5IGCA

Crystal structure of staphylococcal nuclease variant delta+phs v23e/v66h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23E/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igcA00
5IGDA 1A3VA 3C1EA 4J1MA 2EY2A 2EYHA 3D6CA 1KABA 2F0MA 5C5MA 1EQVA 3OMGA 4K5WA 4K8IA 4EQNA 1EYCA 1STBA 3T16A 3SK8A 3R3OA 2OXPA 2EYPA 3MVVA 2M00A 4IZ8A 4KHVA 4N9PA 4QMGA 2EY5A 3P1HA 2F0WA 2NUCA 5CV4A 1EY0A 3SK5A 3V2TA 4N9TA 5C4HA 4EQPA 4K6DA 2EY1A 3EROA 1SYDA 2F0SA 5JAVA 5J22A 3EJIA 5F2DA 5K5PA 3BDLA 1JOQA 1SNDA 1SNOA 1EY4A 4K5XA 3NXWA 5DEHA 4E6IA 5CC4A 2F0VA 4HMIA 5CV8A 1F2MA 3TP8A 1EY6A 4ODGA 1SYGA 2F0OA 3ERQA 3SK6A 3T13A 1EZ8A 1A2UA 2PZTA 4J6HA 1NSNS 2RBMA 4S3SA 5CV7A 5HGTA 2F0UA 1JOOA 1SNQA 2EY6A 4K2KA 4MIUA 2F0EA 2F0GA 2EYFA 5CV5A 5E1FA 5C4ZA 2KQ3A 4QB4A 5IGCA 1KDBA 2KHSA 2SNSA 1SNCA 2QDBA 1KDCA 1SYEA 1EYAA 2EYLA 5HURA 2O4XA 4QF4A 1STNA 5KYLA 2EXZA 5KEEA 1STHA 4I65A 5ISRA 4KY6A 5EKLA 3SXHA 1EY5A 4LAAA 3E5SA 5CR3A 2EYMA 2PZWA 5IIFA 2F0NA 4KJOA 4EQOA 3MEHA 3TP6A 1EY9A 1EY7A 4NDXA 4DFAA 4DF7A 1IHZA 2F0HA 3SR1A 2F0IA 3NUCA 3SHLA 3MHBA 1EY8A 3OWFA 4K5VA 2PQEA 4KJNA 2OF1A 3BDCA 4B9WA 2EYJA 1A2TA 3EVQA 4TRDA 4NP5A 5C5LA 4KV6A 1STGA 4WRDA 1TR5A 2F0TA 3HEJA 4ZUJA 3MZ5A 1F2YA 3H6MA 5I9PA 2EYOA 4KTAA 4H7BA 5E3FA 3QB3A 4NKLA 1JORA 4R8NA 2LKVA 2RKSA 5KGUA 3D8GA 1EZ6A 5CGKA 3NK9A 4RKLA 2PW7A 5JOBA 1STYA 2ENBA 5I6YA 2PYKA 3NQTA 3P75A 1NUCA 2PW5A 2SNMA 3TMEA 5DAUA 4K2LA 4KD3A 1F2ZA 4KD4A 1ENAA 2F0JA 2F3WA 3U9OA 3S9WA 3HZXA 1KAAA 3OSOA 1TT2A 5I9OA 5IGFA 1TQOA 2F0FA 5IGEA 1AEXA 1ENCA 1JOKA 4F7XA 3ITPA 2F0DA 3PMFA 1SNMA 4IALA 5IGBA 5KYIA 2F3VA 3C1FA 2F0QA 5J39A 3DMUA 5IODA 3QOLA 4KY7A 2HQEA 3NHHA 5IOCA 5CV6A 4RKBA 4HTHA 3RUZA 2PZUA 1SYCA 1A3UA 4ID6A 4OL7A 1STAA 1A3TA 4F8MA 3D4WA 3MXPA 5EKKA 4K14A 4ZQ3A 4KY5A 4PNYA 1SNPA 2F0PA 5EGTA 2SOBA 3D4DA 3LX0A 3SK4A 5KIXA 4ME5A 4G57A 5NUCA 4DGZA 2F0LA 2RDFA 2WACA 3NP8A 4DU9A 5C6AA 5I6WA 5KRUA 1SYFA 2F0KA 3TP7A 3VA5A 3QOJA 4EVOA 4PMCA 1EYDA 3TP5A 1II3A 4YIJA 1RKNA 5C3WA 4ZUIA 1KDAA 4B9XA 1U9RA 5CV9A 1SYBA 3DHQA 4NMZA 5J1ZA 5C3XA 3OMCA 4WORA 2OEOA 5M9OA 4PMBA 5IGGA 4K8JA 4HMJA 4IUNA
chains in the Genus database with same CATH superfamily
1TS5A 1KABA 4YWMA 1IBKQ 1QJOA 4DKAC 4GOPA 2RVLA 3HKZE 3FHWA 4YY3L 3SK8A 2EIFA 3C3LA 4DAMA 4JI0L 3K5OA 4IZ8A 1T5EA 2XRSD 4H0LC 4POGA 4BBSH 3S2DH 2XVSA 4U673 2Q8RE 1J9OA 3R2IA 4L5SA 1VQ6A 1JT8A 2EY1A 4LNQA 4KKTA 2Z1CA 1E1TA 4GZYC 3J81c 1J8IA 1N34L 1X55A 2WB1E 3CAMA 1EZ8A 5JVH3 1OXTA 5HGTA 3PO2B 2B63G 2OT2A 1OXVA 1EOTA 1KRTA 1SRUA 3T51B 1PRTC 1V43A 4QIWB 3BJUA 4FF2A 1RIPA 3IL8A 3J81L 3E5SA 5ELDA 3MEHA 1L1OB 1G6ZA 1E1OA 2NVYH 1BCPD 2E5LQ 1WVLA 4DR6Q 4DV6Q 3K57A 1Z6HA 5E3FA 1L2FA 1RD9D 3EIVA 4NKLA 5C44G 4RWSC 4DAYB 1VCIA 1W6JA 1XYIA 1PH6A 4LF9Q 2CWAA 1UEBA 2HT1A 5C4XG 3JAMc 1EEFD 4O0AA 3U9OA 5CBEE 2JXMB 2Z4IA 1F9RA 2J0TD 3NWTA 4A3IB 3GP7A 4X6AH 1KC8C 1IL2A 1PH1A 4IFDH 2PPBC 3BS1A 4CGYB 2IT1A 1SR3A 2F3IA 3NQIA 4DR5Q 4A3DB 1FL0A 1X9NA 4XXEA 2HQLA 5JEAJ 1CKMA 3NBHA 1KRSA 3MXGA 4MN3A 1IW7D 5IYDH 2H4OA 1V1OA 2B8GA 2BCOA 2Z0SA 3JAMi 3EA6A 3DHQA 3GTPB 1EU4A 2WIIB 4PMBA 1TWHB 1Q3LA 4HR7B 2KOLA 1A62A 5IGDA 3C1EA 4J1MA 2O5JC 4N8X1 4R4OA 2NN6G 2EYHA 2MP1A 3TZUA 4KKUA 5C5MA 4EGVA 1TXYA 3HOWH 2R92G 1PRTB 4WJ4A 4CKEA 1M4VA 3MAQA 1CKNA 2MPMA 5CV4A 1DONA 4BBSB 1QVGA 1MJCA 3S2DB 4C3HH 5G3LF 2K04A 3CCSA 1YJNA 4HJAA 2EJMA 3QO2A 1G2TA 1SNOA 4IUVA 4DK0A 5KNDA 3MXNB 3KBXA 1YEZA 2UU9Q 3W1BA 4S3SA 5CV7A 1SNQA 2EYFA 1JJ2A 3KYHC 1LT6D 5IT9c 1MHWC 1SYEA 2XIWA 3ONAB 4A93H 2O4XA 1UEAB 4OX9L 1A63A 2UUCQ 3AB9A 3U58A 1B9MA 2E2IH 3OTOL 4DXFA 1X54A 2EYMA 4U68A 2HDLA 5J3BA 2AWNA 2F0HA 4P74A 4QL5A 1B50A 1EY8A 3PUZA 1BOSA 5EKIA 1IBMQ 2KJXA 3UDGA 4NP5A 2NVYB 1H9KA 1YJ9A 2FHTA 3RD4A 4MNOA 1XWEA 4B3SQ 1RDPD 2JP1A 4QY7A 5FLXc 3S15H 1SXTA 4BA1I 4LF8Q 2O2LD 4LF7L 2J7ZA 4YHHL 2K5NA 4OWTB 2F0DA 1Z7TA 3HS0C 1XXGA 4UPAA 2L0CA 1JMCA 2XWJB 2UXBL 3M4PA 3K5MA 2JA5H 3M7GA 4G7HC 1CSQA 1VQKA 3W1GA 2CQAA 3CXCA 3N6RA 4B3ML 1TWCB 5JPMC 4BBRG 2QDLA 4RA8A 4PQXA 4DU9A 2CH4A 1NMGA 2GA4B 2HD3A 3A8JE 1SFOB 3U50C 1GOZA 4CDDC 1I94L 4UHVA 2N55A 1YHQA 1K9MC 4BY1G 1SMXA 3DUZA 4X66L 3A7LA 2O5IC 3D4RA 4MZ9A 2UUBQ 1NTGA 4K8IA 1YNJD 4K5WA 1JB7A 3HOWB 1HR0Q 1B53A 2XNAC 3U4ZA 4DV4Q 4N9PA 2HCCA 1IBLQ 3SK5A 4CDFC 1BXTA 3EROA 4A3MH 5J22A 5K5PA 4C3HB 1HZBA 3H94A 1YNXA 1WCMG 1H9SA 4RHSA 1J5EQ 1WOCA 1UAPA 2JQOA 1LUZA 2ICEC 4A3EH 1VQ8A 1DOKA 3NTIA 2B2TC 2R61A 2QDBA 4AYBB 1K0SA 3S1MB 4QF4A 4A93B 2OTJA 1JQYD 3D0FA 2YYZA 4ZAIA 1RHPA 1UE5A 4A3GH 2QW7A 2E2IB 4DR4L 3GO5A 3CRKC 2ZXRA 2F0IA 2Z4HA 4XYQA 1IKLA 5JPNC 4HJ5A 2VQEL 1STGA 4JI2Q 3ICEA 4JV5Q 3HEJA 4RFBA 1DYQA 4IUTA 4X65Q 4FF3A 4FXKC 1WTVA 4NXNL 4JI5L 1EOVA 1EZ6A 5ELBA 2XWBB 1H95A 4DR7L 4DNTB 2NVTH 1NBWA 2L4NA 3S15B 1H9JA 3HG9A 1GVPA 3I8ZA 5C3EG 2K7VA 5CORA 5C0XG 1O78A 5DLQE 2KBNA 1AZQA 4ZRZA 4HTHA 2PZUA 1X3GA 1A15A 1PYWD 1B8AA 4OL7A 1D5ZC 3WOFA 1B70B 1S72A 4IFDI 1IYUA 2HHHQ 4FP5D 2JA5B 4ZQ3A 1SROA 5IP9H 1PH5A 4HJ8A 2PI2A 3EN2A 4Z9CB 4KN4C 1C9OA 4KHPL 4NMZA 1QVCA 4RGTA 4V0BA 2NZ1D 1R9TH 1ASZA 2F0MA 4A3LH 1DOMA 3OMGA 1RJTA 5HY6A 4DR3Q 4NXML 2VQFL 1VS0A 2YU9B 3OHXC 4LF4L 1PRTD 1XNRQ 4K0KQ 1Y69U 2NWGA 3P1HA 3FKIH 3T53B 2IL8A 3V2TA 2NB0A 3BZCA 2AWOA 5ELNA 2DGYA 4GLVB 1HNZQ 3RMHA 2WAQG 2SEBD 3KF8A 2L12A 3W5OA 3J81j 4A3CG 4FXDA 2R3ZA 3NXWA 1ZKOA 4BWGB 3TP8A 4LUOA 1W6KA 1NY4A 5I9PA 1RODA 2E75C 3GDEA 4Y7NH 2VUMG 1XMQQ 4A3EB 5D14A 2J4XA 1QILA 2EXZA 1B2TA 3TDQA 4GN4B 1D6EC 5EKLA 1IZ6A 1W3SA 3M3YH 4LAAA 1VQOA 4ZKCB 1X6OA 3I4MH 2H5XA 1IHZA 4A3GB 3NUCA 2EQSA 3I4NH 5KNCA 2ID0A 2Z6KC 2QA4A 4RHRA 4A75A 4X3SA 1FJGL 3DWPA 5AJ3Q 1ENFA 4DV0Q 5CGKA 5M3MB 3K58A 5CYUA 3A7AB 4K2LA 3FEWX 4BXXH 2NVTB 3H3VH 1YZ6A 4FNFA 4C2MB 5GADC 2QKIC 5I4DA 3X3MA 3QG1A 2PI2E 2B2YA 1H9RA 1MD2D 2UXDQ 4DUYL 5EBDA 3HOXH 5T1IA 3I7FA 4DR2Q 4JBKA 4R8IA 4KI0A 3GTGH 1KNAA 4B3TL 4QUFA 2N3SA 4KY5A 2I07B 5EGTA 4A3KH 2F0LA 3HKZG 5M5YH 2QEJC 4EVOA 1LYLA 4OIKA 3VR6A 2ZJRA 4ZYSA 4EQ5A 3BYTB 3M7NA 3H0GH 2Q8IB 3H3VC 5FLMG 1V8QA 1SLJA 4HIOA 2K03A 1ASYA 3IFTA 1A3VA 2ALYB 4A3FB 2RQXA 3KF6B 3PF5A 1R9TB 2CFMA 1R4QB 1OXXK 5A2QE 3GTQH 4IOAA 3R3OA 5FJ8H 4QMGA 1PH4A 1NNXA 2LSSA 4P2CB 1F9PA 1G8ZD 4C3JG 1VQLA 2AQ2B 1PH8A 4JI6L 4IQZA 3FKIB 4IUUA 4K6DA 2JJQA 5E7NA 3MEFA 4AH6A 1VMPA 2A73B 5BR8L 3AQQA 4JI4Q 3TZDA 4M8AA 5EJWA 3BYYB 1DCZA 2IW3A 4K6LA 1EY6A 2EJFC 1PH2A 3DM1A 3SK6A 3SVMA 2CHBD 3HOYH 1N33Q 1ZXTA 1U5KA 1B4OA 2CKZB 4OO1H 2Q2IA 2RDHA 3G4SA 2Z8LA 2NYZD 4O2DA 3J7ZC 5ISRA 1D1KA 1Q7YC 3HGBA 3RN5A 4IPGA 2AQ1B 4X62Q 2K01A 3M3YB 2F0NA 4Y52H 3LGJA 3DM3A 2KCTA 4UY8C 1SBBB 1UUPA 3I4MB 2A68C 3DLLA 2PQEA 2OWOA 2FFKB 2NTTA 4TKOB 3E9IA 1LTGD 1ILQA 2E5LL 1UWVA 1Y8OB 4QGUA 4GN5A 3CCLA 2CQOA 3I4NB 4DR6L 2UXCQ 1MBYA 3MFGA 2IX1A 1Y1WH 3B6YA 2EVBA 3NQTA 2PW5A 4P71A 2VNUD 3KK7A 2WAQE 2F0JA 2EOTA 3OSOA 2D2CC 3VR4A 1Y1WG 3HOUG 1RTNA 1L0WA 5L37A 1AEXA 2D9UA 3ND8A 4JCVE 5GQOA 1ET9A 3RUZA 1CZGA 4OWXB 3HOXB 3TREA 1BVSA 2X6GA 3A5UA 4DV7L 4DR5L 3GTGB 3LWUA 3Q23A 1VQCA 2OQ0A 1PTOF 3RZDH 3V96A 5I6WA 1ICWA 1OO9B 2C35B 1SYFA 1Z9FA 4A3KB 3QOJA 1PH3A 1I4XA 3U4VA 5JJIA 2DY7A 1F2LA 3H0GB 4K8JA 4HMJA 5IY0A 1H9MA 1U0LA 2WB1B 2KEEA 1EYGA 5IYBH 1EUJA 1WI5A 2VB2X 3PV0A 3BVZA 1GUNA 4B08A 4X3KA 4DAVA 2ZXPA 3PIOA 4DN4M 1Y8PB 1O7LA 3GD7A 3RLFA 3GTQB 1MSHA 5LHY1 3L7ZC 2Z9HA 2BA0A 1BBWA 4LFBL 1YITA 4JI8Q 4ULLA 1TS2A 3PQIA 4MTKA 5EAYA 1WFQA 1QVFA 2BDNA 4L63B 4BA2I 4JI1Q 2IPKD 4DV3Q 3J7YW 4TQUS 4C3IB 5CV8A 1ESFA 1XNQL 1MGSA 5EPKA 1AFPA 1GJXA 1S5DD 2MO1A 2UU9L 3F1ZA 2MUYA 2PQAB 4I7AA 3HOYB 5C4ZA 2R6GA 3CC4A 3F2CA 3OW7A 1EU3A 1K73C 1TWGH 3FDTA 2B29A 3ZYYX 1XPOA 2UUCL 1BF4A 5IIFA 5C4JB 1K28A 1EFID 4JI3Q 3J80c 3HP3A 2UUAL 5DNFA 2B63H 3PUXA 2LXJA 1TIID 4DUZQ 3CPFA 4KV6A 4WJ3M 2WKDA 1HXYD 2F0TA 4FXGC 2EJGC 4PZ8A 3K59A 4N8FA 1EIFA 1VQ9A 5JOBA 2K5DA 3J80L 4X3UA 4KD3A 1F2ZA 4HCEA 4KD4A 3S9WA 4DNRB 5I9OA 3KJOA 1EEID 1EQQA 2E2DC 1UE1A 4RGOS 1WD1A 3AYHB 3H3VI 5C44H 3S2HH 3DWAA 1VQNA 4RKBA 1B44D 3VR5A 3J81i 4G4KA 1QZHA 4JOIC 5C4XH 4A3BG 4JVZA 3CCJA 2OCEA 2WKCA 4OEMB 4ZCKA 1I6HH 1GHKA 1GM5A 4JI7L 1BCPF 1PZJD 2B39A 1KHIA 3NP8A 2JEBI 4P75A 3RZDB 2JA7G 3EQLC 3JAME 5CBAE 1EIHA 1CI3M 2A74C 1MIUA 3KDFA 1SYBA 5M5XH 1XX8A 3T1YQ 1B3AA 4CDCC 1Q82C 2L5TA 1F9SA 1A0IA 1OTCA 2K14A 4YCUA 1KAWA 3T16A 3CCMA 4LF5L 3HKSA 3MVVA 2M00A 4HSPA 4DK1A 1LT3D 4HCSA 3FMCA 3NTKA 4IOCA 2NUCA 1JWSD 1IBLL 5K36G 4XQJA 1LTSD 1Y1VG 4FO2A 3EJIA 2RCNA 1G91A 2NN6H 3BVGA 1ML0D 4HMIA 1VQJA 2R92H 5D65A 3UDIA 4J6HA 4POFA 4R4CA 2FJ2A 2F0UA 1WJJA 