5I9PA

Crystal structure of staphylococcal nuclease variant delta+phs t62h at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i9pA00
3E5SA 2F0JA 1STBA 5CV8A 2EYJA 4ODGA 5I9PA 3NUCA 4DF7A 1KABA 3VA5A 5E3FA 3MHBA 4K8JA 4QB4A 4KD4A 3TMEA 5KYLA 3MZ5A 5DAUA 4K8IA 5M9OA 1EY7A 5CV4A 4KD3A 1SNOA 2F0VA 4K5VA 2ENBA 1A2UA 2PZTA 3NQTA 4IALA 1EY4A 1EY9A 3P75A 3QB3A 3TP6A 5J22A 1ENAA 4WRDA 4IUNA 1EY8A 4KJOA 3QOJA 1ENCA 4KY7A 4B9WA 3EVQA 3OMGA 5KRUA 1F2ZA 3BDCA 4RKLA 3SXHA 4F8MA 1SNMA 1SYBA 3D4DA 2EYPA 2F3VA 4NP5A 2EXZA 4DU9A 5EGTA 4LAAA 2EY1A 4KJNA 3NK9A 1SNDA 2F0GA 2WACA 3ITPA 3OMCA 3TP8A 5C3XA 5IGBA 5IGCA 4G57A 2F0FA 4N9PA 1JOKA 1SYGA 3LX0A 1II3A 1A3VA 3ERQA 4ZQ3A 5J1ZA 3U9OA 5C6AA 5IIFA 2PW7A 4KHVA 2EYMA 2F0NA 3C1EA 1STHA 2F3WA 3EROA 4K14A 4K5WA 4R8NA 2PQEA 4YIJA 1TR5A 1EZ6A 2F0DA 3S9WA 4N9TA 1STYA 3SK6A 3TP7A 5CV7A 3NHHA 4H7BA 2EYOA 5ISRA 2PZWA 4WORA 5NUCA 2RKSA 3EJIA 2F0KA 4HMJA 2PW5A 5C5LA 4F7XA 3QOLA 5C5MA 5IGDA 4KY5A 5C3WA 1IHZA 1STGA 4IZ8A 5J39A 3OSOA 4NKLA 2F0LA 1A3TA 2OF1A 4J1MA 5CGKA 2SNMA 5HGTA 5IOCA 1STAA 2F0MA 2QDBA 1SNPA 1EYCA 2F0QA 3DMUA 4ME5A 2O4XA 1SYFA 5KEEA 2F0UA 5CR3A 4B9XA 4KTAA 5IGFA 2KHSA 4ZUJA 3SK5A 5IGGA 2KQ3A 1JORA 3D6CA 5CV9A 1AEXA 4K5XA 1U9RA 2F0HA 2F0OA 3DHQA 1TT2A 1RKNA 5IGEA 3NP8A 4J6HA 5EKLA 1NUCA 2LKVA 2F0IA 1EYDA 3T13A 3T16A 3MXPA 4ZUIA 2RDFA 4QMGA 5F2DA 4EQPA 3SHLA 4ID6A 3P1HA 3RUZA 2PYKA 3R3OA 1A3UA 5IODA 5JAVA 5K5PA 2PZUA 2SNSA 4PMBA 1STNA 3SK4A 2M00A 2EY5A 3SK8A 1SYEA 3HZXA 2RBMA 2EY2A 2OXPA 1KDBA 2F0TA 1F2YA 3MVVA 2OEOA 4MIUA 1JOOA 2F0PA 4NDXA 1SNCA 3HEJA 3NXWA 2F0SA 5DEHA 1SYCA 1F2MA 2EYHA 5EKKA 5JOBA 4I65A 4E6IA 5I6YA 3D4WA 1EY6A 4KV6A 4S3SA 5E1FA 4EQOA 4NMZA 4EVOA 4DGZA 5CC4A 4OL7A 2EYLA 2F0WA 4PMCA 5C4ZA 4K2KA 4TRDA 2SOBA 4HMIA 5KIXA 4EQNA 3H6MA 1JOQA 1EY0A 1EYAA 5C4HA 1KDCA 1KAAA 4DFAA 3D8GA 1EQVA 2EY6A 3BDLA 4K6DA 4KY6A 2NUCA 1KDAA 5KGUA 2F0EA 1TQOA 3SR1A 3V2TA 5HURA 5I9OA 3TP5A 4K2LA 1NSNS 5I6WA 5CV6A 3MEHA 5CV5A 5KYIA 1EZ8A 1SNQA 4QF4A 3PMFA 4RKBA 1SYDA 4PNYA 4HTHA 3OWFA 1EY5A 1A2TA 2HQEA 2EYFA 3C1FA
chains in the Genus database with same CATH superfamily
1D5XC 2ZJQA 2AQ1B 2JQOA 3K0XA 3GTLH 4A93B 2Q2HA 2G9HD 1EQRA 1QVCA 2Z8LA 4DK6C 4A75A 3FMCA 5KYLA 2PPBC 2O5IC 4LF5Q 4RCOA 2ID0A 5CV4A 4KD3A 1PH2A 2UU9Q 1WYDA 5I4DA 4C1NI 1HNWQ 2GVBA 1K8MA 2MO1A 4ZCKA 1XMQQ 3I72A 2EDGA 4JI1L 1JB7A 4GKKQ 2AWOA 4DR3Q 3BZKA 4OEMB 1ZYRD 2VXWA 4G4KA 4NXMQ 3ZJYC 3PUVA 5LMNQ 1SYGA 2Z1CA 2E74C 4MZ9A 1LTTD 1STHA 1Y8NB 2PNRC 1X3GA 4YIJA 4JI2Q 3S9WA 5BN4A 1TWHH 1QZGA 2B2TA 5IWAQ 2RVLA 1HR0W 5NUCA 4A3DB 1I4PA 5C5MA 4KY5A 1C0AA 4RGTA 5J39A 2AMCB 1R9TH 5GQOA 2KVMA 1ASZA 4J8QA 4B9XA 3NWTA 4RHSA 1VMPA 3D6CA 2EOTA 2YYZA 3E3XA 3S2HB 2HHHQ 4X66Q 4DAYA 3CW2C 4P74A 1Y69U 1JICA 3M9BA 5JVG3 3CPWA 2XRSD 4A3IG 2NN6H 4MNOA 3HOZH 2YV5A 3HZXA 1VQOA 5C4XG 2HUGA 2X6GA 1E7ZA 1OO9B 2B2YC 1SNCA 2BH8A 4JI7Q 4BY1G 3CCMA 1D2BA 3S16H 3MC0B 5EKKA 5HY6A 3K5LA 5E4WC 3OTOL 1BF4A 2H4OA 2CCZA 3HOXB 2UXDQ 4KV6A 1XPOA 3S1NB 4NMZA 2E8GA 2K7VA 4XDXA 3S1RH 1PH9A 3CU7A 3D31A 3VR2A 4A3MB 3ICEA 5C4HA 2JEBI 3BDLA 4KY6A 2JA8G 3QG1A 2F0EA 2QF7A 1EFWA 1GKHA 1PZJD 2A6HD 2NN6G 5CV6A 3M4QA 4A3GB 1I94L 1ESFA 3KF6B 2CHBD 2KHIA 1STBA 5CV8A 2EXDA 4V190 3OW2A 1RHPA 4RWSC 4LF6L 1TWFH 3DXJC 1VQ6A 3F2UA 4JBJA 4FXKC 3CP0A 4K6LA 1OXTA 1NE3A 3TMEA 2R92B 3CCUA 2EIFA 3LGJA 3VYUA 4A3JH 1YNJC 3DWQA 1EY7A 1S5ED 4IUTA 4C1NK 3PIP3 1TWGH 1YNND 5BN5A 1OXVA 2ZTDA 3AEVA 4KY7A 2ALYB 2EE1A 3HOUG 1GUGA 4LF5L 4DU9A 4NP5A 2UU9L 1OXXK 1HNWL 5C3XA 3S2DB 1D5ZC 4N9PA 3EIVA 1XMQL 3PUZA 4OO1H 4RMFA 4A3EG 3BDOA 4GKKL 2Z4IA 4DR3L 1K9MC 3EROA 2H1EA 3C46A 1TR5A 3SK6A 4DV0Q 1B70B 2B2VA 4NXML 5LMNL 4X6AH 1G2TA 1U4RA 2RKSA 5C5LA 3TZDA 2A8VA 4JI2L 1J6QA 2A73B 1NAPA 5IWAL 1SFOB 2KBNA 1E2VA 4WJ3M 4ME5A 3OW7A 3DUZA 5E4XA 4JV5Q 5CR3A 1PRTF 4JOIC 3NPPA 5CV9A 4OO1G 5DLQE 4OO1I 3K80C 3QWNA 3T16A 3RN2A 3MXPA 1GUOA 4JI8Q 3CC2A 4DUYQ 1B50A 2HHHL 4YWMA 4KN7C 4X66L 3GTGB 4G7OC 2CVRA 3HOYB 1F9RA 1WTRA 2UUAQ 2JK8A 2EYHA 1B1ZA 2Z6KC 5M5XH 1HQMC 4EVOA 5CC4A 2HDLA 4NW2A 1EIHA 3ONAB 5C4ZA 5C0XJ 4JI7L 5KIXA 1LV9A 1YI2A 2QA4A 2JE6I 4I7AA 4DA2A 1I3QB 3D8GA 4X65Q 2UXDL 3GTMB 3Q0AA 4B3RQ 1Q46A 2B39A 3M3YH 3A8IE 4K2LA 4BBRH 4C3JH 1Q3LA 1SJHD 1SYDA 5ELNA 1VCIA 3HKSA 3HFZB 5J3BA 4XTCS 5BN3A 1NBWA 3S15B 2K50A 4R4CA 1PH5A 4K8JA 2A69C 1NNXA 3MZ5A 5DAUA 1TU2B 2CH4W 4MHEA 1S4ZA 3J80E 3S17B 3SEBA 1VQPA 1SSOA 1P8LA 2KUMA 2MHVA 2K04A 4LNQA 5IGCA 2WACA 3FKIH 3EA6A 3ERQA 1XNRQ 1SRUA 3AYHB 2N78A 4F87A 1Y8PB 2B8FA 1VQDA 4HJ7A 3GTOB 2HCIA 2QDLA 1KD1C 1SLJA 3RZOH 2DY7A 4DV0L 2UUCQ 5IP9H 4DXFA 2KCCA 1J9OA 3OIQA 4OX9Q 4IFDG 3I7FA 2F0QA 2N3SA 1ONLA 5AFWA 1RD9D 1SYFA 4A3BB 1BCPF 2AUKA 3FKIG 3URYA 5IGFA 4IFDI 3SK5A 3PUYA 5KNCA 2KCMA 4J6HA 1KHIA 2XGTA 5LL6S 1JE5A 3A8JE 5IYDH 4OIKA 1LTSD 2RHSB 1V9PA 1XTCD 1Y1WB 4CHTB 1DM0B 4HJAA 4A4IA 1SEBD 1Z47A 2JEAI 1CK1A 1GD7A 3PQIA 1DXMA 1B8AA 3PIOA 2F0TA 1N36Q 1BBUA 3H0GB 1X54A 3NXWA 3GO5A 1YZ6A 2NVTB 1A63A 1JWUD 5M5YB 1YNNC 1DOLA 4DUYL 3KDFB 4U68A 2UUBQ 4DR4Q 4A3LH 3VYSA 1JCKB 1PLFA 4IURA 4L8JA 3RZDH 3PF5A 1QVFA 4JI3Q 4LFAQ 1GM5A 4X64Q 2JJQA 2YU9B 2IPKD 2GA4B 1FJGQ 4LF4Q 5M5WB 4AYBB 2Q8RE 1FNUA 3A8KE 1UAPA 4B3RL 2JA9A 2MNAA 2BCOA 1ICWA 4DV3Q 2A19A 3K7AB 4A3LG 1K83B 4DNIA 1DD2A 4C3HH 2XVSA 5FO7B 2MP1A 5E3FA 3W3AA 4OELB 1A6XA 2B2UA 2IJ0A 3GTLB 5E7NA 4FVMA 3HOWG 5C44G 3I2ZA 5J22A 5M3FH 3F8TA 3N52A 2IHFA 3OMGA 1B44D 3TEHB 3AU7A 5KRUA 3JAMc 3M85A 2ZJRA 1LTBD 4DV1Q 1KXLA 3HG9A 4L63B 5IIFA 2XIWA 2LFNA 4XT1B 1QILA 2PW7A 4O42A 3ULJA 3C1EA 1SROA 2KCTA 4C3HG 4B3SQ 3RLNA 1XNRL 1IHZA 1STGA 5CBEE 5M3FG 2C9OA 1GJXA 1XMOQ 4YWLA 1E3PA 2RQXA 2VUMB 4RAUC 1SNPA 3T4AC 3TSSA 1DYQA 1GVPA 2HCCA 1PRTD 1YHAA 4K5XA 1S5CD 5ELDA 3BYYB 4R4OA 4OX9L 3CCLA 1LO5D 4XQJA 3P1HA 3HOVH 1N34Q 5K5PA 4AQYQ 1NR4A 1O7ZA 3NENA 4HIDA 4O2DA 1PZKD 2VZAA 4IPGA 2OXPA 2LXJA 4N8X1 2JA6H 3BYTB 4POFA 2F0PA 1AFPA 2RF4A 3AB9A 5JPNC 4JBWA 3HOZB 3QR8A 1WTQA 2OCEA 4FP5D 2EYLA 4RGOS 1N36L 1C48A 5T1IA 1WD0A 1L1OA 4IJHA 1B9NA 4DR4L 1HZAA 1AZPA 2KJXA 5KGUA 2SDFA 4JCVE 3M4YA 3S1RB 3HOVG 2NVYH 4QQBX 3MEHA 4GLXA 2JA6G 2I5LX 3PMFA 4JI3L 4ZAIA 5L37A 4MTNA 4LFAL 4X64L 1V1OA 3U58A 2HQEA 1B3QA 1G2SA 1I4GA 4XXEA 2F0JA 1M8AA 2L1BA 1FJGL 1Q12A 4LF4L 2R61A 5FKAC 5JEAJ 2R3ZA 1U5KA 1FL0A 1G51A 1TWAH 4DV3L 1EU3A 2L12A 3NQTA 2PZTA 1EY4A 1TWFB 2ICEC 4H0LC 5EBDA 2E2IH 4B9WA 4A3JB 1V1QA 3SXHA 4GN4B 3NBHA 5FLXc 1CI3M 3OMCA 1SE3A 1TWGB 3W1GA 2DN8A 5IT9c 1CUKA 5CGKA 3S1MH 1L0XB 1DOKA 2LSSA 5BR8Q 4DV1L 1EZ6A 3F2CA 4P71A 2GVAA 2I07B 1E24A 2PI2E 3TRZA 1MBYA 3J80i 2L5TA 4AH6A 4LF9L 4GN3B 4LF7Q 2JA7H 1W6KA 4B3MQ 4NKLA 3VR4A 4J1MA 4RGMA 4B3SL 1KQSA 4F88A 2CKZB 2O4XA 1O78A 1N33Q 1BCPD 2NVXH 1ILQA 1ZXTA 3DHQA 1DOMA 1C4QA 5C4JH 1J8IA 1RTNA 3PUXA 4HIKA 2MQHA 1WTVA 4ID6A 2RCFA 1A3UA 4GNXA 2F4IA 3FHWA 1SXTA 2M00A 5LHY1 3KLSX 4B3TQ 5D14A 1F9QA 2KHJA 1VQ8A 1VQ4A 5I6YA 1N34L 4AQYL 2J0TD 3Q8DA 4BBSB 1EYGA 5A2QL 1K8AC 2VQEQ 4RFBA 1IYUA 1LTID 4HN7A 5M5XB 3MTSA 2AKWB 3STBD 4WJ4A 1VQ5A 3A55A 3SR1A 5C0XI 3JAML 4LFBL 3IFDA 1PH6A 3OHXC 4QF4A 2R7ZH 2RA4A 1TS5A 4YWKA 1A2TA 1S5BD 2RDFA 3M3YB 2O5JC 1KL9A 2RDGA 3RD4A 4BBRB 4C3JB 4H02A 3TS0A 2E2HH 4KHZA 2CW0D 2R93G 3I4MB 4HJ8A 1JB3A 2A68C 1PA6A 1AZQA 3I4OA 1CT1D 2QGQA 4L5RC 4AIMA 3K5NA 3F2BA 1HTLD 1PRTC 2Y0SG 4WRDA 4KI0A 4A76A 4UP7A 3EVQA 1F2ZA 2IHEA 4A3FG 2OTLA 2EYPA 4TSSA 1TS2A 5D65A 1LT4D 4YCUA 2L11A 4UHVA 5HGTA 5J1ZA 5IOCA 1EOVA 4H44C 2F52A 2F0DA 2PI2A 1XTDA 1FVIA 3W2DA 4FDBA 2IX3A 1W6JA 4UAIA 4H13C 2CWAA 3R2TA 4WORA 2B2WA 1LYLA 3J81c 1RTOA 1R4QB 5C3WA 5BR8L 4DPGA 2F0LA 1U4PA 4LUOA 1A62A 3MFYA 4IPHA 3CRKC 4J15A 5FJ8H 1W3SA 1QNUA 4LF7L 4KKUA 1XWEA 3RZOB 2DNEA 4PZ7A 2F0OA 3H91A 1WTPA 3GV6A 5IGEA 1XJVA 3N6RA 2FJ2A 4ZKBB 1R4PB 1N33L 2WAQB 3DWAA 3KLWA 2VW9A 3M4OH 3R3OA 4A3IH 4TQUS 2NBFA 1F77A 3KYHC 3ER0A 3VYRA 2RBMA 1YHQA 3GTQH 1F2YA 5C4XH 5K36G 3UDXA 4BY1H 5FJ8G 1SYCA 1E1TA 3CC7A 4FF1A 1WTHA 1D8LA 1Z7TA 4B3TL 1DGSA 2DNCA 1EY0A 2A1AA 2RHQB 1EYAA 1H95A 3PIPA 3TZUA 1IBKQ 1EQQA 2TMPA 2JA8H 3V2TA 2PQAB 5JJZA 2K32A 3RZDB 5GAGC 5CV5A 2VQEL 4BWGB 2ATWA 4FF2A 1H9SB 5G3LD 5FLXL 2OTJA 4LFCQ 4RKBA 4PNYA 4HTHA 3NELA 3PO3G 1S40A 4LWCA 1CA6A 5IT9L 1VQ9A 3NTKA 1BDOA 3RLOA 3T1HL 4IFDJ 3KF8B 1Y1VB 1I4QA 2OT2A 3HP3A 3UDFA 3S1QH 1RCVD 2FMMA 1OTCA 3IKJA 4CGYB 1BCPC 4C3HB 1BQQT 3PV0A 4HJ5A 3PUWA 1ENCA 3HOUH 4F8MA 1SE2A 2QEJC 1I50B 2A74C 3MFGA 1SNDA 2K75A 1GOZA 1PRTB 5AJ3Q 3MXUA 4A3EH 1W2BA 3PO2H 2G5DA 1TWCH 3HKZE 5CV7A 3R2IA 1YNXA 3CCEA 2I46A 