5IGEA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igeA00
3E5SA 5I6WA 1SYBA 5IGGA 4ZUJA 3OMCA 4EQOA 5KGUA 4ME5A 4RKBA 5CGKA 2M00A 4DGZA 3OSOA 5KEEA 2F0IA 5C3WA 1STYA 4KTAA 2OF1A 1A3TA 1EZ8A 2F3WA 1JOOA 3EROA 3EVQA 3TP7A 5KRUA 5E3FA 2F0MA 2EYPA 1EYDA 5K5PA 1JOQA 1JORA 4R8NA 3SHLA 2ENBA 1IHZA 3NXWA 5CR3A 1SNQA 3V2TA 3VA5A 5E1FA 1JOKA 4EQPA 4H7BA 1KDAA 3QOLA 5IGEA 2PZWA 2O4XA 4E6IA 1EYAA 3HEJA 4J6HA 3SXHA 4ODGA 4F7XA 3SR1A 4K8IA 2HQEA 4KD4A 4KY7A 2EY5A 5C5MA 4YIJA 4F8MA 2EXZA 2PQEA 5CC4A 2F0EA 2EYFA 3BDCA 2EYHA 4N9PA 1A2TA 2F0VA 2F0PA 4B9XA 4HTHA 2F0QA 3NHHA 3BDLA 2F0TA 3DMUA 3MXPA 2PZTA 3QOJA 5ISRA 4PMBA 5J39A 5NUCA 4HMIA 1EY7A 3SK6A 1EZ6A 1SYFA 1TT2A 4NKLA 2F0KA 5J1ZA 2F0OA 3TMEA 2F0WA 2F0DA 4KHVA 5CV8A 1ENAA 4EVOA 3ITPA 4MIUA 5HURA 2SOBA 5F2DA 5KYIA 5IOCA 5J22A 2RBMA 1KDBA 2F0LA 5JAVA 3C1EA 4WRDA 1STGA 4KJOA 1EQVA 5KYLA 4I65A 3NK9A 4K5VA 4K8JA 2EY1A 4K5XA 1KAAA 1A3VA 4KY5A 3P1HA 5EKKA 1NSNS 1STAA 3C1FA 3LX0A 2F0JA 2QDBA 5CV6A 2F0UA 2NUCA 2F0HA 4IUNA 3EJIA 2SNSA 4KD3A 2RKSA 4IZ8A 4TRDA 5I9PA 2PW7A 3D4DA 5I6YA 3HZXA 3NQTA 1EY5A 2EY6A 3ERQA 4NMZA 3H6MA 1SNCA 3P75A 4PMCA 2F0SA 4WORA 4ZUIA 4EQNA 1F2MA 2EYLA 4IALA 2PZUA 5JOBA 3U9OA 4KJNA 4NDXA 1F2ZA 2F0FA 3DHQA 3S9WA 1TR5A 5IGBA 5C6AA 5CV7A 2RDFA 4KV6A 4QF4A 5EKLA 2F0GA 3NUCA 3D6CA 4ZQ3A 1SYGA 5HGTA 1EY6A 1U9RA 3SK4A 2EYOA 1SNOA 3OWFA 5IGDA 3SK5A 5IGCA 1EY8A 4J1MA 4PNYA 5CV5A 2F0NA 3SK8A 4K2KA 5DAUA 3TP8A 1KDCA 1ENCA 4S3SA 5M9OA 1SYDA 3RUZA 1SNDA 1EY0A 1SNPA 2PYKA 4K2LA 4QMGA 5C4HA 5I9OA 1A3UA 1EYCA 1F2YA 2SNMA 2EYMA 3R3OA 1SNMA 4K6DA 5CV4A 3QB3A 1STNA 5IIFA 5KIXA 1EY4A 3TP5A 2LKVA 3MHBA 4LAAA 4OL7A 4DU9A 1SYEA 5IODA 2F3VA 4KY6A 1NUCA 1STHA 2KQ3A 4DF7A 3MZ5A 4N9TA 4K14A 3T13A 3T16A 1EY9A 5DEHA 1A2UA 1RKNA 2OEOA 4B9WA 4DFAA 2EY2A 5CV9A 1KABA 4K5WA 4RKLA 3NP8A 5C3XA 2PW5A 3PMFA 4ID6A 2EYJA 1AEXA 1SYCA 5C4ZA 4G57A 2OXPA 2KHSA 3TP6A 5IGFA 3D8GA 4NP5A 5EGTA 4HMJA 1II3A 1STBA 3D4WA 3MVVA 3MEHA 1TQOA 3OMGA 4QB4A 5C5LA 2WACA
chains in the Genus database with same CATH superfamily
4DV0L 1O78A 4DAPA 4KKUA 4UP7A 4RA8A 5KEEA 4UP8A 1EZ8A 5BR8Q 1DYQA 3MC0B 3NXWA 2JA7H 5IGEA 1JOKA 4XXEA 3GTGB 1EFID 1Q8IA 3BZCA 1JWUD 4UHVA 1U4MA 1PTOF 5A35A 2JA8H 2ZJRA 2RF4A 3KYHC 1WCMG 1PFBA 2XRQD 1Q8KA 2EYHA 4JI5L 3PF4A 4C1NK 3S16B 3MXPA 5FLXc 4GZYC 1KC8C 1TIID 2VQEL 1IBKQ 1N8RC 1AP0A 4DKAC 1XNQQ 5J22A 1DXMA 2C9OA 4LF9Q 1KLUD 4XYQA 3OIPA 5C3EB 1CM9A 2CKZB 4UY8C 1TWCH 4QJFA 2F03A 1KAAA 2WFWA 3KBXA 3S2DH 2PCFB 1R4PB 2NUCA 1XMOQ 1GJXA 1EOTA 5C0XJ 1CZGA 2HIVA 1QVGA 1HFGA 1HA5A 1YITA 1PH2A 2IL8A 4DV6Q 1QNKA 4CGYB 3GO5A 3F2CA 1LLRD 4RHSA 3H94A 3RZDB 3NUCA 4L5SA 1A63A 1EIHA 2V4DA 1JE4A 1EIYB 3K5OA 4JPBW 3R8BA 2KHIA 4UAIA 5CV5A 4O0AA 5M9OA 3RR5A 1RJTA 4K2LA 4NXML 2CQAA 3NTKA 4X6AH 1HRJA 3KJPA 3RN5A 1GUNA 3ULPA 1GM5A 2AMCB 2UXDL 1K8MA 1ET6A 2JA7G 4XQNA 2Z6KA 1NY4A 2DY7A 1ZYRC 1A2UA 1RKNA 4X64L 4BXXH 2NTTA 1S5BD 4L6TB 2PW5A 3PMFA 1AEXA 1MI2A 2OXPA 2E2IB 3FDTA 3OTOQ 5EPJA 1K28A 5C44H 1VF5C 1B2TA 2B2VA 1HR0Q 4Y7NH 4P73A 4FF1A 2IY5B 1CT1D 3D3RA 2G9HD 1KRTA 3KJOA 3TZUA 3GP7A 5KNBA 3EROA 3A8JE 1PV4A 4JI1L 4KLKA 1HJPA 1UE1A 4R8NA 3F2BA 3JAME 1PH6A 4GOPC 2E5LL 1JQYD 4MNOA 2JSOA 5GADC 2CWAA 4FNFA 5C5MA 1HNWL 3E9IA 4ZCKA 1CKOA 1DGSA 2X69A 3RZOB 2BA1A 4X3UA 2KOLA 1A2TA 1BVSA 1LACA 2B2UC 3LWEA 3PIO3 2NN6I 5J39A 4HMIA 1VQIA 2ZTCA 3HG9A 1V43A 1XNRL 4OWTB 2WV6D 2F0DA 1PHJA 4KHPL 1JICA 4DV2Q 2C35B 1EU3A 4RH6A 2Z4IA 