5IGDA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/i92e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/I92E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igdA00
4E6IA 2RDFA 4K5WA 3D4WA 1A3TA 1RKNA 1U9RA 2EYJA 1KDAA 3ERQA 4IZ8A 2EYPA 4QF4A 1STHA 4G57A 4K2LA 2KHSA 5EGTA 1F2ZA 3E5SA 4RKBA 3SXHA 5IGFA 2EYFA 3NP8A 4QMGA 5J39A 1SNOA 4J1MA 1EY6A 4TRDA 3TP8A 1TT2A 2PZTA 3VA5A 3V2TA 4F8MA 2EY1A 5K5PA 2ENBA 1STGA 2NUCA 2RKSA 3NK9A 1EZ8A 4ID6A 2F0TA 1KDBA 5I9PA 5HURA 1EY5A 1SNDA 3HEJA 1TQOA 4EVOA 4F7XA 2PW7A 5IIFA 5IGDA 4I65A 2F0KA 1A3VA 4LAAA 4OL7A 3SHLA 5I6YA 4ZUJA 4DGZA 1EZ6A 3TP5A 4EQNA 2SOBA 1EYAA 3MZ5A 1NSNS 5IODA 1KABA 2F0GA 3PMFA 1KAAA 4R8NA 5J1ZA 4B9XA 1JORA 2F0HA 4KY5A 3U9OA 4KTAA 3QOJA 1EY9A 2EYMA 1JOKA 4DF7A 2EYOA 3OMCA 2F0LA 4IALA 1STNA 4QB4A 4N9PA 3EJIA 5C5MA 5EKKA 1STYA 2F0SA 2RBMA 2F0MA 4ODGA 1SYDA 3BDCA 5CGKA 4PMCA 5HGTA 5F2DA 1SYBA 4N9TA 1F2YA 5CV8A 4KD4A 5CV9A 2O4XA 4S3SA 3P1HA 4KV6A 4DFAA 4K5XA 3SR1A 4KHVA 3T13A 4K8IA 4HMIA 5IGEA 4DU9A 3RUZA 5KYLA 3TMEA 4B9WA 5KRUA 3EVQA 1ENAA 4ZUIA 3SK4A 5I6WA 5J22A 1AEXA 4K5VA 3C1EA 5KIXA 2OXPA 5CV4A 2EYLA 5E1FA 1EQVA 5I9OA 1SNPA 2OEOA 2PW5A 3MEHA 5CV7A 3TP6A 4K6DA 5C5LA 3DMUA 2F0UA 3P75A 1A2UA 4MIUA 1STBA 4ZQ3A 2F0QA 3D4DA 1SNCA 2F3VA 4KY7A 5NUCA 1EY0A 4KJOA 2F0IA 2SNSA 5IGGA 5C3WA 4EQOA 3QB3A 1EY8A 2HQEA 3MXPA 4K8JA 5JOBA 5DAUA 4ME5A 3SK8A 1EY4A 5JAVA 5C4ZA 1EYCA 1SNMA 2EY2A 4IUNA 2KQ3A 2EY6A 5CV6A 5IGCA 3C1FA 1JOOA 2EYHA 3S9WA 5IOCA 5IGBA 2F0NA 1KDCA 3D8GA 4NP5A 5C3XA 3EROA 5C6AA 1JOQA 5E3FA 2LKVA 4RKLA 5KYIA 1EY7A 5EKLA 3QOLA 2PYKA 5KGUA 3HZXA 5CC4A 1A3UA 2QDBA 3T16A 4J6HA 2SNMA 4H7BA 3OWFA 2WACA 2F3WA 2F0JA 4WRDA 2PQEA 3NQTA 1IHZA 2F0DA 3H6MA 1STAA 1SYCA 2M00A 3MHBA 1NUCA 3NUCA 3ITPA 2PZWA 3TP7A 2F0FA 2OF1A 4HMJA 4PMBA 4YIJA 5KEEA 3R3OA 3BDLA 5C4HA 3NHHA 4HTHA 4EQPA 1SNQA 3OSOA 1F2MA 4K14A 2F0PA 3MVVA 4NKLA 5ISRA 3LX0A 3DHQA 3SK6A 4K2KA 2EXZA 1II3A 3NXWA 2F0VA 4NMZA 3OMGA 1ENCA 2F0WA 3SK5A 1SYGA 2F0OA 1SYFA 1A2TA 2F0EA 5CR3A 3D6CA 5DEHA 1EYDA 1SYEA 4KD3A 2PZUA 2EY5A 4WORA 4PNYA 4KJNA 4KY6A 5M9OA 4NDXA 1TR5A 5CV5A
chains in the Genus database with same CATH superfamily
5IY0A 5ELCA 4HIOA 1WTWA 1U9RA 2NZ1D 1XMQQ 1YIJA 2IJ0A 1U0LA 3M3YB 4C3JH 1S5DD 4K2LA 4JBWA 5EGTA 2AQ3B 1ZEQX 1EY6A 4JCVE 1G291 1RODA 3ER0A 1C8CA 1SNDA 3KJOA 2PW7A 3WOFA 2VL6A 5IT9E 1N34Q 2K52A 1RIPA 2NVXB 2B2UC 1SJED 4UAIA 4FYDA 4CKEA 1O80A 5E7NA 2JA5H 2RSNA 4A3DG 1YHBA 3W5OA 1DYQA 1ILQA 4TSSA 1SXTA 5EAYA 1PV4A 2XN9C 3X3NA 5CGKA 5I2YA 3AYHB 3I70A 2EDGA 1Z47A 2NTTA 3G6JB 4S3SA 4A3GH 1YBYA 1PDQA 3VDYA 3T13A 4K8IA 1X3EA 1T9HA 2RQXA 2C5CA 3VYTA 3TRZA 3V96A 4L5QA 4C2MH 2OQKA 4QQBX 1EQVA 3RZOH 3PIPA 2KCTA 4LK1C 3HOYB 4C3IG 1EY0A 2IHFA 2E5LL 4A3JG 3DWAA 3IFTA 4IFDJ 5CORA 2WV6D 1TS4A 3NWTA 1J5EL 3NWSA 1PH6A 3I72A 5IGBA 1LUZA 1I6HH 2CWAA 1HXYD 2L12A 3OOCA 2CW0C 3K0YA 2L0CA 2DY8A 4O2DA 5KGUA 4A3EH 1A3UA 3A7AB 5JEAJ 4KHPQ 4JI5L 1Y1VH 3OWFA 4MNOA 5GADC 1OO9B 3CHBD 3KF8B 4OELB 3S2HH 4LFBQ 2L5TA 3CKIB 4G7OC 2BH2A 4NXNQ 1GHJA 3UE1A 2WAQG 2D62A 4XIGS 1TXYA 1I4HA 3K0XA 4KKTA 1MKHA 4X64L 1LLRD 4P75A 2MQHA 3H3VC 4DR7Q 2BE5C 3KF6B 1FVIA 3V05A 4FO2A 2E2JB 5DEHA 1IYVA 4IN3A 5ELOA 3KDFB 2FFKB 1HNXQ 3J81L 3PUXA 4QUCA 5CV5A 5IYCH 4APVA 5AJ3L 3CXCA 4CBVA 4OWXB 1YJ9A 3S1QH 4DV7Q 3EQLC 1D5MC 2K5QA 2EYFA 2LXJA 3KLSA 4YY3L 3T53B 3HFZB 3S1NH 3ZJYC 1V43A 4FDBA 4DR1L 1EZ8A 4JI7L 3BZCA 4F88A 2IX1A 4JBKA 4UP9A 3NBHA 4B08A 4L5SA 1OXVA 2O2LD 4LMQD 1LT5D 3PUZA 2AHOB 5FKAC 1Q90A 1SEBD 4A3BG 3EJIA 2R93B 2IHEA 4EGVA 1PH7A 2ZTDA 5F2DA 4N9TA 3E9IA 1XPUA 1A0IA 2ZM6Q 1PH4A 2AQ1B 1B7YB 2QCPX 3Q0AA 2FINB 4K5VA 3T4AC 1VQ6A 3EN2A 4RHSA 1CSPA 2OEOA 3QR8A 2E74C 3U4VA 1V1QA 3D4DA 2B63B 5M3MG 2HCCA 2WP8J 3S15B 4A3MB 4BA1I 3S16H 2SNSA 5C3WA 3OPOA 1EY8A 1Y8PB 4IURA 2JA7H 3HS0C 1G51A 1VQHA 4OWTB 1JJCB 4UP8A 2EY6A 4CGYB 1L1OB 3CCVA 1VQ9A 3NTHA 4A3KG 1JWSD 1TS2A 5EBDA 1CA6A 1TY0A 3OIPA 1A15A 2K5HA 4J8QA 1VF5C 3FHWA 3I4OA 3IAYA 1BDOA 2DN8A 2L9HA 4RGTA 2F0DA 4DUYL 1GUOA 1KLUD 1C7YA 2CWPA 2ZXRA 4HTHA 1IW7C 4HIDA 3PIOA 3FEWX 4C3IH 4A3JH 1VQNA 2F0WA 4IOAA 1CZWA 4B3RQ 2F0EA 3LWEA 2ID0A 4JI4Q 1S4ZA 4RAUC 4NDXA 4ZKCB 5M5WH 2K04A 3PF4A 1KLGD 2WB1B 2WAQE 2D2CC 2KCCA 4XQJA 4DK1A 2A6HD 4GLVB 3SVMA 3GTPB 2UXCQ 1SNOA 3CCQA 4A4IA 1U4PA 3PUVA 2HDMA 2EY1A 5ELDA 2ENBA 4CDFC 5I9PA 3I55A 3J81c 1N34L 1LTBD 3GTKH 2JA9A 5FK9C 3IL8A 5IIFA 2RSOA 2XSCA 1W6JA 1LTGD 2CQOA 2XIWA 4ZUJA 4EQNA 2O5JC 2Z8LA 3J81E 2HIXA 2VQFQ 4KY5A 1IBKQ 1R4QB 1EY9A 4LFAQ 2E75C 1K8MA 2NVYB 1BVSA 3U58A 4N9PA 1BCPF 2VUMG 1CZGA 1PH2A 2LY7A 3GV6A 5LMNW 1SROA 1OXXK 1SYDA 1B50A 3GQBA 3BDOA 2KVMA 3MXNB 3F1ZA 2CW0D 3W3AA 1X65A 2K28A 4A3FB 2E2IH 2Q2UA 1NY4A 5I6WA 3S2DH 5JPMC 4A3CG 3M7NA 5C5LA 4Y52H 1H9KA 1STBA 2KCMA 2NWGA 3SGIA 3OTOQ 4AYBB 2E2HB 1RTNA 3TSSA 2UUAQ 3TZUA 1UUPA 5M5YB 1L2FA 2BE5D 5IE8A 3J80L 5KNDA 4A3BH 1HA5A 4IUNA 4X3KA 2SEBD 5IGCA 3TS0A 1JOOA 1O7LA 1NAPA 3QJYA 1JWMD 4X3UA 1XWEA 4DAMA 4KHPL 3U4ZA 3CPWA 2NB0A 3PO3B 1KRSA 4NXNL 1SN8A 3VYRA 1I50H 4K6LA 1PRTB 5M3FB 4WJ3M 1BO0A 4IFDI 2IX0A 1AP0A 2IL8A 4IPGA 1IBLQ 1NJIC 1PYSB 4POGA 4NKLA 2Q8TA 5M3MH 1XX8A 1PH3A 1YNNC 4JYAQ 3B6YA 2F0VA 5DM63 3I4MG 2P5ZX 2VQEL 1HNXL 4KK7A 3JAMi 2PZUA 1K8GA 2B2VC 4A3IB 4KY6A 2NN6G 4DK3C 1AW7A 3FPPA 3ULJA 2NTSA 4C1NI 1WYDA 4A3KH 1VF7A 4DV7L 4A93H 2DY7A 2EJFC 1DOKA 2EYJA 4ZYSA 3SE0A 3M85A 1R9TH 1CQFA 4QF4A 1IBMQ 2KHSA 4JBMA 5IGFA 4ZLTF 4X66Q 5K36G 1I4GA 1LTRD 1CUKA 1STGA 1K28A 4RGMA 4RMFA 4MN3A 4EVOA 2AMCB 4FXKC 1K0SA 2F0KA 3SHLA 3DEOA 1DM0B 3K59A 3PMFA 2N49A 3M4PA 2KHIA 2JK8A 3A55A 2B2TA 1ASYA 4DAVA 4NPSA 4DV5Q 1SAPA 3H94A 1ZKOA 1V1PA 2ZM6L 3A0JA 4X3SA 1VQ5A 1N9WA 1F2YA 5DM73 3S1RB 4Z9CB 2GA4B 4K5XA 3CC7A 5M5XB 1Q82C 5BN3A 5GROA 4LF5L 1LTAD 2A8VA 4ZCKA 4LJZC 2CCZA 2X69A 4BBSH 1WD1A 4HJ7A 2TSSA 4FXDA 1X54A 2KUMA 4K6DA 1RD9D 4DV4Q 1TWAB 1LV9A 5NUCA 1IW7D 2ES2A 1B2TA 1U4RA 1DZ1A 3AFQA 3X3MA 3K5OA 5DNFA 3J7ZC 4OONA 1BR9A 2OT2A 2VUMH 2XTIA 3E9HA 1EFWA 1ICWA 1T5XD 1L1OC 5E3FA 2YU9H 2PYKA 5C0XG 1BXTA 3H3VH 5CC4A 2KEDA 2I5LX 2LSSA 4LF9L 4TVAB 2K5VA 1HR0Q 5FO9B 2K1BA 3H6MA 1STAA 1I4PA 1S5ED 4IJLA 3J80c 3DWPA 3CC2A 4A3CH 3GTLB 4ULLA 4BBRB 1JJGA 3VR3A 4G7ZC 1HUMA 4B3RL 3KBXA 3J80E 4N8FA 3CMEA 2MNAA 4NMZA 4JI4L 1ET9A 2L1BA 4GN5A 1FNVA 1A63A 3GDEA 4PV1C 2MJ8A 3SK8A 2B2WC 3D31A 3D4WA 2QW7A 4GKKQ 4LUZA 1SE3A 3HOVB 2UXCL 1IZ6A 3K6OA 1STHA 1OXSC 3CAMA 1WTPA 1B9NA 1HQRD 3HOWB 1ESFA 1VQPA 3W1BA 1B44D 3UE0A 1HZBA 1EOTA 2HUGA 1EY5A 4OHJA 1F9SA 1TWHB 3VR2A 4RCNA 3S14B 1E1OA 2VQFL 2E2DC 4DR5L 3Q22A 2DJFC 3I4MH 3MZ5A 4LFAL 2NVQH 3AMUA 1JORA 1KAAA 4CJ2C 2N88A 1K8OA 3DLLA 4WJ4A 2NN6H 1CKOA 4RGOS 3UI2A 1Z6HA 1GD7A 1E0BA 3OYYA 3PO2B 4QIWB 1FYCA 5K36H 4TQUS 3KUPA 1K8AC 4KHVA 3ZYYX 2B3GA 1XPRA 2EOTA 2FMMA 1QJOA 3KLWA 1M90C 3K57A 4GNXB 1OXUA 4P72A 4G4KA 5L37A 3OTOL 1SNPA 2QILA 5CV7A 1S72A 2UUAL 4KN7C 2F0QA 3DXJC 1DOLA 4HEDA 3URYA 3G71A 1DXMA 1NE3A 5JAVA 1YNND 3VA7A 1I4XA 3HOUB 1EQRA 3U9SA 1A8VA 3DM3A 1Y1WB 3KOJA 4OIJA 1JICA 1RL2A 3NENA 3S1MH 3CRLC 4JOIC 4RKLA 5KYIA 1Y1VG 2KECA 4FF4A 4RWSC 1AZPA 4R4TA 3GTJH 4PZ7A 2SNMA 2WACA 5KNBA 4YWLA 3CD6A 5C4XG 1B70B 2EIFA 1HA6A 4P71A 1IBLL 5T1GA 1LTTD 4DR4Q 4OWWB 1PRTC 3I73A 4JYAL 2A1AA 1VQMA 1PH1A 2O5IC 4K2KA 2EXZA 1SE8A 5C3EB 3M3YH 4IOCA 1EOVA 1G6PA 3M4OH 4BA2I 3IFDA 4KD3A 3TZDA 4EQ5A 3MTSA 2HQLA 4XYOA 2I5MX 4IPHA 4L5RC 4XT3B 3MAQA 4BXXG 4HJ8A 5C0XH 1RKNA 1TS5A 5BN5A 2R7ZG 3K7AB 4LF6Q 4IZ8A 1S5BD 1LTSD 2NVXH 4PMWA 1I94Q 2HIVA 2PZTA 1NR2A 2MO1A 3MXGA 4P2CB 2KJXA 5K5PA 1E2WA 2K6AA 2PO4A 1QOHA 4XXEA 2K05A 1FJGQ 4LAAA 4BY1G 4DGZA 4DXGA 1S5CD 2F3IA 3EBEA 1KABA 4JG2A 4MZ9A 2F0HA 3U9OA 3I7FA 1PXUA 4KTAA 4DV5L 3BYTB 2UUCQ 2ICEC 3PIP3 1BF4A 1HHVA 2NVTH 1J6QA 2F0MA 1QE6A 2DGYA 1X9NA 5CV8A 5KNCA 5CV9A 2NYZD 3R8BA 3RNUA 3PF5A 1Z7TA 2RA4A 4BY7B 2MUYA 4HMIA 5KYLA 3CRKC 4KKSA 2EJMA 3DUZA 2ATWA 4LWCA 5LMUQ 4DV4L 1K83B 3MEHA 4KI0A 3BZKA 4YCUA 3K58A 1BUVT 1XMOQ 1JWUD 1E2VA 2EPBA 3HKZG 2Q2IA 1H9MA 4L63B 3A8KE 2JA7G 2WB1G 3ONAB 4X6AH 1X3QA 2I07B 5A2QL 2HQEA 1O7ZA 2A6HC 1VQEA 1FD7D 5EQ0A 5C44B 3FRPB 3NBIA 2K14A 5IOCA 4R8IA 1QUQB 1W6KA 1WTRA 3A56A 5FJ8G 1TWFH 3J81i 1Q8KA 1Z9FA 1UE1A 1R4PB 3T16A 1HR0L 3BJUA 1I4RA 1HJPA 2F0JA 1X3PA 2FXQA 1SYCA 2PZWA 2F0FA 4YIJA 3WDNA 1BBWA 3U50C 1CHQD 2LXKA 3OSOA 4RH6A 2JSOA 1PTOB 2YTYA 2B29A 2PI2E 1VQ8A 3OMGA 3C2PA 1G6ZA 1MJEA 1CTMA 2IPKD 1A2TA 4C3JB 1BCPB 5FLMG 2BA1A 4GKKL 5DLQE 1LTLA 2ZJRA 5G3LD 2I5HA 3G7LA 2X6GA 4HCSA 2EZVA 1BBUA 1MIUA 3A5UA 5D3IB 5JVG3 1KDAA 