5IGBA

Crystal structure of staphylococcal nuclease variant delta+phs l36d/v66h at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRDLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36D/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igbA00
4PMCA 1ENCA 1A3VA 1TT2A 3SK5A 3QOLA 3BDCA 4K6DA 3NXWA 3PMFA 1SNDA 1STYA 5J39A 1A2UA 3NK9A 3D4WA 3DHQA 5I9PA 5HURA 5KYLA 1EY9A 5CV8A 2EY1A 2F0GA 4LAAA 5C3XA 5IGFA 1KAAA 4K2LA 3OWFA 5IGDA 1STNA 2SNMA 1STHA 2F0MA 1RKNA 2RDFA 1EY5A 2EY2A 4IALA 3TP8A 3OMGA 2ENBA 3MXPA 2F0SA 2HQEA 5M9OA 3C1FA 5KIXA 5JAVA 4PMBA 3H6MA 5CGKA 4KD3A 2EYMA 4KTAA 1EY4A 4K8IA 4RKBA 3MZ5A 4YIJA 3TP6A 3U9OA 5C4ZA 4NP5A 1A3UA 5IGCA 1F2MA 3D8GA 5DEHA 5C3WA 5HGTA 3SK4A 4E6IA 4J1MA 5KEEA 4EQNA 2EYPA 4IUNA 1KABA 1KDBA 4HMJA 1SYCA 2PZUA 2F0EA 1EY6A 3T16A 1JOKA 3SR1A 4ZUIA 3RUZA 3NHHA 5K5PA 2F0OA 1SNMA 5CV4A 2F0IA 1NUCA 3P75A 4EQOA 4ZUJA 1EY7A 4K5WA 1SYGA 2F0DA 4KJNA 3SK8A 3EROA 5EGTA 2WACA 1EZ8A 4HMIA 3SXHA 1EQVA 4B9XA 2EYFA 3MVVA 4KY7A 3QOJA 4RKLA 2O4XA 3BDLA 1NSNS 3D6CA 5IGEA 4TRDA 1SNPA 2F0WA 2NUCA 1KDAA 4QB4A 4R8NA 4EVOA 2EXZA 3SK6A 3TP5A 3P1HA 2F0UA 1SNCA 3NQTA 1AEXA 5CC4A 1STAA 5J1ZA 4EQPA 2EY6A 3MEHA 3OMCA 3DMUA 5EKKA 1SYBA 1EYAA 1F2YA 2KQ3A 4NDXA 2SNSA 3R3OA 5J22A 4ODGA 4NKLA 3NP8A 2OF1A 5CV9A 5C6AA 1II3A 2EYJA 4DU9A 2PZTA 1JORA 3D4DA 4N9PA 3HEJA 5JOBA 4HTHA 3ERQA 2PZWA 4ID6A 4B9WA 2PQEA 4J6HA 5ISRA 1EY8A 2RBMA 3SHLA 4KY6A 5IODA 3TP7A 2F0TA 5IIFA 2F0QA 3QB3A 1STBA 1STGA 2F3WA 5KYIA 4WRDA 4ZQ3A 4KJOA 3T13A 5EKLA 2LKVA 4KD4A 4F7XA 5I9OA 1JOQA 1TR5A 5IOCA 4QMGA 2OXPA 1U9RA 2PYKA 3EJIA 5CR3A 5DAUA 4DF7A 5C4HA 2M00A 2PW7A 5I6WA 2EYHA 1TQOA 4K2KA 3OSOA 4PNYA 5NUCA 1EYCA 4ME5A 4MIUA 5C5MA 2F3VA 2QDBA 1F2ZA 3LX0A 3EVQA 2SOBA 1A2TA 1IHZA 5C5LA 2F0HA 2F0JA 4IZ8A 4K5VA 4NMZA 1SYFA 3VA5A 2EYOA 2F0FA 3E5SA 3ITPA 5CV6A 4K14A 2F0PA 3MHBA 4KY5A 5E3FA 5IGBA 5F2DA 4I65A 4K5XA 1SNQA 2EYLA 3NUCA 4QF4A 3TMEA 5CV7A 1EZ6A 5I6YA 5KRUA 5E1FA 3V2TA 1SNOA 4N9TA 1SYDA 2F0VA 2PW5A 1ENAA 3C1EA 4S3SA 2F0KA 4DGZA 1JOOA 4KV6A 5KGUA 4H7BA 2F0LA 4F8MA 1EY0A 4DFAA 1SYEA 2KHSA 2OEOA 2RKSA 1A3TA 4OL7A 3S9WA 3HZXA 1EYDA 5CV5A 4WORA 2F0NA 5IGGA 2EY5A 4G57A 4KHVA 4K8JA 1KDCA
chains in the Genus database with same CATH superfamily
1X55A 5BN5A 1IYUA 1XNQL 4L8JA 5AFWA 2Q2HA 1V43A 4IQZA 2CQAA 4QJFA 1RTOA 3FEWX 1EL0A 1PFMA 4HSVA 4RAUC 3ND8A 2K1BA 2HQEA 5BN4A 3HOVG 2VNUD 3HOYB 2QCPX 3H6MA 2CWAA 2R93G 4JI4L 4K8IA 1XNRQ 1MBYA 1Y1WB 1E24A 5IGCA 4J8QA 4XYQA 1IBML 1B53A 1SYCA 3WDNA 5M3FH 3A5ZB 3MC0B 1VQFA 1NE3A 2ALYB 3KJOA 4K5WA 3IAYA 1ZEQX 1AH9A 4RGTA 2B2WA 4C1NK 5BR8L 4XYOA 4A3LH 3GTMB 5IGEA 3QOJA 4DV0Q 3O13A 3W1GA 1XPOA 3I4LA 2ZM6Q 1T5XD 1ML0D 3D3RA 1HNZQ 1BCPD 2CH4W 3MEHA 3DUZA 1QNUA 2KEDA 1NJIC 4OGQC 4UP9A 4B08A 3I2ZA 3H09A 1N34Q 2EYJA 3MTSA 3QR8A 4UY8C 3HEJA 2NVTH 4R4QA 3MAQA 4A3FB 4KHZA 2F03A 4LF6L 1S4ZA 4IUTA 1Q1BA 3GQBA 5IT9c 1GHJA 1TKWB 3G48A 1Z6HA 4PG3A 3WOFA 3CCRA 1B2TA 1PDQA 4KJOA 1T9HA 1AE2A 1PVOA 1V8QA 2AMCB 3ND9A 1VQ7A 1TY2A 1L0XB 3OPOA 1D5XC 3PO2G 4C3IB 4K2KA 1L1OC 5LL6S 2L15A 5IYBG 1JC7A 1RF2D 1YIJA 1A2TA 1IHZA 2Z8LA 4IZ8A 3C2PA 1N32L 4MHEA 4JBKA 4JI3Q 2F0PA 5IGBA 4BBRH 4HEDA 1HZ9A 4I65A 3BVMA 1TS4A 2B63H 2K5WA 4N9TA 1VQGA 1Q8IA 4HIMA 5DNFA 2K05A 3ZJYC 4JI2L 1HNWL 5C0XG 2B2WC 5H1SE 1HZCA 2A69D 2EY5A 1VQCA 2B2TA 2JJQA 3CMEA 1TIID 1E7ZA 1ESRA 1PFBA 3MXUA 3GTQB 1WTVA 3D4WA 4LWCA 1FNUA 4LFCL 2JQOA 1KRSA 4X64Q 1EY9A 1LTLA 4G4KA 3NBHB 2XGTA 3QJYA 4HR7B 2UUBQ 1OO9B 2ZTEA 3M7NA 2RDFA 3OIPA 4DR1L 2WFWA 1OXVA 4DV7L 4IOCA 1XMQL 2B2YA 5GADC 1U4PA 1VDZA 4KTAA 3HOVB 5C4ZA 2PQAB 4Z9CB 2R93B 2WB1E 2E5LQ 3KF8B 4UP8A 4GS3A 1VS0A 1EY6A 2DN8A 3S15H 3S16H 3SR1A 2H1EA 2QGQA 1DD2A 2CFMA 2B29A 3C46A 3VR4A 2OWOA 1CT1D 1DOKA 3DM3A 2A1AA 2LSSA 2NVXB 1IL8A 4JC0A 1MD2D 2HHHQ 1STAA 5J1ZA 3HFZB 3E9IA 4JBWA 5D65A 2K5HA 2B2TC 1QUQA 2K7VA 4AYBB 3D31A 5A35A 3BZCA 5ELDA 1AP0A 1V1PB 1DOMA 2IT1A 3SHLA 1SFOB 1XPUA 5LMNL 4X65Q 3CCSA 1YJNA 4OWWB 4R1JA 5CR3A 4DF7A 4A3CH 1QZGA 2PW7A 1HR0Q 3PO2B 5HY6A 3OSOA 2B2YC 1B9MA 5KNCA 4JI5Q 5C5LA 2F0JA 1X56A 3VA5A 1B44D 3LWEA 3PIPA 4L6TB 2BA1A 2VQFQ 1Q82C 3KDFA 3V2TA 1J8IA 4XTCS 1D1KA 3TRZA 3T56B 2MUYA 3HOZG 2E75C 3A0JA 1SE4A 3FMCA 1S5FD 4YCWA 1VQOA 1GKHA 4JV5Q 2KENA 2AHOB 2YTYA 3RZOH 5JJIA 1HA5A 5IGGA 3DWAA 1TXYA 1UE1A 4LJZC 1LTAD 2XWJB 1L0YB 3A74A 3NWTA 1EIHA 4DAPA 3KF6A 3HOWH 5DM73 3J7YW 4A75A 3DHQA 1IBKL 4MN3A 1LO5D 5HURA 3H0GH 3Q23A 2ES2A 4KN7C 2QW7A 3T1HL 2XIWA 2NZHA 4AYBE 1BBUA 1S3OA 4QIWB 4A3GH 1X54A 4KD3A 3PO3H 1W6JA 3U9OA 3G7LA 1ZYRC 2EJGC 2K33A 4BBSG 1PH9A 5CBEE 4IUNA 2D62A 3TEHB 2RHSB 3M7GA 3GV6A 3EIVA 5K5PA 5JPMC 1IBLL 5EKIA 4Y52H 1RTNA 1TS2A 1GXDC 3R2IA 4BA2I 1VF5C 1C0AA 4JK1C 2WACA 4YHHL 3N6RA 4BXXH 4A3JB 4QQBX 1UWVA 3K5MA 5C4XG 4C3JB 1C8CA 4B3SQ 2K03A 2Y0SE 2JA9A 5D3IB 4QB4A 3ZYYX 1I94L 1N36L 3N52A 3J80i 1C7YA 3TP5A 1W3SA 2IX3A 5FJ8G 2K4KA 4OELB 2AQ1B 4ZLTF 2VY3A 3IFDA 2EY6A 2I5HA 3A8JE 1TWFH 5EBCA 4FF1A 4ABNA 1PA6A 4JI7L 1GOZA 5CV9A 3EQLC 2BOSA 4JPBW 1Q86C 3BYTB 2PQEA 1HUNA 2B2VA 4IN3A 4LF7L 3NENA 3CQZB 1I6HB 2UXDL 2OQKA 2WP8J 3CC7A 5GAHC 3A54A 4JOIA 3ICEA 5I2YA 4GOPC 3S14B 2L11A 5C4HA 2VZAA 4HAEA 2A68C 5TSSA 5E7NA 1UEBA 1BDOA 1YNJC 1SJHD 2A73B 2C35B 3MFYA 3I4NH 2E2DC 2XSCA 5C44H 2XTIA 2EVBA 2KECA 3UDFA 1VQ9A 1M4VA 1K0RA 1S72A 4N8FA 2A6HC 2F0VA 4UAIA 3PQIA 1CQVA 3J7AV 1I6VC 5EPKA 1RDPD 4R4IA 1LTRD 3HOZB 1I4HA 1JJCB 3E0EA 1WD0A 2MO0A 5M5WH 3H3VC 1D6EC 3NTIA 3ULLA 3KYHC 3K7AH 2JA8B 5EPLA 4H44C 4IFDJ 1YI2A 1LYLA 4K6DA 1F2LA 3W1BA 1YHQA 4A93G 2LY7A 3BU2A 4ILWA 5I2XA 5IYDG 2E74C 2F0GA 3JAMi 5IT9L 4BA1I 1H9SA 3I72A 2G9DA 1STHA 1PTOF 2PNHA 4K0KQ 3HKZG 2MGSA 5JAVA 1Q7YC 2A6ED 4IJLA 1TWCH 1V9PA 1K0SA 3S1RB 3E9HA 3SK4A 4J15A 1BBWA 3BVZA 4BBSB 4JOIC 1Q46A 1A15A 3RZDH 3J81c 2EZVA 1GJXA 4LFAL 4IFDI 4ZUJA 3HGBA 1SMYC 2K50A 4GN4B 4HSPA 1I4XA 4FP5D 3BVGA 3EROA 1K8GA 3BYYB 4LUVA 4ZKCB 1QUQB 4A3KG 1RODA 4CJ0B 5C4XB 4R8NA 1CSQA 4PZ6A 3VR6A 4OEMB 2VQEL 3KUPA 3TDQA 2F52A 2WAQG 1IBMQ 4JI1Q 1CA6A 2JYOA 3GTJB 3GD7A 1MSHA 3F8TA 2KQ3A 4DR6L 2E2JB 4DAYA 1E1TA 3S17B 1QWYA 4U673 1VQAA 5EAYA 2OCEA 4IUUA 5BR8Q 3F2DA 2HIXA 3VYTA 2R92H 4X3SA 2F0TA 1WCMH 4JCVE 1K3RA 2IHEA 1WTOA 1F9SA 1K8MA 1HH2P 2EYHA 1TQOA 4ME5A 3KOJA 1R4QB 2F3VA 3U58A 5C0XJ 2JEBI 1EQRA 1QOHA 1CZGA 4F88A 1OTCA 3L3OC 3GTMH 2NBFA 3NUCA 4K5XA 3VR5A 3HOXB 1EZ6A 3CC4A 4LF6Q 2VUMG 2FJ2A 1WVLA 2UUCQ 1Y1VG 3KF6B 4FF3A 3C1EA 4DUZQ 1N33Q 2HCIA 2F0KA 4S3SA 1TU2B 3J7ZC 1MHWC 2N49A 1VCIA 2NVQB 4DNRB 1K9MC 4WJWA 2L55A 3PUXA 4X3TA 1N32Q 4KKTA 1NCVA 3T51B 4QUCA 4O2DA 4A3BG 4A93B 4IPGA 3PIP3 3M3YB 5I9PA 2GN5A 5CV8A 5C0XI 1CZWA 3M85A 3OWFA 3AFPA 1OXUA 2J0TD 3CP0A 1HNWQ 4A3MB 4C3IH 4GZYC 4FF4A 1RL2A 1M8AA 4HN7A 3HKZB 3FRPB 3PUZA 3TZDA 1WTPA 1GVPA 3M4OH 4TKOB 2FINB 1P16A 4LFCQ 4HCEA 5E4WC 1PV4A 1UE6A 1E3PA 2K28A 1E1OA 4ZKBB 4GLXA 1IYVA 4Y7NB 5IP7G 4DR1Q 3PUWA 4DV7Q 2RDGA 4RKLA 3GO5A 3HOYG 4A3KB 1KLGD 1HNXL 3KK7A 3CMAA 2HDLA 1Y1WG 3UE1A 2DNEA 1KTKA 2FHTA 3NQTA 4CBVA 1IYJB 1M1KC 2F4VL 2VXWA 3A56A 1SE8A 2WAQB 4DV3L 4NXML 1VQKA 1EOVA 2PI2A 5J22A 1U4LA 3CHBD 3I73A 1QCBD 3VYSA 4LNQA 2MPMA 1JORA 2A5HA 4IFDH 3HOVH 3EN2A 1TS5A 4CDDC 4B3ML 2BH8A 2IJ0A 2R93H 2WINB 3KJPA 2BE5C 4UP7A 2F3WA 1X32A 4RHSA 2LKVA 1TR5A 4BY1G 5AJ3L 1D7QA 3KBGA 1AZPA 1RJTA 4XDXA 4DV4L 2JN4A 2O5IC 3GDEA 1PTOC 3TS0A 5L37A 3DM1A 1DONA 4TSSA 1XTDA 4DR7L 5CV6A 3ULPA 5E3FA 3CRKC 4QY7A 4DXFA 3TZUA 3IKJA 1FGBD 1I50B 3BS1A 2WB1G 1L2FA 2VUMB 2CHBD 4LF9L 2CQOA 1Y1VB 4H7BA 3IFTA 3CCQA 1LTBD 1MGSA 1X3PA 1TWAH 1YJWA 5IP9G 1D2BA 2LXJA 1H9SB 1J5EQ 1TWHB 3L7ZC 3CF5A 1BO0A 1QJOA 3PIOA 1WTHA 3FHWA 3QOLA 4UPAA 1K73C 4P72A 2WIIB 3PMFA 1HJPA 1STYA 4G7HC 2UUAL 4X6AH 3DEPA 1Z7TA 4A3BB 4X66Q 4NW2A 2JSOA 3PV0A 1X9NA 3PGZA 3T1YL 2SNMA 1CHQD 4FO2A 4IUPA 1GUGA 2RCFA 3UI2A 3PO2H 2EYMA 1UNSA 3STBC 4CKEA 3QG1A 2D0PA 4JI0L 1OXSC 4ALPA 2KJXA 2DUDA 3MXNA 3NPPA 5IT9E 2UXCQ 1VQEA 3PUYA 4ZAIA 2ZJQA 1SYGA 3AU7A 3HOUB 3I55A 2F0DA 1TWGH 2L0CA 1AW7A 3EFXD 1O7YA 1HR0W 1VQ6A 1AFPA 4DAYB 5C0XH 2NN6G 4B9XA 4KHPQ 3GV3A 1ILQA 4DN4M 2UXBQ 2Z0SA 1SNPA 3QO2A 1L1OA 1YZ6A 5LMUL 4DAVA 4JYAL 2K52A 3DMUA 1U0LA 3M9BA 5M5YH 1A62A 2DJFC 5COYA 1GM5A 4PV1C 3L0OA 2WKCA 1EWCA 4RMFA 4YHHQ 3AYHB 1MI2A 1N9WA 2H4OA 4HTHA 4RFBA 2RBMA 3SEBA 4DV6L 4DK6C 1PH3A 1JWUD 1I94Q 1YEZA 4P75A 1FYCA 1N36Q 4XQQA 5EKLA 3S2DB 1X3QA 1JOQA 4R4OA 1K3BC 4BY1B 1IKMA 4XT1B 3J81L 2OT2A 4DR5L 1FD7D 2I0QA 3L2PA 3GTGH 1O7IA 1LTID 1LTTD 3LX0A 1K83H 2F0HA 4K5VA 4JI7Q 4NMZA 1LLRD 3TBIB 4AYBG 3Q22A 3MHBA 1G291 