PMBA 1DGSA 3L7ZC 1QVCA 4KY5A 3BYTB 5JOBA 2A68D 3QO2A 3GDEA 2FINB 1YEZA 1SNPA 3UE0A 3HEJA 4A3IH 1EY4A 2HCIA 2L55A 1C0AA 3U50C 1JWMD 4YWKA 2ATWA 1OXSC 2R92B 4LF5Q 2VS1A 4MIUA 4C3HH 3G4SA 4HIOA 3KUPA 1EY7A 4F7XA 1KQSA 4AQYQ 2A8VA 3HS0C 4DV7Q 1LYLA 5K5PA 1CKNB 1JT8A 1EOTA 4PMWA 3B6YA 1AW7A 1YJ9A 2JK8A 2A19A 2AQ2B 1PVOA 2EY5A 3I73A 3HKSA 1Y1WG 3H0GB 1XTCD 4LFBL 4A3KH 1IW7C 1UE5A 3M4OB 3PIPA 4A3JB 1VQ9A 5D65A 4X65Q 3I4MG 1N9WA 1SFOH 3U9SA 1OXVA 2VY3A 3MFGA 4K8JA 3AFPA 4GLXA 1B9MA 1HHVA 1WTQA 4CGYB 3E3XA 1BR9A 4A93H 1JJGA 1X3QA 3TZUA 3OWEB 4K8IA 3KDFB 1BNZA 3MAQA 4YWLA 2Z6KC 1HNZL 5DEHA 4HJ8A 4N9PA 1RTNA 3OMCA 5JEAH 3J7AF 3KJPA 3FKIB 1PH4A 4B3ML 3HOWB 5KYIA 1G291 1A2UA 1NBWA 4UDUC 5M5XB 3S2DH 5ELEA 1X55A 3RLOA 4HMJA 4LFBQ 3NWSA 3PIOA 1VQAA 3MA2B 2V4DA 1CM9A 2F0VA 4KD3A 5AJ3Q 1D6EC 2K03A 1KTKA 3SK5A 3MC0B 4GOPC 1AP0A 5LHY1 4A3BB 2CQAA 1EYCA 3DWAA 4IURA 1TY0A 5CMDA 4LUVA 5C0XH 3NTKA 3GTJH 4LNQA 3CPWA 5EBDA 4P71A 4JI0L 1CKMA 1PYWD 1WTVA 1VQOA 4JI6L 3E0EA 4WJ4A 1Q90A 3P20A 4KD4A 3K80C 1Y1VH 2XVSA 1TVXA 2RHQB 3VR2A 1U4MA 2ZT9C 2E2HB 3NHHA 1WD1A 1P16A 4NDXA 1QB5D 2N88A 3E5SA 4A3GG 2CHBD 2O4XA 3QOJA 1JE4A 1X65A 4IJHA 4TVAB 2D2CC 1ILPA 1RKNA 3HG9A 2IY5B 5M3MG 2E75C 4YHHL 1SEBD 4QJFA 5TSSA 3BZKA 4CDDC 2F0WA 4DR6L 4C3HG 1SR3A 4FXDA 2GVAA 2VB3X 5K36H 4HJ7A 4C56C 2K5WA 3CMAA 4L6TB 1LTBD 1Q3LA 2NZ1D 3GD7A 4LFAQ 2JA5H 2HHHL 3D8GA 1R9TH 2PQAA 3TS0A 4ZKCB 5C44H 3P7JA 1BCPD 1N36L 5C3EG 1RL2A 4JI1L 1LO5D 3U4VA 4DV1L 3OTOL 4R4CA 3AQQA 4CDCC 2KHIA 2WINB 2N49A 2SEBD 2AKWB 2R93H 2B2VC 3KLSX 4A3EG 2ES2A 1PRTB 2EVBA 3MTSA 1PA6A 3FVQA 4HIKA 1S5ED 3W3AA 1YNJD 1RCVD 3PUXA 4C2MB 1SNOA 4O2DA 2F0TA 1JOOA 1V9PA 1PZKD 1LACA 3I90A 5JEAG 4AYBG 3NBHA 4Z9CB 4RKBA 1LTID 4A3MH 5CBAE 2PZTA 2JA8B 1HQMC 1O80A 4JI1Q 2NVTH 3SE0A 2BCOA 1VQHA 4DV1Q 2F0JA 2JA7G 4MZ9A 4QUCA 1IBML 2DJFC 4FNFA 1KDBA 5C4ZA 1Y8OB 1MSGA 2F0GA 3S16H 1FL0A 4JBWA 4YIJA 1J9OA 2MFIA 2KA7A 1F9PA 1KRSA 2EYHA 2B2WA 1N34L 3IKJA 2RCNA 5C5MA 3EBEA 2NN6I 5C0XG 5ELDA 3H6MA 4J6HA 1M90C 5C6AA 1EIFA 2K04A 1I3QB 3KLRA 1CT1D 3K0XA 3VA5A 1XNQQ 5IP9H 1VQLA 1WCMH 1WOCA 3SR1A 1CI3M 4P73A 1HFNA 1S5CD 2DN8A 2EZVA 4OX9L 1IBMQ 1Z9FA 1YNNC 4ODGA 4QL5A 4RGOS 5IIFA 4BY7B 1HUMA 1CFMA 4A3IB 3W1BA 3L2PA 3BJUA 1TWGH 1SYGA 2OCEA 5IE8A 4IFDG 2AUJD 2KCCA 3VDYA 1HPCA 4RAUC 4MNOA 2RDHA 3M3YH 2B29A 5GAEC 4GLVB 1SNMA 1CZWA 1FVIA 4DR4Q 4C3HB 2VUMH 1LTAD 3A7AB 4P2CB 3DEPA 2F0IA 1WTOA 3S1RH 5JEAJ 1SROA 4ME3A 1SJHD 3CCVA 3NBHB 4GKJQ 5C44G 2NBFA 2HIVA 4DUYL 2JSOA 3PQIA 2OQKA 1QWYA 1F9RA 3PO2H 1SNQA 2LXKA 5LMNQ 1KIXA 4CBVA 4DPGA 5J22A 3OHXC 4A3KB 4HAEA 4IUQA 3MXNA 1HR0L 5EPJA 1AN8A 1TXYA 3H3VI 5C4XH 2XWJB 1PTOH 1H9SB 2BH2A 3K0YA 4A4IA 2A69C 2PYKA 3AFQA 3HOYH 5EAYA 5CV5A 1SE8A 3BVMA 5M5YH 5C0XJ 4RHSA 4LFCL 4A93B 1I4PA 2WB1G 4HN7A 4QB4A 3HOXG 4JBKA 5ELBA 4LF6Q 4I65A 1EFWA 4LW1A 4OIJA 1Q46A 2F0OA 2K28A 1PH2A 3LWUA 1WJJA 2R7DA 1BDOA 4DUYQ 2ZXOA 3K6OA 4PG3A 5E4XA 3ZJYC 3S2DB 3PGZA 4M1UB 5LMNW 1PRTC 1UE1A 1MJCA 2E5LQ 2M2LA 4KMUC 4GN4B 4UP8A 5G3LF 2YTVA 1JJ2A 3KBGA 4JC0A 3K5NA 1IYJB 1SSOA 3CW2C 3P75A 3ICEA 3CCUA 4IFDJ 2A1AA 2JEAI 1NSNS 1UNSA 3QJYA 4KHPL 2HT1A 3PV0A 1UUPA 3STBD 2CH4W 1LM0A 4ZK9B 1JB7A 4AYBE 2VQEL 3GTJB 4EQPA 1AZQA 1D8LA 2EYLA 4C3JH 2MO0A 2F0MA 5FLMH 1SAPA 3BVGA 4FF1A 1AE3A 1STBA 1Y1VB 2HCCA 1G6ZA 4UHVA 2I0QA 2I46A 5LMUL 1X6OA 2O2LD 1XYIA 3DMUA 3GTKH 3GTMH 1PH5A 2E74C 3TDQA 4NPSA 4DUZL 4LK1C 4ALPA 2AQ1B 2HDLA 4QY7A 2F0SA 4DKAC 4H02A 5GAGC 1K8AC 3T1YL 1BBWA 1R4QB 2E76C 1I5FA 3GV6A 1RIPA 3HOUH 5DNFA 3MXNB 2HQEA 4KHPQ 1NE3A 3K59A 4X66L 3OW2A 1JMCA 2PNHA 3WOEA 4KTAA 4G4KA 3RLFA 4A3JH 4IPDA 3GTQH 3VYSA 2KCMA 4DN4M 1Y8PB 4OONA 4BBRH 4LF9L 4IOCA 2ASBA 3EQLC 5LMUQ 3LX0A 2X6LA 2JA5B 5IODA 3U4ZA 2NUCA 1JOQA 1R9TB 3TP7A 3PO2G 4CJ1B 1S5FD 2B3GA 2EXDA 5C44B 4DR3Q 4R9WA 2ZM6L 3A56A 2FJ2A 2P5ZX 5EPKA 5FO9B 1T5XD 3FP9A 5C4XG 2NTTA 4JI4Q 1A8VA 1RODA 2R93B 2AMCB 3HOYG 3O13A 2Z6KA 3HZXA 2XRSD 4QUFA 2HQLA 4R4OA 4JK1C 1XJVA 1VQEA 2OT2A 1UWVA 2BA0A 1DOKA 2NWGA 3HGBA 3FPUB 4ZLTF 3PCOB 2HD3A 1TWFH 5C5LA 3I3CA 2ZTCA 3JC66 1XMOQ 4A3MB 3GTOH 5BR8L 1F2MA 1JR0D 3A5UA 1CTMA 4GOPA 4XXEA 4B9WA 2LSSA 2NVTB 2ZM6Q 5ELCA 4B3TL 4HJAA 2NVYH 5C4JH 4GN5A 2B2WC 2L4NA 1J8IA 4PZ7A 3UDFA 4DAVA 4AIMA 3J80c 3V96A 3S16B 4CKBA 3K5LA 1QVGA 1JWUD 4GNXB 3CKIB 1VF7A 1S3OA 1MIUA 2UXCL 4NXNL 2JXMB 1ESRA 2XN9C 4C3JG 2A6ED 4POFA 4L5RC 2O5JC 2KHSA 4MTNA 4DFAA 4K6LA 2H5XA 4LF8Q 1GUTA 3J80L 1JWSD 5BR8Q 2L15A 1YZ6A 5FK9C 1WCMB 4FF4A 2CFMA 3Q24A 3KF8A 4CKEA 4LF4Q 3K5OA 3A5ZB 3CD6A 5A35A 4JYAL 2PNRC 3F2DA 2F4VQ 4G7ZC 1B44D 2ZJPA 4IUNA 2VXWA 3KLWA 5T1IA 1TWGB 1B2TA 3NWTA 2EE1A 3CMEA 3H0GG 1YIJA 4CDFC 4NXNQ 3FMCA 4GZYC 4A3JG 3M3YB 3IAYA 1PZID 4HSVA 1BQQT 3CRLC 1IKLA 1K73C 2VUMB 4DV5Q 2SNMA 1FYCA 4DV0L 4JBMA 3N52A 4JOIC 2F3IA 3K7UC 1WTHA 3T53B 3S1RB 1LLRD 5COYA 5JAVA 2OTJA 2UXDQ 5ELNA 3MXPA 1YJNA 3PO2B 1KLGD 1K83H 1UAPA 1LV9A 4DR7L 3HOWG 3FKIG 4HEDA 1UEAB 4IUVA 1N33L 2SOBA 5C4XB 2EOTA 3GV3A 1PTOB 4NXML 2PI2A 1U0LA 2PQEA 3HOYB 5FJ8H 1WVLA 1FR3A 4BXXG 1D2BA 4UY8C 1VDZA 1CSPA 5CC4A 1O7LA 1SDFA 4L8JA 5JJZA 3HOZH 3FRPB 4DNIA 4ZAIA 1N8RC 4A3BG 3ERSX 4NKLA 1C4QA 4IALA 2KECA 3FHWA 3GO5A 1W3SA 1X3EA 3RD4A 3KDFA 1TWCH 3ND9A 3M85A 3KFUA 3J81c 4IN3A 2BDNA 4LF5L 1A15A 3BDLA 3D6WA 2PMZB 4ABNA 1N33Q 4CHTB 4AQYL 3NK9A 4NXMQ 4FF2A 3K8AA 2B63H 3I72A 3C1FA 2A6HC 4DNRB 4K5XA 2B2TC 1Q8IA 4FXGC 5IP7G 2IHEA 1GVPA 2NYZD 1FNVA 4FO2A 3J81L 4BY7H 1CHQD 3FEWX 2JA6H 3S24A 4C3JB 4NMZA 4X65L 1Y8NB 2VQFQ 3DXJC 2PMZE 1I4XA 2F0HA 1P8LA 2OXPA 4GNXC 3GTKB 3GTMB 2C5CA 3LNNA 4R8NA 4J15A 5JJLA 1GJXA 2IT1A 4XQQA 1EWHA 1DCZA 4DXFA 2E2IH 1LABA 2EIFA 2PCFB 3HOUB 1ET6A 2B2UC 4A76A 2PW7A 2LMCB 3E6ZX 1X3FA 5AFWA 1ZEQX 2A73B 2BE5D 1Z47A 3D4RA 4ZRZA 5KEEA 1EYGA 2GN5A 3GP7A 1ICFB 5M9OA 4OO1G 3QIAA 3GTQB 4G7OC 3H94A 2I07B 5AJ3L 4RGTA 1C8CA 3GTGH 1OXUA 1ESFA 5DAUA 1MD2D 4BBRB 1U4RA 4DNTB 4HTHA 1I4GA 1HNWL 1NAPA 1I6HB 4XYOA 1BBUA 2L0CA 4A3CG 3KK7A 1HCZA 2LFNA 2FXQA 1BOSA 1VQDA 3OSOA 1M1KC 5HY6A 4KLKA 1B1ZA 2JA8G 2PI2E 1DYQA 2BA1A 4HJ5A 4J1MA 3Q6SA 1TWAH 1HNXQ 1GXDC 1S5DD 3RMHA 2WKDA 3F2BA 4KJNA 4JI8Q 5I2XA 4FVMA 4HJ9A 1HRJA 1U4PA 4QGUA 3H3VH 2EJFC 5IYDG 5I6WA 1W6JA 3EVQA 2BDOA 4KI0A 3STBC 4YCWA 1PFNA 1TWFB 2V1CC 3ULJA 1VQ5A 2D5DA 1HNWQ 3IL8A 5C3WA 3GTOB 1PTOC 3KF6B 4DR1Q 1H9JA 4WRDA 5LL6S 3K7AH 4IOAA 1SE2A 5IWAQ 2X6GA 4G7HC 1VQ4A 4F87A 2NVYB 1TWHH 1PYSB 5C4JB 3A8JE 2KHJA 1PZJD 1EU3A 3I70A 2PPBC 1K3BC 3QR8A 2B63G 4LWCA 4OWWB 1PRTF 4DK0A 1QZHA 4JV5Q 4LFAL 2Y0SG 3CXCA 2EYFA 1KHIA 2DUDA 4HSPA 2N3SA 5H1SE 1SMYD 4L5QA 1MI2A 4BY7G 2RSOA 2WAQG 4E6IA 4TQUS 3D3RA 1FD7D 4A3IG 1A3UA 4KY6A 4RFBA 5I6YA 1L1OA 2SDFA 3SVMA 5F2DA 3VR5A 2F52A 3PUZA 5HURA 1GUOA 4UPAA 1LTGD 1OO9B 1FNWA 2RSNA 5JJIA 1SE3A 3S1QH 2K75A 1KL9A 3NSWA 3LGJA 1LT4D 5JPNC 4M8AA 3D0FA 1XNRL 1XPOA 1STHA 2CCZA 3VYUA 4PQXA 1JB3A 2VZAA 2X69A 1LT3D 2CW0D 3MXUA 1ZYRC 4R4TA 2O5IC 1I4RA 3HOVH 1EUJA 1LT5D 4A3KG 2EYOA 4IUUA 2TMPA 4OWTB 4POGA 4DAMA 2K14A 1HXYD 1MJEA 2F0FA 1EEFD 2NVXH 3M4PA 1BVSA 2QEJC 1QNUA 3MWYW 1K8MA 1V1PA 1D1IA 5KYLA 1DONA 2DY8A 3AEVA 2QW7A 3QOLA 4A93G 1JCKB 1STAA 2JEBI 4K5VA 1SXTA 1U9RA 4RCNA 4BBSH 3L3OC 1E2VA 1PLFA 1K83B 1XNRQ 4DV2Q 2AWOA 1VQFA 2PO4A 1RHPA 2Q2HA 4ZUJA 1XNQL 3TP8A 2EQSA 3SHLA 2IHFA 2LS01 3HFZB 4RA8A 1HTPA 3AU7A 5KNCA 3E0JA 2RDFA 5I4DA 