2ZM6Q 3UE1A 1C0AA 2SNSA 4I7ZC 1VQAA 4QIWE 1EYAA 1TU2B 5IYCG 4P72A 5E4XA 2RCFA 3TBIB 2NVXH 4KY6A 1Q1EA 4OO1I 4H13C 1TWGB 2PZWA 4LWCA 1ZEQX 1SE3A 4KN7C 1STEA 2KEDA 2A6HC 3G71A 4KJNA 1HQMC 4GS3A 2B63B 4L8JA 1TWFH 1GHJA 3I90A 1TR5A 2LMCB 4B3RQ 1HZ9A 4APVA 1IYVA 4KTAA 3I55A 4LFCL 1G2SA 1QWYA 4X65L 3L3OC 1BQQT 2IX0A 1JR0D 5IT9E 2PW7A 3K0XA 2PYKA 3P75A 2JA9A 2OQKA 2L55A 4X3TA 2QGQA 1ENAA 1HTLD 1Y8NB 4HN7A 2KHIA 3MC0B 1JOKA 2BOSA 5IGBA 2FMCA 3TS0A 2JA6G 2SDFA 5IODA 1ONLA 3S1QH 5FK9C 1HNXL 1X3EA 5M5WH 3S2HB 2DY8A 5LMNW 3J7AV 3RZOH 4JI0Q 4JBJA 1N36Q 3K7UC 5C4XB 2AHOB 5FLXE 1IXRA 3OPOA 4DV2L 1NAPA 1V9PA 5C0XJ 1GUWA 4IO9A 3SDZA 1II3A 1TVXA 3I73A 3M9BA 2NTSA 5FOBB 1N34Q 2D62A 1KQSA 2I5HA 3OMCA 2LS01 5M5XB 1S3OA 2B2UC 4BBRH 2E2JH 1DJRD 3P20A 4QQBX 4LFAL 3T56B 3G7LA 2OXPA 4KHVA 2EY5A 1XNRL 1KXLA 4BY1H 1PTOH 5BN5A 2XRQD 3FRPB 2V4DA 4BS9A 2X69A 4HEDA 1HNZL 4JBWA 2A68D 2KCNA 5EPJA 1K8AC 1NE3A 2R92B 1NSNS 1XPRA 3NEMA 5E1FA 2EY6A 1BBXC 3P7JA 4QB4A 1OXUA 2CCZA 3AU7A 1KDCA 4PZ6A 1STNA 4IPCA 2KCMA 1WCMH 3E3XA 4CKBA 2QEXA 4C1NK 2NVXB 2Q2UA 5JEAG 1ET6A 4IPDA 2R93H 1G6PA 1TY2A 1MKHA 3A56A 3H91A 1MSGA 1PTOC 2DNEA 5TSSA 3CCQA 3VYUA 1WD0A 4ME3A 1Q81C 1I50H 1YHBA 2R93G 3T1HL 2JA8G 1KLUD 2Y0SB 3ZJYC 2LKVA 2C5CA 4YWLA 1HTPA 4DAPA 2KHJA 4DV0L 3E0EA 2ZTEA 4OXPA 2VZAA 4RG1A 1R4PB 1Q1BA 4UP9A 1KAAA 1QNUA 3KBGA 3PMFA 3GTLH 5KYIA 2F3VA 2F0QA 1EWHA 3ULLA 1XTDA 1BUVT 4HJ7A 4RAUC 1VQ5A 1H9SB 3S1QB 1VDZA 3QJYA 3AEVA 5M5WB 2CWPA 4DR2L 2ES2A 1LT5D 1V1QA 4NW2A 3RZOB 1PDQA 3S16H 5BN4A 4HIKA 2AMCB 2BE5C 1JICA 2YTYA 3PUYA 5C3EH 4DR1L 5C0XH 1S5FD 2E8GA 1Q8IA 3TP7A 4NPSA 5DM63 5GAEC 4ZUIA 2DUDA 4R4QA 3VDYA 5ELCA 3E9HA 2OEOA 5J39A 3HOVG 2K33A 3GTOH 2EY2A 4FF1A 4JBMA 4OX9Q 3K6OA 4BBRB 2K52A 5IE8A 1GO3E 2EYPA 4LJZC 3OTOQ 2IHEA 5ELFA 5C4HA 5CMDA 3NTHA 5JJZA 3TEHB 2JN4A 2NVQH 1TWAH 5ELOA 3S17H 4GKJQ 1PTOB 3F2UA 2B2TA 2MHVA 1EY4A 2GVBA 4E6IA 1HRJA 4A3JG 4UP7A 4JI4L 3IKJA 1UNSA 3D3RA 3ND9A 1YBYA 2F0OA 5M3FG 1EWCA 1PFBA 2NN6I 1LACA 2PZTA 1PZKD 1EFWA 5IGFA 2K5HA 3BZDB 1CHPD 4TVAB 3E6ZX 3G48A 3JC66 3R8BA 4LF7Q 4JPBW 1STHA 4A3CH 4DV1L 1BO0A 1WCMB 3GQBA 2M9VA 4CJ1B 2IHFA 1DZ1A 1EY9A 4JYAL 4DV5L 1VQBA 3CKIB 2UXBQ 4PG3A 1U4LA 2YTXA 4A3MB 3S14H 5IP7G 2VUMH 1PRTF 3BDCA 1HJPA 3Q8DA 3RLNA 1I4HA 2RSOA 1SE2A 1B7YB 1DOLA 1XTCD 3H6MA 3G6EA 1VQPA 2A1AA 1SE4A 3CHBD 4B3MQ 4A3FG 2UXCL 1RL2A 1T9HA 2KVMA 1XMOL 3RLOA 5HGQA 4H02A 5LMUQ 1CTMA 1E2ZA 2L9HA 1M8AA 3KFUA 3PUVA 1AE3A 1JB3A 2X6LA 1NR2A 1T5XD 1I94Q 1WTWA 1K3RA 4UAIA 5LL6S 1WTQA 4F7XA 4X66Q 2JK8A 3ITPA 2JYOA 3VYSA 3A8IE 3DMUA 2HQEA 5COYA 5LMNL 1K8GA 2XN9C 3KF8B 4AQYL 3DWQA 4DK6C 3D4WA 4RH6A 2F0PA 1TS3A 3PO3G 4JK1C 2L1BA 3S16B 3Q6SA 4LUZA 2OTLA 5C3EB 1K83H 3TP5A 1DD2A 2K50A 1KDAA 2E2HH 1HNWL 5J1ZA 2BA1A 3ER0A 5LL6X 2I5LX 1X32A 5BN3A 1I4RA 4BY7G 1PV4A 3KLWA 2RHQB 1D8LA 1O7ZA 1J6QA 1AH9A 1VQ4A 1M90C 2GN5A 1FGBD 3MXUA 3Q0AA 5D3IB 4IJHA 1E2VA 1JWUD 1N9WA 3CU7A 1IYJB 1K8MA 4MHEA 1QCBD 4DA2A 4DR4Q 5FLMH 1MJEA 5F2DA 5DEHA 1PVOA 3GTKH 3HRZC 5FO8B 1D5XC 2A6HD 1ZYRC 1F2MA 4XIGS 1SYGA 4IURA 1U4RA 3ERSX 1CFMA 2XGTA 4GNXA 4NXNQ 3HOZG 4K2KA 5CC4A 1LTLA 4JI5Q 1QUQB 2F0EA 4C3JH 1SSOA 4DR7Q 1KDBA 1IBKL 4M1UB 1QNKA 5KEEA 3A55A 4I65A 4IN3A 1SE8A 2Z6KA 1UE6A 1X3FA 1FNVA 4EQOA 1PHJA 1WTXA 2B2WC 3AFQA 4RCNA 4JI3L 3SHLA 3HFZB 4K5VA 2OF1A 1CA5A 2EYJA 4C56C 2VUMB 4WRDA 3I2ZA 1FR3A 1F2YA 1V1PA 2DNCA 1TY0A 5FKAC 3NK9A 5D3DA 4Y7NB 2SNMA 1GKHA 3CF5A 5FO7B 4KHPQ 5I2XA 1WTRA 3UI2A 3AMUA 3FP9A 5IGEA 5ELEA 5A2QL 1W2BA 1BKBA 4NB3A 1Q86C 3K8AA 4EX5A 2QILA 4NXMQ 2R7ZG 4LF4Q 4F8MA 4DV6L 1P8LA 2VS1A 2H1EA 1LLRD 3SK4A 3HOUH 4CJ2C 2RDFA 2WACA 1D7QA 3NPPA 4A76A 1YNNC 1KLGD 4LF9L 4P73A 2F4VQ 1KTKA 3L2PA 5EPLA 4B9XA 5C0XI 3S1NH 2E2HB 1L0XB 2KECA 2PO4A 3T1YL 3LNNA 4PV1C 5GAGC 4F87A 1LTBD 3BVMA 3FVQA 3CW2C 3HKZB 3W2DA 4X64Q 3PO2G 2K5VA 2Q2HA 4L5QA 3F8TA 3WOEA 1C4QA 4EQPA 3LWEA 2LXKA 4GOPC 1BR9A 5M5YB 2ASBA 1NMFA 1PTOD 1SNDA 3STBC 4HJ9A 3CRLC 3GTKB 3SEBA 1AN8A 2EE1A 4ODGA 3PF4A 2DJGC 2ZJPA 4RGMA 3R93A 1M1KC 1AW7A 1NCVA 1G291 4GKKQ 3CQZH 2A8VA 2EYLA 3M4QA 3J7AF 2AQ3B 4GLAC 2IY5B 4IPHA 2A5HA 1KD1C 2AUKA 1VF7A 3A74A 1DM0B 3PIPA 4CJ0B 4NDXA 1HCZA 3E0JA 2PQAA 2A6EC 3GV3A 1CZWA 2ZXOA 3T4AC 4TRDA 1S5CD 4OGQC 5C5LA 4A3IG 4Q0FA 1I5FA 3I4LA 3C2PA 3MWYW 1IL8A 4V190 4J8QA 4R8NA 1QG7A 3VYRA 2ENBA 1FGUA 3RR5A 3J7A5 1TKWB 4A3DG 2BE5D 4IUQA 4XT3B 3BG3A 3BU2A 3GTPH 1RTOA 2PMZE 3TRZA 1ILPA 4OONA 3C1FA 1WTHA 1BDOA 3J81E 3CC2A 1P16A 1A3UA 1IBML 3ULPA 1LV9A 1VQHA 4OELB 4R4TA 3QR8A 5EKKA 4K14A 4WFN3 1N36L 4B3SL 4JI6Q 1L1OA 5NUCA 4R4IA 4GOPB 1Y1WB 3HOUB 2F0KA 3VA5A 5BR8Q 4HSVA 1RKNA 3Q24A 4LF8L 2WV6D 4BBSG 1Y14B 3PUWA 2DN8A 1HUNA 2NZOA 2E76C 4WORA 3J80i 5IGGA 4A3BH 4IUNA 1N32Q 3S1NB 4DAYA 2HUGA 2VW9A 1E24A 3D6CA 4CHTB 5T1GA 4OWWB 2JA7H 1STBA 1VQIA 2JEAI 1SEBD 1TS4A 2F0WA 3EBEA 4LF6Q 2K32A 3I4OA 2B2VA 3A54A 1S4ZA 3K7AH 1VQ7A 1YHAA 1JJGA 2EXDA 2RSNA 2ZJQA 3S1RH 3EFXD 1GUGA 4AIMA 3IAYA 1HQRD 5CV5A 2KQ3A 3TS2A 5K36H 2UUBL 1LTAD 3CQZB 2G5DA 5HURA 1Y1VH 4ALPA 2JSOA 2L15A 1HR0L 4DV4L 4XDXA 2AKWB 3GV6A 1PZID 3NBIA 4YCWA 1EIYB 4KJOA 4C1NI 1RF2D 4R1JA 4DFAA 3UDFA 3KJPA 4B9WA 3RNUA 1E7ZA 1J5EL 3KDFB 4XTCS 5IYCH 1HFGA 1LTTD 4DV7Q 1GXDC 5I2YA 2K5QA 5FO9B 4L5TA 3QB3A 3JAML 1C8CA 4KLKA 1TWCH 5KGUA 4IFDG 2K28A 2MFIA 5JJLA 3I72A 3GTJH 1SFOH 2A69C 1LT4D 1AE2A 3NSWA 5IWAQ 5DAUA 3MXNA 2F3WA 2CH4W 3R2TA 4JOIA 1QE6A 3NBHB 2D0PA 5H1SE 2KENA 2K75A 1GUOA 4H44C 1E0BA 5IYDG 1CQVA 4JG2A 3OW2A 3H15A 5G3LD 4A4IA 1JE4A 2CW0C 4JI2L 4JV5L 1LO5D 1D1IA 3QIAA 2HDMA 2I0QA 2MQHA 2SOBA 4LFBQ 1PYSB 1AP0A 3HOWG 3F2DA 2JA6H 2KUMA 1WTPA 5C3WA 2HIXA 3NELA 2WP8J 1U9RA 1CKNB 1XNQQ 3BZKA 3V05A 3DXJC 4C3HG 1ZYRD 2ZT9C 1O7YA 1GD7A 4A3BB 4XQNA 4HIMA 5C44B 4L6TB 4YY3Q 3VYTA 1E22A 3S1MH 3UDXA 4QCLA 1EYCA 2LY7A 4DNIA 2MNAA 2JA7B 2Y0SG 2YV5A 2HCIA 4FVMA 2HHHL 1Z47A 1I6HB 4AYBG 3L9AX 1KIXA 3M4OH 1Q12A 4A93G 2UUAQ 2DJFC 2F0SA 1SMYC 4Q5VA 1HFNA 1I4QA 3A5ZB 3K7AB 4GKJL 1I3QH 1EQRA 1VQMA 5IT9L 1KL9A 1D2BA 1FYCA 2D5DA 4FF4A 3CCVA 3S1RB 1BNZA 1PLFA 1YVCA 4DR3L 1SJED 1Y1VB 5DM73 4K0KL 1EY5A 3MA2B 1VQDA 3I70A 2M2LA 2ZTDA 1UE7A 3OWFA 1I6VC 4O1NA 4JW0A 1A2TA 5FLXL 3C46A 4RMFA 4QUCA 3W3AA 4TSSA 3OIQA 3K0YA 1JORA 1XJVA 2CVRA 2EPBA 4JI7Q 1JJCB 5JEAH 1XMQL 2RHSB 1NUCA 2LFNA 3TMEA 5LMUL 1N8RC 2JA5G 3KUPA 1F77A 1U4MA 2IJ0A 2BDOA 3GTJB 1YNND 3ULJA 3A8KE 5E4WC 1SNMA 1OXSC 2JA8H 1PYBA 3H09A 3NHHA 5IOCA 5CV6A 3K5LA 4XT1B 2YU9H 3RN2A 3WDNA 4LF5Q 3O13A 1TWFB 2G9HD 2RF4A 1SJHD 1HPCA 1VMCA 3D4DA 5AJ3L 1JC7A 1YJWA 3TSSA 4ME5A 3OYYA 4DGZA 2K6AA 2B2UA 3N52A 2JA6B 1B1ZA 1PFNA 1B9NA 2B3GA 3SGIA 3TN2A 2Q2TA 1E2WA 2KA7A 3FPUB 4L5RC 3STBD 1C48A 5M9OA 4RCOA 3S24A 3BDOA 2IWHA 4A3MG 2UXDL 2QCPX 3URYA 1YIJA 1EQVA 1SN8A 1VQFA 1K8OA 3CD6A 2N78A 2RDGA 4LUVA 1CQFA 2EDGA 4A3EG 3KLSA 3Q22A 1Q46A 1SYDA 3HOVH 3M4OB 1PH9A 3SE0A 2A6ED 2I5MX 2F0VA 1I3QB 4A3GG 3K80C 1NJIC 4LFCQ 1A2UA 1XPUA 1VQGA 3UE0A 4GN3B 2F0GA 5M3MH 4FYDA 5IGCA 1U4PA 2KHSA 1HA6A 1S40A 2E2JB 2BH8A 2D0OA 1LTRD 4DPGA 4RGNA 3I91A 4C2MH 3OWEB 4F88A 1A6XA 3SXHA 4A3JH 5M3MG 3M4YA 5M3FH 1EY7A 4BY1B 3U9SA 2I46A 3TQYA 1HNXQ 4DK3C 3EVQA 3D31A 4G7OC 1FD7D 3MFYA 2Y0SE 4OHJA 4AYBE 3D8GA 1N33L 4DV2Q 1STYA 2Q8TA 3OIPA 1SDFA 1CKOA 2R7DA 5IP7H 4YHHQ 3HZXA 5IP9G 4X62L 1ENCA 1G51A 1PH7A 2F03A 1ICFB 2R93B 1E3PA 3CP0A 4A3FH 1BCPC 2VY3A 2JA8B 4IUPA 3KLRA 1SYCA 4LFAQ 4YCVA 4ID6A 2R7FA 4UP8A 1A3TA 1X65A 1I50B 2B2YC 1CHQD 3NE5B 4PNYA 2WINB 1CUKA 1WTOA 4A3LG 1EL0A 1BBUA 2PNRC 5KRUA 1EYDA 4ZKBB 4KMUC 2F4VL 3K5NA 4KHZA 1CSPA 3FKIG 1FVIA 1S5BD 2C9OA 2ATWA 3IRBA 3GTLB 3PO3H 2F1MA 3KLSX 3I56A 2NZHA 2G9DA 3K81C 3PIO3 2ZTCA 4X64L 3A0JA 4GNXC 1EY0A 2NBFA 1IW7C 1FNWA 5JAVA 4BY7H 3PIP3 3BDLA 4CBVA 1JWMD 1GUTA 3HOVB 2ICIA 1WYDA 4K5XA 3F2BA 3PCOB 3ERQA 3T13A 3T1HQ 1S5ED 3I4MG 3L0OA 1JOOA 4QJFA 4MIUA 3GTOB 4OIJA 2K1BA 4GKKL 1K0RA 2XTIA 2VL6A 2A19A 1SNCA 3I4NG 4PZ7A 2A69D 2KCCA 1RCVD 1PFMA 1O80A 4A3JB 3TP6A 4XYOA 4JI8L 4DF7A 1TWAB 4IJLA 3HOZH 2NVQB 5M3FB 1BCPB 1PXUA 1JE5A 1CM9A 1QUQA 3KF6A 3GTMH 1EQTA 2VQEQ 4BXXG 3S17B 4JI1L 2V1CC 1HA5A 4DV3L 1PA6A 1Q90A 2JE6I 2TMPA 3M85A 1YI2A 3CCUA 2CW0D 1CA6A 1QZGA 3HOXG 1QB5D 3CCRA 4DR1Q 5I6YA 3NENA 2FXQA 3VR2A 1B3QA 3QWNA 4J15A 3VR3A 1X3PA 2QF7A 1LM0A 2WAQB 1L0YB 1HZCA 4ABNA 1TT2A 5GAHC 1HR0W 3X3NA 1EIGA 1AZPA 4A3KG 3CC7A 2PNHA 3QOLA 2IX3A 3IFDA 1HUMA 3OOCA 3S14B 4HAEA 3H0GG 4DUZL 3CCEA 2WB1G 3CMEA 4HIDA 1NR4A 3G6JB 4MTNA 1I4PA 2VB3X 3LX0A 5KIXA 4GNXB 2E74C 1SAPA 5C6AA 4KKSA 5FJ8G 1SMYD 2HIVA 4C3IH 2XSCA 5CV9A 2L11A 1X3QA 2R7ZH 1FNUA 2K05A 1N32L 4C3IG 2VQFQ 1JCKB 5JVG3 4PMWA 1HZAA 4EQNA 3PO3B 1DXMA 2BH2A 1IKMA 3PGZA 4R9WA 4DV1Q 3HOYG 1LABA 4CKCA 5C4JH 1V1PB 2FINB 3I3CA 4N9TA 1EWIA 2TSSA 4JYAQ 4DV5Q 2F4IA 3KOJA 4OO1G 4LF6L 2N8NA 4GLXA 1JOQA 4BY7B 1GUSA 2MJ8A 1K83B 2P5ZX 2MO0A 1ESRA 5EQ0A 2Z6BA 4YWKA 3PO2H 2RBMA 4LK1C 1XMOQ 1HH2P 1YNJC 4UDUC 3NWSA 1K3BC 2B2WA 2GVAA 5KYLA 1O7IA 4CDEC 1X56A 1DGSA 2YTVA 5CR3A 4JC0A 3FPPA 3SR1A 5AFWA 5LMNQ 2PMZB 3MHBA 4WJWA 4ZK9B 2N88A 1VF5C 2PCFB 2WFWA 3HOZB 3GTMB 2VXWA 1QOHA 4AQYQ 4O42A 5GROA 1FJGQ 1D5MC 1MI2A 2FMMA 3MZ5A 2K5WA 4ZUJA 5A35A 2EYOA 4H7BA 3AFPA 3MTSA 2RKSA 2ZM6L 2B8FA 4RKLA 4C3JB 1VQEA 4G7ZC 2AUJD 4KK7A 1HNWQ 5JJKA 1KNEA 5IWAL 4A3IH 4FDBA 1TQOA 1Q8KA 1PFSA 2F0FA 3CMAA 1PMRA 2K4KA 1L1OC 4IALA 4ILWA 4DUYQ 3PSIA 1CT1D 2RA4A 4KY7A 4IFDJ 1I4GA 2F52A 4A3DH 3DEOA 4B3TQ 1STAA 3MXPA 3CPWA 1HHVA 1CK1A 5KNBA 4ZLTF 4B3RL 1SNPA 4XQQA 1C7YA 1LTID 5IYBG 4G57A 1A8VA 4LMQD 2N49A 4LW1A 1F9QA 4PMCA 4YIJA 3DEPA 4DXGA 5EBCA 3VA7A 3D6WA 1TWHH 5C3XA 3J80E 2MGSA 2EZVA 3WWVA 2R7ZB 2B2VC