4KJOA 2PPBC 3T56B 4C2MH 3BU2A 3P1HA 1LTRD 1LT3D 3EJIA 2F4IA 3IRBA 4ABNA 1EFWA 3L2PA 4QIWE 3DEPA 1X9NA 4MN3A 4ZUIA 4Q5VA 2JA9A 5LMNW 4DV4Q 4P72A 4DR3Q 2F3IA 2RDFA 4LF8Q 2ZXPA 2A69C 3H3VI 2JA6B 3FEWX 2AQ2B 3SK4A 2QF7A 5C44G 1VCIA 1SFOH 3K8AA 5ELOA 1AZPA 3GTQB 4V0BA 4J1MA 2YU9B 5JEAJ 5JJZA 2HDMA 3ND8A 2R92B 4QMGA 3PUVA 4OEMB 3QJYA 1BBWA 2G9DA 4JI7L 1VQNA 2I0QA 1BR9A 4IPHA 1WTXA 2J0TD 1Y8NB 4ZRZA 3PO2B 3I8ZA 1K9MC 2C5CA 2ASBA 4B9WA 4POFA 4KN4C 2EVBA 3JAMi 1TWGH 4OO1H 3P7JA 3QWNA 2KHSA 3KDFB 2HUGA 4X65L 1CFMA 1YVCA 2EOTA 3AFQA 3D4WA 3WOEA 5C5LA 1P16A 1I4PA 3GTLH 1YNXA 4DR5Q 4FXGC 4H44C 1O7IA 2HIXA 4KTAA 1PMRA 1K83H 1JOOA 3HOYH 4O1NA 1NE3A 2BDNA 2Q2IA 3BZDB 4R4OA 4A3CH 4BBSH 2ENBA 3K7AH 3HKZG 2HCIA 2PZWA 1L0YB 2LXJA 2Z9HA 5IYBH 3S1MH 2EQSA 3SR1A 4KY7A 2DGYA 4PZ8A 4KK7A 1XMQQ 3E0EA 1QE6A 4LF4Q 1D5MC 2F0EA 4DXFA 2KCMA 4ZKCB 4OWWB 1V1QA 2DNCA 3BVGA 3QOJA 2K1BA 2L55A 3B6YA 4PMWA 3E9HA 4GKKQ 5D14A 2VB3X 1ASYA 3ER0A 2NVXH 4YCUA 1FL0A 5M5XH 2L1BA 2FMMA 2SOBA 3WWVA 5HY6A 2B3GA 4CDDC 3W2DA 5C0XI 3HOWG 3VYRA 2F0UA 4BY7B 4DR4L 4O42A 4RWSC 3DM3A 4IO9A 4A3FH 5M5YB 2Z6KC 2KCNA 1MKHA 1L1OB 4N8FA 1I94L 1F2MA 1RL2A 2QEJC 3PUWA 3UE0A 4IUQA 4C3HB 1JT8A 1JE5A 5EKLA 4KV6A 5D65A 2B2VC 3K7UC 1L1OA 3KOJA 4POGA 1C7YA 4CHTB 1H9SB 4L8JA 3SK5A 5C4XH 4BY1G 3Q0AA 1LABA 4CJ0B 4B3SL 1Q12A 1EQQA 3X3MA 4A3BG 4A3DH 4FXDA 1SJED 1H9SA 1JMCA 3BG3A 4QUCA 3HOYG 2QW7A 4LAAA 4DU9A 3I55A 3BZKA 3PCOB 4KY6A 2MUYA 5BN4A 1STHA 4BBSG 5M5WH 4A3CG 1DM0B 1ZXTA 5DM73 4BA2I 3T16A 2Y0SG 5EQ0A 1IYUA 2JE6I 2VXWA 5C3XA 4PQXA 1XJVA 2EXDA 1TKWB 2BE5C 2R3ZA 4HMJA 3D0FA 1JCKB 4IOAA 1QJOA 2SDFA 1E1OA 3I91A 4DAVA 1FNVA 1X54A 4JYAQ 1S4ZA 2RHSB 5CGKA 2HHHQ 1K8GA 1VQBA 2I5LX 4DNIA 3PO3H 5JEAG 3A7LA 2B29A 5CBEE 1VQKA 1Y8PB 2EZVA 1TWHB 1I4HA 1HQMC 1SNQA 1HCZA 1Q3LA 3J81L 1N33Q 3H0GH 1B53A 3K57A 4IPGA 3V96A 2DJGC 4HJAA 5BN5A 4A3GB 2BOSA 4QQBX 1E24A 1OXXK 1Y8OB 3MEFA 2JEAI 3OWEB 5A2QE 4B9XA 2F0PA 3FKIH 3DMUA 4UP9A 4DAMA 1B1ZA 4DK1A 3LNNA 2BE5D 2F0OA 3HOUH 1JR0D 2R93H 1I50B 4DV1L 1VQ6A 1ENAA 3GTPH 5EBDA 3S17B 3HS0C 1KDBA 2B63H 3OHXC 1H95A 4WRDA 1UE5A 5GROA 4ZLTF 3CMAA 1WTRA 1PH8A 1WCMB 5C4XG 1PRTC 4BBRB 1GD7A 1SRUA 4KY5A 3F8TA 1UUPA 5EKKA 3A8KE 5FO9B 1JB3A 1B4OA 1G2TA 1K0RA 1CQVA 4AIMA 1YEZA 3S1NH 3M4OB 2UXCL 3HZXA 2FXQA 2E2DC 1PTOH 2PZUA 2F0FA 4LNQA 4K0KL 3S2HH 4LFBL 1LV9A 2A74C 3F1ZA 4LMQD 1I4XA 2EYOA 4RCOA 4JG2A 4C3JH 2D62A 1X3GA 1YZ6A 1KDCA 4QUFA 2E2HB 3R3OA 1HQRD 2EYMA 2OTLA 5KNCA 5KIXA 5BR8L 1LUZA 2PQAB 4A93H 1PRTD 2AUJD 1QG7A 2K6AA 1E22A 2IHFA 1EY9A 1W2BA 3H0GG 4AYBG 1E3PA 2EY2A 4IPDA 5CV9A 3U4ZA 1A15A 1HTPA 3S1RH 3J7AF 1SYCA 3RN2A 2PQAA 1O80A 4ZKBB 5IP9G 5J3BA 4YCWA 3I72A 1VF7A 1EIGA 2WACA 1YHQA 1RTOA 1PA6A 4L5TA 5T1IA 3T51B 3A5UA 2OWOA 3OPOA 3TP7A 1A3TA 3EVQA 3HOUG 2R93G 2XVSA 4I7AA 5M3MH 1HUNA 1EYDA 2LS01 3UDXA 1XNQL 4EQPA 3NBIA 4LF9L 1DOKA 1VQMA 5LMNL 2RCNA 3U4VA 3NTHA 3CD6A 2BA0A 2VL6A 2VNUD 4XTCS 2NVQH 1ICWA 3DWPA 4A3JG 3CC2A 3T1HQ 5CBAE 5CC4A 1TY0A 5C4JH 4R8IA 2EJGC 2NTSA 1VMCA 1MHWC 3FHWA 1B3QA 1ASZA 4A3KH 4DV5Q 4DV6L 1L1OC 4B3RQ 2DUDA 3CCLA 4EVOA 3I7FA 1W6JA 2ZXOA 5LMUQ 3S2DB 1LTGD 4A3MH 1EYGA 1N32Q 2B8GA 4X3KA 1J8IA 4F88A 1HTLD 2E75C 1Y69U 4C3JG 3BDOA 1TU2B 2XN9C 4L63B 3LX0A 1YNJC 2F0JA 2IX0A 4LF6Q 2RKSA 3MFYA 2EDGA 1B9NA 3MXNB 3ERQA 3SVMA 4EX5A 4FF3A 2TSSA 2EYLA 4A3IG 4GLXA 3S9WA 1TR5A 4IUPA 1IYJB 3MXNA 1VQ7A 1B8AA 5DAUA 1IKLA 1OTCA 2EJMA 2WKDA 5LL6X 5M3MG 3BJUA 1EWIA 5GQOA 