1TU2B 4TRDA 3VA7A 1IBKL 2UUAQ 1H9SA 4FF3A 5EKIA 1ZKOA 3HOZB 1ILQA 1E0BA 1NR2A 1STGA 1JJCB 1X56A 5IYBH 1VQBA 1L1OB 5IGFA 1JQYD 1TWCB 1IBLL 4F8MA 3WOFA 4HR7B 3QG1A 3W5OA 1PDQA 2DNEA 4B3SQ 4DR4L 1Y1VG 2YTYA 4DK1A 3S9WA 3GTLH 5IT9E 4JBJA 4JG2A 3GTPH 2B63B 4KKUA 4P72A 4GKJL 4ID6A 2Y0SB 1XWEA 5FKAC 3TQYA 1IBKQ 5LMNL 1KXLA 4EQ5A 3AB9A 4RHRA 2WAQB 4JI7L 3RZDH 2JA6B 3NUCA 2EDGA 2JJQA 1QUQA 3C46A 4RH6A 4JW0A 1V1PB 1Q1EA 4KJOA 1IBLQ 3DHQA 2QILA 4CDEC 2Q2TA 3A8KE 1XX8A 4EVOA 1VQKA 3VR6A 1S5BD 1EU4A 1ONLA 4YCVA 5K36G 1A62A 3K5MA 1B53A 4LF6L 2XWBB 5JVG3 2RF4A 2BOSA 2JA5G 2E2IB 2Y0SE 3EN2A 4YY3Q 2EPBA 3RN5A 1GUWA 1ET9A 3D6CA 3A74A 3C1EA 3X3NA 5E3FA 3OIPA 1G2SA 4JOIA 4IPHA 2WAQE 1HTLD 1Z7TA 4CJ2C 1Q82C 2E5LL 2R7ZH 2KUMA 2KCTA 3BU2A 4JI7Q 2R93G 1EIYB 2NB0A 5D3DA 2ENBA 3CCRA 3GTGB 1LTSD 1VQCA 1EL0A 1IHZA 1ENCA 1VF5C 1FJGQ 1EYAA 2VB2X 4C3IH 3PF4A 5BN5A 2WP8J 1EQQA 4XT1B 5FO8B 5E1FA 3DLLA 4TKOB 4BBSG 2K4KA 3J80E 3VYTA 1SRUA 2UUBQ 3G6JB 2RA4A 4X3TA 5ELFA 4DK3C 1SYBA 4UP7A 1QZGA 1D5ZC 1FGBD 4A3MG 3AYHB 1IW7D 1FNUA 2EYJA 5JPMC 2CVRA 4U673 1TWAB 2LXJA 2GA4B 5EKLA 3OPOA 1YNXA 1BXTA 1VQPA 4DAYB 1F77A 1JOKA 1B3AA 5CV7A 4KKTA 2Q8TA 1Y69U 1WYDA 4N8X1 2XSCA 3E9HA 2KBNA 2KOLA 2A68C 3DEOA 2NZOA 1OTCA 5ISRA 3M7GA
chains in the Genus database with same CATH topology
2KQ3A 3SDZA 1M4VA 3R2IA 4KHZA 1BF4A 1EY5A 1VMPA 3K7AB 1BCPB 1A3VA 2B2TA 1TWHB 2EY6A 3OMGA 3BDOA 1HQRD 4IFDI 2B8GA 4R8IA 4CJ0B 2LKVA 2AWNA 3D4WA 4OGQC 1V8QA 1B9NA 3Q22A 1H9KA 3NQIA 4TSSA 4QMGA 2FFKB 1GHKA 2B2UA 3S1QB 2K5DA 4FYDA 2IJ0A 1K8OA 2JP1A 4KN4C 1SNDA 2AUKA 1SNCA 5D14A 3ONAB 2RQXA 2JYOA 1A6XA 5IT9L 1GUNA 1U4LA 2L1BA 3HOVB 5KNBA 2NVXB 1GUSA 2F0EA 4C3IG 3J81E 2EJMA 1EFID 2A74C 1ENAA 2M00A 5A2QL 3A55A 2L11A 2J0TD 4BBSB 4ILWA 3AMUA 3TMEA 4H44C 1VMCA 4RGNA 4V190 3WDNA 5D3IB 3SK4A 2B39A 2EYMA 3KLSA 3PIO3 5EPLA 1T5EA 3BZDB 2L9HA 3R93A 2ZXPA 2YU9B 2F0UA 3BVZA 4J8QA 1C48A 3UI2A 1BO0A 3A7LA 1TQOA 3I91A 2IX0A 5IGEA 3NP8A 1DXMA 1PTOF 1B4OA 3GTLB 1SYEA 2K33A 3GTPB 3H3VC 4H0LC 4XQJA 1S4ZA 3VR4A 5IGDA 1TKWB 1GHJA 2AQ3B 1BCPC 1HA5A 3EROA 3RZDB 1A3TA 4KKSA 2DNCA 3NTHA 3GQBA 5J1ZA 4OL7A 1CA6A 2OEOA 5FOBB 1KDAA 2Q8IB 3VYRA 3QB3A 1YNND 1YNJC 5CV9A 2XNAC 3EA6A 1HA6A 3R3OA 5KGUA 1PFMA 1ENFA 3J7YW 3ITPA 2R7ZB 5CV4A 3ZYYX 3CU7A 1PMRA 1NR4A 5CV6A 5IGBA 2MGSA 4C3IB 2IX3A 3A54A 2K5QA 3PUVA 2IPKD 2F4IA 3H09A 2F3VA 1G91A 3V05A 3MHBA 3EJIA 4DU9A 4PMCA 4XTCS 4C1NK 1EZ6A 2EY2A 4O42A 2A69D 1SE4A 3K57A 3DWPA 4LMQD 1EIGA 2KVMA 3ERQA 2MUYA 1KABA 2K32A 1JICA 3BS1A 4IQZA 1PRTD 4XYQA 1IL8A 1Q12A 1L0XB 3G7LA 2NN6H 4ZUIA 3U9OA 4F88A 1M8AA 1I4HA 2LY7A 1HUNA 2KEDA 2IL8A 3MZ5A 2HDMA 2MJ8A 5NUCA 4A3FB 4HMIA 5BN4A 5E4WC 2RVLA 1VCIA 1JORA 2L5TA 3SK6A 1II3A 1IYUA 2QCPX 1EQTA 1IYVA 1W6KA 3PMFA 3S17B 4Q5VA 1A2TA 2IWHA 2RBMA 3NQTA 2XIWA 2RDGA 4C1NI 3K58A 1D1KA 3CRKC 4X3KA 2WACA 3PO3B 3DM1A 4QIWB 3BYYB 5EKKA 4EQNA 4ME5A 3S15B 4KN7C 2M9VA 3QWNA 3HRZC 3T56B 4U68A 1RF2D 3FDTA 3IFDA 4N9TA 2B8FA 3SXHA 2KJXA 2D9UA 3Q0AA 4FP5D 4G57A 4A3DB 1GUGA 3MEHA 2PW5A 4KY7A 4WORA 3TBIB 4EQOA 2HUGA 4ZYSA 3MXGA 4WJWA 4DXGA 4XIGS 5J39A 1WTRA 2ICEC 2EXZA 2NN6G 4O1NA 1F9SA 3BDCA 2E2JB 1SJED 2F0DA 4OO1I 1F2ZA 4DGZA 4ZKBB 4K2LA 3A8IE 2QDBA 1KAAA 5CBEE 4IFDH 1AFPA 3PUYA 1EY9A 3BG3A 4OIKA 3VR3A 1X32A 2A5HA 1XXGA 2K01A 2K6AA 2QF7A 3OIQA 2D62A 2F0PA 2FMMA 1Y1WB 4XT3B 4LJZC 1TS4A 3I4MB 3I8ZA 2NVQB 1O78A 1X3PA 3S1NB 4PV1C 2E2DC 5FLXE 2K7VA 2WIIB 3V2TA 1MBYA 4OHJA 3N6RA 4BWGB 2IX1A 3URYA 2A6EC 1STYA 3KBXA 3ND8A 5G3LD 2EY1A 3SEBA 1CHPD 1V43A 1EY8A 4UAIA 3RUZA 4BY1B 4MHEA 1QILA 4LAAA 1QNKA 1KNEA 5EQ0A 1WTWA 1DJRD 3OWFA 1QG7A 4DAYA 2R61A 5KNDA 3PUWA 3TP6A 3S2HB 1EWCA 1GOZA 1TT2A 1D5MC 1DOMA 1WD0A 1BBXC 3IFTA 1SYDA 5CV8A 2N55A 1I6VC 4QCLA 5A2QE 1EZ8A 3C3LA 2G9HD 3DWQA 2A6HD 1H9RA 4IUPA 4KHVA 2ZXRA 5EBCA 4A3GB 5CGKA 3CHBD 4ULLA 1RJTA 4K14A 3NXWA 2SNSA 5M3FB 5M3MB 3LWEA 3DUZA 1ICWA 1BCPF 3S1MB 4Q0FA 5T1GA 4HCEA 3TP5A 4NW2A 4BS9A 2Z4HA 2K05A 4K2KA 1RD9D 5DM63 3CQZB 3S14B 2XRQD 4EGVA 1DD2A 5JVH3 2Z4IA 1BUVT 5C3EB 2ICIA 2F0QA 1AEXA 1SFOB 3P1HA 4A3EB 1TY2A 1DZ1A 5C0XI 1Z6HA 1QCBD 3I4NB 1PXUA 3Q23A 1B50A 2B2YA 2R3ZA 3NE5B 1CQFA 1TS5A 2K1BA 5LL6X 4AYBB 3TN2A 1O7YA 4MN3A 1RDPD 2L12A 1SYFA 2F03A 4K6DA 2JA7B 1DOLA 3EFXD 3I4LA 4V0BA 1LT6D 1Q1BA 4B9XA 1JC7A 4XQNA 1TR5A 4IZ8A 3NPPA 1PTOD 4S3SA 2PZWA 2BE5C 5I9PA 5HGTA 4QF4A 5FLXL 5I2YA 2J7ZA 2Z1CA 3T13A 1SBBB 1LTTD 2R6GA 1IKMA 2FMCA 5I9OA 5C4HA 3NTIA 1L0YB 3TSSA 3H91A 5BN3A 1E2ZA 1ML0D 1KDCA 2F1MA 4PNYA 1TS2A 3OOCA 2JE6I 5FO7B 4CKCA 3JAME 1OXTA 1DM0B 4DA2A 2F0NA 3PIP3 4RWSC 1O7ZA 1KLUD 5CYUA 3MFYA 2MP1A 5EJWA 3T4AC 1R4PB 1ZYRD 3L9AX 4K5WA 4KK7A 5EGTA 2H4OA 3J7AV 2FHTA 2ID0A 1I4QA 3R8BA 3T16A 1EY6A 3T51B 1RTOA 3D31A 5DM73 2WB1B 4IUTA 3SK8A 3HOXB 1STEA 4BA1I 2G9DA 4XDXA 1SMYC 1TS3A 4X3SA 1WTPA 1MGSA 5KIXA 1QOHA 1OXXK 4H13C 1D5XC 3NBIA 4H7BA 1NUCA 1SYCA 4NP5A 3RZOB 4KV6A 2KCNA 4BA2I 1HFGA 2J4XA 3D4DA 3R2TA 1G2TA 1CZGA 2QKIC 5CR3A 2EJGC 5M5WB 4DAPA 1E2WA 4RCOA 3M7NA 2YYZA 2CW0C 4L63B 5KRUA 1TIID 1CQVA 2MPMA 4B08A 3MVVA 1F2LA 3OW7A 4X3UA 1MSHA 4DF7A 1QE6A 2C9OA 1AZPA 2WKCA 3X3MA 4RGMA 2DY7A 2F3WA 2WV6D 2EYPA 4FXKC 4WFN3 2OF1A 4OO1H 2IW3A 1EEID 2RKSA 1H9MA 2PZUA 2TSSA 2VNUD 4RKLA 3HKZB 3HP3A 4HCSA 2Z8LA 1EY0A 1QJOA 2B2VA 1EQVA 4ZQ3A 3TZDA 5CORA 2H1EA 1WTXA 1EYDA 2Q8RE 1KNAA 5IOCA 1CA5A 1I50B 3M4YA 3FPPA 1G8ZD 2B2YC 1STNA 3C2PA 5M5YB 5IGCA 1CK1A 1V1OA 1LTRD 1NCVA 2KEEA 2NTSA 1EIHA 2F0LA 2F0KA 3JAML 1ZXTA 4Y7NB 5C3XA 2MHVA 3F2UA 3W2DA 1F9QA 4I7ZC 1PFBA 1F2YA 5IGGA 4PMBA 3L7ZC 4KY5A 3BYTB 5JOBA 2A68D 3QO2A 2FINB 1SNPA 3HEJA 1EY4A 2HCIA 2L55A 1JWMD 1OXSC 2R92B 4MIUA 3KUPA 1EY7A 4F7XA 3HS0C 5K5PA 1EOTA 4PMWA 1AW7A 2AQ2B 2EY5A 3I73A 3H0GB 1XTCD 3M4OB 1IW7C 4A3JB 5D65A 3U9SA 1OXVA 3MFGA 4K8JA 1B9MA 1HHVA 1WTQA 4CGYB 1BR9A 1X3QA 3TZUA 3OWEB 4K8IA 1BNZA 3MAQA 5DEHA 4N9PA 1RTNA 3OMCA 5JEAH 3J7AF 3HOWB 3FKIB 5KYIA 1G291 1A2UA 5M5XB 4UDUC 5ELEA 4HMJA 3NWSA 3MA2B 2V4DA 1CM9A 2F0VA 4KD3A 1D6EC 2K03A 1KTKA 3SK5A 3MC0B 1AP0A 5LHY1 4A3BB 2CQAA 1EYCA 3DWAA 4IURA 1TY0A 5CMDA 5C0XH 3NTKA 5EBDA 1PYWD 1WTVA 1Q90A 3P20A 4KD4A 2XVSA 1TVXA 3VR2A 2E2HB 1U4MA 2ZT9C 3NHHA 1WD1A 4NDXA 1QB5D 2N88A 3E5SA 2CHBD 2O4XA 3QOJA 1JE4A 2D2CC 1ILPA 1RKNA 3HG9A 2E75C 1SEBD 5TSSA 2F0WA 4C3HG 4FXDA 2VB3X 5K36H 4C56C 2K5WA 4L6TB 1LTBD 1Q3LA 2NZ1D 3GD7A 3D8GA 4ZKCB 3P7JA 1BCPD 1LO5D 2WINB 2SEBD 2B2VC 3KLSX 1PRTB 2EVBA 3MTSA 3FVQA 1S5ED 3W3AA 1YNJD 1RCVD 3PUXA 4C2MB 1SNOA 2F0TA 1JOOA 1PZKD 1LACA 3I90A 5JEAG 3NBHA 4Z9CB 4RKBA 1LTID 5CBAE 2PZTA 2JA8B 1HQMC 1O80A 3SE0A 2BCOA 2F0JA 4QUCA 4FNFA 1KDBA 5C4ZA 1Y8OB 1MSGA 2F0GA 4JBWA 4YIJA 1J9OA 2KA7A 1F9PA 2EYHA 2B2WA 3IKJA 5C5MA 2NN6I 5C0XG 5ELDA 3H6MA 4J6HA 5C6AA 2K04A 1I3QB 3KLRA 1CT1D 3VA5A 3SR1A 1CI3M 1HFNA 1S5CD 2DN8A 2EZVA 4ODGA 1YNNC 4RGOS 5IIFA 4BY7B 1HUMA 1CFMA 4A3IB 1SYGA 4IFDG 2AUJD 2KCCA 1HPCA 4RAUC 2RDHA 1SNMA 1CZWA 4C3HB 1LTAD 3A7AB 4P2CB 3DEPA 2F0IA 1WTOA 5JEAJ 1SJHD 2NBFA 2JSOA 1QWYA 1F9RA 1SNQA 4CBVA 5J22A 3OHXC 4A3KB 4HAEA 4IUQA 3MXNA 5EPJA 1AN8A 2XWJB 1PTOH 1H9SB 3K0YA 2A69C 2PYKA 5CV5A 3BVMA 5C0XJ 4RHSA 4A93B 1I4PA 4HN7A 4QB4A 5ELBA 4I65A 4OIJA 2F0OA 2K28A 3LWUA 1BDOA 2ZXOA 3K6OA 5E4XA 3S2DB 4M1UB 1PRTC 2M2LA 4KMUC 5G3LF 3KBGA 3K5NA 1SSOA 3P75A 4IFDJ 2JEAI 1NSNS 1UNSA 3QJYA 3PV0A 1UUPA 4ZK9B 