1JMCA 2PCFB 2H4OA 1CFMA 1CKNA 3AQQA 3E5SA 2ALYB 4LF7Q 5C4XH 1VQ4A 1PYBA 4TRDA 1TT2A 2JEBI 1YI2A 4F8MA 1LT4D 2JA5B 1ILPA 4F7XA 3HGBA 4CJ0B 2F52A 5IWAQ 4R4CA 1TWCH 4DUZL 4X3TA 4IJHA 1X3GA 3PO3G 3AFPA 4A3GB 4IPCA 3ICEA 2EYOA 2JEAI 3OIQA 4BXXH 4DV3Q 2R7ZH 4CJ1B 1HTPA 5HGTA 1GXDC 2XWBB 5E4XA 4C2MB 1BBXC 3S15H 2QA4A 2R92G 3ERSX 2JN4A 3EVQA 4ZUIA 1P8LA 1UWVA 2RVLA 1MI2A 1QNUA 1IL2A 3I4NB 3L3OC 4GNXC 3NELA 3K7UC 4BY1H 4ZQ3A 1PRTD 2VB3X 4B3TQ 4KY7A 5JJKA 2H5XA 1EIHA 2F0IA 3NPPA 4DV0L 2DNEA 5DAUA 4A3EB 3GTQB 1QNKA 2VZAA 5BN4A 3CC4A 2QKIC 3RZDB 3PIO3 2KHJA 1BOSA 3EIVA 1B3AA 3J7AV 1JC7A 2K5WA 2EJGC 1VS0A 3HKZE 2XRQD 3ULPA 2WB1E 1Q81C 1IKLA 1DONA 2N8NA 2V4DA 3K80C 4V190 2MPMA 4DAPA 4DXFA 5A2QE 3NBHB 2M9VA 2VB2X 3S1QB 1X3FA 1JB3A 1EYDA 1A62A 3HG9A 2EY5A 4A93G 5M9OA 4A75A 3ND9A 4KHZA 2JA8G 1BKBA 2L55A 1E2ZA 3MWYW 5FJ8H 4K5WA 1EQQA 4LF6L 4X65Q 3S1NB 1RCVD 4QGUA 2B2WA 4G57A 2ZTCA 3SXHA 2PQAA 3H0GG 4ZAIA 3PCOB 1P16A 3BYYB 2Z4HA 1X56A 3NK9A 1FJGL 3MXUA 5D3DA 3CCRA 4DV2Q 4OXPA 3QG1A 2VS1A 2J0TD 5IP9H 1EU3A 5CMDA 2UUCL 4A3FH 1XMQL 5IYDG 5FLMH 1F9PA 4B3SQ 1VQAA 1PFSA 5EKKA 3J80i 3D3RA 4L5TA 2N55A 2J4XA 4JI8Q 2K03A 3VR4A 1SYBA 1CK1A 1CSQA 1STEA 2IT1A 2YTXA 4DFAA 1LABA 3SR1A 2E2HH 1XXGA 5M5YH 4BBSG 4B9WA 3NSWA 3SK4A 5LMUL 3S16B 1XMOL 2OXPA 1HH2P 2QGQA 4A3DB 4P73A 2BDNA 1EU4A 1YNJC 5CBEE 2F0UA 1NTGA 3D0FA 5I4DA 1NNXA 2BA0A 3E3XA 5IGGA 3CP0A 3PO3H 4ME5A 4UP7A 2EY2A 1D5XC 3K8AA 3HOWG 5CV6A 1XJVA 3S24A 1X55A 2F4IA 4MTKA 5C4JB 3G4SA 4JI2Q 4H13C 2F4VQ 2B2YC 4H0LC 5JVH3 2R92H 4OO1G 2I0QA 2B39A 2PQEA 4RCOA 3H3VI 2D5DA 1N33Q 2C9OA 1H9SA 3M4YA 4A76A 3UDGA 4Q0FA 2JYOA 4POFA 3PV0A 2RHSB 2Y0SB 3BS1A 3D6WA 4QJFA 1PTOC 1Q1BA 3G48A 2YV5A 4WFN3 1GM5A 4GOPA 4UY8C 2HCIA 3I90A 4GN4B 4LFBL 5EJWA 3A54A 3ND8A 2WAQB 3AU7A 1L0YB 2BDOA 3F8TA 3FDTA 5EPLA 4LF7L 4OX9Q 3RLFA 1X6OA 2YYZA 3F2UA 3GTKB 4RKBA 1GUTA 2Z6KC 4DR7L 2AQ2B 3NQIA 3DM1A 1LM0A 4IFDG 4I7ZC 4XTCS 3GTOB 1UAPA 2DUDA 5HURA 2XWJB 3PUYA 1TQOA 1QCBD 3HOXG 5GAEC 1AH9A 2WFWA 1EZ6A 2RCFA 5IODA 5M5XH 2F0GA 1MSGA 4R4QA 1HR0W 1NMGA 5JEAG 4C3HG 4DF7A 4DV3L 4FF2A 2JA8H 2E2IB 2F0SA 3CQZB 4GLAC 1IL8A 4KD4A 2O4XA 3H0GH 1PLFA 1VMCA 2K01A 1VQFA 3RUZA 3HOZB 5J22A 1ENAA 3Q6SA 3T51B 1UEAB 1S5FD 4GN3B 4GLXA 4G7HC 3KBGA 4B3TL 4A3BB 1J8IA 4LUOA 3DMUA 1FR3A 1A2UA 1JR0D 1PVOA 1FL0A 2B2UA 2G9HD 4KJOA 4HCEA 1HCZA 5IYDH 3T1HQ 1KIXA 1JT8A 1K3BC 4XYQA 3O13A 2L4NA 1I50B 3GTLH 2LKVA 4LF8Q 5EKLA 2XNAC 3CCUA 4O42A 1QILA 4BBRH 4V0BA 4IUUA 1WTQA 3EA6A 4LF4Q 1SMYC 5BR8Q 5M3MB 1PH9A 4ZRZA 1PFMA 3I3CA 3RR5A 2DNCA 1KXLA 1YNXA 1V1OA 2YTVA 5C4HA 3VYUA 1HNZQ 1KD1C 2B8GA 2G9DA 1WTHA 4A3KB 3HOVH 3TBIB 5FOBB 3A74A 4FF3A 1F9RA 1H9JA 3MFYA 4LFCQ 3HOWH 1TY2A 4BY7G 3KLSX 3PUWA 4DKAC 4X65L 2JA6B 1ASZA 2L11A 4QCLA 3A5ZB 1YZ6A 1SMXA 1V1PB 4GZYC 1HNWQ 1TWHH 2MO0A 5ELBA 1KTKA 3S14H 3OW2A 4OO1H 1U4MA 5JPNC 3RN5A 1A6XA 4DN4M 4QMGA 5J39A 4NXMQ 1XNRQ 3V2TA 4DV2L 4ID6A 1UE5A 1VQJA 3HEJA 3PO2H 4HR7B 1D5ZC 3FMCA 2K75A 2OTJA 4XQQA 3TP5A 1YNJD 4CDDC 1SFOB 2Z6BA 1WTVA 4Q5VA 1Y8OB 4DR6Q 5C5MA 1XTCD 1GUSA 3CCSA 4ODGA 2GVBA 3HOYG 3N52A 5G3LF 1G91A 4FP5D 4KV6A 3DWQA 3G6EA 4IFDH 3KLRA 1Y69U 2V1CC 2Z9HA 1IBKL 3HOXH 4LNQA 3P75A 4DR2Q 3UDXA 2PMZE 4DAYA 1SNCA 4AQYQ 4I7AA 1IKMA 1ET6A 2YU9B 2XRSD 4ILWA 1B1ZA 5JEAH 5JOBA 4C3HH 2OTLA 1GOZA 2VW9A 1E22A 1PTOD 2KQ3A 3GTGH 2K50A 1HTLD 1GUNA 1VQGA 2A74C 2ICIA 1VQ7A 4JI2L 5C6AA 2F4VL 2CQAA 1BCPD 4YWKA 1DD2A 1Q3LA 2EE1A 2K5NA 5EPKA 2F3WA 1N33L 1KHIA 1VCIA 4PZ8A 3NQTA 1IHZA 3BVMA 2ZT9C 3N6RA 2DJGC 4PMBA 1PH5A 1HRJA 1LYLA 3BDLA 3K7AH 1PRTF 3SK5A 4O1NA 4K0KQ 2ZXOA 3TS2A 4DR1Q 1XNQQ 1SYEA 4DNTB 5GAHC 2KENA 3RLOA 2OQ0A 4KJNA 2QF7A 1IYJB 5CYUA 4UDUC 4Y7NB 4OX9L 1D1IA 3R2IA 2K4KA 3JC66 2FJ2A 3ERQA 2EYPA 1HZ9A 5EKIA 2MP1A 1TWGB 1LTID 1GUWA 3I4MB 2R93G 2NVQB 2RKSA 3HRZC 1M8AA 1F9QA 1I4QA 4C56C 4OL7A 1A3VA 4OGQC 5TSSA 4BWGB 3R93A 5ELEA 1CHPD 1I3QB 4B9XA 3FP9A 4BY7H 1IBML 1KC8C 4RGNA 4X66L 4QB4A 3CCMA 1XYIA 1STYA 2RBMA 4IQZA 3I91A 2B63G 1K83H 4A3MG 1FNUA 1CT1D 3GTMB 1M4VA 4U673 4O0AA 3TREA 2E76C 1L0XB 1SMYD 3RN2A 1KL9A 2K5DA 2EYLA 5C44H 3MEFA 1EFID 3KFUA 4B3MQ 2EQSA 3RD4A 3AEVA 1K73C 2A69C 2BOSA 3KYHC 3H91A 3S1MB 1B8AA 4DK0A 3T1HL 3QB3A 3E0JA 4PZ6A 1AN8A 3GTJB 1KAWA 5FLXc 3J7A5 4LF8L 1EIGA 5H1SE 3D8GA 3HOYH 3S17B 2J7ZA 3R2TA 1EY7A 4LF4L 1PMRA 3QOLA 3NTKA 5IP7G 4FF1A 1MSHA 1O7YA 5AFWA 3FKIB 3I56A 1PTOH 4YCWA 2B2YA 2R6GA 4L6TB 1HPCA 1J9OA 2M00A 1DCZA 2Q2TA 3KK7A 1HNZL 3UDIA 1C4QA 3M4OB 1QVCA 3FVQA 1FGBD 5IT9c 1SNQA 4ME3A 2F0PA 2PNRC 4OEMB 3SK6A 1WCMB 1HFNA 4LFCL 4DR3Q 4JI3Q 2F03A 4LUVA 1WOCA 3D6CA 1ZYRD 3QO2A 4GS3A 2AWOA 4JBJA 1X32A 4IUVA 2B2TC 1HNWL 3T56B 4E6IA 4DV1Q 2E2JH 3WWVA 4QL5A 3QWNA 4CDEC 1HUNA 4NXML 3NP8A 5HGQA 4JPBW 1XNRL 2VY3A 4J1MA 1NMFA 3KF8A 3D4RA 1JB7A 4IO9A 2Z6KA 2A68C 5IP9G 2LMCB 5EPJA 4I65A 4A3FG 3RMHA 2K7VA 2NVTB 2A73B 3KF6A 1EYAA 4NW2A 1NSNS 5J1ZA 3CU7A 2FMCA 2B2VA 4DR6L 1PH8A 2CKZB 2XVSA 5GQOA 3KDFA 2R3ZA 4IALA 2ZTEA 2A5HA 1O7IA 2E8GA 1IXRA 2CH4W 2Z4IA 3I4NH 3C3LA 2RF4A 4AYBG 1D8LA 3L9AX 3CF5A 2HT1A 1Q1EA 4MTNA 1SE2A 3P1HA 3GO5A 3TN2A 4JI6Q 2Y0SG 4DU9A 2R93H 3TMEA 1PZID 4DPGA 3GTQH 3UDFA 1S40A 2PI2A 5KIXA 2UXDQ 2HHHQ 4DR2L 1EEFD 3RZDH 2PW5A 3TP6A 1MD2D 1XTDA 4AQYL 1UE6A 2SDFA 1GVPA 2WINB 3GP7A 1VDZA 1TWFB 3MXPA 5M3FG 1EY4A 1ZXTA 4DNRB 1KRTA 1GO3E 1OTCA 3RZOB 1JQYD 2B63H 1KDCA 1T5EA 2D0PA 1ICFB 4A3MH 1VMPA 1G8ZD 1SRUA 3A8IE 2VQEQ 5LHY1 1CKNB 1MHWC 1TIID 3HKSA 1IYUA 4A3LH 4A3IG 1CM9A 1AFPA 1Y8NB 3I8ZA 1E24A 1NUCA 1F77A 1I6HB 1TS3A 3T1YQ 1PHJA 4QUFA 1BQQT 3MVVA 1TKWB 4K0KL 3DHQA 3CMAA 1XNQL 1Y1VB 4L8JA 1CA5A 1EQTA 3S2HB 4RFBA 2C35B 3H15A 5C4XB 1YHQA 3K5NA 1SJHD 3HOZG 5ELNA 1YVCA 1TU2B 1L1OA 3BVGA 2RDFA 1AE3A 2KCNA 5ELFA 2UU9Q 5IP7H 4DR4L 4XT1B 3K5LA 1FNWA 4C1NK 2UUBQ 2GN5A 1W3SA 5FO7B 4FNFA 4M1UB 5EBCA 2K33A 2CHBD 3BG3A 4X62Q 1QB5D 2ZJQA 3W2DA 1TWCB 3VA5A 3BU2A 4N8X1 2QEJC 1K3RA 3VR6A 3W1GA 2R7FA 2B8FA 4HIKA 5C0XJ 1MJCA 1Q8IA 5IGDA 3GTPH 4J15A 4LF5Q 1SLJA 2UXBQ 2R7ZB 1RF2D 2A69D 4H44C 1PZKD 3QOJA 2F0LA 4R4IA 5LL6S 1YJNA 2ZXPA 1I94L 1VQKA 3J81j 3MA2B 4A3DH 4KKUA 2R61A 4PMCA 4JI0Q 4XQNA 1AE2A 1QZGA 4PQXA 2NVYH 1N32Q 4BY1B 1UEBA 1PZJD 5I2XA 5CBAE 2R7DA 1WTXA 4B3ML 4CDCC 1LACA 5E1FA 1QWYA 1B4OA 2JA6G 5C4JH 4YHHQ 4LF9Q 2TMPA 1DGSA 3OHXC 3GV3A 4MIUA 1TVXA 3CCLA 4AYBE 4KMUC 5FO8B 3WOEA 4LW1A 4K8JA 3RLNA 4KLKA 3E6ZX 4ALPA 1GUGA 2Y0SE 2Z0SA 4UPAA 3BZDB 4BBRG 5JJIA 1N36Q 3E0EA 3QIAA 3MXNA 2QDBA 3HKZB 3HP3A 4J6HA 2PQAB 3EFXD 2AUJD 2JA7B 1B9MA 4H02A 1SBBB 2OF1A 2H1EA 1F2LA 3HOVG 1JCKB 3STBC 2A68D 2EVBA 4DR3L 1WFQA 4JI3L 3F2DA 1K9MC 2CFMA 4ZKBB 4WJWA 4CKBA 5IYBG 2F0OA 4M8AA 5M3FH 5CR3A 3PSIA 4GKJQ 4WORA 4XDXA 2AUKA 4R4OA 4DV1L 4JOIA 1LT6D 1EWIA 1PTOF 1YJWA 1GJXA 1HFGA 2LFNA 1Q12A 4DR5Q 2FHTA 3TQYA 2N78A 3GTOH 4C3IB 1VQIA 4A3JB 2HD3A 1RDPD 1E3PA 1KNEA 4JV5Q 1DOMA 4A3IH 5D65A 3K81C 3TP8A 3PO2G 3CCJA 5M5WB 1SSOA 1D1KA 4OO1I 3CW2C 3CQZH 2XGTA 3J7AF 4OIKA 1I6VC 2VXWA 1WI5A 2PNHA 1BCPC 1M1KC 1XPOA 1Q86C 1EYGA 3HOZH 3P7JA 4F87A 1STNA 1W2BA 1B53A 1NBWA 3F2BA 2MFIA 4JI6L 1KQSA 3TDQA 4HSVA 3BVZA 3A7LA 3L7ZC 3HOUG 4CHTB 1Y1WG 2UXDL 5IWAL 2HHHL 3H09A 2IY5B 1AEXA 1EWCA 4FVMA 4NB3A 1WTOA 1EUJA 3S1RH 1H9SB 2OCEA 2RDHA 3VYSA 1YHAA 5HY6A 4HJ9A 2RCNA 2KBNA 4PG3A 1Q7YC 4IUQA 4JC0A 3S2DB 5C4ZA 1SNMA 4GOPB 1C0AA 2R92B 2A19A 3S9WA 3C1FA 1NR4A 1PYWD 1TWAH 2NN6I 2QEXA 3GD7A 2NZOA 4NP5A 5C3XA 1JOQA 4JVZA 1EIFA 1KNAA 5C3EG 1WJJA 3LGJA 3M9BA 3MC0B 5JJLA 2D0OA 2RDGA 1ONLA 1RHPA 2A6EC 3J7YW 3VR5A 3AB9A 1FGUA 2K32A 3T1YL 1LT3D 2VNUD 5I9OA 3TP7A 1QG7A 2JA6H 4JI1Q 1MBYA 2BCOA 1JE5A 3R3OA 1B3QA 5LMNQ 4EQPA 1F2MA 3C46A 1E7ZA 1EWHA 1SR3A 2BH8A 4TKOB 4HAEA 1II3A 4UHVA 1ENCA 4DNIA 1E1TA 3I4LA 4HJAA 1RJTA 4PNYA 1UE7A 2UU9L 1TR5A 3A8JE 4DV6Q 1A3TA 2UUBL 2Q8RE 1CI3M 3F2CA 5GAGC 4IUTA 4X62L 1F2ZA 3TEHB 1CKMA 3IRBA 1SFOH 4BS9A 1C48A 1HZCA 2CVRA 1DJRD 2JXMB 4A93B 1Q46A 3Q24A 2UXBL 3CPFA 1R9TB 1C9OA 2JA8B 1VQLA 2AWNA 3SDZA 5I6YA 5IYBH 2M2LA 3JAML 1EIYB 3FKIG 3H0GB 2WIIB 2EYMA 1JOKA 2HDLA 1VQCA 3ULLA 3L2PA 2ZJPA 1WVLA 4JI0L 3M4QA 3BDCA 2MGSA 2AKWB 4QIWE 1N32L 5C0XI 4HSPA 1WCMG 4KN4C 5IGEA 5C44G 2KEEA 1U4LA 2D9UA 3C1EA 4ZK9B 4YHHL 4HIMA 1H95A 1S3OA 1EL0A 1ZYRC 4B3SL 1K0RA 5J3BA 4QY7A 2L15A 1D2BA 2QDLA 3PQIA 2F3VA 3STBD 1G2SA 4JI8L 4CKCA 1GKHA 3LWUA 1QZHA 4YWMA 1WD0A 3OW7A 2IW3A 2F1MA 3Q8DA 2ASBA 2E5LQ 1N36L 4BBSB 1D7QA 2JJQA 1MGSA 5E4WC 4HJ5A 4DA2A 1J5EQ 1CQVA 3K5MA 5FLXL 3LNNA 3HOUH 4DK6C 3PGZA 4C3JG 1Y1WH 1V8QA 3OWEB 4JI5Q 1ESRA 2VUMB 3NUCA 1PFBA 3ITPA 4GNXA 4HMJA 5KEEA 4Y7NH 1QVFA 5ISRA 3LX0A 1VQBA 4X64Q 3NXWA 2X6LA 4GKJL 3Q23A 4R9WA 1SYFA 1G2TA 2RHQB 5IT9L 1TWGH 2WKDA 1I5FA 3P20A 2JA5G 1L0WA 1QVGA 5C3EH 4IPDA 4JV5L 4DUZQ 5AJ3Q 4A3GG 3KJPA 1I3QH 1PA6A 1Y14B 1LO5D 1VQDA 3I2ZA 4YY3Q 2NUCA 2GVAA 2F0TA 1KDBA 1NCVA 2JP1A 2N3SA 4JI7Q 2JE6I 5LL6X 3DEPA 1GHKA 4DAYB 5COYA 3CCEA 2MHVA 2SOBA 2OWOA 3GTMH 1YEZA 4R8NA 4U68A 3NEMA 3I4NG 3OMCA 4RHRA 1OXTA 1N8RC 4IUPA 1JE4A 4MHEA 1SE4A 3FPUB 4ABNA 2KOLA 4DV0Q 3SEBA 3NTIA 3HOXB 1U5KA 4A3EG 2NZHA 2I46A 4AIMA 4RA8A 1AZQA 4YCVA 3JAMc 1SDFA 2A6ED 5KRUA 5CV4A 2Q8IB 4C3HB 4FXGC 1VQOA 5JJZA 1V9PA 1EEID 3IKJA 3S17H 3JAME 3GTGB 2PMZB 1RTOA 2PPBC 4EX5A 1HZAA 3FKIH 3NE5B 4EQOA 1D6EC 1JJ2A 1EYCA 2CH4A 4GOPC 3M7GA 4P74A 1BNZA 2EYHA 2F0NA 3EROA 5IYCG 4RG1A 5A35A 2Q2HA 4A3LG 4AH6A 3HZXA 1O78A 1WCMH 3MFGA 4H7BA 1H9RA 2LS01 5T1IA 4JW0A 4WRDA 4JI1L 3MHBA 2Z1CA 5LMNL 1YITA 3L0OA 1PFNA 2IWHA 1ENFA 4DUYQ 5D14A 3NHHA 2KA7A 4K14A 2EXDA 2G5DA 2WKCA 2NBFA 4HN7A 1HQMC 4JK1C 2JQOA 4R1JA 1SYGA 2IX3A 1UNSA 4DV6L 1ML0D 5BR8L 5FLXE 1QUQA