1NUCA 1J5EQ 3G48A 1YNJD 3J80c 5C44B 2UU9Q 4DFAA 2QEXA 1DD2A 2EIFA 2JA5G 4HJ7A 1QVCA 2MNAA 5JVH3 1C0AA 1LTSD 1CSPA 1TWAB 1TWFB 3I4LA 3M3YH 2B2TA 3H09A 3SE0A 3IL8A 4CDCC 4UPAA 1DONA 1FNUA 4DK0A 5I6WA 2FFKB 1Y1WH 4A3KG 3A0JA 1S5DD 4EQOA 4ME5A 3TEHB 3HOZB 5KRUA 3C2PA 1RDPD 4YWKA 4DR7Q 5IP7H 2XSCA 4JI3L 4JI0Q 2N8NA 1Q1EA 3PGZA 4OONA 1OO9B 2D5DA 2L11A 4E6IA 3K0XA 2ZXRA 3UDFA 2HQEA 1F9PA 1VQFA 2FINB 2PQEA 4A76A 1VQPA 3J7A5 3HOXH 1FGBD 3S14H 4PZ7A 1LYLA 2RSNA 4JI4L 1FYCA 3U9SA 3HKZB 5E4XA 3I90A 3UE1A 3FRPB 3CCSA 4C2MB 5IT9E 4DR3L 1R4QB 2RBMA 3ERSX 2F0LA 1B3AA 2K28A 4I65A 4G4KA 3NK9A 3OOCA 3W5OA 3GTOB 3IFDA 1SBBB 4CJ1B 4DV3Q 1A3VA 4B08A 4B3ML 2NN6H 2BCOA 3M4QA 4IZ8A 1XPOA 3GDEA 1C48A 2PW7A 1LTID 1PXUA 2K5WA 3P75A 4CKBA 1ONLA 4HAEA 3W3AA 1EWCA 1PFSA 1J9OA 1PFMA 3HOWB 5IGBA 4HEDA 3EQLC 1B70B 4ZK9B 1K0SA 1HXYD 3H91A 3IKJA 2CW0C 2VY3A 1U9RA 1SNOA 4JV5Q 1EOVA 2KVMA 5IGDA 1QZHA 1D1IA 5FLXE 3TP8A 1KRSA 3AMUA 1GKHA 2EE1A 1EY0A 4GN5A 4LUZA 2Z0SA 2XTIA 4DR6L 3TQYA 4H02A 4MZ9A 3T1YL 4A3EH 2NVTB 2WAQG 1NMGA 5DLQE 4RHRA 2UXBQ 1HNZQ 1FD7D 4H0LC 5IP7G 1HFNA 1LT5D 2Z8LA 4JI2Q 3TS2A 4BY1B 3H15A 1R9TB 3M4YA 2L12A 4G57A 1F2LA 3MXUA 3GTLB 4A3BB 3MTSA 3L3OC 1II3A 2VB2X 4LF4L 3HOXG 1UWVA 4ZUJA 1L0WA 4BBSB 4IOCA 3FVQA 2CW0D 1XXGA 3IFTA 2Y0SB 4X62Q 4GKKL 3H3VC 4LF7L 2CVRA 4CJ2C 2E2JH 4TKOB 4DUZQ 1WTPA 2IX3A 3M7NA 3DUZA 2ICIA 2L15A 4IUUA 2R6GA 1I5FA 3ZYYX 2NVYH 5ELFA 4X66L 3S15B 2JA8G 3PQIA 1QB5D 4CBVA 1JWMD 3A56A 4KD4A 4IN3A 4YIJA 2EXZA 1MBYA 4RFBA 4MTKA 1BCPC 4L5RC 1A62A 2F0VA 1IL2A 2H4OA 4HJ8A 2QKIC 1EY7A 3BVZA 1W3SA 2RVLA 1KIXA 1K3RA 2D0PA 1RIPA 4GKJQ 1TS4A 1S5CD 1DJRD 1AZQA 4WJ4A 1EQVA 2OQKA 3VR4A 5M3FH 1BBXC 4IUVA 1GUOA 4K5XA 5CORA 3JAMc 3KLWA 1EUJA 1NSNS 4GN4B 1V9PA 3DEOA 2E74C 4JW0A 4KD3A 4CKCA 4HSVA 1ZYRD 1FVIA 4A3EG 1BQQT 1GUGA 4YWLA 1PYBA 1VQHA 4RMFA 4IPCA 3A55A 1AN8A 3G4SA 3S1QB 1I4QA 2VZAA 5I2YA 3GTJB 4YHHQ 2K03A 1I6HB 4GS3A 1E1TA 1E7ZA 2B2TC 4XT1B 4ULLA 4GN3B 2E8GA 3VDYA 5IGCA 4AQYQ 5EKIA 1WD0A 1V8QA 3GV3A 4JYAL 3PIOA 1A3UA 1EYCA 2PMZE 1S40A 1EU4A 1CHPD 4R1JA 4OL7A 3FPUB 2IW3A 3NQIA 3CCRA 2F52A 4Y52H 4BXXG 2GVAA 2WAQE 5DEHA 3C46A 5HGQA 1Z47A 2N49A 4OIJA 3TREA 1PRTB 2KCCA 3KUPA 4WFN3 4JI8L 2WB1G 1I3QB 2L5TA 1IXRA 4C3IB 1G6ZA 4JI6Q 3TS0A 1LM0A 4QCLA 3JC66 2OF1A 4AYBB 1IKMA 1Y1VB 3AB9A 3S16H 3QOLA 2B2WC 4EGVA 1HZBA 1F77A 2KA7A 3V05A 2OCEA 2KBNA 4PV1C 2K50A 5C3EH 2R93B 2EYFA 4JI5Q 2B8FA 3NHHA 2CH4A 2A69D 3BDLA 5K36H 3TDQA 2BH2A 5NUCA 4DR1Q 3KLSX 1MJEA 3AEVA 5D3DA 1KXLA 3J7YW 4RGMA 1EWHA 4A3JB 1H9MA 2AUKA 1HR0W 2EY1A 4LFCL 3RZDH 3S24A 3GTKB 5IWAQ 2YV5A 1IYVA 3C3LA 1IL8A 4YY3L 3EBEA 1HNXQ 1IZ6A 2WINB 1IBLQ 5C3WA 4IURA 3AQQA 3Q23A 3CCUA 1T5XD 5EJWA 2VW9A 4ZQ3A 2UUAL 1QILA 1TS5A 1VQJA 2BH8A 1G51A 1G8ZD 2NZ1D 1ZKOA 1ET9A 1SYDA 2RQXA 4NXMQ 2E2IH 1F2YA 4A3IB 2OTJA 1MJCA 1ICFB 3T4AC 2UXDQ 1VQ8A 3T13A 5AJ3Q 3A5ZB 4APVA 1KABA 4OO1G 2MQHA 2PI2E 2Q2UA 1C9OA 3ND9A 1VQOA 3LGJA 4G7ZC 4NP5A 3ULLA 4EQ5A 4XT3B 5JJIA 5KNDA 2JXMB 3T1HL 2PNHA 1SMXA 1U5KA 4QGUA 5M3MB 1BF4A 1Q46A 5CMDA 2WB1E 5IYCH 1YIJA 5K36G 2PNRC 4DXGA 1QZGA 3R2IA 3OSOA 4OWXB 2MGSA 4B3RL 3RZOH 4IJHA 5E3FA 2JN4A 3L9AX 1WYDA 4JI1Q 2NVQB 2QGQA 1N36Q 2JA5B 5JJKA 2AWNA 3MWYW 5LMUL 1IHZA 3V2TA 3Q24A 1YJWA 4CDEC 5IYBG 2O4XA 4KMUC 2E5LQ 3HEJA 1H9KA 3CXCA 1GXDC 2EY5A 2DJFC 5IY0A 4LF6L 4HN7A 1HNWQ 2I5MX 2NBFA 4RGTA 3I4NH 1D6EC 1S72A 3HGBA 1TY2A 3BVMA 2F0TA 2HQLA 3N6RA 2K5VA 2K4KA 3SK6A 1SYFA 3I4MB 