3GTJB 4EQPA 1AZQA 2EYLA 2F0MA 1SAPA 3BVGA 4FF1A 1STBA 1Y1VB 2HCCA 1G6ZA 2I46A 2O2LD 1XYIA 3DMUA 2E74C 3TDQA 4LK1C 2AQ1B 2HDLA 2F0SA 1R4QB 2E76C 3GV6A 5DNFA 2HQEA 3K59A 3WOEA 4KTAA 4G4KA 3RLFA 3VYSA 4DN4M 1Y8PB 3EQLC 3LX0A 2X6LA 2JA5B 5IODA 2NUCA 1JOQA 1R9TB 3TP7A 4CJ1B 1S5FD 5C44B 4R9WA 3A56A 2FJ2A 5EPKA 5FO9B 1T5XD 2NTTA 1RODA 2R93B 3O13A 4QUFA 3HZXA 2XRSD 4JK1C 2OT2A 2BA0A 1DOKA 2NWGA 3HGBA 3FPUB 4ZLTF 5C5LA 3I3CA 4A3MB 1F2MA 1JR0D 1CTMA 4XXEA 4B9WA 2NVTB 5ELCA 2B2WC 2L4NA 1J8IA 4DAVA 3V96A 3S16B 4CKBA 3K5LA 1JWUD 3CKIB 1VF7A 2JXMB 1ESRA 2XN9C 4C3JG 2A6ED 2O5JC 2KHSA 4DFAA 4K6LA 1GUTA 3J80L 1JWSD 5FK9C 1WCMB 4FF4A 3Q24A 3KF8A 4CKEA 3K5OA 5A35A 2PNRC 4G7ZC 1B44D 4IUNA 2VXWA 5T1IA 1TWGB 1B2TA 3NWTA 2EE1A 3FMCA 4GZYC 3M3YB 3IAYA 1PZID 4HSVA 1BQQT 3CRLC 1IKLA 2VUMB 2SNMA 1FYCA 3N52A 3T53B 3S1RB 1LLRD 5COYA 5JAVA 3MXPA 3PO2B 1KLGD 1UAPA 1LV9A 4HEDA 1UEAB 4IUVA 2SOBA 5C4XB 2EOTA 3GV3A 1PTOB 2PQEA 3HOYB 1WVLA 1FR3A 1D2BA 1VDZA 5CC4A 1O7LA 1SDFA 4L8JA 5JJZA 3FRPB 4ZAIA 4NKLA 1C4QA 4IALA 2KECA 3GO5A 3RD4A 3ND9A 3M85A 4IN3A 2BDNA 1A15A 3BDLA 3D6WA 2PMZB 4ABNA 4CHTB 3NK9A 4FF2A 3I72A 3C1FA 2A6HC 4DNRB 4K5XA 2B2TC 1Q8IA 4FXGC 2NYZD 1FNVA 4FO2A 3J81L 1CHQD 3FEWX 4C3JB 4NMZA 1Y8NB 3DXJC 1I4XA 2F0HA 2OXPA 3GTKB 3GTMB 2C5CA 3LNNA 4R8NA 1GJXA 2IT1A 4XQQA 1EWHA 1DCZA 4DXFA 1LABA 2PCFB 3HOUB 1ET6A 2B2UC 2PW7A 2LMCB 3E6ZX 5AFWA 1ZEQX 2A73B 2BE5D 1Z47A 3D4RA 4ZRZA 5KEEA 3GP7A 5M9OA 4OO1G 3QIAA 3GTQB 4G7OC 3H94A 2I07B 4RGTA 1C8CA 1OXUA 1ESFA 5DAUA 1MD2D 4BBRB 1U4RA 4DNTB 4HTHA 1I4GA 1NAPA 1I6HB 4XYOA 2L0CA 3KK7A 1HCZA 2LFNA 1BOSA 3OSOA 1B1ZA 1DYQA 2BA1A 4J1MA 3Q6SA 1GXDC 1S5DD 3RMHA 2WKDA 4KJNA 5I2XA 4FVMA 1HRJA 1U4PA 2EJFC 5I6WA 1W6JA 3EVQA 2BDOA 4KI0A 1PFNA 1TWFB 2D5DA 3IL8A 5C3WA 3GTOB 1PTOC 1H9JA 4WRDA 5LL6S 1SE2A 2X6GA 4G7HC 4F87A 2NVYB 5C4JB 3A8JE 1PZJD 1EU3A 3I70A 2PPBC 1PRTF 4DK0A 2EYFA 4HSPA 1SMYD 1MI2A 2RSOA 4E6IA 4TQUS 3D3RA 1FD7D 1A3UA 4KY6A 4RFBA 5I6YA 2SDFA 3SVMA 5F2DA 3VR5A 3PUZA 5HURA 1GUOA 1LTGD 1OO9B 1FNWA 2RSNA 1SE3A 3NSWA 1LT4D 5JPNC 4M8AA 1STHA 3VYUA 4PQXA 1JB3A 2X69A 1LT3D 2CW0D 3MXUA 1ZYRC 2O5IC 1I4RA 1LT5D 2EYOA 4IUUA 2TMPA 1HXYD 2F0FA 1EEFD 2QEJC 1QNUA 3MWYW 1K8MA 1V1PA 1D1IA 5KYLA 1DONA 2DY8A 3QOLA 1JCKB 1STAA 2JEBI 4K5VA 1SXTA 1U9RA 4RCNA 3L3OC 1E2VA 1PLFA 1K83B 2AWOA 2PO4A 1RHPA 4ZUJA 3TP8A 3SHLA 2LS01 4RA8A 1HTPA 3AU7A 5KNCA 3E0JA 2RDFA 5I4DA 1TU2B 4TRDA 3VA7A 1H9SA 4FF3A 5EKIA 1ZKOA 3HOZB 1ILQA 1E0BA 1NR2A 1STGA 5IGFA 1JQYD 1TWCB 4F8MA 3WOFA 4HR7B 3QG1A 1PDQA 2DNEA 4DK1A 3S9WA 5IT9E 2B63B 4KKUA 4ID6A 2Y0SB 1XWEA 5FKAC 3AB9A 4RHRA 2WAQB 2JA6B 3NUCA 2EDGA 3C46A 4RH6A 1V1PB 1Q1EA 4KJOA 3DHQA 2QILA 3A8KE 1XX8A 4EVOA 3VR6A 1S5BD 1EU4A 1ONLA 5K36G 3K5MA 1B53A 2XWBB 5JVG3 2BOSA 2E2IB 2EPBA 1GUWA 1ET9A 3D6CA 3C1EA 3X3NA 5E3FA 3OIPA 1G2SA 1HTLD 1Z7TA 4CJ2C 2KUMA 2NB0A 5D3DA 2ENBA 3GTGB 1LTSD 1EL0A 1IHZA 1ENCA 1VF5C 1EYAA 2VB2X 5BN5A 2WP8J 4XT1B 5FO8B 5E1FA 4TKOB 3J80E 3VYTA 3G6JB 2RA4A 4X3TA 5ELFA 1SYBA 1D5ZC 1FGBD 1IW7D 1FNUA 2EYJA 5JPMC 2CVRA 4U673 1TWAB 2GA4B 5EKLA 3OPOA 1BXTA 1F77A 1JOKA 1B3AA 5CV7A 4KKTA 2Q8TA 1Y69U 2XSCA 2KOLA 2A68C 3DEOA 5ISRA 3M7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ3 A;  4DU9 A;  3SK4 A;  2RKS A;  5KYI A;  2EYF A;  2EYM A;  1EZ6 A;  2PZU A;  4NMZ A;  3S9W A;  2EY2 A;  2EY5 A;  1SNM A;  1EY5 A;  2F0Q A;  2HQE A;  4RKL A;  1AEX A;  4E6I A;  3P1H A;  4N9T A;  3D8G A;  1A3V A;  3SXH A;  2F0I A;  2F0H A;  2OXP A;  1A3U A;  2F0U A;  4K5W A;  2EY6 A;  4ID6 A;  1EY0 A;  4KY6 A;  3OMG A;  4R8N A;  5EGT A;  1EQV A;  3V2T A;  5I6Y A;  4KTA A;  4IUN A;  4ZQ3 A;  4G57 A;  4K8J A;  5F2D A;  3T16 A;  1TQO A;  3ERQ A;  5HUR A;  1EY6 A;  1STY A;  5IGE A;  3NP8 A;  1EYD A;  3MEH A;  3NUC A;  2LKV A;  5IOC A;  1SNQ A;  1KAB A;  2PW5 A;  4K8I A;  2EY1 A;  3D4W A;  4KY7 A;  1SYE A;  3LX0 A;  4WOR A;  1EY8 A;  4EQO A;  2PW7 A;  3RUZ A;  5IOD A;  5J22 A;  2NUC A;  5DEH A;  4KJO A;  2SNM A;  1JOQ A;  4N9P A;  3DHQ A;  3SK8 A;  5KEE A;  3TP7 A;  3OMC A;  1STN A;  5M9O A;  4LAA A;  4EVO A;  1STH A;  1SYF A;  1SNO A;  5JAV A;  1A2U A;  2F0T A;  4K6D A;  5IGD A;  1JOO A;  2PYK A;  3OWF A;  5IGC A;  5CV5 A;  5KIX A;  2F0L A;  4HMJ A;  2F0K A;  4ZUI A;  3U9O A;  3TP6 A;  5J39 A;  3MXP A;  4QMG A;  3ERO A;  4RKB A;  2EYO A;  5DAU A;  1A3T A;  4QB4 A;  2PZT A;  3D6C A;  4H7B A;  1NUC A;  1SYC A;  1TT2 A;  2EXZ A;  2F0V A;  2F0F A;  3C1E A;  3HZX A;  4KD3 A;  3MZ5 A;  4HTH A;  4NP5 A;  5E3F A;  4B9X A;  5C3X A;  4I65 A;  3SK5 A;  5J1Z A;  3BDC A;  2F0O A;  2SOB A;  1SYD A;  4KV6 A;  1SND A;  4OL7 A;  2F0D A;  1SNC A;  2F0J A;  5CV8 A;  5NUC A;  2OEO A;  4HMI A;  5KYL A;  1TR5 A;  4IZ8 A;  1F2Z A;  3D4D A;  1KDA A;  1KDB A;  3OSO A;  5C4Z A;  2F0G A;  1EYC A;  3QOL A;  4DGZ A;  5CR3 A;  1EZ8 A;  2PQE A;  1STA A;  4S3S A;  2PZW A;  4YIJ A;  4K5V A;  2ENB A;  3QB3 A;  5I9P A;  1JOR A;  1F2Y A;  5CV9 A;  4QF4 A;  1U9R A;  5HGT A;  1IHZ A;  4J1M A;  4KHV A;  5C5L A;  1ENC A;  2EYH A;  4K2L A;  3SK6 A;  4PMB A;  2QDB A;  1KAA A;  5IGG A;  5CGK A;  4KY5 A;  5CC4 A;  1EYA A;  5C5M A;  1F2M A;  1II3 A;  4KD4 A;  4KJN A;  3R3O A;  5JOB A;  3T13 A;  5KRU A;  4K14 A;  3H6M A;  3NXW A;  4J6H A;  4NKL A;  2SNS A;  4IAL A;  2F0E A;  5E1F A;  4ZUJ A;  1EY9 A;  5KGU A;  3P75 A;  5I9O A;  5C4H A;  3TP8 A;  3NHH A;  3SHL A;  3MVV A;  1SNP A;  1NSN S;  3ITP A;  5C6A A;  5CV4 A;  3PMF A;  4NDX A;  3E5S A;  1SYB A;  3HEJ A;  5I6W A;  1ENA A;  3VA5 A;  1EY4 A;  1A2T A;  2RDF A;  3EVQ A;  2M00 A;  5CV6 A;  4B9W A;  2O4X A;  4TRD A;  5IGB A;  3BDL A;  3QOJ A;  3SR1 A;  2EYJ A;  4EQP A;  1KDC A;  2EYL A;  4PNY A;  5C3W A;  5EKL A;  2F0M A;  2RBM A;  3NQT A;  1RKN A;  4DF7 A;  3TP5 A;  3NK9 A;  1STB A;  4MIU A;  4WRD A;  4ODG A;  1JOK A;  2F0P A;  3C1F A;  1STG A;  5CV7 A;  3TME A;  2F3V A;  2F3W A;  2WAC A;  3DMU A;  1EY7 A;  4K5X A;  4F7X A;  2KHS A;  5IIF A;  2F0W A;  4DFA A;  4K2K A;  5IGF A;  5ISR A;  2EYP A;  5EKK A;  2F0N A;  4EQN A;  4ME5 A;  5K5P A;  2OF1 A;  2F0S A;  3MHB A;  4F8M A;  1SYG A;  3EJI A;  4PMC A; 
#chains in the Genus database with same CATH topology
 2KQ3 A;  3SDZ A;  1M4V A;  3R2I A;  4KHZ A;  1QUQ B;  1O7I A;  1BF4 A;  1EY5 A;  1VMP A;  1E7Z A;  3TRZ A;  4A3L H;  1K9M C;  3K7A B;  1BCP B;  1A3V A;  2B2T A;  3CCQ A;  1TWH B;  2EY6 A;  3OMG A;  5IP9 G;  1E24 A;  1WCM G;  3PSI A;  3BDO A;  1HQR D;  3G6E A;  4IFD I;  1B7Y B;  2B8G A;  4R8I A;  4GN3 B;  4CJ0 B;  2LKV A;  2AWN A;  1L1O C;  2ZTD A;  3D4W A;  4OGQ C;  2OQ0 A;  4YCU A;  1V8Q A;  4DR3 L;  4GNX A;  2CQO A;  1B9N A;  1PH1 A;  3Q22 A;  4A3F H;  4JI4 L;  2CWP A;  5IT9 c;  1H9K A;  3NQI A;  4GKK Q;  4TSS A;  4QMG A;  2VUM G;  2FFK B;  1GHK A;  2B2U A;  2Z9H A;  3S1Q B;  2K5D A;  1J5E Q;  4FYD A;  2XTI A;  2IJ0 A;  4APV A;  1A0I A;  1K8O A;  2JP1 A;  4KN4 C;  1SND A;  2AUK A;  1SNC A;  5D14 A;  3ONA B;  1UE7 A;  2RQX A;  2JYO A;  1A6X A;  1BKB A;  1I6H H;  1XMO L;  3S17 H;  5IT9 L;  1GUN A;  2Z6B A;  1U4L A;  2L1B A;  3HOV B;  5KNB A;  1G6P A;  1UE6 A;  2KEN A;  2NVX B;  1GUS A;  2F0E A;  3K81 C;  3PO3 H;  4C3I G;  1GO3 E;  3J81 E;  2NZH A;  1V1Q A;  2AHO B;  2EJM A;  1EFI D;  2A74 C;  1ENA A;  3S15 H;  2JN4 A;  2M00 A;  2K52 