chains in the Genus database with same CATH topology
5ELCA 1WTWA 1U9RA 2NZ1D 2IJ0A 3M3YB 1S5DD 4K2LA 4JBWA 5EGTA 2AQ3B 1ZEQX 1EY6A 1G291 1RODA 1C8CA 1SNDA 2PW7A 3WOFA 5IT9E 2NVXB 2B2UC 1SJED 4UAIA 4FYDA 4CKEA 1O80A 2RSNA 1DYQA 1ILQA 4TSSA 1SXTA 2XN9C 3X3NA 5CGKA 5I2YA 3I70A 2EDGA 1Z47A 2NTTA 3G6JB 4S3SA 1PDQA 3T13A 4K8IA 2RQXA 2C5CA 3VYTA 3V96A 1EQVA 4LK1C 3HOYB 4C3IG 1EY0A 3DWAA 3IFTA 4IFDJ 5CORA 2WV6D 1TS4A 3NWTA 3NWSA 3I72A 5IGBA 2L12A 1HXYD 3OOCA 2CW0C 3K0YA 2L0CA 2DY8A 5KGUA 1A3UA 3A7AB 5JEAJ 3OWFA 1OO9B 3CHBD 2L5TA 3CKIB 4G7OC 1GHJA 2D62A 4XIGS 4KKTA 1I4HA 1LLRD 3H3VC 2BE5C 3V05A 4FO2A 2E2JB 5DEHA 1IYVA 4IN3A 2FFKB 3J81L 3PUXA 4QUCA 5CV5A 4CBVA 3EQLC 1D5MC 2K5QA 2EYFA 3KLSA 3T53B 1V43A 1EZ8A 4F88A 2IX1A 3NBHA 4B08A 1OXVA 2O2LD 4LMQD 1LT5D 3PUZA 5FKAC 1Q90A 1SEBD 3EJIA 2R93B 4EGVA 5F2DA 4N9TA 2AQ1B 2QCPX 3Q0AA 2FINB 4K5VA 3T4AC 4RHSA 2OEOA 2E74C 3D4DA 2B63B 2HCCA 2WP8J 3S15B 4A3MB 4BA1I 2SNSA 5C3WA 3OPOA 1EY8A 1Y8PB 4IURA 3HS0C 2EY6A 4CGYB 3NTHA 1JWSD 1TS2A 5EBDA 1CA6A 1TY0A 3OIPA 1A15A 4J8QA 1VF5C 3IAYA 1BDOA 2DN8A 2L9HA 4RGTA 2F0DA 1GUOA 1KLUD 2ZXRA 4HTHA 1IW7C 3FEWX 2F0WA 1CZWA 2F0EA 3LWEA 2ID0A 1S4ZA 4RAUC 4NDXA 4ZKCB 2K04A 1KLGD 2WB1B 2D2CC 2KCCA 4XQJA 4DK1A 2A6HD 3SVMA 3GTPB 1SNOA 1U4PA 3PUVA 2HDMA 2EY1A 5ELDA 2ENBA 5I9PA 1LTBD 5IIFA 5FK9C 3IL8A 2RSOA 2XSCA 1W6JA 1LTGD 2XIWA 4ZUJA 4EQNA 2O5JC 2Z8LA 3J81E 4KY5A 1R4QB 1EY9A 2E75C 1K8MA 2NVYB 4N9PA 1BCPF 1CZGA 2LY7A 3GV6A 1OXXK 1SYDA 1B50A 3GQBA 3BDOA 2KVMA 2CW0D 3W3AA 4A3FB 2K28A 5I6WA 5JPMC 3M7NA 5C5LA 1H9KA 1STBA 2NWGA 4AYBB 2E2HB 1RTNA 3TSSA 3TZUA 1UUPA 5M5YB 2BE5D 3J80L 5KNDA 1HA5A 4IUNA 4X3KA 2SEBD 5IGCA 1JOOA 1O7LA 1NAPA 3QJYA 1JWMD 4X3UA 1XWEA 2NB0A 3PO3B 3VYRA 4K6LA 1PRTB 5M3FB 1BO0A 4IFDI 2IX0A 1AP0A 2IL8A 4NKLA 2Q8TA 1XX8A 1YNNC 2F0VA 5DM63 4KK7A 2PZUA 2B2VC 4A3IB 4KY6A 2NN6G 1AW7A 3FPPA 2NTSA 4C1NI 1VF7A 2DY7A 2EJFC 1DOKA 2EYJA 4ZYSA 3SE0A 3M85A 1CQFA 4QF4A 2KHSA 5IGFA 4ZLTF 5K36G 1I4GA 1LTRD 1STGA 4RGMA 4MN3A 4EVOA 4FXKC 2F0KA 3SHLA 3DEOA 1DM0B 3K59A 3PMFA 3A55A 2B2TA 4DAVA 1SAPA 3H94A 1ZKOA 1V1PA 4X3SA 1F2YA 5DM73 3S1RB 4Z9CB 2GA4B 4K5XA 5M5XB 5BN3A 1LTAD 4LJZC 2X69A 1WD1A 2TSSA 4FXDA 2KUMA 4K6DA 1RD9D 1TWAB 1LV9A 5NUCA 1IW7D 1B2TA 1U4RA 1DZ1A 3X3MA 3K5OA 5DNFA 1BR9A 2OT2A 1ICWA 1T5XD 5E3FA 2PYKA 5C0XG 1BXTA 5CC4A 2KEDA 5FO9B 2K1BA 3H6MA 1STAA 1I4PA 1S5ED 3DWPA 3GTLB 4ULLA 4BBRB 3VR3A 4G7ZC 1HUMA 3KBXA 3J80E 4NMZA 1ET9A 2L1BA 1FNVA 4PV1C 2MJ8A 3SK8A 2B2WC 3D31A 3D4WA 1SE3A 3HOVB 3K6OA 1STHA 1OXSC 1WTPA 1B9NA 1HQRD 3HOWB 1ESFA 1B44D 1EOTA 2HUGA 1EY5A 4OHJA 1F9SA 1TWHB 3VR2A 4RCNA 3S14B 2E2DC 3Q22A 3MZ5A 3AMUA 1JORA 1KAAA 4CJ2C 2N88A 1K8OA 2NN6H 4RGOS 3UI2A 1Z6HA 1E0BA 3PO2B 4QIWB 1FYCA 5K36H 4TQUS 3KUPA 4KHVA 3ZYYX 2EOTA 2FMMA 1QJOA 3K57A 1OXUA 4G4KA 1SNPA 2QILA 5CV7A 4KN7C 2F0QA 3DXJC 1DOLA 4HEDA 3URYA 1DXMA 5JAVA 1YNND 3VA7A 1I4XA 3HOUB 3U9SA 1Y1WB 4OIJA 1JICA 3CRLC 4RKLA 5KYIA 2KECA 4FF4A 4RWSC 1AZPA 2SNMA 2WACA 5KNBA 1HA6A 5T1GA 1LTTD 1PRTC 3I73A 2O5IC 4K2KA 2EXZA 5C3EB 4BA2I 3IFDA 4KD3A 3TZDA 3MTSA 4XYOA 4XT3B 3MAQA 5C0XH 1RKNA 1TS5A 5BN5A 3K7AB 4IZ8A 1S5BD 1LTSD 4PMWA 2PZTA 1NR2A 3MXGA 4P2CB 2KJXA 5K5PA 1E2WA 2K6AA 2PO4A 1QOHA 4XXEA 2K05A 4LAAA 4DGZA 4DXGA 1S5CD 1KABA 2F0HA 3U9OA 1PXUA 4KTAA 3BYTB 2ICEC 3PIP3 1BF4A 1HHVA 2F0MA 1QE6A 5CV8A 5KNCA 5CV9A 2NYZD 3R8BA 1Z7TA 2RA4A 4BY7B 2MUYA 4HMIA 5KYLA 3CRKC 4KKSA 2EJMA 3DUZA 1K83B 3MEHA 4KI0A 3K58A 1BUVT 1JWUD 1E2VA 2EPBA 1H9MA 4L63B 3A8KE 3ONAB 1X3QA 2I07B 5A2QL 2HQEA 1O7ZA 2A6HC 1FD7D 5EQ0A 5C44B 3FRPB 3NBIA 5IOCA 4R8IA 1W6KA 1WTRA 3A56A 1R4PB 3T16A 1I4RA 2F0JA 1X3PA 1SYCA 2PZWA 2F0FA 4YIJA 3WDNA 1CHQD 3OSOA 4RH6A 2JSOA 1PTOB 3C2PA 3OMGA 1G6ZA 1CTMA 2IPKD 1A2TA 4C3JB 1BCPB 2BA1A 5G3LD 3G7LA 2X6GA 4HCSA 2EZVA 5D3IB 5JVG3 1KDAA 2PCFB 2H4OA 1CFMA 3E5SA 4TRDA 1TT2A 2JEBI 4F8MA 1LT4D 2JA5B 1ILPA 4F7XA 3HGBA 4CJ0B 4X3TA 4A3GB 2EYOA 2JEAI 3OIQA 4CJ1B 1HTPA 5HGTA 1GXDC 2XWBB 5E4XA 4C2MB 1BBXC 3EVQA 4ZUIA 2RVLA 1MI2A 1QNUA 3I4NB 3L3OC 4ZQ3A 1PRTD 2VB3X 4KY7A 1EIHA 2F0IA 3NPPA 2DNEA 5DAUA 4A3EB 3GTQB 1QNKA 5BN4A 2QKIC 3RZDB 3PIO3 1BOSA 1B3AA 3J7AV 1JC7A 2K5WA 2EJGC 2XRQD 1IKLA 1DONA 2V4DA 4V190 2MPMA 4DAPA 4DXFA 5A2QE 2M9VA 2VB2X 3S1QB 1JB3A 1EYDA 3HG9A 2EY5A 5M9OA 3ND9A 4KHZA 2L55A 1E2ZA 3MWYW 3S1NB 4K5WA 1RCVD 2B2WA 4G57A 3SXHA 4ZAIA 3BYYB 2Z4HA 3NK9A 3MXUA 5D3DA 3QG1A 2J0TD 1EU3A 5CMDA 1F9PA 5EKKA 3D3RA 2N55A 2J4XA 2K03A 3VR4A 1SYBA 1CK1A 1STEA 2IT1A 4DFAA 1LABA 3SR1A 1XXGA 4B9WA 3NSWA 3SK4A 3S16B 2OXPA 4A3DB 2BDNA 1EU4A 1YNJC 5CBEE 2F0UA 5I4DA 2BA0A 5IGGA 4ME5A 2EY2A 1D5XC 5CV6A 2F4IA 5C4JB 4H13C 2B2YC 4H0LC 5JVH3 4OO1G 2B39A 2PQEA 4RCOA 2D5DA 2C9OA 1H9SA 3M4YA 4Q0FA 2JYOA 3PV0A 2Y0SB 3BS1A 3D6WA 1PTOC 1Q1BA 4WFN3 2HCIA 3I90A 5EJWA 3A54A 3ND8A 2WAQB 3AU7A 1L0YB 2BDOA 3FDTA 5EPLA 3RLFA 2YYZA 3F2UA 3GTKB 4RKBA 1GUTA 2AQ2B 3NQIA 3DM1A 4IFDG 4I7ZC 4XTCS 3GTOB 1UAPA 5HURA 2XWJB 3PUYA 1TQOA 1QCBD 1EZ6A 5IODA 2F0GA 1MSGA 5JEAG 4C3HG 4DF7A 4FF2A 2E2IB 2F0SA 3CQZB 1IL8A 4KD4A 2O4XA 1PLFA 1VMCA 2K01A 3RUZA 3HOZB 5J22A 1ENAA 3Q6SA 3T51B 1UEAB 1S5FD 4G7HC 3KBGA 4A3BB 1J8IA 3DMUA 1FR3A 1A2UA 1JR0D 2B2UA 2G9HD 4KJOA 4HCEA 1HCZA 4XYQA 3O13A 2L4NA 1I50B 2LKVA 5EKLA 2XNAC 4O42A 1QILA 4V0BA 4IUUA 1WTQA 3EA6A 1SMYC 5M3MB 4ZRZA 1PFMA 3I3CA 2DNCA 1V1OA 5C4HA 3VYUA 2B8GA 2G9DA 4A3KB 3TBIB 5FOBB 4FF3A 1F9RA 1H9JA 3MFYA 1TY2A 3KLSX 3PUWA 2JA6B 2L11A 4QCLA 1V1PB 4GZYC 5ELBA 1KTKA 4OO1H 1U4MA 5JPNC 1A6XA 4DN4M 4QMGA 5J39A 3V2TA 4ID6A 3HEJA 4HR7B 1D5ZC 3FMCA 4XQQA 3TP5A 1YNJD 1SFOB 1WTVA 4Q5VA 1Y8OB 5C5MA 1XTCD 1GUSA 4ODGA 3N52A 5G3LF 1G91A 4FP5D 4KV6A 3DWQA 4IFDH 3KLRA 1Y69U 3P75A 4DAYA 1SNCA 1IKMA 1ET6A 2YU9B 2XRSD 4ILWA 1B1ZA 5JEAH 5JOBA 1GOZA 1PTOD 2KQ3A 1HTLD 1GUNA 2A74C 2ICIA 5C6AA 2CQAA 1BCPD 1DD2A 1Q3LA 2EE1A 5EPKA 2F3WA 1VCIA 3NQTA 1IHZA 3BVMA 2ZT9C 3N6RA 4PMBA 1HRJA 3BDLA 1PRTF 3SK5A 4O1NA 2ZXOA 1SYEA 4DNTB 4KJNA 2QF7A 5CYUA 4UDUC 4Y7NB 1D1IA 3R2IA 2FJ2A 3ERQA 2EYPA 5EKIA 2MP1A 1TWGB 1LTID 1GUWA 3I4MB 2NVQB 2RKSA 3HRZC 1M8AA 1F9QA 1I4QA 4C56C 4OL7A 1A3VA 4OGQC 5TSSA 4BWGB 3R93A 5ELEA 1CHPD 1I3QB 4B9XA 4RGNA 4QB4A 1XYIA 1STYA 2RBMA 4IQZA 3I91A 1FNUA 1CT1D 3GTMB 1M4VA 4U673 2E76C 1L0XB 1SMYD 2K5DA 2EYLA 1EFID 3RD4A 2A69C 2BOSA 3H91A 3S1MB 4DK0A 3QB3A 3E0JA 1AN8A 3GTJB 1EIGA 3S17B 3D8GA 2J7ZA 3R2TA 1EY7A 1PMRA 3QOLA 3NTKA 4FF1A 1MSHA 1O7YA 5AFWA 3FKIB 1PTOH 2B2YA 2R6GA 4L6TB 1HPCA 1J9OA 2M00A 1DCZA 3KK7A 1C4QA 3M4OB 3FVQA 1FGBD 1SNQA 2F0PA 2PNRC 3SK6A 1WCMB 1HFNA 2F03A 3D6CA 1ZYRD 3QO2A 2AWOA 1X32A 4IUVA 2B2TC 3T56B 4E6IA 3QWNA 1HUNA 3NP8A 4J1MA 3KF8A 3D4RA 2A68C 2LMCB 5EPJA 4I65A 3RMHA 2K7VA 2NVTB 2A73B 1EYAA 4NW2A 1NSNS 5J1ZA 3CU7A 2FMCA 2B2VA 2XVSA 2R3ZA 4IALA 2A5HA 2Z4IA 3C3LA 3L9AX 1Q1EA 1SE2A 3P1HA 3GO5A 3TN2A 4DU9A 3TMEA 1PZID 5KIXA 1EEFD 2PW5A 3TP6A 1MD2D 2SDFA 2WINB 3GP7A 1VDZA 1TWFB 3MXPA 1EY4A 1ZXTA 4DNRB 3RZOB 1JQYD 1KDCA 1T5EA 1VMPA 1G8ZD 3A8IE 5LHY1 1TIID 1IYUA 1CM9A 1AFPA 1Y8NB 3I8ZA 1NUCA 1F77A 1I6HB 1TS3A 4QUFA 1BQQT 3MVVA 1TKWB 3DHQA 1Y1VB 4L8JA 1CA5A 1EQTA 3S2HB 4RFBA 5C4XB 3K5NA 1SJHD 1TU2B 3BVGA 2RDFA 2KCNA 5ELFA 4XT1B 3K5LA 1FNWA 4C1NK 5FO7B 4FNFA 4M1UB 5EBCA 2K33A 2CHBD 3BG3A 1QB5D 3W2DA 1TWCB 3VA5A 2QEJC 3VR6A 2B8FA 5C0XJ 1Q8IA 5IGDA 2R7ZB 1RF2D 2A69D 4H44C 1PZKD 3QOJA 2F0LA 5LL6S 2ZXPA 3MA2B 4KKUA 2R61A 4PMCA 4XQNA 4PQXA 4BY1B 1PZJD 5I2XA 5CBAE 1WTXA 1LACA 5E1FA 1QWYA 1B4OA 