3CPFA 3RLFA 2L0CA 2WP8J 4HCEA 1EIFA 1Q90A 5F2DA 3W1GA 3C1EA 3E0JA 1E2VA 1STGA 4K8JA 1KTKA 2NWGA 4X3TA 2JA6H 1Z6HA 3DM1A 4A3FG 2SNSA 3GTMB 3GTQH 4ME3A 4JCVE 1G2SA 3D4DA 4HSPA 2CQOA 2IHEA 1X55A 2R92H 2MO1A 4OGQC 1J5EL 4TQUS 2UUCQ 4IALA 5GAGC 3CMEA 2UU9L 3AYHB 5FO8B 1HH2P 1RF2D 2MHVA 1UEBA 2OT2A 4NPSA 3PIP3 2ZJPA 4DR2L 3PO2H 1VS0A 2VS1A 3CQZB 2K52A 4JBWA 3G71A 4A3DG 4O2DA 5CYUA 4OX9L 3RMHA 4JK1C 2E76C 4NW2A 1PFNA 5EBCA 4DR7L 3MZ5A 4HIKA 3M3YB 2OEOA 1AE2A 4RKLA 2EYJA 5ELEA 2Z6BA 4NXNQ 2JQOA 1X3PA 4QIWB 3I4NG 3X3NA 2ZJQA 2VQFQ 1FJGQ 4M8AA 4DNRB 2LSSA 3G6JB 3ICEA 4AH6A 5COYA 3GD7A 5IE8A 2DNEA 4QY7A 4CKEA 3PO3G 4IFDH 2F3WA 5EAYA 1CTMA 1SE3A 2MO0A 2H1EA 5E1FA 1IBMQ 3TRZA 1Z7TA 1Z9FA 4KN7C 3J81E 2YTYA 4DV3L 3HOXB 4J8QA 4JBJA 1X3QA 2KECA 3GQBA 3VR2A 3Q8DA 3NELA 2FHTA 4RCNA 1PTOC 3FKIG 2JA7B 2A6HC 1YJNA 2R92G 2PZTA 4RG1A 2AHOB 4BY7H 1IBKL 1JC7A 3GV6A 3PUZA 5M5YH 3OYYA 5HURA 2JA8B 2B63G 5KYIA 3MFGA 4JV5L 4LWCA 4WJ3M 4TVAB 4C3HH 5IYDH 3NE5B 2Z1CA 4OXPA 2G5DA 2J4XA 1TVXA 1NCVA 4R9WA 4DR4Q 1M4VA 2F0HA 4IUNA 1C8CA 1XMOL 3J80L 1LT4D 3N52A 2RHQB 4GLVB 4EQNA 2AWOA 2R61A 2UXBL 1PH5A 2ZTEA 1B50A 3K58A 4NDXA 1TXYA 1TWCB 1SE4A 4OHJA 3NENA 4NB3A 1BXTA 2F0GA 3IAYA 3D6CA 1PTOD 5HGTA 2A6HD 1E2WA 2YTXA 1EY8A 4PG3A 4P71A 4A3EB 1GHKA 3UDIA 3SK8A 1ENCA 3K5LA 1BCPB 3PUYA 3NEMA 4IFDG 3K0YA 2I46A 4CDFC 4BA1I 4A93G 3MHBA 1PYWD 4BS9A 3VR6A 4DUZL 2KQ3A 4OELB 4KKSA 1MSHA 4Q0FA 1JJGA 1KNEA 2IT1A 3OIQA 3J81i 4ID6A 1IW7C 5C4ZA 3AU7A 2KEDA 3OTOL 3MA2B 1HR0L 4QB4A 4S3SA 5IIFA 2RA4A 1OXTA 5IGGA 2VUMH 4LUVA 5JPMC 4JVZA 3T53B 1VQ9A 3LWUA 5ELNA 1X6OA 4A3GH 1WOCA 3M85A 2K14A 1SSOA 3BYYB 4Y7NB 1VMPA 3PSIA 2AQ3B 3SXHA 1I50H 1LO5D 1Q81C 5I4DA 4HIMA 4A3LH 3S17H 4K8IA 3F2UA 1DOLA 2A68C 1NJIC 4XDXA 4BBRH 3J80E 2XWJB 2F0QA 1IW7D 3AFPA 4LK1C 2K5QA 5FJ8H 1G6PA 1PH7A 1PRTF 3M4OH 1BNZA 1V1PB 1MGSA 4A3MG 4DV2L 2KCTA 4H13C 2UUBQ 2KENA 4FF4A 2Q2HA 4AQYL 5ELDA 4OIKA 4JC0A 1L0XB 4FDBA 2KJXA 1V1PA 2K01A 2D0OA 3A54A 3ONAB 2B2YC 2EJFC 1FR3A 3F2DA 4C1NI 1D8LA 1XTDA 1EY5A 1Y14B 2Z4HA 3CC7A 2XGTA 2E2HH 4FVMA 1NAPA 1PZJD 1YI2A 3U9OA 1QCBD 4DV4L 1Q82C 1HZAA 2A68D 3I56A 2MFIA 1EQTA 4LF8L 1PH9A 4J15A 4DNTB 2M9VA 1SYGA 1OXUA 4GLAC 4A4IA 2B2WA 4FO2A 2VUMG 1SE2A 1SNPA 4JI6L 3HOVH 4K6DA 4A3GG 1QVFA 2LKVA 3KK7A 1SJHD 1UAPA 1SFOB 4LFAQ 2GVBA 3VYSA 1JB7A 4K5WA 4A3LG 3QR8A 5EPLA 3TP6A 2WIIB 1WD1A 2QILA 1STEA 2KEEA 1N34Q 1STBA 4JOIC 3TSSA 4BBRG 1GO3E 1Y1WG 3PV0A 1A8VA 3J80i 4DR5L 4DR1L 1EEID 5FJ8G 1TWGB 3STBC 2K75A 3K81C 4QL5A 1E2ZA 1YNNC 3H3VH 3I70A 3VYTA 2K33A 5E7NA 3JAML 5LMNQ 3FMCA 4KI0A 4LJZC 3FP9A 1OXVA 3ZJYC 2ICEC 3EIVA 2HDLA 3SGIA 5GAEC 4HJ9A 4G7HC 5IWAL 1WTOA 4FP5D 1XMQL 1K83B 1U0LA 3HOYB 1HNXL 1IBLL 3K7AB 3NBHB 2ZM6Q 1M8AA 3S1MB 1K73C 4MHEA 3W1BA 4LF5Q 5FO7B 4ZYSA 4IUTA 3NBHA 1M1KC 3SEBA 2R7ZH 2Q8TA 1UEAB 2JJQA 3STBD 2XIWA 1Q86C 4JBMA 2QDBA 5CV6A 2NN6G 3VR3A 3HOVG 4R4CA 1YNND 2NVXB 2A6EC 2N55A 3CU7A 2A73B 1V1OA 3NWTA 5M5XB 1PH3A 1DCZA 1VQ5A 2EY6A 3RLNA 1XTCD 4DV7Q 1KD1C 2X6GA 1WTQA 3DXJC 1GUTA 5AJ3L 1F2ZA 5JVG3 4YWMA 4QF4A 1LTBD 1I6VC 3E3XA 1EY6A 1SLJA 2XRSD 4A3FB 1UE6A 1VQEA 1A0IA 3Q22A 5H1SE 1H9JA 5CV4A 1CHQD 1STNA 1TWAH 1TWFH 1Q1BA 3TP5A 3MXGA 1SYEA 2BDOA 3OW2A 4HCSA 1N36L 4DF7A 1YBYA 4RGOS 5C4XB 3KLSA 3HOZH 3MAQA 5C0XH 1PLFA 1PZID 2A6ED 3NP8A 1BCPD 1AFPA 3CHBD 4A3DB 3EN2A 2K5NA 1UNSA 2LFNA 5LHY1 4X3SA 1TQOA 1VQGA 4GNXB 5TSSA 2X6LA 3HRZC 5M5WB 1JJ2A 4DN4M 2I5HA 2NZOA 4DPGA 1XPUA 2HHHL 