chains in the Genus database with same CATH topology
1TS5A 1KABA 1QJOA 2RVLA 3SK8A 3C3LA 3K5OA 4IZ8A 1T5EA 2XRSD 4H0LC 2XVSA 4U673 2Q8RE 1J9OA 3R2IA 2EY1A 4KKTA 2Z1CA 4GZYC 1J8IA 1EZ8A 5JVH3 1OXTA 5HGTA 3PO2B 2OT2A 1OXVA 1EOTA 3T51B 1PRTC 1V43A 4QIWB 4FF2A 3IL8A 3J81L 3E5SA 5ELDA 3MEHA 1G6ZA 1BCPD 1WVLA 3K57A 1Z6HA 5E3FA 4NKLA 1RD9D 4RWSC 1VCIA 1W6JA 1XYIA 1EEFD 3U9OA 5CBEE 2JXMB 2Z4IA 1F9RA 2J0TD 3NWTA 4A3IB 3GP7A 4IFDH 2PPBC 3BS1A 4CGYB 2IT1A 3NQIA 4A3DB 4XXEA 5JEAJ 3NBHA 3MXGA 4MN3A 1IW7D 2H4OA 1V1OA 2B8GA 2BCOA 3EA6A 3DHQA 3GTPB 1EU4A 2WIIB 4PMBA 1TWHB 1Q3LA 4HR7B 2KOLA 5IGDA 3C1EA 4J1MA 2O5JC 2NN6G 2EYHA 2MP1A 3TZUA 4KKUA 5C5MA 4EGVA 1PRTB 4CKEA 1M4VA 3MAQA 2MPMA 5CV4A 1DONA 4BBSB 3S2DB 5G3LF 2K04A 2EJMA 3QO2A 1G2TA 1SNOA 4IUVA 4DK0A 5KNDA 3KBXA 4S3SA 5CV7A 1SNQA 2EYFA 1LT6D 3ONAB 1SYEA 2XIWA 2O4XA 1UEAB 3AB9A 1B9MA 4DXFA 2EYMA 4U68A 2HDLA 2AWNA 2F0HA 1B50A 1EY8A 3PUZA 1BOSA 5EKIA 2KJXA 4NP5A 2NVYB 1H9KA 2FHTA 3RD4A 1XWEA 1RDPD 2JP1A 1SXTA 4BA1I 2O2LD 2J7ZA 2F0DA 1Z7TA 3HS0C 1XXGA 2L0CA 2XWJB 3K5MA 3M7GA 4G7HC 2CQAA 3N6RA 1TWCB 5JPMC 4RA8A 4PQXA 4DU9A 2GA4B 3A8JE 1SFOB 1GOZA 2N55A 3DUZA 3A7LA 2O5IC 3D4RA 4K8IA 1YNJD 4K5WA 3HOWB 1B53A 2XNAC 4N9PA 2HCCA 3SK5A 1BXTA 3EROA 5J22A 5K5PA 4C3HB 3H94A 1H9SA 4RHSA 1UAPA 2ICEC 1DOKA 3NTIA 2B2TC 2R61A 2QDBA 4AYBB 3S1MB 4QF4A 4A93B 1JQYD 2YYZA 4ZAIA 1RHPA 2E2IB 3GO5A 3CRKC 2ZXRA 2F0IA 2Z4HA 4XYQA 1IKLA 5JPNC 1STGA 3HEJA 4RFBA 1DYQA 4IUTA 4FF3A 4FXKC 1WTVA 1EZ6A 5ELBA 2XWBB 4DNTB 2L4NA 3S15B 1H9JA 3HG9A 3I8ZA 2K7VA 5CORA 5C0XG 1O78A 1AZQA 4ZRZA 4HTHA 2PZUA 1A15A 1PYWD 4OL7A 1D5ZC 3WOFA 4IFDI 1IYUA 2JA5B 4FP5D 4ZQ3A 4Z9CB 4KN4C 4NMZA 4RGTA 4V0BA 2NZ1D 2F0MA 1DOMA 3OMGA 1RJTA 2YU9B 3OHXC 1PRTD 1Y69U 2NWGA 3P1HA 3T53B 2IL8A 3V2TA 2NB0A 2AWOA 3RMHA 2SEBD 3KF8A 2L12A 4FXDA 2R3ZA 3NXWA 1ZKOA 4BWGB 3TP8A 1W6KA 5I9PA 1RODA 2E75C 4A3EB 5D14A 2J4XA 1QILA 2EXZA 1B2TA 3TDQA 1D6EC 5EKLA 4LAAA 4ZKCB 1IHZA 4A3GB 3NUCA 5KNCA 2ID0A 4RHRA 4X3SA 3DWPA 1ENFA 5CGKA 5M3MB 3K58A 5CYUA 3A7AB 4K2LA 3FEWX 2NVTB 4FNFA 4C2MB 2QKIC 5I4DA 3X3MA 3QG1A 2B2YA 1H9RA 1MD2D 5EBDA 5T1IA 4R8IA 4KI0A 1KNAA 4QUFA 4KY5A 2I07B 5EGTA 2F0LA 2QEJC 4EVOA 4OIKA 3VR6A 4ZYSA 3BYTB 3M7NA 2Q8IB 3H3VC 1V8QA 2K03A 3IFTA 1A3VA 4A3FB 2RQXA 1R9TB 1R4QB 1OXXK 5A2QE 3R3OA 4QMGA 4P2CB 1F9PA 1G8ZD 4C3JG 2AQ2B 4IQZA 3FKIB 4IUUA 4K6DA 1VMPA 2A73B 3TZDA 4M8AA 5EJWA 3BYYB 1DCZA 2IW3A 4K6LA 1EY6A 2EJFC 3DM1A 3SK6A 3SVMA 2CHBD 1ZXTA 1B4OA 4OO1H 2RDHA 2Z8LA 2NYZD 5ISRA 1D1KA 3HGBA 2AQ1B 2K01A 3M3YB 2F0NA 1SBBB 1UUPA 3I4MB 2A68C 2PQEA 2FFKB 2NTTA 4TKOB 1ILQA 1LTGD 1Y8OB 3I4NB 1MBYA 3MFGA 2IX1A 2EVBA 3NQTA 2PW5A 2VNUD 3KK7A 2F0JA 3VR4A 2EOTA 3OSOA 2D2CC 1RTNA 1AEXA 2D9UA 3ND8A 1ET9A 3RUZA 1CZGA 3HOXB 2X6GA 3GTGB 3LWUA 3Q23A 1PTOF 3V96A 5I6WA 1ICWA 1OO9B 1SYFA 4A3KB 3QOJA 1I4XA 2DY7A 1F2LA 3H0GB 4K8JA 4HMJA 1H9MA 2WB1B 2KEEA 2VB2X 3PV0A 3BVZA 1GUNA 4B08A 4X3KA 4DAVA 2ZXPA 4DN4M 1Y8PB 1O7LA 3GD7A 3RLFA 3GTQB 1MSHA 5LHY1 3L7ZC 2BA0A 4ULLA 1TS2A 2BDNA 4L63B 4BA2I 2IPKD 3J7YW 4TQUS 4C3IB 5CV8A 1ESFA 1MGSA 5EPKA 1AFPA 1GJXA 1S5DD 2MUYA 3HOYB 5C4ZA 2R6GA 3OW7A 1EU3A 3FDTA 3ZYYX 1BF4A 5IIFA 5C4JB 1EFID 3HP3A 5DNFA 3PUXA 1TIID 4KV6A 2WKDA 1HXYD 2F0TA 4FXGC 2EJGC 3K59A 5JOBA 2K5DA 3J80L 4X3UA 4KD3A 1F2ZA 4HCEA 4KD4A 3S9WA 4DNRB 5I9OA 1EEID 2E2DC 4RGOS 1WD1A 3DWAA 4RKBA 1B44D 3VR5A 4G4KA 2WKCA 1GHKA 1BCPF 1PZJD 2B39A 3NP8A 2JEBI 3RZDB 3EQLC 3JAME 5CBAE 1EIHA 1CI3M 2A74C 1SYBA 1XX8A 1B3AA 2L5TA 1F9SA 3T16A 3MVVA 2M00A 4HSPA 4DK1A 1LT3D 4HCSA 3FMCA 3NTKA 2NUCA 1JWSD 5K36G 4XQJA 1LTSD 4FO2A 3EJIA 1G91A 2NN6H 3BVGA 1ML0D 4HMIA 5D65A 4J6HA 2FJ2A 2F0UA 2SNSA 4I7ZC 1EYAA 1TU2B 5E4XA 3TBIB 4KY6A 1Q1EA 4OO1I 4H13C 1TWGB 2PZWA 1ZEQX 1SE3A 4KN7C 1STEA 2KEDA 2A6HC 4KJNA 1HQMC 2B63B 4L8JA 1GHJA 3I90A 1TR5A 2LMCB 1IYVA 4KTAA 1G2SA 1QWYA 5IT9E 3L3OC 1BQQT 2IX0A 1JR0D 2PW7A 2PYKA 3P75A 2L55A 4X3TA 1ENAA 1HTLD 1Y8NB 4HN7A 3MC0B 1JOKA 2BOSA 5IGBA 2FMCA 2SDFA 5IODA 1ONLA 5FK9C 3S2HB 2DY8A 3J7AV 5C4XB 5FLXE 3OPOA 1NAPA 5C0XJ 1GUWA 3SDZA 1II3A 1TVXA 3I73A 2NTSA 5FOBB 2D62A 3OMCA 2LS01 5M5XB 2B2UC 1DJRD 3P20A 3T56B 3G7LA 2OXPA 4KHVA 2EY5A 1PTOH 5BN5A 2XRQD 3FRPB 2V4DA 4BS9A 2X69A 4HEDA 4JBWA 2A68D 2KCNA 5EPJA 2R92B 1NSNS 5E1FA 2EY6A 1BBXC 3P7JA 4QB4A 1OXUA 3AU7A 1KDCA 1STNA 4CKBA 4C1NK 2NVXB 5JEAG 1ET6A 1TY2A 3A56A 3H91A 1MSGA 1PTOC 2DNEA 5TSSA 3VYUA 1WD0A 1KLUD 2Y0SB 2LKVA 2C5CA 1HTPA 4DAPA 1R4PB 1Q1BA 1KAAA 1QNUA 3KBGA 3PMFA 5KYIA 2F3VA 2F0QA 1EWHA 1BUVT 4RAUC 1H9SB 3S1QB 1VDZA 3QJYA 5M5WB 1LT5D 4NW2A 3RZOB 1PDQA 5BN4A 2BE5C 1JICA 3PUYA 5C0XH 1S5FD 1Q8IA 3TP7A 5DM63 4ZUIA 5ELCA 2OEOA 5J39A 2K33A 2EY2A 4FF1A 3K6OA 4BBRB 2EYPA 4LJZC 5ELFA 5C4HA 5CMDA 3NTHA 5JJZA 1PTOB 3F2UA 2B2TA 2MHVA 1EY4A 1HRJA 4E6IA 3IKJA 1UNSA 3D3RA 3ND9A 2F0OA 1EWCA 1PFBA 2NN6I 1LACA 2PZTA 1PZKD 5IGFA 3BZDB 1CHPD 3E6ZX 3R8BA 1STHA 1BO0A 1WCMB 3GQBA 2M9VA 4CJ1B 1DZ1A 1EY9A 3CKIB 1U4LA 4A3MB 1PRTF 3BDCA 1I4HA 2RSOA 1SE2A 1DOLA 1XTCD 3H6MA 1SE4A 3CHBD 2KVMA 1CTMA 1E2ZA 2L9HA 1M8AA 3PUVA 1JB3A 2X6LA 1NR2A 1T5XD 1WTWA 4UAIA 5LL6S 1WTQA 4F7XA 3ITPA 2JYOA 3VYSA 3A8IE 3DMUA 2HQEA 5COYA 2XN9C 3DWQA 3D4WA 4RH6A 2F0PA 1TS3A 4JK1C 2L1BA 3S16B 3Q6SA 5C3EB 3TP5A 1DD2A 1KDAA 5J1ZA 2BA1A 5LL6X 1X32A 5BN3A 1I4RA 1O7ZA 1FGBD 3MXUA 3Q0AA 5D3IB 1E2VA 1JWUD 3CU7A 1K8MA 4MHEA 1QCBD 4DA2A 5F2DA 5DEHA 3HRZC 5FO8B 1D5XC 2A6HD 1ZYRC 1F2MA 4XIGS 1SYGA 4IURA 1U4RA 1CFMA 4K2KA 5CC4A 2F0EA 1SSOA 1KDBA 4M1UB 1QNKA 5KEEA 3A55A 4I65A 4IN3A 1FNVA 4EQOA 1WTXA 2B2WC 4RCNA 3SHLA 4K5VA 2OF1A 1CA5A 2EYJA 4C56C 2VUMB 4WRDA 1FR3A 1F2YA 1V1PA 2DNCA 1TY0A 5FKAC 3NK9A 5D3DA 4Y7NB 2SNMA 5FO7B 5I2XA 1WTRA 3UI2A 3AMUA 5IGEA 5ELEA 5A2QL 2QILA 4F8MA 2H1EA 1LLRD 3SK4A 4CJ2C 2RDFA 2WACA 3NPPA 1YNNC 1KLGD 1KTKA 5EPLA 4B9XA 5C0XI 2E2HB 1L0XB 2KECA 2PO4A 3LNNA 4PV1C 4F87A 1LTBD 3BVMA 3FVQA 3HKZB 3W2DA 3WOEA 1C4QA 4EQPA 3LWEA 1BR9A 5M5YB 1PTOD 1SNDA 3CRLC 3GTKB 3SEBA 1AN8A 2EE1A 4ODGA 4RGMA 3R93A 1AW7A 1NCVA 1G291 2EYLA 3J7AF 2AQ3B 2A5HA 2AUKA 1VF7A 1DM0B 4CJ0B 4NDXA 1HCZA 3E0JA 2A6EC 3GV3A 1CZWA 2ZXOA 3T4AC 4TRDA 1S5CD 4OGQC 5C5LA 4Q0FA 3I4LA 3C2PA 3MWYW 1IL8A 4V190 4J8QA 4R8NA 1QG7A 3VYRA 2ENBA 1TKWB 2BE5D 4IUQA 4XT3B 3BG3A 1RTOA 1ILPA 3C1FA 1BDOA 3J81E 1A3UA 1LV9A 5EKKA 4K14A 4WFN3 5NUCA 1Y1WB 3HOUB 2F0KA 3VA5A 4HSVA 1RKNA 3Q24A 2WV6D 3PUWA 2DN8A 1HUNA 2E76C 4WORA 5IGGA 4IUNA 3S1NB 4DAYA 2HUGA 3D6CA 4CHTB 5T1GA 1STBA 2JEAI 1SEBD 1TS4A 2F0WA 2K32A 2B2VA 3A54A 1S4ZA 2RSNA 3EFXD 1GUGA 3IAYA 1HQRD 5CV5A 2KQ3A 5K36H 1LTAD 3CQZB 5HURA 2JSOA 4XDXA 3GV6A 1PZID 3NBIA 4KJOA 4C1NI 1RF2D 4DFAA 4B9WA 4XTCS 1HFGA 1LTTD 1GXDC 5I2YA 2K5QA 5FO9B 3QB3A 3JAML 1C8CA 5KGUA 4IFDG 2K28A 3I72A 2A69C 1LT4D 3NSWA 5DAUA 3MXNA 2F3WA 3R2TA 1QE6A 1GUOA 4H44C 1E0BA 1CQVA 5G3LD 1JE4A 2CW0C 1LO5D 1D1IA 3QIAA 2HDMA 2SOBA 1AP0A 2KUMA 1WTPA 5C3WA 2WP8J 1U9RA 3V05A 3DXJC 4C3HG 1ZYRD 2ZT9C 1O7YA 4A3BB 4XQNA 5C44B 4L6TB 3VYTA 4QCLA 1EYCA 2LY7A 2JA7B 2HCIA 4FVMA 1Z47A 1I6HB 3L9AX 1Q12A 2F0SA 1SMYC 4Q5VA 1HFNA 1I4QA 3K7AB 5IT9L 1D2BA 1FYCA 2D5DA 4FF4A 3S1RB 1BNZA 1PLFA 1SJED 1Y1VB 5DM73 1EY5A 3MA2B 3I70A 2M2LA 3OWFA 1I6VC 4O1NA 1A2TA 5FLXL 3C46A 4QUCA 3W3AA 4TSSA 3OIQA 3K0YA 1JORA 2CVRA 2EPBA 5JEAH 1NUCA 2LFNA 3TMEA 3KUPA 1F77A 1U4MA 2IJ0A 2BDOA 3GTJB 1YNND 3A8KE 5E4WC 1SNMA 1OXSC 3H09A 3NHHA 5IOCA 5CV6A 3K5LA 4XT1B 3WDNA 3O13A 1TWFB 2G9HD 1SJHD 1HPCA 1VMCA 3D4DA 1JC7A 