3UDIA 1CQFA 1PYSB 5HGQA 1BO0A 2B2TC 2QDBA 3MXNB 4LUZA 3GTKH 5KEEA 5IP7G 3BZCA 3SE0A 1ESRA 1MSHA 3EFXD 4KTAA 1PTOH 2DY8A 2V1CC 3DEOA 3I4NG 1AP0A 3PO2G 1TT2A 2KEEA 2R7DA 1TXYA 2LKVA 2EQSA 2F0IA 4HJ9A 4DXGA 3AMUA 3A56A 3RUZA 2PYKA 5IODA 4A3KG 3C3LA 1GHKA 2PCFB 3A7LA 2HD3A 1AN8A 2Q8IB 1AW7A 1PH3A 2JA6B 3KBGA 3F1ZA 3IAYA 1CKMA 3PF4A 4DKAC 3J81j 3E6ZX 1IYJB 1X3EA 1EQVA 1F9SA 3U50C 3Q22A 1PTOD 2UXBQ 1D6EC 1X56A 3H3VC 1YVCA 2F03A 2D2CC 5KYIA 4FXDA 1IBKL 5KNBA 2EYFA 2CQOA 2EJFC 4UPAA 3BVZA 3E5SA 1WTWA 2NVYB 3M7NA 1BNZA 4DR1Q 1MHWC 4IPDA 4C2MH 4LFCL 2BDNA 4ILWA 1GUNA 3MHBA 2HQLA 1GO3E 3J81L 1ZYRC 2KOLA 1B7YB 2ENBA 4MTKA 1QUQB 3TP6A 4UP9A 1V1PA 1G291 4HIMA 1EY8A 4ALPA 3TDQA 3VA7A 3JAME 4DAMA 1PDQA 1Q1EA 1TWAB 2KECA 2K5VA 2IL8A 5EJWA 1VQFA 2E2IB 1BCPB 2D0OA 3NE5B 1KNEA 5C3EG 1VDZA 1HUMA 4JW0A 2K5DA 3CCVA 4R1JA 4X3UA 1VF7A 5ISRA 1AH9A 5AJ3L 1NMFA 3S1MB 4HMJA 2JA5G 2PW5A 3QOLA 1D1KA 1SMXA 4FXGC 2KEDA 3OSOA 3T56B 1A3TA 1CZGA 2E2JH 1HNZQ 2IW3A 2B2VC 2QW7A 4IFDH 4V0BA 2JA7B 2K6AA 1EQTA 4JI0Q 3NEMA 4XQNA 5ELCA 1CHPD 2HIXA 3D6WA 4BY7B 5TSSA 4JK1C 4RH6A 3KFUA 3T13A 4M1UB 4XT3B 1PFSA 2NVXB 2PMZB 2Z4HA 2E75C 5DNFA 3V96A 2NZOA 4IOCA 2DGYA 1ET9A 3SK4A 5C4JB 5FK9C 4GOPA 1BUVT 5GAEC 1HHVA 2VB2X 4Z9CB 2B63B 2WB1B 4DK0A 1EY6A 1QB5D 4QIWB 4DGZA 4BA1I 4OL7A 3RN5A 2A6HC 4KMUC 2VL6A 4K2KA 1CKNA 5M3MG 4DAYB 2WFWA 3QIAA 1JOQA 2K5HA 2ZT9C 4JV5L 4C3IG 2NUCA 1HJPA 1TS4A 4ABNA 4BXXG 5EAYA 4A93G 3L3OC 1O80A 1SMYD 2A5HA 2LMCB 2V4DA 2VY3A 2WKCA 5CORA 1EY5A 2UXBL 2B8GA 3P7JA 4JI8L 2LY7A 3K81C 1LT6D 4A3DH 3MA2B 3U4VA 1MGSA 1JJ2A 2R7ZB 1PFNA 2LXKA 4RHRA 3VA5A 1VQAA 3W5OA 4WFN3 4RGNA 1VQIA 2DJGC 2UUAL 2AQ2B 2E2HB 3CCRA 4K5VA 1YJWA 1O7YA 3P75A 4PZ8A 1C9OA 3HOWH 1L0YB 5C44H 4DR1L 2E5LQ 4IUNA 3IFTA 1PHJA 2ZM6Q 2E2DC 4JYAQ 1B2TA 3KLSA 5FLXE 4X65L 4PQXA 2IWHA 2O2LD 5IT9E 1K8OA 3A5UA 3LX0A 1Q7YC 5C6AA 4A3DG 1SE8A 5JJKA 1PFMA 1TIID 3FRPB 1I6HH 1BVSA 3EJIA 1NTGA 3G4SA 3CRLC 2DUDA 3I8ZA 3CAMA 1STAA 2K01A 2R7FA 1EIGA 2N8NA 5ELEA 1JORA 1JWMD 3PCOB 4CDCC 2Z6BA 4PV1C 4R4IA 1HNZL 3NP8A 2R6GA 3U9SA 2L15A 1EWCA 1H9KA 3PGZA 3IL8A 3SHLA 1PZID 4XQQA 4JI0L 4DR2Q 2EVBA 4X62Q 4Y7NH 3HOXG 2YTYA 1SYEA 3LNNA 1TWHB 5H1SE 2IT1A 2F0SA 3M4OB 4A3MG 4A3IB 2PNHA 3L9AX 5E1FA 3GTQB 5C4XB 1VQGA 2UUCL 1R9TB 3X3MA 4TRDA 4BY1B 2SOBA 4A3GG 2KCNA 4HEDA 2RSOA 1S72A 4CDFC 1X6OA 3J80c 1IXRA 5IYCG 3S2DH 5HURA 3AFQA 5I9OA 3TP5A 1X9NA 3A5ZB 3TQYA 5ELBA 1G8ZD 4DK1A 2XN9C 3FDTA 2JA8B 2R92G 1U4MA 3C1FA 4DR7Q 1P16A 1V8QA 4G7HC 3CQZH 3ULPA 1WTXA 3KOJA 3DM1A 1MI2A 1NCVA 2L55A 1FGUA 1O7IA 3CMAA 3S16B 1SFOH 2CQAA 2XSCA 3GDEA 2UUBL 3NSWA 1M90C 1B3AA 2K1BA 2XTIA 5G3LF 4DUZQ 3S1QB 1TS3A 2B2UC 2JXMB 3J7AF 3TP8A 1B4OA 2E5LL 4IOAA 3DM3A 3D4RA 3HOUB 5IY0A 2ZM6L 2EYMA 4JYAL 2VQFQ 1K8GA 2P5ZX 3NHHA 4FF4A 3J81E 4A3EB 1QCBD 4F7XA 3VDYA 3G71A 1G91A 2NWGA 1S3OA 2L9HA 3Q6SA 4NB3A 1D7QA 3A0JA 4UP8A 1CZWA 4QGUA 1C7YA 3C2PA 4CBVA 4KLKA 4BA2I 3EN2A 2Q2UA 1E1OA 1F9PA 3WWVA 1I5FA 1PH7A 2YTVA 1QZHA 3DLLA 1U9RA 4OWXB 2D62A 1RKNA 5EKLA 1NUCA 3GTKB 1XYIA 1EYDA 1IZ6A 3H09A 1SE4A 5F2DA 2MFIA 3HOYG 2AWNA 3EBEA 2CH4A 1Y8OB 4OXPA 3VR5A 5FO8B 1YITA 2EY2A 4TVAB 1PXUA 3K7UC 2OEOA 4P2CB 3S15H 2VB3X 3ERSX 5DEHA 2ASBA 3KF6A 4DR2L 4X62L 3OIPA 4HIOA 4EQOA 3E0JA 1GUWA 4I7ZC 2ICIA 1QNKA 1SBBB 4JI1Q 1XMOL 4OONA 3H94A 3X3NA 4P73A 1OXUA 2I5HA 5C0XH 3M7GA 5JJIA 2K5WA 1L1OC 1X65A 1UUPA 2XRQD 3M4PA 1CHQD 1VF5C 3B6YA 1KLUD 5D3IB 1CSPA 4EQ5A 1Z6HA 2R93H 4EGVA 4DF7A 1QOHA 1QE6A 3K59A 1ICFB 3CKIB 4KD4A 4L5QA 3J7A5 4DR7L 4K8IA 4KK7A 1PTOF 2C5CA 2K14A 1LT3D 4HR7B 1EY9A 1XPUA 3DEPA 4C2MB 4KKTA 3TBIB 5C0XG 1GUSA 4CJ1B 4LF8Q 5ELOA 4NXNQ 1X3QA 2FHTA 2K28A 5LMUQ 2Z0SA 3CXCA 4FNFA 4CKCA 4A3FH 1BBXC 2JSOA 2B29A 5EGTA 2KA7A 1EEFD 4EX5A 3VYTA 2F0GA 3GQBA 2WB1E 1VQHA 4X3KA 4LJZC 1BXTA 1JWSD 3I4LA 5EPJA 4KHVA 4R8NA 4K5WA 4DUZL 4JBMA 4R8IA 4N9TA 2N49A 2EYOA 2PZWA 3RR5A 1SAPA 3HRZC 5M5YH 1YEZA 2VQFL 3E9HA 1EL0A 1NJIC 3BG3A 3DWPA 3UE1A 1JT8A 3A54A 3BVGA 1IKLA 5EPKA 3WOFA 1Y1WG 3CPFA 4POGA 2E2JB 4CKBA 4DAVA 2K03A 4IN3A 1WI5A 3I3CA 5M5WH 1VQCA 2B2YA 3FKIB 3AFPA 3H0GG 4ZUIA 1SJED 4QMGA 1HPCA 3BU2A 1UEAB 4FYDA 5FOBB 1XXGA 2B3GA 1STNA 3ZYYX 4LF6Q 3UE0A 3CHBD 5K36H 2D9UA 2OQ0A 4AYBE 2I0QA 3RNUA 1HTPA 5T1GA 4E6IA 1HUNA 4GNXC 4B3ML 1GUTA 4JI5Q 1RL2A 2GN5A 4DNTB 4YCWA 1QG7A 1VQMA 4HMIA 3U4ZA 3MXGA 4AYBG 1PH8A 4K6DA 3AQQA 3GTJH 2DJFC 4R4QA 5ELFA 1A8VA 1NSNS 3K5OA 4GLAC 1KNAA 3PO3H 3WDNA 3MWYW 4LMQD 2MPMA 1WOCA 2HIVA 3V05A 1T5EA 4GKJQ 3FVQA 4KN4C 1L1OB 4LUVA 2YTXA 2FXQA 1CM9A 4NPSA 1WFQA 1ILPA 1F2LA 2VUMH 3HS0C 5GROA 3H15A 2QILA 1H9RA 1ZKOA 5FO9B 3A7AB 1B53A 1ET6A 1VS0A 1B9MA 3QB3A 4DV4Q 3NWSA 1DONA 2NB0A 4KJOA 1IBLQ 4CJ2C 2K5NA 1SYBA 1JR0D 2A69D 3HOWB 2ZXRA 3ITPA 5C44B 1CFMA 4YHHQ 4NXNL 5JAVA 4JVZA 4LF8L 1JOKA 4DN4M 5LMUL 2F0NA 2F3WA 2PQEA 1EU4A 3LWEA 3SDZA 3TP7A 1LTRD 3TREA 1M4VA 2WINB 1IL2A 1VQKA 1XNQQ 1L2FA 1PVOA 3UI2A 3NBIA 5GAHC 2VUMG 3GV3A 3VR3A 4JOIA 2IX0A 1STEA 1Z9FA 1I6HB 1WCMH 3NBHB 2B2WC 1EYCA 3KJPA 5IP7H 1WVLA 1EIFA 1Q8KA 1EFID 3G7LA 2D5DA 5M3FB 3TS2A 3KDFA 4QJFA 4FO2A 1I4XA 3GTPH 4ZLTF 3I4NH 2A6ED 3R93A 3J81i 1LACA 4GLVB 1E2ZA 1WTOA 4A3KH 1LABA 2Z6KA 3T1YQ 1PYWD 3LWUA 3QJYA 1HA5A 1MD2D 3HOZG 4L5TA 4UY8C 2NN6I 4QUCA 1V43A 1JOOA 1WCMG 4OHJA 3HKZG 3I90A 4R4TA 3STBC 4Y7NB 4JI4Q 3R8BA 4DAPA 2NVQH 3S24A 2F0WA 2OQKA 2ZXPA 1EEID 2XWBB 2QKIC 4CDEC 2ZTCA 1KAAA 2QEXA 3RMHA 5EKIA 4GNXB 1KDAA 1TQOA 4DV6Q 4IUQA 4JI6Q 4OWWB 4K0KQ 4JI5L 2N55A 2WV6D 4ME3A 2CW0C 4X3SA 1RIPA 2PO4A 3S14H 1OXSC 2MGSA 1Q90A 1X55A 2SEBD 3HOVB 2AQ3B 4HCSA 3J7AV 3FP9A 1UWVA 1EWHA 2MUYA 1I4RA 2M9VA 5CMDA 4A3JG 5JEAH 3CQZB 1SNOA 3J7YW 5COYA 1A2UA 4GKJL 3BVMA 4R9WA 1ENAA 5CBAE 5JVH3 4N8FA 3I56A 2JP1A 5FLMH 2NYZD 3F2DA 3A74A 4KJNA 4GZYC 2Q8TA 5IGBA 1EWIA 4P72A 4DV4L 4G57A 2F0FA 3D0FA 4DV2Q 1II3A 3U9OA 4G7ZC 4ZQ3A 1HZ9A 4B08A 1IBLL 3ND8A 5C3EH 4HCEA 1HH2P 1STYA 4IUUA 1IYVA 5A2QE 1LM0A 4DR6Q 4YHHL 1E2WA 5JEAG 2BH2A 2JA5H 2F0KA 1VQBA 5JJLA 3OPOA 2FINB 4IZ8A 1H9JA 4DR5Q 4BBSH 1UEBA 3G48A 1PV4A 1XNQL 5FLMG 3K5MA 4IUVA 4RCNA 2F0UA 1YBYA 3K57A 1JJCB 3O13A 1GHJA 2F0HA 4QL5A 1XPRA 2HT1A 1JJGA 2RCNA 2Q2IA 4IJLA 3I70A 1EOTA 2K05A 2J4XA 3CD6A 2CWPA 1DCZA 2Q2TA 3NQIA 1KRSA 3SGIA 3TN2A 2HDMA 1L0WA 1PH1A 3I4MH 4BBSG 3HEJA 2MO0A 2X69A 1GXDC 3T1YL 2WKDA 3D4WA 2ZTEA 1O7LA 3KK7A 4IO9A 1D1IA 5M3MH 5DM63 1WJJA 3K6OA 2BOSA 3KUPA 1KDCA 4JI4L 1QWYA 2F4VQ 2NZHA 2Z9HA 4C3IH 3KBXA 4KHPQ 1UE7A 4BBRG 4BXXH 2EPBA 4IUPA 4C3JG 2EJGC 1I6VC 4DK3C 4A93H 4OIJA 1KLGD 1A0IA 3I4MG 3QO2A 4UDUC 2NZ1D 1MIUA 1CQVA 4JI6L 4DV6L 4K0KL 1G6ZA 1BKBA 1IW7D 4Q5VA 1MJEA 4ODGA 5I9PA 4DV7Q 5LMNW 3E0EA 1KABA 1XX8A 5EQ0A 5M9OA 3KLRA 4PG3A 4U673 2R93B 1RODA 3CCQA 3WOEA 3QOJA 2A6EC 1BBWA 1VQJA 5D3DA 1VQLA 3K0YA 3I55A 3OOCA 1DZ1A 2EXZA 1JC7A 2Y0SB 2NTTA 1BOSA 1EUJA 1I4HA 3NTIA 1K3RA 1CKOA 1Q8IA 3RLFA 3MAQA 4XIGS 4A3FB 1IKMA 1HRJA 4K14A 1QVGA 4WJWA 1NR2A 1KRTA 4DV2L 2LS01 3FPPA 1MSGA 2WAQE 4LK1C 1AE2A 1TY0A 2F3IA 4IPCA 3OWEB 3GP7A 1KTKA 2OF1A 1K28A 2M2LA 4GS3A 4DV5Q 4DR6L 5IP9G 2F0MA 3S2HH 1T5XD 4CDDC 4L5SA 1PFBA 2WAQG 1N9WA 4DR5L 1YIJA 1LUZA 4O1NA 2K4KA 3L0OA 1T9HA 5EBCA 1SN8A 5IYDG 3MEFA 3L2PA 2K33A 4PMWA 1FNWA 1LTGD 3BS1A 3HOXH 3K8AA 3S1NH 3MVVA 4MIUA 1Y1VH 3GD7A 4HSPA 4A3MH 2H5XA 1F2MA 5JOBA 4I65A 3D3RA 1PTOC 4JBKA 1VQEA 1K3BC 4GOPC 1HZCA 2UXCQ 1HQRD 1JE4A 3E9IA 4C56C 3H6MA 3I73A 4A3GH 1S5DD 1I50H 1MKHA 1FR3A 2CFMA 1HZBA 3ULLA 4XYQA 5IYCH 3UDGA 4HAEA 1FYCA 3T53B 1EZ8A 2ES2A 2F1MA 3PIO3 1YJ9A 1PMRA 2F4VL 3OWFA 4BS9A 2R92H 4LF9Q 1Y1VG 4LW1A 1C8CA 1VQ7A 3GTJB 4KHPL 1E0BA 1J5EQ 3FEWX 4KKSA 3SVMA 3NUCA 5CYUA 1UE6A 4JG2A 3PO3B 3CCSA 1ASYA 1D5MC 2F0VA 4IALA 4DV7L 3HGBA 4XYOA 2E76C 2A68D 3BDCA 3D4DA 2F3VA 1BR9A 4ULLA 4YCVA 1CSQA 3Q24A 4OWTB 1IL8A 1KC8C 4QCLA 2I5MX 2QCPX 1HR0Q 1LTLA 2RSNA 2KENA 3PSIA 2BE5D 1HNXQ 1X32A 1UE1A 1AE3A 2TSSA 1LT5D 1HXYD 5IGDA 1V1PB 4X3TA 1IBMQ 1ML0D 3BZDB 4ZRZA 1CTMA 2X6LA 5JPMC 2XNAC 1U0LA 1N32Q 1K0RA 3K58A 1UNSA 2ZXOA 4TKOB 1Q1BA 3J7ZC 3P20A 4ZUJA 4QUFA 1ENFA 5IGGA 2KQ3A 5IYBH 1WCMB 3HKZB 1X3FA 4DV5L 2MJ8A 1K0SA 4LFBQ 3T51B 4QY7A 3GTGH 1MJCA 4EQPA 1QJOA 3HOYH 4GN5A 3GTPB 1IW7C 2NTSA 3I4NB 3JAMi 2PZUA 2SNSA 3ND9A 4PMBA 3PO2B 1TWCB 2PQAA 3JC66 2EY5A 5I2YA 1TY2A 2K52A 1N8RC 1PYBA 1KDBA 4RG1A 1VMCA 2K5QA 1H9SA 1S5FD 3NTHA 4A3KB 1YHBA 1FD7D 2RDHA 1I3QH 4YY3Q 1JMCA 4S3SA 2IY5B 3GTMH 4APVA 5IYBG 2OWOA 4CJ0B 1YJNA 1SMYC 1KIXA 4EQNA 2EZVA 3KF8A 1H9MA 4DFAA 2NVQB 2EY6A 1PTOB 2L4NA 1K73C 2UXCL 3BJUA 4GOPB 5I6WA 1HA6A 5EPLA 3FPUB 1G6PA 2BA1A 3OYYA 4JPBW 4HSVA 1DJRD 2FMCA 1Q81C 2EYJA 2JN4A 3S14B 2VS1A 1CKNB 2WP8J 1TKWB 3S17H 2J7ZA 4Y52H 2IX1A 2WIIB 4QB4A 4A3CH 2AHOB 5IE8A 2EJMA 1J5EL 2N88A 4IQZA 4M8AA 1M1KC 1FNVA 4RKLA 1SNMA 3Q23A 5LL6X 4BY7H 4LAAA 2EY1A 3NK9A 3MXNA 1NY4A 1CA5A 1A3VA 1ZEQX 2BA0A 3GTOH 4Q0FA 4RA8A 1TVXA 4H7BA 1VQNA 4MN3A 3I91A 4A3CG 2B63H 4OGQC 5C3EB 1WD1A 2JA7G 2ZJPA 1HR0L 4A3BH 2PMZE 4L6TB 2SNMA 1HNXL 3IRBA 2G9DA 5A35A 4PZ6A 1FGBD 3G6EA 2JA5B 1YNJD 4BY7G 3DMUA 1EIYB 4O0AA 2KHSA 1Y1WH 1AEXA 2C35B 1IBML 3VR6A 4QIWE 1RDPD 1SDFA 1N32L 1SR3A 4ZYSA 4FF3A 4CKEA 2JYOA 3G6JB 3H0GH 1A15A 1Q82C 1LTAD 5I2XA 3CCJA 2B63G 2NVTH 2WB1G 3W1BA 1KAWA 3OTOQ 3H3VH 1HFGA 3EQLC 5GADC 4A3BG 3SK8A 2XWJB 3KJOA 1JQYD 1Q86C 3CMEA 4NDXA 3T1HQ 2VNUD 1U4LA 1RF2D 4ZKCB 2Y0SE 2FFKB 5DM73 4DNRB 4ZK9B 2YU9H 4PMCA 2AUJD 3L7ZC 4P75A 1I94Q 1HFNA 1RJTA 4YY3L 1Y14B 5KNDA 3J80L 1PH4A 3CF5A 1QUQA 4JC0A 5M3MB 1E22A 2BDOA 1UE5A 2L0CA 1LLRD 3K7AH 2BE5C 1K83H 1HCZA 3H3VI 1SNQA 2R7ZG 3CC4A 4C3IB 2D0PA 1NMGA 1X3PA