1JCKB 2MJ8A 5I6YA 3K5OA 4NXNQ 3GTPB 4LF7Q 4ZCKA 5JPNC 4LF4L 3T4AC 2WB1B 4OO1G 3BDOA 3CCLA 1X6OA 2IHFA 4KKSA 4GKKQ 1SYEA 1H9JA 4B3TQ 1A3TA 1CKNB 4KN4C 2MFIA 1EOTA 1ZKOA 1JB7A 4MZ9A 3GTLB 3FPUB 1PZJD 3BDCA 3W5OA 1I3QB 1U4MA 1PTOB 4KKUA 3I90A 2Y0SG 2RHQB 3CQZH 2NVYH 1DOLA 1J9OA 3UDIA 1PH2A 2EY1A 4DK0A 3PF4A 5EBDA 4C2MB 3CW2C 1STNA 3TP8A 1BNZA 4DUYL 1MKHA 1Q3LA 2VB2X 3U4VA 3LNNA 2YTVA 1PRTF 1IW7C 5C3EH 2PMZB 4CJ2C 3D8GA 1NMGA 1IKLA 3AFQA 3CPFA 1ZYRD 3I3CA 4DV2L 2F0EA 5FOBB 1B7YB 1DGSA 1JICA 4CKCA 5BN3A 3F2BA 4NB3A 1N8RC 1SNMA 2B3GA 2CKZB 2IX0A 4FF2A 2K75A 3ULJA 2K32A 4KY7A 1E0BA 1NSNS 2NUCA 4EVOA 1HTLD 4DV1Q 4V190 3JAMc 3P1HA 1JE4A 1SNCA 4U68A 1PXUA 1D5MC 1LTGD 4PZ7A 4G7ZC 1VQ5A 2EXDA 1RD9D 5C4JH 1II3A 2PZTA 3D4DA 2PZWA 4A3JG 4HJ9A 3TP7A 4LMQD 5IIFA 2F0QA 3W3AA 4C3JG 4LFBL 4B3RQ 4A3LG 3I70A 5IOCA 1KNAA 4DR3Q 4FYDA 1Q1EA 2ZXPA 2A68D 3K0XA 3RLFA 5IODA 1LT6D 1YNJD 2R7ZH 3NTHA 4LF5L 5ELCA 4F87A 2PMZE 4KY5A 4DV5Q 1HZBA 3ERSX 2OTJA 1GO3E 1JR0D 1OXXK 4JW0A 3X3NA 3G6JB 1F9RA 2K5QA 2A6HD 3WOEA 3GTJH 4POFA 4HIDA 1QVFA 1CI3M 1DZ1A 3K7UC 2ZJRA 1PHJA 2PI2E 4O1NA 1FR3A 1A3VA 3RNUA 5J39A 4GLAC 5A2QL 1QB5D 3KLWA 4O0AA 3CXCA 3HP3A 2Y0SB 2JA7G 3MXNB 2JA5G 2Z6BA 3RLNA 3VA7A 1RKNA 1EY5A 5M9OA 3S1MB 3PSIA 1PZKD 4A3DG 3A8IE 5JJZA 3PIO3 2B39A 2E76C 2JA8G 3F2UA 4LF8L 2G5DA 4NPSA 2YYZA 1EYGA 3PF5A 1L1OB 2E2HH 5D14A 4APVA 1A8VA 3RUZA 4DKAC 5CV4A 3U50C 2YU9B 1HZAA 1B50A 1C48A 2EQSA 3Q6SA 3S1QB 4OX9L 1SMYD 1QNKA 4GOPA 3J7A5 1XYIA 2NVQH 5T1GA 2Q8IB 1GHKA 2V4DA 1WTWA 3U9SA 3HRZC 1ICWA 1QILA 2RCNA 1WYDA 2AUJD 4CJ1B 1HQMC 1S5DD 2HUGA 5LL6X 5IYDH 3UDXA 1LV9A 2I5LX 3HS0C 1R9TB 5JJLA 2IWHA 2RA4A 1KL9A 4ID6A 2ZTCA 4J6HA 1HNXQ 4PMWA 2EJFC 4KD4A 4QMGA 4QGUA 2F4VQ 3Q8DA 1PH5A 2M00A 2M9VA 4DV3Q 4JI8Q 2JXMB 3M4PA 2EYOA 3ITPA 2JA6G 4Y7NH 1PRTC 5M5XH 4DR2Q 3JC66 4IOAA 1JJ2A 2X69A 4B3MQ 2WKDA 2EDGA 1SNOA 1TS3A 4CHTB 2F0LA 3J81E 2NVTB 4XIGS 4DV0L 4DK3C 1Y8NB 2RKSA 3I7FA 4CDCC 3HZXA 4DV4Q 3I56A 2NZ1D 3DXJC 2F0NA 1HNZL 3EBEA 3K0YA 3FKIG 4C1NI 1ENCA 4JVZA 1SN8A 2Q8TA 4DR7Q 1PH6A 3I4MG 2KHIA 1AE3A 2R3ZA 2O2LD 1B1ZA 3HOXG 1XJVA 4GNXA 4YY3L 5IGFA 4K2LA 3CAMA 2GVBA 3OYYA 2JA7B 1IXRA 2JA5B 4BBRB 1WOCA 3OMGA 2ENBA 1HQRD 3NWSA 5KIXA 2B63B 1EY4A 1HXYD 4YCUA 1SROA 4A3DB 3E3XA 3HKSA 2A74C 4I7AA 3G71A 2EYPA 3RLOA 4AH6A 1YNXA 2RSNA 1I50H 2SDFA 1HPCA 1D8LA 3W2DA 1C4QA 2VUMH 1JB3A 1Y1VH 4JI6Q 1VQHA 4MNOA 3D0FA 1NR2A 3H0GG 1TVXA 4BY7H 5FO7B 1BVSA 4A3MG 1WFQA 3MVVA 2O4XA 3D6CA 4I7ZC 2JEAI 2K6AA 5FLXc 2C9OA 3S1NB 5CC4A 1YHBA 2D0OA 3S2HH 5EJWA 2HDMA 2ZT9C 4A3IG 1NNXA 1SYBA 5LMNW 1VMCA 1XNQQ 2NN6I 2KEEA 3H91A 1YITA 4BWGB 3S15B 3S16B 1NBWA 1PMRA 4A76A 2UUBL 2KVMA 1AN8A 3QB3A 1STBA 4GNXC 4ZYSA 3VR2A 1GUWA 5LMUQ 4JI4Q 1E2ZA 1O7ZA 2RSOA 4AQYL 2BE5D 1VMPA 2OXPA 2QEJC 3EJIA 3Q24A 4JYAQ 2E5LL 3DEOA 4MIUA 3F1ZA 2BDNA 1DYQA 1I4PA 4RCOA 1KXLA 1PTOD 3CPWA 2JA6B 2AWNA 5IP7H 3K5NA 4DV6Q 3HOYH 2WV6D 1JOOA 2BA0A 2ICEC 1M90C 1Y1WH 1PH8A 4XXEA 3VYUA 4DFAA 3JAML 3QIAA 4R9WA 3TREA 3K5LA 2CW0C 4RGMA 2XRQD 3KDFB 3TSSA 1FJGL 3GP7A 2NZOA 1B8AA 2N78A 2E8GA 4JBJA 3SK5A 3FKIB 3NXWA 1SNDA 2VB3X 1O78A 3I4MB 2QKIC 2AQ2B 5K36G 2ID0A 1JWSD 1KAAA 1XTCD 3S2DH 4LF4Q 2AUKA 2KBNA 2X6LA 3D4RA 2P5ZX 3MXPA 4YWKA 1BXTA 2B2UA 4YIJA 5DM63 1H95A 3RR5A 2FMCA 5A2QE 2KCMA 4GOPB 2N55A 3STBD 3DWQA 2QA4A 4HMJA 4UDUC 1R4PB 2Q2UA 4JI5L 3NELA 3T16A 4A3FH 1EWHA 4ME3A 3P75A 4EQOA 3C3LA 2VQFL 4KJNA 2CH4A 3KLSA 4DUYQ 4JI2Q 3MWYW 3H0GB 5IP9H 1E2WA 3GTLH 1KDAA 2IX1A 4A3GB 4DV2Q 1PYSB 3PO3B 2SEBD 5CBAE 4A3IB 2XVSA 4A3EG 5ELOA 3HOUG 2IL8A 3ERQA 1RIPA 4POGA 1EUJA 2IPKD 2E2IB 4Q5VA 1YJ9A 2CWPA 1WTQA 1XMQQ 1CKMA 2ZXOA 2K5DA 1NR4A 2CVRA 1U9RA 3GTQH 2LS01 4DR4L 1LACA 4GLVB 2B2UC 4C3HG 4PNYA 3CKIB 2QDBA 5E4XA 3EVQA 5KEEA 2NTTA 2VL6A 3ONAB 1Q90A 3CD6A 2NN6H 5F2DA 3DLLA 4KMUC 1CSPA 2AWOA 3GTKB 5IY0A 1ENAA 4OXPA 1KD1C 5IYCG 1KHIA 3R2TA 4OIJA 1WCMG 2PPBC 1BQQT 1EEFD 2HQLA 3I91A 1SDFA 1KDCA 3L9AX 2R7FA 3NBHA 4XQJA 4RCNA 4HCSA 1EU4A 2EIFA 2HIVA 3NE5B 3P20A 3I4NB 1FL0A 3H94A 4RHRA 1HA6A 4R8IA 2FXQA 1G51A 1HCZA 3KF8A 2NVXH 1YHAA 3NSWA 5LMNQ 1QVGA 1SLJA 3IL8A 4DK1A 4WJ4A 1Z47A 2Z1CA 1KLUD 5G3LF 1ENFA 1Y14B 1EEID 1I4QA 4P2CB 2RVLA 4R4CA 5HGTA 3F2CA 3TS2A 3VDYA 5M5WB 2BCOA 1IW7D 3E6ZX 1X3FA 2PZUA 2EJMA 2IW3A 3K7AB 2RDHA 4AIMA 3D6WA 2F0OA 5KNDA 1SFOH 1PYWD 1G2SA 2FFKB 1I4GA 3SXHA 2VW9A 2JP1A 4RWSC 2ZTDA 3EA6A 4OHJA 1EU3A 2KHJA 2F0WA 3J80E 1XWEA 4O42A 4IPHA 1AEXA 1I5FA 5IYBH 3K57A 3OMCA 5EKKA 2BDOA 3K81C 2K01A 1CHPD 5I4DA 4DNIA 2N3SA 1HFGA 3V96A 1A6XA 3NP8A 1IBKQ 1B4OA 2OF1A 4A3EB 3S1MH 1E22A 4GN3B 1G6PA 1DXMA 5ISRA 3T1HQ 2DJGC 5J3BA 1GUTA 3J81i 4WRDA 4K0KL 1TY0A 2RQXA 1YNNC 1K28A 2PCFB 1K8AC 2L12A 1PZID 4YWLA 5JEAG 5M3MG 1EYCA 3FDTA 5C5MA 3X3MA 2NTSA 4YWMA 4C3HB 4DXGA 4Q0FA 4X62L 2YU9H 3S1QH 4DA2A 1BCPF 1IBLQ 1SNQA 2B8FA 3CCJA 4OIKA 2L1BA 3P7JA 1SYDA 2PW5A 4IFDG 1QE6A 3MEFA 2MQHA 5FLXL 2R92B 1LT3D 1PFSA 1VQIA 1WCMB 4WJ3M 4K8JA 4YCVA 4FXDA 1R9TH 4JI1L 4R4TA 2DY7A 1ESFA 2RF4A 2D9UA 1QVCA 3J80c 4A3JH 4IPCA 1KNEA 5KYLA 1VF7A 3JAME 5C3XA 4C3JH 1UUPA 1Q12A 2UXDQ 2A19A 3WWVA 1S5CD 2MHVA 1OXTA 1S5ED 2KCCA 4UHVA 1PH1A 2Q2TA 1WTXA 1JJGA 1BOSA 4KLKA 4HIOA 5GROA 2K14A 1D5ZC 5DLQE 3GTOB 1JMCA 3G6EA 1WD1A 4L5TA 1G6ZA 5FLMG 2Z6KA 3NHHA 1EQTA 4YY3Q 4TQUS 1EY7A 1I6HH 1GUNA 2B8GA 2DGYA 3DWPA 1BUVT 3KFUA 5FO9B 1EZ8A 2UUCL 1NMFA 1N33L 3KBXA 3S14H 4DUZL 1HHVA 4GKJL 3LWUA 3SK6A 2F0UA 4JBMA 3RMHA 1ET6A 2JA7H 1STEA 1W6KA 5IWAL 3M4OB 2GA4B 2JA5H 2YV5A 4DU9A 4K6LA 3FPPA 1MJCA 3HOZH 1CA5A 2UU9L 4IJHA 4B9WA 4FVMA 1EY8A 3H3VI 4FXKC 4A3DH 3T53B 1STGA 1IL2A 2JA8H 5ELNA 2VS1A 1UE5A 2PYKA 1ET9A 3CCMA 5M3MB 1BBXC 1H9KA 1SAPA 2F0FA 3KLRA 1J6QA 4LFAQ 4K14A 2OTLA 5M3FG 1IZ6A 1AZQA 1S40A 5KRUA 1PRTD 1L0WA 2Z6KC 1G8ZD 3S1NH 3S1RH 1KRTA 4AQYQ 4GN5A 2KCNA 1VQMA 4BBSH 1EYDA 2VQEQ 1P8LA 4IURA 3SDZA 3UDGA 1TT2A 2TSSA 3A7LA 4DR6Q 3M4YA 2LXKA 4L63B 4PQXA 4L5QA 4XQNA 1CM9A 2Z4HA 1LM0A 1F9PA 4PZ8A 5C4XH 2EY2A 4IALA 3R93A 5GAGC 1XMOL 1ASZA 1F77A 1NAPA 5FJ8H 5CGKA 1X3EA 1FJGQ 4EX5A 2E2JH 4CDEC 5KNBA 1F2MA 1UEAB 4H0LC 1TWAB 4J1MA 4M1UB 3S17H 2JA6H 3OTOL 2KA7A 2HCCA 4ZUIA 1KIXA 1UE7A 1FVIA 3OW7A 2X6GA 5D3DA 1GUSA 1NTGA 2LMCB 3K58A 4BBRG 1EQVA 1BR9A 1EIFA 1RHPA 2B63G 4L5RC 1Y69U 1BCPC 4TRDA 3CCUA 3FKIH 4P74A 3SGIA 4LUOA 1U5KA 1J5EL 3I4MH 5C3EG 1MIUA 4FXGC 2IY5B 3SE0A 2I46A 3R3OA 1YVCA 3HOXH 2PNRC 1Y8OB 4ODGA 5FK9C 1PH7A 4X66L 1D1IA 4N9PA 5CMDA 3BG3A 2HD3A 1X3GA 3OWEB 1BF4A 2R7DA 4P71A 1TWGB 4DAMA 5JJKA 5IE8A 4X3UA 1U4RA 3E0JA 5CORA 4A93H 1V1QA 1ASYA 1VQ8A 3M3YH 1CUKA 1F2ZA 1VQ4A 1LT5D 2UXCL 2XN9C 5M5YB 2GVAA 4QF4A 2MNAA 4A3MH 5M3FB 3RN5A 1ONLA 1RCVD 3AQQA 1EIGA 1SEBD 1HRJA 4FNFA 3H3VH 4KHPL 4F8MA 2A69C 3B6YA 3RD4A 2KHSA 2UXBL 4RGOS 3NEMA 4IO9A 1Y8PB 4A3IH 4DR4Q 5FO8B 2V1CC 1VQLA 1XNRL 1SRUA 4PMCA 2CW0D 2Q8RE 3I8ZA 5GAEC 4NXMQ 1E2VA 1SBBB 1WJJA 1A2UA 1PYBA 1YBYA 3NK9A 1EFWA 1WTRA 1Q81C 2E2IH 3GTGB 2R7ZG 1K83B 1EIYB 2MP1A 3AB9A 1PH4A 5FLXE 4LAAA 1DCZA 3A8KE 4A3KH 4OONA 5IGDA 2ATWA 1LT4D 2F4IA 1XPRA 1SJED 1JWMD 1A0IA 2EOTA 4EGVA 5AJ3Q 4H13C 2ZM6L 3QWNA 3H15A 3NTKA 1CTMA 4E6IA 2FMMA 4EQNA 5ELBA 4A3CG 1I4RA 1DJRD 2L4NA 3GTKH 1VQPA 5GQOA 1N34L 1NUCA 1G2TA 5EGTA 1O7LA 4NXNL 2NVYB 2YTXA 4LF9Q 3MA2B 2PO4A 4GKKL 3HG9A 4B3TL 1EWIA 2I07B 5ELFA 1QZHA 2H5XA 4QIWE 4NDXA 5C3EB 5K36H 1FGUA 3J80L 2UUAQ 2K5VA 1S5BD 4RG1A 5CYUA 4JI3L 5JEAJ 1PFNA 3HOWG 5ELEA 5FKAC 3T1YQ 4HJ8A 1SE2A 2HT1A 1TWHH 4OWTB 4RGNA 1KC8C 3FP9A 1KQSA 4ULLA 3TN2A 1BCPB 3CCVA 5DAUA 4JI0Q 4A3GG 5NUCA 3PO3G 3NBIA 4A3BH 4IPDA 2N88A 3NQIA 2KCTA 3TMEA 5JVG3 4X64L 1GD7A 5C4JB 1FNVA 1CKOA 3BZDB 5KGUA 3MFGA 2KUMA 2I5MX 4BXXG 4IUVA 2B2VC 2CCZA 3J7AF 4KK7A 1VQJA 2M2LA 4MTNA 3OHXC 4DV1L 3U4ZA 2NYZD 2OQ0A 2ZXRA 4X62Q 4A3EH 2JK8A 2AQ3B 4EQ5A 1X65A 3HOUH 2Z4IA 1XXGA 1MJEA 4MTKA 4N8X1 3CC2A 5LHY1 2R7ZB 4H02A 4DPGA 1W2BA 2F0MA 2L5TA 1UAPA 2F0SA 1CQFA 2F3IA 4B3RL 3FVQA 4C3HH 4DNTB 4RKBA 3TP6A 1LABA 4NP5A 5DEHA 4DR5Q 5C3WA 3VR3A 4HJ5A 4DR3L 2HHHL 3OW2A 1KABA 2R6GA 4QCLA 1WI5A 3A7AB 4OWXB 1VQNA 3I4NG 4DV5L 4OO1I 5C44G 4CKBA 3I4OA 3BJUA 1PRTB 4HJAA 4HMIA 4C56C 5IYCH 3AEVA 3CU7A 2Q2IA 2EYFA 3LGJA 3G4SA 2DNCA 4BY1H 3BDLA 1FNWA 4X65L 2QEXA 2EXZA 4KI0A 2MO1A 4M8AA 4ZRZA 3OOCA 4HIKA 1JT8A 4EQPA 1HR0L 1EYAA 1F2YA 2NB0A 5T1IA 3BZKA 3MXGA 3V05A 3RZOB 4QUFA 3GTPH 4NKLA 5C6AA 2E2HB 1V1OA 3PUVA 5JOBA 1T5EA 2QILA 2AKWB 3SVMA 3IRBA 2ZJPA 3HOWB 3UE0A 3K59A 1Q8KA 4KY6A 3A5UA 4GKJQ 4XT3B 5KYIA 4BY7G 1B3QA 4A4IA 4JV5L 3GTOH 1I3QH 2A8VA 1PTOH 1YNND 5EPJA 3VYRA 2EE1A 5IWAQ 2QDLA 4C2MH 1SYFA 3E5SA 4RH6A 2UU9Q 2EYLA 3CCEA 3OIQA 4IUQA 5CV7A 1CKNA 2DY8A 1LTSD 2N8NA 1JQYD 1H9MA 1G91A 4LW1A 1EY0A 2OEOA 3S9WA 4WFN3 4OL7A 4WORA 4G57A 1BKBA 4KHVA 4CDFC 3TQYA 4BS9A 1A63A 5JVH3 1NY4A 1SR3A 1VQBA 2C5CA 2EPBA 4P73A 2Z9HA 1SMXA 3AMUA 1F9QA 1QG7A 1TWFB 2ICIA 1CK1A 1K8OA 2F1MA 4LK1C 2K04A 5M5XB 1HFNA 2A6EC 4V0BA 4LFBQ 2ASBA 3C1FA 5JEAH 4PMBA 2XWBB 3URYA 1JE5A 2R92G 4B3SL 2G9HD 5M3MH 4JG2A 4GNXB 3MZ5A 1A3UA 1O80A 1SE3A 4ZK9B 3K80C 1B70B 2XRSD 1CFMA 1XX8A 4JI8L 2XNAC 1KDBA 1JOKA 2J7ZA 4LF5Q 2KOLA 2JE6I 2F0IA 1ILPA 4DR2L 2J4XA 3SK8A 5HGQA 5C44B 1MSGA 2PQAA 3M4QA 1XMOQ 4TVAB 2BH2A 4HJ7A 2D2CC 1B9NA 2K5NA 3OTOQ 2NWGA 1KAWA 2SNSA 1SXTA 3HKZE 1DM0B 4L5SA 4RA8A 3PCOB 1EQQA 3RN2A 2R61A 1SSOA 1VQDA 2QF7A 1C9OA 4A3FG 4OO1H 3Q0AA 2L9HA 4LUZA 3CRLC 3KLSX 1HTPA 4ZQ3A 3T13A 2D5DA 4F7XA 5I9OA 4BY7B 1PLFA 4C3IG 5I6WA 4LF8Q 5FLMH 1H9RA 1ICFB 1V1PA 2SOBA 3A55A 1TWCB 3ER0A 3K6OA 3K8AA 1LUZA 4CGYB 3S2HB 4QL5A 5EQ0A 3R8BA 3RZDB 2WAQE 4JI6L 4FDBA 3J81j 5E1FA 4X3KA 5G3LD 4OX9Q 1ZXTA 2TMPA 4DGZA 4KV6A 1EFID 1B3AA 2LFNA 2O5JC 4G7OC 1HUMA 1GUOA 1Z9FA 5CV5A 3S24A