3TSSA 4ME5A 4DGZA 2K6AA 2B2UA 3N52A 2JA6B 1B1ZA 1PFNA 1B9NA 3TN2A 1E2WA 2KA7A 3FPUB 1C48A 5M9OA 4RCOA 3BDOA 2IWHA 2QCPX 3URYA 1EQVA 1K8OA 2RDGA 1CQFA 2EDGA 3KLSA 3Q22A 1SYDA 3M4OB 3SE0A 2A6ED 2F0VA 1I3QB 1A2UA 2F0GA 4FYDA 5IGCA 1U4PA 2KHSA 1HA6A 2E2JB 1LTRD 4RGNA 3I91A 3OWEB 4F88A 1A6XA 3SXHA 3M4YA 1EY7A 4BY1B 3U9SA 2I46A 3EVQA 3D31A 4G7OC 1FD7D 3MFYA 4OHJA 3D8GA 1STYA 2Q8TA 3OIPA 1SDFA 3HZXA 1ENCA 2F03A 2R93B 1BCPC 2JA8B 4IUPA 3KLRA 1SYCA 4ID6A 1A3TA 1I50B 2B2YC 1CHQD 3NE5B 4PNYA 2WINB 1WTOA 1EL0A 2PNRC 5KRUA 1EYDA 4ZKBB 4KMUC 3K5NA 4KHZA 1S5BD 2C9OA 3GTLB 2F1MA 3KLSX 2G9DA 3PIO3 1EY0A 2NBFA 1IW7C 1FNWA 5JAVA 3PIP3 3BDLA 4CBVA 1JWMD 1GUTA 3HOVB 2ICIA 4K5XA 3ERQA 3T13A 1S5ED 1JOOA 4MIUA 3GTOB 4OIJA 2K1BA 1SNCA 2A69D 2KCCA 1RCVD 1PFMA 1O80A 4A3JB 3TP6A 4XYOA 4DF7A 2NVQB 1TWAB 5M3FB 1BCPB 1PXUA 1CM9A 3S17B 1EQTA 1HA5A 1Q90A 2JE6I 2TMPA 3M85A 2CW0D 1CA6A 1QB5D 5I6YA 3VR2A 3QWNA 3VR3A 1X3PA 2QF7A 2WAQB 1L0YB 4ABNA 1TT2A 3X3NA 1EIGA 1AZPA 3QOLA 2IX3A 3IFDA 1HUMA 3OOCA 3S14B 4HAEA 1NR4A 3G6JB 1I4PA 2VB3X 3LX0A 5KIXA 2E74C 1SAPA 5C6AA 4KKSA 1SMYD 2XSCA 5CV9A 2L11A 1X3QA 1FNUA 2K05A 4C3IG 5JVG3 1JCKB 4PMWA 4EQNA 3PO3B 1DXMA 1IKMA 4R9WA 1LABA 4CKCA 1V1PB 2FINB 3I3CA 4N9TA 2TSSA 4OO1G 2F4IA 1JOQA 4BY7B 1GUSA 2MJ8A 1K83B 1ESRA 5EQ0A 2RBMA 4LK1C 1YNJC 4UDUC 3NWSA 2B2WA 5KYLA 5CR3A 3FPPA 3SR1A 5AFWA 2PMZB 3MHBA 4WJWA 4ZK9B 2N88A 1VF5C 2PCFB 3HOZB 3GTMB 2VXWA 1QOHA 4O42A 1D5MC 1MI2A 2FMMA 3MZ5A 2K5WA 4ZUJA 5A35A 2EYOA 4H7BA 3MTSA 2RKSA 2B8FA 4RKLA 4C3JB 4G7ZC 2AUJD 4KK7A 1KNEA 1TQOA 2F0FA 1PMRA 4ILWA 4IALA 1CT1D 2RA4A 4KY7A 4IFDJ 1I4GA 3DEOA 1STAA 3MXPA 1HHVA 1CK1A 5KNBA 4ZLTF 1SNPA 4XQQA 1LTID 4G57A 4LMQD 1F9QA 4PMCA 4YIJA 3DEPA 4DXGA 5EBCA 3VA7A 3D6WA 5C3XA 3J80E 2MGSA 2EZVA 2R7ZB 2B2VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGD A;  1A3V A;  3C1E A;  4J1M A;  2EY2 A;  2EYH A;  3D6C A;  1KAB A;  2F0M A;  5C5M A;  1EQV A;  3OMG A;  4K5W A;  4K8I A;  4EQN A;  1EYC A;  1STB A;  3T16 A;  3SK8 A;  3R3O A;  2OXP A;  2EYP A;  3MVV A;  2M00 A;  4IZ8 A;  4KHV A;  4N9P A;  4QMG A;  2EY5 A;  3P1H A;  2F0W A;  2NUC A;  5CV4 A;  1EY0 A;  3SK5 A;  3V2T A;  4N9T A;  5C4H A;  4EQP A;  4K6D A;  2EY1 A;  3ERO A;  1SYD A;  2F0S A;  5JAV A;  5J22 A;  3EJI A;  5F2D A;  5K5P A;  3BDL A;  1JOQ A;  1SND A;  1SNO A;  1EY4 A;  4K5X A;  3NXW A;  5DEH A;  4E6I A;  5CC4 A;  2F0V A;  4HMI A;  5CV8 A;  1F2M A;  3TP8 A;  1EY6 A;  4ODG A;  1SYG A;  2F0O A;  3ERQ A;  3SK6 A;  3T13 A;  1EZ8 A;  1A2U A;  2PZT A;  4J6H A;  1NSN S;  2RBM A;  4S3S A;  5CV7 A;  5HGT A;  2F0U A;  1JOO A;  1SNQ A;  2EY6 A;  4K2K A;  4MIU A;  2F0E A;  2F0G A;  2EYF A;  5CV5 A;  5E1F A;  5C4Z A;  2KQ3 A;  4QB4 A;  5IGC A;  1KDB A;  2KHS A;  2SNS A;  1SNC A;  2QDB A;  1KDC A;  1SYE A;  1EYA A;  2EYL A;  5HUR A;  2O4X A;  4QF4 A;  1STN A;  5KYL A;  2EXZ A;  5KEE A;  1STH A;  4I65 A;  5ISR A;  4KY6 A;  5EKL A;  3SXH A;  1EY5 A;  4LAA A;  3E5S A;  5CR3 A;  2EYM A;  2PZW A;  5IIF A;  2F0N A;  4KJO A;  4EQO A;  3MEH A;  3TP6 A;  1EY9 A;  1EY7 A;  4NDX A;  4DFA A;  4DF7 A;  1IHZ A;  2F0H A;  3SR1 A;  2F0I A;  3NUC A;  3SHL A;  3MHB A;  1EY8 A;  3OWF A;  4K5V A;  2PQE A;  4KJN A;  2OF1 A;  3BDC A;  4B9W A;  2EYJ A;  1A2T A;  3EVQ A;  4TRD A;  4NP5 A;  5C5L A;  4KV6 A;  1STG A;  4WRD A;  1TR5 A;  2F0T A;  3HEJ A;  4ZUJ A;  3MZ5 A;  1F2Y A;  3H6M A;  5I9P A;  2EYO A;  4KTA A;  4H7B A;  5E3F A;  3QB3 A;  4NKL A;  1JOR A;  4R8N A;  2LKV A;  2RKS A;  5KGU A;  3D8G A;  1EZ6 A;  5CGK A;  3NK9 A;  4RKL A;  2PW7 A;  5JOB A;  1STY A;  2ENB A;  5I6Y A;  2PYK A;  3NQT A;  3P75 A;  1NUC A;  2PW5 A;  2SNM A;  3TME A;  5DAU A;  4K2L A;  4KD3 A;  1F2Z A;  4KD4 A;  1ENA A;  2F0J A;  2F3W A;  3U9O A;  3S9W A;  3HZX A;  1KAA A;  3OSO A;  1TT2 A;  5I9O A;  5IGF A;  1TQO A;  2F0F A;  5IGE A;  1AEX A;  1ENC A;  1JOK A;  4F7X A;  3ITP A;  2F0D A;  3PMF A;  1SNM A;  4IAL A;  5IGB A;  5KYI A;  2F3V A;  3C1F A;  2F0Q A;  5J39 A;  3DMU A;  5IOD A;  3QOL A;  4KY7 A;  2HQE A;  3NHH A;  5IOC A;  5CV6 A;  4RKB A;  4HTH A;  3RUZ A;  2PZU A;  1SYC A;  1A3U A;  4ID6 A;  4OL7 A;  1STA A;  1A3T A;  4F8M A;  3D4W A;  3MXP A;  5EKK A;  4K14 A;  4ZQ3 A;  4KY5 A;  4PNY A;  1SNP A;  2F0P A;  5EGT A;  2SOB A;  3D4D A;  3LX0 A;  3SK4 A;  5KIX A;  4ME5 A;  4G57 A;  5NUC A;  4DGZ A;  2F0L A;  2RDF A;  2WAC A;  3NP8 A;  4DU9 A;  5C6A A;  5I6W A;  5KRU A;  1SYF A;  2F0K A;  3TP7 A;  3VA5 A;  3QOJ A;  4EVO A;  4PMC A;  1EYD A;  3TP5 A;  1II3 A;  4YIJ A;  1RKN A;  5C3W A;  4ZUI A;  1KDA A;  4B9X A;  1U9R A;  5CV9 A;  1SYB A;  3DHQ A;  4NMZ A;  5J1Z A;  5C3X A;  3OMC A;  4WOR A;  2OEO A;  5M9O A;  4PMB A;  5IGG A;  4K8J A;  4HMJ A;  4IUN A; 
#chains in the Genus database with same CATH topology
 1TS5 A;  1KAB A;  4YWM A;  1IBK Q;  1QJO A;  4DKA C;  4GOP A;  2RVL A;  3HKZ E;  3FHW A;  4YY3 L;  3SK8 A;  2EIF A;  3C3L A;  4DAM A;  4JI0 L;  3K5O A;  4IZ8 A;  1T5E A;  2XRS D;  4H0L C;  4POG A;  4BBS H;  3S2D H;  2XVS A;  4U67 3;  2Q8R E;  1J9O A;  3R2I A;  4L5S A;  1VQ6 A;  1JT8 A;  2EY1 A;  4LNQ A;  4KKT A;  2Z1C A;  1E1T A;  4GZY C;  3J81 c;  1J8I A;  1N34 L;  1X55 A;  2WB1 E;  3CAM A;  1EZ8 A;  5JVH 3;  1OXT A;  5HGT A;  3PO2 B;  2B63 G;  2OT2 A;  1OXV A;  1EOT A;  1KRT A;  1SRU A;  3T51 B;  1PRT C;  1V43 A;  4QIW B;  3BJU A;  4FF2 A;  1RIP A;  3IL8 A;  3J81 L;  3E5S A;  5ELD A;  3MEH A;  1L1O B;  1G6Z A;  1E1O A;  2NVY H;  1BCP D;  2E5L Q;  1WVL A;  4DR6 Q;  4DV6 Q;  3K57 A;  1Z6H A;  5E3F A;  1L2F A;  1RD9 D;  3EIV A;  4NKL A;  5C44 G;  4RWS C;  4DAY B;  1VCI A;  1W6J A;  1XYI A;  1PH6 A;  4LF9 Q;  2CWA A;  1UEB A;  2HT1 A;  5C4X G;  3JAM c;  1EEF D;  4O0A A;  3U9O A;  5CBE E;  2JXM B;  2Z4I A;  1F9R A;  2J0T D;  3NWT A;  4A3I B;  3GP7 A;  4X6A H;  1KC8 C;  1IL2 A;  1PH1 A;  4IFD H;  2PPB C;  3BS1 A;  4CGY B;  2IT1 A;  1SR3 A;  2F3I A;  3NQI A;  4DR5 Q;  4A3D B;  1FL0 A;  1X9N A;  4XXE A;  2HQL A;  5JEA J;  1CKM A;  3NBH A;  1KRS A;  3MXG A;  4MN3 A;  1IW7 D;  5IYD H;  2H4O A;  1V1O A;  2B8G A;  2BCO A;  2Z0S A;  3JAM i;  3EA6 A;  3DHQ A;  3GTP B;  1EU4 A;  2WII B;  4PMB A;  1TWH B;  1Q3L A;  4HR7 B;  2KOL A;  1A62 A;  5IGD A;  3C1E A;  4J1M A;  2O5J C;  4N8X 1;  4R4O A;  2NN6 G;  2EYH A;  2MP1 A;  3TZU A;  4KKU A;  5C5M A;  4EGV A;  1TXY A;  3HOW H;  2R92 G;  1PRT B;  4WJ4 A;  4CKE A;  1M4V A;  3MAQ A;  1CKN A;  2MPM A;  5CV4 A;  1DON A;  4BBS B;  1QVG A;  1MJC A;  3S2D B;  4C3H H;  5G3L F;  2K04 A;  3CCS A;  1YJN A;  4HJA A;  2EJM A;  3QO2 A;  1G2T A;  1SNO A;  4IUV A;  4DK0 A;  5KND A;  3MXN B;  3KBX A;  1YEZ A;  2UU9 Q;  3W1B A;  4S3S A;  5CV7 A;  1SNQ A;  2EYF A;  1JJ2 A;  3KYH C;  1LT6 D;  5IT9 c;  1MHW C;  1SYE A;  2XIW A;  3ONA B;  4A93 H;  2O4X A;  1UEA B;  4OX9 L;  1A63 A;  2UUC Q;  3AB9 A;  3U58 A;  1B9M A;  2E2I H;  3OTO L;  4DXF A;  1X54 A;  2EYM A;  4U68 A;  2HDL A;  5J3B A;  2AWN A;  2F0H A;  4P74 A;  4QL5 A;  1B50 A;  1EY8 A;  3PUZ A;  1BOS A;  5EKI A;  1IBM Q;  2KJX A;  3UDG A;  4NP5 A;  2NVY B;  1H9K A;  1YJ9 A;  2FHT A;  3RD4 A;  4MNO A;  1XWE A;  4B3S Q;  1RDP D;  2JP1 A;  4QY7 A;  5FLX c;  3S15 H;  1SXT A;  4BA1 I;  4LF8 Q;  2O2L D;  4LF7 L;  2J7Z A;  4YHH L;  2K5N A;  4OWT B;  2F0D A;  1Z7T A;  3HS0 C;  1XXG A;  4UPA A;  2L0C A;  1JMC A;  2XWJ B;  2UXB L;  3M4P A;  3K5M A;  2JA5 H;  3M7G A;  4G7H C;  1CSQ A;  1VQK A;  3W1G A;  2CQA A;  3CXC A;  3N6R A;  4B3M L;  1TWC B;  5JPM C;  4BBR G;  2QDL A;  4RA8 A;  4PQX A;  4DU9 A;  2CH4 A;  1NMG A;  2GA4 B;  2HD3 A;  3A8J E;  1SFO B;  3U50 C;  1GOZ A;  4CDD C;  1I94 L;  4UHV A;  2N55 A;  1YHQ A;  1K9M C;  4BY1 G;  1SMX A;  3DUZ A;  4X66 L;  3A7L A;  2O5I C;  3D4R A;  4MZ9 A;  2UUB Q;  1NTG A;  4K8I A;  1YNJ D;  4K5W A;  1JB7 A;  3HOW B;  1HR0 Q;  1B53 A;  2XNA C;  3U4Z A;  4DV4 Q;  4N9P A;  2HCC A;  1IBL Q;  3SK5 A;  4CDF C;  1BXT A;  3ERO A;  4A3M H;  5J22 A;  5K5P A;  4C3H B;  1HZB A;  3H94 A;  1YNX A;  1WCM G;  1H9S A;  4RHS A;  1J5E Q;  1WOC A;  1UAP A;  2JQO A;  1LUZ A;  2ICE C;  4A3E H;  1VQ8 A;  1DOK A;  3NTI A;  2B2T C;  2R61 A;  2QDB A;  4AYB B;  1K0S A;  3S1M B;  4QF4 A;  4A93 B;  2OTJ A;  1JQY D;  3D0F A;  2YYZ A;  4ZAI A;  1RHP A;  1UE5 A;  4A3G H;  2QW7 A;  2E2I B;  4DR4 L;  3GO5 A;  3CRK C;  2ZXR A;  2F0I A;  2Z4H A;  4XYQ A;  1IKL A;  5JPN C;  4HJ5 A;  2VQE L;  1STG A;  4JI2 Q;  3ICE A;  4JV5 Q;  3HEJ A;  4RFB A;  1DYQ A;  