1I4GA 5ELBA 2IWHA 2F0MA 5K5PA 4GNXA 2XNAC 1CI3M 3CCMA 5CR3A 4I7ZC 1SN8A 4H7BA 4Z9CB 4JI3Q 1J6QA 1N33L 3I4NB 1DOMA 2KUMA 3HFZB 2R7ZG 1U4RA 1BOSA 4DUYQ 1LTLA 4B3TQ 5DM63 3GTGH 2F4VQ 3PO3B 4DV0Q 1F9QA 2DN8A 3GTOH 5FLMH 4N9PA 3VR5A 1LT6D 2ZT9C 1CK1A 4JI4Q 1K3BC 2K04A 3H0GB 3QG1A 3NWSA 4DAYB 2UUCL 3TMEA 2J7ZA 4R4TA 4KHVA 2HD3A 2TMPA 5CV8A 4DK6C 2IPKD 5M3FG 1UE7A 4DAYA 1BUVT 1QOHA 1TS2A 3QIAA 3HOWH 1W6KA 3CC4A 3FKIB 5E4WC 5G3LD 1WFQA 1CKMA 4UDUC 4B3MQ 2CH4W 3CRKC 2CHBD 3HOUB 2QDLA 3GTPB 1LTAD 2N88A 1XX8A 4PMCA 3H6MA 2B63B 1WTHA 1RCVD 2N3SA 2VQEQ 3CCEA 3HOZG 5C0XG 4IQZA 2NZHA 3D4RA 1CSQA 2NVTH 4NXNL 1EQRA 3U58A 3S1NB 2VQFL 1FJGL 4BY1H 1R9TH 1C4QA 2WKCA 3RUZA 1SNDA 4A3BH 2PYKA 5I9OA 1H9RA 1PTOB 4DR6Q 3KDFA 3R93A 3T1YQ 4XQQA 1EY4A 1ESFA 1RODA 3EFXD 2M2LA 3S2HB 1Q7YC 2P5ZX 1IBML 1O7YA 3ULJA 4C3JB 4G7OC 1X3EA 3CCJA 2EPBA 3KF6B 5EGTA 1GHJA 1QWYA 1L2FA 2H5XA 2Q2TA 4A93B 3E5SA 5FLMG 1SEBD 3S15H 3BYTB 1WI5A 2YTVA 2HT1A 3KF6A 4DGZA 1FNWA 2F0IA 3KF8B 1STYA 2AKWB 4TSSA 4A75A 4LF7Q 2NYZD 1X56A 3KBGA 5JEAH 3BS1A 3NTIA 3S1RB 1GUWA 2EYPA 1QNUA 1JORA 3SHLA 3O13A 4RAUC 5I9PA 1QUQB 4X64Q 3NSWA 3KF8A 1EYAA 1BCPF 4J6HA 1XYIA 1KQSA 4X66Q 1E0BA 1HZCA 1ILQA 5BN3A 1QUQA 2K5HA 1KNAA 5C3EG 3BDCA 1EL0A 1VQDA 5A2QL 1T9HA 1NMFA 4JBKA 2MJ8A 1A6XA 4DV5L 1XPRA 1WJJA 4YCVA 5J1ZA 2F0WA 3TN2A 1B7YB 1AW7A 3K59A 4FF2A 2JYOA 2K05A 5L37A 1N32L 3S1QH 2QCPX 5C4JB 3GTJH 4K5VA 3EA6A 4A3KB 2ES2A 4V190 1I6HH 3E6ZX 2LXKA 2NB0A 2RDGA 2CCZA 2F1MA 4BWGB 1BDOA 3NQTA 4L5QA 1P8LA 4P2CB 4A3MB 2SEBD 4WORA 4RGNA 3HKSA 4R4IA 4ILWA 1XNRQ 2YYZA 1S3OA 1K8AC 2PO4A 3A7AB 4KHPQ 2CFMA 1HPCA 3VA7A 2OQ0A 1U4PA 2I07B 1BO0A 3OWFA 1D5XC 2MPMA 4IFDJ 4PNYA 4OO1I 2F0NA 2A1AA 2ID0A 1SAPA 1LTTD 5G3LF 1ML0D 1S5FD 3CCQA 4LUOA 2LY7A 1F9SA 2RCFA 3VYUA 1O7ZA 4GNXC 2ALYB 3QB3A 2YU9H 1NTGA 1I3QH 1U4LA 1GVPA 5IODA 1AH9A 3G7LA 4C3IH 5EPKA 3K6OA 4KKTA 2IX1A 1VQAA 3I4OA 1D5ZC 3DWQA 1N9WA 3HKZE 2FJ2A 2VUMB 2GA4B 1D2BA 1G291 1Y1VH 4JI8Q 1XWEA 5IP9H 1ENFA 3MVVA 2RSOA 3MEHA 3OMGA 2RDHA 5FKAC 4K6LA 1HUMA 5IYCG 1K8OA 1SYBA 4M1UB 3OMCA 2LMCB 5AFWA 4JI7Q 1PYSB 2D9UA 3CPWA 1PVOA 1CUKA 2B2YA 4F87A 1KDAA 3PIPA 4JI0L 4P75A 4HR7B 2UUBL 1FGUA 4HIDA 3G6EA 3WDNA 4F7XA 2PMZB 4DA2A 1Y1WB 3CW2C 4X65Q 2O2LD 4U673 4F8MA 4A3JH 2K7VA 3Q6SA 4LW1A 1KHIA 2WAQB 2JEBI 4HTHA 3GTKH 1MIUA 2QA4A 2FMCA 3RD4A 4NKLA 2F0KA 2B39A 2A5HA 3ITPA 3NPPA 1ILPA 1VDZA 1CZWA 2Q8IB 1MSGA 5JAVA 5D3IB 1T5EA 2IJ0A 1PH1A 1KAWA 4LFCQ 3S14B 5FOBB 2K5DA 2V1CC 3J81c 1STAA 2JA6G 3CRLC 4PZ6A 3J7ZC 4YY3Q 1G91A 2D2CC 3I3CA 5I2XA 1BKBA 1WTVA 3K5MA 3U50C 5I6YA 2Q8RE 4JOIA 5GAHC 4C3IG 2F0SA 3SDZA 4LFAL 4A3IH 3M4PA 3DHQA 2ATWA 1SROA 1GUSA 4WJWA 2O5JC 5JJLA 2Y0SE 1SXTA 4KHZA 1PZKD 2UUAQ 3HOVB 1Y1VG 5JPNC 1WVLA 3PO2G 4ALPA 1N34L 5LL6S 1CQFA 3M9BA 4P74A 4K2KA 1M90C 1B44D 1KLGD 2AQ1B 5C4HA 1JJCB 3M7GA 1HHVA 2SNMA 1DZ1A 1HA6A 1SNMA 4FXKC 4C56C 3CKIB 2L9HA 1SDFA 1I94Q 3PF5A 1JWSD 4DK3C 4N9TA 4K14A 1NR4A 1HNZL 3TZDA 3URYA 4JI2L 1OXSC 5T1GA 1EEFD 4XIGS 5DNFA 2JA5H 3QO2A 1MD2D 3TBIB 5KYLA 1ESRA 3UDGA 4B3SQ 3RNUA 1CKNB 5KGUA 4RKBA 2M00A 2ZM6L 4X62L 3KFUA 3J81j 1RD9D 1O7LA 1RHPA 1JOQA 1CKNA 3VA5A 3CCVA 3I2ZA 4HIOA 1B9MA 4ZAIA 4LF5L 1PH4A 3I4MH 1KL9A 4ODGA 4IJLA 1TWHH 3I73A 3P20A 1YJ9A 1HZ9A 3A74A 2XWBB 1VQCA 3UI2A 4HJ5A 3RLOA 2E2JB 1SMYC 2HCCA 3L7ZC 1NBWA 1X32A 3HP3A 1NR2A 4XQJA 1NNXA 5ISRA 4BY7G 3DWAA 4PMBA 3A8IE 4DV7L 1EZ6A 3D6WA 1TT2A 3GTMH 2NVYB 5IT9L 2R7ZB 3K5NA 4GKJL 