2TMPA 3OHXC 3GV3A 4MIUA 1TVXA 4KMUC 5FO8B 3WOEA 4K8JA 3E6ZX 1GUGA 3BZDB 3QIAA 3MXNA 2QDBA 3HKZB 3HP3A 4J6HA 3EFXD 2AUJD 2JA7B 1B9MA 1SBBB 2OF1A 2H1EA 1F2LA 1JCKB 2A68D 2EVBA 4ZKBB 4WJWA 4CKBA 2F0OA 4M8AA 5CR3A 4WORA 4XDXA 2AUKA 1PTOF 1LT6D 1GJXA 1HFGA 2LFNA 1Q12A 2FHTA 4C3IB 4A3JB 1RDPD 1KNEA 1DOMA 5D65A 3TP8A 5M5WB 1SSOA 1D1KA 4OO1I 3J7AF 4OIKA 1I6VC 2VXWA 1BCPC 3P7JA 4F87A 1STNA 1B53A 3TDQA 4HSVA 3BVZA 3A7LA 3L7ZC 4CHTB 3H09A 1AEXA 1EWCA 4FVMA 1WTOA 1H9SB 2RDHA 3VYSA 4IUQA 3S2DB 5C4ZA 1SNMA 2R92B 3S9WA 3C1FA 1NR4A 1PYWD 2NN6I 3GD7A 4NP5A 5C3XA 1JOQA 1KNAA 3MC0B 2RDGA 1ONLA 1RHPA 2A6EC 3J7YW 3VR5A 3AB9A 2K32A 1LT3D 2VNUD 5I9OA 3TP7A 1QG7A 1MBYA 2BCOA 3R3OA 4EQPA 1F2MA 3C46A 1EWHA 4TKOB 4HAEA 1II3A 1ENCA 3I4LA 1RJTA 4PNYA 1TR5A 3A8JE 1A3TA 2Q8RE 1CI3M 4IUTA 1F2ZA 4BS9A 1C48A 2CVRA 1DJRD 2JXMB 4A93B 3Q24A 1R9TB 2JA8B 2AWNA 3SDZA 5I6YA 2M2LA 3JAML 2WIIB 3H0GB 2EYMA 1JOKA 2HDLA 1WVLA 3BDCA 2MGSA 5C0XI 4HSPA 4KN4C 5IGEA 2KEEA 1U4LA 2D9UA 3C1EA 4ZK9B 1EL0A 1ZYRC 1D2BA 2F3VA 1G2SA 4CKCA 3LWUA 1WD0A 3OW7A 2IW3A 2F1MA 4BBSB 1MGSA 5E4WC 4DA2A 1CQVA 3K5MA 5FLXL 3LNNA 4C3JG 1V8QA 3OWEB 1ESRA 2VUMB 3NUCA 1PFBA 3ITPA 4HMJA 5KEEA 5ISRA 3LX0A 3NXWA 2X6LA 3Q23A 4R9WA 1SYFA 1G2TA 5IT9L 2WKDA 3P20A 1LO5D 2NUCA 2F0TA 1KDBA 1NCVA 2JP1A 2JE6I 5LL6X 3DEPA 1GHKA 5COYA 2MHVA 2SOBA 4R8NA 4U68A 3OMCA 4RHRA 1OXTA 4IUPA 1JE4A 4MHEA 1SE4A 3FPUB 4ABNA 2KOLA 3SEBA 3NTIA 3HOXB 2I46A 1AZQA 4RA8A 1SDFA 2A6ED 5KRUA 5CV4A 2Q8IB 4C3HB 4FXGC 5JJZA 1EEID 3IKJA 3JAME 3GTGB 2PMZB 1RTOA 2PPBC 3NE5B 4EQOA 1D6EC 1EYCA 3M7GA 1BNZA 2EYHA 2F0NA 3EROA 5A35A 3HZXA 1O78A 3MFGA 4H7BA 1H9RA 2LS01 5T1IA 4WRDA 3MHBA 2Z1CA 1PFNA 2IWHA 1ENFA 5D14A 3NHHA 2KA7A 4K14A 2WKCA 2NBFA 4HN7A 1HQMC 4JK1C 1SYGA 2IX3A 1UNSA 1ML0D 5FLXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E6I A;  2RDF A;  4K5W A;  3D4W A;  1A3T A;  1RKN A;  1U9R A;  2EYJ A;  1KDA A;  3ERQ A;  4IZ8 A;  2EYP A;  4QF4 A;  1STH A;  4G57 A;  4K2L A;  2KHS A;  5EGT A;  1F2Z A;  3E5S A;  4RKB A;  3SXH A;  5IGF A;  2EYF A;  3NP8 A;  4QMG A;  5J39 A;  1SNO A;  4J1M A;  1EY6 A;  4TRD A;  3TP8 A;  1TT2 A;  2PZT A;  3VA5 A;  3V2T A;  4F8M A;  2EY1 A;  5K5P A;  2ENB A;  1STG A;  2NUC A;  2RKS A;  3NK9 A;  1EZ8 A;  4ID6 A;  2F0T A;  1KDB A;  5I9P A;  5HUR A;  1EY5 A;  1SND A;  3HEJ A;  1TQO A;  4EVO A;  4F7X A;  2PW7 A;  5IIF A;  5IGD A;  4I65 A;  2F0K A;  1A3V A;  4LAA A;  4OL7 A;  3SHL A;  5I6Y A;  4ZUJ A;  4DGZ A;  1EZ6 A;  3TP5 A;  4EQN A;  2SOB A;  1EYA A;  3MZ5 A;  1NSN S;  5IOD A;  1KAB A;  2F0G A;  3PMF A;  1KAA A;  4R8N A;  5J1Z A;  4B9X A;  1JOR A;  2F0H A;  4KY5 A;  3U9O A;  4KTA A;  3QOJ A;  1EY9 A;  2EYM A;  1JOK A;  4DF7 A;  2EYO A;  3OMC A;  2F0L A;  4IAL A;  1STN A;  4QB4 A;  4N9P A;  3EJI A;  5C5M A;  5EKK A;  1STY A;  2F0S A;  2RBM A;  2F0M A;  4ODG A;  1SYD A;  3BDC A;  5CGK A;  4PMC A;  5HGT A;  5F2D A;  1SYB A;  4N9T A;  1F2Y A;  5CV8 A;  4KD4 A;  5CV9 A;  2O4X A;  4S3S A;  3P1H A;  4KV6 A;  4DFA A;  4K5X A;  3SR1 A;  4KHV A;  3T13 A;  4K8I A;  4HMI A;  5IGE A;  4DU9 A;  3RUZ A;  5KYL A;  3TME A;  4B9W A;  5KRU A;  3EVQ A;  1ENA A;  4ZUI A;  3SK4 A;  5I6W A;  5J22 A;  1AEX A;  4K5V A;  3C1E A;  5KIX A;  2OXP A;  5CV4 A;  2EYL A;  5E1F A;  1EQV A;  5I9O A;  1SNP A;  2OEO A;  2PW5 A;  3MEH A;  5CV7 A;  3TP6 A;  4K6D A;  5C5L A;  3DMU A;  2F0U A;  3P75 A;  1A2U A;  4MIU A;  1STB A;  4ZQ3 A;  2F0Q A;  3D4D A;  1SNC A;  2F3V A;  4KY7 A;  5NUC A;  1EY0 A;  4KJO A;  2F0I A;  2SNS A;  5IGG A;  5C3W A;  4EQO A;  3QB3 A;  1EY8 A;  2HQE A;  3MXP A;  4K8J A;  5JOB A;  5DAU A;  4ME5 A;  3SK8 A;  1EY4 A;  5JAV A;  5C4Z A;  1EYC A;  1SNM A;  2EY2 A;  4IUN A;  2KQ3 A;  2EY6 A;  5CV6 A;  5IGC A;  3C1F A;  1JOO A;  2EYH A;  3S9W A;  5IOC A;  5IGB A;  2F0N A;  1KDC A;  3D8G A;  4NP5 A;  5C3X A;  3ERO A;  5C6A A;  1JOQ A;  5E3F A;  2LKV A;  4RKL A;  5KYI A;  1EY7 A;  5EKL A;  3QOL A;  2PYK A;  5KGU A;  3HZX A;  5CC4 A;  1A3U A;  2QDB A;  3T16 A;  4J6H A;  2SNM A;  4H7B A;  3OWF A;  2WAC A;  2F3W A;  2F0J A;  4WRD A;  2PQE A;  3NQT A;  1IHZ A;  2F0D A;  3H6M A;  1STA A;  1SYC A;  2M00 A;  3MHB A;  1NUC A;  3NUC A;  3ITP A;  2PZW A;  3TP7 A;  2F0F A;  2OF1 A;  4HMJ A;  4PMB A;  4YIJ A;  5KEE A;  3R3O A;  3BDL A;  5C4H A;  3NHH A;  4HTH A;  4EQP A;  1SNQ A;  3OSO A;  1F2M A;  4K14 A;  2F0P A;  3MVV A;  4NKL A;  5ISR A;  3LX0 A;  3DHQ A;  3SK6 A;  4K2K A;  2EXZ A;  1II3 A;  3NXW A;  2F0V A;  4NMZ A;  3OMG A;  1ENC A;  2F0W A;  3SK5 A;  1SYG A;  2F0O A;  1SYF A;  1A2T A;  2F0E A;  5CR3 A;  3D6C A;  5DEH A;  1EYD A;  1SYE A;  4KD3 A;  2PZU A;  2EY5 A;  4WOR A;  4PNY A;  4KJN A;  4KY6 A;  5M9O A;  4NDX A;  1TR5 A;  5CV5 A; 
#chains in the Genus database with same CATH topology
 5IY0 A;  5ELC A;  4HIO A;  1WTW A;  1U9R A;  2NZ1 D;  1XMQ Q;  1YIJ A;  2IJ0 A;  1U0L A;  3M3Y B;  4C3J H;  1S5D D;  4K2L A;  4JBW A;  5EGT A;  2AQ3 B;  1ZEQ X;  1EY6 A;  4JCV E;  1G29 1;  1ROD A;  3ER0 A;  1C8C A;  1SND A;  3KJO A;  2PW7 A;  3WOF A;  2VL6 A;  5IT9 E;  1N34 Q;  2K52 A;  1RIP A;  2NVX B;  2B2U C;  1SJE D;  4UAI A;  4FYD A;  4CKE A;  1O80 A;  5E7N A;  2JA5 H;  2RSN A;  4A3D G;  1YHB A;  3W5O A;  1DYQ A;  1ILQ A;  4TSS A;  1SXT A;  5EAY A;  1PV4 A;  2XN9 C;  3X3N A;  5CGK A;  5I2Y A;  3AYH B;  3I70 A;  2EDG A;  1Z47 A;  2NTT A;  3G6J B;  4S3S A;  4A3G H;  1YBY A;  1PDQ A;  3VDY A;  3T13 A;  4K8I A;  1X3E A;  1T9H A;  2RQX A;  2C5C A;  3VYT A;  3TRZ A;  3V96 A;  4L5Q A;  4C2M H;  2OQK A;  4QQB X;  1EQV A;  3RZO H;  3PIP A;  2KCT A;  4LK1 C;  3HOY B;  4C3I G;  1EY0 A;  2IHF A;  2E5L L;  4A3J G;  3DWA A;  3IFT A;  4IFD J;  5COR A;  2WV6 D;  1TS4 A;  3NWT A;  1J5E L;  3NWS A;  1PH6 A;  3I72 A;  5IGB A;  1LUZ A;  1I6H H;  2CWA A;  1HXY D;  2L12 A;  3OOC A;  2CW0 C;  3K0Y A;  2L0C A;  2DY8 A;  4O2D A;  5KGU A;  4A3E H;  1A3U A;  3A7A B;  5JEA J;  4KHP Q;  4JI5 L;  1Y1V H;  3OWF A;  4MNO A;  5GAD C;  1OO9 B;  3CHB D;  3KF8 B;  4OEL B;  3S2H H;  4LFB Q;  2L5T A;  3CKI B;  4G7O C;  2BH2 A;  4NXN Q;  1GHJ A;  3UE1 A;  2WAQ G;  2D62 A;  4XIG S;  1TXY A;  1I4H A;  3K0X A;  4KKT A;  1MKH A;  4X64 L;  1LLR D;  4P75 A;  2MQH A;  3H3V C;  4DR7 Q;  2BE5 C;  3KF6 B;  1FVI A;  3V05 A;  4FO2 A;  2E2J B;  5DEH A;  1IYV A;  4IN3 A;  5ELO A;  3KDF B;  2FFK B;  1HNX Q;  3J81 L;  3PUX A;  4QUC A;  5CV5 A;  5IYC H;  4APV A;  5AJ3 L;  3CXC A;  4CBV A;  4OWX B;  1YJ9 A;  3S1Q H;  4DV7 Q;  3EQL C;  1D5M C;  2K5Q A;  2EYF A;  2LXJ A;  3KLS A;  4YY3 L;  3T53 B;  3HFZ B;  3S1N H;  3ZJY C;  1V43 A;  4FDB A;  4DR1 L;  1EZ8 A;  4JI7 L;  3BZC A;  4F88 A;  2IX1 A;  4JBK A;  4UP9 A;  3NBH A;  4B08 A;  4L5S A;  1OXV A;  2O2L D;  4LMQ D;  1LT5 D;  3PUZ A;  2AHO B;  5FKA C;  1Q90 A;  1SEB D;  4A3B G;  3EJI A;  2R93 B;  2IHE A;  4EGV A;  1PH7 A;  2ZTD A;  5F2D A;  4N9T A;  3E9I A;  1XPU A;  1A0I A;  2ZM6 Q;  1PH4 A;  2AQ1 B;  1B7Y B;  2QCP X;  3Q0A A;  2FIN B;  4K5V A;  3T4A C;  1VQ6 A;  3EN2 A;  4RHS A;  1CSP A;  2OEO A;  3QR8 A;  2E74 C;  3U4V A;  1V1Q A;  3D4D A;  2B63 B;  5M3M G;  2HCC A;  2WP8 J;  3S15 B;  4A3M B;  4BA1 I;  3S16 H;  2SNS A;  5C3W A;  3OPO A;  1EY8 A;  1Y8P B;  4IUR A;  2JA7 H;  3HS0 C;  1G51 A;  1VQH A;  4OWT B;  1JJC B;  4UP8 A;  2EY6 A;  4CGY B;  1L1O B;  3CCV A;  1VQ9 A;  3NTH A;  4A3K G;  1JWS D;  1TS2 A;  5EBD A;  1CA6 A;  1TY0 A;  3OIP A;  1A15 A;  2K5H A;  4J8Q A;  1VF5 C;  3FHW A;  3I4O A;  3IAY A;  1BDO A;  2DN8 A;  2L9H A;  4RGT A;  2F0D A;  4DUY L;  1GUO A;  1KLU D;  1C7Y A;  2CWP A;  2ZXR A;  4HTH A;  1IW7 C;  4HID A;  3PIO A;  3FEW X;  4C3I H;  4A3J H;  1VQN A;  2F0W A;  4IOA A;  1CZW A;  4B3R Q;  2F0E A;  3LWE A;  2ID0 A;  4JI4 Q;  1S4Z A;  4RAU C;  4NDX A;  4ZKC B;  5M5W H;  2K04 A;  3PF4 A;  1KLG D;  2WB1 B;  2WAQ E;  2D2C C;  2KCC A;  4XQJ A;  4DK1 A;  2A6H D;  4GLV B;  3SVM A;  3GTP B;  2UXC Q;  1SNO A;  3CCQ A;  4A4I A;  1U4P A;  3PUV A;  2HDM A;  2EY1 A;  5ELD A;  2ENB A;  4CDF C;  5I9P A;  3I55 A;  3J81 c;  1N34 L;  1LTB D;  3GTK H;  2JA9 A;  5FK9 C;  3IL8 A;  5IIF A;  2RSO A;  2XSC A;  1W6J A;  1LTG D;  2CQO A;  2XIW A;  4ZUJ A;  4EQN A;  2O5J C;  2Z8L A;  3J81 E;  2HIX A;  2VQF Q;  4KY5 A;  1IBK Q;  1R4Q B;  1EY9 A;  4LFA Q;  2E75 C;  1K8M A;  2NVY B;  1BVS A;  3U58 A;  4N9P A;  1BCP F;  2VUM G;  1CZG A;  1PH2 A;  2LY7 A;  3GV6 A;  5LMN W;  1SRO A;  1OXX K;  1SYD A;  1B50 A;  3GQB A;  3BDO A;  2KVM