4IUT A;  4X65 Q;  4FF3 A;  4FXK C;  1WTV A;  4NXN L;  4JI5 L;  1EOV A;  1EZ6 A;  5ELB A;  2XWB B;  1H95 A;  4DR7 L;  4DNT B;  2NVT H;  1NBW A;  2L4N A;  3S15 B;  1H9J A;  3HG9 A;  1GVP A;  3I8Z A;  5C3E G;  2K7V A;  5COR A;  5C0X G;  1O78 A;  5DLQ E;  2KBN A;  1AZQ A;  4ZRZ A;  4HTH A;  2PZU A;  1X3G A;  1A15 A;  1PYW D;  1B8A A;  4OL7 A;  1D5Z C;  3WOF A;  1B70 B;  1S72 A;  4IFD I;  1IYU A;  2HHH Q;  4FP5 D;  2JA5 B;  4ZQ3 A;  1SRO A;  5IP9 H;  1PH5 A;  4HJ8 A;  2PI2 A;  3EN2 A;  4Z9C B;  4KN4 C;  1C9O A;  4KHP L;  4NMZ A;  1QVC A;  4RGT A;  4V0B A;  2NZ1 D;  1R9T H;  1ASZ A;  2F0M A;  4A3L H;  1DOM A;  3OMG A;  1RJT A;  5HY6 A;  4DR3 Q;  4NXM L;  2VQF L;  1VS0 A;  2YU9 B;  3OHX C;  4LF4 L;  1PRT D;  1XNR Q;  4K0K Q;  1Y69 U;  2NWG A;  3P1H A;  3FKI H;  3T53 B;  2IL8 A;  3V2T A;  2NB0 A;  3BZC A;  2AWO A;  5ELN A;  2DGY A;  4GLV B;  1HNZ Q;  3RMH A;  2WAQ G;  2SEB D;  3KF8 A;  2L12 A;  3W5O A;  3J81 j;  4A3C G;  4FXD A;  2R3Z A;  3NXW A;  1ZKO A;  4BWG B;  3TP8 A;  4LUO A;  1W6K A;  1NY4 A;  5I9P A;  1ROD A;  2E75 C;  3GDE A;  4Y7N H;  2VUM G;  1XMQ Q;  4A3E B;  5D14 A;  2J4X A;  1QIL A;  2EXZ A;  1B2T A;  3TDQ A;  4GN4 B;  1D6E C;  5EKL A;  1IZ6 A;  1W3S A;  3M3Y H;  4LAA A;  1VQO A;  4ZKC B;  1X6O A;  3I4M H;  2H5X A;  1IHZ A;  4A3G B;  3NUC A;  2EQS A;  3I4N H;  5KNC A;  2ID0 A;  2Z6K C;  2QA4 A;  4RHR A;  4A75 A;  4X3S A;  1FJG L;  3DWP A;  5AJ3 Q;  1ENF A;  4DV0 Q;  5CGK A;  5M3M B;  3K58 A;  5CYU A;  3A7A B;  4K2L A;  3FEW X;  4BXX H;  2NVT B;  3H3V H;  1YZ6 A;  4FNF A;  4C2M B;  5GAD C;  2QKI C;  5I4D A;  3X3M A;  3QG1 A;  2PI2 E;  2B2Y A;  1H9R A;  1MD2 D;  2UXD Q;  4DUY L;  5EBD A;  3HOX H;  5T1I A;  3I7F A;  4DR2 Q;  4JBK A;  4R8I A;  4KI0 A;  3GTG H;  1KNA A;  4B3T L;  4QUF A;  2N3S A;  4KY5 A;  2I07 B;  5EGT A;  4A3K H;  2F0L A;  3HKZ G;  5M5Y H;  2QEJ C;  4EVO A;  1LYL A;  4OIK A;  3VR6 A;  2ZJR A;  4ZYS A;  4EQ5 A;  3BYT B;  3M7N A;  3H0G H;  2Q8I B;  3H3V C;  5FLM G;  1V8Q A;  1SLJ A;  4HIO A;  2K03 A;  1ASY A;  3IFT A;  1A3V A;  2ALY B;  4A3F B;  2RQX A;  3KF6 B;  3PF5 A;  1R9T B;  2CFM A;  1R4Q B;  1OXX K;  5A2Q E;  3GTQ H;  4IOA A;  3R3O A;  5FJ8 H;  4QMG A;  1PH4 A;  1NNX A;  2LSS A;  4P2C B;  1F9P A;  1G8Z D;  4C3J G;  1VQL A;  2AQ2 B;  1PH8 A;  4JI6 L;  4IQZ A;  3FKI B;  4IUU A;  4K6D A;  2JJQ A;  5E7N A;  3MEF A;  4AH6 A;  1VMP A;  2A73 B;  5BR8 L;  3AQQ A;  4JI4 Q;  3TZD A;  4M8A A;  5EJW A;  3BYY B;  1DCZ A;  2IW3 A;  4K6L A;  1EY6 A;  2EJF C;  1PH2 A;  3DM1 A;  3SK6 A;  3SVM A;  2CHB D;  3HOY H;  1N33 Q;  1ZXT A;  1U5K A;  1B4O A;  2CKZ B;  4OO1 H;  2Q2I A;  2RDH A;  3G4S A;  2Z8L A;  2NYZ D;  4O2D A;  3J7Z C;  5ISR A;  1D1K A;  1Q7Y C;  3HGB A;  3RN5 A;  4IPG A;  2AQ1 B;  4X62 Q;  2K01 A;  3M3Y B;  2F0N A;  4Y52 H;  3LGJ A;  3DM3 A;  2KCT A;  4UY8 C;  1SBB B;  1UUP A;  3I4M B;  2A68 C;  3DLL A;  2PQE A;  2OWO A;  2FFK B;  2NTT A;  4TKO B;  3E9I A;  1LTG D;  1ILQ A;  2E5L L;  1UWV A;  1Y8O B;  4QGU A;  4GN5 A;  3CCL A;  2CQO A;  3I4N B;  4DR6 L;  2UXC Q;  1MBY A;  3MFG A;  2IX1 A;  1Y1W H;  3B6Y A;  2EVB A;  3NQT A;  2PW5 A;  4P71 A;  2VNU D;  3KK7 A;  2WAQ E;  2F0J A;  2EOT A;  3OSO A;  2D2C C;  3VR4 A;  1Y1W G;  3HOU G;  1RTN A;  1L0W A;  5L37 A;  1AEX A;  2D9U A;  3ND8 A;  4JCV E;  5GQO A;  1ET9 A;  3RUZ A;  1CZG A;  4OWX B;  3HOX B;  3TRE A;  1BVS A;  2X6G A;  3A5U A;  4DV7 L;  4DR5 L;  3GTG B;  3LWU A;  3Q23 A;  1VQC A;  2OQ0 A;  1PTO F;  3RZD H;  3V96 A;  5I6W A;  1ICW A;  1OO9 B;  2C35 B;  1SYF A;  1Z9F A;  4A3K B;  3QOJ A;  1PH3 A;  1I4X A;  3U4V A;  5JJI A;  2DY7 A;  1F2L A;  3H0G B;  4K8J A;  4HMJ A;  5IY0 A;  1H9M A;  1U0L A;  2WB1 B;  2KEE A;  1EYG A;  5IYB H;  1EUJ A;  1WI5 A;  2VB2 X;  3PV0 A;  3BVZ A;  1GUN A;  4B08 A;  4X3K A;  4DAV A;  2ZXP A;  3PIO A;  4DN4 M;  1Y8P B;  1O7L A;  3GD7 A;  3RLF A;  3GTQ B;  1MSH A;  5LHY 1;  3L7Z C;  2Z9H A;  2BA0 A;  1BBW A;  4LFB L;  1YIT A;  4JI8 Q;  4ULL A;  1TS2 A;  3PQI A;  4MTK A;  5EAY A;  1WFQ A;  1QVF A;  2BDN A;  4L63 B;  4BA2 I;  4JI1 Q;  2IPK D;  4DV3 Q;  3J7Y W;  4TQU S;  4C3I B;  5CV8 A;  1ESF A;  1XNQ L;  1MGS A;  5EPK A;  1AFP A;  1GJX A;  1S5D D;  2MO1 A;  2UU9 L;  3F1Z A;  2MUY A;  2PQA B;  4I7A A;  3HOY B;  5C4Z A;  2R6G A;  3CC4 A;  3F2C A;  3OW7 A;  1EU3 A;  1K73 C;  1TWG H;  3FDT A;  2B29 A;  3ZYY X;  1XPO A;  2UUC L;  1BF4 A;  5IIF A;  5C4J B;  1K28 A;  1EFI D;  4JI3 Q;  3J80 c;  3HP3 A;  2UUA L;  5DNF A;  2B63 H;  3PUX A;  2LXJ A;  1TII D;  4DUZ Q;  3CPF A;  4KV6 A;  4WJ3 M;  2WKD A;  1HXY D;  2F0T A;  4FXG C;  2EJG C;  4PZ8 A;  3K59 A;  4N8F A;  1EIF A;  1VQ9 A;  5JOB A;  2K5D A;  3J80 L;  4X3U A;  4KD3 A;  1F2Z A;  4HCE A;  4KD4 A;  3S9W A;  4DNR B;  5I9O A;  3KJO A;  1EEI D;  1EQQ A;  2E2D C;  1UE1 A;  4RGO S;  1WD1 A;  3AYH B;  3H3V I;  5C44 H;  3S2H H;  3DWA A;  1VQN A;  4RKB A;  1B44 D;  3VR5 A;  3J81 i;  4G4K A;  1QZH A;  4JOI C;  5C4X H;  4A3B G;  4JVZ A;  3CCJ A;  2OCE A;  2WKC A;  4OEM B;  4ZCK A;  1I6H H;  1GHK A;  1GM5 A;  4JI7 L;  1BCP F;  1PZJ D;  2B39 A;  1KHI A;  3NP8 A;  2JEB I;  4P75 A;  3RZD B;  2JA7 G;  3EQL C;  3JAM E;  5CBA E;  1EIH A;  1CI3 M;  2A74 C;  1MIU A;  3KDF A;  1SYB A;  5M5X H;  1XX8 A;  3T1Y Q;  1B3A A;  4CDC C;  1Q82 C;  2L5T A;  1F9S A;  1A0I A;  1OTC A;  2K14 A;  4YCU A;  1KAW A;  3T16 A;  3CCM A;  4LF5 L;  3HKS A;  3MVV A;  2M00 A;  4HSP A;  4DK1 A;  1LT3 D;  4HCS A;  3FMC A;  3NTK A;  4IOC A;  2NUC A;  1JWS D;  1IBL L;  5K36 G;  4XQJ A;  1LTS D;  1Y1V G;  4FO2 A;  3EJI A;  2RCN A;  1G91 A;  2NN6 H;  3BVG A;  1ML0 D;  4HMI A;  1VQJ A;  2R92 H;  5D65 A;  3UDI A;  4J6H A;  4POF A;  4R4C A;  2FJ2 A;  2F0U A;  1WJJ A;  2ZM6 Q;  3UE1 A;  1C0A A;  2SNS A;  4I7Z C;  1VQA A;  4QIW E;  1EYA A;  1TU2 B;  5IYC G;  4P72 A;  5E4X A;  2RCF A;  3TBI B;  2NVX H;  4KY6 A;  1Q1E A;  4OO1 I;  4H13 C;  1TWG B;  2PZW A;  4LWC A;  1ZEQ X;  1SE3 A;  4KN7 C;  1STE A;  2KED A;  2A6H C;  3G71 A;  4KJN A;  1HQM C;  4GS3 A;  2B63 B;  4L8J A;  1TWF H;  1GHJ A;  3I90 A;  1TR5 A;  2LMC B;  4B3R Q;  1HZ9 A;  4APV A;  1IYV A;  4KTA A;  3I55 A;  4LFC L;  1G2S A;  1QWY A;  4X65 L;  3L3O C;  1BQQ T;  2IX0 A;  1JR0 D;  5IT9 E;  2PW7 A;  3K0X A;  2PYK A;  3P75 A;  2JA9 A;  2OQK A;  2L55 A;  4X3T A;  2QGQ A;  1ENA A;  1HTL D;  1Y8N B;  4HN7 A;  2KHI A;  3MC0 B;  1JOK A;  2BOS A;  5IGB A;  2FMC A;  3TS0 A;  2JA6 G;  2SDF A;  5IOD A;  1ONL A;  3S1Q H;  5FK9 C;  1HNX L;  1X3E A;  5M5W H;  3S2H B;  2DY8 A;  5LMN W;  3J7A V;  3RZO H;  4JI0 Q;  4JBJ A;  1N36 Q;  3K7U C;  5C4X B;  2AHO B;  5FLX E;  1IXR A;  3OPO A;  4DV2 L;  1NAP A;  1V9P A;  5C0X J;  1GUW A;  4IO9 A;  3SDZ A;  1II3 A;  1TVX A;  3I73 A;  3M9B A;  2NTS A;  5FOB B;  1N34 Q;  2D62 A;  1KQS A;  2I5H A;  3OMC A;  2LS0 1;  5M5X B;  1S3O A;  2B2U C;  4BBR H;  2E2J H;  1DJR D;  3P20 A;  4QQB X;  4LFA L;  3T56 B;  3G7L A;  2OXP A;  4KHV A;  2EY5 A;  1XNR L;  1KXL A;  4BY1 H;  1PTO H;  5BN5 A;  2XRQ D;  3FRP B;  2V4D A;  4BS9 A;  2X69 A;  4HED A;  1HNZ L;  4JBW A;  2A68 D;  2KCN A;  5EPJ A;  1K8A C;  1NE3 A;  2R92 B;  1NSN S;  1XPR A;  3NEM A;  5E1F A;  2EY6 A;  1BBX C;  3P7J A;  4QB4 A;  1OXU A;  2CCZ A;  3AU7 A;  1KDC A;  4PZ6 A;  1STN A;  4IPC A;  2KCM A;  1WCM H;  3E3X A;  4CKB A;  2QEX A;  4C1N K;  2NVX B;  2Q2U A;  5JEA G;  1ET6 A;  4IPD A;  2R93 H;  1G6P A;  1TY2 A;  1MKH A;  3A56 A;  3H91 A;  1MSG A;  1PTO C;  2DNE A;  5TSS A;  3CCQ A;  3VYU A;  1WD0 A;  4ME3 A;  1Q81 C;  1I50 H;  1YHB A;  2R93 G;  3T1H L;  2JA8 G;  1KLU D;  2Y0S B;  3ZJY C;  2LKV A;  2C5C A;  4YWL A;  1HTP A;  4DAP A;  2KHJ A;  4DV0 L;  3E0E A;  2ZTE A;  4OXP A;  2VZA A;  4RG1 A;  1R4P B;  1Q1B A;  4UP9 A;  1KAA A;  1QNU A;  3KBG A;  3PMF A;  3GTL H;  5KYI A;  2F3V A;  2F0Q A;  1EWH A;  3ULL A;  1XTD A;  1BUV T;  4HJ7 A;  4RAU C;  1VQ5 A;  1H9S B;  3S1Q B;  1VDZ A;  3QJY A;  3AEV A;  5M5W B;  2CWP A;  4DR2 L;  2ES2 A;  1LT5 D;  1V1Q A;  4NW2 A;  3RZO B;  1PDQ A;  3S16 H;  5BN4 A;  4HIK A;  2AMC B;  2BE5 C;  1JIC A;  2YTY A;  3PUY A;  5C3E H;  4DR1 L;  5C0X H;  1S5F D;  2E8G A;  1Q8I A;  3TP7 A;  4NPS A;  5DM6 3;  5GAE C;  4ZUI A;  2DUD A;  4R4Q A;  3VDY A;  5ELC A;  3E9H A;  2OEO A;  5J39 A;  3HOV G;  2K33 A;  3GTO H;  2EY2 A;  4FF1 A;  4JBM A;  4OX9 Q;  3K6O A;  4BBR B;  2K52 A;  5IE8 A;  1GO3 E;  2EYP A;  4LJZ C;  3OTO Q;  2IHE A;  5ELF A;  5C4H A;  5CMD A;  