chains in the Genus database with same CATH topology
5BN5A 1IYUA 4L8JA 5AFWA 1V43A 4IQZA 2CQAA 1RTOA 3FEWX 1EL0A 1PFMA 4HSVA 4RAUC 3ND8A 2K1BA 2HQEA 5BN4A 2VNUD 3HOYB 2QCPX 3H6MA 4K8IA 1MBYA 1Y1WB 5IGCA 4J8QA 4XYQA 1B53A 1SYCA 3WDNA 3MC0B 4K5WA 3IAYA 1ZEQX 4RGTA 2B2WA 4C1NK 4XYOA 3GTMB 5IGEA 3QOJA 3O13A 3I4LA 1T5XD 1ML0D 3D3RA 1BCPD 3MEHA 3DUZA 1QNUA 2KEDA 4OGQC 4B08A 3H09A 2EYJA 3MTSA 3HEJA 4A3FB 3MAQA 4KHZA 2F03A 1S4ZA 4IUTA 1Q1BA 3GQBA 1GHJA 1TKWB 3WOFA 1Z6HA 1B2TA 1PDQA 4KJOA 1V8QA 3ND9A 1TY2A 1L0XB 3OPOA 1D5XC 4C3IB 4K2KA 5LL6S 1JC7A 1RF2D 1A2TA 1IHZA 2Z8LA 4IZ8A 3C2PA 4MHEA 2F0PA 5IGBA 4HEDA 4I65A 3BVMA 1TS4A 2K5WA 4N9TA 1Q8IA 5DNFA 2K05A 5C0XG 2B2WC 2A69D 2EY5A 2B2TA 1TIID 1ESRA 1PFBA 3MXUA 3GTQB 1WTVA 3D4WA 1FNUA 1EY9A 4G4KA 3QJYA 4HR7B 1OO9B 3M7NA 2RDFA 3OIPA 1OXVA 2B2YA 1U4PA 1VDZA 4KTAA 3HOVB 5C4ZA 4Z9CB 2R93B 1EY6A 2DN8A 3SR1A 2H1EA 1DD2A 3C46A 3VR4A 1CT1D 1DOKA 2NVXB 1IL8A 1MD2D 1STAA 5J1ZA 4JBWA 5D65A 2B2TC 2K7VA 4AYBB 3D31A 5A35A 5ELDA 1AP0A 1V1PB 1DOMA 2IT1A 3SHLA 1SFOB 5CR3A 4DF7A 2PW7A 3PO2B 3OSOA 2B2YC 1B9MA 5KNCA 5C5LA 2F0JA 3VA5A 1B44D 3LWEA 4L6TB 2BA1A 3V2TA 1J8IA 4XTCS 1D1KA 3T56B 2MUYA 2E75C 1SE4A 3FMCA 1S5FD 1HA5A 5IGGA 3DWAA 4LJZC 1LTAD 2XWJB 1L0YB 3NWTA 1EIHA 4DAPA 5DM73 3J7YW 3DHQA 4MN3A 1LO5D 5HURA 3Q23A 4KN7C 2XIWA 4QIWB 4KD3A 1W6JA 3U9OA 3G7LA 1ZYRC 2EJGC 2K33A 5CBEE 4IUNA 2D62A 3M7GA 3GV6A 5K5PA 5JPMC 5EKIA 1RTNA 1TS2A 1GXDC 3R2IA 4BA2I 1VF5C 4JK1C 2WACA 3N6RA 4A3JB 3K5MA 4C3JB 1C8CA 2K03A 5D3IB 3ZYYX 4QB4A 3N52A 3TP5A 2IX3A 2AQ1B 4ZLTF 3IFDA 2EY6A 3A8JE 5EBCA 4FF1A 4ABNA 1GOZA 5CV9A 3EQLC 2BOSA 3BYTB 2PQEA 1HUNA 2B2VA 4IN3A 1I6HB 3CQZB 2WP8J 3A54A 5I2YA 3S14B 2L11A 5C4HA 4HAEA 2A68C 5TSSA 1BDOA 1YNJC 1SJHD 2A73B 3MFYA 2E2DC 2XSCA 2EVBA 2KECA 1M4VA 2A6HC 2F0VA 4UAIA 3J7AV 1CQVA 1I6VC 5EPKA 1RDPD 3HOZB 1LTRD 1I4HA 1WD0A 3H3VC 1D6EC 3NTIA 2JA8B 5EPLA 4H44C 4IFDJ 4K6DA 1F2LA 2LY7A 4ILWA 5I2XA 2E74C 2F0GA 5IT9L 4BA1I 1H9SA 3I72A 2G9DA 1STHA 1PTOF 2MGSA 5JAVA 2A6ED 3S1RB 3SK4A 3BVZA 4BBSB 1A15A 2EZVA 1GJXA 4IFDI 4ZUJA 3HGBA 1SMYC 4HSPA 1I4XA 4FP5D 3BVGA 3EROA 3BYYB 4ZKCB 1RODA 4CJ0B 5C4XB 4R8NA 3VR6A 3KUPA 3TDQA 1CA6A 2JYOA 3GTJB 3GD7A 1MSHA 2KQ3A 2E2JB 4DAYA 3S17B 1QWYA 4U673 4IUUA 3VYTA 4X3SA 2F0TA 1WTOA 1F9SA 1K8MA 2EYHA 1TQOA 4ME5A 1R4QB 2F3VA 5C0XJ 2JEBI 1QOHA 1CZGA 4F88A 3L3OC 2NBFA 3NUCA 4K5XA 3VR5A 3HOXB 1EZ6A 2FJ2A 1WVLA 4FF3A 3C1EA 2HCIA 2F0KA 4S3SA 1TU2B 1VCIA 2NVQB 4DNRB 4WJWA 2L55A 3PUXA 4X3TA 4KKTA 1NCVA 3T51B 4QUCA 4A93B 3PIP3 3M3YB 5I9PA 5CV8A 5C0XI 1CZWA 3M85A 3OWFA 1OXUA 2J0TD 4A3MB 4GZYC 4FF4A 1M8AA 4HN7A 3HKZB 3FRPB 3PUZA 3TZDA 1WTPA 4TKOB 2FINB 4HCEA 5E4WC 2K28A 4ZKBB 1IYVA 4Y7NB 3PUWA 2RDGA 4RKLA 3GO5A 4A3KB 1KLGD 3KK7A 2HDLA 2DNEA 1KTKA 2FHTA 3NQTA 4CBVA 2VXWA 3A56A 2WAQB 5J22A 1U4LA 3CHBD 3I73A 1QCBD 3VYSA 1JORA 2MPMA 2A5HA 4IFDH 1TS5A 2IJ0A 2WINB 2BE5C 2F3WA 1X32A 4RHSA 2LKVA 1TR5A 3KBGA 1AZPA 1RJTA 4XDXA 2O5IC 1PTOC 3DM1A 1DONA 4TSSA 5CV6A 5E3FA 3CRKC 4DXFA 3TZUA 3IKJA 1FGBD 1I50B 3BS1A 2VUMB 2CHBD 1Y1VB 4H7BA 3IFTA 1LTBD 1MGSA 1X3PA 1D2BA 1H9SB 1TWHB 3L7ZC 1BO0A 1QJOA 3QOLA 2WIIB 3PMFA 1STYA 4G7HC 3DEPA 1Z7TA 4A3BB 4NW2A 2JSOA 3PV0A 2SNMA 1CHQD 4FO2A 4IUPA 1GUGA 3UI2A 2EYMA 1UNSA 4CKEA 3QG1A 1OXSC 2KJXA 3MXNA 3NPPA 5IT9E 3PUYA 4ZAIA 1SYGA 3AU7A 3HOUB 2F0DA 2L0CA 1AW7A 3EFXD 1O7YA 1AFPA 5C0XH 2NN6G 4B9XA 3GV3A 1ILQA 4DN4M 1SNPA 3QO2A 4DAVA 3DMUA 5COYA 4PV1C 2WKCA 1EWCA 4HTHA 1MI2A 2H4OA 4RFBA 2RBMA 3SEBA 1JWUD 1FYCA 4XQQA 5EKLA 3S2DB 1X3QA 1JOQA 4BY1B 1IKMA 4XT1B 3J81L 2OT2A 1FD7D 1LTID 1LTTD 3LX0A 2F0HA 4K5VA 4NMZA 1LLRD 3TBIB 3Q22A 3MHBA 1G291 1JCKB 2MJ8A 5I6YA 3K5OA 3GTPB 5JPNC 3T4AC 2WB1B 4OO1G 3BDOA 4KKSA 1SYEA 1H9JA 1A3TA 4KN4C 1EOTA 1ZKOA 3GTLB 3FPUB 1PZJD 3BDCA 1I3QB 1U4MA 1PTOB 4KKUA 3I90A 1DOLA 1J9OA 2EY1A 4DK0A 5EBDA 4C2MB 1STNA 3TP8A 1BNZA 1Q3LA 2VB2X 3LNNA 1PRTF 1IW7C 2PMZB 4CJ2C 3D8GA 1IKLA 1ZYRD 3I3CA 2F0EA 5FOBB 4CKCA 1JICA 5BN3A 1SNMA 2IX0A 4FF2A 2K32A 4KY7A 1E0BA 1NSNS 2NUCA 4EVOA 1HTLD 4V190 3P1HA 1JE4A 1SNCA 4U68A 1PXUA 1D5MC 1LTGD 4G7ZC 1RD9D 1II3A 2PZTA 3D4DA 2PZWA 3TP7A 4LMQD 5IIFA 2F0QA 3W3AA 4C3JG 3I70A 5IOCA 1KNAA 4FYDA 1Q1EA 2ZXPA 2A68D 3RLFA 5IODA 1LT6D 1YNJD 3NTHA 5ELCA 4F87A 4KY5A 1JR0D 1OXXK 3X3NA 3G6JB 1F9RA 2K5QA 2A6HD 3WOEA 1DZ1A 1CI3M 4O1NA 1FR3A 1A3VA 5J39A 5A2QL 1QB5D 3HP3A 2Y0SB 3VA7A 1RKNA 1EY5A 5M9OA 3S1MB 1PZKD 3A8IE 5JJZA 3PIO3 2B39A 2E76C 3F2UA 2YYZA 5D14A 3RUZA 5CV4A 2YU9B 1B50A 1C48A 3Q6SA 3S1QB 1SMYD 1QNKA 1XYIA 5T1GA 2Q8IB 1GHKA 2V4DA 1WTWA 3U9SA 3HRZC 1ICWA 1QILA 2AUJD 4CJ1B 1HQMC 1S5DD 2HUGA 5LL6X 1LV9A 3HS0C 1R9TB 2IWHA 2RA4A 4ID6A 4J6HA 4PMWA 2EJFC 4KD4A 4QMGA 2M00A 2M9VA 2JXMB 2EYOA 3ITPA 1PRTC 2X69A 2WKDA 2EDGA 1SNOA 1TS3A 4CHTB 2F0LA 3J81E 2NVTB 4XIGS 1Y8NB 2RKSA 3HZXA 2NZ1D 3DXJC 2F0NA 3K0YA 4C1NI 1ENCA 2Q8TA 2R3ZA 2O2LD 1B1ZA 5IGFA 4K2LA 2JA7B 2JA5B 4BBRB 3OMGA 2ENBA 1HQRD 3NWSA 5KIXA 2B63B 1EY4A 1HXYD 4A3DB 2A74C 2EYPA 2RSNA 2SDFA 1HPCA 3W2DA 1C4QA 1JB3A 1NR2A 1TVXA 5FO7B 3MVVA 2O4XA 3D6CA 4I7ZC 2JEAI 2K6AA 2C9OA 3S1NB 5CC4A 5EJWA 2HDMA 2ZT9C 1SYBA 1VMCA 2NN6I 2KEEA 3H91A 4BWGB 3S15B 3S16B 1PMRA 2KVMA 1AN8A 3QB3A 1STBA 4ZYSA 3VR2A 1GUWA 1E2ZA 1O7ZA 2RSOA 2BE5D 1VMPA 2OXPA 2QEJC 3EJIA 3Q24A 3DEOA 4MIUA 2BDNA 1DYQA 1I4PA 4RCOA 1PTOD 2JA6B 2AWNA 3K5NA 2WV6D 1JOOA 2BA0A 2ICEC 4DFAA 4XXEA 3VYUA 3JAML 3QIAA 4R9WA 3K5LA 2CW0C 4RGMA 2XRQD 3TSSA 3GP7A 3SK5A 3FKIB 3NXWA 1SNDA 2VB3X 1O78A 3I4MB 2QKIC 2AQ2B 5K36G 2ID0A 1JWSD 1KAAA 1XTCD 2AUKA 2X6LA 3D4RA 3MXPA 1BXTA 2B2UA 4YIJA 5DM63 2FMCA 5A2QE 2N55A 3DWQA 4HMJA 4UDUC 1R4PB 3T16A 1EWHA 3P75A 4EQOA 3C3LA 4KJNA 3KLSA 3MWYW 3H0GB 1E2WA 1KDAA 2IX1A 4A3GB 3PO3B 2SEBD 5CBAE 4A3IB 2XVSA 2IL8A 3ERQA 2IPKD 2E2IB 4Q5VA 1WTQA 2ZXOA 2K5DA 1NR4A 2CVRA 1U9RA 2LS01 1LACA 2B2UC 4C3HG 4PNYA 3CKIB 2QDBA 5E4XA 3EVQA 5KEEA 2NTTA 3ONAB 1Q90A 2NN6H 5F2DA 4KMUC 2AWOA 3GTKB 1ENAA 3R2TA 4OIJA 2PPBC 1BQQT 1EEFD 3I91A 1SDFA 1KDCA 3L9AX 3NBHA 4XQJA 4RCNA 4HCSA 1EU4A 3NE5B 3P20A 3I4NB 1HA6A 3H94A 4RHRA 4R8IA 1HCZA 3KF8A 3NSWA 3IL8A 4DK1A 1Z47A 2Z1CA 1KLUD 5G3LF 1ENFA 1EEID 1I4QA 4P2CB 2RVLA 5HGTA 5M5WB 2BCOA 1IW7D 3E6ZX 2PZUA 2EJMA 2IW3A 3K7AB 2RDHA 3D6WA 2F0OA 5KNDA 1PYWD 1G2SA 2FFKB 1I4GA 3SXHA 2JP1A 4RWSC 3EA6A 4OHJA 1EU3A 2F0WA 3J80E 1XWEA 4O42A 1AEXA 3K57A 3OMCA 5EKKA 2BDOA 2K01A 1CHPD 5I4DA 1HFGA 3V96A 1A6XA 3NP8A 1B4OA 2OF1A 4A3EB 1DXMA 5ISRA 1GUTA 4WRDA 1TY0A 2RQXA 1YNNC 2PCFB 2L12A 1PZID 5JEAG 1EYCA 3FDTA 5C5MA 3X3MA 2NTSA 4C3HB 4DXGA 4Q0FA 4DA2A 1BCPF 1SNQA 2B8FA 4OIKA 2L1BA 3P7JA 1SYDA 2PW5A 4IFDG 1QE6A 5FLXL 2R92B 1LT3D 1WCMB 4K8JA 4FXDA 2DY7A 1ESFA 2D9UA 5KYLA 1KNEA 1VF7A 3JAME 5C3XA 1UUPA 1Q12A 1S5CD 2MHVA 1OXTA 1S5ED 2KCCA 1WTXA 1BOSA 1D5ZC 3GTOB 1WD1A 1G6ZA 3NHHA 1EQTA 4TQUS 1EY7A 1GUNA 2B8GA 3DWPA 1BUVT 5FO9B 1EZ8A 3KBXA 1HHVA 3LWUA 3SK6A 2F0UA 3RMHA 1ET6A 1STEA 1W6KA 3M4OB 2GA4B 4DU9A 4K6LA 3FPPA 1CA5A 4B9WA 4FVMA 1EY8A 4FXKC 3T53B 1STGA 2PYKA 1ET9A 5M3MB 1BBXC 1H9KA 1SAPA 2F0FA 3KLRA 4K14A 1AZQA 5KRUA 1PRTD 1G8ZD 2KCNA 1EYDA 4IURA 3SDZA 1TT2A 2TSSA 3A7LA 3M4YA 4L63B 4PQXA 4XQNA 1CM9A 2Z4HA 1F9PA 2EY2A 4IALA 3R93A 1F77A 1NAPA 5CGKA 5KNBA 1F2MA 1UEAB 4H0LC 1TWAB 4J1MA 4M1UB 2KA7A 2HCCA 4ZUIA 3OW7A 2X6GA 5D3DA 1GUSA 2LMCB 3K58A 1EQVA 1BR9A 1RHPA 1Y69U 1BCPC 4TRDA 4FXGC 3SE0A 2I46A 3R3OA 2PNRC 1Y8OB 4ODGA 5FK9C 1D1IA 