A;  3WWV A;  1PH6 A;  5A2Q L;  3A55 A;  2L11 A;  2J0T D;  4BBS B;  4ILW A;  1IZ6 A;  3AMU A;  2RHS B;  2C35 B;  3L0O A;  4LF8 L;  3TME A;  2ZJR A;  3IRB A;  4H44 C;  1VMC A;  1E1O A;  4LF4 L;  4RGN A;  4V19 0;  3WDN A;  5D3I B;  2F4V L;  4A3D H;  3J80 i;  3SK4 A;  4B3R Q;  2B39 A;  4MTK A;  4IPG A;  2EYM A;  3KLS A;  3PIO 3;  5EPL A;  1T5E A;  2JQO A;  3BZD B;  2L9H A;  4OWX B;  3R93 A;  2D0O A;  2ZXP A;  2YU9 B;  2F0U A;  3BVZ A;  4ZCK A;  1C7Y A;  4J8Q A;  1C48 A;  3CCL A;  1WFQ A;  3UI2 A;  1BO0 A;  2QA4 A;  3A7L A;  1TQO A;  3I91 A;  5FLM G;  5GRO A;  2IX0 A;  1JE5 A;  1ASZ A;  5IGE A;  3NP8 A;  4DV5 L;  1XMQ Q;  1DXM A;  1PTO F;  1B4O A;  3GTL B;  1SYE A;  2K33 A;  3GTP B;  4A75 A;  3H3V C;  4H0L C;  2E2J H;  2UXD L;  1K8G A;  4XQJ A;  1S4Z A;  3VR4 A;  1EOV A;  5IGD A;  1TKW B;  4O0A A;  2CKZ B;  1GHJ A;  3HOU G;  2AQ3 B;  1BCP C;  1HA5 A;  3TRE A;  3ERO A;  3RZD B;  1A3T A;  4KKS A;  1NTG A;  2ZJQ A;  2DNC A;  4JI5 L;  3NTH A;  3GQB A;  5J1Z A;  4OL7 A;  1CA6 A;  2OEO A;  5FOB B;  1KDA A;  3T1H Q;  2Q8I B;  1U5K A;  3VYR A;  4BBR G;  4DR5 Q;  3QB3 A;  1YNN D;  1YNJ C;  5CV9 A;  2XNA C;  3EA6 A;  1HA6 A;  3R3O A;  5IYC H;  5KGU A;  1PFM A;  1Y1W H;  2Q2U A;  1ENF A;  3J7Y W;  3ITP A;  2R7Z B;  5CV4 A;  3ZYY X;  3CU7 A;  4LUO A;  1K0S A;  1PMR A;  1NR4 A;  3I4M H;  1X54 A;  1VQM A;  5CV6 A;  2NVQ H;  5IGB A;  3PO3 G;  4JI5 Q;  2MGS A;  4C3I B;  2IX3 A;  3A54 A;  1I94 Q;  2K5Q A;  3PUV A;  2IPK D;  1GM5 A;  3S1N H;  2F4I A;  3H09 A;  3G71 A;  2F3V A;  1T9H A;  1G91 A;  3V05 A;  3MHB A;  3EJI A;  4DU9 A;  4PMC A;  4XTC S;  2VQF L;  4C1N K;  3J81 i;  3KYH C;  1EZ6 A;  2EY2 A;  2UU9 L;  4O42 A;  2CH4 A;  2I5H A;  4BY1 H;  2A69 D;  1PFS A;  1VQ8 A;  4A3D G;  4OEL B;  1SE4 A;  4X62 Q;  1B8A A;  3K57 A;  3TEH B;  3DWP A;  4LMQ D;  1EIG A;  2XGT A;  2KVM A;  3ERQ A;  2MUY A;  3G48 A;  3S2H H;  1ASY A;  5E7N A;  5GAH C;  1KAB A;  2K32 A;  4JI2 Q;  1JIC A;  3CP0 A;  3F8T A;  3BS1 A;  4IQZ A;  1PRT D;  1K28 A;  4XYQ A;  1IL8 A;  1Q12 A;  2MQH A;  1LTL A;  1L0X B;  1VS0 A;  3KF6 A;  3G7L A;  1YBY A;  2NN6 H;  2UU9 Q;  4ZUI A;  3U9O A;  4F88 A;  1M8A A;  1I4H A;  1EWI A;  4A3G H;  2LY7 A;  1HUN A;  2KED A;  2IL8 A;  1WI5 A;  3MZ5 A;  4GLA C;  2HDM A;  2MJ8 A;  5NUC A;  5M3F H;  4A3F B;  4HMI A;  5M3M H;  4LF7 Q;  5BN4 A;  5E4W C;  1HNX L;  2RVL A;  1VCI A;  4JI8 L;  1JOR A;  2L5T A;  3I56 A;  1VQI A;  3S1M H;  3SK6 A;  1II3 A;  1IYU A;  2QCP X;  4R1J A;  1EQT A;  1IYV A;  1NY4 A;  1PHJ A;  1W6K A;  3PMF A;  3CQZ H;  3S17 B;  3S14 H;  4Q5V A;  5IYC G;  4DR1 L;  1A2T A;  3PF5 A;  5C3E H;  2Q2I A;  5IWA L;  1XPU A;  2IWH A;  2RBM A;  3NQT A;  2XIW A;  5GQO A;  2RDG A;  4C1N I;  3K58 A;  1PH8 A;  1D1K A;  4A3E H;  3CRK C;  4X3K A;  4JV5 L;  2WAC A;  5FJ8 G;  3PO3 B;  3DM1 A;  4QIW B;  2BH8 A;  2VL6 A;  3BYY B;  5EKK A;  4EQN A;  4ME5 A;  3I4N H;  1YJW A;  3S15 B;  4KN7 C;  3HOZ G;  2M9V A;  3QWN A;  4R4I A;  3HRZ C;  1HZ9 A;  3T56 B;  4U68 A;  4PZ8 A;  1RF2 D;  3FDT A;  3IFD A;  4N9T A;  2B8F A;  3SXH A;  2K5H A;  2KJX A;  2D9U A;  2WFW A;  5DLQ E;  3Q0A A;  4FP5 D;  3J7A 5;  4BY1 G;  4G57 A;  1EQR A;  1YHB A;  1LUZ A;  2JA7 H;  1YIT A;  4A3D B;  1Q86 C;  1GUG A;  3MEH A;  4QIW E;  2PW5 A;  4KY7 A;  3CF5 A;  1QVF A;  1Q81 C;  2K50 A;  3CPF A;  4WOR A;  3TBI B;  4EQO A;  2HUG A;  4RG1 A;  4DV4 L;  2QGQ A;  4ZYS A;  3I7F A;  1HNZ Q;  2JA6 G;  3MXG A;  3KJO A;  4WJW A;  3RLN A;  4DXG A;  4XIG S;  4B3M Q;  5J39 A;  1WTR A;  2DGY A;  2ICE C;  2EXZ A;  2NN6 G;  4O1N A;  2UXB L;  1F9S A;  3BDC A;  2E2J B;  1YHA A;  1SJE D;  2F0D A;  4P75 A;  4OO1 I;  1FGU A;  1F2Z A;  1AH9 A;  2QDL A;  4DGZ A;  2YV5 A;  1L2F A;  4ZKB B;  1XPR A;  1X3G A;  1GKH A;  2DJG C;  5M3F G;  2RCF A;  4DV2 L;  1E3P A;  4K2L A;  3A8I E;  2QDB A;  1KAA A;  5CBE E;  4EX5 A;  4IFD H;  4DV4 Q;  1AFP A;  3PUY A;  3H15 A;  4YWM A;  1EY9 A;  4JI0 Q;  3BG3 A;  4OIK A;  4DK6 C;  4JI6 Q;  1SN8 A;  3VR3 A;  1X32 A;  2UUA L;  2A5H A;  1VQN A;  4DV3 L;  1XXG A;  1NMF A;  4L5T A;  2UXB Q;  2K01 A;  2K6A A;  2QF7 A;  4IPC A;  3OIQ A;  2D62 A;  1K0R A;  2F0P A;  3I4O A;  4DR2 L;  2FMM A;  1Y1W B;  1E1T A;  1MHW C;  4XT3 B;  4B3S L;  2ZTE A;  3J81 j;  4LJZ C;  4YHH Q;  3CCJ A;  1TS4 A;  3I4M B;  3I8Z A;  4RMF A;  2NVQ B;  3DM3 A;  4DR6 Q;  3UDG A;  4N8F A;  1O78 A;  1Y14 B;  1X3P A;  3NEL A;  3I4N G;  3RR5 A;  4L5S A;  1S72 A;  4PV1 C;  3S1N B;  2E2D C;  4DV3 Q;  3HOX H;  1NMG A;  4AH6 A;  5FLX E;  3CC4 A;  2K7V A;  2WII B;  4PZ6 A;  3V2T A;  1MBY A;  4OHJ A;  3N6R A;  4BWG B;  2HHH Q;  3ULL A;  2YU9 H;  2IX1 A;  5JJK A;  3URY A;  3M9B A;  1N36 Q;  2A6E C;  1STY A;  3KBX A;  3ND8 A;  5G3L D;  4DR2 Q;  2EY1 A;  3SEB A;  3OTO Q;  1KD1 C;  1CHP D;  3RZO H;  1V43 A;  4JVZ A;  1EY8 A;  4UAI A;  3RUZ A;  4BY1 B;  4MHE A;  1QIL A;  2QEX A;  4R4Q A;  2JA9 A;  1QNK A;  1KNE A;  4LAA A;  5EQ0 A;  3UDX A;  3CC7 A;  4JPB W;  1WTW A;  1A63 A;  4YY3 L;  1DJR D;  3OWF A;  1QG7 A;  4DAY A;  2R61 A;  5M5W H;  5KND A;  1PH7 A;  4X6A H;  3PUW A;  3TP6 A;  3S2H B;  1EWC A;  1GOZ A;  1TT2 A;  1CSQ A;  1D5M C;  1DOM A;  1WD0 A;  1BBX C;  3IFT A;  1SYD A;  5CV8 A;  2N55 A;  1I6V C;  1HZB A;  1SLJ A;  4QCL A;  1FJG L;  5A2Q E;  1GD7 A;  1EZ8 A;  3C3L A;  2G9H D;  1YHQ A;  2E8G A;  3DWQ A;  2A6H D;  2PQA B;  1H9R A;  4IUP A;  4KHV A;  2ZXR A;  3W1G A;  2K5V A;  5EBC A;  4HID A;  2UUC L;  4A3G B;  2I5L X;  5CGK A;  3CHB D;  2UUB L;  4ULL A;  4K0K L;  1RJT A;  1IL2 A;  4K14 A;  3NXW A;  2SNS A;  1N34 Q;  5M3F B;  5M3M B;  4UP9 A;  3LWE A;  1E22 A;  1VQ6 A;  3HOV G;  3DUZ A;  1ICW A;  3EIV A;  1BCP F;  2MO1 A;  4FDB A;  4X64 L;  3S1M B;  3UDI A;  2OWO A;  4Q0F A;  5T1G A;  3U58 A;  4HCE A;  3TP5 A;  4DV6 L;  4NW2 A;  4BS9 A;  2Z4H A;  2K05 A;  4K2K A;  4OX9 Q;  1RD9 D;  1C9O A;  5DM6 3;  3CQZ B;  3S14 B;  2UUC Q;  2XRQ D;  4EGV A;  2VW9 A;  1DD2 A;  5JVH 3;  2Z4I A;  1BUV T;  5C3E B;  4K0K Q;  3F2C A;  1I50 H;  2ICI A;  2F0Q A;  1AEX A;  1SFO B;  3P1H A;  4A3E B;  1TY2 A;  1DZ1 A;  3RNU A;  4QQB X;  5C0X I;  1NJI C;  4X64 Q;  1Z6H A;  1QCB D;  3I4N B;  1PXU A;  4JCV E;  3Q23 A;  1B50 A;  4DV6 Q;  2B2Y A;  5GAD C;  2R3Z A;  3NE5 B;  1CQF A;  1TS5 A;  2K1B A;  4Y7N H;  5IYB G;  5LL6 X;  2GVB A;  4AYB B;  3TN2 A;  1O7Y A;  2CWA A;  4MN3 A;  1Q8K A;  1RDP D;  2L12 A;  5J3B A;  1CUK A;  4GKK L;  1SYF A;  2F03 A;  2D0P A;  4K6D A;  1HR0 Q;  1J5E L;  2JA7 B;  2OTL A;  1DOL A;  1J6Q A;  3EFX D;  5FLX c;  3I4L A;  4V0B A;  1LT6 D;  2N78 A;  1Q1B A;  4B9X A;  4LFC Q;  1JC7 A;  1H95 A;  4XQN A;  1TR5 A;  4IZ8 A;  4Y52 H;  3NPP A;  1PTO D;  1KRT A;  4S3S A;  2PZW A;  2BE5 C;  1G51 A;  5I9P A;  5HGT A;  4QF4 A;  1VQ7 A;  5FLX L;  2R92 H;  1KC8 C;  5HGQ A;  5I2Y A;  2YTX A;  2J7Z A;  2Z1C A;  3T13 A;  1SBB B;  1LTT D;  2R6G A;  1IKM A;  1HR0 W;  3CCE A;  2FMC A;  5I9O A;  5C4H A;  3NTI A;  1L0Y B;  4LUZ A;  1X9N A;  3TSS A;  1YI2 A;  3H91 A;  5BN3 A;  1E2Z A;  1ML0 D;  1KDC A;  2F1M A;  4PNY A;  1TS2 A;  3OOC A;  2JE6 I;  5FO7 B;  3H0G H;  3M4O H;  1B70 B;  4CKC A;  2R7Z G;  2VQE Q;  1AE2 A;  3JAM E;  3ULP A;  1IXR A;  1OXT A;  4B3R L;  1DM0 B;  3E9I A;  4DA2 A;  3HKZ G;  2F0N A;  2Z0S