A;  3MXN B;  3F1Z A;  2CW0 D;  3W3A A;  1X65 A;  2K28 A;  4A3F B;  2E2I H;  2Q2U A;  1NY4 A;  5I6W A;  3S2D H;  5JPM C;  4A3C G;  3M7N A;  5C5L A;  4Y52 H;  1H9K A;  1STB A;  2KCM A;  2NWG A;  3SGI A;  3OTO Q;  4AYB B;  2E2H B;  1RTN A;  3TSS A;  2UUA Q;  3TZU A;  1UUP A;  5M5Y B;  1L2F A;  2BE5 D;  5IE8 A;  3J80 L;  5KND A;  4A3B H;  1HA5 A;  4IUN A;  4X3K A;  2SEB D;  5IGC A;  3TS0 A;  1JOO A;  1O7L A;  1NAP A;  3QJY A;  1JWM D;  4X3U A;  1XWE A;  4DAM A;  4KHP L;  3U4Z A;  3CPW A;  2NB0 A;  3PO3 B;  1KRS A;  4NXN L;  1SN8 A;  3VYR A;  1I50 H;  4K6L A;  1PRT B;  5M3F B;  4WJ3 M;  1BO0 A;  4IFD I;  2IX0 A;  1AP0 A;  2IL8 A;  4IPG A;  1IBL Q;  1NJI C;  1PYS B;  4POG A;  4NKL A;  2Q8T A;  5M3M H;  1XX8 A;  1PH3 A;  1YNN C;  4JYA Q;  3B6Y A;  2F0V A;  5DM6 3;  3I4M G;  2P5Z X;  2VQE L;  1HNX L;  4KK7 A;  3JAM i;  2PZU A;  1K8G A;  2B2V C;  4A3I B;  4KY6 A;  2NN6 G;  4DK3 C;  1AW7 A;  3FPP A;  3ULJ A;  2NTS A;  4C1N I;  1WYD A;  4A3K H;  1VF7 A;  4DV7 L;  4A93 H;  2DY7 A;  2EJF C;  1DOK A;  2EYJ A;  4ZYS A;  3SE0 A;  3M85 A;  1R9T H;  1CQF A;  4QF4 A;  1IBM Q;  2KHS A;  4JBM A;  5IGF A;  4ZLT F;  4X66 Q;  5K36 G;  1I4G A;  1LTR D;  1CUK A;  1STG A;  1K28 A;  4RGM A;  4RMF A;  4MN3 A;  4EVO A;  2AMC B;  4FXK C;  1K0S A;  2F0K A;  3SHL A;  3DEO A;  1DM0 B;  3K59 A;  3PMF A;  2N49 A;  3M4P A;  2KHI A;  2JK8 A;  3A55 A;  2B2T A;  1ASY A;  4DAV A;  4NPS A;  4DV5 Q;  1SAP A;  3H94 A;  1ZKO A;  1V1P A;  2ZM6 L;  3A0J A;  4X3S A;  1VQ5 A;  1N9W A;  1F2Y A;  5DM7 3;  3S1R B;  4Z9C B;  2GA4 B;  4K5X A;  3CC7 A;  5M5X B;  1Q82 C;  5BN3 A;  5GRO A;  4LF5 L;  1LTA D;  2A8V A;  4ZCK A;  4LJZ C;  2CCZ A;  2X69 A;  4BBS H;  1WD1 A;  4HJ7 A;  2TSS A;  4FXD A;  1X54 A;  2KUM A;  4K6D A;  1RD9 D;  4DV4 Q;  1TWA B;  1LV9 A;  5NUC A;  1IW7 D;  2ES2 A;  1B2T A;  1U4R A;  1DZ1 A;  3AFQ A;  3X3M A;  3K5O A;  5DNF A;  3J7Z C;  4OON A;  1BR9 A;  2OT2 A;  2VUM H;  2XTI A;  3E9H A;  1EFW A;  1ICW A;  1T5X D;  1L1O C;  5E3F A;  2YU9 H;  2PYK A;  5C0X G;  1BXT A;  3H3V H;  5CC4 A;  2KED A;  2I5L X;  2LSS A;  4LF9 L;  4TVA B;  2K5V A;  1HR0 Q;  5FO9 B;  2K1B A;  3H6M A;  1STA A;  1I4P A;  1S5E D;  4IJL A;  3J80 c;  3DWP A;  3CC2 A;  4A3C H;  3GTL B;  4ULL A;  4BBR B;  1JJG A;  3VR3 A;  4G7Z C;  1HUM A;  4B3R L;  3KBX A;  3J80 E;  4N8F A;  3CME A;  2MNA A;  4NMZ A;  4JI4 L;  1ET9 A;  2L1B A;  4GN5 A;  1FNV A;  1A63 A;  3GDE A;  4PV1 C;  2MJ8 A;  3SK8 A;  2B2W C;  3D31 A;  3D4W A;  2QW7 A;  4GKK Q;  4LUZ A;  1SE3 A;  3HOV B;  2UXC L;  1IZ6 A;  3K6O A;  1STH A;  1OXS C;  3CAM A;  1WTP A;  1B9N A;  1HQR D;  3HOW B;  1ESF A;  1VQP A;  3W1B A;  1B44 D;  3UE0 A;  1HZB A;  1EOT A;  2HUG A;  1EY5 A;  4OHJ A;  1F9S A;  1TWH B;  3VR2 A;  4RCN A;  3S14 B;  1E1O A;  2VQF L;  2E2D C;  4DR5 L;  3Q22 A;  2DJF C;  3I4M H;  3MZ5 A;  4LFA L;  2NVQ H;  3AMU A;  1JOR A;  1KAA A;  4CJ2 C;  2N88 A;  1K8O A;  3DLL A;  4WJ4 A;  2NN6 H;  1CKO A;  4RGO S;  3UI2 A;  1Z6H A;  1GD7 A;  1E0B A;  3OYY A;  3PO2 B;  4QIW B;  1FYC A;  5K36 H;  4TQU S;  3KUP A;  1K8A C;  4KHV A;  3ZYY X;  2B3G A;  1XPR A;  2EOT A;  2FMM A;  1QJO A;  3KLW A;  1M90 C;  3K57 A;  4GNX B;  1OXU A;  4P72 A;  4G4K A;  5L37 A;  3OTO L;  1SNP A;  2QIL A;  5CV7 A;  1S72 A;  2UUA L;  4KN7 C;  2F0Q A;  3DXJ C;  1DOL A;  4HED A;  3URY A;  3G71 A;  1DXM A;  1NE3 A;  5JAV A;  1YNN D;  3VA7 A;  1I4X A;  3HOU B;  1EQR A;  3U9S A;  1A8V A;  3DM3 A;  1Y1W B;  3KOJ A;  4OIJ A;  1JIC A;  1RL2 A;  3NEN A;  3S1M H;  3CRL C;  4JOI C;  4RKL A;  5KYI A;  1Y1V G;  2KEC A;  4FF4 A;  4RWS C;  1AZP A;  4R4T A;  3GTJ H;  4PZ7 A;  2SNM A;  2WAC A;  5KNB A;  4YWL A;  3CD6 A;  5C4X G;  1B70 B;  2EIF A;  1HA6 A;  4P71 A;  1IBL L;  5T1G A;  1LTT D;  4DR4 Q;  4OWW B;  1PRT C;  3I73 A;  4JYA L;  2A1A A;  1VQM A;  1PH1 A;  2O5I C;  4K2K A;  2EXZ A;  1SE8 A;  5C3E B;  3M3Y H;  4IOC A;  1EOV A;  1G6P A;  3M4O H;  4BA2 I;  3IFD A;  4KD3 A;  3TZD A;  4EQ5 A;  3MTS A;  2HQL A;  4XYO A;  2I5M X;  4IPH A;  4L5R C;  4XT3 B;  3MAQ A;  4BXX G;  4HJ8 A;  5C0X H;  1RKN A;  1TS5 A;  5BN5 A;  2R7Z G;  3K7A B;  4LF6 Q;  4IZ8 A;  1S5B D;  1LTS D;  2NVX H;  4PMW A;  1I94 Q;  2HIV A;  2PZT A;  1NR2 A;  2MO1 A;  3MXG A;  4P2C B;  2KJX A;  5K5P A;  1E2W A;  2K6A A;  2PO4 A;  1QOH A;  4XXE A;  2K05 A;  1FJG Q;  4LAA A;  4BY1 G;  4DGZ A;  4DXG A;  1S5C D;  2F3I A;  3EBE A;  1KAB A;  4JG2 A;  4MZ9 A;  2F0H A;  3U9O A;  3I7F A;  1PXU A;  4KTA A;  4DV5 L;  3BYT B;  2UUC Q;  2ICE C;  3PIP 3;  1BF4 A;  1HHV A;  2NVT H;  1J6Q A;  2F0M A;  1QE6 A;  2DGY A;  1X9N A;  5CV8 A;  5KNC A;  5CV9 A;  2NYZ D;  3R8B A;  3RNU A;  3PF5 A;  1Z7T A;  2RA4 A;  4BY7 B;  2MUY A;  4HMI A;  5KYL A;  3CRK C;  4KKS A;  2EJM A;  3DUZ A;  2ATW A;  4LWC A;  5LMU Q;  4DV4 L;  1K83 B;  3MEH A;  4KI0 A;  3BZK A;  4YCU A;  3K58 A;  1BUV T;  1XMO Q;  1JWU D;  1E2V A;  2EPB A;  3HKZ G;  2Q2I A;  1H9M A;  4L63 B;  3A8K E;  2JA7 G;  2WB1 G;  3ONA B;  4X6A H;  1X3Q A;  2I07 B;  5A2Q L;  2HQE A;  1O7Z A;  2A6H C;  1VQE A;  1FD7 D;  5EQ0 A;  5C44 B;  3FRP B;  3NBI A;  2K14 A;  5IOC A;  4R8I A;  1QUQ B;  1W6K A;  1WTR A;  3A56 A;  5FJ8 G;  1TWF H;  3J81 i;  1Q8K A;  1Z9F A;  1UE1 A;  1R4P B;  3T16 A;  1HR0 L;  3BJU A;  1I4R A;  1HJP A;  2F0J A;  1X3P A;  2FXQ A;  1SYC A;  2PZW A;  2F0F A;  4YIJ A;  3WDN A;  1BBW A;  3U50 C;  1CHQ D;  2LXK A;  3OSO A;  4RH6 A;  2JSO A;  1PTO B;  2YTY A;  2B29 A;  2PI2 E;  1VQ8 A;  3OMG A;  3C2P A;  1G6Z A;  1MJE A;  1CTM A;  2IPK D;  1A2T A;  4C3J B;  1BCP B;  5FLM G;  2BA1 A;  4GKK L;  5DLQ E;  1LTL A;  2ZJR A;  5G3L D;  2I5H A;  3G7L A;  2X6G A;  4HCS A;  2EZV A;  1BBU A;  1MIU A;  3A5U A;  5D3I B;  5JVG 3;  1KDA A;  1JMC A;  2PCF B;  2H4O A;  1CFM A;  1CKN A;  3AQQ A;  3E5S A;  2ALY B;  4LF7 Q;  5C4X H;  1VQ4 A;  1PYB A;  4TRD A;  1TT2 A;  2JEB I;  1YI2 A;  4F8M A;  1LT4 D;  2JA5 B;  1ILP A;  4F7X A;  3HGB A;  4CJ0 B;  2F52 A;  5IWA Q;  4R4C A;  1TWC H;  4DUZ L;  4X3T A;  4IJH A;  1X3G A;  3PO3 G;  3AFP A;  4A3G B;  4IPC A;  3ICE A;  2EYO A;  2JEA I;  3OIQ A;  4BXX H;  4DV3 Q;  2R7Z H;  4CJ1 B;  1HTP A;  5HGT A;  1GXD C;  2XWB B;  5E4X A;  4C2M B;  1BBX C;  3S15 H;  2QA4 A;  2R92 G;  3ERS X;  2JN4 A;  3EVQ A;  4ZUI A;  1P8L A;  1UWV A;  2RVL A;  1MI2 A;  1QNU A;  1IL2 A;  3I4N B;  3L3O C;  4GNX C;  3NEL A;  3K7U C;  4BY1 H;  4ZQ3 A;  1PRT D;  2VB3 X;  4B3T Q;  4KY7 A;  5JJK A;  2H5X A;  1EIH A;  2F0I A;  3NPP A;  4DV0 L;  2DNE A;  5DAU A;  4A3E B;  3GTQ B;  1QNK A;  2VZA A;  5BN4 A;  3CC4 A;  2QKI C;  3RZD B;  3PIO 3;  2KHJ A;  1BOS A;  3EIV A;  1B3A A;  3J7A V;  1JC7 A;  2K5W A;  2EJG C;  1VS0 A;  3HKZ E;  2XRQ D;  3ULP A;  2WB1 E;  1Q81 C;  1IKL A;  1DON A;  2N8N A;  2V4D A;  3K80 C;  4V19 0;  2MPM A;  4DAP A;  4DXF A;  5A2Q E;  3NBH B;  2M9V A;  2VB2 X;  3S1Q B;  1X3F A;  1JB3 A;  1EYD A;  1A62 A;  3HG9 A;  2EY5 A;  4A93 G;  5M9O A;  4A75 A;  3ND9 A;  4KHZ A;  2JA8 G;  1BKB A;  2L55 A;  1E2Z A;  3MWY W;  5FJ8 H;  4K5W A;  1EQQ A;  4LF6 L;  4X65 Q;  3S1N B;  1RCV D;  4QGU A;  2B2W A;  4G57 A;  2ZTC A;  3SXH A;  2PQA A;  3H0G G;  4ZAI A;  3PCO B;  1P16 A;  3BYY B;  2Z4H A;  1X56 A;  3NK9 A;  1FJG L;  3MXU A;  5D3D A;  3CCR A;  4DV2 Q;  4OXP A;  3QG1 A;  2VS1 A;  2J0T D;  5IP9 H;  1EU3 A;  5CMD A;  2UUC L;  4A3F H;  1XMQ L;  5IYD G;  5FLM H;  1F9P A;  4B3S Q;  1VQA A;  1PFS A;  5EKK A;  3J80 i;  3D3R A;  4L5T A;  2N55 A;  2J4X A;  4JI8 Q;  2K03 A;  3VR4 A;  1SYB A;  1CK1 A;  1CSQ A;  1STE A;  2IT1 A;  2YTX A;  4DFA A;  1LAB A;  3SR1 A;  2E2H H;  1XXG A;  5M5Y H;  4BBS G;  4B9W A;  3NSW A;  3SK4 A;  5LMU L;  3S16 B;  1XMO L;  2OXP A;  1HH2 P;  2QGQ A;  4A3D B;  4P73 A;  2BDN A;  1EU4 A;  1YNJ C;  5CBE E;  2F0U A;  1NTG A;  3D0F A;  5I4D A;  1NNX A;  2BA0 A;  3E3X A;  5IGG A;  3CP0 A;  3PO3 H;  4ME5 A;  4UP7 A;  2EY2 A;  1D5X C;  3K8A A;  3HOW G;  5CV6 A;  1XJV A;  3S24 A;  1X55 A;  2F4I A;  4MTK A;  5C4J B;  3G4S A;  4JI2 Q;  4H13 C;  2F4V Q;  2B2Y C;  4H0L C;  5JVH 3;  2R92 H;  4OO1 G;  2I0Q A;  2B39 A;  2PQE A;  4RCO A;  3H3V I;  2D5D A;  1N33 Q;  2C9O A;  1H9S A;  3M4Y A;  4A76 A;  3UDG A;  4Q0F A;  2JYO A;  4POF A;  3PV0 A;  2RHS B;  2Y0S B;  3BS1 A;  3D6W A;  4QJF A;  1PTO C;  1Q1B A;  3G48 A;  2YV5 A;  4WFN 3;  1GM5 A;  4GOP A;  4UY8 C;  2HCI A;  3I90 A;  4GN4 B;  4LFB L;  5EJW A;  3A54 A;  3ND8 A;  2WAQ B;  3AU7 A;  1L0Y B;  2BDO