4MIUA 1VQ4A 2ZTDA 4GOPB 1PDQA 5IOCA 2R7DA 1SR3A 2A19A 2PI2A 2WB1B 3CAMA 4C3HG 5IYDG 1D7QA 2O5IC 1YHBA 3C1FA 4GOPA 4TRDA 1D1KA 2R7FA 3R2TA 3J7AV 1WCMH 3PUXA 3D31A 4U68A 3CQZH 4NMZA 2JK8A 1SNCA 2DY8A 5M3FB 4IFDI 5JOBA 4YHHL 4KJNA 1GOZA 5FK9C 2B2UA 4DV1Q 1SMYD 5C6AA 5CV7A 1WTWA 2N78A 1X3FA 4R4QA 4AYBE 3L0OA 1TS3A 4MTNA 4DR2Q 3WOFA 5FLXL 3KLRA 3DLLA 1X65A 1VQLA 5ELCA 4OX9Q 1ZEQX 1F9RA 2K32A 2UXCQ 1I4RA 3FPPA 1YHAA 2GN5A 2A8VA 1BBUA 2F3VA 2CWPA 3K80C 3CF5A 2JP1A 3CP0A 2L4NA 1CA5A 3I4MG 4K0KQ 4LFBQ 1CA6A 4XYOA 1S5ED 4N8X1 4DUYL 5IGFA 1SE8A 3D8GA 3OW7A 2KHJA 1AE3A 5IT9c 2MP1A 1RTNA 4FYDA 4B3TL 2F4VL
chains in the Genus database with same CATH topology
1O78A 4DAPA 4KKUA 4RA8A 5KEEA 1EZ8A 1DYQA 3MC0B 3NXWA 5IGEA 1JOKA 4XXEA 3GTGB 1EFID 1Q8IA 1JWUD 1U4MA 1PTOF 5A35A 1PFBA 2XRQD 2EYHA 4C1NK 3S16B 3MXPA 4GZYC 1TIID 1AP0A 5J22A 1DXMA 2C9OA 1KLUD 4XYQA 3OIPA 5C3EB 1CM9A 2F03A 1KAAA 3KBXA 2PCFB 1R4PB 2NUCA 1GJXA 1EOTA 5C0XJ 1CZGA 1HFGA 1HA5A 2IL8A 1QNKA 4CGYB 3GO5A 1LLRD 4RHSA 3H94A 3RZDB 3NUCA 1EIHA 2V4DA 1JE4A 3K5OA 3R8BA 4UAIA 5CV5A 5M9OA 1RJTA 4K2LA 2CQAA 3NTKA 1HRJA 1GUNA 1K8MA 1ET6A 4XQNA 2DY7A 1ZYRC 1A2UA 1RKNA 2NTTA 1S5BD 4L6TB 2PW5A 3PMFA 1AEXA 1MI2A 2OXPA 2E2IB 3FDTA 5EPJA 1VF5C 1B2TA 2B2VA 4FF1A 1CT1D 3D3RA 2G9HD 3TZUA 3GP7A 5KNBA 3EROA 3A8JE 4R8NA 3JAME 1JQYD 2JSOA 4FNFA 5C5MA 3RZOB 2X69A 2BA1A 4X3UA 2KOLA 1A2TA 1LACA 2B2UC 3LWEA 3PIO3 2NN6I 5J39A 4HMIA 3HG9A 1V43A 2WV6D 2F0DA 1JICA 1EU3A 4RH6A 2Z4IA 4KJOA 2PPBC 3T56B 3P1HA 1LTRD 1LT3D 3EJIA 2F4IA 4ABNA 3DEPA 4MN3A 4ZUIA 4Q5VA 2RDFA 2ZXPA 2A69C 2JA6B 3FEWX 2AQ2B 3SK4A 2QF7A 1VCIA 1AZPA 3GTQB 4V0BA 4J1MA 2YU9B 5JEAJ 5JJZA 2HDMA 3ND8A 2R92B 4QMGA 3PUVA 3QJYA 2G9DA 1BR9A 1WTXA 2J0TD 1Y8NB 4ZRZA 3PO2B 3I8ZA 2C5CA 4B9WA 4KN4C 2EVBA 4OO1H 3P7JA 3QWNA 2KHSA 2HUGA 1CFMA 2EOTA 3D4WA 3WOEA 5C5LA 1I4PA 4FXGC 4H44C 4KTAA 1PMRA 1JOOA 4O1NA 2BDNA 3BZDB 2ENBA 2HCIA 2PZWA 1L0YB 3SR1A 4KY7A 4KK7A 1QE6A 1D5MC 2F0EA 4DXFA 4ZKCB 2DNCA 3BVGA 3QOJA 2K1BA 2L55A 4PMWA 5D14A 2VB3X 2L1BA 2FMMA 2SOBA 3W2DA 5C0XI 3VYRA 2F0UA 4BY7B 4O42A 4RWSC 5M5YB 2KCNA 1F2MA 2QEJC 3PUWA 4IUQA 4C3HB 5EKLA 4KV6A 5D65A 2B2VC 4CHTB 1H9SB 4L8JA 3SK5A 3Q0AA 1LABA 4CJ0B 1Q12A 3X3MA 4FXDA 1SJED 1H9SA 3BG3A 4QUCA 4LAAA 4DU9A 4KY6A 5BN4A 2MUYA 1STHA 1DM0B 5DM73 1ZXTA 4BA2I 3T16A 5EQ0A 1IYUA 2JE6I 2VXWA 5C3XA 4PQXA 1TKWB 2BE5C 2R3ZA 4HMJA 1JCKB 1QJOA 2SDFA 3I91A 4DAVA 1FNVA 1S4ZA 5CGKA 5JEAG 3A7LA 5CBEE 1Y8PB 2EZVA 1TWHB 1I4HA 1HQMC 1SNQA 1HCZA 1Q3LA 3J81L 1B53A 3K57A 3V96A 5BN5A 4A3GB 2BOSA 1OXXK 1Y8OB 2JEAI 3OWEB 5A2QE 4B9XA 2F0PA 3DMUA 1B1ZA 4DK1A 3LNNA 2BE5D 2F0OA 1JR0D 1I50B 1ENAA 5EBDA 3S17B 3HS0C 1KDBA 3OHXC 4WRDA 4ZLTF 1WTRA 1WCMB 1PRTC 4BBRB 4KY5A 1UUPA 5EKKA 3A8KE 5FO9B 1JB3A 1B4OA 1G2TA 1CQVA 3M4OB 3HZXA 2E2DC 1PTOH 2PZUA 2F0FA 1LV9A 2A74C 4LMQD 1I4XA 2EYOA 4RCOA 2D62A 1KDCA 4QUFA 2E2HB 3R3OA 1HQRD 2EYMA 5KNCA 5KIXA 1PRTD 2AUJD 1QG7A 2K6AA 1EY9A 2EY2A 5CV9A 1A15A 1HTPA 3J7AF 1SYCA 1O80A 4ZKBB 3I72A 1VF7A 1EIGA 2WACA 1RTOA 3T51B 5T1IA 3OPOA 3TP7A 1A3TA 3EVQA 2XVSA 1HUNA 1EYDA 2LS01 4EQPA 3NBIA 1DOKA 3NTHA 2BA0A 2VNUD 4XTCS 1ICWA 3DWPA 5CBAE 5CC4A 1TY0A 4R8IA 2EJGC 2NTSA 1VMCA 4EVOA 1W6JA 2ZXOA 3S2DB 1LTGD 2B8GA 4X3KA 1J8IA 4F88A 1HTLD 2E75C 1Y69U 4C3JG 3BDOA 1TU2B 2XN9C 4L63B 3LX0A 1YNJC 2F0JA 2IX0A 2RKSA 3MFYA 2EDGA 1B9NA 3ERQA 3SVMA 4FF3A 2TSSA 2EYLA 3S9WA 1TR5A 4IUPA 3MXNA 5DAUA 1IKLA 2EJMA 2WKDA 5LL6X 1NUCA 