4N9PA 5CMDA 3BG3A 3OWEB 1BF4A 1TWGB 4X3UA 1U4RA 3E0JA 5CORA 1F2ZA 1LT5D 2XN9C 5M5YB 4QF4A 5M3FB 1ONLA 1RCVD 1EIGA 1SEBD 1HRJA 4FNFA 4F8MA 2A69C 3RD4A 2KHSA 4RGOS 1Y8PB 5FO8B 4PMCA 2CW0D 2Q8RE 3I8ZA 1E2VA 1SBBB 1A2UA 3NK9A 1WTRA 3GTGB 1K83B 2MP1A 3AB9A 5FLXE 4LAAA 1DCZA 3A8KE 5IGDA 1LT4D 2F4IA 1SJED 1JWMD 2EOTA 4EGVA 4H13C 3QWNA 3NTKA 1CTMA 4E6IA 2FMMA 4EQNA 5ELBA 1I4RA 1DJRD 2L4NA 1NUCA 1G2TA 5EGTA 1O7LA 2NVYB 3MA2B 2PO4A 3HG9A 2I07B 5ELFA 4NDXA 5C3EB 5K36H 3J80L 1S5BD 5CYUA 5JEAJ 1PFNA 5ELEA 5FKAC 1SE2A 4RGNA 4ULLA 3TN2A 1BCPB 5DAUA 5NUCA 3NBIA 2N88A 3NQIA 3TMEA 5JVG3 5C4JB 1FNVA 3BZDB 5KGUA 3MFGA 2KUMA 4IUVA 2B2VC 3J7AF 4KK7A 2M2LA 3OHXC 2NYZD 2ZXRA 2AQ3B 2Z4IA 1XXGA 5LHY1 2R7ZB 2F0MA 2L5TA 1UAPA 2F0SA 1CQFA 3FVQA 4DNTB 4RKBA 3TP6A 1LABA 4NP5A 5DEHA 5C3WA 3VR3A 1KABA 2R6GA 4QCLA 3A7AB 4OO1I 4CKBA 1PRTB 4HMIA 4C56C 3CU7A 2EYFA 2DNCA 3BDLA 1FNWA 2EXZA 4KI0A 4M8AA 4ZRZA 3OOCA 4EQPA 1EYAA 1F2YA 2NB0A 5T1IA 3MXGA 3V05A 3RZOB 4QUFA 4NKLA 5C6AA 2E2HB 1V1OA 3PUVA 5JOBA 1T5EA 2QILA 3SVMA 3HOWB 3K59A 4KY6A 4XT3B 5KYIA 1PTOH 1YNND 5EPJA 3VYRA 2EE1A 1SYFA 3E5SA 4RH6A 2EYLA 3OIQA 4IUQA 5CV7A 2DY8A 1LTSD 1JQYD 1H9MA 1G91A 1EY0A 2OEOA 3S9WA 4WFN3 4OL7A 4WORA 4G57A 4KHVA 4BS9A 5JVH3 2C5CA 2EPBA 3AMUA 1F9QA 1QG7A 1TWFB 2ICIA 1CK1A 1K8OA 2F1MA 4LK1C 2K04A 5M5XB 1HFNA 2A6EC 4V0BA 3C1FA 5JEAH 4PMBA 2XWBB 3URYA 2G9HD 3MZ5A 1A3UA 1O80A 1SE3A 4ZK9B 2XRSD 1CFMA 1XX8A 2XNAC 1KDBA 1JOKA 2J7ZA 2KOLA 2JE6I 2F0IA 1ILPA 2J4XA 3SK8A 5C44B 1MSGA 2D2CC 1B9NA 2NWGA 2SNSA 1SXTA 1DM0B 4RA8A 2R61A 1SSOA 2QF7A 4OO1H 3Q0AA 2L9HA 3CRLC 3KLSX 1HTPA 4ZQ3A 3T13A 2D5DA 4F7XA 5I9OA 4BY7B 1PLFA 4C3IG 5I6WA 1H9RA 1V1PA 2SOBA 3A55A 1TWCB 3K6OA 4CGYB 3S2HB 5EQ0A 3R8BA 3RZDB 5E1FA 4X3KA 5G3LD 1ZXTA 2TMPA 4DGZA 4KV6A 1EFID 1B3AA 2LFNA 2O5JC 4G7OC 1HUMA 1GUOA 5CV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMC A;  1ENC A;  1A3V A;  1TT2 A;  3SK5 A;  3QOL A;  3BDC A;  4K6D A;  3NXW A;  3PMF A;  1SND A;  1STY A;  5J39 A;  1A2U A;  3NK9 A;  3D4W A;  3DHQ A;  5I9P A;  5HUR A;  5KYL A;  1EY9 A;  5CV8 A;  2EY1 A;  2F0G A;  4LAA A;  5C3X A;  5IGF A;  1KAA A;  4K2L A;  3OWF A;  5IGD A;  1STN A;  2SNM A;  1STH A;  2F0M A;  1RKN A;  2RDF A;  1EY5 A;  2EY2 A;  4IAL A;  3TP8 A;  3OMG A;  2ENB A;  3MXP A;  2F0S A;  2HQE A;  5M9O A;  3C1F A;  5KIX A;  5JAV A;  4PMB A;  3H6M A;  5CGK A;  4KD3 A;  2EYM A;  4KTA A;  1EY4 A;  4K8I A;  4RKB A;  3MZ5 A;  4YIJ A;  3TP6 A;  3U9O A;  5C4Z A;  4NP5 A;  1A3U A;  5IGC A;  1F2M A;  3D8G A;  5DEH A;  5C3W A;  5HGT A;  3SK4 A;  4E6I A;  4J1M A;  5KEE A;  4EQN A;  2EYP A;  4IUN A;  1KAB A;  1KDB A;  4HMJ A;  1SYC A;  2PZU A;  2F0E A;  1EY6 A;  3T16 A;  1JOK A;  3SR1 A;  4ZUI A;  3RUZ A;  3NHH A;  5K5P A;  2F0O A;  1SNM A;  5CV4 A;  2F0I A;  1NUC A;  3P75 A;  4EQO A;  4ZUJ A;  1EY7 A;  4K5W A;  1SYG A;  2F0D A;  4KJN A;  3SK8 A;  3ERO A;  5EGT A;  2WAC A;  1EZ8 A;  4HMI A;  3SXH A;  1EQV A;  4B9X A;  2EYF A;  3MVV A;  4KY7 A;  3QOJ A;  4RKL A;  2O4X A;  3BDL A;  1NSN S;  3D6C A;  5IGE A;  4TRD A;  1SNP A;  2F0W A;  2NUC A;  1KDA A;  4QB4 A;  4R8N A;  4EVO A;  2EXZ A;  3SK6 A;  3TP5 A;  3P1H A;  2F0U A;  1SNC A;  3NQT A;  1AEX A;  5CC4 A;  1STA A;  5J1Z A;  4EQP A;  2EY6 A;  3MEH A;  3OMC A;  3DMU A;  5EKK A;  1SYB A;  1EYA A;  1F2Y A;  2KQ3 A;  4NDX A;  2SNS A;  3R3O A;  5J22 A;  4ODG A;  4NKL A;  3NP8 A;  2OF1 A;  5CV9 A;  5C6A A;  1II3 A;  2EYJ A;  4DU9 A;  2PZT A;  1JOR A;  3D4D A;  4N9P A;  3HEJ A;  5JOB A;  4HTH A;  3ERQ A;  2PZW A;  4ID6 A;  4B9W A;  2PQE A;  4J6H A;  5ISR A;  1EY8 A;  2RBM A;  3SHL A;  4KY6 A;  5IOD A;  3TP7 A;  2F0T A;  5IIF A;  2F0Q A;  3QB3 A;  1STB A;  1STG A;  2F3W A;  5KYI A;  4WRD A;  4ZQ3 A;  4KJO A;  3T13 A;  5EKL A;  2LKV A;  4KD4 A;  4F7X A;  5I9O A;  1JOQ A;  1TR5 A;  5IOC A;  4QMG A;  2OXP A;  1U9R A;  2PYK A;  3EJI A;  5CR3 A;  5DAU A;  4DF7 A;  5C4H A;  2M00 A;  2PW7 A;  5I6W A;  2EYH A;  1TQO A;  4K2K A;  3OSO A;  4PNY A;  5NUC A;  1EYC A;  4ME5 A;  4MIU A;  5C5M A;  2F3V A;  2QDB A;  1F2Z A;  3LX0 A;  3EVQ A;  2SOB A;  1A2T A;  1IHZ A;  5C5L A;  2F0H A;  2F0J A;  4IZ8 A;  4K5V A;  4NMZ A;  1SYF A;  3VA5 A;  2EYO A;  2F0F A;  3E5S A;  3ITP A;  5CV6 A;  4K14 A;  2F0P A;  3MHB A;  4KY5 A;  5E3F A;  5IGB A;  5F2D A;  4I65 A;  4K5X A;  1SNQ A;  2EYL A;  3NUC A;  4QF4 A;  3TME A;  5CV7 A;  1EZ6 A;  5I6Y A;  5KRU A;  5E1F A;  3V2T A;  1SNO A;  4N9T A;  1SYD A;  2F0V A;  2PW5 A;  1ENA A;  3C1E A;  4S3S A;  2F0K A;  4DGZ A;  1JOO A;  4KV6 A;  5KGU A;  4H7B A;  2F0L A;  4F8M A;  1EY0 A;  4DFA A;  1SYE A;  2KHS A;  2OEO A;  2RKS A;  1A3T A;  4OL7 A;  3S9W A;  3HZX A;  1EYD A;  5CV5 A;  4WOR A;  2F0N A;  5IGG A;  2EY5 A;  4G57 A;  4KHV A;  4K8J A;  1KDC A; 
#chains in the Genus database with same CATH topology
 1X55 A;  5BN5 A;  1IYU A;  1XNQ L;  4L8J A;  5AFW A;  2Q2H A;  1V43 A;  4IQZ A;  2CQA A;  4QJF A;  1RTO A;  3FEW X;  1EL0 A;  1PFM A;  4HSV A;  4RAU C;  3ND8 A;  2K1B A;  2HQE A;  5BN4 A;  3HOV G;  2VNU D;  3HOY B;  2QCP X;  3H6M A;  2CWA A;  2R93 G;  4JI4 L;  4K8I A;  1XNR Q;  1MBY A;  1Y1W B;  1E24 A;  5IGC A;  4J8Q A;  4XYQ A;  1IBM L;  1B53 A;  1SYC A;  3WDN A;  5M3F H;  3A5Z B;  3MC0 B;  1VQF A;  1NE3 A;  2ALY B;  3KJO A;  4K5W A;  3IAY A;  1ZEQ X;  1AH9 A;  4RGT A;  2B2W A;  4C1N K;  5BR8 L;  4XYO A;  4A3L H;  3GTM B;  5IGE A;  3QOJ A;  4DV0 Q;  3O13 A;  3W1G A;  1XPO A;  3I4L A;  2ZM6 Q;  1T5X D;  1ML0 D;  3D3R A;  1HNZ Q;  1BCP D;  2CH4 W;  3MEH A;  3DUZ A;  1QNU A;  2KED A;  1NJI C;  4OGQ C;  4UP9 A;  4B08 A;  3I2Z A;  3H09 A;  1N34 Q;  2EYJ A;  3MTS A;  3QR8 A;  4UY8 C;  3HEJ A;  2NVT H;  4R4Q A;  3MAQ A;  4A3F B;  4KHZ A;  2F03 A;  4LF6 L;  1S4Z A;  4IUT A;  1Q1B A;  3GQB A;  5IT9 c;  1GHJ A;  1TKW B;  3G48 A;  1Z6H A;  4PG3 A;  3WOF A;  3CCR A;  1B2T A;  1PDQ A;  4KJO A;  1T9H A;  1AE2 A;  1PVO A;  1V8Q A;  2AMC B;  3ND9 A;  1VQ7 A;  1TY2 A;  1L0X B;  3OPO A;  1D5X C;  3PO2 G;  4C3I B;  4K2K A;  1L1O C;  5LL6 S;  2L15 A;  5IYB G;  1JC7 A;  1RF2 D;  1YIJ A;  1A2T A;  1IHZ A;  2Z8L A;  4IZ8 A;  3C2P A;  1N32 L;  4MHE A;  4JBK A;  4JI3 Q;  2F0P A;  5IGB A;  4BBR H;  4HED A;  1HZ9 A;  4I65 A;  3BVM A;  1TS4 A;  2B63 H;  2K5W A;  4N9T A;  1VQG A;  1Q8I A;  4HIM A;  5DNF A;  2K05 A;  3ZJY C;  4JI2 L;  1HNW L;  5C0X G;  2B2W C;  5H1S E;  1HZC A;  2A69 D;  2EY5 A;  1VQC A;  2B2T A;  2JJQ A;  3CME A;  1TII D;  1E7Z A;  1ESR A;  1PFB A;  3MXU A;  3GTQ B;  1WTV A;  3D4W A;  4LWC A;  1FNU A;  4LFC L;  2JQO A;  1KRS A;  4X64 Q;  1EY9 A;  1LTL A;  4G4K A;  3NBH B;  2XGT A;  3QJY A;  4HR7 B;  2UUB Q;  1OO9 B;  2ZTE A;  3M7N A;  2RDF A;  3OIP A;  4DR1 L;  2WFW A;  1OXV A;  4DV7 L;  4IOC A;  1XMQ L;  2B2Y A;  5GAD C;  1U4P A;  1VDZ A;  4KTA A;  3HOV B;  5C4Z A;  2PQA B;  4Z9C B;  2R93 B;  2WB1 E;  2E5L Q;  3KF8 B;  4UP8 A;  4GS3 A;  1VS0 A;  1EY6 A;  2DN8 A;  3S15 H;  3S16 H;  3SR1 A;  2H1E A;  2QGQ A;  1DD2 A;  2CFM A;  2B29 A;  3C46 A;  3VR4 A;  2OWO A;  1CT1 D;  1DOK A;  3DM3 A;  2A1A A;  2LSS A;  2NVX B;  1IL8 A;  4JC0 A;  1MD2 D;  2HHH Q;  1STA A;  5J1Z A;  3HFZ B;  3E9I A;  4JBW A;  5D65 A;  2K5H A;  2B2T C;  1QUQ A;  2K7V A;  4AYB B;  3D31 A;  5A35 A;  3BZC A;  5ELD A;  1AP0 A;  1V1P B;  1DOM A;  2IT1 A;  3SHL A;  1SFO B;  1XPU A;  5LMN L;  4X65 Q;  3CCS A;  1YJN A;  4OWW B;  4R1J A;  5CR3 A;  4DF7 A;  4A3C H;  1QZG A;  2PW7 A;  1HR0 Q;  3PO2 B;  5HY6 A;  3OSO A;  2B2Y C;  1B9M A;  5KNC A;  4JI5 Q;  5C5L A;  2F0J A;  1X56 A;  3VA5 A;  1B44 D;  3LWE A;  3PIP A;  4L6T B;  2BA1 A;  2VQF Q;  1Q82 C;  3KDF A;  3V2T A;  1J8I A;  4XTC S;  1D1K A;  3TRZ A;  3T56 B;  2MUY A;  3HOZ G;  2E75 C;  3A0J A;  1SE4 A;  3FMC A;  1S5F D;  4YCW A;  1VQO A;  1GKH A;  4JV5 Q;  2KEN A;  2AHO B;  2YTY A;  3RZO H;  5JJI A;  1HA5 A;  5IGG A;  3DWA A;  1TXY A;  1UE1 A;  4LJZ C;  1LTA D;  2XWJ B;  1L0Y B;  3A74 A;  3NWT A;  1EIH A;  4DAP A;  3KF6 A;  3HOW H;  5DM7 3;  3J7Y W;  4A75 A;  3DHQ A;  1IBK L;  4MN3 A;  1LO5 D;  5HUR A;  3H0G H;  3Q23 A;  2ES2 A;  4KN7 C;  2QW7 A;  3T1H L;  2XIW A;  2NZH A;  4AYB E;  1BBU A;  1S3O A;  4QIW B;  4A3G H;  1X54 A;  4KD3 A;  3PO3 H;  1W6J A;  3U9O A;  3G7L A;  1ZYR C;  2EJG C;  2K33 A;  4BBS G;  1PH9 A;  5CBE E;  4IUN A;  2D62 A;  3TEH B;  2RHS B;  3M7G A;  3GV6 A;  3EIV A;  5K5P A;  5JPM C;  1IBL L;  5EKI A;  4Y52 H;  1RTN A;  1TS2 A;  1GXD C;  3R2I A;  4BA2 I;  1VF5 