chains in the Genus database with same CATH topology
1D5XC 2AQ1B 4A93B 2G9HD 2Z8LA 3FMCA 5KYLA 2PPBC 2O5IC 4RCOA 2ID0A 5CV4A 4KD3A 5I4DA 4C1NI 1K8MA 3I72A 2EDGA 2AWOA 1ZYRD 2VXWA 4G4KA 3PUVA 1SYGA 2Z1CA 2E74C 1LTTD 1STHA 1Y8NB 2PNRC 4YIJA 3S9WA 5BN4A 2B2TA 2RVLA 5NUCA 4A3DB 1I4PA 5C5MA 4KY5A 4RGTA 5J39A 2KVMA 4J8QA 4B9XA 3NWTA 4RHSA 1VMPA 3D6CA 2EOTA 2YYZA 3S2HB 4DAYA 1Y69U 1JICA 5JVG3 2XRSD 2NN6H 3HZXA 2HUGA 2X6GA 1OO9B 2B2YC 1SNCA 1D2BA 3MC0B 5EKKA 3K5LA 1BF4A 5E4WC 2H4OA 3HOXB 4KV6A 3S1NB 4NMZA 2K7VA 4XDXA 3CU7A 3D31A 3VR2A 4A3MB 5C4HA 2JEBI 3BDLA 4KY6A 3QG1A 2F0EA 2QF7A 1PZJD 2A6HD 2NN6G 5CV6A 4A3GB 1ESFA 2CHBD 1STBA 5CV8A 4V190 1RHPA 4RWSC 3DXJC 3F2UA 4FXKC 4K6LA 2R92B 1OXTA 3TMEA 3VYUA 1YNJC 3DWQA 1EY7A 1S5ED 4IUTA 4C1NK 3PIP3 1YNND 5BN5A 1OXVA 4KY7A 2EE1A 1GUGA 4DU9A 4NP5A 1OXXK 5C3XA 3S2DB 1D5ZC 4N9PA 3PUZA 4OO1H 3BDOA 2Z4IA 3EROA 2H1EA 3C46A 1TR5A 3SK6A 2B2VA 1G2TA 1U4RA 2RKSA 5C5LA 3TZDA 2A73B 1NAPA 1SFOB 1E2VA 4ME5A 3OW7A 3DUZA 5E4XA 5CR3A 1PRTF 3NPPA 5CV9A 4OO1G 4OO1I 3QWNA 3T16A 3MXPA 1GUOA 1B50A 4KN7C 3GTGB 4G7OC 2CVRA 3HOYB 1F9RA 1WTRA 2EYHA 1B1ZA 1HQMC 4EVOA 5CC4A 2HDLA 4NW2A 1EIHA 3ONAB 5C4ZA 5C0XJ 5KIXA 1LV9A 2JE6I 4DA2A 1I3QB 3D8GA 3GTMB 3Q0AA 2B39A 3A8IE 4K2LA 1Q3LA 1SJHD 1SYDA 1VCIA 4XTCS 5BN3A 3S15B 4K8JA 2A69C 3MZ5A 5DAUA 1TU2B 4MHEA 1S4ZA 3J80E 3S17B 3SEBA 1SSOA 2KUMA 2MHVA 2K04A 5IGCA 2WACA 3EA6A 3ERQA 4F87A 1Y8PB 2B8FA 3GTOB 2HCIA 2DY7A 4DXFA 2KCCA 1J9OA 3OIQA 4IFDG 2F0QA 5AFWA 1ONLA 1RD9D 1SYFA 4A3BB 1BCPF 3URYA 5IGFA 2AUKA 4IFDI 3SK5A 3PUYA 5KNCA 4J6HA 5LL6S 3A8JE 4OIKA 1LTSD 1Y1WB 1XTCD 4CHTB 1DM0B 1SEBD 1Z47A 2JEAI 1CK1A 1DXMA 2F0TA 3H0GB 3NXWA 3GO5A 2NVTB 1JWUD 5M5YB 1YNNC 1DOLA 4U68A 3VYSA 1JCKB 1PLFA 4IURA 4L8JA 2YU9B 2IPKD 2GA4B 5M5WB 4AYBB 2Q8RE 1FNUA 3A8KE 1UAPA 2BCOA 1ICWA 3K7AB 1K83B 1DD2A 2XVSA 5FO7B 2MP1A 5E3FA 3W3AA 1A6XA 2B2UA 2IJ0A 3GTLB 4FVMA 5J22A 3N52A 3OMGA 1B44D 5KRUA 3AU7A 3M85A 1LTBD 3HG9A 4L63B 5IIFA 2XIWA 2LFNA 4XT1B 1QILA 2PW7A 4O42A 3C1EA 4C3HG 1IHZA 1STGA 5CBEE 2C9OA 1GJXA 2RQXA 2VUMB 4RAUC 1SNPA 3T4AC 3TSSA 1DYQA 2HCCA 1PRTD 4K5XA 1S5CD 5ELDA 3BYYB 1LO5D 4XQJA 3P1HA 5K5PA 1NR4A 1O7ZA 1PZKD 2OXPA 3BYTB 2F0PA 1AFPA 3AB9A 5JPNC 4JBWA 3HOZB 1WTQA 4FP5D 2EYLA 4RGOS 1C48A 5T1IA 1WD0A 1B9NA 1AZPA 2KJXA 5KGUA 2SDFA 3M4YA 3S1RB 3MEHA 3PMFA 4ZAIA 1V1OA 2HQEA 1G2SA 1I4GA 4XXEA 2F0JA 1M8AA 2L1BA 1Q12A 2R61A 5FKAC 5JEAJ 2R3ZA 1EU3A 2L12A 3NQTA 2PZTA 1EY4A 1TWFB 2ICEC 4H0LC 5EBDA 4B9WA 4A3JB 3SXHA 3NBHA 1CI3M 3OMCA 1SE3A 1TWGB 2DN8A 5CGKA 1L0XB 1DOKA 1EZ6A 2I07B 1MBYA 2L5TA 1W6KA 4NKLA 3VR4A 4J1MA 4RGMA 4F88A 2O4XA 1O78A 1BCPD 1ILQA 1ZXTA 3DHQA 1DOMA 1C4QA 1J8IA 1RTNA 3PUXA 1WTVA 4ID6A 1A3UA 2F4IA 1SXTA 2M00A 5LHY1 3KLSX 5D14A 1F9QA 5I6YA 2J0TD 4BBSB 5A2QL 4RFBA 1IYUA 1LTID 4HN7A 5M5XB 3MTSA 3A55A 3SR1A 5C0XI 3JAML 3IFDA 3OHXC 4QF4A 2RA4A 1TS5A 1S5BD 1A2TA 2RDFA 3M3YB 2O5JC 2RDGA 3RD4A 4BBRB 4C3JB 4KHZA 2CW0D 3I4MB 1JB3A 2A68C 1AZQA 1CT1D 3K5NA 1HTLD 1PRTC 4WRDA 4KI0A 3EVQA 1F2ZA 2EYPA 4TSSA 1TS2A 5D65A 1LT4D 2L11A 5HGTA 5J1ZA 5IOCA 4H44C 2F0DA 3W2DA 2IX3A 1W6JA 4UAIA 4H13C 3R2TA 4WORA 2B2WA 1RTOA 1R4QB 5C3WA 2F0LA 1U4PA 3MFYA 3CRKC 1QNUA 4KKUA 1XWEA 3RZOB 2DNEA 2F0OA 3H91A 1WTPA 3GV6A 5IGEA 3N6RA 2FJ2A 4ZKBB 1R4PB 2WAQB 3DWAA 3R3OA 4TQUS 2NBFA 1F77A 3VYRA 2RBMA 1F2YA 5K36G 1SYCA 4FF1A 1Z7TA 2DNCA 1EY0A 1EYAA 3TZUA 2TMPA 3V2TA 5JJZA 2K32A 3RZDB 5CV5A 4BWGB 4FF2A 1H9SB 5G3LD 5FLXL 4RKBA 4PNYA 4HTHA 1CA6A 5IT9L 3NTKA 1BDOA 1Y1VB 1I4QA 2OT2A 3HP3A 1RCVD 2FMMA 3IKJA 4CGYB 1BCPC 4C3HB 1BQQT 3PV0A 3PUWA 1ENCA 4F8MA 1SE2A 2QEJC 1I50B 2A74C 3MFGA 1SNDA 1GOZA 1PRTB 3MXUA 5CV7A 3R2IA 2I46A 1CQFA 1BO0A 2B2TC 2QDBA 5KEEA 3SE0A 1ESRA 1MSHA 3EFXD 4KTAA 1PTOH 2DY8A 3DEOA 1AP0A 1TT2A 2KEEA 2LKVA 2F0IA 4DXGA 3AMUA 3A56A 3RUZA 2PYKA 5IODA 3C3LA 1GHKA 2PCFB 3A7LA 1AN8A 2Q8IB 1AW7A 2JA6B 3KBGA 3IAYA 3E6ZX 1EQVA 1F9SA 3Q22A 1PTOD 1D6EC 3H3VC 2F03A 2D2CC 5KYIA 4FXDA 5KNBA 2EYFA 1WTWA 2EJFC 3BVZA 3E5SA 2NVYB 3M7NA 1BNZA 2BDNA 4ILWA 1GUNA 3MHBA 3J81L 1ZYRC 2KOLA 2ENBA 3TP6A 1V1PA 1G291 1EY8A 3TDQA 3VA7A 3JAME 1PDQA 1Q1EA 1TWAB 2KECA 2IL8A 5EJWA 2E2IB 1BCPB 3NE5B 1KNEA 1VDZA 1HUMA 2K5DA 4X3UA 1VF7A 5ISRA 3S1MB 4HMJA 2PW5A 3QOLA 1D1KA 4FXGC 2KEDA 3OSOA 3T56B 1A3TA 1CZGA 2IW3A 2B2VC 4IFDH 4V0BA 2JA7B 2K6AA 1EQTA 4XQNA 5ELCA 1CHPD 3D6WA 4BY7B 5TSSA 4JK1C 4RH6A 3T13A 4M1UB 4XT3B 2NVXB 2PMZB 2Z4HA 2E75C 5DNFA 3V96A 1ET9A 3SK4A 5C4JB 5FK9C 1BUVT 1HHVA 2VB2X 4Z9CB 2B63B 2WB1B 4DK0A 1EY6A 1QB5D 4QIWB 4DGZA 4BA1I 4OL7A 2A6HC 4KMUC 4K2KA 3QIAA 1JOQA 2ZT9C 4C3IG 2NUCA 1TS4A 4ABNA 3L3OC 1O80A 1SMYD 2A5HA 2LMCB 2V4DA 2WKCA 5CORA 1EY5A 2B8GA 3P7JA 2LY7A 1LT6D 3MA2B 1MGSA 2R7ZB 1PFNA 4RHRA 3VA5A 4WFN3 4RGNA 2AQ2B 2E2HB 4K5VA 1O7YA 3P75A 1L0YB 4IUNA 3IFTA 2E2DC 1B2TA 3KLSA 5FLXE 4PQXA 2IWHA 2O2LD 5IT9E 1K8OA 3LX0A 5C6AA 1PFMA 1TIID 3FRPB 3EJIA 3CRLC 3I8ZA 1STAA 2K01A 1EIGA 5ELEA 1JORA 1JWMD 4PV1C 3NP8A 2R6GA 3U9SA 1EWCA 1H9KA 3IL8A 3SHLA 1PZID 4XQQA 2EVBA 1SYEA 3LNNA 1TWHB 2IT1A 2F0SA 3M4OB 4A3IB 3L9AX 5E1FA 3GTQB 5C4XB 1R9TB 3X3MA 4TRDA 4BY1B 2SOBA 2KCNA 4HEDA 2RSOA 5HURA 5I9OA 3TP5A 5ELBA 1G8ZD 4DK1A 2XN9C 3FDTA 2JA8B 1U4MA 3C1FA 1V8QA 4G7HC 1WTXA 3DM1A 1MI2A 1NCVA 2L55A 3S16B 2CQAA 2XSCA 3NSWA 1B3AA 2K1BA 5G3LF 3S1QB 1TS3A 2B2UC 2JXMB 3J7AF 3TP8A 1B4OA 3D4RA 3HOUB 2EYMA 3NHHA 4FF4A 3J81E 4A3EB 1QCBD 4F7XA 1G91A 2NWGA 2L9HA 3Q6SA 1CZWA 3C2PA 4CBVA 4BA2I 1F9PA 1U9RA 2D62A 1RKNA 5EKLA 1NUCA 3GTKB 1XYIA 1EYDA 3H09A 1SE4A 5F2DA 2AWNA 1Y8OB 3VR5A 5FO8B 2EY2A 1PXUA 2OEOA 4P2CB 2VB3X 5DEHA 3OIPA 4EQOA 3E0JA 1GUWA 4I7ZC 2ICIA 1QNKA 1SBBB 3H94A 3X3NA 1OXUA 5C0XH 3M7GA 2K5WA 1UUPA 2XRQD 1CHQD 1VF5C 1KLUD 5D3IB 1Z6HA 4EGVA 4DF7A 1QOHA 1QE6A 3K59A 3CKIB 4KD4A 4K8IA 4KK7A 1PTOF 2C5CA 1LT3D 4HR7B 1EY9A 3DEPA 4C2MB 4KKTA 3TBIB 5C0XG 1GUSA 4CJ1B 4IFDJ 1X3QA 2FHTA 2K28A 4FNFA 4CKCA 1BBXC 2JSOA 5EGTA 2KA7A 1EEFD 3VYTA 2F0GA 3GQBA 4X3KA 4LJZC 1BXTA 1JWSD 3I4LA 5EPJA 4KHVA 4R8NA 4K5WA 4R8IA 4N9TA 2EYOA 2PZWA 1SAPA 3HRZC 1EL0A 3BG3A 3DWPA 3A54A 3BVGA 1IKLA 3WOFA 5EPKA 2E2JB 4CKBA 4DAVA 2K03A 4IN3A 3I3CA 2B2YA 3FKIB 4ZUIA 1SJED 4QMGA 1HPCA 1UEAB 4FYDA 5FOBB 1XXGA 1STNA 3ZYYX 3CHBD 5K36H 2D9UA 1HTPA 5T1GA 4E6IA 1HUNA 1GUTA 4DNTB 1QG7A 4HMIA 3MXGA 4K6DA 5ELFA 1NSNS 3K5OA 1KNAA 3WDNA 3MWYW 4LMQD 2MPMA 3V05A 1T5EA 3FVQA 4KN4C 1CM9A 1ILPA 1F2LA 3HS0C 2QILA 1H9RA 1ZKOA 5FO9B 3A7AB 1B53A 1ET6A 3QB3A 1B9MA 1DONA 3NWSA 2NB0A 4KJOA 4CJ2C 1SYBA 1JR0D 2A69D 3HOWB 2ZXRA 3ITPA 5C44B 1CFMA 5JAVA 1JOKA 4DN4M 2F0NA 2F3WA 2PQEA 1EU4A 3LWEA 3SDZA 3TP7A 1LTRD 1M4VA 2WINB 3UI2A 3NBIA 3GV3A 3VR3A 2IX0A 1STEA 1I6HB 2B2WC 1EYCA 1WVLA 3G7LA 1EFID 2D5DA 5M3FB 4FO2A 1I4XA 4ZLTF 2A6ED 3R93A 1LACA 1E2ZA 1WTOA 1LABA 1PYWD 3LWUA 3QJYA 1HA5A 1MD2D 2NN6I 4QUCA 1V43A 1JOOA 4OHJA 3I90A 4Y7NB 3R8BA 4DAPA 2F0WA 2ZXPA 1EEID 2XWBB 2QKIC 1KAAA 3RMHA 5EKIA 1KDAA 1TQOA 4IUQA 2N55A 2WV6D 4X3SA 2CW0C 2PO4A 1OXSC 2MGSA 1Q90A 2SEBD 3HOVB 2AQ3B 4HCSA 3J7AV 1EWHA 2MUYA 1I4RA 2M9VA 5CMDA 5JEAH 3CQZB 1SNOA 3J7YW 5COYA 1A2UA 3BVMA 4R9WA 1ENAA 5CBAE 5JVH3 2JP1A 2NYZD 4KJNA 4GZYC 2Q8TA 5IGBA 4G57A 2F0FA 1II3A 3U9OA 4G7ZC 4ZQ3A 4B08A 3ND8A 4HCEA 1STYA 4IUUA 1IYVA 5A2QE 1E2WA 5JEAG 2F0KA 3OPOA 2FINB 4IZ8A 1H9JA 3K5MA 4IUVA 4RCNA 2F0UA 3K57A 3O13A 1GHJA 2F0HA 3I70A 1EOTA 2K05A 2J4XA 1DCZA 3NQIA 3TN2A 2HDMA 3HEJA 2X69A 1GXDC 2WKDA 3D4WA 1O7LA 3KK7A 1D1IA 5DM63 3K6OA 2BOSA 3KUPA 1KDCA 1QWYA 3KBXA 2EPBA 