1YNJD 5C44B 4DFAA 1DD2A 5JVH3 1LTSD 1TWAB 3I4LA 1TWFB 2B2TA 3H09A 3SE0A 3IL8A 1DONA 1FNUA 4DK0A 5I6WA 2FFKB 1S5DD 4EQOA 4ME5A 3HOZB 5KRUA 3C2PA 1RDPD 2XSCA 1Q1EA 1OO9B 2D5DA 2L11A 4E6IA 2ZXRA 2HQEA 1F9PA 2FINB 2PQEA 1FGBD 2RSNA 1FYCA 3U9SA 3HKZB 5E4XA 3I90A 3FRPB 4C2MB 5IT9E 1R4QB 2RBMA 2F0LA 1B3AA 2K28A 4I65A 4G4KA 3NK9A 3OOCA 3GTOB 3IFDA 1SBBB 4CJ1B 1A3VA 4B08A 2NN6H 2BCOA 4IZ8A 1C48A 2PW7A 1LTID 1PXUA 2K5WA 3P75A 4CKBA 1ONLA 4HAEA 3W3AA 1EWCA 1J9OA 1PFMA 3HOWB 5IGBA 4HEDA 3EQLC 4ZK9B 1HXYD 3H91A 3IKJA 2CW0C 1U9RA 1SNOA 2KVMA 5IGDA 1D1IA 5FLXE 3TP8A 3AMUA 2EE1A 1EY0A 2NVTB 4RHRA 1FD7D 4H0LC 1HFNA 1LT5D 2Z8LA 4BY1B 1R9TB 3M4YA 2L12A 4G57A 1F2LA 3MXUA 3GTLB 4A3BB 3MTSA 3L3OC 1II3A 2VB2X 4ZUJA 4BBSB 3FVQA 2CW0D 1XXGA 3IFTA 2Y0SB 3H3VC 2CVRA 4CJ2C 4TKOB 1WTPA 2IX3A 3M7NA 3DUZA 2ICIA 4IUUA 2R6GA 3ZYYX 5ELFA 3S15B 1QB5D 4CBVA 1JWMD 3A56A 4KD4A 4IN3A 4YIJA 2EXZA 1MBYA 4RFBA 1BCPC 2F0VA 2H4OA 2QKIC 1EY7A 3BVZA 2RVLA 1TS4A 1S5CD 1DJRD 1AZQA 1EQVA 3VR4A 1BBXC 4IUVA 1GUOA 4K5XA 5CORA 1NSNS 3DEOA 2E74C 4KD3A 4CKCA 4HSVA 1ZYRD 1BQQT 1GUGA 3A55A 1AN8A 3S1QB 1I4QA 5I2YA 3GTJB 2K03A 1I6HB 2B2TC 4XT1B 4ULLA 5IGCA 5EKIA 1WD0A 1V8QA 3GV3A 1A3UA 1EYCA 1EU4A 1CHPD 4OL7A 3FPUB 2IW3A 3NQIA 5DEHA 3C46A 1Z47A 4OIJA 4WFN3 1PRTB 2KCCA 3KUPA 1I3QB 2L5TA 4C3IB 1G6ZA 4QCLA 2OF1A 4AYBB 1IKMA 1Y1VB 3AB9A 3QOLA 2B2WC 4EGVA 1F77A 2KA7A 3V05A 4PV1C 2R93B 2EYFA 2B8FA 2A69D 3BDLA 3NHHA 5K36H 3TDQA 5NUCA 3KLSX 5D3DA 3J7YW 4RGMA 1EWHA 4A3JB 1H9MA 2AUKA 2EY1A 3GTKB 1IYVA 3C3LA 1IL8A 2WINB 5C3WA 4IURA 3Q23A 1T5XD 5EJWA 4ZQ3A 1QILA 1TS5A 1G8ZD 2NZ1D 1ZKOA 1SYDA 1ET9A 2RQXA 1F2YA 4A3IB 3T4AC 3T13A 1KABA 4OO1G 3ND9A 4G7ZC 4NP5A 4XT3B 5KNDA 2JXMB 5M3MB 1BF4A 5CMDA 5K36G 2PNRC 4DXGA 3R2IA 3OSOA 2MGSA 5E3FA 3L9AX 2NVQB 2JA5B 2AWNA 3MWYW 1IHZA 3V2TA 3Q24A 2O4XA 4KMUC 3HEJA 1H9KA 1GXDC 2EY5A 4HN7A 2NBFA 4RGTA 1D6EC 3HGBA 1TY2A 3BVMA 2F0TA 3N6RA 3SK6A 1SYFA 3I4MB 3RLFA 2L0CA 2WP8J 4HCEA 1Q90A 5F2DA 3C1EA 3E0JA 1E2VA 1STGA 4K8JA 1KTKA 2NWGA 4X3TA 1Z6HA 3DM1A 2SNSA 3GTMB 1G2SA 3D4DA 4HSPA 4OGQC 4TQUS 4IALA 5FO8B 1RF2D 2MHVA 2OT2A 3PIP3 3CQZB 4JBWA 5CYUA 3RMHA 4JK1C 2E76C 4NW2A 1PFNA 5EBCA 3MZ5A 3M3YB 2OEOA 4RKLA 2EYJA 5ELEA 1X3PA 4QIWB 3X3NA 4M8AA 4DNRB 3G6JB 5COYA 3GD7A 2DNEA 4CKEA 4IFDH 2F3WA 1CTMA 1SE3A 2H1EA 5E1FA 1Z7TA 4KN7C 3J81E 3HOXB 4J8QA 1X3QA 2KECA 3GQBA 3VR2A 2FHTA 4RCNA 1PTOC 2JA7B 2A6HC 2PZTA 1JC7A 3GV6A 3PUZA 2JA8B 5HURA 5KYIA 3MFGA 3NE5B 2Z1CA 2J4XA 1TVXA 1NCVA 4R9WA 1M4VA 2F0HA 4IUNA 1C8CA 3J80L 1LT4D 3N52A 4EQNA 2AWOA 2R61A 1B50A 3K58A 4NDXA 1TWCB 1SE4A 4OHJA 1BXTA 2F0GA 3IAYA 3D6CA 1PTOD 5HGTA 2A6HD 1E2WA 1EY8A 4A3EB 1GHKA 3SK8A 1ENCA 3K5LA 1BCPB 3PUYA 4IFDG 3K0YA 2I46A 4BA1I 3MHBA 1PYWD 4BS9A 3VR6A 2KQ3A 4KKSA 1MSHA 4Q0FA 1KNEA 2IT1A 3OIQA 4ID6A 1IW7C 5C4ZA 3AU7A 2KEDA 3MA2B 4QB4A 4S3SA 5IIFA 2RA4A 1OXTA 5IGGA 5JPMC 3T53B 3LWUA 3M85A 1SSOA 3BYYB 4Y7NB 1VMPA 2AQ3B 3SXHA 1LO5D 5I4DA 4K8IA 3F2UA 1DOLA 2A68C 4XDXA 3J80E 2XWJB 2F0QA 1IW7D 4LK1C 2K5QA 1PRTF 1BNZA 1V1PB 1MGSA 4H13C 4FF4A 5ELDA 4OIKA 1L0XB 2KJXA 1V1PA 2K01A 3A54A 3ONAB 2B2YC 2EJFC 1FR3A 4C1NI 1EY5A 2Z4HA 4FVMA 1NAPA 1PZJD 3U9OA 1QCBD 2A68D 1EQTA 4DNTB 2M9VA 1SYGA 1OXUA 2B2WA 4FO2A 1SE2A 1SNPA 4K6DA 2LKVA 3KK7A 1SJHD 1UAPA 1SFOB 3VYSA 4K5WA 5EPLA 3TP6A 2WIIB 1WD1A 2QILA 1STEA 2KEEA 1STBA 3TSSA 3PV0A 1EEID 1TWGB 1E2ZA 1YNNC 3VYTA 3I70A 2K33A 3JAML 3FMCA 4KI0A 4LJZC 1OXVA 2ICEC 2HDLA 