A;  3F8T A;  3FDT A;  5EPL A;  4LF7 L;  4OX9 Q;  3RLF A;  1X6O A;  2YYZ A;  3F2U A;  3GTK B;  4RKB A;  1GUT A;  2Z6K C;  4DR7 L;  2AQ2 B;  3NQI A;  3DM1 A;  1LM0 A;  4IFD G;  4I7Z C;  4XTC S;  3GTO B;  1UAP A;  2DUD A;  5HUR A;  2XWJ B;  3PUY A;  1TQO A;  1QCB D;  3HOX G;  5GAE C;  1AH9 A;  2WFW A;  1EZ6 A;  2RCF A;  5IOD A;  5M5X H;  2F0G A;  1MSG A;  4R4Q A;  1HR0 W;  1NMG A;  5JEA G;  4C3H G;  4DF7 A;  4DV3 L;  4FF2 A;  2JA8 H;  2E2I B;  2F0S A;  3CQZ B;  4GLA C;  1IL8 A;  4KD4 A;  2O4X A;  3H0G H;  1PLF A;  1VMC A;  2K01 A;  1VQF A;  3RUZ A;  3HOZ B;  5J22 A;  1ENA A;  3Q6S A;  3T51 B;  1UEA B;  1S5F D;  4GN3 B;  4GLX A;  4G7H C;  3KBG A;  4B3T L;  4A3B B;  1J8I A;  4LUO A;  3DMU A;  1FR3 A;  1A2U A;  1JR0 D;  1PVO A;  1FL0 A;  2B2U A;  2G9H D;  4KJO A;  4HCE A;  1HCZ A;  5IYD H;  3T1H Q;  1KIX A;  1JT8 A;  1K3B C;  4XYQ A;  3O13 A;  2L4N A;  1I50 B;  3GTL H;  2LKV A;  4LF8 Q;  5EKL A;  2XNA C;  3CCU A;  4O42 A;  1QIL A;  4BBR H;  4V0B A;  4IUU A;  1WTQ A;  3EA6 A;  4LF4 Q;  1SMY C;  5BR8 Q;  5M3M B;  1PH9 A;  4ZRZ A;  1PFM A;  3I3C A;  3RR5 A;  2DNC A;  1KXL A;  1YNX A;  1V1O A;  2YTV A;  5C4H A;  3VYU A;  1HNZ Q;  1KD1 C;  2B8G A;  2G9D A;  1WTH A;  4A3K B;  3HOV H;  3TBI B;  5FOB B;  3A74 A;  4FF3 A;  1F9R A;  1H9J A;  3MFY A;  4LFC Q;  3HOW H;  1TY2 A;  4BY7 G;  3KLS X;  3PUW A;  4DKA C;  4X65 L;  2JA6 B;  1ASZ A;  2L11 A;  4QCL A;  3A5Z B;  1YZ6 A;  1SMX A;  1V1P B;  4GZY C;  1HNW Q;  1TWH H;  2MO0 A;  5ELB A;  1KTK A;  3S14 H;  3OW2 A;  4OO1 H;  1U4M A;  5JPN C;  3RN5 A;  1A6X A;  4DN4 M;  4QMG A;  5J39 A;  4NXM Q;  1XNR Q;  3V2T A;  4DV2 L;  4ID6 A;  1UE5 A;  1VQJ A;  3HEJ A;  3PO2 H;  4HR7 B;  1D5Z C;  3FMC A;  2K75 A;  2OTJ A;  4XQQ A;  3TP5 A;  1YNJ D;  4CDD C;  1SFO B;  2Z6B A;  1WTV A;  4Q5V A;  1Y8O B;  4DR6 Q;  5C5M A;  1XTC D;  1GUS A;  3CCS A;  4ODG A;  2GVB A;  3HOY G;  3N52 A;  5G3L F;  1G91 A;  4FP5 D;  4KV6 A;  3DWQ A;  3G6E A;  4IFD H;  3KLR A;  1Y69 U;  2V1C C;  2Z9H A;  1IBK L;  3HOX H;  4LNQ A;  3P75 A;  4DR2 Q;  3UDX A;  2PMZ E;  4DAY A;  1SNC A;  4AQY Q;  4I7A A;  1IKM A;  1ET6 A;  2YU9 B;  2XRS D;  4ILW A;  1B1Z A;  5JEA H;  5JOB A;  4C3H H;  2OTL A;  1GOZ A;  2VW9 A;  1E22 A;  1PTO D;  2KQ3 A;  3GTG H;  2K50 A;  1HTL D;  1GUN A;  1VQG A;  2A74 C;  2ICI A;  1VQ7 A;  4JI2 L;  5C6A A;  2F4V L;  2CQA A;  1BCP D;  4YWK A;  1DD2 A;  1Q3L A;  2EE1 A;  2K5N A;  5EPK A;  2F3W A;  1N33 L;  1KHI A;  1VCI A;  4PZ8 A;  3NQT A;  1IHZ A;  3BVM A;  2ZT9 C;  3N6R A;  2DJG C;  4PMB A;  1PH5 A;  1HRJ A;  1LYL A;  3BDL A;  3K7A H;  1PRT F;  3SK5 A;  4O1N A;  4K0K Q;  2ZXO A;  3TS2 A;  4DR1 Q;  1XNQ Q;  1SYE A;  4DNT B;  5GAH C;  2KEN A;  3RLO A;  2OQ0 A;  4KJN A;  2QF7 A;  1IYJ B;  5CYU A;  4UDU C;  4Y7N B;  4OX9 L;  1D1I A;  3R2I A;  2K4K A;  3JC6 6;  2FJ2 A;  3ERQ A;  2EYP A;  1HZ9 A;  5EKI A;  2MP1 A;  1TWG B;  1LTI D;  1GUW A;  3I4M B;  2R93 G;  2NVQ B;  2RKS A;  3HRZ C;  1M8A A;  1F9Q A;  1I4Q A;  4C56 C;  4OL7 A;  1A3V A;  4OGQ C;  5TSS A;  4BWG B;  3R93 A;  5ELE A;  1CHP D;  1I3Q B;  4B9X A;  3FP9 A;  4BY7 H;  1IBM L;  1KC8 C;  4RGN A;  4X66 L;  4QB4 A;  3CCM A;  1XYI A;  1STY A;  2RBM A;  4IQZ A;  3I91 A;  2B63 G;  1K83 H;  4A3M G;  1FNU A;  1CT1 D;  3GTM B;  1M4V A;  4U67 3;  4O0A A;  3TRE A;  2E76 C;  1L0X B;  1SMY D;  3RN2 A;  1KL9 A;  2K5D A;  2EYL A;  5C44 H;  3MEF A;  1EFI D;  3KFU A;  4B3M Q;  2EQS A;  3RD4 A;  3AEV A;  1K73 C;  2A69 C;  2BOS A;  3KYH C;  3H91 A;  3S1M B;  1B8A A;  4DK0 A;  3T1H L;  3QB3 A;  3E0J A;  4PZ6 A;  1AN8 A;  3GTJ B;  1KAW A;  5FLX c;  3J7A 5;  4LF8 L;  1EIG A;  5H1S E;  3D8G A;  3HOY H;  3S17 B;  2J7Z A;  3R2T A;  1EY7 A;  4LF4 L;  1PMR A;  3QOL A;  3NTK A;  5IP7 G;  4FF1 A;  1MSH A;  1O7Y A;  5AFW A;  3FKI B;  3I56 A;  1PTO H;  4YCW A;  2B2Y A;  2R6G A;  4L6T B;  1HPC A;  1J9O A;  2M00 A;  1DCZ A;  2Q2T A;  3KK7 A;  1HNZ L;  3UDI A;  1C4Q A;  3M4O B;  1QVC A;  3FVQ A;  1FGB D;  5IT9 c;  1SNQ A;  4ME3 A;  2F0P A;  2PNR C;  4OEM B;  3SK6 A;  1WCM B;  1HFN A;  4LFC L;  4DR3 Q;  4JI3 Q;  2F03 A;  4LUV A;  1WOC A;  3D6C A;  1ZYR D;  3QO2 A;  4GS3 A;  2AWO A;  4JBJ A;  1X32 A;  4IUV A;  2B2T C;  1HNW L;  3T56 B;  4E6I A;  4DV1 Q;  2E2J H;  3WWV A;  4QL5 A;  3QWN A;  4CDE C;  1HUN A;  4NXM L;  3NP8 A;  5HGQ A;  4JPB W;  1XNR L;  2VY3 A;  4J1M A;  1NMF A;  3KF8 A;  3D4R A;  1JB7 A;  4IO9 A;  2Z6K A;  2A68 C;  5IP9 G;  2LMC B;  5EPJ A;  4I65 A;  4A3F G;  3RMH A;  2K7V A;  2NVT B;  2A73 B;  3KF6 A;  1EYA A;  4NW2 A;  1NSN S;  5J1Z A;  3CU7 A;  2FMC A;  2B2V A;  4DR6 L;  1PH8 A;  2CKZ B;  2XVS A;  5GQO A;  3KDF A;  2R3Z A;  4IAL A;  2ZTE A;  2A5H A;  1O7I A;  2E8G A;  1IXR A;  2CH4 W;  2Z4I A;  3I4N H;  3C3L A;  2RF4 A;  4AYB G;  1D8L A;  3L9A X;  3CF5 A;  2HT1 A;  1Q1E A;  4MTN A;  1SE2 A;  3P1H A;  3GO5 A;  3TN2 A;  4JI6 Q;  2Y0S G;  4DU9 A;  2R93 H;  3TME A;  1PZI D;  4DPG A;  3GTQ H;  3UDF A;  1S40 A;  2PI2 A;  5KIX A;  2UXD Q;  2HHH Q;  4DR2 L;  1EEF D;  3RZD H;  2PW5 A;  3TP6 A;  1MD2 D;  1XTD A;  4AQY L;  1UE6 A;  2SDF A;  1GVP A;  2WIN B;  3GP7 A;  1VDZ A;  1TWF B;  3MXP A;  5M3F G;  1EY4 A;  1ZXT A;  4DNR B;  1KRT A;  1GO3 E;  1OTC A;  3RZO B;  1JQY D;  2B63 H;  1KDC A;  1T5E A;  2D0P A;  1ICF B;  4A3M H;  1VMP A;  1G8Z D;  1SRU A;  3A8I E;  2VQE Q;  5LHY 1;  1CKN B;  1MHW C;  1TII D;  3HKS A;  1IYU A;  4A3L H;  4A3I G;  1CM9 A;  1AFP A;  1Y8N B;  3I8Z A;  1E24 A;  1NUC A;  1F77 A;  1I6H B;  1TS3 A;  3T1Y Q;  1PHJ A;  4QUF A;  1BQQ T;  3MVV A;  1TKW B;  4K0K L;  3DHQ A;  3CMA A;  1XNQ L;  1Y1V B;  4L8J A;  1CA5 A;  1EQT A;  3S2H B;  4RFB A;  2C35 B;  3H15 A;  5C4X B;  1YHQ A;  3K5N A;  1SJH D;  3HOZ G;  5ELN A;  1YVC A;  1TU2 B;  1L1O A;  3BVG A;  2RDF A;  1AE3 A;  2KCN A;  5ELF A;  2UU9 Q;  5IP7 H;  4DR4 L;  4XT1 B;  3K5L A;  1FNW A;  4C1N K;  2UUB Q;  2GN5 A;  1W3S A;  5FO7 B;  4FNF A;  4M1U B;  5EBC A;  2K33 A;  2CHB D;  3BG3 A;  4X62 Q;  1QB5 D;  2ZJQ A;  3W2D A;  1TWC B;  3VA5 A;  3BU2 A;  4N8X 1;  2QEJ C;  1K3R A;  3VR6 A;  3W1G A;  2R7F A;  2B8F A;  4HIK A;  5C0X J;  1MJC A;  1Q8I A;  5IGD A;  3GTP H;  4J15 A;  4LF5 Q;  1SLJ A;  2UXB Q;  2R7Z B;  1RF2 D;  2A69 D;  4H44 C;  1PZK D;  3QOJ A;  2F0L A;  4R4I A;  5LL6 S;  1YJN A;  2ZXP A;  1I94 L;  1VQK A;  3J81 j;  3MA2 B;  4A3D H;  4KKU A;  2R61 A;  4PMC A;  4JI0 Q;  4XQN A;  1AE2 A;  1QZG A;  4PQX A;  2NVY H;  1N32 Q;  4BY1 B;  1UEB A;  1PZJ D;  5I2X A;  5CBA E;  2R7D A;  1WTX A;  4B3M L;  4CDC C;  1LAC A;  5E1F A;  1QWY A;  1B4O A;  2JA6 G;  5C4J H;  4YHH Q;  4LF9 Q;  2TMP A;  1DGS A;  3OHX C;  3GV3 A;  4MIU A;  1TVX A;  3CCL A;  4AYB E;  4KMU C;  5FO8 B;  3WOE A;  4LW1 A;  4K8J A;  3RLN A;  4KLK A;  3E6Z X;  4ALP A;  1GUG A;  2Y0S E;  2Z0S A;  4UPA A;  3BZD B;  4BBR G;  5JJI A;  1N36 Q;  3E0E A;  3QIA A;  3MXN A;  2QDB A;  3HKZ B;  3HP3 A;  4J6H A;  2PQA B;  3EFX D;  2AUJ D;  2JA7 B;  1B9M A;  4H02 A;  1SBB B;  2OF1 A;  2H1E A;  1F2L A;  3HOV G;  1JCK B;  3STB C;  2A68 D;  2EVB A;  4DR3 L;  1WFQ A;  4JI3 L;  3F2D A;  1K9M C;  2CFM A;  4ZKB B;  4WJW A;  4CKB A;  5IYB G;  2F0O A;  4M8A A;  5M3F H;  5CR3 A;  3PSI A;  4GKJ Q;  4WOR A;  4XDX A;  2AUK A;  4R4O A;  4DV1 L;  4JOI A;  1LT6 D;  1EWI A;  1PTO F;  1YJW A;  1GJX A;  1HFG A;  2LFN A;  1Q12 A;  4DR5 Q;  2FHT A;  3TQY A;  2N78 A;  3GTO H;  4C3I B;  1VQI A;  4A3J B;  2HD3 A;  1RDP D;  1E3P A;  1KNE A;  4JV5 Q;  1DOM A;  4A3I H;  5D65 A;  3K81 C;  3TP8 A;  3PO2 G;  3CCJ A;  5M5W B;  1SSO A;  1D1K A;  4OO1 I;  3CW2 C;  3CQZ H;  2XGT A;  3J7A F;  4OIK A;  1I6V C;  2VXW A;  1WI5 A;  2PNH A;  1BCP C;  1M1K C;  1XPO A;  1Q86 C;  1EYG A;  3HOZ H;  3P7J A;  4F87 A;  1STN A;  1W2B A;  1B53 A;  1NBW A;  3F2B A;  2MFI A;  4JI6 L;  1KQS A;  3TDQ A;  4HSV A;  3BVZ A;  3A7L A;  3L7Z C;  3HOU G;  4CHT B;  1Y1W G;  2UXD L;  5IWA L;  2HHH L;  3H09 A;  2IY5 B;  1AEX A;  1EWC A;  4FVM A;  4NB3 A;  1WTO A;  1EUJ A;  3S1R H;  1H9S B;  2OCE A;  2RDH A;  3VYS A;  1YHA A;  5HY6 A;  4HJ9 A;  2RCN A;  2KBN A;  4PG3 A;  1Q7Y C;  4IUQ A;  4JC0 A;  3S2D B;  5C4Z A;  1SNM A;  4GOP B;  1C0A A;  2R92 B;  2A19 A;  3S9W A;  3C1F A;  1NR4 A;  1PYW D;  1TWA H;  2NN6 I;  2QEX A;  3GD7 A;  2NZO A;  4NP5 A;  5C3X A;  1JOQ A;  4JVZ A;  1EIF A;  1KNA A;  5C3E G;  1WJJ A;  3LGJ A;  3M9B A;  3MC0 B;  5JJL A;  2D0O A;  2RDG A;  1ONL A;  1RHP A;  2A6E C;  3J7Y W;  3VR5 