4IUPA 4C3JG 2EJGC 1I6VC 4OIJA 1KLGD 3QO2A 4UDUC 2NZ1D 1CQVA 1G6ZA 1IW7D 4Q5VA 4ODGA 5I9PA 1KABA 1XX8A 5EQ0A 5M9OA 3KLRA 4U673 2R93B 1RODA 3WOEA 3QOJA 2A6EC 5D3DA 3K0YA 3OOCA 1DZ1A 2EXZA 1JC7A 2Y0SB 2NTTA 1BOSA 1I4HA 3NTIA 1Q8IA 3RLFA 3MAQA 4XIGS 4A3FB 1IKMA 1HRJA 4K14A 4WJWA 1NR2A 2LS01 3FPPA 1MSGA 4LK1C 1TY0A 3OWEB 3GP7A 1KTKA 2OF1A 2M2LA 2F0MA 1T5XD 1PFBA 4O1NA 5EBCA 2K33A 4PMWA 1FNWA 1LTGD 3BS1A 3MVVA 4MIUA 3GD7A 4HSPA 1F2MA 5JOBA 4I65A 3D3RA 1PTOC 1HQRD 1JE4A 4C56C 3H6MA 3I73A 1S5DD 1FR3A 4XYQA 4HAEA 1FYCA 3T53B 1EZ8A 2F1MA 3PIO3 1PMRA 3OWFA 4BS9A 1C8CA 3GTJB 1E0BA 3FEWX 4KKSA 3SVMA 3NUCA 5CYUA 3PO3B 1D5MC 2F0VA 4IALA 3HGBA 4XYOA 2E76C 2A68D 3BDCA 3D4DA 2F3VA 1BR9A 4ULLA 3Q24A 4QCLA 1IL8A 2QCPX 2RSNA 2BE5D 1X32A 2TSSA 1LT5D 1HXYD 5IGDA 1V1PB 4X3TA 1ML0D 3BZDB 4ZRZA 1CTMA 2X6LA 5JPMC 2XNAC 3K58A 1UNSA 4TKOB 2ZXOA 1Q1BA 3P20A 4ZUJA 4QUFA 1ENFA 5IGGA 2KQ3A 1WCMB 3HKZB 2MJ8A 3T51B 4EQPA 1QJOA 3GTPB 1IW7C 2NTSA 3I4NB 3PO2B 2PZUA 2SNSA 3ND9A 4PMBA 1TWCB 2EY5A 5I2YA 1TY2A 1KDBA 1VMCA 2K5QA 1H9SA 1S5FD 3NTHA 4A3KB 1FD7D 2RDHA 4S3SA 4CJ0B 1SMYC 4EQNA 2EZVA 3KF8A 1H9MA 4DFAA 2NVQB 2EY6A 1PTOB 2L4NA 5I6WA 1HA6A 5EPLA 3FPUB 2BA1A 4HSVA 1DJRD 2FMCA 2EYJA 3S14B 2WP8J 1TKWB 2J7ZA 2IX1A 2WIIB 4QB4A 2EJMA 2N88A 4IQZA 4M8AA 1FNVA 4RKLA 1SNMA 3Q23A 5LL6X 4LAAA 2EY1A 3NK9A 3MXNA 1CA5A 1A3VA 1ZEQX 2BA0A 4Q0FA 4RA8A 1TVXA 4H7BA 4MN3A 3I91A 4OGQC 5C3EB 1WD1A 4L6TB 2SNMA 2G9DA 5A35A 1FGBD 2JA5B 1YNJD 3DMUA 2KHSA 1AEXA 3VR6A 1RDPD 1SDFA 4ZYSA 4FF3A 4CKEA 2JYOA 3G6JB 1A15A 1LTAD 5I2XA 1HFGA 3EQLC 3SK8A 2XWJB 1JQYD 4NDXA 2VNUD 1U4LA 1RF2D 4ZKCB 2FFKB 5DM73 4DNRB 4ZK9B 4PMCA 2AUJD 3L7ZC 1HFNA 1RJTA 5KNDA 3J80L 5M3MB 2BDOA 2L0CA 1LLRD 2BE5C 1HCZA 1SNQA 4C3IB 1X3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E5S A;  2F0J A;  1STB A;  5CV8 A;  2EYJ A;  4ODG A;  5I9P A;  3NUC A;  4DF7 A;  1KAB A;  3VA5 A;  5E3F A;  3MHB A;  4K8J A;  4QB4 A;  4KD4 A;  3TME A;  5KYL A;  3MZ5 A;  5DAU A;  4K8I A;  5M9O A;  1EY7 A;  5CV4 A;  4KD3 A;  1SNO A;  2F0V A;  4K5V A;  2ENB A;  1A2U A;  2PZT A;  3NQT A;  4IAL A;  1EY4 A;  1EY9 A;  3P75 A;  3QB3 A;  3TP6 A;  5J22 A;  1ENA A;  4WRD A;  4IUN A;  1EY8 A;  4KJO A;  3QOJ A;  1ENC A;  4KY7 A;  4B9W A;  3EVQ A;  3OMG A;  5KRU A;  1F2Z A;  3BDC A;  4RKL A;  3SXH A;  4F8M A;  1SNM A;  1SYB A;  3D4D A;  2EYP A;  2F3V A;  4NP5 A;  2EXZ A;  4DU9 A;  5EGT A;  4LAA A;  2EY1 A;  4KJN A;  3NK9 A;  1SND A;  2F0G A;  2WAC A;  3ITP A;  3OMC A;  3TP8 A;  5C3X A;  5IGB A;  5IGC A;  4G57 A;  2F0F A;  4N9P A;  1JOK A;  1SYG A;  3LX0 A;  1II3 A;  1A3V A;  3ERQ A;  4ZQ3 A;  5J1Z A;  3U9O A;  5C6A A;  5IIF A;  2PW7 A;  4KHV A;  2EYM A;  2F0N A;  3C1E A;  1STH A;  2F3W A;  3ERO A;  4K14 A;  4K5W A;  4R8N A;  2PQE A;  4YIJ A;  1TR5 A;  1EZ6 A;  2F0D A;  3S9W A;  4N9T A;  1STY A;  3SK6 A;  3TP7 A;  5CV7 A;  3NHH A;  4H7B A;  2EYO A;  5ISR A;  2PZW A;  4WOR A;  5NUC A;  2RKS A;  3EJI A;  2F0K A;  4HMJ A;  2PW5 A;  5C5L A;  4F7X A;  3QOL A;  5C5M A;  5IGD A;  4KY5 A;  5C3W A;  1IHZ A;  1STG A;  4IZ8 A;  5J39 A;  3OSO A;  4NKL A;  2F0L A;  1A3T A;  2OF1 A;  4J1M A;  5CGK A;  2SNM A;  5HGT A;  5IOC A;  1STA A;  2F0M A;  2QDB A;  1SNP A;  1EYC A;  2F0Q A;  3DMU A;  4ME5 A;  2O4X A;  1SYF A;  5KEE A;  2F0U A;  5CR3 A;  4B9X A;  4KTA A;  5IGF A;  2KHS A;  4ZUJ A;  3SK5 A;  5IGG A;  2KQ3 A;  1JOR A;  3D6C A;  5CV9 A;  1AEX A;  4K5X A;  1U9R A;  2F0H A;  2F0O A;  3DHQ A;  1TT2 A;  1RKN A;  5IGE A;  3NP8 A;  4J6H A;  5EKL A;  1NUC A;  2LKV A;  2F0I A;  1EYD A;  3T13 A;  3T16 A;  3MXP A;  4ZUI A;  2RDF A;  4QMG A;  5F2D A;  4EQP A;  3SHL A;  4ID6 A;  3P1H A;  3RUZ A;  2PYK A;  3R3O A;  1A3U A;  5IOD A;  5JAV A;  5K5P A;  2PZU A;  2SNS A;  4PMB A;  1STN A;  3SK4 A;  2M00 A;  2EY5 A;  3SK8 A;  1SYE A;  3HZX A;  2RBM A;  2EY2 A;  2OXP A;  1KDB A;  2F0T A;  1F2Y A;  3MVV A;  2OEO A;  4MIU A;  1JOO A;  2F0P A;  4NDX A;  1SNC A;  3HEJ A;  3NXW A;  2F0S A;  5DEH A;  1SYC A;  1F2M A;  2EYH A;  5EKK A;  5JOB A;  4I65 A;  4E6I A;  5I6Y A;  3D4W A;  1EY6 A;  4KV6 A;  4S3S A;  5E1F A;  4EQO A;  4NMZ A;  4EVO A;  4DGZ A;  5CC4 A;  4OL7 A;  2EYL A;  2F0W A;  4PMC A;  5C4Z A;  4K2K A;  4TRD A;  2SOB A;  4HMI A;  5KIX A;  4EQN A;  3H6M A;  1JOQ A;  1EY0 A;  1EYA A;  5C4H A;  1KDC A;  1KAA A;  4DFA A;  3D8G A;  1EQV A;  2EY6 A;  3BDL A;  4K6D A;  4KY6 A;  2NUC A;  1KDA A;  5KGU A;  2F0E A;  1TQO A;  3SR1 A;  3V2T A;  5HUR A;  5I9O A;  3TP5 A;  4K2L A;  1NSN S;  5I6W A;  5CV6 A;  3MEH A;  5CV5 A;  5KYI A;  1EZ8 A;  1SNQ A;  4QF4 A;  3PMF A;  4RKB A;  1SYD A;  4PNY A;  4HTH A;  3OWF A;  1EY5 A;  1A2T A;  2HQE A;  2EYF A;  3C1F A; 
#chains in the Genus database with same CATH topology
 1D5X C;  2ZJQ A;  2AQ1 B;  2JQO A;  3K0X A;  3GTL H;  4A93 B;  2Q2H A;  2G9H D;  1EQR A;  1QVC A;  2Z8L A;  4DK6 C;  4A75 A;  3FMC A;  5KYL A;  2PPB C;  2O5I C;  4LF5 Q;  4RCO A;  2ID0 A;  5CV4 A;  4KD3 A;  1PH2 A;  2UU9 Q;  1WYD A;  5I4D A;  4C1N I;  1HNW Q;  2GVB A;  1K8M A;  2MO1 A;  4ZCK A;  1XMQ Q;  3I72 A;  2EDG A;  4JI1 L;  1JB7 A;  4GKK Q;  2AWO A;  4DR3 Q;  3BZK A;  4OEM B;  1ZYR D;  2VXW A;  4G4K A;  4NXM Q;  3ZJY C;  3PUV A;  5LMN Q;  1SYG A;  2Z1C A;  2E74 C;  4MZ9 A;  1LTT D;  1STH A;  1Y8N B;  2PNR C;  1X3G A;  4YIJ A;  4JI2 Q;  3S9W A;  5BN4 A;  1TWH H;  1QZG A;  2B2T A;  5IWA Q;  2RVL A;  1HR0 W;  5NUC A;  4A3D B;  1I4P A;  5C5M A;  4KY5 A;  1C0A A;  4RGT A;  5J39 A;  2AMC B;  1R9T H;  5GQO A;  2KVM A;  1ASZ A;  4J8Q A;  4B9X A;  3NWT A;  4RHS A;  1VMP A;  3D6C A;  2EOT A;  2YYZ A;  3E3X A;  3S2H B;  2HHH Q;  4X66 Q;  4DAY A;  3CW2 C;  4P74 A;  1Y69 U;  1JIC A;  3M9B A;  5JVG 3;  3CPW A;  2XRS D;  4A3I G;  2NN6 H;  4MNO A;  3HOZ H;  2YV5 A;  3HZX A;  1VQO A;  5C4X G;  2HUG A;  2X6G A;  1E7Z A;  1OO9 B;  2B2Y C;  1SNC A;  2BH8 A;  4JI7 Q;  4BY1 G;  3CCM A;  1D2B A;  3S16 H;  3MC0 B;  5EKK A;  5HY6 A;  3K5L A;  5E4W C;  3OTO L;  1BF4 A;  2H4O A;  2CCZ A;  3HOX B;  2UXD Q;  4KV6 A;  1XPO A;  3S1N B;  4NMZ A;  2E8G A;  2K7V A;  4XDX A;  3S1R H;  1PH9 A;  3CU7 A;  3D31 A;  3VR2 A;  4A3M B;  3ICE A;  5C4H A;  2JEB I;  3BDL A;  4KY6 A;  2JA8 G;  3QG1 A;  2F0E A;  2QF7 A;  1EFW A;  1GKH A;  1PZJ D;  2A6H D;  2NN6 G;  5CV6 A;  3M4Q A;  4A3G B;  1I94 L;  1ESF A;  3KF6 B;  2CHB D;  2KHI A;  1STB A;  5CV8 A;  2EXD A;  4V19 0;  3OW2 A;  1RHP A;  4RWS C;  4LF6 L;  1TWF H;  3DXJ C;  1VQ6 A;  3F2U A;  4JBJ A;  4FXK C;  3CP0 A;  4K6L A;  1OXT A;  1NE3 A;  3TME A;  2R92 B;  3CCU A;  2EIF A;  3LGJ A;  3VYU A;  4A3J H;  1YNJ C;  3DWQ A;  1EY7 A;  1S5E D;  4IUT A;  4C1N K;  3PIP 3;  1TWG H;  1YNN D;  5BN5 A;  1OXV A;  2ZTD A;  3AEV A;  4KY7 A;  2ALY B;  2EE1 A;  3HOU G;  1GUG A;  4LF5 L;  4DU9 A;  4NP5 A;  2UU9 L;  1OXX K;  1HNW L;  5C3X A;  3S2D B;  1D5Z C;  4N9P A;  3EIV A;  1XMQ L;  3PUZ A;  4OO1 H;  4RMF A;  4A3E G;  3BDO A;  4GKK L;  2Z4I A;  4DR3 L;  1K9M C;  3ERO A;  2H1E A;  3C46 A;  1TR5 A;  3SK6 A;  4DV0 Q;  1B70 B;  2B2V A;  4NXM L;  5LMN L;  4X6A H;  1G2T A;  1U4R A;  2RKS A;  5C5L A;  3TZD A;  2A8V A;  4JI2 L;  1J6Q A;  2A73 B;  1NAP A;  5IWA L;  1SFO B;  2KBN A;  1E2V A;  4WJ3 M;  4ME5 A;  3OW7 A;  3DUZ A;  5E4X A;  4JV5 Q;  5CR3 A;  1PRT F;  4JOI C;  3NPP A;  5CV9 A;  4OO1 G;  5DLQ E;  4OO1 I;  3K80 C;  3QWN A;  3T16 A;  3RN2 A;  3MXP A;  1GUO A;  4JI8 Q;  3CC2 A;  4DUY Q;  1B50 A;  2HHH L;  4YWM A;  4KN7 C;  4X66 L;  3GTG B;  4G7O C;  2CVR A;  3HOY B;  1F9R A;  1WTR A;  2UUA Q;  2JK8 A;  2EYH A;  1B1Z A;  2Z6K C;  5M5X H;  1HQM C;  4EVO A;  5CC4 A;  2HDL A;  4NW2 A;  1EIH A;  3ONA B;  5C4Z A;  5C0X J;  4JI7 L;  5KIX A;  1LV9 A;  1YI2 A;  2QA4 A;  2JE6 I;  4I7A A;  4DA2 A;  1I3Q B;  3D8G A;  4X65 Q;  2UXD L;  3GTM B;  3Q0A A;  4B3R Q;  1Q46 A;  2B39 A;  3M3Y H;  3A8I E;  4K2L A;  4BBR H;  4C3J H;  1Q3L A;  1SJH D;  1SYD A;  5ELN A;  1VCI A;  3HKS A;  3HFZ B;  5J3B A;  4XTC S;  5BN3 A;  1NBW A;  3S15 B;  2K50 A;  4R4C A;  1PH5 A;  4K8J A;  2A69 C;  1NNX A;  3MZ5 A;  5DAU A;  1TU2 B;  2CH4 W;  4MHE A;  1S4Z A;  3J80 E;  3S17 B;  3SEB A;  1VQP A;  1SSO A;  1P8L A;  2KUM A;  2MHV A;  2K04 A;  4LNQ A;  5IGC A;  2WAC A;  3FKI H;  3EA6 A;  3ERQ A;  1XNR Q;  1SRU A;  3AYH B;  2N78 A;  4F87 A;  1Y8P B;  2B8F A;  1VQD A;  4HJ7 A;  3GTO B;  2HCI A;  2QDL A;  1KD1 C;  1SLJ A;  3RZO H;  2DY7 A;  4DV0 L;  2UUC Q;  5IP9 H;  4DXF A;  2KCC A;  