C;  1C0A A;  4JK1 C;  2WAC A;  4YHH L;  3N6R A;  4BXX H;  4A3J B;  4QQB X;  1UWV A;  3K5M A;  5C4X G;  4C3J B;  1C8C A;  4B3S Q;  2K03 A;  2Y0S E;  2JA9 A;  5D3I B;  4QB4 A;  3ZYY X;  1I94 L;  1N36 L;  3N52 A;  3J80 i;  1C7Y A;  3TP5 A;  1W3S A;  2IX3 A;  5FJ8 G;  2K4K A;  4OEL B;  2AQ1 B;  4ZLT F;  2VY3 A;  3IFD A;  2EY6 A;  2I5H A;  3A8J E;  1TWF H;  5EBC A;  4FF1 A;  4ABN A;  1PA6 A;  4JI7 L;  1GOZ A;  5CV9 A;  3EQL C;  2BOS A;  4JPB W;  1Q86 C;  3BYT B;  2PQE A;  1HUN A;  2B2V A;  4IN3 A;  4LF7 L;  3NEN A;  3CQZ B;  1I6H B;  2UXD L;  2OQK A;  2WP8 J;  3CC7 A;  5GAH C;  3A54 A;  4JOI A;  3ICE A;  5I2Y A;  4GOP C;  3S14 B;  2L11 A;  5C4H A;  2VZA A;  4HAE A;  2A68 C;  5TSS A;  5E7N A;  1UEB A;  1BDO A;  1YNJ C;  1SJH D;  2A73 B;  2C35 B;  3MFY A;  3I4N H;  2E2D C;  2XSC A;  5C44 H;  2XTI A;  2EVB A;  2KEC A;  3UDF A;  1VQ9 A;  1M4V A;  1K0R A;  1S72 A;  4N8F A;  2A6H C;  2F0V A;  4UAI A;  3PQI A;  1CQV A;  3J7A V;  1I6V C;  5EPK A;  1RDP D;  4R4I A;  1LTR D;  3HOZ B;  1I4H A;  1JJC B;  3E0E A;  1WD0 A;  2MO0 A;  5M5W H;  3H3V C;  1D6E C;  3NTI A;  3ULL A;  3KYH C;  3K7A H;  2JA8 B;  5EPL A;  4H44 C;  4IFD J;  1YI2 A;  1LYL A;  4K6D A;  1F2L A;  3W1B A;  1YHQ A;  4A93 G;  2LY7 A;  3BU2 A;  4ILW A;  5I2X A;  5IYD G;  2E74 C;  2F0G A;  3JAM i;  5IT9 L;  4BA1 I;  1H9S A;  3I72 A;  2G9D A;  1STH A;  1PTO F;  2PNH A;  4K0K Q;  3HKZ G;  2MGS A;  5JAV A;  1Q7Y C;  2A6E D;  4IJL A;  1TWC H;  1V9P A;  1K0S A;  3S1R B;  3E9H A;  3SK4 A;  4J15 A;  1BBW A;  3BVZ A;  4BBS B;  4JOI C;  1Q46 A;  1A15 A;  3RZD H;  3J81 c;  2EZV A;  1GJX A;  4LFA L;  4IFD I;  4ZUJ A;  3HGB A;  1SMY C;  2K50 A;  4GN4 B;  4HSP A;  1I4X A;  4FP5 D;  3BVG A;  3ERO A;  1K8G A;  3BYY B;  4LUV A;  4ZKC B;  1QUQ B;  4A3K G;  1ROD A;  4CJ0 B;  5C4X B;  4R8N A;  1CSQ A;  4PZ6 A;  3VR6 A;  4OEM B;  2VQE L;  3KUP A;  3TDQ A;  2F52 A;  2WAQ G;  1IBM Q;  4JI1 Q;  1CA6 A;  2JYO A;  3GTJ B;  3GD7 A;  1MSH A;  3F8T A;  2KQ3 A;  4DR6 L;  2E2J B;  4DAY A;  1E1T A;  3S17 B;  1QWY A;  4U67 3;  1VQA A;  5EAY A;  2OCE A;  4IUU A;  5BR8 Q;  3F2D A;  2HIX A;  3VYT A;  2R92 H;  4X3S A;  2F0T A;  1WCM H;  4JCV E;  1K3R A;  2IHE A;  1WTO A;  1F9S A;  1K8M A;  1HH2 P;  2EYH A;  1TQO A;  4ME5 A;  3KOJ A;  1R4Q B;  2F3V A;  3U58 A;  5C0X J;  2JEB I;  1EQR A;  1QOH A;  1CZG A;  4F88 A;  1OTC A;  3L3O C;  3GTM H;  2NBF A;  3NUC A;  4K5X A;  3VR5 A;  3HOX B;  1EZ6 A;  3CC4 A;  4LF6 Q;  2VUM G;  2FJ2 A;  1WVL A;  2UUC Q;  1Y1V G;  3KF6 B;  4FF3 A;  3C1E A;  4DUZ Q;  1N33 Q;  2HCI A;  2F0K A;  4S3S A;  1TU2 B;  3J7Z C;  1MHW C;  2N49 A;  1VCI A;  2NVQ B;  4DNR B;  1K9M C;  4WJW A;  2L55 A;  3PUX A;  4X3T A;  1N32 Q;  4KKT A;  1NCV A;  3T51 B;  4QUC A;  4O2D A;  4A3B G;  4A93 B;  4IPG A;  3PIP 3;  3M3Y B;  5I9P A;  2GN5 A;  5CV8 A;  5C0X I;  1CZW A;  3M85 A;  3OWF A;  3AFP A;  1OXU A;  2J0T D;  3CP0 A;  1HNW Q;  4A3M B;  4C3I H;  4GZY C;  4FF4 A;  1RL2 A;  1M8A A;  4HN7 A;  3HKZ B;  3FRP B;  3PUZ A;  3TZD A;  1WTP A;  1GVP A;  3M4O H;  4TKO B;  2FIN B;  1P16 A;  4LFC Q;  4HCE A;  5E4W C;  1PV4 A;  1UE6 A;  1E3P A;  2K28 A;  1E1O A;  4ZKB B;  4GLX A;  1IYV A;  4Y7N B;  5IP7 G;  4DR1 Q;  3PUW A;  4DV7 Q;  2RDG A;  4RKL A;  3GO5 A;  3HOY G;  4A3K B;  1KLG D;  1HNX L;  3KK7 A;  3CMA A;  2HDL A;  1Y1W G;  3UE1 A;  2DNE A;  1KTK A;  2FHT A;  3NQT A;  4CBV A;  1IYJ B;  1M1K C;  2F4V L;  2VXW A;  3A56 A;  1SE8 A;  2WAQ B;  4DV3 L;  4NXM L;  1VQK A;  1EOV A;  2PI2 A;  5J22 A;  1U4L A;  3CHB D;  3I73 A;  1QCB D;  3VYS A;  4LNQ A;  2MPM A;  1JOR A;  2A5H A;  4IFD H;  3HOV H;  3EN2 A;  1TS5 A;  4CDD C;  4B3M L;  2BH8 A;  2IJ0 A;  2R93 H;  2WIN B;  3KJP A;  2BE5 C;  4UP7 A;  2F3W A;  1X32 A;  4RHS A;  2LKV A;  1TR5 A;  4BY1 G;  5AJ3 L;  1D7Q A;  3KBG A;  1AZP A;  1RJT A;  4XDX A;  4DV4 L;  2JN4 A;  2O5I C;  3GDE A;  1PTO C;  3TS0 A;  5L37 A;  3DM1 A;  1DON A;  4TSS A;  1XTD A;  4DR7 L;  5CV6 A;  3ULP A;  5E3F A;  3CRK C;  4QY7 A;  4DXF A;  3TZU A;  3IKJ A;  1FGB D;  1I50 B;  3BS1 A;  2WB1 G;  1L2F A;  2VUM B;  2CHB D;  4LF9 L;  2CQO A;  1Y1V B;  4H7B A;  3IFT A;  3CCQ A;  1LTB D;  1MGS A;  1X3P A;  1TWA H;  1YJW A;  5IP9 G;  1D2B A;  2LXJ A;  1H9S B;  1J5E Q;  1TWH B;  3L7Z C;  3CF5 A;  1BO0 A;  1QJO A;  3PIO A;  1WTH A;  3FHW A;  3QOL A;  4UPA A;  1K73 C;  4P72 A;  2WII B;  3PMF A;  1HJP A;  1STY A;  4G7H C;  2UUA L;  4X6A H;  3DEP A;  1Z7T A;  4A3B B;  4X66 Q;  4NW2 A;  2JSO A;  3PV0 A;  1X9N A;  3PGZ A;  3T1Y L;  2SNM A;  1CHQ D;  4FO2 A;  4IUP A;  1GUG A;  2RCF A;  3UI2 A;  3PO2 H;  2EYM A;  1UNS A;  3STB C;  4CKE A;  3QG1 A;  2D0P A;  4JI0 L;  1OXS C;  4ALP A;  2KJX A;  2DUD A;  3MXN A;  3NPP A;  5IT9 E;  2UXC Q;  1VQE A;  3PUY A;  4ZAI A;  2ZJQ A;  1SYG A;  3AU7 A;  3HOU B;  3I55 A;  2F0D A;  1TWG H;  2L0C A;  1AW7 A;  3EFX D;  1O7Y A;  1HR0 W;  1VQ6 A;  1AFP A;  4DAY B;  5C0X H;  2NN6 G;  4B9X A;  4KHP Q;  3GV3 A;  1ILQ A;  4DN4 M;  2UXB Q;  2Z0S A;  1SNP A;  3QO2 A;  1L1O A;  1YZ6 A;  5LMU L;  4DAV A;  4JYA L;  2K52 A;  3DMU A;  1U0L A;  3M9B A;  5M5Y H;  1A62 A;  2DJF C;  5COY A;  1GM5 A;  4PV1 C;  3L0O A;  2WKC A;  1EWC A;  4RMF A;  4YHH Q;  3AYH B;  1MI2 A;  1N9W A;  2H4O A;  4HTH A;  4RFB A;  2RBM A;  3SEB A;  4DV6 L;  4DK6 C;  1PH3 A;  1JWU D;  1I94 Q;  1YEZ A;  4P75 A;  1FYC A;  1N36 Q;  4XQQ A;  5EKL A;  3S2D B;  1X3Q A;  1JOQ A;  4R4O A;  1K3B C;  4BY1 B;  1IKM A;  4XT1 B;  3J81 L;  2OT2 A;  4DR5 L;  1FD7 D;  2I0Q A;  3L2P A;  3GTG H;  1O7I A;  1LTI D;  1LTT D;  3LX0 A;  1K83 H;  2F0H A;  4K5V A;  4JI7 Q;  4NMZ A;  1LLR D;  3TBI B;  4AYB G;  3Q22 A;  3MHB A;  1G29 1;  1JCK B;  2MJ8 A;  5I6Y A;  3K5O A;  4NXN Q;  3GTP B;  4LF7 Q;  4ZCK A;  5JPN C;  4LF4 L;  3T4A C;  2WB1 B;  4OO1 G;  3BDO A;  3CCL A;  1X6O A;  2IHF A;  4KKS A;  4GKK Q;  1SYE A;  1H9J A;  4B3T Q;  1A3T A;  1CKN B;  4KN4 C;  2MFI A;  1EOT A;  1ZKO A;  1JB7 A;  4MZ9 A;  3GTL B;  3FPU B;  1PZJ D;  3BDC A;  3W5O A;  1I3Q B;  1U4M A;  1PTO B;  4KKU A;  3I90 A;  2Y0S G;  2RHQ B;  3CQZ H;  2NVY H;  1DOL A;  1J9O A;  3UDI A;  1PH2 A;  2EY1 A;  4DK0 A;  3PF4 A;  5EBD A;  4C2M B;  3CW2 C;  1STN A;  3TP8 A;  1BNZ A;  4DUY L;  1MKH A;  1Q3L A;  2VB2 X;  3U4V A;  3LNN A;  2YTV A;  1PRT F;  1IW7 C;  5C3E H;  2PMZ B;  4CJ2 C;  3D8G A;  1NMG A;  1IKL A;  3AFQ A;  3CPF A;  1ZYR D;  3I3C A;  4DV2 L;  2F0E A;  5FOB B;  1B7Y B;  1DGS A;  1JIC A;  4CKC A;  5BN3 A;  3F2B A;  4NB3 A;  1N8R C;  1SNM A;  2B3G A;  2CKZ B;  2IX0 A;  4FF2 A;  2K75 A;  3ULJ A;  2K32 A;  4KY7 A;  1E0B A;  1NSN S;  2NUC A;  4EVO A;  1HTL D;  4DV1 Q;  4V19 0;  3JAM c;  3P1H A;  1JE4 A;  1SNC A;  4U68 A;  1PXU A;  1D5M C;  1LTG D;  4PZ7 A;  4G7Z C;  1VQ5 A;  2EXD A;  1RD9 D;  5C4J H;  1II3 A;  2PZT A;  3D4D A;  2PZW A;  4A3J G;  4HJ9 A;  3TP7 A;  4LMQ D;  5IIF A;  2F0Q A;  3W3A A;  4C3J G;  4LFB L;  4B3R Q;  4A3L G;  3I70 A;  5IOC A;  1KNA A;  4DR3 Q;  4FYD A;  1Q1E A;  2ZXP A;  2A68 D;  3K0X A;  3RLF A;  5IOD A;  1LT6 D;  1YNJ D;  2R7Z H;  3NTH A;  4LF5 L;  5ELC A;  4F87 A;  2PMZ E;  4KY5 A;  4DV5 Q;  1HZB A;  3ERS X;  2OTJ A;  1GO3 E;  1JR0 D;  1OXX K;  4JW0 A;  3X3N A;  3G6J B;  1F9R A;  2K5Q A;  2A6H D;  3WOE A;  3GTJ H;  4POF A;  4HID A;  1QVF A;  1CI3 M;  1DZ1 A;  3K7U C;  2ZJR A;  1PHJ A;  2PI2 E;  4O1N A;  1FR3 A;  1A3V A;  3RNU A;  5J39 A;  4GLA C;  5A2Q L;  1QB5 D;  3KLW A;  4O0A A;  3CXC A;  3HP3 A;  2Y0S B;  2JA7 G;  3MXN B;  2JA5 G;  2Z6B A;  3RLN A;  3VA7 A;  1RKN A;  1EY5 A;  5M9O A;  3S1M B;  3PSI A;  1PZK D;  4A3D G;  3A8I E;  5JJZ A;  3PIO 3;  2B39 A;  2E76 C;  2JA8 G;  3F2U A;  4LF8 L;  2G5D A;  4NPS A;  2YYZ A;  1EYG A;  3PF5 A;  1L1O B;  2E2H H;  5D14 A;  4APV A;  1A8V A;  3RUZ A;  4DKA C;  5CV4 A;  3U50 C;  2YU9 B;  1HZA A;  1B50 A;  1C48 A;  2EQS A;  3Q6S A;  3S1Q B;  4OX9 L;  1SMY D;  1QNK A;  4GOP A;  3J7A 5;  1XYI A;  2NVQ H;  5T1G A;  2Q8I B;  1GHK A;  2V4D A;  1WTW A;  3U9S A;  3HRZ C;  1ICW A;  1QIL A;  2RCN A;  1WYD A;  2AUJ D;  4CJ1 B;  1HQM C;  1S5D D;  2HUG A;  5LL6 X;  5IYD H;  3UDX A;  1LV9 A;  2I5L X;  3HS0 C;  1R9T B;  5JJL A;  2IWH A;  2RA4 A;  1KL9 A;  4ID6 A;  2ZTC A;  4J6H A;  1HNX Q;  4PMW A;  2EJF C;  4KD4 A;  4QMG A;  4QGU A;  2F4V Q;  3Q8D A;  1PH5 A;  2M00 A;  2M9V A;  4DV3 Q;  4JI8 Q;  2JXM B;  3M4P A;  2EYO A;  3ITP A;  2JA6 G;  4Y7N H;  1PRT C;  5M5X H;  4DR2 Q;  3JC6 6;  4IOA A;  1JJ2 A;  2X69 