A;  3AB9 A;  1FGU A;  2K32 A;  3T1Y L;  1LT3 D;  2VNU D;  5I9O A;  3TP7 A;  1QG7 A;  2JA6 H;  4JI1 Q;  1MBY A;  2BCO A;  1JE5 A;  3R3O A;  1B3Q A;  5LMN Q;  4EQP A;  1F2M A;  3C46 A;  1E7Z A;  1EWH A;  1SR3 A;  2BH8 A;  4TKO B;  4HAE A;  1II3 A;  4UHV A;  1ENC A;  4DNI A;  1E1T A;  3I4L A;  4HJA A;  1RJT A;  4PNY A;  1UE7 A;  2UU9 L;  1TR5 A;  3A8J E;  4DV6 Q;  1A3T A;  2UUB L;  2Q8R E;  1CI3 M;  3F2C A;  5GAG C;  4IUT A;  4X62 L;  1F2Z A;  3TEH B;  1CKM A;  3IRB A;  1SFO H;  4BS9 A;  1C48 A;  1HZC A;  2CVR A;  1DJR D;  2JXM B;  4A93 B;  1Q46 A;  3Q24 A;  2UXB L;  3CPF A;  1R9T B;  1C9O A;  2JA8 B;  1VQL A;  2AWN A;  3SDZ A;  5I6Y A;  5IYB H;  2M2L A;  3JAM L;  1EIY B;  3FKI G;  3H0G B;  2WII B;  2EYM A;  1JOK A;  2HDL A;  1VQC A;  3ULL A;  3L2P A;  2ZJP A;  1WVL A;  4JI0 L;  3M4Q A;  3BDC A;  2MGS A;  2AKW B;  4QIW E;  1N32 L;  5C0X I;  4HSP A;  1WCM G;  4KN4 C;  5IGE A;  5C44 G;  2KEE A;  1U4L A;  2D9U A;  3C1E A;  4ZK9 B;  4YHH L;  4HIM A;  1H95 A;  1S3O A;  1EL0 A;  1ZYR C;  4B3S L;  1K0R A;  5J3B A;  4QY7 A;  2L15 A;  1D2B A;  2QDL A;  3PQI A;  2F3V A;  3STB D;  1G2S A;  4JI8 L;  4CKC A;  1GKH A;  3LWU A;  1QZH A;  4YWM A;  1WD0 A;  3OW7 A;  2IW3 A;  2F1M A;  3Q8D A;  2ASB A;  2E5L Q;  1N36 L;  4BBS B;  1D7Q A;  2JJQ A;  1MGS A;  5E4W C;  4HJ5 A;  4DA2 A;  1J5E Q;  1CQV A;  3K5M A;  5FLX L;  3LNN A;  3HOU H;  4DK6 C;  3PGZ A;  4C3J G;  1Y1W H;  1V8Q A;  3OWE B;  4JI5 Q;  1ESR A;  2VUM B;  3NUC A;  1PFB A;  3ITP A;  4GNX A;  4HMJ A;  5KEE A;  4Y7N H;  1QVF A;  5ISR A;  3LX0 A;  1VQB A;  4X64 Q;  3NXW A;  2X6L A;  4GKJ L;  3Q23 A;  4R9W A;  1SYF A;  1G2T A;  2RHQ B;  5IT9 L;  1TWG H;  2WKD A;  1I5F A;  3P20 A;  2JA5 G;  1L0W A;  1QVG A;  5C3E H;  4IPD A;  4JV5 L;  4DUZ Q;  5AJ3 Q;  4A3G G;  3KJP A;  1I3Q H;  1PA6 A;  1Y14 B;  1LO5 D;  1VQD A;  3I2Z A;  4YY3 Q;  2NUC A;  2GVA A;  2F0T A;  1KDB A;  1NCV A;  2JP1 A;  2N3S A;  4JI7 Q;  2JE6 I;  5LL6 X;  3DEP A;  1GHK A;  4DAY B;  5COY A;  3CCE A;  2MHV A;  2SOB A;  2OWO A;  3GTM H;  1YEZ A;  4R8N A;  4U68 A;  3NEM A;  3I4N G;  3OMC A;  4RHR A;  1OXT A;  1N8R C;  4IUP A;  1JE4 A;  4MHE A;  1SE4 A;  3FPU B;  4ABN A;  2KOL A;  4DV0 Q;  3SEB A;  3NTI A;  3HOX B;  1U5K A;  4A3E G;  2NZH A;  2I46 A;  4AIM A;  4RA8 A;  1AZQ A;  4YCV A;  3JAM c;  1SDF A;  2A6E D;  5KRU A;  5CV4 A;  2Q8I B;  4C3H B;  4FXG C;  1VQO A;  5JJZ A;  1V9P A;  1EEI D;  3IKJ A;  3S17 H;  3JAM E;  3GTG B;  2PMZ B;  1RTO A;  2PPB C;  4EX5 A;  1HZA A;  3FKI H;  3NE5 B;  4EQO A;  1D6E C;  1JJ2 A;  1EYC A;  2CH4 A;  4GOP C;  3M7G A;  4P74 A;  1BNZ A;  2EYH A;  2F0N A;  3ERO A;  5IYC G;  4RG1 A;  5A35 A;  2Q2H A;  4A3L G;  4AH6 A;  3HZX A;  1O78 A;  1WCM H;  3MFG A;  4H7B A;  1H9R A;  2LS0 1;  5T1I A;  4JW0 A;  4WRD A;  4JI1 L;  3MHB A;  2Z1C A;  5LMN L;  1YIT A;  3L0O A;  1PFN A;  2IWH A;  1ENF A;  4DUY Q;  5D14 A;  3NHH A;  2KA7 A;  4K14 A;  2EXD A;  2G5D A;  2WKC A;  2NBF A;  4HN7 A;  1HQM C;  4JK1 C;  2JQO A;  4R1J A;  1SYG A;  2IX3 A;  1UNS A;  4DV6 L;  1ML0 D;  5BR8 L;  5FLX E;  1QUQ A; 
#chains in the Genus database with same CATH homology
 5ELC A;  1WTW A;  1U9R A;  2NZ1 D;  2IJ0 A;  3M3Y B;  1S5D D;  4K2L A;  4JBW A;  5EGT A;  2AQ3 B;  1ZEQ X;  1EY6 A;  1G29 1;  1ROD A;  1C8C A;  1SND A;  2PW7 A;  3WOF A;  5IT9 E;  2NVX B;  2B2U C;  1SJE D;  4UAI A;  4FYD A;  4CKE A;  1O80 A;  2RSN A;  1DYQ A;  1ILQ A;  4TSS A;  1SXT A;  2XN9 C;  3X3N A;  5CGK A;  5I2Y A;  3I70 A;  2EDG A;  1Z47 A;  2NTT A;  3G6J B;  4S3S A;  1PDQ A;  3T13 A;  4K8I A;  2RQX A;  2C5C A;  3VYT A;  3V96 A;  1EQV A;  4LK1 C;  3HOY B;  4C3I G;  1EY0 A;  3DWA A;  3IFT A;  4IFD J;  5COR A;  2WV6 D;  1TS4 A;  3NWT A;  3NWS A;  3I72 A;  5IGB A;  2L12 A;  1HXY D;  3OOC A;  2CW0 C;  3K0Y A;  2L0C A;  2DY8 A;  5KGU A;  1A3U A;  3A7A B;  5JEA J;  3OWF A;  1OO9 B;  3CHB D;  2L5T A;  3CKI B;  4G7O C;  1GHJ A;  2D62 A;  4XIG S;  4KKT A;  1I4H A;  1LLR D;  3H3V C;  2BE5 C;  3V05 A;  4FO2 A;  2E2J B;  5DEH A;  1IYV A;  4IN3 A;  2FFK B;  3J81 L;  3PUX A;  4QUC A;  5CV5 A;  4CBV A;  3EQL C;  1D5M C;  2K5Q A;  2EYF A;  3KLS A;  3T53 B;  1V43 A;  1EZ8 A;  4F88 A;  2IX1 A;  3NBH A;  4B08 A;  1OXV A;  2O2L D;  4LMQ D;  1LT5 D;  3PUZ A;  5FKA C;  1Q90 A;  1SEB D;  3EJI A;  2R93 B;  4EGV A;  5F2D A;  4N9T A;  2AQ1 B;  2QCP X;  3Q0A A;  2FIN B;  4K5V A;  3T4A C;  4RHS A;  2OEO A;  2E74 C;  3D4D A;  2B63 B;  2HCC A;  2WP8 J;  3S15 B;  4A3M B;  4BA1 I;  2SNS A;  5C3W A;  3OPO A;  1EY8 A;  1Y8P B;  4IUR A;  3HS0 C;  2EY6 A;  4CGY B;  3NTH A;  1JWS D;  1TS2 A;  5EBD A;  1CA6 A;  1TY0 A;  3OIP A;  1A15 A;  4J8Q A;  1VF5 C;  3IAY A;  1BDO A;  2DN8 A;  2L9H A;  4RGT A;  2F0D A;  1GUO A;  1KLU D;  2ZXR A;  4HTH A;  1IW7 C;  3FEW X;  2F0W A;  1CZW A;  2F0E A;  3LWE A;  2ID0 A;  1S4Z A;  4RAU C;  4NDX A;  4ZKC B;  2K04 A;  1KLG D;  2WB1 B;  2D2C C;  2KCC A;  4XQJ A;  4DK1 A;  2A6H D;  3SVM A;  3GTP B;  1SNO A;  1U4P A;  3PUV A;  2HDM A;  2EY1 A;  5ELD A;  2ENB A;  5I9P A;  1LTB D;  5IIF A;  5FK9 C;  3IL8 A;  2RSO A;  2XSC A;  1W6J A;  1LTG D;  2XIW A;  4ZUJ A;  4EQN A;  2O5J C;  2Z8L A;  3J81 E;  4KY5 A;  1R4Q B;  1EY9 A;  2E75 C;  1K8M A;  2NVY B;  4N9P A;  1BCP F;  1CZG A;  2LY7 A;  3GV6 A;  1OXX K;  1SYD A;  1B50 A;  3GQB A;  3BDO A;  2KVM A;  2CW0 D;  3W3A A;  4A3F B;  2K28 A;  5I6W A;  5JPM C;  3M7N A;  5C5L A;  1H9K A;  1STB A;  2NWG A;  4AYB B;  2E2H B;  1RTN A;  3TSS A;  3TZU A;  1UUP A;  5M5Y B;  2BE5 D;  3J80 L;  5KND A;  1HA5 A;  4IUN A;  4X3K A;  2SEB D;  5IGC A;  1JOO A;  1O7L A;  1NAP A;  3QJY A;  1JWM D;  4X3U A;  1XWE A;  2NB0 A;  3PO3 B;  3VYR A;  4K6L A;  1PRT B;  5M3F B;  1BO0 A;  4IFD I;  2IX0 A;  1AP0 A;  2IL8 A;  4NKL A;  2Q8T A;  1XX8 A;  1YNN C;  2F0V A;  5DM6 3;  4KK7 A;  2PZU A;  2B2V C;  4A3I B;  4KY6 A;  2NN6 G;  1AW7 A;  3FPP A;  2NTS A;  4C1N I;  1VF7 A;  2DY7 A;  2EJF C;  1DOK A;  2EYJ A;  4ZYS A;  3SE0 A;  3M85 A;  1CQF A;  4QF4 A;  2KHS A;  5IGF A;  4ZLT F;  5K36 G;  1I4G A;  1LTR D;  1STG A;  4RGM A;  4MN3 A;  4EVO A;  4FXK C;  2F0K A;  3SHL A;  3DEO A;  1DM0 B;  3K59 A;  3PMF A;  3A55 A;  2B2T A;  4DAV A;  1SAP A;  3H94 A;  1ZKO A;  1V1P A;  4X3S A;  1F2Y A;  5DM7 3;  3S1R B;  4Z9C B;  2GA4 B;  4K5X A;  5M5X B;  5BN3 A;  1LTA D;  4LJZ C;  2X69 A;  1WD1 A;  2TSS A;  4FXD A;  2KUM A;  4K6D A;  1RD9 D;  1TWA B;  1LV9 A;  5NUC A;  1IW7 D;  1B2T A;  1U4R A;  1DZ1 A;  3X3M A;  3K5O A;  5DNF A;  1BR9 A;  2OT2 A;  1ICW A;  1T5X D;  5E3F A;  2PYK A;  5C0X G;  1BXT A;  5CC4 A;  2KED A;  5FO9 B;  2K1B A;  3H6M A;  1STA A;  1I4P A;  1S5E D;  3DWP A;  3GTL B;  4ULL A;  4BBR B;  3VR3 A;  4G7Z C;  1HUM A;  3KBX A;  3J80 E;  4NMZ A;  1ET9 A;  2L1B A;  1FNV A;  4PV1 C;  2MJ8 A;  3SK8 A;  2B2W C;  3D31 A;  3D4W A;  1SE3 A;  3HOV B;  3K6O A;  1STH A;  1OXS C;  1WTP A;  1B9N A;  1HQR D;  3HOW B;  1ESF A;  1B44 D;  1EOT A;  2HUG A;  1EY5 A;  4OHJ A;  1F9S A;  1TWH B;  3VR2 A;  4RCN A;  3S14 B;  2E2D C;  3Q22 A;  3MZ5 A;  3AMU A;  1JOR A;  1KAA A;  4CJ2 C;  2N88 A;  1K8O A;  2NN6 H;  4RGO S;  3UI2 A;  1Z6H A;  1E0B A;  3PO2 B;  4QIW B;  1FYC A;  5K36 H;  4TQU S;  3KUP A;  4KHV A;  3ZYY X;  2EOT A;  2FMM A;  1QJO A;  3K57 A;  1OXU A;  4G4K A;  1SNP A;  2QIL A;  5CV7 A;  4KN7 C;  2F0Q A;  3DXJ C;  1DOL A;  4HED A;  3URY A;  1DXM A;  5JAV A;  1YNN D;  3VA7 A;  1I4X A;  3HOU B;  3U9S A;  1Y1W B;  4OIJ A;  1JIC A;  3CRL C;  4RKL A;  5KYI A;  2KEC A;  4FF4 A;  4RWS C;  1AZP A;  2SNM A;  2WAC A;  5KNB A;  1HA6 A;  5T1G A;  1LTT D;  1PRT C;  3I73 A;  2O5I C;  4K2K A;  2EXZ A;  5C3E B;  4BA2 I;  3IFD A;  4KD3 A;  3TZD A;  3MTS A;  4XYO A;  4XT3 B;  3MAQ A;  5C0X H;  1RKN A;  1TS5 A;  5BN5 A;  3K7A B;  4IZ8 A;  1S5B D;  1LTS D;  4PMW A;  2PZT A;  1NR2 A;  3MXG A;  4P2C B;  2KJX A;  5K5P A;  1E2W A;  2K6A A;  2PO4 A;  1QOH A;  4XXE A;  2K05 A;  4LAA A;  4DGZ A;  4DXG A;  1S5C D;  1KAB A;  2F0H A;  3U9O A;  1PXU A;  4KTA A;  3BYT B;  2ICE C;  3PIP 3;  1BF4 A;  1HHV A;  2F0M A;  1QE6 A;  5CV8 A;  5KNC A;  5CV9 A;  2NYZ D;  3R8B A;  1Z7T A;  2RA4 A;  4BY7 B;  2MUY A;  4HMI A;  5KYL A;  3CRK C;  4KKS A;  2EJM A;  3DUZ A;  1K83 B;  3MEH A;  4KI0 A;  3K58 A;  1BUV T;  1JWU D;  1E2V A;  2EPB A;  1H9M A;  4L63 B;  3A8K E;  3ONA B;  1X3Q A;  2I07 B;  5A2Q L;  2HQE A;  1O7Z A;  2A6H C;  1FD7 D;  5EQ0 A;  5C44 B;  3FRP B;  3NBI A;  5IOC A;  4R8I