A;  1W2B A;  3PIP 3;  4RWS C;  2HIX A;  1O7Z A;  3I2Z A;  4DUZ Q;  1KLU D;  5CYU A;  3MFY A;  2MP1 A;  5EJW A;  3T4A C;  1R4P B;  3T1Y Q;  1K3R A;  3CAM A;  1ZYR D;  3SGI A;  5ELO A;  3L9A X;  4K5W A;  4KK7 A;  4OEM B;  5EGT A;  3HOW H;  3FKI H;  2H4O A;  1L0W A;  5M5X H;  1XMQ L;  3J7A V;  2FHT A;  2ID0 A;  1I4Q A;  3R8B A;  4IJL A;  3T16 A;  4X66 Q;  3KOJ A;  1EY6 A;  3T51 B;  1RTO A;  3D31 A;  4HIM A;  4IO9 A;  1YVC A;  5DM7 3;  4BXX H;  2WB1 B;  4LF9 Q;  4IUT A;  3SK8 A;  3HOX B;  4GS3 A;  1STE A;  3OYY A;  4BA1 I;  2G9D A;  4A3B H;  4XDX A;  1SMY C;  1TS3 A;  4X3S A;  1NNX A;  1WTP A;  1PH3 A;  1MGS A;  5KIX A;  1QOH A;  1XTD A;  1OXX K;  3M4Q A;  4H13 C;  1D5X C;  4OXP A;  4A3L G;  3NBI A;  1PYB A;  2N8N A;  3NEN A;  4H7B A;  1NUC A;  1SYC A;  4NP5 A;  3RZO B;  1VQJ A;  3T1H L;  2I5M X;  4WJ3 M;  4KV6 A;  2KCN A;  4DR5 L;  2E2H H;  1S40 A;  4BA2 I;  1HFG A;  3BZC A;  2J4X A;  3D4D A;  3R2T A;  3I55 A;  1G2T A;  1CZG A;  2QKI C;  3CCM A;  5CR3 A;  2EJG C;  2WB1 E;  1PH9 A;  5M5W B;  3MEF A;  4DAP A;  1E2W A;  4P74 A;  4RCO A;  5IP7 H;  3M7N A;  2R7F A;  2YYZ A;  2CW0 C;  4A3F G;  4L63 B;  1CKO A;  5KRU A;  1HJP A;  1TII D;  3RN2 A;  1CQV A;  2MPM A;  2R92 G;  1HZC A;  4B08 A;  3MVV A;  1F2L A;  3OW7 A;  3CCS A;  4B3T Q;  1I94 L;  4X3U A;  3UE1 A;  1MSH A;  1SMX A;  4NB3 A;  4DF7 A;  1QE6 A;  1HZA A;  2C9O A;  1AZP A;  2WKC A;  4I7A A;  3X3M A;  4RGM A;  1B3Q A;  2DY7 A;  2F3W A;  2WV6 D;  1D7Q A;  2UXC Q;  2EYP A;  5L37 A;  4FXK C;  4WFN 3;  3CC2 A;  2OF1 A;  4OO1 H;  3Q8D A;  2IW3 A;  1EEI D;  3J7Z C;  2RKS A;  1H9M A;  4X62 L;  2PZU A;  3ER0 A;  2TSS A;  3A0J A;  2VNU D;  4RKL A;  2ALY B;  3HKZ B;  1VQG A;  3HP3 A;  4HCS A;  1N32 L;  2Z8L A;  4JYA Q;  1EY0 A;  1QJO A;  2B2V A;  4C2M H;  1EQV A;  4ZQ3 A;  3TZD A;  3JAM i;  4A3C H;  1HH2 P;  3JAM c;  4GOP B;  1KAW A;  5COR A;  4JI2 L;  2H1E A;  1CKN A;  1WTX A;  1EYD A;  2Q8R E;  1KNA A;  5IOC A;  1CA5 A;  2K5N A;  2JA8 H;  1I50 B;  3M4Y A;  3FPP A;  1MKH A;  4JI3 L;  1G8Z D;  2B2Y C;  1STN A;  2G5D A;  1Q7Y C;  3C2P A;  5M5Y B;  3HKZ E;  1CK1 A;  5IGC A;  4DV0 Q;  1V1O A;  1LTR D;  1NCV A;  2KEE A;  2NTS A;  1EIH A;  2F0L A;  2F0K A;  3JAM L;  1ZXT A;  1PV4 A;  5IYD H;  4Y7N B;  1UEB A;  1N32 Q;  4LF7 L;  5C3X A;  2MHV A;  3NEM A;  3TS2 A;  3F2U A;  3KF8 B;  3W2D A;  4DR7 Q;  1I3Q H;  5IY0 A;  1F9Q A;  4I7Z C;  1PFB A;  1F2Y A;  4JI3 Q;  4DV7 L;  3F1Z A;  2MNA A;  5IGG A;  4PMB A;  1DGS A;  3L7Z C;  1QVC A;  4KY5 A;  3BYT B;  5JOB A;  2A68 D;  3QO2 A;  3GDE A;  2FIN B;  1YEZ A;  1SNP A;  3UE0 A;  3HEJ A;  4A3I H;  1EY4 A;  2HCI A;  2L55 A;  1C0A A;  3U50 C;  1JWM D;  4YWK A;  2ATW A;  1OXS C;  2R92 B;  4LF5 Q;  2VS1 A;  4MIU A;  4C3H H;  3G4S A;  4HIO A;  3KUP A;  1EY7 A;  4F7X A;  1KQS A;  4AQY Q;  2A8V A;  3HS0 C;  4DV7 Q;  1LYL A;  5K5P A;  1CKN B;  1JT8 A;  1EOT A;  4PMW A;  3B6Y A;  1AW7 A;  1YJ9 A;  2JK8 A;  2A19 A;  2AQ2 B;  1PVO A;  2EY5 A;  3I73 A;  3HKS A;  1Y1W G;  3H0G B;  1XTC D;  4LFB L;  4A3K H;  1IW7 C;  1UE5 A;  3M4O B;  3PIP A;  4A3J B;  1VQ9 A;  5D65 A;  4X65 Q;  3I4M G;  1N9W A;  1SFO H;  3U9S A;  1OXV A;  2VY3 A;  3MFG A;  4K8J A;  3AFP A;  4GLX A;  1B9M A;  1HHV A;  1WTQ A;  4CGY B;  3E3X A;  1BR9 A;  4A93 H;  1JJG A;  1X3Q A;  3TZU A;  3OWE B;  4K8I A;  3KDF B;  1BNZ A;  3MAQ A;  4YWL A;  2Z6K C;  1HNZ L;  5DEH A;  4HJ8 A;  4N9P A;  1RTN A;  3OMC A;  5JEA H;  3J7A F;  3KJP A;  3FKI B;  1PH4 A;  4B3M L;  3HOW B;  5KYI A;  1G29 1;  1A2U A;  1NBW A;  4UDU C;  5M5X B;  3S2D H;  5ELE A;  1X55 A;  3RLO A;  4HMJ A;  4LFB Q;  3NWS A;  3PIO A;  1VQA A;  3MA2 B;  2V4D A;  1CM9 A;  2F0V A;  4KD3 A;  5AJ3 Q;  1D6E C;  2K03 A;  1KTK A;  3SK5 A;  3MC0 B;  4GOP C;  1AP0 A;  5LHY 1;  4A3B B;  2CQA A;  1EYC A;  3DWA A;  4IUR A;  1TY0 A;  5CMD A;  4LUV A;  5C0X H;  3NTK A;  3GTJ H;  4LNQ A;  3CPW A;  5EBD A;  4P71 A;  4JI0 L;  1CKM A;  1PYW D;  1WTV A;  1VQO A;  4JI6 L;  3E0E A;  4WJ4 A;  1Q90 A;  3P20 A;  4KD4 A;  3K80 C;  1Y1V H;  2XVS A;  1TVX A;  2RHQ B;  3VR2 A;  1U4M A;  2ZT9 C;  2E2H B;  3NHH A;  1WD1 A;  1P16 A;  4NDX A;  1QB5 D;  2N88 A;  3E5S A;  4A3G G;  2CHB D;  2O4X A;  3QOJ A;  1JE4 A;  1X65 A;  4IJH A;  4TVA B;  2D2C C;  1ILP A;  1RKN A;  3HG9 A;  2IY5 B;  5M3M G;  2E75 C;  4YHH L;  1SEB D;  4QJF A;  5TSS A;  3BZK A;  4CDD C;  2F0W A;  4DR6 L;  4C3H G;  1SR3 A;  4FXD A;  2GVA A;  2VB3 X;  5K36 H;  4HJ7 A;  4C56 C;  2K5W A;  3CMA A;  4L6T B;  1LTB D;  1Q3L A;  2NZ1 D;  3GD7 A;  4LFA Q;  2JA5 H;  2HHH L;  3D8G A;  1R9T H;  2PQA A;  3TS0 A;  4ZKC B;  5C44 H;  3P7J A;  1BCP D;  1N36 L;  5C3E G;  1RL2 A;  4JI1 L;  1LO5 D;  3U4V A;  4DV1 L;  3OTO L;  4R4C A;  3AQQ A;  4CDC C;  2KHI A;  2WIN B;  2N49 A;  2SEB D;  2AKW B;  2R93 H;  2B2V C;  3KLS X;  4A3E G;  2ES2 A;  1PRT B;  2EVB A;  3MTS A;  1PA6 A;  3FVQ A;  4HIK A;  1S5E D;  3W3A A;  1YNJ D;  1RCV D;  3PUX A;  4C2M B;  1SNO A;  4O2D A;  2F0T A;  1JOO A;  1V9P A;  1PZK D;  1LAC A;  3I90 A;  5JEA G;  4AYB G;  3NBH A;  4Z9C B;  4RKB A;  1LTI D;  4A3M H;  5CBA E;  2PZT A;  2JA8 B;  1HQM C;  1O80 A;  4JI1 Q;  2NVT H;  3SE0 A;  2BCO A;  1VQH A;  4DV1 Q;  2F0J A;  2JA7 G;  4MZ9 A;  4QUC A;  1IBM L;  2DJF C;  4FNF A;  1KDB A;  5C4Z A;  1Y8O B;  1MSG A;  2F0G A;  3S16 H;  1FL0 A;  4JBW A;  4YIJ A;  1J9O A;  2MFI A;  2KA7 A;  1F9P A;  1KRS A;  2EYH A;  2B2W A;  1N34 L;  3IKJ A;  2RCN A;  5C5M A;  3EBE A;  2NN6 I;  5C0X G;  5ELD A;  3H6M A;  4J6H A;  1M90 C;  5C6A A;  1EIF A;  2K04 A;  1I3Q B;  3KLR A;  1CT1 D;  3K0X A;  3VA5 A;  1XNQ Q;  5IP9 H;  1VQL A;  1WCM H;  1WOC A;  3SR1 A;  1CI3 M;  4P73 A;  1HFN A;  1S5C D;  2DN8 A;  2EZV A;  4OX9 L;  1IBM Q;  1Z9F A;  1YNN C;  4ODG A;  4QL5 A;  4RGO S;  5IIF A;  4BY7 B;  1HUM A;  1CFM A;  4A3I B;  3W1B A;  3L2P A;  3BJU A;  1TWG H;  1SYG A;  2OCE A;  5IE8 A;  4IFD G;  2AUJ D;  2KCC A;  3VDY A;  1HPC A;  4RAU C;  4MNO A;  2RDH A;  3M3Y H;  2B29 A;  5GAE C;  4GLV B;  1SNM A;  1CZW A;  1FVI A;  4DR4 Q;  4C3H B;  2VUM H;  1LTA D;  3A7A B;  4P2C B;  3DEP A;  2F0I A;  1WTO A;  3S1R H;  5JEA J;  1SRO A;  4ME3 A;  1SJH D;  3CCV A;  3NBH B;  4GKJ Q;  5C44 G;  2NBF A;  2HIV A;  4DUY L;  2JSO A;  3PQI A;  2OQK A;  1QWY A;  1F9R A;  3PO2 H;  1SNQ A;  2LXK A;  5LMN Q;  1KIX A;  4CBV A;  4DPG A;  5J22 A;  3OHX C;  4A3K B;  4HAE A;  4IUQ A;  3MXN A;  1HR0 L;  5EPJ A;  1AN8 A;  1TXY A;  3H3V I;  5C4X H;  2XWJ B;  1PTO H;  1H9S B;  2BH2 A;  3K0Y A;  4A4I A;  2A69 C;  2PYK A;  3AFQ A;  3HOY H;  5EAY A;  5CV5 A;  1SE8 A;  3BVM A;  5M5Y H;  5C0X J;  4RHS A;  4LFC L;  4A93 B;  1I4P A;  2WB1 G;  4HN7 A;  4QB4 A;  3HOX G;  4JBK A;  5ELB A;  4LF6 Q;  4I65 A;  1EFW A;  4LW1 A;  4OIJ A;  1Q46 A;  2F0O A;  2K28 A;  1PH2 A;  3LWU A;  1WJJ A;  2R7D A;  1BDO A;  4DUY Q;  2ZXO A;  3K6O A;  4PG3 A;  5E4X A;  3ZJY C;  3S2D B;  3PGZ A;  4M1U B;  5LMN W;  1PRT C;  1UE1 A;  1MJC A;  2E5L Q;  2M2L A;  4KMU C;  4GN4 B;  4UP8 A;  5G3L F;  2YTV A;  1JJ2 A;  3KBG A;  4JC0 A;  3K5N A;  1IYJ B;  1SSO A;  3CW2 C;  3P75 A;  3ICE A;  3CCU A;  4IFD J;  2A1A A;  2JEA I;  1NSN S;  1UNS A;  3QJY A;  4KHP L;  2HT1 A;  3PV0 A;  1UUP A;  3STB D;  2CH4 W;  1LM0 A;  4ZK9 B;  1JB7 A;  