1J9O A;  3OIQ A;  4OX9 Q;  4IFD G;  3I7F A;  2F0Q A;  2N3S A;  1ONL A;  5AFW A;  1RD9 D;  1SYF A;  4A3B B;  1BCP F;  2AUK A;  3FKI G;  3URY A;  5IGF A;  4IFD I;  3SK5 A;  3PUY A;  5KNC A;  2KCM A;  4J6H A;  1KHI A;  2XGT A;  5LL6 S;  1JE5 A;  3A8J E;  5IYD H;  4OIK A;  1LTS D;  2RHS B;  1V9P A;  1XTC D;  1Y1W B;  4CHT B;  1DM0 B;  4HJA A;  4A4I A;  1SEB D;  1Z47 A;  2JEA I;  1CK1 A;  1GD7 A;  3PQI A;  1DXM A;  1B8A A;  3PIO A;  2F0T A;  1N36 Q;  1BBU A;  3H0G B;  1X54 A;  3NXW A;  3GO5 A;  1YZ6 A;  2NVT B;  1A63 A;  1JWU D;  5M5Y B;  1YNN C;  1DOL A;  4DUY L;  3KDF B;  4U68 A;  2UUB Q;  4DR4 Q;  4A3L H;  3VYS A;  1JCK B;  1PLF A;  4IUR A;  4L8J A;  3RZD H;  3PF5 A;  1QVF A;  4JI3 Q;  4LFA Q;  1GM5 A;  4X64 Q;  2JJQ A;  2YU9 B;  2IPK D;  2GA4 B;  1FJG Q;  4LF4 Q;  5M5W B;  4AYB B;  2Q8R E;  1FNU A;  3A8K E;  1UAP A;  4B3R L;  2JA9 A;  2MNA A;  2BCO A;  1ICW A;  4DV3 Q;  2A19 A;  3K7A B;  4A3L G;  1K83 B;  4DNI A;  1DD2 A;  4C3H H;  2XVS A;  5FO7 B;  2MP1 A;  5E3F A;  3W3A A;  4OEL B;  1A6X A;  2B2U A;  2IJ0 A;  3GTL B;  5E7N A;  4FVM A;  3HOW G;  5C44 G;  3I2Z A;  5J22 A;  5M3F H;  3F8T A;  3N52 A;  2IHF A;  3OMG A;  1B44 D;  3TEH B;  3AU7 A;  5KRU A;  3JAM c;  3M85 A;  2ZJR A;  1LTB D;  4DV1 Q;  1KXL A;  3HG9 A;  4L63 B;  5IIF A;  2XIW A;  2LFN A;  4XT1 B;  1QIL A;  2PW7 A;  4O42 A;  3ULJ A;  3C1E A;  1SRO A;  2KCT A;  4C3H G;  4B3S Q;  3RLN A;  1XNR L;  1IHZ A;  1STG A;  5CBE E;  5M3F G;  2C9O A;  1GJX A;  1XMO Q;  4YWL A;  1E3P A;  2RQX A;  2VUM B;  4RAU C;  1SNP A;  3T4A C;  3TSS A;  1DYQ A;  1GVP A;  2HCC A;  1PRT D;  1YHA A;  4K5X A;  1S5C D;  5ELD A;  3BYY B;  4R4O A;  4OX9 L;  3CCL A;  1LO5 D;  4XQJ A;  3P1H A;  3HOV H;  1N34 Q;  5K5P A;  4AQY Q;  1NR4 A;  1O7Z A;  3NEN A;  4HID A;  4O2D A;  1PZK D;  2VZA A;  4IPG A;  2OXP A;  2LXJ A;  4N8X 1;  2JA6 H;  3BYT B;  4POF A;  2F0P A;  1AFP A;  2RF4 A;  3AB9 A;  5JPN C;  4JBW A;  3HOZ B;  3QR8 A;  1WTQ A;  2OCE A;  4FP5 D;  2EYL A;  4RGO S;  1N36 L;  1C48 A;  5T1I A;  1WD0 A;  1L1O A;  4IJH A;  1B9N A;  4DR4 L;  1HZA A;  1AZP A;  2KJX A;  5KGU A;  2SDF A;  4JCV E;  3M4Y A;  3S1R B;  3HOV G;  2NVY H;  4QQB X;  3MEH A;  4GLX A;  2JA6 G;  2I5L X;  3PMF A;  4JI3 L;  4ZAI A;  5L37 A;  4MTN A;  4LFA L;  4X64 L;  1V1O A;  3U58 A;  2HQE A;  1B3Q A;  1G2S A;  1I4G A;  4XXE A;  2F0J A;  1M8A A;  2L1B A;  1FJG L;  1Q12 A;  4LF4 L;  2R61 A;  5FKA C;  5JEA J;  2R3Z A;  1U5K A;  1FL0 A;  1G51 A;  1TWA H;  4DV3 L;  1EU3 A;  2L12 A;  3NQT A;  2PZT A;  1EY4 A;  1TWF B;  2ICE C;  4H0L C;  5EBD A;  2E2I H;  4B9W A;  4A3J B;  1V1Q A;  3SXH A;  4GN4 B;  3NBH A;  5FLX c;  1CI3 M;  3OMC A;  1SE3 A;  1TWG B;  3W1G A;  2DN8 A;  5IT9 c;  1CUK A;  5CGK A;  3S1M H;  1L0X B;  1DOK A;  2LSS A;  5BR8 Q;  4DV1 L;  1EZ6 A;  3F2C A;  4P71 A;  2GVA A;  2I07 B;  1E24 A;  2PI2 E;  3TRZ A;  1MBY A;  3J80 i;  2L5T A;  4AH6 A;  4LF9 L;  4GN3 B;  4LF7 Q;  2JA7 H;  1W6K A;  4B3M Q;  4NKL A;  3VR4 A;  4J1M A;  4RGM A;  4B3S L;  1KQS A;  4F88 A;  2CKZ B;  2O4X A;  1O78 A;  1N33 Q;  1BCP D;  2NVX H;  1ILQ A;  1ZXT A;  3DHQ A;  1DOM A;  1C4Q A;  5C4J H;  1J8I A;  1RTN A;  3PUX A;  4HIK A;  2MQH A;  1WTV A;  4ID6 A;  2RCF A;  1A3U A;  4GNX A;  2F4I A;  3FHW A;  1SXT A;  2M00 A;  5LHY 1;  3KLS X;  4B3T Q;  5D14 A;  1F9Q A;  2KHJ A;  1VQ8 A;  1VQ4 A;  5I6Y A;  1N34 L;  4AQY L;  2J0T D;  3Q8D A;  4BBS B;  1EYG A;  5A2Q L;  1K8A C;  2VQE Q;  4RFB A;  1IYU A;  1LTI D;  4HN7 A;  5M5X B;  3MTS A;  2AKW B;  3STB D;  4WJ4 A;  1VQ5 A;  3A55 A;  3SR1 A;  5C0X I;  3JAM L;  4LFB L;  3IFD A;  1PH6 A;  3OHX C;  4QF4 A;  2R7Z H;  2RA4 A;  1TS5 A;  4YWK A;  1A2T A;  1S5B D;  2RDF A;  3M3Y B;  2O5J C;  1KL9 A;  2RDG A;  3RD4 A;  4BBR B;  4C3J B;  4H02 A;  3TS0 A;  2E2H H;  4KHZ A;  2CW0 D;  2R93 G;  3I4M B;  4HJ8 A;  1JB3 A;  2A68 C;  1PA6 A;  1AZQ A;  3I4O A;  1CT1 D;  2QGQ A;  4L5R C;  4AIM A;  3K5N A;  3F2B A;  1HTL D;  1PRT C;  2Y0S G;  4WRD A;  4KI0 A;  4A76 A;  4UP7 A;  3EVQ A;  1F2Z A;  2IHE A;  4A3F G;  2OTL A;  2EYP A;  4TSS A;  1TS2 A;  5D65 A;  1LT4 D;  4YCU A;  2L11 A;  4UHV A;  5HGT A;  5J1Z A;  5IOC A;  1EOV A;  4H44 C;  2F52 A;  2F0D A;  2PI2 A;  1XTD A;  1FVI A;  3W2D A;  4FDB A;  2IX3 A;  1W6J A;  4UAI A;  4H13 C;  2CWA A;  3R2T A;  4WOR A;  2B2W A;  1LYL A;  3J81 c;  1RTO A;  1R4Q B;  5C3W A;  5BR8 L;  4DPG A;  2F0L A;  1U4P A;  4LUO A;  1A62 A;  3MFY A;  4IPH A;  3CRK C;  4J15 A;  5FJ8 H;  1W3S A;  1QNU A;  4LF7 L;  4KKU A;  1XWE A;  3RZO B;  2DNE A;  4PZ7 A;  2F0O A;  3H91 A;  1WTP A;  3GV6 A;  5IGE A;  1XJV A;  3N6R A;  2FJ2 A;  4ZKB B;  1R4P B;  1N33 L;  2WAQ B;  3DWA A;  3KLW A;  2VW9 A;  3M4O H;  3R3O A;  4A3I H;  4TQU S;  2NBF A;  1F77 A;  3KYH C;  3ER0 A;  3VYR A;  2RBM A;  1YHQ A;  3GTQ H;  1F2Y A;  5C4X H;  5K36 G;  3UDX A;  4BY1 H;  5FJ8 G;  1SYC A;  1E1T A;  3CC7 A;  4FF1 A;  1WTH A;  1D8L A;  1Z7T A;  4B3T L;  1DGS A;  2DNC A;  1EY0 A;  2A1A A;  2RHQ B;  1EYA A;  1H95 A;  3PIP A;  3TZU A;  1IBK Q;  1EQQ A;  2TMP A;  2JA8 H;  3V2T A;  2PQA B;  5JJZ A;  2K32 A;  3RZD B;  5GAG C;  5CV5 A;  2VQE L;  4BWG B;  2ATW A;  4FF2 A;  1H9S B;  5G3L D;  5FLX L;  2OTJ A;  4LFC Q;  4RKB A;  4PNY A;  4HTH A;  3NEL A;  3PO3 G;  1S40 A;  4LWC A;  1CA6 A;  5IT9 L;  1VQ9 A;  3NTK A;  1BDO A;  3RLO A;  3T1H L;  4IFD J;  3KF8 B;  1Y1V B;  1I4Q A;  2OT2 A;  3HP3 A;  3UDF A;  3S1Q H;  1RCV D;  2FMM A;  1OTC A;  3IKJ A;  4CGY B;  1BCP C;  4C3H B;  1BQQ T;  3PV0 A;  4HJ5 A;  3PUW A;  1ENC A;  3HOU H;  4F8M A;  1SE2 A;  2QEJ C;  1I50 B;  2A74 C;  3MFG A;  1SND A;  2K75 A;  1GOZ A;  1PRT B;  5AJ3 Q;  3MXU A;  4A3E H;  1W2B A;  3PO2 H;  2G5D A;  1TWC H;  3HKZ E;  5CV7 A;  3R2I A;  1YNX A;  3CCE A;  2I46 A;  3UDI A;  1CQF A;  1PYS B;  5HGQ A;  1BO0 A;  2B2T C;  2QDB A;  3MXN B;  4LUZ A;  3GTK H;  5KEE A;  5IP7 G;  3BZC A;  3SE0 A;  1ESR A;  1MSH A;  3EFX D;  4KTA A;  1PTO H;  2DY8 A;  2V1C C;  3DEO A;  3I4N G;  1AP0 A;  3PO2 G;  1TT2 A;  2KEE A;  2R7D A;  1TXY A;  2LKV A;  2EQS A;  2F0I A;  4HJ9 A;  4DXG A;  3AMU A;  3A56 A;  3RUZ A;  2PYK A;  5IOD A;  4A3K G;  3C3L A;  1GHK A;  2PCF B;  3A7L A;  2HD3 A;  1AN8 A;  2Q8I B;  1AW7 A;  1PH3 A;  2JA6 B;  3KBG A;  3F1Z A;  3IAY A;  1CKM A;  3PF4 A;  4DKA C;  3J81 j;  3E6Z X;  1IYJ B;  1X3E A;  1EQV A;  1F9S A;  3U50 C;  3Q22 A;  1PTO D;  2UXB Q;  1D6E C;  1X56 A;  3H3V C;  1YVC A;  2F03 A;  2D2C C;  5KYI A;  4FXD A;  1IBK L;  5KNB A;  2EYF A;  2CQO A;  2EJF C;  4UPA A;  3BVZ A;  3E5S A;  1WTW A;  2NVY B;  3M7N A;  1BNZ A;  4DR1 Q;  1MHW C;  4IPD A;  4C2M H;  4LFC L;  2BDN A;  4ILW A;  1GUN A;  3MHB A;  2HQL A;  1GO3 E;  3J81 L;  1ZYR C;  2KOL A;  1B7Y B;  2ENB A;  4MTK A;  1QUQ B;  3TP6 A;  4UP9 A;  1V1P A;  1G29 1;  4HIM A;  1EY8 A;  4ALP A;  3TDQ A;  3VA7 A;  3JAM E;  4DAM A;  1PDQ A;  1Q1E A;  1TWA B;  2KEC A;  2K5V A;  2IL8 A;  5EJW A;  1VQF A;  2E2I B;  1BCP B;  2D0O A;  3NE5 B;  1KNE A;  5C3E G;  1VDZ A;  1HUM A;  4JW0 A;  2K5D A;  3CCV A;  4R1J A;  4X3U A;  1VF7 A;  5ISR A;  1AH9 A;  5AJ3 L;  1NMF A;  3S1M B;  4HMJ A;  2JA5 G;  2PW5 A;  3QOL A;  1D1K A;  1SMX A;  4FXG C;  2KED A;  3OSO A;  3T56 B;  1A3T A;  1CZG A;  2E2J H;  1HNZ Q;  2IW3 A;  2B2V C;  2QW7 A;  4IFD H;  4V0B A;  2JA7 B;  2K6A A;  1EQT A;  4JI0 Q;  3NEM A;  4XQN A;  5ELC A;  1CHP D;  2HIX A;  3D6W A;  4BY7 B;  5TSS A;  4JK1 C;  4RH6 A;  3KFU A;  3T13 A;  4M1U B;  4XT3 B;  1PFS A;  2NVX B;  2PMZ B;  2Z4H A;  2E75 C;  5DNF A;  3V96 A;  2NZO A;  4IOC A;  2DGY A;  1ET9 A;  3SK4 A;  5C4J B;  5FK9 C;  4GOP A;  1BUV T;  5GAE C;  1HHV A;  2VB2 X;  4Z9C B;  2B63 B;  2WB1 B;  4DK0 A;  1EY6 A;  1QB5 D;  4QIW B;  4DGZ A;  4BA1 I;  4OL7 A;  3RN5 A;  2A6H C;  4KMU C;  2VL6 A;  4K2K A;  1CKN A;  5M3M G;  4DAY B;  2WFW A;  3QIA A;  1JOQ A;  2K5H A;  2ZT9 C;  4JV5 L;  4C3I G;  2NUC A;  1HJP A;  1TS4 A;  4ABN A;  4BXX G;  5EAY A;  4A93 G;  3L3O C;  1O80 A;  1SMY D;  2A5H A;  2LMC B;  2V4D A;  2VY3 A;  2WKC A;  5COR A;  1EY5 A;  2UXB L;  2B8G A;  3P7J A;  4JI8 L;  2LY7 A;  3K81 C;  1LT6 D;  4A3D H;  3MA2 B;  3U4V A;  1MGS A;  1JJ2 A;  2R7Z B;  1PFN A;  2LXK A;  4RHR A;  3VA5 A;  1VQA A;  3W5O A;  4WFN 3;  4RGN A;  1VQI A;  2DJG C;  2UUA L;  2AQ2 B;  2E2H B;  3CCR A;  4K5V A;  1YJW A;  1O7Y A;  3P75 A;  4PZ8 A;  1C9O A;  3HOW H;  1L0Y B;  5C44 H;  4DR1 L;  2E5L Q;  4IUN A;  3IFT A;  1PHJ A;  2ZM6 