A;  1W6K A;  1WTR A;  3A56 A;  1R4P B;  3T16 A;  1I4R A;  2F0J A;  1X3P A;  1SYC A;  2PZW A;  2F0F A;  4YIJ A;  3WDN A;  1CHQ D;  3OSO A;  4RH6 A;  2JSO A;  1PTO B;  3C2P A;  3OMG A;  1G6Z A;  1CTM A;  2IPK D;  1A2T A;  4C3J B;  1BCP B;  2BA1 A;  5G3L D;  3G7L A;  2X6G A;  4HCS A;  2EZV A;  5D3I B;  5JVG 3;  1KDA A;  2PCF B;  2H4O A;  1CFM A;  3E5S A;  4TRD A;  1TT2 A;  2JEB I;  4F8M A;  1LT4 D;  2JA5 B;  1ILP A;  4F7X A;  3HGB A;  4CJ0 B;  4X3T A;  4A3G B;  2EYO A;  2JEA I;  3OIQ A;  4CJ1 B;  1HTP A;  5HGT A;  1GXD C;  2XWB B;  5E4X A;  4C2M B;  1BBX C;  3EVQ A;  4ZUI A;  2RVL A;  1MI2 A;  1QNU A;  3I4N B;  3L3O C;  4ZQ3 A;  1PRT D;  2VB3 X;  4KY7 A;  1EIH A;  2F0I A;  3NPP A;  2DNE A;  5DAU A;  4A3E B;  3GTQ B;  1QNK A;  5BN4 A;  2QKI C;  3RZD B;  3PIO 3;  1BOS A;  1B3A A;  3J7A V;  1JC7 A;  2K5W A;  2EJG C;  2XRQ D;  1IKL A;  1DON A;  2V4D A;  4V19 0;  2MPM A;  4DAP A;  4DXF A;  5A2Q E;  2M9V A;  2VB2 X;  3S1Q B;  1JB3 A;  1EYD A;  3HG9 A;  2EY5 A;  5M9O A;  3ND9 A;  4KHZ A;  2L55 A;  1E2Z A;  3MWY W;  3S1N B;  4K5W A;  1RCV D;  2B2W A;  4G57 A;  3SXH A;  4ZAI A;  3BYY B;  2Z4H A;  3NK9 A;  3MXU A;  5D3D A;  3QG1 A;  2J0T D;  1EU3 A;  5CMD A;  1F9P A;  5EKK A;  3D3R A;  2N55 A;  2J4X A;  2K03 A;  3VR4 A;  1SYB A;  1CK1 A;  1STE A;  2IT1 A;  4DFA A;  1LAB A;  3SR1 A;  1XXG A;  4B9W A;  3NSW A;  3SK4 A;  3S16 B;  2OXP A;  4A3D B;  2BDN A;  1EU4 A;  1YNJ C;  5CBE E;  2F0U A;  5I4D A;  2BA0 A;  5IGG A;  4ME5 A;  2EY2 A;  1D5X C;  5CV6 A;  2F4I A;  5C4J B;  4H13 C;  2B2Y C;  4H0L C;  5JVH 3;  4OO1 G;  2B39 A;  2PQE A;  4RCO A;  2D5D A;  2C9O A;  1H9S A;  3M4Y A;  4Q0F A;  2JYO A;  3PV0 A;  2Y0S B;  3BS1 A;  3D6W A;  1PTO C;  1Q1B A;  4WFN 3;  2HCI A;  3I90 A;  5EJW A;  3A54 A;  3ND8 A;  2WAQ B;  3AU7 A;  1L0Y B;  2BDO A;  3FDT A;  5EPL A;  3RLF A;  2YYZ A;  3F2U A;  3GTK B;  4RKB A;  1GUT A;  2AQ2 B;  3NQI A;  3DM1 A;  4IFD G;  4I7Z C;  4XTC S;  3GTO B;  1UAP A;  5HUR A;  2XWJ B;  3PUY A;  1TQO A;  1QCB D;  1EZ6 A;  5IOD A;  2F0G A;  1MSG A;  5JEA G;  4C3H G;  4DF7 A;  4FF2 A;  2E2I B;  2F0S A;  3CQZ B;  1IL8 A;  4KD4 A;  2O4X A;  1PLF A;  1VMC A;  2K01 A;  3RUZ A;  3HOZ B;  5J22 A;  1ENA A;  3Q6S A;  3T51 B;  1UEA B;  1S5F D;  4G7H C;  3KBG A;  4A3B B;  1J8I A;  3DMU A;  1FR3 A;  1A2U A;  1JR0 D;  2B2U A;  2G9H D;  4KJO A;  4HCE A;  1HCZ A;  4XYQ A;  3O13 A;  2L4N A;  1I50 B;  2LKV A;  5EKL A;  2XNA C;  4O42 A;  1QIL A;  4V0B A;  4IUU A;  1WTQ A;  3EA6 A;  1SMY C;  5M3M B;  4ZRZ A;  1PFM A;  3I3C A;  2DNC A;  1V1O A;  5C4H A;  3VYU A;  2B8G A;  2G9D A;  4A3K B;  3TBI B;  5FOB B;  4FF3 A;  1F9R A;  1H9J A;  3MFY A;  1TY2 A;  3KLS X;  3PUW A;  2JA6 B;  2L11 A;  4QCL A;  1V1P B;  4GZY C;  5ELB A;  1KTK A;  4OO1 H;  1U4M A;  5JPN C;  1A6X A;  4DN4 M;  4QMG A;  5J39 A;  3V2T A;  4ID6 A;  3HEJ A;  4HR7 B;  1D5Z C;  3FMC A;  4XQQ A;  3TP5 A;  1YNJ D;  1SFO B;  1WTV A;  4Q5V A;  1Y8O B;  5C5M A;  1XTC D;  1GUS A;  4ODG A;  3N52 A;  5G3L F;  1G91 A;  4FP5 D;  4KV6 A;  3DWQ A;  4IFD H;  3KLR A;  1Y69 U;  3P75 A;  4DAY A;  1SNC A;  1IKM A;  1ET6 A;  2YU9 B;  2XRS D;  4ILW A;  1B1Z A;  5JEA H;  5JOB A;  1GOZ A;  1PTO D;  2KQ3 A;  1HTL D;  1GUN A;  2A74 C;  2ICI A;  5C6A A;  2CQA A;  1BCP D;  1DD2 A;  1Q3L A;  2EE1 A;  5EPK A;  2F3W A;  1VCI A;  3NQT A;  1IHZ A;  3BVM A;  2ZT9 C;  3N6R A;  4PMB A;  1HRJ A;  3BDL A;  1PRT F;  3SK5 A;  4O1N A;  2ZXO A;  1SYE A;  4DNT B;  4KJN A;  2QF7 A;  5CYU A;  4UDU C;  4Y7N B;  1D1I A;  3R2I A;  2FJ2 A;  3ERQ A;  2EYP A;  5EKI A;  2MP1 A;  1TWG B;  1LTI D;  1GUW A;  3I4M B;  2NVQ B;  2RKS A;  3HRZ C;  1M8A A;  1F9Q A;  1I4Q A;  4C56 C;  4OL7 A;  1A3V A;  4OGQ C;  5TSS A;  4BWG B;  3R93 A;  5ELE A;  1CHP D;  1I3Q B;  4B9X A;  4RGN A;  4QB4 A;  1XYI A;  1STY A;  2RBM A;  4IQZ A;  3I91 A;  1FNU A;  1CT1 D;  3GTM B;  1M4V A;  4U67 3;  2E76 C;  1L0X B;  1SMY D;  2K5D A;  2EYL A;  1EFI D;  3RD4 A;  2A69 C;  2BOS A;  3H91 A;  3S1M B;  4DK0 A;  3QB3 A;  3E0J A;  1AN8 A;  3GTJ B;  1EIG A;  3S17 B;  3D8G A;  2J7Z A;  3R2T A;  1EY7 A;  1PMR A;  3QOL A;  3NTK A;  4FF1 A;  1MSH A;  1O7Y A;  5AFW A;  3FKI B;  1PTO H;  2B2Y A;  2R6G A;  4L6T B;  1HPC A;  1J9O A;  2M00 A;  1DCZ A;  3KK7 A;  1C4Q A;  3M4O B;  3FVQ A;  1FGB D;  1SNQ A;  2F0P A;  2PNR C;  3SK6 A;  1WCM B;  1HFN A;  2F03 A;  3D6C A;  1ZYR D;  3QO2 A;  2AWO A;  1X32 A;  4IUV A;  2B2T C;  3T56 B;  4E6I A;  3QWN A;  1HUN A;  3NP8 A;  4J1M A;  3KF8 A;  3D4R A;  2A68 C;  2LMC B;  5EPJ A;  4I65 A;  3RMH A;  2K7V A;  2NVT B;  2A73 B;  1EYA A;  4NW2 A;  1NSN S;  5J1Z A;  3CU7 A;  2FMC A;  2B2V A;  2XVS A;  2R3Z A;  4IAL A;  2A5H A;  2Z4I A;  3C3L A;  3L9A X;  1Q1E A;  1SE2 A;  3P1H A;  3GO5 A;  3TN2 A;  4DU9 A;  3TME A;  1PZI D;  5KIX A;  1EEF D;  2PW5 A;  3TP6 A;  1MD2 D;  2SDF A;  2WIN B;  3GP7 A;  1VDZ A;  1TWF B;  3MXP A;  1EY4 A;  1ZXT A;  4DNR B;  3RZO B;  1JQY D;  1KDC A;  1T5E A;  1VMP A;  1G8Z D;  3A8I E;  5LHY 1;  1TII D;  1IYU A;  1CM9 A;  1AFP A;  1Y8N B;  3I8Z A;  1NUC A;  1F77 A;  1I6H B;  1TS3 A;  4QUF A;  1BQQ T;  3MVV A;  1TKW B;  3DHQ A;  1Y1V B;  4L8J A;  1CA5 A;  1EQT A;  3S2H B;  4RFB A;  5C4X B;  3K5N A;  1SJH D;  1TU2 B;  3BVG A;  2RDF A;  2KCN A;  5ELF A;  4XT1 B;  3K5L A;  1FNW A;  4C1N K;  5FO7 B;  4FNF A;  4M1U B;  5EBC A;  2K33 A;  2CHB D;  3BG3 A;  1QB5 D;  3W2D A;  1TWC B;  3VA5 A;  2QEJ C;  3VR6 A;  2B8F A;  5C0X J;  1Q8I A;  5IGD A;  2R7Z B;  1RF2 D;  2A69 D;  4H44 C;  1PZK D;  3QOJ A;  2F0L A;  5LL6 S;  2ZXP A;  3MA2 B;  4KKU A;  2R61 A;  4PMC A;  4XQN A;  4PQX A;  4BY1 B;  1PZJ D;  5I2X A;  5CBA E;  1WTX A;  1LAC A;  5E1F A;  1QWY A;  1B4O A;  2TMP A;  3OHX C;  3GV3 A;  4MIU A;  1TVX A;  4KMU C;  5FO8 B;  3WOE A;  4K8J A;  3E6Z X;  1GUG A;  3BZD B;  3QIA A;  3MXN A;  2QDB A;  3HKZ B;  3HP3 A;  4J6H A;  3EFX D;  2AUJ D;  2JA7 B;  1B9M A;  1SBB B;  2OF1 A;  2H1E A;  1F2L A;  1JCK B;  2A68 D;  2EVB A;  4ZKB B;  4WJW A;  4CKB A;  2F0O A;  4M8A A;  5CR3 A;  4WOR A;  4XDX A;  2AUK A;  1PTO F;  1LT6 D;  1GJX A;  1HFG A;  2LFN A;  1Q12 A;  2FHT A;  4C3I B;  4A3J B;  1RDP D;  1KNE A;  1DOM A;  5D65 A;  3TP8 A;  5M5W B;  1SSO A;  1D1K A;  4OO1 I;  3J7A F;  4OIK A;  1I6V C;  2VXW A;  1BCP C;  3P7J A;  4F87 A;  1STN A;  1B53 A;  3TDQ A;  4HSV A;  3BVZ A;  3A7L A;  3L7Z C;  4CHT B;  3H09 A;  1AEX A;  1EWC A;  4FVM A;  1WTO A;  1H9S B;  2RDH A;  3VYS A;  4IUQ A;  3S2D B;  5C4Z A;  1SNM A;  2R92 B;  3S9W A;  3C1F A;  1NR4 A;  1PYW D;  2NN6 I;  3GD7 A;  4NP5 A;  5C3X A;  1JOQ A;  1KNA A;  3MC0 B;  2RDG A;  1ONL A;  1RHP A;  2A6E C;  3J7Y W;  3VR5 A;  3AB9 A;  2K32 A;  1LT3 D;  2VNU D;  5I9O A;  3TP7 A;  1QG7 A;  1MBY A;  2BCO A;  3R3O A;  4EQP A;  1F2M A;  3C46 A;  1EWH A;  4TKO B;  4HAE A;  1II3 A;  1ENC A;  3I4L A;  1RJT A;  4PNY A;  1TR5 A;  3A8J E;  1A3T A;  2Q8R E;  1CI3 M;  4IUT A;  1F2Z A;  4BS9 A;  1C48 A;  2CVR A;  1DJR D;  2JXM B;  4A93 B;  3Q24 A;  1R9T B;  2JA8 B;  2AWN A;  3SDZ A;  5I6Y A;  2M2L A;  3JAM L;  2WII B;  3H0G B;  2EYM A;  1JOK A;  2HDL A;  1WVL A;  3BDC A;  2MGS A;  5C0X I;  4HSP A;  4KN4 C;  5IGE A;  2KEE A;  1U4L A;  2D9U A;  3C1E A;  4ZK9 B;  1EL0 A;  1ZYR C;  1D2B A;  2F3V A;  1G2S A;  4CKC A;  3LWU A;  1WD0 A;  3OW7 A;  2IW3 A;  2F1M A;  4BBS B;  1MGS A;  5E4W C;  4DA2 A;  1CQV A;  3K5M A;  5FLX L;  3LNN A;  4C3J G;  1V8Q A;  3OWE B;  1ESR A;  2VUM B;  3NUC A;  1PFB A;  3ITP A;  4HMJ A;  5KEE A;  5ISR A;  3LX0 A;  3NXW A;  2X6L A;  3Q23 A;  4R9W A;  1SYF A;  1G2T A;  5IT9 L;  2WKD A;  3P20 A;  1LO5 D;  2NUC A;  2F0T A;  1KDB A;  1NCV A;  2JP1 A;  2JE6 I;  5LL6 X;  3DEP A;  1GHK A;  5COY A;  2MHV A;  2SOB A;  4R8N A;  4U68 A;  3OMC A;  4RHR A;  1OXT A;  4IUP A;  1JE4 A;  4MHE A;  1SE4 A;  3FPU B;  4ABN A;  2KOL A;  3SEB A;  3NTI A;  3HOX B;  2I46 A;  1AZQ A;  4RA8 A;  1SDF A;  2A6E D;  5KRU A;  5CV4 A;  2Q8I B;  4C3H B;  4FXG C;  5JJZ A;  1EEI D;  3IKJ A;  3JAM E;  3GTG B;  2PMZ B;  1RTO A;  2PPB C;  3NE5 B;  4EQO A;  1D6E C;  1EYC A;  3M7G A;  1BNZ A;  2EYH A;  2F0N A;  3ERO A;  5A35 A;  3HZX A;  1O78 A;  3MFG A;  4H7B A;  1H9R A;  2LS0 1;  5T1I A;  4WRD A;  3MHB A;  2Z1C A;  1PFN A;  2IWH A;  1ENF A;  5D14 A;  3NHH A;  2KA7 A;  4K14 A;  2WKC A;  2NBF A;  4HN7 A;  1HQM C;  4JK1 C;  1SYG A;  2IX3 A;  1UNS A;  1ML0 D;  5FLX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...