4AYB E;  2VQE L;  3GTJ B;  4EQP A;  1AZQ A;  1D8L A;  2EYL A;  4C3J H;  2MO0 A;  2F0M A;  5FLM H;  1SAP A;  3BVG A;  4FF1 A;  1AE3 A;  1STB A;  1Y1V B;  2HCC A;  1G6Z A;  4UHV A;  2I0Q A;  2I46 A;  5LMU L;  1X6O A;  2O2L D;  1XYI A;  3DMU A;  3GTK H;  3GTM H;  1PH5 A;  2E74 C;  3TDQ A;  4NPS A;  4DUZ L;  4LK1 C;  4ALP A;  2AQ1 B;  2HDL A;  4QY7 A;  2F0S A;  4DKA C;  4H02 A;  5GAG C;  1K8A C;  3T1Y L;  1BBW A;  1R4Q B;  2E76 C;  1I5F A;  3GV6 A;  1RIP A;  3HOU H;  5DNF A;  3MXN B;  2HQE A;  4KHP Q;  1NE3 A;  3K59 A;  4X66 L;  3OW2 A;  1JMC A;  2PNH A;  3WOE A;  4KTA A;  4G4K A;  3RLF A;  4A3J H;  4IPD A;  3GTQ H;  3VYS A;  2KCM A;  4DN4 M;  1Y8P B;  4OON A;  4BBR H;  4LF9 L;  4IOC A;  2ASB A;  3EQL C;  5LMU Q;  3LX0 A;  2X6L A;  2JA5 B;  5IOD A;  3U4Z A;  2NUC A;  1JOQ A;  1R9T B;  3TP7 A;  3PO2 G;  4CJ1 B;  1S5F D;  2B3G A;  2EXD A;  5C44 B;  4DR3 Q;  4R9W A;  2ZM6 L;  3A56 A;  2FJ2 A;  2P5Z X;  5EPK A;  5FO9 B;  1T5X D;  3FP9 A;  5C4X G;  2NTT A;  4JI4 Q;  1A8V A;  1ROD A;  2R93 B;  2AMC B;  3HOY G;  3O13 A;  2Z6K A;  3HZX A;  2XRS D;  4QUF A;  2HQL A;  4R4O A;  4JK1 C;  1XJV A;  1VQE A;  2OT2 A;  1UWV A;  2BA0 A;  1DOK A;  2NWG A;  3HGB A;  3FPU B;  4ZLT F;  3PCO B;  2HD3 A;  1TWF H;  5C5L A;  3I3C A;  2ZTC A;  3JC6 6;  1XMO Q;  4A3M B;  3GTO H;  5BR8 L;  1F2M A;  1JR0 D;  3A5U A;  1CTM A;  4GOP A;  4XXE A;  4B9W A;  2LSS A;  2NVT B;  2ZM6 Q;  5ELC A;  4B3T L;  4HJA A;  2NVY H;  5C4J H;  4GN5 A;  2B2W C;  2L4N A;  1J8I A;  4PZ7 A;  3UDF A;  4DAV A;  4AIM A;  3J80 c;  3V96 A;  3S16 B;  4CKB A;  3K5L A;  1QVG A;  1JWU D;  4GNX B;  3CKI B;  1VF7 A;  1S3O A;  1MIU A;  2UXC L;  4NXN L;  2JXM B;  1ESR A;  2XN9 C;  4C3J G;  2A6E D;  4POF A;  4L5R C;  2O5J C;  2KHS A;  4MTN A;  4DFA A;  4K6L A;  2H5X A;  4LF8 Q;  1GUT A;  3J80 L;  1JWS D;  5BR8 Q;  2L15 A;  1YZ6 A;  5FK9 C;  1WCM B;  4FF4 A;  2CFM A;  3Q24 A;  3KF8 A;  4CKE A;  4LF4 Q;  3K5O A;  3A5Z B;  3CD6 A;  5A35 A;  4JYA L;  2PNR C;  3F2D A;  2F4V Q;  4G7Z C;  1B44 D;  2ZJP A;  4IUN A;  2VXW A;  3KLW A;  5T1I A;  1TWG B;  1B2T A;  3NWT A;  2EE1 A;  3CME A;  3H0G G;  1YIJ A;  4CDF C;  4NXN Q;  3FMC A;  4GZY C;  4A3J G;  3M3Y B;  3IAY A;  1PZI D;  4HSV A;  1BQQ T;  3CRL C;  1IKL A;  1K73 C;  2VUM B;  4DV5 Q;  2SNM A;  1FYC A;  4DV0 L;  4JBM A;  3N52 A;  4JOI C;  2F3I A;  3K7U C;  1WTH A;  3T53 B;  3S1R B;  1LLR D;  5COY A;  5JAV A;  2OTJ A;  2UXD Q;  5ELN A;  3MXP A;  1YJN A;  3PO2 B;  1KLG D;  1K83 H;  1UAP A;  1LV9 A;  4DR7 L;  3HOW G;  3FKI G;  4HED A;  1UEA B;  4IUV A;  1N33 L;  2SOB A;  5C4X B;  2EOT A;  3GV3 A;  1PTO B;  4NXM L;  2PI2 A;  1U0L A;  2PQE A;  3HOY B;  5FJ8 H;  1WVL A;  1FR3 A;  4BXX G;  1D2B A;  4UY8 C;  1VDZ A;  1CSP A;  5CC4 A;  1O7L A;  1SDF A;  4L8J A;  5JJZ A;  3HOZ H;  3FRP B;  4DNI A;  4ZAI A;  1N8R C;  4A3B G;  3ERS X;  4NKL A;  1C4Q A;  4IAL A;  2KEC A;  3FHW A;  3GO5 A;  1W3S A;  1X3E A;  3RD4 A;  3KDF A;  1TWC H;  3ND9 A;  3M85 A;  3KFU A;  3J81 c;  4IN3 A;  2BDN A;  4LF5 L;  1A15 A;  3BDL A;  3D6W A;  2PMZ B;  4ABN A;  1N33 Q;  4CHT B;  4AQY L;  3NK9 A;  4NXM Q;  4FF2 A;  3K8A A;  2B63 H;  3I72 A;  3C1F A;  2A6H C;  4DNR B;  4K5X A;  2B2T C;  1Q8I A;  4FXG C;  5IP7 G;  2IHE A;  1GVP A;  2NYZ D;  1FNV A;  4FO2 A;  3J81 L;  4BY7 H;  1CHQ D;  3FEW X;  2JA6 H;  3S24 A;  4C3J B;  4NMZ A;  4X65 L;  1Y8N B;  2VQF Q;  3DXJ C;  2PMZ E;  1I4X A;  2F0H A;  1P8L A;  2OXP A;  4GNX C;  3GTK B;  3GTM B;  2C5C A;  3LNN A;  4R8N A;  4J15 A;  5JJL A;  1GJX A;  2IT1 A;  4XQQ A;  1EWH A;  1DCZ A;  4DXF A;  2E2I H;  1LAB A;  2EIF A;  2PCF B;  3HOU B;  1ET6 A;  2B2U C;  4A76 A;  2PW7 A;  2LMC B;  3E6Z X;  1X3F A;  5AFW A;  1ZEQ X;  2A73 B;  2BE5 D;  1Z47 A;  3D4R A;  4ZRZ A;  5KEE A;  1EYG A;  2GN5 A;  3GP7 A;  1ICF B;  5M9O A;  4OO1 G;  3QIA A;  3GTQ B;  4G7O C;  3H94 A;  2I07 B;  5AJ3 L;  4RGT A;  1C8C A;  3GTG H;  1OXU A;  1ESF A;  5DAU A;  1MD2 D;  4BBR B;  1U4R A;  4DNT B;  4HTH A;  1I4G A;  1HNW L;  1NAP A;  1I6H B;  4XYO A;  1BBU A;  2L0C A;  4A3C G;  3KK7 A;  1HCZ A;  2LFN A;  2FXQ A;  1BOS A;  1VQD A;  3OSO A;  1M1K C;  5HY6 A;  4KLK A;  1B1Z A;  2JA8 G;  2PI2 E;  1DYQ A;  2BA1 A;  4HJ5 A;  4J1M A;  3Q6S A;  1TWA H;  1HNX Q;  1GXD C;  1S5D D;  3RMH A;  2WKD A;  3F2B A;  4KJN A;  4JI8 Q;  5I2X A;  4FVM A;  4HJ9 A;  1HRJ A;  1U4P A;  4QGU A;  3H3V H;  2EJF C;  5IYD G;  5I6W A;  1W6J A;  3EVQ A;  2BDO A;  4KI0 A;  3STB C;  4YCW A;  1PFN A;  1TWF B;  2V1C C;  3ULJ A;  1VQ5 A;  2D5D A;  1HNW Q;  3IL8 A;  5C3W A;  3GTO B;  1PTO C;  3KF6 B;  4DR1 Q;  1H9J A;  4WRD A;  5LL6 S;  3K7A H;  4IOA A;  1SE2 A;  5IWA Q;  2X6G A;  4G7H C;  1VQ4 A;  4F87 A;  2NVY B;  1TWH H;  1PYS B;  5C4J B;  3A8J E;  2KHJ A;  1PZJ D;  1EU3 A;  3I70 A;  2PPB C;  1K3B C;  3QR8 A;  2B63 G;  4LWC A;  4OWW B;  1PRT F;  4DK0 A;  1QZH A;  4JV5 Q;  4LFA L;  2Y0S G;  3CXC A;  2EYF A;  1KHI A;  2DUD A;  4HSP A;  2N3S A;  5H1S E;  1SMY D;  4L5Q A;  1MI2 A;  4BY7 G;  2RSO A;  2WAQ G;  4E6I A;  4TQU S;  3D3R A;  1FD7 D;  4A3I G;  1A3U A;  4KY6 A;  4RFB A;  5I6Y A;  1L1O A;  2SDF A;  3SVM A;  5F2D A;  3VR5 A;  2F52 A;  3PUZ A;  5HUR A;  1GUO A;  4UPA A;  1LTG D;  1OO9 B;  1FNW A;  2RSN A;  5JJI A;  1SE3 A;  3S1Q H;  2K75 A;  1KL9 A;  3NSW A;  3LGJ A;  1LT4 D;  5JPN C;  4M8A A;  3D0F A;  1XNR L;  1XPO A;  1STH A;  2CCZ A;  3VYU A;  4PQX A;  1JB3 A;  2VZA A;  2X69 A;  1LT3 D;  2CW0 D;  3MXU A;  1ZYR C;  4R4T A;  2O5I C;  1I4R A;  3HOV H;  1EUJ A;  1LT5 D;  4A3K G;  2EYO A;  4IUU A;  2TMP A;  4OWT B;  4POG A;  4DAM A;  2K14 A;  1HXY D;  1MJE A;  2F0F A;  1EEF D;  2NVX H;  3M4P A;  1BVS A;  2QEJ C;  1QNU A;  3MWY W;  1K8M A;  1V1P A;  1D1I A;  5KYL A;  1DON A;  2DY8 A;  3AEV A;  2QW7 A;  3QOL A;  4A93 G;  1JCK B;  1STA A;  2JEB I;  4K5V A;  1SXT A;  1U9R A;  4RCN A;  4BBS H;  3L3O C;  1E2V A;  1PLF A;  1K83 B;  1XNR Q;  4DV2 Q;  2AWO A;  1VQF A;  2PO4 A;  1RHP A;  2Q2H A;  4ZUJ A;  1XNQ L;  3TP8 A;  2EQS A;  3SHL A;  2IHF A;  2LS0 1;  3HFZ B;  4RA8 A;  1HTP A;  3AU7 A;  5KNC A;  3E0J A;  2RDF A;  5I4D A;  1TU2 B;  4TRD A;  3VA7 A;  1IBK L;  2UUA Q;  1H9S A;  4FF3 A;  5EKI A;  1ZKO A;  3HOZ B;  1ILQ A;  1E0B A;  1NR2 A;  1STG A;  1JJC B;  1X56 A;  5IYB H;  1VQB A;  1L1O B;  5IGF A;  1JQY D;  1TWC B;  1IBL L;  4F8M A;  3WOF A;  4HR7 B;  3QG1 A;  3W5O A;  1PDQ A;  2DNE A;  4B3S Q;  4DR4 L;  1Y1V G;  2YTY A;  4DK1 A;  3S9W A;  3GTL H;  5IT9 E;  4JBJ A;  4JG2 A;  3GTP H;  2B63 B;  4KKU A;  4P72 A;  4GKJ L;  4ID6 A;  2Y0S B;  1XWE A;  5FKA C;  3TQY A;  1IBK Q;  5LMN L;  1KXL A;  4EQ5 A;  3AB9 A;  4RHR A;  2WAQ B;  4JI7 L;  3RZD H;  2JA6 B;  3NUC A;  2EDG A;  2JJQ A;  1QUQ A;  3C46 A;  4RH6 A;  4JW0 A;  1V1P B;  1Q1E A;  4KJO A;  1IBL Q;  3DHQ A;  2QIL A;  4CDE C;  2Q2T A;  3A8K E;  1XX8 A;  4EVO A;  1VQK A;  3VR6 A;  1S5B D;  1EU4 A;  1ONL A;  4YCV A;  5K36 G;  1A62 A;  3K5M A;  1B53 A;  4LF6 L;  2XWB B;  5JVG 3;  2RF4 A;  2BOS A;  2JA5 G;  2E2I B;  2Y0S E;  3EN2 A;  4YY3 Q;  2EPB A;  3RN5 A;  1GUW A;  1ET9 A;  3D6C A;  3A74 A;  3C1E A;  3X3N A;  5E3F A;  3OIP A;  1G2S A;  4JOI A;  4IPH A;  2WAQ E;  1HTL D;  1Z7T A;  4CJ2 C;  1Q82 C;  2E5L L;  2R7Z H;  2KUM A;  2KCT A;  3BU2 A;  4JI7 Q;  2R93 G;  1EIY B;  2NB0 A;  5D3D A;  2ENB A;  3CCR A;  3GTG B;  1LTS D;  1VQC A;  1EL0 A;  1IHZ A;  1ENC A;  1VF5 C;  1FJG Q;  1EYA A;  2VB2 X;  4C3I H;  3PF4 A;  5BN5 A;  2WP8 J;  1EQQ A;  4XT1 B;  5FO8 B;  5E1F A;  3DLL A;  4TKO B;  4BBS G;  2K4K A;  3J80 E;  3VYT A;  1SRU A;  2UUB Q;  3G6J B;  2RA4 A;  4X3T A;  5ELF A;  4DK3 C;  1SYB A;  4UP7 A;  1QZG A;  1D5Z C;  1FGB D;  4A3M G;  3AYH B;  1IW7 D;  1FNU A;  2EYJ A;  5JPM C;  2CVR A;  4U67 3;  1TWA B;  2LXJ A;  2GA4 B;  5EKL A;  3OPO A;  1YNX A;  1BXT A;  1VQP A;  4DAY B;  1F77 A;  1JOK A;  1B3A A;  5CV7 A;  4KKT A;  2Q8T A;  1Y69 U;  1WYD A;  4N8X 1;  2XSC A;  3E9H A;  2KBN A;  2KOL A;  2A68 C;  3DEO A;  2NZO A;  1OTC A;  5ISR A;  3M7G A; 