Q;  2E2D C;  4JYA Q;  1B2T A;  3KLS A;  5FLX E;  4X65 L;  4PQX A;  2IWH A;  2O2L D;  5IT9 E;  1K8O A;  3A5U A;  3LX0 A;  1Q7Y C;  5C6A A;  4A3D G;  1SE8 A;  5JJK A;  1PFM A;  1TII D;  3FRP B;  1I6H H;  1BVS A;  3EJI A;  1NTG A;  3G4S A;  3CRL C;  2DUD A;  3I8Z A;  3CAM A;  1STA A;  2K01 A;  2R7F A;  1EIG A;  2N8N A;  5ELE A;  1JOR A;  1JWM D;  3PCO B;  4CDC C;  2Z6B A;  4PV1 C;  4R4I A;  1HNZ L;  3NP8 A;  2R6G A;  3U9S A;  2L15 A;  1EWC A;  1H9K A;  3PGZ A;  3IL8 A;  3SHL A;  1PZI D;  4XQQ A;  4JI0 L;  4DR2 Q;  2EVB A;  4X62 Q;  4Y7N H;  3HOX G;  2YTY A;  1SYE A;  3LNN A;  1TWH B;  5H1S E;  2IT1 A;  2F0S A;  3M4O B;  4A3M G;  4A3I B;  2PNH A;  3L9A X;  5E1F A;  3GTQ B;  5C4X B;  1VQG A;  2UUC L;  1R9T B;  3X3M A;  4TRD A;  4BY1 B;  2SOB A;  4A3G G;  2KCN A;  4HED A;  2RSO A;  1S72 A;  4CDF C;  1X6O A;  3J80 c;  1IXR A;  5IYC G;  3S2D H;  5HUR A;  3AFQ A;  5I9O A;  3TP5 A;  1X9N A;  3A5Z B;  3TQY A;  5ELB A;  1G8Z D;  4DK1 A;  2XN9 C;  3FDT A;  2JA8 B;  2R92 G;  1U4M A;  3C1F A;  4DR7 Q;  1P16 A;  1V8Q A;  4G7H C;  3CQZ H;  3ULP A;  1WTX A;  3KOJ A;  3DM1 A;  1MI2 A;  1NCV A;  2L55 A;  1FGU A;  1O7I A;  3CMA A;  3S16 B;  1SFO H;  2CQA A;  2XSC A;  3GDE A;  2UUB L;  3NSW A;  1M90 C;  1B3A A;  2K1B A;  2XTI A;  5G3L F;  4DUZ Q;  3S1Q B;  1TS3 A;  2B2U C;  2JXM B;  3J7A F;  3TP8 A;  1B4O A;  2E5L L;  4IOA A;  3DM3 A;  3D4R A;  3HOU B;  5IY0 A;  2ZM6 L;  2EYM A;  4JYA L;  2VQF Q;  1K8G A;  2P5Z X;  3NHH A;  4FF4 A;  3J81 E;  4A3E B;  1QCB D;  4F7X A;  3VDY A;  3G71 A;  1G91 A;  2NWG A;  1S3O A;  2L9H A;  3Q6S A;  4NB3 A;  1D7Q A;  3A0J A;  4UP8 A;  1CZW A;  4QGU A;  1C7Y A;  3C2P A;  4CBV A;  4KLK A;  4BA2 I;  3EN2 A;  2Q2U A;  1E1O A;  1F9P A;  3WWV A;  1I5F A;  1PH7 A;  2YTV A;  1QZH A;  3DLL A;  1U9R A;  4OWX B;  2D62 A;  1RKN A;  5EKL A;  1NUC A;  3GTK B;  1XYI A;  1EYD A;  1IZ6 A;  3H09 A;  1SE4 A;  5F2D A;  2MFI A;  3HOY G;  2AWN A;  3EBE A;  2CH4 A;  1Y8O B;  4OXP A;  3VR5 A;  5FO8 B;  1YIT A;  2EY2 A;  4TVA B;  1PXU A;  3K7U C;  2OEO A;  4P2C B;  3S15 H;  2VB3 X;  3ERS X;  5DEH A;  2ASB A;  3KF6 A;  4DR2 L;  4X62 L;  3OIP A;  4HIO A;  4EQO A;  3E0J A;  1GUW A;  4I7Z C;  2ICI A;  1QNK A;  1SBB B;  4JI1 Q;  1XMO L;  4OON A;  3H94 A;  3X3N A;  4P73 A;  1OXU A;  2I5H A;  5C0X H;  3M7G A;  5JJI A;  2K5W A;  1L1O C;  1X65 A;  1UUP A;  2XRQ D;  3M4P A;  1CHQ D;  1VF5 C;  3B6Y A;  1KLU D;  5D3I B;  1CSP A;  4EQ5 A;  1Z6H A;  2R93 H;  4EGV A;  4DF7 A;  1QOH A;  1QE6 A;  3K59 A;  1ICF B;  3CKI B;  4KD4 A;  4L5Q A;  3J7A 5;  4DR7 L;  4K8I A;  4KK7 A;  1PTO F;  2C5C A;  2K14 A;  1LT3 D;  4HR7 B;  1EY9 A;  1XPU A;  3DEP A;  4C2M B;  4KKT A;  3TBI B;  5C0X G;  1GUS A;  4CJ1 B;  4LF8 Q;  5ELO A;  4NXN Q;  1X3Q A;  2FHT A;  2K28 A;  5LMU Q;  2Z0S A;  3CXC A;  4FNF A;  4CKC A;  4A3F H;  1BBX C;  2JSO A;  2B29 A;  5EGT A;  2KA7 A;  1EEF D;  4EX5 A;  3VYT A;  2F0G A;  3GQB A;  2WB1 E;  1VQH A;  4X3K A;  4LJZ C;  1BXT A;  1JWS D;  3I4L A;  5EPJ A;  4KHV A;  4R8N A;  4K5W A;  4DUZ L;  4JBM A;  4R8I A;  4N9T A;  2N49 A;  2EYO A;  2PZW A;  3RR5 A;  1SAP A;  3HRZ C;  5M5Y H;  1YEZ A;  2VQF L;  3E9H A;  1EL0 A;  1NJI C;  3BG3 A;  3DWP A;  3UE1 A;  1JT8 A;  3A54 A;  3BVG A;  1IKL A;  5EPK A;  3WOF A;  1Y1W G;  3CPF A;  4POG A;  2E2J B;  4CKB A;  4DAV A;  2K03 A;  4IN3 A;  1WI5 A;  3I3C A;  5M5W H;  1VQC A;  2B2Y A;  3FKI B;  3AFP A;  3H0G G;  4ZUI A;  1SJE D;  4QMG A;  1HPC A;  3BU2 A;  1UEA B;  4FYD A;  5FOB B;  1XXG A;  2B3G A;  1STN A;  3ZYY X;  4LF6 Q;  3UE0 A;  3CHB D;  5K36 H;  2D9U A;  2OQ0 A;  4AYB E;  2I0Q A;  3RNU A;  1HTP A;  5T1G A;  4E6I A;  1HUN A;  4GNX C;  4B3M L;  1GUT A;  4JI5 Q;  1RL2 A;  2GN5 A;  4DNT B;  4YCW A;  1QG7 A;  1VQM A;  4HMI A;  3U4Z A;  3MXG A;  4AYB G;  1PH8 A;  4K6D A;  3AQQ A;  3GTJ H;  2DJF C;  4R4Q A;  5ELF A;  1A8V A;  1NSN S;  3K5O A;  4GLA C;  1KNA A;  3PO3 H;  3WDN A;  3MWY W;  4LMQ D;  2MPM A;  1WOC A;  2HIV A;  3V05 A;  1T5E A;  4GKJ Q;  3FVQ A;  4KN4 C;  1L1O B;  4LUV A;  2YTX A;  2FXQ A;  1CM9 A;  4NPS A;  1WFQ A;  1ILP A;  1F2L A;  2VUM H;  3HS0 C;  5GRO A;  3H15 A;  2QIL A;  1H9R A;  1ZKO A;  5FO9 B;  3A7A B;  1B53 A;  1ET6 A;  1VS0 A;  1B9M A;  3QB3 A;  4DV4 Q;  3NWS A;  1DON A;  2NB0 A;  4KJO A;  1IBL Q;  4CJ2 C;  2K5N A;  1SYB A;  1JR0 D;  2A69 D;  3HOW B;  2ZXR A;  3ITP A;  5C44 B;  1CFM A;  4YHH Q;  4NXN L;  5JAV A;  4JVZ A;  4LF8 L;  1JOK A;  4DN4 M;  5LMU L;  2F0N A;  2F3W A;  2PQE A;  1EU4 A;  3LWE A;  3SDZ A;  3TP7 A;  1LTR D;  3TRE A;  1M4V A;  2WIN B;  1IL2 A;  1VQK A;  1XNQ Q;  1L2F A;  1PVO A;  3UI2 A;  3NBI A;  5GAH C;  2VUM G;  3GV3 A;  3VR3 A;  4JOI A;  2IX0 A;  1STE A;  1Z9F A;  1I6H B;  1WCM H;  3NBH B;  2B2W C;  1EYC A;  3KJP A;  5IP7 H;  1WVL A;  1EIF A;  1Q8K A;  1EFI D;  3G7L A;  2D5D A;  5M3F B;  3TS2 A;  3KDF A;  4QJF A;  4FO2 A;  1I4X A;  3GTP H;  4ZLT F;  3I4N H;  2A6E D;  3R93 A;  3J81 i;  1LAC A;  4GLV B;  1E2Z A;  1WTO A;  4A3K H;  1LAB A;  2Z6K A;  3T1Y Q;  1PYW D;  3LWU A;  3QJY A;  1HA5 A;  1MD2 D;  3HOZ G;  4L5T A;  4UY8 C;  2NN6 I;  4QUC A;  1V43 A;  1JOO A;  1WCM G;  4OHJ A;  3HKZ G;  3I90 A;  4R4T A;  3STB C;  4Y7N B;  4JI4 Q;  3R8B A;  4DAP A;  2NVQ H;  3S24 A;  2F0W A;  2OQK A;  2ZXP A;  1EEI D;  2XWB B;  2QKI C;  4CDE C;  2ZTC A;  1KAA A;  2QEX A;  3RMH A;  5EKI A;  4GNX B;  1KDA A;  1TQO A;  4DV6 Q;  4IUQ A;  4JI6 Q;  4OWW B;  4K0K Q;  4JI5 L;  2N55 A;  2WV6 D;  4ME3 A;  2CW0 C;  4X3S A;  1RIP A;  2PO4 A;  3S14 H;  1OXS C;  2MGS A;  1Q90 A;  1X55 A;  2SEB D;  3HOV B;  2AQ3 B;  4HCS A;  3J7A V;  3FP9 A;  1UWV A;  1EWH A;  2MUY A;  1I4R A;  2M9V A;  5CMD A;  4A3J G;  5JEA H;  3CQZ B;  1SNO A;  3J7Y W;  5COY A;  1A2U A;  4GKJ L;  3BVM A;  4R9W A;  1ENA A;  5CBA E;  5JVH 3;  4N8F A;  3I56 A;  2JP1 A;  5FLM H;  2NYZ D;  3F2D A;  3A74 A;  4KJN A;  4GZY C;  2Q8T A;  5IGB A;  1EWI A;  4P72 A;  4DV4 L;  4G57 A;  2F0F A;  3D0F A;  4DV2 Q;  1II3 A;  3U9O A;  4G7Z C;  4ZQ3 A;  1HZ9 A;  4B08 A;  1IBL L;  3ND8 A;  5C3E H;  4HCE A;  1HH2 P;  1STY A;  4IUU A;  1IYV A;  5A2Q E;  1LM0 A;  4DR6 Q;  4YHH L;  1E2W A;  5JEA G;  2BH2 A;  2JA5 H;  2F0K A;  1VQB A;  5JJL A;  3OPO A;  2FIN B;  4IZ8 A;  1H9J A;  4DR5 Q;  4BBS H;  1UEB A;  3G48 A;  1PV4 A;  1XNQ L;  5FLM G;  3K5M A;  4IUV A;  4RCN A;  2F0U A;  1YBY A;  3K57 A;  1JJC B;  3O13 A;  1GHJ A;  2F0H A;  4QL5 A;  1XPR A;  2HT1 A;  1JJG A;  2RCN A;  2Q2I A;  4IJL A;  3I70 A;  1EOT A;  2K05 A;  2J4X A;  3CD6 A;  2CWP A;  1DCZ A;  2Q2T A;  3NQI A;  1KRS A;  3SGI A;  3TN2 A;  2HDM A;  1L0W A;  1PH1 A;  3I4M H;  4BBS G;  3HEJ A;  2MO0 A;  2X69 A;  1GXD C;  3T1Y L;  2WKD A;  3D4W A;  2ZTE A;  1O7L A;  3KK7 A;  4IO9 A;  1D1I A;  5M3M H;  5DM6 3;  1WJJ A;  3K6O A;  2BOS A;  3KUP A;  1KDC A;  4JI4 L;  1QWY A;  2F4V Q;  2NZH A;  2Z9H A;  4C3I H;  3KBX A;  4KHP Q;  1UE7 A;  4BBR G;  4BXX H;  2EPB A;  4IUP A;  4C3J G;  2EJG C;  1I6V C;  4DK3 C;  4A93 H;  4OIJ A;  1KLG D;  1A0I A;  3I4M G;  3QO2 A;  4UDU C;  2NZ1 D;  1MIU A;  1CQV A;  4JI6 L;  4DV6 L;  4K0K L;  1G6Z A;  1BKB A;  1IW7 D;  4Q5V A;  1MJE A;  4ODG A;  5I9P A;  4DV7 Q;  5LMN W;  3E0E A;  1KAB A;  1XX8 A;  5EQ0 A;  5M9O A;  3KLR A;  4PG3 A;  4U67 3;  2R93 B;  1ROD A;  3CCQ A;  3WOE A;  3QOJ A;  2A6E C;  1BBW A;  1VQJ A;  5D3D A;  1VQL A;  3K0Y A;  3I55 A;  3OOC A;  1DZ1 A;  2EXZ A;  1JC7 A;  2Y0S B;  2NTT A;  1BOS A;  1EUJ A;  1I4H A;  3NTI A;  1K3R A;  1CKO A;  1Q8I A;  3RLF A;  3MAQ A;  4XIG S;  4A3F B;  1IKM A;  1HRJ A;  4K14 A;  1QVG A;  4WJW A;  1NR2 A;  1KRT A;  4DV2 L;  2LS0 1;  3FPP A;  1MSG A;  2WAQ E;  4LK1 C;  1AE2 A;  1TY0 A;  2F3I A;  4IPC A;  3OWE B;  3GP7 A;  1KTK A;  2OF1 A;  1K28 A;  2M2L A;  4GS3 A;  4DV5 Q;  4DR6 L;  5IP9 G;  2F0M A;  3S2H H;  1T5X D;  4CDD C;  4L5S A;  1PFB A;  2WAQ G;  1N9W A;  4DR5 L;  1YIJ A;  1LUZ A;  4O1N A;  2K4K A;  3L0O A;  1T9H A;  5EBC A;  1SN8 A;  5IYD G;  3MEF A;  3L2P A;  2K33 A;  4PMW A;  1FNW A;  1LTG D;  3BS1 A;  3HOX H;  3K8A A;  3S1N H;  3MVV A;  4MIU A;  1Y1V H;  3GD7 A;  4HSP A;  4A3M H;  2H5X A;  1F2M A;  5JOB A;  4I65 A;  3D3R A;  1PTO C;  4JBK A;  1VQE A;  1K3B C;  4GOP C;  1HZC A;  2UXC Q;  1HQR D;  1JE4 A;  3E9I A;  4C56 C;  3H6M A;  3I73 A;  4A3G H;  1S5D D;  1I50 H;  1MKH A;  1FR3 A;  2CFM A;  1HZB A;  3ULL A;  4XYQ A;  5IYC H;  3UDG A;  4HAE A;  1FYC A;  3T53 B;  1EZ8 A;  