A;  4B3M Q;  2WKD A;  2EDG A;  1SNO A;  1TS3 A;  4CHT B;  2F0L A;  3J81 E;  2NVT B;  4XIG S;  4DV0 L;  4DK3 C;  1Y8N B;  2RKS A;  3I7F A;  4CDC C;  3HZX A;  4DV4 Q;  3I56 A;  2NZ1 D;  3DXJ C;  2F0N A;  1HNZ L;  3EBE A;  3K0Y A;  3FKI G;  4C1N I;  1ENC A;  4JVZ A;  1SN8 A;  2Q8T A;  4DR7 Q;  1PH6 A;  3I4M G;  2KHI A;  1AE3 A;  2R3Z A;  2O2L D;  1B1Z A;  3HOX G;  1XJV A;  4GNX A;  4YY3 L;  5IGF A;  4K2L A;  3CAM A;  2GVB A;  3OYY A;  2JA7 B;  1IXR A;  2JA5 B;  4BBR B;  1WOC A;  3OMG A;  2ENB A;  1HQR D;  3NWS A;  5KIX A;  2B63 B;  1EY4 A;  1HXY D;  4YCU A;  1SRO A;  4A3D B;  3E3X A;  3HKS A;  2A74 C;  4I7A A;  3G71 A;  2EYP A;  3RLO A;  4AH6 A;  1YNX A;  2RSN A;  1I50 H;  2SDF A;  1HPC A;  1D8L A;  3W2D A;  1C4Q A;  2VUM H;  1JB3 A;  1Y1V H;  4JI6 Q;  1VQH A;  4MNO A;  3D0F A;  1NR2 A;  3H0G G;  1TVX A;  4BY7 H;  5FO7 B;  1BVS A;  4A3M G;  1WFQ A;  3MVV A;  2O4X A;  3D6C A;  4I7Z C;  2JEA I;  2K6A A;  5FLX c;  2C9O A;  3S1N B;  5CC4 A;  1YHB A;  2D0O A;  3S2H H;  5EJW A;  2HDM A;  2ZT9 C;  4A3I G;  1NNX A;  1SYB A;  5LMN W;  1VMC A;  1XNQ Q;  2NN6 I;  2KEE A;  3H91 A;  1YIT A;  4BWG B;  3S15 B;  3S16 B;  1NBW A;  1PMR A;  4A76 A;  2UUB L;  2KVM A;  1AN8 A;  3QB3 A;  1STB A;  4GNX C;  4ZYS A;  3VR2 A;  1GUW A;  5LMU Q;  4JI4 Q;  1E2Z A;  1O7Z A;  2RSO A;  4AQY L;  2BE5 D;  1VMP A;  2OXP A;  2QEJ C;  3EJI A;  3Q24 A;  4JYA Q;  2E5L L;  3DEO A;  4MIU A;  3F1Z A;  2BDN A;  1DYQ A;  1I4P A;  4RCO A;  1KXL A;  1PTO D;  3CPW A;  2JA6 B;  2AWN A;  5IP7 H;  3K5N A;  4DV6 Q;  3HOY H;  2WV6 D;  1JOO A;  2BA0 A;  2ICE C;  1M90 C;  1Y1W H;  1PH8 A;  4XXE A;  3VYU A;  4DFA A;  3JAM L;  3QIA A;  4R9W A;  3TRE A;  3K5L A;  2CW0 C;  4RGM A;  2XRQ D;  3KDF B;  3TSS A;  1FJG L;  3GP7 A;  2NZO A;  1B8A A;  2N78 A;  2E8G A;  4JBJ A;  3SK5 A;  3FKI B;  3NXW A;  1SND A;  2VB3 X;  1O78 A;  3I4M B;  2QKI C;  2AQ2 B;  5K36 G;  2ID0 A;  1JWS D;  1KAA A;  1XTC D;  3S2D H;  4LF4 Q;  2AUK A;  2KBN A;  2X6L A;  3D4R A;  2P5Z X;  3MXP A;  4YWK A;  1BXT A;  2B2U A;  4YIJ A;  5DM6 3;  1H95 A;  3RR5 A;  2FMC A;  5A2Q E;  2KCM A;  4GOP B;  2N55 A;  3STB D;  3DWQ A;  2QA4 A;  4HMJ A;  4UDU C;  1R4P B;  2Q2U A;  4JI5 L;  3NEL A;  3T16 A;  4A3F H;  1EWH A;  4ME3 A;  3P75 A;  4EQO A;  3C3L A;  2VQF L;  4KJN A;  2CH4 A;  3KLS A;  4DUY Q;  4JI2 Q;  3MWY W;  3H0G B;  5IP9 H;  1E2W A;  3GTL H;  1KDA A;  2IX1 A;  4A3G B;  4DV2 Q;  1PYS B;  3PO3 B;  2SEB D;  5CBA E;  4A3I B;  2XVS A;  4A3E G;  5ELO A;  3HOU G;  2IL8 A;  3ERQ A;  1RIP A;  4POG A;  1EUJ A;  2IPK D;  2E2I B;  4Q5V A;  1YJ9 A;  2CWP A;  1WTQ A;  1XMQ Q;  1CKM A;  2ZXO A;  2K5D A;  1NR4 A;  2CVR A;  1U9R A;  3GTQ H;  2LS0 1;  4DR4 L;  1LAC A;  4GLV B;  2B2U C;  4C3H G;  4PNY A;  3CKI B;  2QDB A;  5E4X A;  3EVQ A;  5KEE A;  2NTT A;  2VL6 A;  3ONA B;  1Q90 A;  3CD6 A;  2NN6 H;  5F2D A;  3DLL A;  4KMU C;  1CSP A;  2AWO A;  3GTK B;  5IY0 A;  1ENA A;  4OXP A;  1KD1 C;  5IYC G;  1KHI A;  3R2T A;  4OIJ A;  1WCM G;  2PPB C;  1BQQ T;  1EEF D;  2HQL A;  3I91 A;  1SDF A;  1KDC A;  3L9A X;  2R7F A;  3NBH A;  4XQJ A;  4RCN A;  4HCS A;  1EU4 A;  2EIF A;  2HIV A;  3NE5 B;  3P20 A;  3I4N B;  1FL0 A;  3H94 A;  4RHR A;  1HA6 A;  4R8I A;  2FXQ A;  1G51 A;  1HCZ A;  3KF8 A;  2NVX H;  1YHA A;  3NSW A;  5LMN Q;  1QVG A;  1SLJ A;  3IL8 A;  4DK1 A;  4WJ4 A;  1Z47 A;  2Z1C A;  1KLU D;  5G3L F;  1ENF A;  1Y14 B;  1EEI D;  1I4Q A;  4P2C B;  2RVL A;  4R4C A;  5HGT A;  3F2C A;  3TS2 A;  3VDY A;  5M5W B;  2BCO A;  1IW7 D;  3E6Z X;  1X3F A;  2PZU A;  2EJM A;  2IW3 A;  3K7A B;  2RDH A;  4AIM A;  3D6W A;  2F0O A;  5KND A;  1SFO H;  1PYW D;  1G2S A;  2FFK B;  1I4G A;  3SXH A;  2VW9 A;  2JP1 A;  4RWS C;  2ZTD A;  3EA6 A;  4OHJ A;  1EU3 A;  2KHJ A;  2F0W A;  3J80 E;  1XWE A;  4O42 A;  4IPH A;  1AEX A;  1I5F A;  5IYB H;  3K57 A;  3OMC A;  5EKK A;  2BDO A;  3K81 C;  2K01 A;  1CHP D;  5I4D A;  4DNI A;  2N3S A;  1HFG A;  3V96 A;  1A6X A;  3NP8 A;  1IBK Q;  1B4O A;  2OF1 A;  4A3E B;  3S1M H;  1E22 A;  4GN3 B;  1G6P A;  1DXM A;  5ISR A;  3T1H Q;  2DJG C;  5J3B A;  1GUT A;  3J81 i;  4WRD A;  4K0K L;  1TY0 A;  2RQX A;  1YNN C;  1K28 A;  2PCF B;  1K8A C;  2L12 A;  1PZI D;  4YWL A;  5JEA G;  5M3M G;  1EYC A;  3FDT A;  5C5M A;  3X3M A;  2NTS A;  4YWM A;  4C3H B;  4DXG A;  4Q0F A;  4X62 L;  2YU9 H;  3S1Q H;  4DA2 A;  1BCP F;  1IBL Q;  1SNQ A;  2B8F A;  3CCJ A;  4OIK A;  2L1B A;  3P7J A;  1SYD A;  2PW5 A;  4IFD G;  1QE6 A;  3MEF A;  2MQH A;  5FLX L;  2R92 B;  1LT3 D;  1PFS A;  1VQI A;  1WCM B;  4WJ3 M;  4K8J A;  4YCV A;  4FXD A;  1R9T H;  4JI1 L;  4R4T A;  2DY7 A;  1ESF A;  2RF4 A;  2D9U A;  1QVC A;  3J80 c;  4A3J H;  4IPC A;  1KNE A;  5KYL A;  1VF7 A;  3JAM E;  5C3X A;  4C3J H;  1UUP A;  1Q12 A;  2UXD Q;  2A19 A;  3WWV A;  1S5C D;  2MHV A;  1OXT A;  1S5E D;  2KCC A;  4UHV A;  1PH1 A;  2Q2T A;  1WTX A;  1JJG A;  1BOS A;  4KLK A;  4HIO A;  5GRO A;  2K14 A;  1D5Z C;  5DLQ E;  3GTO B;  1JMC A;  3G6E A;  1WD1 A;  4L5T A;  1G6Z A;  5FLM G;  2Z6K A;  3NHH A;  1EQT A;  4YY3 Q;  4TQU S;  1EY7 A;  1I6H H;  1GUN A;  2B8G A;  2DGY A;  3DWP A;  1BUV T;  3KFU A;  5FO9 B;  1EZ8 A;  2UUC L;  1NMF A;  1N33 L;  3KBX A;  3S14 H;  4DUZ L;  1HHV A;  4GKJ L;  3LWU A;  3SK6 A;  2F0U A;  4JBM A;  3RMH A;  1ET6 A;  2JA7 H;  1STE A;  1W6K A;  5IWA L;  3M4O B;  2GA4 B;  2JA5 H;  2YV5 A;  4DU9 A;  4K6L A;  3FPP A;  1MJC A;  3HOZ H;  1CA5 A;  2UU9 L;  4IJH A;  4B9W A;  4FVM A;  1EY8 A;  3H3V I;  4FXK C;  4A3D H;  3T53 B;  1STG A;  1IL2 A;  2JA8 H;  5ELN A;  2VS1 A;  1UE5 A;  2PYK A;  1ET9 A;  3CCM A;  5M3M B;  1BBX C;  1H9K A;  1SAP A;  2F0F A;  3KLR A;  1J6Q A;  4LFA Q;  4K14 A;  2OTL A;  5M3F G;  1IZ6 A;  1AZQ A;  1S40 A;  5KRU A;  1PRT D;  1L0W A;  2Z6K C;  1G8Z D;  3S1N H;  3S1R H;  1KRT A;  4AQY Q;  4GN5 A;  2KCN A;  1VQM A;  4BBS H;  1EYD A;  2VQE Q;  1P8L A;  4IUR A;  3SDZ A;  3UDG A;  1TT2 A;  2TSS A;  3A7L A;  4DR6 Q;  3M4Y A;  2LXK A;  4L63 B;  4PQX A;  4L5Q A;  4XQN A;  1CM9 A;  2Z4H A;  1LM0 A;  1F9P A;  4PZ8 A;  5C4X H;  2EY2 A;  4IAL A;  3R93 A;  5GAG C;  1XMO L;  1ASZ A;  1F77 A;  1NAP A;  5FJ8 H;  5CGK A;  1X3E A;  1FJG Q;  4EX5 A;  2E2J H;  4CDE C;  5KNB A;  1F2M A;  1UEA B;  4H0L C;  1TWA B;  4J1M A;  4M1U B;  3S17 H;  2JA6 H;  3OTO L;  2KA7 A;  2HCC A;  4ZUI A;  1KIX A;  1UE7 A;  1FVI A;  3OW7 A;  2X6G A;  5D3D A;  1GUS A;  1NTG A;  2LMC B;  3K58 A;  4BBR G;  1EQV A;  1BR9 A;  1EIF A;  1RHP A;  2B63 G;  4L5R C;  1Y69 U;  1BCP C;  4TRD A;  3CCU A;  3FKI H;  4P74 A;  3SGI A;  4LUO A;  1U5K A;  1J5E L;  3I4M H;  5C3E G;  1MIU A;  4FXG C;  2IY5 B;  3SE0 A;  2I46 A;  3R3O A;  1YVC A;  3HOX H;  2PNR C;  1Y8O B;  4ODG A;  5FK9 C;  1PH7 A;  4X66 L;  1D1I A;  4N9P A;  5CMD A;  3BG3 A;  2HD3 A;  1X3G A;  3OWE B;  1BF4 A;  2R7D A;  4P71 A;  1TWG B;  4DAM A;  5JJK A;  5IE8 A;  4X3U A;  1U4R A;  3E0J A;  5COR A;  4A93 H;  1V1Q A;  1ASY A;  1VQ8 A;  3M3Y H;  1CUK A;  1F2Z A;  1VQ4 A;  1LT5 D;  2UXC L;  2XN9 C;  5M5Y B;  2GVA A;  4QF4 A;  2MNA A;  4A3M H;  5M3F B;  3RN5 A;  1ONL A;  1RCV D;  3AQQ A;  1EIG A;  1SEB D;  1HRJ A;  4FNF A;  3H3V H;  4KHP L;  4F8M A;  2A69 C;  3B6Y A;  3RD4 A;  2KHS A;  2UXB L;  4RGO S;  3NEM A;  4IO9 A;  1Y8P B;  4A3I H;  4DR4 Q;  5FO8 B;  2V1C C;  1VQL A;  1XNR L;  1SRU A;  4PMC A;  2CW0 D;  2Q8R E;  3I8Z A;  5GAE C;  4NXM Q;  1E2V A;  1SBB B;  1WJJ A;  1A2U A;  1PYB A;  1YBY A;  3NK9 A;  1EFW A;  1WTR A;  1Q81 C;  2E2I H;  3GTG B;  2R7Z G;  1K83 B;  1EIY B;  2MP1 A;  3AB9 A;  1PH4 A;  5FLX E;  4LAA A;  1DCZ A;  3A8K E;  4A3K H;  4OON A;  5IGD A;  2ATW A;  1LT4 D;  2F4I A;  1XPR A;  1SJE D;  1JWM D;  1A0I A;  2EOT A;  4EGV A;  5AJ3 Q;  4H13 C;  2ZM6 L;  3QWN A;  3H15 A;  3NTK A;  1CTM A;  4E6I A;  2FMM A;  4EQN A;  5ELB A;  4A3C G;  1I4R A;  1DJR D;  2L4N A;  3GTK H;  1VQP A;  5GQO A;  1N34 L;  1NUC A;  1G2T A;  5EGT A;  1O7L A;  4NXN L;  2NVY B;  2YTX A;  4LF9 Q;  3MA2 B;  2PO4 A;  4GKK L;  3HG9 A;  4B3T L;  1EWI A;  2I07 B;  5ELF A;  1QZH A;  2H5X A;  4QIW E;  4NDX A;  5C3E B;  5K36 H;  1FGU A;  3J80 L;  2UUA Q;  2K5V A;  1S5B D;  4RG1 A;  5CYU A;  4JI3 L;  5JEA J;  1PFN A;  3HOW G;  5ELE A;  5FKA C;  3T1Y Q;  4HJ8 A;  1SE2 A;  2HT1 A;  1TWH H;  4OWT B;  4RGN A;  1KC8 C;  3FP9 A;  1KQS A;  4ULL A;  3TN2 A;  1BCP B;  3CCV A;  5DAU A;  4JI0 Q;  4A3G G;  5NUC A;  3PO3 G;  3NBI A;  4A3B H;  4IPD A;  2N88 A;  3NQI A;  2KCT