3NTH A;  5JJZ A;  3TEH B;  2JN4 A;  2NVQ H;  1TWA H;  5ELO A;  3S17 H;  4GKJ Q;  1PTO B;  3F2U A;  2B2T A;  2MHV A;  1EY4 A;  2GVB A;  4E6I A;  1HRJ A;  4A3J G;  4UP7 A;  4JI4 L;  3IKJ A;  1UNS A;  3D3R A;  3ND9 A;  1YBY A;  2F0O A;  5M3F G;  1EWC A;  1PFB A;  2NN6 I;  1LAC A;  2PZT A;  1PZK D;  1EFW A;  5IGF A;  2K5H A;  3BZD B;  1CHP D;  4TVA B;  3E6Z X;  3G48 A;  3JC6 6;  3R8B A;  4LF7 Q;  4JPB W;  1STH A;  4A3C H;  4DV1 L;  1BO0 A;  1WCM B;  3GQB A;  2M9V A;  4CJ1 B;  2IHF A;  1DZ1 A;  1EY9 A;  4JYA L;  4DV5 L;  1VQB A;  3CKI B;  2UXB Q;  4PG3 A;  1U4L A;  2YTX A;  4A3M B;  3S14 H;  5IP7 G;  2VUM H;  1PRT F;  3BDC A;  1HJP A;  3Q8D A;  3RLN A;  1I4H A;  2RSO A;  1SE2 A;  1B7Y B;  1DOL A;  1XTC D;  3H6M A;  3G6E A;  1VQP A;  2A1A A;  1SE4 A;  3CHB D;  4B3M Q;  4A3F G;  2UXC L;  1RL2 A;  1T9H A;  2KVM A;  1XMO L;  3RLO A;  5HGQ A;  4H02 A;  5LMU Q;  1CTM A;  1E2Z A;  2L9H A;  1M8A A;  3KFU A;  3PUV A;  1AE3 A;  1JB3 A;  2X6L A;  1NR2 A;  1T5X D;  1I94 Q;  1WTW A;  1K3R A;  4UAI A;  5LL6 S;  1WTQ A;  4F7X A;  4X66 Q;  2JK8 A;  3ITP A;  2JYO A;  3VYS A;  3A8I E;  3DMU A;  2HQE A;  5COY A;  5LMN L;  1K8G A;  2XN9 C;  3KF8 B;  4AQY L;  3DWQ A;  4DK6 C;  3D4W A;  4RH6 A;  2F0P A;  1TS3 A;  3PO3 G;  4JK1 C;  2L1B A;  3S16 B;  3Q6S A;  4LUZ A;  2OTL A;  5C3E B;  1K83 H;  3TP5 A;  1DD2 A;  2K50 A;  1KDA A;  2E2H H;  1HNW L;  5J1Z A;  2BA1 A;  3ER0 A;  5LL6 X;  2I5L X;  1X32 A;  5BN3 A;  1I4R A;  4BY7 G;  1PV4 A;  3KLW A;  2RHQ B;  1D8L A;  1O7Z A;  1J6Q A;  1AH9 A;  1VQ4 A;  1M90 C;  2GN5 A;  1FGB D;  3MXU A;  3Q0A A;  5D3I B;  4IJH A;  1E2V A;  1JWU D;  1N9W A;  3CU7 A;  1IYJ B;  1K8M A;  4MHE A;  1QCB D;  4DA2 A;  4DR4 Q;  5FLM H;  1MJE A;  5F2D A;  5DEH A;  1PVO A;  3GTK H;  3HRZ C;  5FO8 B;  1D5X C;  2A6H D;  1ZYR C;  1F2M A;  4XIG S;  1SYG A;  4IUR A;  1U4R A;  3ERS X;  1CFM A;  2XGT A;  4GNX A;  4NXN Q;  3HOZ G;  4K2K A;  5CC4 A;  1LTL A;  4JI5 Q;  1QUQ B;  2F0E A;  4C3J H;  1SSO A;  4DR7 Q;  1KDB A;  1IBK L;  4M1U B;  1QNK A;  5KEE A;  3A55 A;  4I65 A;  4IN3 A;  1SE8 A;  2Z6K A;  1UE6 A;  1X3F A;  1FNV A;  4EQO A;  1PHJ A;  1WTX A;  2B2W C;  3AFQ A;  4RCN A;  4JI3 L;  3SHL A;  3HFZ B;  4K5V A;  2OF1 A;  1CA5 A;  2EYJ A;  4C56 C;  2VUM B;  4WRD A;  3I2Z A;  1FR3 A;  1F2Y A;  1V1P A;  2DNC A;  1TY0 A;  5FKA C;  3NK9 A;  5D3D A;  4Y7N B;  2SNM A;  1GKH A;  3CF5 A;  5FO7 B;  4KHP Q;  5I2X A;  1WTR A;  3UI2 A;  3AMU A;  3FP9 A;  5IGE A;  5ELE A;  5A2Q L;  1W2B A;  1BKB A;  4NB3 A;  1Q86 C;  3K8A A;  4EX5 A;  2QIL A;  4NXM Q;  2R7Z G;  4LF4 Q;  4F8M A;  4DV6 L;  1P8L A;  2VS1 A;  2H1E A;  1LLR D;  3SK4 A;  3HOU H;  4CJ2 C;  2RDF A;  2WAC A;  1D7Q A;  3NPP A;  4A76 A;  1YNN C;  1KLG D;  4LF9 L;  4P73 A;  2F4V Q;  1KTK A;  3L2P A;  5EPL A;  4B9X A;  5C0X I;  3S1N H;  2E2H B;  1L0X B;  2KEC A;  2PO4 A;  3T1Y L;  3LNN A;  4PV1 C;  5GAG C;  4F87 A;  1LTB D;  3BVM A;  3FVQ A;  3CW2 C;  3HKZ B;  3W2D A;  4X64 Q;  3PO2 G;  2K5V A;  2Q2H A;  4L5Q A;  3F8T A;  3WOE A;  1C4Q A;  4EQP A;  3LWE A;  2LXK A;  4GOP C;  1BR9 A;  5M5Y B;  2ASB A;  1NMF A;  1PTO D;  1SND A;  3STB C;  4HJ9 A;  3CRL C;  3GTK B;  3SEB A;  1AN8 A;  2EE1 A;  4ODG A;  3PF4 A;  2DJG C;  2ZJP A;  4RGM A;  3R93 A;  1M1K C;  1AW7 A;  1NCV A;  1G29 1;  4GKK Q;  3CQZ H;  2A8V A;  2EYL A;  3M4Q A;  3J7A F;  2AQ3 B;  4GLA C;  2IY5 B;  4IPH A;  2A5H A;  1KD1 C;  2AUK A;  1VF7 A;  3A74 A;  1DM0 B;  3PIP A;  4CJ0 B;  4NDX A;  1HCZ A;  3E0J A;  2PQA A;  2A6E C;  3GV3 A;  1CZW A;  2ZXO A;  3T4A C;  4TRD A;  1S5C D;  4OGQ C;  5C5L A;  4A3I G;  4Q0F A;  1I5F A;  3I4L A;  3C2P A;  3MWY W;  1IL8 A;  4V19 0;  4J8Q A;  4R8N A;  1QG7 A;  3VYR A;  2ENB A;  1FGU A;  3RR5 A;  3J7A 5;  1TKW B;  4A3D G;  2BE5 D;  4IUQ A;  4XT3 B;  3BG3 A;  3BU2 A;  3GTP H;  1RTO A;  2PMZ E;  3TRZ A;  1ILP A;  4OON A;  3C1F A;  1WTH A;  1BDO A;  3J81 E;  3CC2 A;  1P16 A;  1A3U A;  1IBM L;  3ULP A;  1LV9 A;  1VQH A;  4OEL B;  4R4T A;  3QR8 A;  5EKK A;  4K14 A;  4WFN 3;  1N36 L;  4B3S L;  4JI6 Q;  1L1O A;  5NUC A;  4R4I A;  4GOP B;  1Y1W B;  3HOU B;  2F0K A;  3VA5 A;  5BR8 Q;  4HSV A;  1RKN A;  3Q24 A;  4LF8 L;  2WV6 D;  4BBS G;  1Y14 B;  3PUW A;  2DN8 A;  1HUN A;  2NZO A;  2E76 C;  4WOR A;  3J80 i;  5IGG A;  4A3B H;  4IUN A;  1N32 Q;  3S1N B;  4DAY A;  2HUG A;  2VW9 A;  1E24 A;  3D6C A;  4CHT B;  5T1G A;  4OWW B;  2JA7 H;  1STB A;  1VQI A;  2JEA I;  1SEB D;  1TS4 A;  2F0W A;  3EBE A;  4LF6 Q;  2K32 A;  3I4O A;  2B2V A;  3A54 A;  1S4Z A;  3K7A H;  1VQ7 A;  1YHA A;  1JJG A;  2EXD A;  2RSN A;  2ZJQ A;  3S1R H;  3EFX D;  1GUG A;  4AIM A;  3IAY A;  1HQR D;  5CV5 A;  2KQ3 A;  3TS2 A;  5K36 H;  2UUB L;  1LTA D;  3CQZ B;  2G5D A;  5HUR A;  1Y1V H;  4ALP A;  2JSO A;  2L15 A;  1HR0 L;  4DV4 L;  4XDX A;  2AKW B;  3GV6 A;  1PZI D;  3NBI A;  4YCW A;  1EIY B;  4KJO A;  4C1N I;  1RF2 D;  4R1J A;  4DFA A;  3UDF A;  3KJP A;  4B9W A;  3RNU A;  1E7Z A;  1J5E L;  3KDF B;  4XTC S;  5IYC H;  1HFG A;  1LTT D;  4DV7 Q;  1GXD C;  5I2Y A;  2K5Q A;  5FO9 B;  4L5T A;  3QB3 A;  3JAM L;  1C8C A;  4KLK A;  1TWC H;  5KGU A;  4IFD G;  2K28 A;  2MFI A;  5JJL A;  3I72 A;  3GTJ H;  1SFO H;  2A69 C;  1LT4 D;  1AE2 A;  3NSW A;  5IWA Q;  5DAU A;  3MXN A;  2F3W A;  2CH4 W;  3R2T A;  4JOI A;  1QE6 A;  3NBH B;  2D0P A;  5H1S E;  2KEN A;  2K75 A;  1GUO A;  4H44 C;  1E0B A;  5IYD G;  1CQV A;  4JG2 A;  3OW2 A;  3H15 A;  5G3L D;  4A4I A;  1JE4 A;  2CW0 C;  4JI2 L;  4JV5 L;  1LO5 D;  1D1I A;  3QIA A;  2HDM A;  2I0Q A;  2MQH A;  2SOB A;  4LFB Q;  1PYS B;  1AP0 A;  3HOW G;  3F2D A;  2JA6 H;  2KUM A;  1WTP A;  5C3W A;  2HIX A;  3NEL A;  2WP8 J;  1U9R A;  1CKN B;  1XNQ Q;  3BZK A;  3V05 A;  3DXJ C;  4C3H G;  1ZYR D;  2ZT9 C;  1O7Y A;  1GD7 A;  4A3B B;  4XQN A;  4HIM A;  5C44 B;  4L6T B;  4YY3 Q;  3VYT A;  1E22 A;  3S1M H;  3UDX A;  4QCL A;  1EYC A;  2LY7 A;  4DNI A;  2MNA A;  2JA7 B;  2Y0S G;  2YV5 A;  2HCI A;  4FVM A;  2HHH L;  1Z47 A;  1I6H B;  4AYB G;  3L9A X;  1KIX A;  3M4O H;  1Q12 A;  4A93 G;  2UUA Q;  2DJF C;  2F0S A;  1SMY C;  4Q5V A;  1HFN A;  1I4Q A;  3A5Z B;  3K7A B;  4GKJ L;  1I3Q H;  1EQR A;  1VQM A;  5IT9 L;  1KL9 A;  1D2B A;  1FYC A;  2D5D A;  4FF4 A;  3CCV A;  3S1R B;  1BNZ A;  1PLF A;  1YVC A;  4DR3 L;  1SJE D;  1Y1V B;  5DM7 3;  4K0K L;  1EY5 A;  3MA2 B;  1VQD A;  3I70 A;  2M2L A;  2ZTD A;  1UE7 A;  3OWF A;  1I6V C;  4O1N A;  4JW0 A;  1A2T A;  5FLX L;  3C46 A;  4RMF A;  4QUC A;  3W3A A;  4TSS A;  3OIQ A;  3K0Y A;  1JOR A;  1XJV A;  2CVR A;  2EPB A;  4JI7 Q;  1JJC B;  5JEA H;  1XMQ L;  2RHS B;  1NUC A;  2LFN A;  3TME A;  5LMU L;  1N8R C;  2JA5 G;  3KUP A;  1F77 A;  1U4M A;  2IJ0 A;  2BDO A;  3GTJ B;  1YNN D;  3ULJ A;  3A8K E;  5E4W C;  1SNM A;  1OXS C;  2JA8 H;  1PYB A;  3H09 A;  3NHH A;  5IOC A;  5CV6 A;  3K5L A;  4XT1 B;  2YU9 H;  3RN2 A;  3WDN A;  4LF5 Q;  3O13 A;  1TWF B;  2G9H D;  2RF4 A;  1SJH D;  1HPC A;  1VMC A;  3D4D A;  5AJ3 L;  1JC7 A;  1YJW A;  3TSS A;  4ME5 A;  3OYY A;  4DGZ A;  2K6A A;  2B2U A;  3N52 A;  2JA6 B;  1B1Z A;  1PFN A;  1B9N A;  2B3G A;  3SGI A;  3TN2 A;  2Q2T A;  1E2W A;  2KA7 A;  3FPU B;  4L5R C;  3STB D;  1C48 A;  5M9O A;  4RCO A;  3S24 A;  3BDO A;  2IWH A;  4A3M G;  2UXD L;  2QCP X;  3URY A;  1YIJ A;  1EQV A;  1SN8 A;  1VQF A;  1K8O A;  3CD6 A;  2N78 A;  2RDG A;  4LUV A;  1CQF A;  2EDG A;  4A3E G;  3KLS A;  3Q22 A;  1Q46 A;  1SYD A;  3HOV H;  3M4O B;  1PH9 A;  3SE0 A;  2A6E D;  2I5M X;  2F0V A;  1I3Q B;  4A3G G;  3K80 C;  1NJI C;  4LFC Q;  1A2U A;  1XPU A;  1VQG A;  3UE0 A;  4GN3 B;  2F0G A;  5M3M H;  4FYD A;  5IGC A;  1U4P A;  2KHS A;  1HA6 A;  1S40 A;  2E2J B;  2BH8 A;  2D0O A;  1LTR D;  4DPG A;  4RGN A;  3I91 A;  4C2M H;  3OWE B;  4F88 A;  1A6X A;  3SXH A;  4A3J H;  5M3M G;  3M4Y A;  5M3F H;  1EY7 A;  4BY1 B;  3U9S A;  2I46 A;  3TQY A;  1HNX Q;  4DK3 C;  3EVQ A;  3D31 A;  4G7O C;  1FD7 D;  3MFY A;  2Y0S E;  4OHJ A;  4AYB E;  3D8G A;  1N33 L;  4DV2 Q;  1STY A;  2Q8T A;  3OIP A;  1SDF A;  1CKO A;  2R7D A;  5IP7 H;  4YHH Q;  3HZX A;  5IP9 G;  4X62 L;  1ENC A;  1G51 A;  1PH7 A;  2F03 A;  1ICF B;  2R93 B;  1E3P A;  3CP0 A;  4A3F H;  1BCP C;  2VY3 A;  2JA8 B;  4IUP A;  3KLR A;  1SYC A;  4LFA Q;  4YCV A;  4ID6 A;  2R7F A;  4UP8 A;  1A3T A;  1X65 A;  1I50 B;  2B2Y C;  1CHQ D;  3NE5 B;  4PNY A;  2WIN B;  1CUK A;  1WTO A;  4A3L G;  1EL0 A;  1BBU A;  2PNR C;  5KRU A;  1EYD A;  4ZKB B;  4KMU