2ES2 A;  2F1M A;  3PIO 3;  1YJ9 A;  1PMR A;  2F4V L;  3OWF A;  4BS9 A;  2R92 H;  4LF9 Q;  1Y1V G;  4LW1 A;  1C8C A;  1VQ7 A;  3GTJ B;  4KHP L;  1E0B A;  1J5E Q;  3FEW X;  4KKS A;  3SVM A;  3NUC A;  5CYU A;  1UE6 A;  4JG2 A;  3PO3 B;  3CCS A;  1ASY A;  1D5M C;  2F0V A;  4IAL A;  4DV7 L;  3HGB A;  4XYO A;  2E76 C;  2A68 D;  3BDC A;  3D4D A;  2F3V A;  1BR9 A;  4ULL A;  4YCV A;  1CSQ A;  3Q24 A;  4OWT B;  1IL8 A;  1KC8 C;  4QCL A;  2I5M X;  2QCP X;  1HR0 Q;  1LTL A;  2RSN A;  2KEN A;  3PSI A;  2BE5 D;  1HNX Q;  1X32 A;  1UE1 A;  1AE3 A;  2TSS A;  1LT5 D;  1HXY D;  5IGD A;  1V1P B;  4X3T A;  1IBM Q;  1ML0 D;  3BZD B;  4ZRZ A;  1CTM A;  2X6L A;  5JPM C;  2XNA C;  1U0L A;  1N32 Q;  1K0R A;  3K58 A;  1UNS A;  2ZXO A;  4TKO B;  1Q1B A;  3J7Z C;  3P20 A;  4ZUJ A;  4QUF A;  1ENF A;  5IGG A;  2KQ3 A;  5IYB H;  1WCM B;  3HKZ B;  1X3F A;  4DV5 L;  2MJ8 A;  1K0S A;  4LFB Q;  3T51 B;  4QY7 A;  3GTG H;  1MJC A;  4EQP A;  1QJO A;  3HOY H;  4GN5 A;  3GTP B;  1IW7 C;  2NTS A;  3I4N B;  3JAM i;  2PZU A;  2SNS A;  3ND9 A;  4PMB A;  3PO2 B;  1TWC B;  2PQA A;  3JC6 6;  2EY5 A;  5I2Y A;  1TY2 A;  2K52 A;  1N8R C;  1PYB A;  1KDB A;  4RG1 A;  1VMC A;  2K5Q A;  1H9S A;  1S5F D;  3NTH A;  4A3K B;  1YHB A;  1FD7 D;  2RDH A;  1I3Q H;  4YY3 Q;  1JMC A;  4S3S A;  2IY5 B;  3GTM H;  4APV A;  5IYB G;  2OWO A;  4CJ0 B;  1YJN A;  1SMY C;  1KIX A;  4EQN A;  2EZV A;  3KF8 A;  1H9M A;  4DFA A;  2NVQ B;  2EY6 A;  1PTO B;  2L4N A;  1K73 C;  2UXC L;  3BJU A;  4GOP B;  5I6W A;  1HA6 A;  5EPL A;  3FPU B;  1G6P A;  2BA1 A;  3OYY A;  4JPB W;  4HSV A;  1DJR D;  2FMC A;  1Q81 C;  2EYJ A;  2JN4 A;  3S14 B;  2VS1 A;  1CKN B;  2WP8 J;  1TKW B;  3S17 H;  2J7Z A;  4Y52 H;  2IX1 A;  2WII B;  4QB4 A;  4A3C H;  2AHO B;  5IE8 A;  2EJM A;  1J5E L;  2N88 A;  4IQZ A;  4M8A A;  1M1K C;  1FNV A;  4RKL A;  1SNM A;  3Q23 A;  5LL6 X;  4BY7 H;  4LAA A;  2EY1 A;  3NK9 A;  3MXN A;  1NY4 A;  1CA5 A;  1A3V A;  1ZEQ X;  2BA0 A;  3GTO H;  4Q0F A;  4RA8 A;  1TVX A;  4H7B A;  1VQN A;  4MN3 A;  3I91 A;  4A3C G;  2B63 H;  4OGQ C;  5C3E B;  1WD1 A;  2JA7 G;  2ZJP A;  1HR0 L;  4A3B H;  2PMZ E;  4L6T B;  2SNM A;  1HNX L;  3IRB A;  2G9D A;  5A35 A;  4PZ6 A;  1FGB D;  3G6E A;  2JA5 B;  1YNJ D;  4BY7 G;  3DMU A;  1EIY B;  4O0A A;  2KHS A;  1Y1W H;  1AEX A;  2C35 B;  1IBM L;  3VR6 A;  4QIW E;  1RDP D;  1SDF A;  1N32 L;  1SR3 A;  4ZYS A;  4FF3 A;  4CKE A;  2JYO A;  3G6J B;  3H0G H;  1A15 A;  1Q82 C;  1LTA D;  5I2X A;  3CCJ A;  2B63 G;  2NVT H;  2WB1 G;  3W1B A;  1KAW A;  3OTO Q;  3H3V H;  1HFG A;  3EQL C;  5GAD C;  4A3B G;  3SK8 A;  2XWJ B;  3KJO A;  1JQY D;  1Q86 C;  3CME A;  4NDX A;  3T1H Q;  2VNU D;  1U4L A;  1RF2 D;  4ZKC B;  2Y0S E;  2FFK B;  5DM7 3;  4DNR B;  4ZK9 B;  2YU9 H;  4PMC A;  2AUJ D;  3L7Z C;  4P75 A;  1I94 Q;  1HFN A;  1RJT A;  4YY3 L;  1Y14 B;  5KND A;  3J80 L;  1PH4 A;  3CF5 A;  1QUQ A;  4JC0 A;  5M3M B;  1E22 A;  2BDO A;  1UE5 A;  2L0C A;  1LLR D;  3K7A H;  2BE5 C;  1K83 H;  1HCZ A;  3H3V I;  1SNQ A;  2R7Z G;  3CC4 A;  4C3I B;  2D0P A;  1NMG A;  1X3P A; 
#chains in the Genus database with same CATH homology
 1D5X C;  2AQ1 B;  4A93 B;  2G9H D;  2Z8L A;  3FMC A;  5KYL A;  2PPB C;  2O5I C;  4RCO A;  2ID0 A;  5CV4 A;  4KD3 A;  5I4D A;  4C1N I;  1K8M A;  3I72 A;  2EDG A;  2AWO A;  1ZYR D;  2VXW A;  4G4K A;  3PUV A;  1SYG A;  2Z1C A;  2E74 C;  1LTT D;  1STH A;  1Y8N B;  2PNR C;  4YIJ A;  3S9W A;  5BN4 A;  2B2T A;  2RVL A;  5NUC A;  4A3D B;  1I4P A;  5C5M A;  4KY5 A;  4RGT A;  5J39 A;  2KVM A;  4J8Q A;  4B9X A;  3NWT A;  4RHS A;  1VMP A;  3D6C A;  2EOT A;  2YYZ A;  3S2H B;  4DAY A;  1Y69 U;  1JIC A;  5JVG 3;  2XRS D;  2NN6 H;  3HZX A;  2HUG A;  2X6G A;  1OO9 B;  2B2Y C;  1SNC A;  1D2B A;  3MC0 B;  5EKK A;  3K5L A;  1BF4 A;  5E4W C;  2H4O A;  3HOX B;  4KV6 A;  3S1N B;  4NMZ A;  2K7V A;  4XDX A;  3CU7 A;  3D31 A;  3VR2 A;  4A3M B;  5C4H A;  2JEB I;  3BDL A;  4KY6 A;  3QG1 A;  2F0E A;  2QF7 A;  1PZJ D;  2A6H D;  2NN6 G;  5CV6 A;  4A3G B;  1ESF A;  2CHB D;  1STB A;  5CV8 A;  4V19 0;  1RHP A;  4RWS C;  3DXJ C;  3F2U A;  4FXK C;  4K6L A;  2R92 B;  1OXT A;  3TME A;  3VYU A;  1YNJ C;  3DWQ A;  1EY7 A;  1S5E D;  4IUT A;  4C1N K;  3PIP 3;  1YNN D;  5BN5 A;  1OXV A;  4KY7 A;  2EE1 A;  1GUG A;  4DU9 A;  4NP5 A;  1OXX K;  5C3X A;  3S2D B;  1D5Z C;  4N9P A;  3PUZ A;  4OO1 H;  3BDO A;  2Z4I A;  3ERO A;  2H1E A;  3C46 A;  1TR5 A;  3SK6 A;  2B2V A;  1G2T A;  1U4R A;  2RKS A;  5C5L A;  3TZD A;  2A73 B;  1NAP A;  1SFO B;  1E2V A;  4ME5 A;  3OW7 A;  3DUZ A;  5E4X A;  5CR3 A;  1PRT F;  3NPP A;  5CV9 A;  4OO1 G;  4OO1 I;  3QWN A;  3T16 A;  3MXP A;  1GUO A;  1B50 A;  4KN7 C;  3GTG B;  4G7O C;  2CVR A;  3HOY B;  1F9R A;  1WTR A;  2EYH A;  1B1Z A;  1HQM C;  4EVO A;  5CC4 A;  2HDL A;  4NW2 A;  1EIH A;  3ONA B;  5C4Z A;  5C0X J;  5KIX A;  1LV9 A;  2JE6 I;  4DA2 A;  1I3Q B;  3D8G A;  3GTM B;  3Q0A A;  2B39 A;  3A8I E;  4K2L A;  1Q3L A;  1SJH D;  1SYD A;  1VCI A;  4XTC S;  5BN3 A;  3S15 B;  4K8J A;  2A69 C;  3MZ5 A;  5DAU A;  1TU2 B;  4MHE A;  1S4Z A;  3J80 E;  3S17 B;  3SEB A;  1SSO A;  2KUM A;  2MHV A;  2K04 A;  5IGC A;  2WAC A;  3EA6 A;  3ERQ A;  4F87 A;  1Y8P B;  2B8F A;  3GTO B;  2HCI A;  2DY7 A;  4DXF A;  2KCC A;  1J9O A;  3OIQ A;  4IFD G;  2F0Q A;  5AFW A;  1ONL A;  1RD9 D;  1SYF A;  4A3B B;  1BCP F;  3URY A;  5IGF A;  2AUK A;  4IFD I;  3SK5 A;  3PUY A;  5KNC A;  4J6H A;  5LL6 S;  3A8J E;  4OIK A;  1LTS D;  1Y1W B;  1XTC D;  4CHT B;  1DM0 B;  1SEB D;  1Z47 A;  2JEA I;  1CK1 A;  1DXM A;  2F0T A;  3H0G B;  3NXW A;  3GO5 A;  2NVT B;  1JWU D;  5M5Y B;  1YNN C;  1DOL A;  4U68 A;  3VYS A;  1JCK B;  1PLF A;  4IUR A;  4L8J A;  2YU9 B;  2IPK D;  2GA4 B;  5M5W B;  4AYB B;  2Q8R E;  1FNU A;  3A8K E;  1UAP A;  2BCO A;  1ICW A;  3K7A B;  1K83 B;  1DD2 A;  2XVS A;  5FO7 B;  2MP1 A;  5E3F A;  3W3A A;  1A6X A;  2B2U A;  2IJ0 A;  3GTL B;  4FVM A;  5J22 A;  3N52 A;  3OMG A;  1B44 D;  5KRU A;  3AU7 A;  3M85 A;  1LTB D;  3HG9 A;  4L63 B;  5IIF A;  2XIW A;  2LFN A;  4XT1 B;  1QIL A;  2PW7 A;  4O42 A;  3C1E A;  4C3H G;  1IHZ A;  1STG A;  5CBE E;  2C9O A;  1GJX A;  2RQX A;  2VUM B;  4RAU C;  1SNP A;  3T4A C;  3TSS A;  1DYQ A;  2HCC A;  1PRT D;  4K5X A;  1S5C D;  5ELD A;  3BYY B;  1LO5 D;  4XQJ A;  3P1H A;  5K5P A;  1NR4 A;  1O7Z A;  1PZK D;  2OXP A;  3BYT B;  2F0P A;  1AFP A;  3AB9 A;  5JPN C;  4JBW A;  3HOZ B;  1WTQ A;  4FP5 D;  2EYL A;  4RGO S;  1C48 A;  5T1I A;  1WD0 A;  1B9N A;  1AZP A;  2KJX A;  5KGU A;  2SDF A;  3M4Y A;  3S1R B;  3MEH A;  3PMF A;  4ZAI A;  1V1O A;  2HQE A;  1G2S A;  1I4G A;  4XXE A;  2F0J A;  1M8A A;  2L1B A;  1Q12 A;  2R61 A;  5FKA C;  5JEA J;  2R3Z A;  1EU3 A;  2L12 A;  3NQT A;  2PZT A;  1EY4 A;  1TWF B;  2ICE C;  4H0L C;  5EBD A;  4B9W A;  4A3J B;  3SXH A;  3NBH A;  1CI3 M;  3OMC A;  1SE3 A;  1TWG B;  2DN8 A;  5CGK A;  1L0X B;  1DOK A;  1EZ6 A;  2I07 B;  1MBY A;  2L5T A;  1W6K A;  4NKL A;  3VR4 A;  4J1M A;  4RGM A;  4F88 A;  2O4X A;  1O78 A;  1BCP D;  1ILQ A;  1ZXT A;  3DHQ A;  1DOM A;  1C4Q A;  1J8I A;  1RTN A;  3PUX A;  1WTV A;  4ID6 A;  1A3U A;  2F4I A;  1SXT A;  2M00 A;  5LHY 1;  3KLS X;  5D14 A;  1F9Q A;  5I6Y A;  2J0T D;  4BBS B;  5A2Q L;  4RFB A;  1IYU A;  1LTI D;  4HN7 A;  5M5X B;  3MTS A;  3A55 A;  3SR1 A;  5C0X I;  3JAM L;  3IFD A;  3OHX C;  4QF4 A;  2RA4 A;  1TS5 A;  1S5B D;  1A2T A;  2RDF A;  3M3Y B;  2O5J C;  2RDG A;  3RD4 A;  4BBR B;  4C3J B;  4KHZ A;  2CW0 D;  3I4M B;  1JB3 A;  2A68 C;  1AZQ A;  1CT1 D;  3K5N A;  1HTL D;  1PRT C;  4WRD A;  4KI0 A;  3EVQ A;  1F2Z A;  2EYP A;  4TSS A;  1TS2 A;  5D65 A;  1LT4 D;  2L11 A;  5HGT A;  5J1Z A;  5IOC A;  4H44 C;  2F0D A;  3W2D A;  2IX3 A;  1W6J A;  4UAI A;  4H13 C;  3R2T A;  4WOR A;  2B2W A;  1RTO A;  1R4Q B;  5C3W A;  2F0L A;  1U4P A;  3MFY A;  3CRK C;  1QNU A;  4KKU A;  1XWE A;  3RZO B;  2DNE A;  2F0O A;  3H91 A;  1WTP A;  3GV6 A;  5IGE A;  3N6R A;  2FJ2 A;  4ZKB B;  1R4P B;  2WAQ B;  3DWA A;  3R3O A;  4TQU S;  2NBF A;  1F77 A;  3VYR A;  2RBM A;  1F2Y A;  5K36 G;  1SYC A;  4FF1 A;  1Z7T A;  2DNC A;  1EY0 A;  1EYA A;  3TZU A;  2TMP A;  3V2T A;  5JJZ A;  2K32 A;  3RZD B;  5CV5 A;  4BWG B;  4FF2 A;  1H9S B;  5G3L D;  5FLX L;  4RKB A;  4PNY A;  4HTH A;  1CA6 A;  5IT9 L;  3NTK A;  1BDO A;  1Y1V B;  1I4Q A;  2OT2 A;  3HP3 A;  1RCV D;  2FMM A;  3IKJ A;  4CGY B;  1BCP C;  4C3H B;  1BQQ T;  3PV0 A;  3PUW A;  1ENC A;  