A;  3TME A;  5JVG 3;  4X64 L;  1GD7 A;  5C4J B;  1FNV A;  1CKO A;  3BZD B;  5KGU A;  3MFG A;  2KUM A;  2I5M X;  4BXX G;  4IUV A;  2B2V C;  2CCZ A;  3J7A F;  4KK7 A;  1VQJ A;  2M2L A;  4MTN A;  3OHX C;  4DV1 L;  3U4Z A;  2NYZ D;  2OQ0 A;  2ZXR A;  4X62 Q;  4A3E H;  2JK8 A;  2AQ3 B;  4EQ5 A;  1X65 A;  3HOU H;  2Z4I A;  1XXG A;  1MJE A;  4MTK A;  4N8X 1;  3CC2 A;  5LHY 1;  2R7Z B;  4H02 A;  4DPG A;  1W2B A;  2F0M A;  2L5T A;  1UAP A;  2F0S A;  1CQF A;  2F3I A;  4B3R L;  3FVQ A;  4C3H H;  4DNT B;  4RKB A;  3TP6 A;  1LAB A;  4NP5 A;  5DEH A;  4DR5 Q;  5C3W A;  3VR3 A;  4HJ5 A;  4DR3 L;  2HHH L;  3OW2 A;  1KAB A;  2R6G A;  4QCL A;  1WI5 A;  3A7A B;  4OWX B;  1VQN A;  3I4N G;  4DV5 L;  4OO1 I;  5C44 G;  4CKB A;  3I4O A;  3BJU A;  1PRT B;  4HJA A;  4HMI A;  4C56 C;  5IYC H;  3AEV A;  3CU7 A;  2Q2I A;  2EYF A;  3LGJ A;  3G4S A;  2DNC A;  4BY1 H;  3BDL A;  1FNW A;  4X65 L;  2QEX A;  2EXZ A;  4KI0 A;  2MO1 A;  4M8A A;  4ZRZ A;  3OOC A;  4HIK A;  1JT8 A;  4EQP A;  1HR0 L;  1EYA A;  1F2Y A;  2NB0 A;  5T1I A;  3BZK A;  3MXG A;  3V05 A;  3RZO B;  4QUF A;  3GTP H;  4NKL A;  5C6A A;  2E2H B;  1V1O A;  3PUV A;  5JOB A;  1T5E A;  2QIL A;  2AKW B;  3SVM A;  3IRB A;  2ZJP A;  3HOW B;  3UE0 A;  3K59 A;  1Q8K A;  4KY6 A;  3A5U A;  4GKJ Q;  4XT3 B;  5KYI A;  4BY7 G;  1B3Q A;  4A4I A;  4JV5 L;  3GTO H;  1I3Q H;  2A8V A;  1PTO H;  1YNN D;  5EPJ A;  3VYR A;  2EE1 A;  5IWA Q;  2QDL A;  4C2M H;  1SYF A;  3E5S A;  4RH6 A;  2UU9 Q;  2EYL A;  3CCE A;  3OIQ A;  4IUQ A;  5CV7 A;  1CKN A;  2DY8 A;  1LTS D;  2N8N A;  1JQY D;  1H9M A;  1G91 A;  4LW1 A;  1EY0 A;  2OEO A;  3S9W A;  4WFN 3;  4OL7 A;  4WOR A;  4G57 A;  1BKB A;  4KHV A;  4CDF C;  3TQY A;  4BS9 A;  1A63 A;  5JVH 3;  1NY4 A;  1SR3 A;  1VQB A;  2C5C A;  2EPB A;  4P73 A;  2Z9H A;  1SMX A;  3AMU A;  1F9Q A;  1QG7 A;  1TWF B;  2ICI A;  1CK1 A;  1K8O A;  2F1M A;  4LK1 C;  2K04 A;  5M5X B;  1HFN A;  2A6E C;  4V0B A;  4LFB Q;  2ASB A;  3C1F A;  5JEA H;  4PMB A;  2XWB B;  3URY A;  1JE5 A;  2R92 G;  4B3S L;  2G9H D;  5M3M H;  4JG2 A;  4GNX B;  3MZ5 A;  1A3U A;  1O80 A;  1SE3 A;  4ZK9 B;  3K80 C;  1B70 B;  2XRS D;  1CFM A;  1XX8 A;  4JI8 L;  2XNA C;  1KDB A;  1JOK A;  2J7Z A;  4LF5 Q;  2KOL A;  2JE6 I;  2F0I A;  1ILP A;  4DR2 L;  2J4X A;  3SK8 A;  5HGQ A;  5C44 B;  1MSG A;  2PQA A;  3M4Q A;  1XMO Q;  4TVA B;  2BH2 A;  4HJ7 A;  2D2C C;  1B9N A;  2K5N A;  3OTO Q;  2NWG A;  1KAW A;  2SNS A;  1SXT A;  3HKZ E;  1DM0 B;  4L5S A;  4RA8 A;  3PCO B;  1EQQ A;  3RN2 A;  2R61 A;  1SSO A;  1VQD A;  2QF7 A;  1C9O A;  4A3F G;  4OO1 H;  3Q0A A;  2L9H A;  4LUZ A;  3CRL C;  3KLS X;  1HTP A;  4ZQ3 A;  3T13 A;  2D5D A;  4F7X A;  5I9O A;  4BY7 B;  1PLF A;  4C3I G;  5I6W A;  4LF8 Q;  5FLM H;  1H9R A;  1ICF B;  1V1P A;  2SOB A;  3A55 A;  1TWC B;  3ER0 A;  3K6O A;  3K8A A;  1LUZ A;  4CGY B;  3S2H B;  4QL5 A;  5EQ0 A;  3R8B A;  3RZD B;  2WAQ E;  4JI6 L;  4FDB A;  3J81 j;  5E1F A;  4X3K A;  5G3L D;  4OX9 Q;  1ZXT A;  2TMP A;  4DGZ A;  4KV6 A;  1EFI D;  1B3A A;  2LFN A;  2O5J C;  4G7O C;  1HUM A;  1GUO A;  1Z9F A;  5CV5 A;  3S24 A; 
#chains in the Genus database with same CATH homology
 5BN5 A;  1IYU A;  4L8J A;  5AFW A;  1V43 A;  4IQZ A;  2CQA A;  1RTO A;  3FEW X;  1EL0 A;  1PFM A;  4HSV A;  4RAU C;  3ND8 A;  2K1B A;  2HQE A;  5BN4 A;  2VNU D;  3HOY B;  2QCP X;  3H6M A;  4K8I A;  1MBY A;  1Y1W B;  5IGC A;  4J8Q A;  4XYQ A;  1B53 A;  1SYC A;  3WDN A;  3MC0 B;  4K5W A;  3IAY A;  1ZEQ X;  4RGT A;  2B2W A;  4C1N K;  4XYO A;  3GTM B;  5IGE A;  3QOJ A;  3O13 A;  3I4L A;  1T5X D;  1ML0 D;  3D3R A;  1BCP D;  3MEH A;  3DUZ A;  1QNU A;  2KED A;  4OGQ C;  4B08 A;  3H09 A;  2EYJ A;  3MTS A;  3HEJ A;  4A3F B;  3MAQ A;  4KHZ A;  2F03 A;  1S4Z A;  4IUT A;  1Q1B A;  3GQB A;  1GHJ A;  1TKW B;  3WOF A;  1Z6H A;  1B2T A;  1PDQ A;  4KJO A;  1V8Q A;  3ND9 A;  1TY2 A;  1L0X B;  3OPO A;  1D5X C;  4C3I B;  4K2K A;  5LL6 S;  1JC7 A;  1RF2 D;  1A2T A;  1IHZ A;  2Z8L A;  4IZ8 A;  3C2P A;  4MHE A;  2F0P A;  5IGB A;  4HED A;  4I65 A;  3BVM A;  1TS4 A;  2K5W A;  4N9T A;  1Q8I A;  5DNF A;  2K05 A;  5C0X G;  2B2W C;  2A69 D;  2EY5 A;  2B2T A;  1TII D;  1ESR A;  1PFB A;  3MXU A;  3GTQ B;  1WTV A;  3D4W A;  1FNU A;  1EY9 A;  4G4K A;  3QJY A;  4HR7 B;  1OO9 B;  3M7N A;  2RDF A;  3OIP A;  1OXV A;  2B2Y A;  1U4P A;  1VDZ A;  4KTA A;  3HOV B;  5C4Z A;  4Z9C B;  2R93 B;  1EY6 A;  2DN8 A;  3SR1 A;  2H1E A;  1DD2 A;  3C46 A;  3VR4 A;  1CT1 D;  1DOK A;  2NVX B;  1IL8 A;  1MD2 D;  1STA A;  5J1Z A;  4JBW A;  5D65 A;  2B2T C;  2K7V A;  4AYB B;  3D31 A;  5A35 A;  5ELD A;  1AP0 A;  1V1P B;  1DOM A;  2IT1 A;  3SHL A;  1SFO B;  5CR3 A;  4DF7 A;  2PW7 A;  3PO2 B;  3OSO A;  2B2Y C;  1B9M A;  5KNC A;  5C5L A;  2F0J A;  3VA5 A;  1B44 D;  3LWE A;  4L6T B;  2BA1 A;  3V2T A;  1J8I A;  4XTC S;  1D1K A;  3T56 B;  2MUY A;  2E75 C;  1SE4 A;  3FMC A;  1S5F D;  1HA5 A;  5IGG A;  3DWA A;  4LJZ C;  1LTA D;  2XWJ B;  1L0Y B;  3NWT A;  1EIH A;  4DAP A;  5DM7 3;  3J7Y W;  3DHQ A;  4MN3 A;  1LO5 D;  5HUR A;  3Q23 A;  4KN7 C;  2XIW A;  4QIW B;  4KD3 A;  1W6J A;  3U9O A;  3G7L A;  1ZYR C;  2EJG C;  2K33 A;  5CBE E;  4IUN A;  2D62 A;  3M7G A;  3GV6 A;  5K5P A;  5JPM C;  5EKI A;  1RTN A;  1TS2 A;  1GXD C;  3R2I A;  4BA2 I;  1VF5 C;  4JK1 C;  2WAC A;  3N6R A;  4A3J B;  3K5M A;  4C3J B;  1C8C A;  2K03 A;  5D3I B;  3ZYY X;  4QB4 A;  3N52 A;  3TP5 A;  2IX3 A;  2AQ1 B;  4ZLT F;  3IFD A;  2EY6 A;  3A8J E;  5EBC A;  4FF1 A;  4ABN A;  1GOZ A;  5CV9 A;  3EQL C;  2BOS A;  3BYT B;  2PQE A;  1HUN A;  2B2V A;  4IN3 A;  1I6H B;  3CQZ B;  2WP8 J;  3A54 A;  5I2Y A;  3S14 B;  2L11 A;  5C4H A;  4HAE A;  2A68 C;  5TSS A;  1BDO A;  1YNJ C;  1SJH D;  2A73 B;  3MFY A;  2E2D C;  2XSC A;  2EVB A;  2KEC A;  1M4V A;  2A6H C;  2F0V A;  4UAI A;  3J7A V;  1CQV A;  1I6V C;  5EPK A;  1RDP D;  3HOZ B;  1LTR D;  1I4H A;  1WD0 A;  3H3V C;  1D6E C;  3NTI A;  2JA8 B;  5EPL A;  4H44 C;  4IFD J;  4K6D A;  1F2L A;  2LY7 A;  4ILW A;  5I2X A;  2E74 C;  2F0G A;  5IT9 L;  4BA1 I;  1H9S A;  3I72 A;  2G9D A;  1STH A;  1PTO F;  2MGS A;  5JAV A;  2A6E D;  3S1R B;  3SK4 A;  3BVZ A;  4BBS B;  1A15 A;  2EZV A;  1GJX A;  4IFD I;  4ZUJ A;  3HGB A;  1SMY C;  4HSP A;  1I4X A;  4FP5 D;  3BVG A;  3ERO A;  3BYY B;  4ZKC B;  1ROD A;  4CJ0 B;  5C4X B;  4R8N A;  3VR6 A;  3KUP A;  3TDQ A;  1CA6 A;  2JYO A;  3GTJ B;  3GD7 A;  1MSH A;  2KQ3 A;  2E2J B;  4DAY A;  3S17 B;  1QWY A;  4U67 3;  4IUU A;  3VYT A;  4X3S A;  2F0T A;  1WTO A;  1F9S A;  1K8M A;  2EYH A;  1TQO A;  4ME5 A;  1R4Q B;  2F3V A;  5C0X J;  2JEB I;  1QOH A;  1CZG A;  4F88 A;  3L3O C;  2NBF A;  3NUC A;  4K5X A;  3VR5 A;  3HOX B;  1EZ6 A;  2FJ2 A;  1WVL A;  4FF3 A;  3C1E A;  2HCI A;  2F0K A;  4S3S A;  1TU2 B;  1VCI A;  2NVQ B;  4DNR B;  4WJW A;  2L55 A;  3PUX A;  4X3T A;  4KKT A;  1NCV A;  3T51 B;  4QUC A;  4A93 B;  3PIP 3;  3M3Y B;  5I9P A;  5CV8 A;  5C0X I;  1CZW A;  3M85 A;  3OWF A;  1OXU A;  2J0T D;  4A3M B;  4GZY C;  4FF4 A;  1M8A A;  4HN7 A;  3HKZ B;  3FRP B;  3PUZ A;  3TZD A;  1WTP A;  4TKO B;  2FIN B;  4HCE A;  5E4W C;  2K28 A;  4ZKB B;  1IYV A;  4Y7N B;  3PUW A;  2RDG A;  4RKL A;  3GO5 A;  4A3K B;  1KLG D;  3KK7 A;  2HDL A;  2DNE A;  1KTK A;  2FHT A;  3NQT A;  4CBV A;  2VXW A;  3A56 A;  2WAQ B;  5J22 A;  1U4L A;  3CHB D;  3I73 A;  1QCB D;  3VYS A;  1JOR A;  2MPM A;  2A5H A;  4IFD H;  1TS5 A;  2IJ0 A;  2WIN B;  2BE5 C;  2F3W A;  1X32 A;  4RHS A;  2LKV A;  1TR5 A;  3KBG A;  1AZP A;  1RJT A;  4XDX A;  2O5I C;  1PTO C;  3DM1 A;  1DON A;  4TSS A;  5CV6 A;  5E3F A;  3CRK C;  4DXF A;  3TZU A;  3IKJ A;  1FGB D;  1I50 B;  3BS1 A;  2VUM B;  2CHB D;  1Y1V B;  4H7B A;  3IFT A;  1LTB D;  1MGS A;  1X3P A;  1D2B A;  1H9S B;  1TWH B;  3L7Z C;  1BO0 A;  1QJO A;  3QOL A;  2WII B;  3PMF A;  1STY A;  4G7H C;  3DEP A;  1Z7T A;  4A3B B;  4NW2 A;  2JSO A;  3PV0 A;  2SNM A;  1CHQ D;  4FO2 A;  4IUP A;  1GUG A;  3UI2 A;  2EYM A;  1UNS A;  4CKE A;  3QG1 A;  1OXS C;  2KJX A;  3MXN A;  3NPP A;  5IT9 E;  3PUY A;  4ZAI A;  1SYG A;  3AU7 A;  3HOU B;  2F0D A;  2L0C A;  1AW7 A;  3EFX D;  1O7Y A;  1AFP A;  5C0X H;  2NN6 G;  4B9X A;  3GV3 A;  1ILQ A;  4DN4 M;  1SNP A;  3QO2 A;  4DAV A;  3DMU A;  5COY A;  4PV1 C;  2WKC A;  1EWC A;  4HTH A;  1MI2 A;  2H4O A;  4RFB A;  2RBM A;  3SEB A;  1JWU D;  1FYC A;  4XQQ A;  5EKL A;  3S2D B;  1X3Q A;  1JOQ A;  4BY1 B;  1IKM A;  4XT1 B;  3J81 L;  2OT2 A;  1FD7 D;  1LTI