C;  2F4V L;  3K5N A;  4KHZ A;  1CSP A;  3FKI G;  1FVI A;  1S5B D;  2C9O A;  2ATW A;  3IRB A;  3GTL B;  3PO3 H;  2F1M A;  3KLS X;  3I56 A;  2NZH A;  2G9D A;  3K81 C;  3PIO 3;  2ZTC A;  4X64 L;  3A0J A;  4GNX C;  1EY0 A;  2NBF A;  1IW7 C;  1FNW A;  5JAV A;  4BY7 H;  3PIP 3;  3BDL A;  4CBV A;  1JWM D;  1GUT A;  3HOV B;  2ICI A;  1WYD A;  4K5X A;  3F2B A;  3PCO B;  3ERQ A;  3T13 A;  3T1H Q;  1S5E D;  3I4M G;  3L0O A;  1JOO A;  4QJF A;  4MIU A;  3GTO B;  4OIJ A;  2K1B A;  4GKK L;  1K0R A;  2XTI A;  2VL6 A;  2A19 A;  1SNC A;  3I4N G;  4PZ7 A;  2A69 D;  2KCC A;  1RCV D;  1PFM A;  1O80 A;  4A3J B;  3TP6 A;  4XYO A;  4JI8 L;  4DF7 A;  1TWA B;  4IJL A;  3HOZ H;  2NVQ B;  5M3F B;  1BCP B;  1PXU A;  1JE5 A;  1CM9 A;  1QUQ A;  3KF6 A;  3GTM H;  1EQT A;  2VQE Q;  4BXX G;  3S17 B;  4JI1 L;  2V1C C;  1HA5 A;  4DV3 L;  1PA6 A;  1Q90 A;  2JE6 I;  2TMP A;  3M85 A;  1YI2 A;  3CCU A;  2CW0 D;  1CA6 A;  1QZG A;  3HOX G;  1QB5 D;  3CCR A;  4DR1 Q;  5I6Y A;  3NEN A;  2FXQ A;  3VR2 A;  1B3Q A;  3QWN A;  4J15 A;  3VR3 A;  1X3P A;  2QF7 A;  1LM0 A;  2WAQ B;  1L0Y B;  1HZC A;  4ABN A;  1TT2 A;  5GAH C;  1HR0 W;  3X3N A;  1EIG A;  1AZP A;  4A3K G;  3CC7 A;  2PNH A;  3QOL A;  2IX3 A;  3IFD A;  1HUM A;  3OOC A;  3S14 B;  4HAE A;  3H0G G;  4DUZ L;  3CCE A;  2WB1 G;  3CME A;  4HID A;  1NR4 A;  3G6J B;  4MTN A;  1I4P A;  2VB3 X;  3LX0 A;  5KIX A;  4GNX B;  2E74 C;  1SAP A;  5C6A A;  4KKS A;  5FJ8 G;  1SMY D;  2HIV A;  4C3I H;  2XSC A;  5CV9 A;  2L11 A;  1X3Q A;  2R7Z H;  1FNU A;  2K05 A;  1N32 L;  4C3I G;  2VQF Q;  1JCK B;  5JVG 3;  4PMW A;  1HZA A;  4EQN A;  3PO3 B;  1DXM A;  2BH2 A;  1IKM A;  3PGZ A;  4R9W A;  4DV1 Q;  3HOY G;  1LAB A;  4CKC A;  5C4J H;  1V1P B;  2FIN B;  3I3C A;  4N9T A;  1EWI A;  2TSS A;  4JYA Q;  4DV5 Q;  2F4I A;  3KOJ A;  4OO1 G;  4LF6 L;  2N8N A;  4GLX A;  1JOQ A;  4BY7 B;  1GUS A;  2MJ8 A;  1K83 B;  2P5Z X;  2MO0 A;  1ESR A;  5EQ0 A;  2Z6B A;  4YWK A;  3PO2 H;  2RBM A;  4LK1 C;  1XMO Q;  1HH2 P;  1YNJ C;  4UDU C;  3NWS A;  1K3B C;  2B2W A;  2GVA A;  5KYL A;  1O7I A;  4CDE C;  1X56 A;  1DGS A;  2YTV A;  5CR3 A;  4JC0 A;  3FPP A;  3SR1 A;  5AFW A;  5LMN Q;  2PMZ B;  3MHB A;  4WJW A;  4ZK9 B;  2N88 A;  1VF5 C;  2PCF B;  2WFW A;  3HOZ B;  3GTM B;  2VXW A;  1QOH A;  4AQY Q;  4O42 A;  5GRO A;  1FJG Q;  1D5M C;  1MI2 A;  2FMM A;  3MZ5 A;  2K5W A;  4ZUJ A;  5A35 A;  2EYO A;  4H7B A;  3AFP A;  3MTS A;  2RKS A;  2ZM6 L;  2B8F A;  4RKL A;  4C3J B;  1VQE A;  4G7Z C;  2AUJ D;  4KK7 A;  1HNW Q;  5JJK A;  1KNE A;  5IWA L;  4A3I H;  4FDB A;  1TQO A;  1Q8K A;  1PFS A;  2F0F A;  3CMA A;  1PMR A;  2K4K A;  1L1O C;  4IAL A;  4ILW A;  4DUY Q;  3PSI A;  1CT1 D;  2RA4 A;  4KY7 A;  4IFD J;  1I4G A;  2F52 A;  4A3D H;  3DEO A;  4B3T Q;  1STA A;  3MXP A;  3CPW A;  1HHV A;  1CK1 A;  5KNB A;  4ZLT F;  4B3R L;  1SNP A;  4XQQ A;  1C7Y A;  1LTI D;  5IYB G;  4G57 A;  1A8V A;  4LMQ D;  2N49 A;  4LW1 A;  1F9Q A;  4PMC A;  4YIJ A;  3DEP A;  4DXG A;  5EBC A;  3VA7 A;  3D6W A;  1TWH H;  5C3X A;  3J80 E;  2MGS A;  2EZV A;  3WWV A;  2R7Z B;  2B2V C; 
#chains in the Genus database with same CATH homology
 1TS5 A;  1KAB A;  1QJO A;  2RVL A;  3SK8 A;  3C3L A;  3K5O A;  4IZ8 A;  1T5E A;  2XRS D;  4H0L C;  2XVS A;  4U67 3;  2Q8R E;  1J9O A;  3R2I A;  2EY1 A;  4KKT A;  2Z1C A;  4GZY C;  1J8I A;  1EZ8 A;  5JVH 3;  1OXT A;  5HGT A;  3PO2 B;  2OT2 A;  1OXV A;  1EOT A;  3T51 B;  1PRT C;  1V43 A;  4QIW B;  4FF2 A;  3IL8 A;  3J81 L;  3E5S A;  5ELD A;  3MEH A;  1G6Z A;  1BCP D;  1WVL A;  3K57 A;  1Z6H A;  5E3F A;  4NKL A;  1RD9 D;  4RWS C;  1VCI A;  1W6J A;  1XYI A;  1EEF D;  3U9O A;  5CBE E;  2JXM B;  2Z4I A;  1F9R A;  2J0T D;  3NWT A;  4A3I B;  3GP7 A;  4IFD H;  2PPB C;  3BS1 A;  4CGY B;  2IT1 A;  3NQI A;  4A3D B;  4XXE A;  5JEA J;  3NBH A;  3MXG A;  4MN3 A;  1IW7 D;  2H4O A;  1V1O A;  2B8G A;  2BCO A;  3EA6 A;  3DHQ A;  3GTP B;  1EU4 A;  2WII B;  4PMB A;  1TWH B;  1Q3L A;  4HR7 B;  2KOL A;  5IGD A;  3C1E A;  4J1M A;  2O5J C;  2NN6 G;  2EYH A;  2MP1 A;  3TZU A;  4KKU A;  5C5M A;  4EGV A;  1PRT B;  4CKE A;  1M4V A;  3MAQ A;  2MPM A;  5CV4 A;  1DON A;  4BBS B;  3S2D B;  5G3L F;  2K04 A;  2EJM A;  3QO2 A;  1G2T A;  1SNO A;  4IUV A;  4DK0 A;  5KND A;  3KBX A;  4S3S A;  5CV7 A;  1SNQ A;  2EYF A;  1LT6 D;  3ONA B;  1SYE A;  2XIW A;  2O4X A;  1UEA B;  3AB9 A;  1B9M A;  4DXF A;  2EYM A;  4U68 A;  2HDL A;  2AWN A;  2F0H A;  1B50 A;  1EY8 A;  3PUZ A;  1BOS A;  5EKI A;  2KJX A;  4NP5 A;  2NVY B;  1H9K A;  2FHT A;  3RD4 A;  1XWE A;  1RDP D;  2JP1 A;  1SXT A;  4BA1 I;  2O2L D;  2J7Z A;  2F0D A;  1Z7T A;  3HS0 C;  1XXG A;  2L0C A;  2XWJ B;  3K5M A;  3M7G A;  4G7H C;  2CQA A;  3N6R A;  1TWC B;  5JPM C;  4RA8 A;  4PQX A;  4DU9 A;  2GA4 B;  3A8J E;  1SFO B;  1GOZ A;  2N55 A;  3DUZ A;  3A7L A;  2O5I C;  3D4R A;  4K8I A;  1YNJ D;  4K5W A;  3HOW B;  1B53 A;  2XNA C;  4N9P A;  2HCC A;  3SK5 A;  1BXT A;  3ERO A;  5J22 A;  5K5P A;  4C3H B;  3H94 A;  1H9S A;  4RHS A;  1UAP A;  2ICE C;  1DOK A;  3NTI A;  2B2T C;  2R61 A;  2QDB A;  4AYB B;  3S1M B;  4QF4 A;  4A93 B;  1JQY D;  2YYZ A;  4ZAI A;  1RHP A;  2E2I B;  3GO5 A;  3CRK C;  2ZXR A;  2F0I A;  2Z4H A;  4XYQ A;  1IKL A;  5JPN C;  1STG A;  3HEJ A;  4RFB A;  1DYQ A;  4IUT A;  4FF3 A;  4FXK C;  1WTV A;  1EZ6 A;  5ELB A;  2XWB B;  4DNT B;  2L4N A;  3S15 B;  1H9J A;  3HG9 A;  3I8Z A;  2K7V A;  5COR A;  5C0X G;  1O78 A;  1AZQ A;  4ZRZ A;  4HTH A;  2PZU A;  1A15 A;  1PYW D;  4OL7 A;  1D5Z C;  3WOF A;  4IFD I;  1IYU A;  2JA5 B;  4FP5 D;  4ZQ3 A;  4Z9C B;  4KN4 C;  4NMZ A;  4RGT A;  4V0B A;  2NZ1 D;  2F0M A;  1DOM A;  3OMG A;  1RJT A;  2YU9 B;  3OHX C;  1PRT D;  1Y69 U;  2NWG A;  3P1H A;  3T53 B;  2IL8 A;  3V2T A;  2NB0 A;  2AWO A;  3RMH A;  2SEB D;  3KF8 A;  2L12 A;  4FXD A;  2R3Z A;  3NXW A;  1ZKO A;  4BWG B;  3TP8 A;  1W6K A;  5I9P A;  1ROD A;  2E75 C;  4A3E B;  5D14 A;  2J4X A;  1QIL A;  2EXZ A;  1B2T A;  3TDQ A;  1D6E C;  5EKL A;  4LAA A;  4ZKC B;  1IHZ A;  4A3G B;  3NUC A;  5KNC A;  2ID0 A;  4RHR A;  4X3S A;  3DWP A;  1ENF A;  5CGK A;  5M3M B;  3K58 A;  5CYU A;  3A7A B;  4K2L A;  3FEW X;  2NVT B;  4FNF A;  4C2M B;  2QKI C;  5I4D A;  3X3M A;  3QG1 A;  2B2Y A;  1H9R A;  1MD2 D;  5EBD A;  5T1I A;  4R8I A;  4KI0 A;  1KNA A;  4QUF A;  4KY5 A;  2I07 B;  5EGT A;  2F0L A;  2QEJ C;  4EVO A;  4OIK A;  3VR6 A;  4ZYS A;  3BYT B;  3M7N A;  2Q8I B;  3H3V C;  1V8Q A;  2K03 A;  3IFT A;  1A3V A;  4A3F B;  2RQX A;  1R9T B;  1R4Q B;  1OXX K;  5A2Q E;  3R3O A;  4QMG A;  4P2C B;  1F9P A;  1G8Z D;  4C3J G;  2AQ2 B;  4IQZ A;  3FKI B;  4IUU A;  4K6D A;  1VMP A;  2A73 B;  3TZD A;  4M8A A;  5EJW A;  3BYY B;  1DCZ A;  2IW3 A;  4K6L A;  1EY6 A;  2EJF C;  3DM1 A;  3SK6 A;  3SVM A;  2CHB D;  1ZXT A;  1B4O A;  4OO1 H;  2RDH A;  2Z8L A;  2NYZ D;  5ISR A;  1D1K A;  3HGB A;  2AQ1 B;  2K01 A;  3M3Y B;  2F0N A;  1SBB B;  1UUP A;  3I4M B;  2A68 C;  2PQE A;  2FFK B;  2NTT A;  4TKO B;  1ILQ A;  1LTG D;  1Y8O B;  3I4N B;  1MBY A;  3MFG A;  2IX1 A;  2EVB A;  3NQT A;  2PW5 A;  2VNU D;  3KK7 A;  2F0J A;  3VR4 A;  2EOT A;  3OSO A;  2D2C C;  1RTN A;  1AEX A;  2D9U A;  3ND8 A;  1ET9 A;  3RUZ A;  1CZG A;  3HOX B;  2X6G A;  3GTG B;  3LWU A;  3Q23 A;  1PTO F;  3V96 A;  5I6W A;  1ICW A;  1OO9 B;  1SYF A;  4A3K B;  3QOJ A;  1I4X A;  2DY7 A;  1F2L A;  3H0G B;  4K8J A;  4HMJ A;  1H9M A;  2WB1 B;  2KEE A;  2VB2 X;  3PV0 A;  3BVZ A;  1GUN A;  4B08 A;  4X3K A;  4DAV A;  2ZXP A;  4DN4 M;  1Y8P B;  1O7L A;  3GD7 A;  3RLF A;  3GTQ B;  1MSH A;  5LHY 1;  3L7Z C;  2BA0 A;  4ULL A;  1TS2 A;  2BDN A;  4L63 B;  4BA2 I;  2IPK D;  3J7Y W;  4TQU S;  4C3I B;  5CV8 A;  1ESF A;  1MGS A;  5EPK A;  1AFP A;  1GJX A;  1S5D D;  2MUY A;  3HOY B;  5C4Z A;  2R6G A;  3OW7 A;  1EU3 A;  3FDT A;  3ZYY X;  1BF4 A;  5IIF A;  5C4J B;  1EFI D;  3HP3 A;  5DNF A;  3PUX A;  1TII D;  4KV6 A;  2WKD A;  1HXY D;  2F0T A;  4FXG C;  2EJG C;  3K59 A;  5JOB A;  2K5D A;  3J80 L;  4X3U A;  4KD3 A;  1F2Z A;  4HCE A;  4KD4 A;  3S9W A;  4DNR B;  5I9O A;  1EEI D;  2E2D C;  4RGO S;  1WD1 A;  3DWA A;  4RKB A;  1B44 D;  3VR5 A;  4G4K A;  2WKC A;  1GHK A;  1BCP F;  1PZJ D;  2B39 A;  3NP8 A;  2JEB I;  3RZD B;  3EQL C;  3JAM E;  5CBA E;  1EIH A;  1CI3 M;  2A74 C;  1SYB A;  1XX8 A;  1B3A A;  2L5T A;  1F9S A;  3T16 A;  3MVV A;  2M00 A;  4HSP A;  4DK1 A;  1LT3 D;  4HCS A;  3FMC A;  3NTK A;  2NUC A;  1JWS D;  5K36 G;  4XQJ A;  1LTS