#chains in the Genus database with same CATH homology
 2KQ3 A;  3SDZ A;  1M4V A;  3R2I A;  4KHZ A;  1BF4 A;  1EY5 A;  1VMP A;  3K7A B;  1BCP B;  1A3V A;  2B2T A;  1TWH B;  2EY6 A;  3OMG A;  3BDO A;  1HQR D;  4IFD I;  2B8G A;  4R8I A;  4CJ0 B;  2LKV A;  2AWN A;  3D4W A;  4OGQ C;  1V8Q A;  1B9N A;  3Q22 A;  1H9K A;  3NQI A;  4TSS A;  4QMG A;  2FFK B;  1GHK A;  2B2U A;  3S1Q B;  2K5D A;  4FYD A;  2IJ0 A;  1K8O A;  2JP1 A;  4KN4 C;  1SND A;  2AUK A;  1SNC A;  5D14 A;  3ONA B;  2RQX A;  2JYO A;  1A6X A;  5IT9 L;  1GUN A;  1U4L A;  2L1B A;  3HOV B;  5KNB A;  2NVX B;  1GUS A;  2F0E A;  4C3I G;  3J81 E;  2EJM A;  1EFI D;  2A74 C;  1ENA A;  2M00 A;  5A2Q L;  3A55 A;  2L11 A;  2J0T D;  4BBS B;  4ILW A;  3AMU A;  3TME A;  4H44 C;  1VMC A;  4RGN A;  4V19 0;  3WDN A;  5D3I B;  3SK4 A;  2B39 A;  2EYM A;  3KLS A;  3PIO 3;  5EPL A;  1T5E A;  3BZD B;  2L9H A;  3R93 A;  2ZXP A;  2YU9 B;  2F0U A;  3BVZ A;  4J8Q A;  1C48 A;  3UI2 A;  1BO0 A;  3A7L A;  1TQO A;  3I91 A;  2IX0 A;  5IGE A;  3NP8 A;  1DXM A;  1PTO F;  1B4O A;  3GTL B;  1SYE A;  2K33 A;  3GTP B;  3H3V C;  4H0L C;  4XQJ A;  1S4Z A;  3VR4 A;  5IGD A;  1TKW B;  1GHJ A;  2AQ3 B;  1BCP C;  1HA5 A;  3ERO A;  3RZD B;  1A3T A;  4KKS A;  2DNC A;  3NTH A;  3GQB A;  5J1Z A;  4OL7 A;  1CA6 A;  2OEO A;  5FOB B;  1KDA A;  2Q8I B;  3VYR A;  3QB3 A;  1YNN D;  1YNJ C;  5CV9 A;  2XNA C;  3EA6 A;  1HA6 A;  3R3O A;  5KGU A;  1PFM A;  1ENF A;  3J7Y W;  3ITP A;  2R7Z B;  5CV4 A;  3ZYY X;  3CU7 A;  1PMR A;  1NR4 A;  5CV6 A;  5IGB A;  2MGS A;  4C3I B;  2IX3 A;  3A54 A;  2K5Q A;  3PUV A;  2IPK D;  2F4I A;  3H09 A;  2F3V A;  1G91 A;  3V05 A;  3MHB A;  3EJI A;  4DU9 A;  4PMC A;  4XTC S;  4C1N K;  1EZ6 A;  2EY2 A;  4O42 A;  2A69 D;  1SE4 A;  3K57 A;  3DWP A;  4LMQ D;  1EIG A;  2KVM A;  3ERQ A;  2MUY A;  1KAB A;  2K32 A;  1JIC A;  3BS1 A;  4IQZ A;  1PRT D;  4XYQ A;  1IL8 A;  1Q12 A;  1L0X B;  3G7L A;  2NN6 H;  4ZUI A;  3U9O A;  4F88 A;  1M8A A;  1I4H A;  2LY7 A;  1HUN A;  2KED A;  2IL8 A;  3MZ5 A;  2HDM A;  2MJ8 A;  5NUC A;  4A3F B;  4HMI A;  5BN4 A;  5E4W C;  2RVL A;  1VCI A;  1JOR A;  2L5T A;  3SK6 A;  1II3 A;  1IYU A;  2QCP X;  1EQT A;  1IYV A;  1W6K A;  3PMF A;  3S17 B;  4Q5V A;  1A2T A;  2IWH A;  2RBM A;  3NQT A;  2XIW A;  2RDG A;  4C1N I;  3K58 A;  1D1K A;  3CRK C;  4X3K A;  2WAC A;  3PO3 B;  3DM1 A;  4QIW B;  3BYY B;  5EKK A;  4EQN A;  4ME5 A;  3S15 B;  4KN7 C;  2M9V A;  3QWN A;  3HRZ C;  3T56 B;  4U68 A;  1RF2 D;  3FDT A;  3IFD A;  4N9T A;  2B8F A;  3SXH A;  2KJX A;  2D9U A;  3Q0A A;  4FP5 D;  4G57 A;  4A3D B;  1GUG A;  3MEH A;  2PW5 A;  4KY7 A;  4WOR A;  3TBI B;  4EQO A;  2HUG A;  4ZYS A;  3MXG A;  4WJW A;  4DXG A;  4XIG S;  5J39 A;  1WTR A;  2ICE C;  2EXZ A;  2NN6 G;  4O1N A;  1F9S A;  3BDC A;  2E2J B;  1SJE D;  2F0D A;  4OO1 I;  1F2Z A;  4DGZ A;  4ZKB B;  4K2L A;  3A8I E;  2QDB A;  1KAA A;  5CBE E;  4IFD H;  1AFP A;  3PUY A;  1EY9 A;  3BG3 A;  4OIK A;  3VR3 A;  1X32 A;  2A5H A;  1XXG A;  2K01 A;  2K6A A;  2QF7 A;  3OIQ A;  2D62 A;  2F0P A;  2FMM A;  1Y1W B;  4XT3 B;  4LJZ C;  1TS4 A;  3I4M B;  3I8Z A;  2NVQ B;  1O78 A;  1X3P A;  3S1N B;  4PV1 C;  2E2D C;  5FLX E;  2K7V A;  2WII B;  3V2T A;  1MBY A;  4OHJ A;  3N6R A;  4BWG B;  2IX1 A;  3URY A;  2A6E C;  1STY A;  3KBX A;  3ND8 A;  5G3L D;  2EY1 A;  3SEB A;  1CHP D;  1V43 A;  1EY8 A;  4UAI A;  3RUZ A;  4BY1 B;  4MHE A;  1QIL A;  4LAA A;  1QNK A;  1KNE A;  5EQ0 A;  1WTW A;  1DJR D;  3OWF A;  1QG7 A;  4DAY A;  2R61 A;  5KND A;  3PUW A;  3TP6 A;  3S2H B;  1EWC A;  1GOZ A;  1TT2 A;  1D5M C;  1DOM A;  1WD0 A;  1BBX C;  3IFT A;  1SYD A;  5CV8 A;  2N55 A;  1I6V C;  4QCL A;  5A2Q E;  1EZ8 A;  3C3L A;  2G9H D;  3DWQ A;  2A6H D;  1H9R A;  4IUP A;  4KHV A;  2ZXR A;  5EBC A;  4A3G B;  5CGK A;  3CHB D;  4ULL A;  1RJT A;  4K14 A;  3NXW A;  2SNS A;  5M3F B;  5M3M B;  3LWE A;  3DUZ A;  1ICW A;  1BCP F;  3S1M B;  4Q0F A;  5T1G A;  4HCE A;  3TP5 A;  4NW2 A;  4BS9 A;  2Z4H A;  2K05 A;  4K2K A;  1RD9 D;  5DM6 3;  3CQZ B;  3S14 B;  2XRQ D;  4EGV A;  1DD2 A;  5JVH 3;  2Z4I A;  1BUV T;  5C3E B;  2ICI A;  2F0Q A;  1AEX A;  1SFO B;  3P1H A;  4A3E B;  1TY2 A;  1DZ1 A;  5C0X I;  1Z6H A;  1QCB D;  3I4N B;  1PXU A;  3Q23 A;  1B50 A;  2B2Y A;  2R3Z A;  3NE5 B;  1CQF A;  1TS5 A;  2K1B A;  5LL6 X;  4AYB B;  3TN2 A;  1O7Y A;  4MN3 A;  1RDP D;  2L12 A;  1SYF A;  2F03 A;  4K6D A;  2JA7 B;  1DOL A;  3EFX D;  3I4L A;  4V0B A;  1LT6 D;  1Q1B A;  4B9X A;  1JC7 A;  4XQN A;  1TR5 A;  4IZ8 A;  3NPP A;  1PTO D;  4S3S A;  2PZW A;  2BE5 C;  5I9P A;  5HGT A;  4QF4 A;  5FLX L;  5I2Y A;  2J7Z A;  2Z1C A;  3T13 A;  1SBB B;  1LTT D;  2R6G A;  1IKM A;  2FMC A;  5I9O A;  5C4H A;  3NTI A;  1L0Y B;  3TSS A;  3H91 A;  5BN3 A;  1E2Z A;  1ML0 D;  1KDC A;  2F1M A;  4PNY A;  1TS2 A;  3OOC A;  2JE6 I;  5FO7 B;  4CKC A;  3JAM E;  1OXT A;  1DM0 B;  4DA2 A;  2F0N A;  3PIP 3;  4RWS C;  1O7Z A;  1KLU D;  5CYU A;  3MFY A;  2MP1 A;  5EJW A;  3T4A C;  1R4P B;  1ZYR D;  3L9A X;  4K5W A;  4KK7 A;  5EGT A;  2H4O A;  3J7A V;  2FHT A;  2ID0 A;  1I4Q A;  3R8B A;  3T16 A;  1EY6 A;  3T51 B;  1RTO A;  3D31 A;  5DM7 3;  2WB1 B;  4IUT A;  3SK8 A;  3HOX B;  1STE A;  4BA1 I;  2G9D A;  4XDX A;  1SMY C;  1TS3 A;  4X3S A;  1WTP A;  1MGS A;  5KIX A;  1QOH A;  1OXX K;  4H13 C;  1D5X C;  3NBI A;  4H7B A;  1NUC A;  1SYC A;  4NP5 A;  3RZO B;  4KV6 A;  2KCN A;  4BA2 I;  1HFG A;  2J4X A;  3D4D A;  3R2T A;  1G2T A;  1CZG A;  2QKI C;  5CR3 A;  2EJG C;  5M5W B;  4DAP A;  1E2W A;  4RCO A;  3M7N A;  2YYZ A;  2CW0 C;  4L63 B;  5KRU A;  1TII D;  1CQV A;  2MPM A;  4B08 A;  3MVV A;  1F2L A;  3OW7 A;  4X3U A;  1MSH A;  4DF7 A;  1QE6 A;  2C9O A;  1AZP A;  2WKC A;  3X3M A;  4RGM A;  2DY7 A;  2F3W A;  2WV6 D;  2EYP A;  4FXK C;  4WFN 3;  2OF1 A;  4OO1 H;  2IW3 A;  1EEI D;  2RKS A;  1H9M A;  2PZU A;  2TSS A;  2VNU D;  4RKL A;  3HKZ B;  3HP3 A;  4HCS A;  2Z8L A;  1EY0 A;  1QJO A;  2B2V A;  1EQV A;  4ZQ3 A;  3TZD A;  5COR A;  2H1E A;  1WTX A;  1EYD A;  2Q8R E;  1KNA A;  5IOC A;  1CA5 A;  1I50 B;  3M4Y A;  3FPP A;  1G8Z D;  2B2Y C;  1STN A;  3C2P A;  5M5Y B;  5IGC A;  1CK1 A;  1V1O A;  1LTR D;  1NCV A;  2KEE A;  2NTS A;  1EIH A;  2F0L A;  2F0K A;  3JAM L;  1ZXT A;  4Y7N B;  5C3X A;  2MHV A;  3F2U A;  3W2D A;  1F9Q A;  4I7Z C;  1PFB A;  1F2Y A;  5IGG A;  4PMB A;  3L7Z C;  4KY5 A;  3BYT B;  5JOB A;  2A68 D;  3QO2 A;  2FIN B;  1SNP A;  3HEJ A;  1EY4 A;  2HCI A;  2L55 A;  1JWM D;  1OXS C;  2R92 B;  4MIU A;  3KUP A;  1EY7 A;  