D;  1LTT D;  3LX0 A;  2F0H A;  4K5V A;  4NMZ A;  1LLR D;  3TBI B;  3Q22 A;  3MHB A;  1G29 1;  1JCK B;  2MJ8 A;  5I6Y A;  3K5O A;  3GTP B;  5JPN C;  3T4A C;  2WB1 B;  4OO1 G;  3BDO A;  4KKS A;  1SYE A;  1H9J A;  1A3T A;  4KN4 C;  1EOT A;  1ZKO A;  3GTL B;  3FPU B;  1PZJ D;  3BDC A;  1I3Q B;  1U4M A;  1PTO B;  4KKU A;  3I90 A;  1DOL A;  1J9O A;  2EY1 A;  4DK0 A;  5EBD A;  4C2M B;  1STN A;  3TP8 A;  1BNZ A;  1Q3L A;  2VB2 X;  3LNN A;  1PRT F;  1IW7 C;  2PMZ B;  4CJ2 C;  3D8G A;  1IKL A;  1ZYR D;  3I3C A;  2F0E A;  5FOB B;  4CKC A;  1JIC A;  5BN3 A;  1SNM A;  2IX0 A;  4FF2 A;  2K32 A;  4KY7 A;  1E0B A;  1NSN S;  2NUC A;  4EVO A;  1HTL D;  4V19 0;  3P1H A;  1JE4 A;  1SNC A;  4U68 A;  1PXU A;  1D5M C;  1LTG D;  4G7Z C;  1RD9 D;  1II3 A;  2PZT A;  3D4D A;  2PZW A;  3TP7 A;  4LMQ D;  5IIF A;  2F0Q A;  3W3A A;  4C3J G;  3I70 A;  5IOC A;  1KNA A;  4FYD A;  1Q1E A;  2ZXP A;  2A68 D;  3RLF A;  5IOD A;  1LT6 D;  1YNJ D;  3NTH A;  5ELC A;  4F87 A;  4KY5 A;  1JR0 D;  1OXX K;  3X3N A;  3G6J B;  1F9R A;  2K5Q A;  2A6H D;  3WOE A;  1DZ1 A;  1CI3 M;  4O1N A;  1FR3 A;  1A3V A;  5J39 A;  5A2Q L;  1QB5 D;  3HP3 A;  2Y0S B;  3VA7 A;  1RKN A;  1EY5 A;  5M9O A;  3S1M B;  1PZK D;  3A8I E;  5JJZ A;  3PIO 3;  2B39 A;  2E76 C;  3F2U A;  2YYZ A;  5D14 A;  3RUZ A;  5CV4 A;  2YU9 B;  1B50 A;  1C48 A;  3Q6S A;  3S1Q B;  1SMY D;  1QNK A;  1XYI A;  5T1G A;  2Q8I B;  1GHK A;  2V4D A;  1WTW A;  3U9S A;  3HRZ C;  1ICW A;  1QIL A;  2AUJ D;  4CJ1 B;  1HQM C;  1S5D D;  2HUG A;  5LL6 X;  1LV9 A;  3HS0 C;  1R9T B;  2IWH A;  2RA4 A;  4ID6 A;  4J6H A;  4PMW A;  2EJF C;  4KD4 A;  4QMG A;  2M00 A;  2M9V A;  2JXM B;  2EYO A;  3ITP A;  1PRT C;  2X69 A;  2WKD A;  2EDG A;  1SNO A;  1TS3 A;  4CHT B;  2F0L A;  3J81 E;  2NVT B;  4XIG S;  1Y8N B;  2RKS A;  3HZX A;  2NZ1 D;  3DXJ C;  2F0N A;  3K0Y A;  4C1N I;  1ENC A;  2Q8T A;  2R3Z A;  2O2L D;  1B1Z A;  5IGF A;  4K2L A;  2JA7 B;  2JA5 B;  4BBR B;  3OMG A;  2ENB A;  1HQR D;  3NWS A;  5KIX A;  2B63 B;  1EY4 A;  1HXY D;  4A3D B;  2A74 C;  2EYP A;  2RSN A;  2SDF A;  1HPC A;  3W2D A;  1C4Q A;  1JB3 A;  1NR2 A;  1TVX A;  5FO7 B;  3MVV A;  2O4X A;  3D6C A;  4I7Z C;  2JEA I;  2K6A A;  2C9O A;  3S1N B;  5CC4 A;  5EJW A;  2HDM A;  2ZT9 C;  1SYB A;  1VMC A;  2NN6 I;  2KEE A;  3H91 A;  4BWG B;  3S15 B;  3S16 B;  1PMR A;  2KVM A;  1AN8 A;  3QB3 A;  1STB A;  4ZYS A;  3VR2 A;  1GUW A;  1E2Z A;  1O7Z A;  2RSO A;  2BE5 D;  1VMP A;  2OXP A;  2QEJ C;  3EJI A;  3Q24 A;  3DEO A;  4MIU A;  2BDN A;  1DYQ A;  1I4P A;  4RCO A;  1PTO D;  2JA6 B;  2AWN A;  3K5N A;  2WV6 D;  1JOO A;  2BA0 A;  2ICE C;  4DFA A;  4XXE A;  3VYU A;  3JAM L;  3QIA A;  4R9W A;  3K5L A;  2CW0 C;  4RGM A;  2XRQ D;  3TSS A;  3GP7 A;  3SK5 A;  3FKI B;  3NXW A;  1SND A;  2VB3 X;  1O78 A;  3I4M B;  2QKI C;  2AQ2 B;  5K36 G;  2ID0 A;  1JWS D;  1KAA A;  1XTC D;  2AUK A;  2X6L A;  3D4R A;  3MXP A;  1BXT A;  2B2U A;  4YIJ A;  5DM6 3;  2FMC A;  5A2Q E;  2N55 A;  3DWQ A;  4HMJ A;  4UDU C;  1R4P B;  3T16 A;  1EWH A;  3P75 A;  4EQO A;  3C3L A;  4KJN A;  3KLS A;  3MWY W;  3H0G B;  1E2W A;  1KDA A;  2IX1 A;  4A3G B;  3PO3 B;  2SEB D;  5CBA E;  4A3I B;  2XVS A;  2IL8 A;  3ERQ A;  2IPK D;  2E2I B;  4Q5V A;  1WTQ A;  2ZXO A;  2K5D A;  1NR4 A;  2CVR A;  1U9R A;  2LS0 1;  1LAC A;  2B2U C;  4C3H G;  4PNY A;  3CKI B;  2QDB A;  5E4X A;  3EVQ A;  5KEE A;  2NTT A;  3ONA B;  1Q90 A;  2NN6 H;  5F2D A;  4KMU C;  2AWO A;  3GTK B;  1ENA A;  3R2T A;  4OIJ A;  2PPB C;  1BQQ T;  1EEF D;  3I91 A;  1SDF A;  1KDC A;  3L9A X;  3NBH A;  4XQJ A;  4RCN A;  4HCS A;  1EU4 A;  3NE5 B;  3P20 A;  3I4N B;  1HA6 A;  3H94 A;  4RHR A;  4R8I A;  1HCZ A;  3KF8 A;  3NSW A;  3IL8 A;  4DK1 A;  1Z47 A;  2Z1C A;  1KLU D;  5G3L F;  1ENF A;  1EEI D;  1I4Q A;  4P2C B;  2RVL A;  5HGT A;  5M5W B;  2BCO A;  1IW7 D;  3E6Z X;  2PZU A;  2EJM A;  2IW3 A;  3K7A B;  2RDH A;  3D6W A;  2F0O A;  5KND A;  1PYW D;  1G2S A;  2FFK B;  1I4G A;  3SXH A;  2JP1 A;  4RWS C;  3EA6 A;  4OHJ A;  1EU3 A;  2F0W A;  3J80 E;  1XWE A;  4O42 A;  1AEX A;  3K57 A;  3OMC A;  5EKK A;  2BDO A;  2K01 A;  1CHP D;  5I4D A;  1HFG A;  3V96 A;  1A6X A;  3NP8 A;  1B4O A;  2OF1 A;  4A3E B;  1DXM A;  5ISR A;  1GUT A;  4WRD A;  1TY0 A;  2RQX A;  1YNN C;  2PCF B;  2L12 A;  1PZI D;  5JEA G;  1EYC A;  3FDT A;  5C5M A;  3X3M A;  2NTS A;  4C3H B;  4DXG A;  4Q0F A;  4DA2 A;  1BCP F;  1SNQ A;  2B8F A;  4OIK A;  2L1B A;  3P7J A;  1SYD A;  2PW5 A;  4IFD G;  1QE6 A;  5FLX L;  2R92 B;  1LT3 D;  1WCM B;  4K8J A;  4FXD A;  2DY7 A;  1ESF A;  2D9U A;  5KYL A;  1KNE A;  1VF7 A;  3JAM E;  5C3X A;  1UUP A;  1Q12 A;  1S5C D;  2MHV A;  1OXT A;  1S5E D;  2KCC A;  1WTX A;  1BOS A;  1D5Z C;  3GTO B;  1WD1 A;  1G6Z A;  3NHH A;  1EQT A;  4TQU S;  1EY7 A;  1GUN A;  2B8G A;  3DWP A;  1BUV T;  5FO9 B;  1EZ8 A;  3KBX A;  1HHV A;  3LWU A;  3SK6 A;  2F0U A;  3RMH A;  1ET6 A;  1STE A;  1W6K A;  3M4O B;  2GA4 B;  4DU9 A;  4K6L A;  3FPP A;  1CA5 A;  4B9W A;  4FVM A;  1EY8 A;  4FXK C;  3T53 B;  1STG A;  2PYK A;  1ET9 A;  5M3M B;  1BBX C;  1H9K A;  1SAP A;  2F0F A;  3KLR A;  4K14 A;  1AZQ A;  5KRU A;  1PRT D;  1G8Z D;  2KCN A;  1EYD A;  4IUR A;  3SDZ A;  1TT2 A;  2TSS A;  3A7L A;  3M4Y A;  4L63 B;  4PQX A;  4XQN A;  1CM9 A;  2Z4H A;  1F9P A;  2EY2 A;  4IAL A;  3R93 A;  1F77 A;  1NAP A;  5CGK A;  5KNB A;  1F2M A;  1UEA B;  4H0L C;  1TWA B;  4J1M A;  4M1U B;  2KA7 A;  2HCC A;  4ZUI A;  3OW7 A;  2X6G A;  5D3D A;  1GUS A;  2LMC B;  3K58 A;  1EQV A;  1BR9 A;  1RHP A;  1Y69 U;  1BCP C;  4TRD A;  4FXG C;  3SE0 A;  2I46 A;  3R3O A;  2PNR C;  1Y8O B;  4ODG A;  5FK9 C;  1D1I A;  4N9P A;  5CMD A;  3BG3 A;  3OWE B;  1BF4 A;  1TWG B;  4X3U A;  1U4R A;  3E0J A;  5COR A;  1F2Z A;  1LT5 D;  2XN9 C;  5M5Y B;  4QF4 A;  5M3F B;  1ONL A;  1RCV D;  1EIG A;  1SEB D;  1HRJ A;  4FNF A;  4F8M A;  2A69 C;  3RD4 A;  2KHS A;  4RGO S;  1Y8P B;  5FO8 B;  4PMC A;  2CW0 D;  2Q8R E;  3I8Z A;  1E2V A;  1SBB B;  1A2U A;  3NK9 A;  1WTR A;  3GTG B;  1K83 B;  2MP1 A;  3AB9 A;  5FLX E;  4LAA A;  1DCZ A;  3A8K E;  5IGD A;  1LT4 D;  2F4I A;  1SJE D;  1JWM D;  2EOT A;  4EGV A;  4H13 C;  3QWN A;  3NTK A;  1CTM A;  4E6I A;  2FMM A;  4EQN A;  5ELB A;  1I4R A;  1DJR D;  2L4N A;  1NUC A;  1G2T A;  5EGT A;  1O7L A;  2NVY B;  3MA2 B;  2PO4 A;  3HG9 A;  2I07 B;  5ELF A;  4NDX A;  5C3E B;  5K36 H;  3J80 L;  1S5B D;  5CYU A;  5JEA J;  1PFN A;  5ELE A;  5FKA C;  1SE2 A;  4RGN A;  4ULL A;  3TN2 A;  1BCP B;  5DAU A;  5NUC A;  3NBI A;  2N88 A;  3NQI A;  3TME A;  5JVG 3;  5C4J B;  1FNV A;  3BZD B;  5KGU A;  3MFG A;  2KUM A;  4IUV A;  2B2V C;  3J7A F;  4KK7 A;  2M2L A;  3OHX C;  2NYZ D;  2ZXR A;  2AQ3 B;  2Z4I A;  1XXG A;  5LHY 1;  2R7Z B;  2F0M A;  2L5T A;  1UAP A;  2F0S A;  1CQF A;  3FVQ A;  4DNT B;  4RKB A;  3TP6 A;  1LAB A;  4NP5 A;  5DEH A;  5C3W A;  3VR3 A;  1KAB A;  2R6G A;  4QCL A;  3A7A B;  4OO1 I;  4CKB A;  1PRT B;  4HMI A;  4C56 C;  3CU7 A;  2EYF A;  2DNC A;  3BDL A;  1FNW A;  2EXZ A;  4KI0 A;  4M8A A;  4ZRZ A;  3OOC A;  4EQP A;  1EYA A;  1F2Y A;  2NB0 A;  5T1I A;  3MXG A;  3V05 A;  3RZO B;  4QUF A;  4NKL A;  5C6A A;  2E2H B;  1V1O A;  3PUV A;  5JOB A;  1T5E A;  2QIL A;  3SVM A;  3HOW B;  3K59 A;  4KY6 A;  4XT3 B;  5KYI A;  1PTO H;  1YNN D;  5EPJ A;  3VYR A;  2EE1 A;  1SYF A;  3E5S A;  4RH6 A;  2EYL A;  3OIQ A;  4IUQ A;  5CV7 A;  2DY8 A;  1LTS D;  1JQY D;  1H9M A;  1G91 A;  1EY0 A;  2OEO A;  3S9W A;  4WFN 3;  4OL7 A;  4WOR A;  4G57 A;  4KHV A;  4BS9 A;  5JVH 3;  2C5C A;  2EPB A;  3AMU A;  1F9Q A;  1QG7 A;  1TWF B;  2ICI A;  1CK1 A;  1K8O A;  2F1M A;  4LK1 C;  2K04 A;  5M5X B;  1HFN A;  2A6E C;  4V0B A;  3C1F A;  5JEA H;  4PMB A;  2XWB B;  3URY A;  2G9H D;  3MZ5 A;  1A3U A;  1O80 A;  1SE3 A;  4ZK9 B;  2XRS D;  1CFM A;  1XX8 A;  2XNA C;  1KDB A;  1JOK A;  2J7Z A;  2KOL A;  2JE6 I;  2F0I A;  1ILP A;  2J4X A;  3SK8 A;  5C44 B;  1MSG A;  2D2C C;  1B9N A;  2NWG A;  2SNS A;  1SXT A;  1DM0 B;  4RA8 A;  2R61 A;  1SSO A;  2QF7 A;  4OO1 H;  3Q0A A;  2L9H A;  3CRL C;  3KLS X;  1HTP A;  4ZQ3 A;  3T13 A;  2D5D A;  4F7X A;  5I9O A;  4BY7 B;  1PLF A;  4C3I G;  5I6W A;  1H9R A;  1V1P A;  2SOB A;  3A55 A;  1TWC B;  3K6O A;  4CGY B;  3S2H B;  5EQ0 A;  3R8B A;  3RZD B;  5E1F A;  4X3K A;  5G3L D;  1ZXT A;  2TMP A;  4DGZ A;  4KV6 A;  1EFI D;  1B3A A;  2LFN A;  2O5J C;  4G7O C;  1HUM A;  1GUO A;  5CV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...