D;  4FO2 A;  3EJI A;  1G91 A;  2NN6 H;  3BVG A;  1ML0 D;  4HMI A;  5D65 A;  4J6H A;  2FJ2 A;  2F0U A;  2SNS A;  4I7Z C;  1EYA A;  1TU2 B;  5E4X A;  3TBI B;  4KY6 A;  1Q1E A;  4OO1 I;  4H13 C;  1TWG B;  2PZW A;  1ZEQ X;  1SE3 A;  4KN7 C;  1STE A;  2KED A;  2A6H C;  4KJN A;  1HQM C;  2B63 B;  4L8J A;  1GHJ A;  3I90 A;  1TR5 A;  2LMC B;  1IYV A;  4KTA A;  1G2S A;  1QWY A;  5IT9 E;  3L3O C;  1BQQ T;  2IX0 A;  1JR0 D;  2PW7 A;  2PYK A;  3P75 A;  2L55 A;  4X3T A;  1ENA A;  1HTL D;  1Y8N B;  4HN7 A;  3MC0 B;  1JOK A;  2BOS A;  5IGB A;  2FMC A;  2SDF A;  5IOD A;  1ONL A;  5FK9 C;  3S2H B;  2DY8 A;  3J7A V;  5C4X B;  5FLX E;  3OPO A;  1NAP A;  5C0X J;  1GUW A;  3SDZ A;  1II3 A;  1TVX A;  3I73 A;  2NTS A;  5FOB B;  2D62 A;  3OMC A;  2LS0 1;  5M5X B;  2B2U C;  1DJR D;  3P20 A;  3T56 B;  3G7L A;  2OXP A;  4KHV A;  2EY5 A;  1PTO H;  5BN5 A;  2XRQ D;  3FRP B;  2V4D A;  4BS9 A;  2X69 A;  4HED A;  4JBW A;  2A68 D;  2KCN A;  5EPJ A;  2R92 B;  1NSN S;  5E1F A;  2EY6 A;  1BBX C;  3P7J A;  4QB4 A;  1OXU A;  3AU7 A;  1KDC A;  1STN A;  4CKB A;  4C1N K;  2NVX B;  5JEA G;  1ET6 A;  1TY2 A;  3A56 A;  3H91 A;  1MSG A;  1PTO C;  2DNE A;  5TSS A;  3VYU A;  1WD0 A;  1KLU D;  2Y0S B;  2LKV A;  2C5C A;  1HTP A;  4DAP A;  1R4P B;  1Q1B A;  1KAA A;  1QNU A;  3KBG A;  3PMF A;  5KYI A;  2F3V A;  2F0Q A;  1EWH A;  1BUV T;  4RAU C;  1H9S B;  3S1Q B;  1VDZ A;  3QJY A;  5M5W B;  1LT5 D;  4NW2 A;  3RZO B;  1PDQ A;  5BN4 A;  2BE5 C;  1JIC A;  3PUY A;  5C0X H;  1S5F D;  1Q8I A;  3TP7 A;  5DM6 3;  4ZUI A;  5ELC A;  2OEO A;  5J39 A;  2K33 A;  2EY2 A;  4FF1 A;  3K6O A;  4BBR B;  2EYP A;  4LJZ C;  5ELF A;  5C4H A;  5CMD A;  3NTH A;  5JJZ A;  1PTO B;  3F2U A;  2B2T A;  2MHV A;  1EY4 A;  1HRJ A;  4E6I A;  3IKJ A;  1UNS A;  3D3R A;  3ND9 A;  2F0O A;  1EWC A;  1PFB A;  2NN6 I;  1LAC A;  2PZT A;  1PZK D;  5IGF A;  3BZD B;  1CHP D;  3E6Z X;  3R8B A;  1STH A;  1BO0 A;  1WCM B;  3GQB A;  2M9V A;  4CJ1 B;  1DZ1 A;  1EY9 A;  3CKI B;  1U4L A;  4A3M B;  1PRT F;  3BDC A;  1I4H A;  2RSO A;  1SE2 A;  1DOL A;  1XTC D;  3H6M A;  1SE4 A;  3CHB D;  2KVM A;  1CTM A;  1E2Z A;  2L9H A;  1M8A A;  3PUV A;  1JB3 A;  2X6L A;  1NR2 A;  1T5X D;  1WTW A;  4UAI A;  5LL6 S;  1WTQ A;  4F7X A;  3ITP A;  2JYO A;  3VYS A;  3A8I E;  3DMU A;  2HQE A;  5COY A;  2XN9 C;  3DWQ A;  3D4W A;  4RH6 A;  2F0P A;  1TS3 A;  4JK1 C;  2L1B A;  3S16 B;  3Q6S A;  5C3E B;  3TP5 A;  1DD2 A;  1KDA A;  5J1Z A;  2BA1 A;  5LL6 X;  1X32 A;  5BN3 A;  1I4R A;  1O7Z A;  1FGB D;  3MXU A;  3Q0A A;  5D3I B;  1E2V A;  1JWU D;  3CU7 A;  1K8M A;  4MHE A;  1QCB D;  4DA2 A;  5F2D A;  5DEH A;  3HRZ C;  5FO8 B;  1D5X C;  2A6H D;  1ZYR C;  1F2M A;  4XIG S;  1SYG A;  4IUR A;  1U4R A;  1CFM A;  4K2K A;  5CC4 A;  2F0E A;  1SSO A;  1KDB A;  4M1U B;  1QNK A;  5KEE A;  3A55 A;  4I65 A;  4IN3 A;  1FNV A;  4EQO A;  1WTX A;  2B2W C;  4RCN A;  3SHL A;  4K5V A;  2OF1 A;  1CA5 A;  2EYJ A;  4C56 C;  2VUM B;  4WRD A;  1FR3 A;  1F2Y A;  1V1P A;  2DNC A;  1TY0 A;  5FKA C;  3NK9 A;  5D3D A;  4Y7N B;  2SNM A;  5FO7 B;  5I2X A;  1WTR A;  3UI2 A;  3AMU A;  5IGE A;  5ELE A;  5A2Q L;  2QIL A;  4F8M A;  2H1E A;  1LLR D;  3SK4 A;  4CJ2 C;  2RDF A;  2WAC A;  3NPP A;  1YNN C;  1KLG D;  1KTK A;  5EPL A;  4B9X A;  5C0X I;  2E2H B;  1L0X B;  2KEC A;  2PO4 A;  3LNN A;  4PV1 C;  4F87 A;  1LTB D;  3BVM A;  3FVQ A;  3HKZ B;  3W2D A;  3WOE A;  1C4Q A;  4EQP A;  3LWE A;  1BR9 A;  5M5Y B;  1PTO D;  1SND A;  3CRL C;  3GTK B;  3SEB A;  1AN8 A;  2EE1 A;  4ODG A;  4RGM A;  3R93 A;  1AW7 A;  1NCV A;  1G29 1;  2EYL A;  3J7A F;  2AQ3 B;  2A5H A;  2AUK A;  1VF7 A;  1DM0 B;  4CJ0 B;  4NDX A;  1HCZ A;  3E0J A;  2A6E C;  3GV3 A;  1CZW A;  2ZXO A;  3T4A C;  4TRD A;  1S5C D;  4OGQ C;  5C5L A;  4Q0F A;  3I4L A;  3C2P A;  3MWY W;  1IL8 A;  4V19 0;  4J8Q A;  4R8N A;  1QG7 A;  3VYR A;  2ENB A;  1TKW B;  2BE5 D;  4IUQ A;  4XT3 B;  3BG3 A;  1RTO A;  1ILP A;  3C1F A;  1BDO A;  3J81 E;  1A3U A;  1LV9 A;  5EKK A;  4K14 A;  4WFN 3;  5NUC A;  1Y1W B;  3HOU B;  2F0K A;  3VA5 A;  4HSV A;  1RKN A;  3Q24 A;  2WV6 D;  3PUW A;  2DN8 A;  1HUN A;  2E76 C;  4WOR A;  5IGG A;  4IUN A;  3S1N B;  4DAY A;  2HUG A;  3D6C A;  4CHT B;  5T1G A;  1STB A;  2JEA I;  1SEB D;  1TS4 A;  2F0W A;  2K32 A;  2B2V A;  3A54 A;  1S4Z A;  2RSN A;  3EFX D;  1GUG A;  3IAY A;  1HQR D;  5CV5 A;  2KQ3 A;  5K36 H;  1LTA D;  3CQZ B;  5HUR A;  2JSO A;  4XDX A;  3GV6 A;  1PZI D;  3NBI A;  4KJO A;  4C1N I;  1RF2 D;  4DFA A;  4B9W A;  4XTC S;  1HFG A;  1LTT D;  1GXD C;  5I2Y A;  2K5Q A;  5FO9 B;  3QB3 A;  3JAM L;  1C8C A;  5KGU A;  4IFD G;  2K28 A;  3I72 A;  2A69 C;  1LT4 D;  3NSW A;  5DAU A;  3MXN A;  2F3W A;  3R2T A;  1QE6 A;  1GUO A;  4H44 C;  1E0B A;  1CQV A;  5G3L D;  1JE4 A;  2CW0 C;  1LO5 D;  1D1I A;  3QIA A;  2HDM A;  2SOB A;  1AP0 A;  2KUM A;  1WTP A;  5C3W A;  2WP8 J;  1U9R A;  3V05 A;  3DXJ C;  4C3H G;  1ZYR D;  2ZT9 C;  1O7Y A;  4A3B B;  4XQN A;  5C44 B;  4L6T B;  3VYT A;  4QCL A;  1EYC A;  2LY7 A;  2JA7 B;  2HCI A;  4FVM A;  1Z47 A;  1I6H B;  3L9A X;  1Q12 A;  2F0S A;  1SMY C;  4Q5V A;  1HFN A;  1I4Q A;  3K7A B;  5IT9 L;  1D2B A;  1FYC A;  2D5D A;  4FF4 A;  3S1R B;  1BNZ A;  1PLF A;  1SJE D;  1Y1V B;  5DM7 3;  1EY5 A;  3MA2 B;  3I70 A;  2M2L A;  3OWF A;  1I6V C;  4O1N A;  1A2T A;  5FLX L;  3C46 A;  4QUC A;  3W3A A;  4TSS A;  3OIQ A;  3K0Y A;  1JOR A;  2CVR A;  2EPB A;  5JEA H;  1NUC A;  2LFN A;  3TME A;  3KUP A;  1F77 A;  1U4M A;  2IJ0 A;  2BDO A;  3GTJ B;  1YNN D;  3A8K E;  5E4W C;  1SNM A;  1OXS C;  3H09 A;  3NHH A;  5IOC A;  5CV6 A;  3K5L A;  4XT1 B;  3WDN A;  3O13 A;  1TWF B;  2G9H D;  1SJH D;  1HPC A;  1VMC A;  3D4D A;  1JC7 A;  3TSS A;  4ME5 A;  4DGZ A;  2K6A A;  2B2U A;  3N52 A;  2JA6 B;  1B1Z A;  1PFN A;  1B9N A;  3TN2 A;  1E2W A;  2KA7 A;  3FPU B;  1C48 A;  5M9O A;  4RCO A;  3BDO A;  2IWH A;  2QCP X;  3URY A;  1EQV A;  1K8O A;  2RDG A;  1CQF A;  2EDG A;  3KLS A;  3Q22 A;  1SYD A;  3M4O B;  3SE0 A;  2A6E D;  2F0V A;  1I3Q B;  1A2U A;  2F0G A;  4FYD A;  5IGC A;  1U4P A;  2KHS A;  1HA6 A;  2E2J B;  1LTR D;  4RGN A;  3I91 A;  3OWE B;  4F88 A;  1A6X A;  3SXH A;  3M4Y A;  1EY7 A;  4BY1 B;  3U9S A;  2I46 A;  3EVQ A;  3D31 A;  4G7O C;  1FD7 D;  3MFY A;  4OHJ A;  3D8G A;  1STY A;  2Q8T A;  3OIP A;  1SDF A;  3HZX A;  1ENC A;  2F03 A;  2R93 B;  1BCP C;  2JA8 B;  4IUP A;  3KLR A;  1SYC A;  4ID6 A;  1A3T A;  1I50 B;  2B2Y C;  1CHQ D;  3NE5 B;  4PNY A;  2WIN B;  1WTO A;  1EL0 A;  2PNR C;  5KRU A;  1EYD A;  4ZKB B;  4KMU C;  3K5N A;  4KHZ A;  1S5B D;  2C9O A;  3GTL B;  2F1M A;  3KLS X;  2G9D A;  3PIO 3;  1EY0 A;  2NBF A;  1IW7 C;  1FNW A;  5JAV A;  3PIP 3;  3BDL A;  4CBV A;  1JWM D;  1GUT A;  3HOV B;  2ICI A;  4K5X A;  3ERQ A;  3T13 A;  1S5E D;  1JOO A;  4MIU A;  3GTO B;  4OIJ A;  2K1B A;  1SNC A;  2A69 D;  2KCC A;  1RCV D;  1PFM A;  1O80 A;  4A3J B;  3TP6 A;  4XYO A;  4DF7 A;  2NVQ B;  1TWA B;  5M3F B;  1BCP B;  1PXU A;  1CM9 A;  3S17 B;  1EQT A;  1HA5 A;  1Q90 A;  2JE6 I;  2TMP A;  3M85 A;  2CW0 D;  1CA6 A;  1QB5 D;  5I6Y A;  3VR2 A;  3QWN A;  3VR3 A;  1X3P A;  2QF7 A;  2WAQ B;  1L0Y B;  4ABN A;  1TT2 A;  3X3N A;  1EIG A;  1AZP A;  3QOL A;  2IX3 A;  3IFD A;  1HUM A;  3OOC A;  3S14 B;  4HAE A;  1NR4 A;  3G6J B;  1I4P A;  2VB3 X;  3LX0 A;  5KIX A;  2E74 C;  1SAP A;  5C6A A;  4KKS A;  1SMY D;  2XSC A;  5CV9 A;  2L11 A;  1X3Q A;  1FNU A;  2K05 A;  4C3I G;  5JVG 3;  1JCK B;  4PMW A;  4EQN A;  3PO3 B;  1DXM A;  1IKM A;  4R9W A;  1LAB A;  4CKC A;  1V1P B;  2FIN B;  3I3C A;  4N9T A;  2TSS A;  4OO1 G;  2F4I A;  1JOQ A;  4BY7 B;  1GUS A;  2MJ8 A;  1K83 B;  1ESR A;  5EQ0 A;  2RBM A;  4LK1 C;  1YNJ C;  4UDU C;  3NWS A;  2B2W A;  5KYL A;  5CR3 A;  3FPP A;  3SR1 A;  5AFW A;  2PMZ B;  3MHB A;  4WJW A;  4ZK9 B;  2N88 A;  1VF5 C;  2PCF B;  3HOZ B;  3GTM B;  2VXW A;  1QOH A;  4O42 A;  1D5M C;  1MI2 A;  2FMM A;  3MZ5 A;  2K5W A;  4ZUJ A;  5A35 A;  2EYO A;  4H7B A;  3MTS A;  2RKS A;  2B8F A;  4RKL A;  4C3J B;  4G7Z C;  2AUJ D;  4KK7 A;  1KNE A;  1TQO A;  2F0F A;  1PMR A;  4ILW A;  4IAL A;  1CT1 D;  2RA4 A;  4KY7 A;  4IFD J;  1I4G A;  3DEO A;  1STA A;  3MXP A;  1HHV A;  1CK1 A;  5KNB A;  4ZLT F;  1SNP A;  4XQQ A;  1LTI D;  4G57 A;  4LMQ D;  1F9Q A;  4PMC A;  4YIJ A;  3DEP A;  4DXG A;  5EBC A;  3VA7 A;  3D6W A;  5C3X A;  3J80 E;  2MGS A;  2EZV A;  2R7Z B;  2B2V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...