4F8M A;  1SE2 A;  2QEJ C;  1I50 B;  2A74 C;  3MFG A;  1SND A;  1GOZ A;  1PRT B;  3MXU A;  5CV7 A;  3R2I A;  2I46 A;  1CQF A;  1BO0 A;  2B2T C;  2QDB A;  5KEE A;  3SE0 A;  1ESR A;  1MSH A;  3EFX D;  4KTA A;  1PTO H;  2DY8 A;  3DEO A;  1AP0 A;  1TT2 A;  2KEE A;  2LKV A;  2F0I A;  4DXG A;  3AMU A;  3A56 A;  3RUZ A;  2PYK A;  5IOD A;  3C3L A;  1GHK A;  2PCF B;  3A7L A;  1AN8 A;  2Q8I B;  1AW7 A;  2JA6 B;  3KBG A;  3IAY A;  3E6Z X;  1EQV A;  1F9S A;  3Q22 A;  1PTO D;  1D6E C;  3H3V C;  2F03 A;  2D2C C;  5KYI A;  4FXD A;  5KNB A;  2EYF A;  1WTW A;  2EJF C;  3BVZ A;  3E5S A;  2NVY B;  3M7N A;  1BNZ A;  2BDN A;  4ILW A;  1GUN A;  3MHB A;  3J81 L;  1ZYR C;  2KOL A;  2ENB A;  3TP6 A;  1V1P A;  1G29 1;  1EY8 A;  3TDQ A;  3VA7 A;  3JAM E;  1PDQ A;  1Q1E A;  1TWA B;  2KEC A;  2IL8 A;  5EJW A;  2E2I B;  1BCP B;  3NE5 B;  1KNE A;  1VDZ A;  1HUM A;  2K5D A;  4X3U A;  1VF7 A;  5ISR A;  3S1M B;  4HMJ A;  2PW5 A;  3QOL A;  1D1K A;  4FXG C;  2KED A;  3OSO A;  3T56 B;  1A3T A;  1CZG A;  2IW3 A;  2B2V C;  4IFD H;  4V0B A;  2JA7 B;  2K6A A;  1EQT A;  4XQN A;  5ELC A;  1CHP D;  3D6W A;  4BY7 B;  5TSS A;  4JK1 C;  4RH6 A;  3T13 A;  4M1U B;  4XT3 B;  2NVX B;  2PMZ B;  2Z4H A;  2E75 C;  5DNF A;  3V96 A;  1ET9 A;  3SK4 A;  5C4J B;  5FK9 C;  1BUV T;  1HHV A;  2VB2 X;  4Z9C B;  2B63 B;  2WB1 B;  4DK0 A;  1EY6 A;  1QB5 D;  4QIW B;  4DGZ A;  4BA1 I;  4OL7 A;  2A6H C;  4KMU C;  4K2K A;  3QIA A;  1JOQ A;  2ZT9 C;  4C3I G;  2NUC A;  1TS4 A;  4ABN A;  3L3O C;  1O80 A;  1SMY D;  2A5H A;  2LMC B;  2V4D A;  2WKC A;  5COR A;  1EY5 A;  2B8G A;  3P7J A;  2LY7 A;  1LT6 D;  3MA2 B;  1MGS A;  2R7Z B;  1PFN A;  4RHR A;  3VA5 A;  4WFN 3;  4RGN A;  2AQ2 B;  2E2H B;  4K5V A;  1O7Y A;  3P75 A;  1L0Y B;  4IUN A;  3IFT A;  2E2D C;  1B2T A;  3KLS A;  5FLX E;  4PQX A;  2IWH A;  2O2L D;  5IT9 E;  1K8O A;  3LX0 A;  5C6A A;  1PFM A;  1TII D;  3FRP B;  3EJI A;  3CRL C;  3I8Z A;  1STA A;  2K01 A;  1EIG A;  5ELE A;  1JOR A;  1JWM D;  4PV1 C;  3NP8 A;  2R6G A;  3U9S A;  1EWC A;  1H9K A;  3IL8 A;  3SHL A;  1PZI D;  4XQQ A;  2EVB A;  1SYE A;  3LNN A;  1TWH B;  2IT1 A;  2F0S A;  3M4O B;  4A3I B;  3L9A X;  5E1F A;  3GTQ B;  5C4X B;  1R9T B;  3X3M A;  4TRD A;  4BY1 B;  2SOB A;  2KCN A;  4HED A;  2RSO A;  5HUR A;  5I9O A;  3TP5 A;  5ELB A;  1G8Z D;  4DK1 A;  2XN9 C;  3FDT A;  2JA8 B;  1U4M A;  3C1F A;  1V8Q A;  4G7H C;  1WTX A;  3DM1 A;  1MI2 A;  1NCV A;  2L55 A;  3S16 B;  2CQA A;  2XSC A;  3NSW A;  1B3A A;  2K1B A;  5G3L F;  3S1Q B;  1TS3 A;  2B2U C;  2JXM B;  3J7A F;  3TP8 A;  1B4O A;  3D4R A;  3HOU B;  2EYM A;  3NHH A;  4FF4 A;  3J81 E;  4A3E B;  1QCB D;  4F7X A;  1G91 A;  2NWG A;  2L9H A;  3Q6S A;  1CZW A;  3C2P A;  4CBV A;  4BA2 I;  1F9P A;  1U9R A;  2D62 A;  1RKN A;  5EKL A;  1NUC A;  3GTK B;  1XYI A;  1EYD A;  3H09 A;  1SE4 A;  5F2D A;  2AWN A;  1Y8O B;  3VR5 A;  5FO8 B;  2EY2 A;  1PXU A;  2OEO A;  4P2C B;  2VB3 X;  5DEH A;  3OIP A;  4EQO A;  3E0J A;  1GUW A;  4I7Z C;  2ICI A;  1QNK A;  1SBB B;  3H94 A;  3X3N A;  1OXU A;  5C0X H;  3M7G A;  2K5W A;  1UUP A;  2XRQ D;  1CHQ D;  1VF5 C;  1KLU D;  5D3I B;  1Z6H A;  4EGV A;  4DF7 A;  1QOH A;  1QE6 A;  3K59 A;  3CKI B;  4KD4 A;  4K8I A;  4KK7 A;  1PTO F;  2C5C A;  1LT3 D;  4HR7 B;  1EY9 A;  3DEP A;  4C2M B;  4KKT A;  3TBI B;  5C0X G;  1GUS A;  4CJ1 B;  4IFD J;  1X3Q A;  2FHT A;  2K28 A;  4FNF A;  4CKC A;  1BBX C;  2JSO A;  5EGT A;  2KA7 A;  1EEF D;  3VYT A;  2F0G A;  3GQB A;  4X3K A;  4LJZ C;  1BXT A;  1JWS D;  3I4L A;  5EPJ A;  4KHV A;  4R8N A;  4K5W A;  4R8I A;  4N9T A;  2EYO A;  2PZW A;  1SAP A;  3HRZ C;  1EL0 A;  3BG3 A;  3DWP A;  3A54 A;  3BVG A;  1IKL A;  3WOF A;  5EPK A;  2E2J B;  4CKB A;  4DAV A;  2K03 A;  4IN3 A;  3I3C A;  2B2Y A;  3FKI B;  4ZUI A;  1SJE D;  4QMG A;  1HPC A;  1UEA B;  4FYD A;  5FOB B;  1XXG A;  1STN A;  3ZYY X;  3CHB D;  5K36 H;  2D9U A;  1HTP A;  5T1G A;  4E6I A;  1HUN A;  1GUT A;  4DNT B;  1QG7 A;  4HMI A;  3MXG A;  4K6D A;  5ELF A;  1NSN S;  3K5O A;  1KNA A;  3WDN A;  3MWY W;  4LMQ D;  2MPM A;  3V05 A;  1T5E A;  3FVQ A;  4KN4 C;  1CM9 A;  1ILP A;  1F2L A;  3HS0 C;  2QIL A;  1H9R A;  1ZKO A;  5FO9 B;  3A7A B;  1B53 A;  1ET6 A;  3QB3 A;  1B9M A;  1DON A;  3NWS A;  2NB0 A;  4KJO A;  4CJ2 C;  1SYB A;  1JR0 D;  2A69 D;  3HOW B;  2ZXR A;  3ITP A;  5C44 B;  1CFM A;  5JAV A;  1JOK A;  4DN4 M;  2F0N A;  2F3W A;  2PQE A;  1EU4 A;  3LWE A;  3SDZ A;  3TP7 A;  1LTR D;  1M4V A;  2WIN B;  3UI2 A;  3NBI A;  3GV3 A;  3VR3 A;  2IX0 A;  1STE A;  1I6H B;  2B2W C;  1EYC A;  1WVL A;  3G7L A;  1EFI D;  2D5D A;  5M3F B;  4FO2 A;  1I4X A;  4ZLT F;  2A6E D;  3R93 A;  1LAC A;  1E2Z A;  1WTO A;  1LAB A;  1PYW D;  3LWU A;  3QJY A;  1HA5 A;  1MD2 D;  2NN6 I;  4QUC A;  1V43 A;  1JOO A;  4OHJ A;  3I90 A;  4Y7N B;  3R8B A;  4DAP A;  2F0W A;  2ZXP A;  1EEI D;  2XWB B;  2QKI C;  1KAA A;  3RMH A;  5EKI A;  1KDA A;  1TQO A;  4IUQ A;  2N55 A;  2WV6 D;  4X3S A;  2CW0 C;  2PO4 A;  1OXS C;  2MGS A;  1Q90 A;  2SEB D;  3HOV B;  2AQ3 B;  4HCS A;  3J7A V;  1EWH A;  2MUY A;  1I4R A;  2M9V A;  5CMD A;  5JEA H;  3CQZ B;  1SNO A;  3J7Y W;  5COY A;  1A2U A;  3BVM A;  4R9W A;  1ENA A;  5CBA E;  5JVH 3;  2JP1 A;  2NYZ D;  4KJN A;  4GZY C;  2Q8T A;  5IGB A;  4G57 A;  2F0F A;  1II3 A;  3U9O A;  4G7Z C;  4ZQ3 A;  4B08 A;  3ND8 A;  4HCE A;  1STY A;  4IUU A;  1IYV A;  5A2Q E;  1E2W A;  5JEA G;  2F0K A;  3OPO A;  2FIN B;  4IZ8 A;  1H9J A;  3K5M A;  4IUV A;  4RCN A;  2F0U A;  3K57 A;  3O13 A;  1GHJ A;  2F0H A;  3I70 A;  1EOT A;  2K05 A;  2J4X A;  1DCZ A;  3NQI A;  3TN2 A;  2HDM A;  3HEJ A;  2X69 A;  1GXD C;  2WKD A;  3D4W A;  1O7L A;  3KK7 A;  1D1I A;  5DM6 3;  3K6O A;  2BOS A;  3KUP A;  1KDC A;  1QWY A;  3KBX A;  2EPB A;  4IUP A;  4C3J G;  2EJG C;  1I6V C;  4OIJ A;  1KLG D;  3QO2 A;  4UDU C;  2NZ1 D;  1CQV A;  1G6Z A;  1IW7 D;  4Q5V A;  4ODG A;  5I9P A;  1KAB A;  1XX8 A;  5EQ0 A;  5M9O A;  3KLR A;  4U67 3;  2R93 B;  1ROD A;  3WOE A;  3QOJ A;  2A6E C;  5D3D A;  3K0Y A;  3OOC A;  1DZ1 A;  2EXZ A;  1JC7 A;  2Y0S B;  2NTT A;  1BOS A;  1I4H A;  3NTI A;  1Q8I A;  3RLF A;  3MAQ A;  4XIG S;  4A3F B;  1IKM A;  1HRJ A;  4K14 A;  4WJW A;  1NR2 A;  2LS0 1;  3FPP A;  1MSG A;  4LK1 C;  1TY0 A;  3OWE B;  3GP7 A;  1KTK A;  2OF1 A;  2M2L A;  2F0M A;  1T5X D;  1PFB A;  4O1N A;  5EBC A;  2K33 A;  4PMW A;  1FNW A;  1LTG D;  3BS1 A;  3MVV A;  4MIU A;  3GD7 A;  4HSP A;  1F2M A;  5JOB A;  4I65 A;  3D3R A;  1PTO C;  1HQR D;  1JE4 A;  4C56 C;  3H6M A;  3I73 A;  1S5D D;  1FR3 A;  4XYQ A;  4HAE A;  1FYC A;  3T53 B;  1EZ8 A;  2F1M A;  3PIO 3;  1PMR A;  3OWF A;  4BS9 A;  1C8C A;  3GTJ B;  1E0B A;  3FEW X;  4KKS A;  3SVM A;  3NUC A;  5CYU A;  3PO3 B;  1D5M C;  2F0V A;  4IAL A;  3HGB A;  4XYO A;  2E76 C;  2A68 D;  3BDC A;  3D4D A;  2F3V A;  1BR9 A;  4ULL A;  3Q24 A;  4QCL A;  1IL8 A;  2QCP X;  2RSN A;  2BE5 D;  1X32 A;  2TSS A;  1LT5 D;  1HXY D;  5IGD A;  1V1P B;  4X3T A;  1ML0 D;  3BZD B;  4ZRZ A;  1CTM A;  2X6L A;  5JPM C;  2XNA C;  3K58 A;  1UNS A;  4TKO B;  2ZXO A;  1Q1B A;  3P20 A;  4ZUJ A;  4QUF A;  1ENF A;  5IGG A;  2KQ3 A;  1WCM B;  3HKZ B;  2MJ8 A;  3T51 B;  4EQP A;  1QJO A;  3GTP B;  1IW7 C;  2NTS A;  3I4N B;  3PO2 B;  2PZU A;  2SNS A;  3ND9 A;  4PMB A;  1TWC B;  2EY5 A;  5I2Y A;  1TY2 A;  1KDB A;  1VMC A;  2K5Q A;  1H9S A;  1S5F D;  3NTH A;  4A3K B;  1FD7 D;  2RDH A;  4S3S A;  4CJ0 B;  1SMY C;  4EQN A;  2EZV A;  3KF8 A;  1H9M A;  4DFA A;  2NVQ B;  2EY6 A;  1PTO B;  2L4N A;  5I6W A;  1HA6 A;  5EPL A;  3FPU B;  2BA1 A;  4HSV A;  1DJR D;  2FMC A;  2EYJ A;  3S14 B;  2WP8 J;  1TKW B;  2J7Z A;  2IX1 A;  2WII B;  4QB4 A;  2EJM A;  2N88 A;  4IQZ A;  4M8A A;  1FNV A;  4RKL A;  1SNM A;  3Q23 A;  5LL6 X;  4LAA A;  2EY1 A;  3NK9 A;  3MXN A;  1CA5 A;  1A3V A;  1ZEQ X;  2BA0 A;  4Q0F A;  4RA8 A;  1TVX A;  4H7B A;  4MN3 A;  3I91 A;  4OGQ C;  5C3E B;  1WD1 A;  4L6T B;  2SNM A;  2G9D A;  5A35 A;  1FGB D;  2JA5 B;  1YNJ D;  3DMU A;  2KHS A;  1AEX A;  3VR6 A;  1RDP D;  1SDF A;  4ZYS A;  4FF3 A;  4CKE A;  2JYO A;  3G6J B;  1A15 A;  1LTA D;  5I2X A;  1HFG A;  3EQL C;  3SK8 A;  2XWJ B;  1JQY D;  4NDX A;  2VNU D;  1U4L A;  1RF2 D;  4ZKC B;  2FFK B;  5DM7 3;  4DNR B;  4ZK9 B;  4PMC A;  2AUJ D;  3L7Z C;  1HFN A;  1RJT A;  5KND A;  3J80 L;  5M3M B;  2BDO A;  2L0C A;  1LLR D;  2BE5 C;  1HCZ A;  1SNQ A;  4C3I B;  1X3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...