4F7X A;  3HS0 C;  5K5P A;  1EOT A;  4PMW A;  1AW7 A;  2AQ2 B;  2EY5 A;  3I73 A;  3H0G B;  1XTC D;  3M4O B;  1IW7 C;  4A3J B;  5D65 A;  3U9S A;  1OXV A;  3MFG A;  4K8J A;  1B9M A;  1HHV A;  1WTQ A;  4CGY B;  1BR9 A;  1X3Q A;  3TZU A;  3OWE B;  4K8I A;  1BNZ A;  3MAQ A;  5DEH A;  4N9P A;  1RTN A;  3OMC A;  5JEA H;  3J7A F;  3HOW B;  3FKI B;  5KYI A;  1G29 1;  1A2U A;  5M5X B;  4UDU C;  5ELE A;  4HMJ A;  3NWS A;  3MA2 B;  2V4D A;  1CM9 A;  2F0V A;  4KD3 A;  1D6E C;  2K03 A;  1KTK A;  3SK5 A;  3MC0 B;  1AP0 A;  5LHY 1;  4A3B B;  2CQA A;  1EYC A;  3DWA A;  4IUR A;  1TY0 A;  5CMD A;  5C0X H;  3NTK A;  5EBD A;  1PYW D;  1WTV A;  1Q90 A;  3P20 A;  4KD4 A;  2XVS A;  1TVX A;  3VR2 A;  2E2H B;  1U4M A;  2ZT9 C;  3NHH A;  1WD1 A;  4NDX A;  1QB5 D;  2N88 A;  3E5S A;  2CHB D;  2O4X A;  3QOJ A;  1JE4 A;  2D2C C;  1ILP A;  1RKN A;  3HG9 A;  2E75 C;  1SEB D;  5TSS A;  2F0W A;  4C3H G;  4FXD A;  2VB3 X;  5K36 H;  4C56 C;  2K5W A;  4L6T B;  1LTB D;  1Q3L A;  2NZ1 D;  3GD7 A;  3D8G A;  4ZKC B;  3P7J A;  1BCP D;  1LO5 D;  2WIN B;  2SEB D;  2B2V C;  3KLS X;  1PRT B;  2EVB A;  3MTS A;  3FVQ A;  1S5E D;  3W3A A;  1YNJ D;  1RCV D;  3PUX A;  4C2M B;  1SNO A;  2F0T A;  1JOO A;  1PZK D;  1LAC A;  3I90 A;  5JEA G;  3NBH A;  4Z9C B;  4RKB A;  1LTI D;  5CBA E;  2PZT A;  2JA8 B;  1HQM C;  1O80 A;  3SE0 A;  2BCO A;  2F0J A;  4QUC A;  4FNF A;  1KDB A;  5C4Z A;  1Y8O B;  1MSG A;  2F0G A;  4JBW A;  4YIJ A;  1J9O A;  2KA7 A;  1F9P A;  2EYH A;  2B2W A;  3IKJ A;  5C5M A;  2NN6 I;  5C0X G;  5ELD A;  3H6M A;  4J6H A;  5C6A A;  2K04 A;  1I3Q B;  3KLR A;  1CT1 D;  3VA5 A;  3SR1 A;  1CI3 M;  1HFN A;  1S5C D;  2DN8 A;  2EZV A;  4ODG A;  1YNN C;  4RGO S;  5IIF A;  4BY7 B;  1HUM A;  1CFM A;  4A3I B;  1SYG A;  4IFD G;  2AUJ D;  2KCC A;  1HPC A;  4RAU C;  2RDH A;  1SNM A;  1CZW A;  4C3H B;  1LTA D;  3A7A B;  4P2C B;  3DEP A;  2F0I A;  1WTO A;  5JEA J;  1SJH D;  2NBF A;  2JSO A;  1QWY A;  1F9R A;  1SNQ A;  4CBV A;  5J22 A;  3OHX C;  4A3K B;  4HAE A;  4IUQ A;  3MXN A;  5EPJ A;  1AN8 A;  2XWJ B;  1PTO H;  1H9S B;  3K0Y A;  2A69 C;  2PYK A;  5CV5 A;  3BVM A;  5C0X J;  4RHS A;  4A93 B;  1I4P A;  4HN7 A;  4QB4 A;  5ELB A;  4I65 A;  4OIJ A;  2F0O A;  2K28 A;  3LWU A;  1BDO A;  2ZXO A;  3K6O A;  5E4X A;  3S2D B;  4M1U B;  1PRT C;  2M2L A;  4KMU C;  5G3L F;  3KBG A;  3K5N A;  1SSO A;  3P75 A;  4IFD J;  2JEA I;  1NSN S;  1UNS A;  3QJY A;  3PV0 A;  1UUP A;  4ZK9 B;  3GTJ B;  4EQP A;  1AZQ A;  2EYL A;  2F0M A;  1SAP A;  3BVG A;  4FF1 A;  1STB A;  1Y1V B;  2HCC A;  1G6Z A;  2I46 A;  2O2L D;  1XYI A;  3DMU A;  2E74 C;  3TDQ A;  4LK1 C;  2AQ1 B;  2HDL A;  2F0S A;  1R4Q B;  2E76 C;  3GV6 A;  5DNF A;  2HQE A;  3K59 A;  3WOE A;  4KTA A;  4G4K A;  3RLF A;  3VYS A;  4DN4 M;  1Y8P B;  3EQL C;  3LX0 A;  2X6L A;  2JA5 B;  5IOD A;  2NUC A;  1JOQ A;  1R9T B;  3TP7 A;  4CJ1 B;  1S5F D;  5C44 B;  4R9W A;  3A56 A;  2FJ2 A;  5EPK A;  5FO9 B;  1T5X D;  2NTT A;  1ROD A;  2R93 B;  3O13 A;  4QUF A;  3HZX A;  2XRS D;  4JK1 C;  2OT2 A;  2BA0 A;  1DOK A;  2NWG A;  3HGB A;  3FPU B;  4ZLT F;  5C5L A;  3I3C A;  4A3M B;  1F2M A;  1JR0 D;  1CTM A;  4XXE A;  4B9W A;  2NVT B;  5ELC A;  2B2W C;  2L4N A;  1J8I A;  4DAV A;  3V96 A;  3S16 B;  4CKB A;  3K5L A;  1JWU D;  3CKI B;  1VF7 A;  2JXM B;  1ESR A;  2XN9 C;  4C3J G;  2A6E D;  2O5J C;  2KHS A;  4DFA A;  4K6L A;  1GUT A;  3J80 L;  1JWS D;  5FK9 C;  1WCM B;  4FF4 A;  3Q24 A;  3KF8 A;  4CKE A;  3K5O A;  5A35 A;  2PNR C;  4G7Z C;  1B44 D;  4IUN A;  2VXW A;  5T1I A;  1TWG B;  1B2T A;  3NWT A;  2EE1 A;  3FMC A;  4GZY C;  3M3Y B;  3IAY A;  1PZI D;  4HSV A;  1BQQ T;  3CRL C;  1IKL A;  2VUM B;  2SNM A;  1FYC A;  3N52 A;  3T53 B;  3S1R B;  1LLR D;  5COY A;  5JAV A;  3MXP A;  3PO2 B;  1KLG D;  1UAP A;  1LV9 A;  4HED A;  1UEA B;  4IUV A;  2SOB A;  5C4X B;  2EOT A;  3GV3 A;  1PTO B;  2PQE A;  3HOY B;  1WVL A;  1FR3 A;  1D2B A;  1VDZ A;  5CC4 A;  1O7L A;  1SDF A;  4L8J A;  5JJZ A;  3FRP B;  4ZAI A;  4NKL A;  1C4Q A;  4IAL A;  2KEC A;  3GO5 A;  3RD4 A;  3ND9 A;  3M85 A;  4IN3 A;  2BDN A;  1A15 A;  3BDL A;  3D6W A;  2PMZ B;  4ABN A;  4CHT B;  3NK9 A;  4FF2 A;  3I72 A;  3C1F A;  2A6H C;  4DNR B;  4K5X A;  2B2T C;  1Q8I A;  4FXG C;  2NYZ D;  1FNV A;  4FO2 A;  3J81 L;  1CHQ D;  3FEW X;  4C3J B;  4NMZ A;  1Y8N B;  3DXJ C;  1I4X A;  2F0H A;  2OXP A;  3GTK B;  3GTM B;  2C5C A;  3LNN A;  4R8N A;  1GJX A;  2IT1 A;  4XQQ A;  1EWH A;  1DCZ A;  4DXF A;  1LAB A;  2PCF B;  3HOU B;  1ET6 A;  2B2U C;  2PW7 A;  2LMC B;  3E6Z X;  5AFW A;  1ZEQ X;  2A73 B;  2BE5 D;  1Z47 A;  3D4R A;  4ZRZ A;  5KEE A;  3GP7 A;  5M9O A;  4OO1 G;  3QIA A;  3GTQ B;  4G7O C;  3H94 A;  2I07 B;  4RGT A;  1C8C A;  1OXU A;  1ESF A;  5DAU A;  1MD2 D;  4BBR B;  1U4R A;  4DNT B;  4HTH A;  1I4G A;  1NAP A;  1I6H B;  4XYO A;  2L0C A;  3KK7 A;  1HCZ A;  2LFN A;  1BOS A;  3OSO A;  1B1Z A;  1DYQ A;  2BA1 A;  4J1M A;  3Q6S A;  1GXD C;  1S5D D;  3RMH A;  2WKD A;  4KJN A;  5I2X A;  4FVM A;  1HRJ A;  1U4P A;  2EJF C;  5I6W A;  1W6J A;  3EVQ A;  2BDO A;  4KI0 A;  1PFN A;  1TWF B;  2D5D A;  3IL8 A;  5C3W A;  3GTO B;  1PTO C;  1H9J A;  4WRD A;  5LL6 S;  1SE2 A;  2X6G A;  4G7H C;  4F87 A;  2NVY B;  5C4J B;  3A8J E;  1PZJ D;  1EU3 A;  3I70 A;  2PPB C;  1PRT F;  4DK0 A;  2EYF A;  4HSP A;  1SMY D;  1MI2 A;  2RSO A;  4E6I A;  4TQU S;  3D3R A;  1FD7 D;  1A3U A;  4KY6 A;  4RFB A;  5I6Y A;  2SDF A;  3SVM A;  5F2D A;  3VR5 A;  3PUZ A;  5HUR A;  1GUO A;  1LTG D;  1OO9 B;  1FNW A;  2RSN A;  1SE3 A;  3NSW A;  1LT4 D;  5JPN C;  4M8A A;  1STH A;  3VYU A;  4PQX A;  1JB3 A;  2X69 A;  1LT3 D;  2CW0 D;  3MXU A;  1ZYR C;  2O5I C;  1I4R A;  1LT5 D;  2EYO A;  4IUU A;  2TMP A;  1HXY D;  2F0F A;  1EEF D;  2QEJ C;  1QNU A;  3MWY W;  1K8M A;  1V1P A;  1D1I A;  5KYL A;  1DON A;  2DY8 A;  3QOL A;  1JCK B;  1STA A;  2JEB I;  4K5V A;  1SXT A;  1U9R A;  4RCN A;  3L3O C;  1E2V A;  1PLF A;  1K83 B;  2AWO A;  2PO4 A;  1RHP A;  4ZUJ A;  3TP8 A;  3SHL A;  2LS0 1;  4RA8 A;  1HTP A;  3AU7 A;  5KNC A;  3E0J A;  2RDF A;  5I4D A;  1TU2 B;  4TRD A;  3VA7 A;  1H9S A;  4FF3 A;  5EKI A;  1ZKO A;  3HOZ B;  1ILQ A;  1E0B A;  1NR2 A;  1STG A;  5IGF A;  1JQY D;  1TWC B;  4F8M A;  3WOF A;  4HR7 B;  3QG1 A;  1PDQ A;  2DNE A;  4DK1 A;  3S9W A;  5IT9 E;  2B63 B;  4KKU A;  4ID6 A;  2Y0S B;  1XWE A;  5FKA C;  3AB9 A;  4RHR A;  2WAQ B;  2JA6 B;  3NUC A;  2EDG A;  3C46 A;  4RH6 A;  1V1P B;  1Q1E A;  4KJO A;  3DHQ A;  2QIL A;  3A8K E;  1XX8 A;  4EVO A;  3VR6 A;  1S5B D;  1EU4 A;  1ONL A;  5K36 G;  3K5M A;  1B53 A;  2XWB B;  5JVG 3;  2BOS A;  2E2I B;  2EPB A;  1GUW A;  1ET9 A;  3D6C A;  3C1E A;  3X3N A;  5E3F A;  3OIP A;  1G2S A;  1HTL D;  1Z7T A;  4CJ2 C;  2KUM A;  2NB0 A;  5D3D A;  2ENB A;  3GTG B;  1LTS D;  1EL0 A;  1IHZ A;  1ENC A;  1VF5 C;  1EYA A;  2VB2 X;  5BN5 A;  2WP8 J;  4XT1 B;  5FO8 B;  5E1F A;  4TKO B;  3J80 E;  3VYT A;  3G6J B;  2RA4 A;  4X3T A;  5ELF A;  1SYB A;  1D5Z C;  1FGB D;  1IW7 D;  1FNU A;  2EYJ A;  5JPM C;  2CVR A;  4U67 3;  1TWA B;  2GA4 B;  5EKL A;  3OPO A;  1BXT A;  1F77 A;  1JOK A;  1B3A A;  5CV7 A;  4KKT A;  2Q8T A;  1Y69 U;  2XSC A;  2KOL A;  2A68 C;  3DEO A;  5ISR A;  3M7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...