4G7HC 1WTOA 4FP5D 1K83B 3HOYB 3K7AB 1M8AA 3S1MB 4MHEA 5FO7B 4ZYSA 4IUTA 3NBHA 3SEBA 2Q8TA 1UEAB 2XIWA 2QDBA 5CV6A 2NN6G 3VR3A 1YNND 2NVXB 2A6EC 2N55A 3CU7A 2A73B 1V1OA 3NWTA 5M5XB 1DCZA 2EY6A 1XTCD 2X6GA 1WTQA 3DXJC 1GUTA 1F2ZA 5JVG3 4QF4A 1LTBD 1I6VC 1EY6A 2XRSD 4A3FB 3Q22A 1H9JA 5CV4A 1CHQD 1STNA 1Q1BA 3TP5A 3MXGA 1SYEA 2BDOA 4HCSA 4DF7A 4RGOS 5C4XB 3KLSA 3MAQA 5C0XH 1PLFA 1PZID 2A6ED 3NP8A 1BCPD 1AFPA 3CHBD 4A3DB 1UNSA 2LFNA 5LHY1 4X3SA 1TQOA 5TSSA 2X6LA 3HRZC 5M5WB 4DN4M 1I4GA 5ELBA 2IWHA 2F0MA 5K5PA 2XNAC 1CI3M 5CR3A 4I7ZC 4H7BA 4Z9CB 3I4NB 1DOMA 2KUMA 1U4RA 1BOSA 5DM63 3PO3B 1F9QA 2DN8A 4N9PA 3VR5A 1LT6D 2ZT9C 1CK1A 2K04A 3H0GB 3QG1A 3NWSA 3TMEA 2J7ZA 4KHVA 2TMPA 5CV8A 2IPKD 4DAYA 1BUVT 1QOHA 1TS2A 3QIAA 1W6KA 3FKIB 5E4WC 5G3LD 4UDUC 3CRKC 2CHBD 3HOUB 3GTPB 1LTAD 2N88A 1XX8A 4PMCA 3H6MA 2B63B 1RCVD 5C0XG 4IQZA 3D4RA 3S1NB 1C4QA 2WKCA 3RUZA 1SNDA 2PYKA 5I9OA 1PTOB 1H9RA 3R93A 4XQQA 1EY4A 1ESFA 1RODA 3EFXD 2M2LA 3S2HB 1O7YA 4C3JB 4G7OC 2EPBA 5EGTA 1GHJA 1QWYA 4A93B 3E5SA 1SEBD 3BYTB 4DGZA 1FNWA 2F0IA 1STYA 4TSSA 2NYZD 3KBGA 3BS1A 5JEAH 3S1RB 3NTIA 1GUWA 2EYPA 1QNUA 1JORA 3SHLA 3O13A 4RAUC 5I9PA 3NSWA 3KF8A 1EYAA 1BCPF 4J6HA 1XYIA 1E0BA 1ILQA 5BN3A 1KNAA 3BDCA 1EL0A 5A2QL 2MJ8A 1A6XA 5J1ZA 2F0WA 3TN2A 1AW7A 3K59A 4FF2A 2JYOA 2K05A 2QCPX 5C4JB 4K5VA 3EA6A 4A3KB 4V190 3E6ZX 2NB0A 2RDGA 2F1MA 4BWGB 1BDOA 3NQTA 4P2CB 4A3MB 2SEBD 4WORA 4RGNA 4ILWA 2YYZA 2PO4A 3A7AB 1HPCA 3VA7A 1U4PA 2I07B 1BO0A 3OWFA 1D5XC 2MPMA 4IFDJ 4PNYA 4OO1I 2F0NA 2ID0A 5G3LF 1SAPA 1LTTD 1ML0D 1S5FD 2LY7A 1F9SA 3VYUA 1O7ZA 3QB3A 1U4LA 5IODA 3G7LA 5EPKA 3K6OA 4KKTA 2IX1A 1D5ZC 3DWQA 2FJ2A 2VUMB 2GA4B 1D2BA 1G291 1XWEA 1ENFA 3MVVA 2RSOA 3MEHA 3OMGA 2RDHA 5FKAC 4K6LA 1HUMA 1K8OA 1SYBA 4M1UB 3OMCA 2LMCB 5AFWA 2D9UA 2B2YA 4F87A 1KDAA 4HR7B 3WDNA 4F7XA 2PMZB 4DA2A 1Y1WB 2O2LD 4U673 4F8MA 2K7VA 3Q6SA 2WAQB 2JEBI 4HTHA 2FMCA 3RD4A 4NKLA 2F0KA 2B39A 2A5HA 3ITPA 3NPPA 1ILPA 1VDZA 1CZWA 2Q8IB 1MSGA 5JAVA 5D3IB 1T5EA 2IJ0A 3S14B 5FOBB 2K5DA 1STAA 3CRLC 1G91A 2D2CC 3I3CA 5I2XA 1WTVA 3K5MA 5I6YA 2Q8RE 4C3IG 2F0SA 3SDZA 3DHQA 1GUSA 4WJWA 2O5JC 1SXTA 4KHZA 1PZKD 3HOVB 5JPNC 1WVLA 5LL6S 1CQFA 4K2KA 1B44D 1KLGD 2AQ1B 5C4HA 3M7GA 1HHVA 2SNMA 1DZ1A 1HA6A 1SNMA 4FXKC 4C56C 3CKIB 2L9HA 1SDFA 1JWSD 4N9TA 4K14A 1NR4A 3TZDA 3URYA 1OXSC 5T1GA 1EEFD 4XIGS 5DNFA 3QO2A 1MD2D 3TBIB 5KYLA 1ESRA 5KGUA 4RKBA 2M00A 1RD9D 1O7LA 1RHPA 1JOQA 3VA5A 1B9MA 4ZAIA 4ODGA 3I73A 3P20A 2XWBB 3UI2A 2E2JB 1SMYC 2HCCA 3L7ZC 1X32A 3HP3A 1NR2A 4XQJA 5ISRA 3DWAA 4PMBA 3A8IE 1EZ6A 3D6WA 1TT2A 2NVYB 5IT9L 2R7ZB 3K5NA 4MIUA 1PDQA 5IOCA 2WB1B 4C3HG 2O5IC 3C1FA 4TRDA 1D1KA 3R2TA 3J7AV 3PUXA 3D31A 4U68A 4NMZA 1SNCA 2DY8A 5M3FB 4IFDI 5JOBA 4KJNA 1GOZA 5FK9C 2B2UA 1SMYD 5C6AA 5CV7A 1WTWA 1TS3A 3WOFA 5FLXL 3KLRA 5ELCA 1ZEQX 1F9RA 2K32A 1I4RA 3FPPA 2F3VA 2JP1A 2L4NA 1CA5A 1CA6A 4XYOA 1S5ED 5IGFA 3OW7A 3D8GA 2MP1A 1RTNA 4FYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E5S A;  5I6W A;  1SYB A;  5IGG A;  4ZUJ A;  3OMC A;  4EQO A;  5KGU A;  4ME5 A;  4RKB A;  5CGK A;  2M00 A;  4DGZ A;  3OSO A;  5KEE A;  2F0I A;  5C3W A;  1STY A;  4KTA A;  2OF1 A;  1A3T A;  1EZ8 A;  2F3W A;  1JOO A;  3ERO A;  3EVQ A;  3TP7 A;  5KRU A;  5E3F A;  2F0M A;  2EYP A;  1EYD A;  5K5P A;  1JOQ A;  1JOR A;  4R8N A;  3SHL A;  2ENB A;  1IHZ A;  3NXW A;  5CR3 A;  1SNQ A;  3V2T A;  3VA5 A;  5E1F A;  1JOK A;  4EQP A;  4H7B A;  1KDA A;  3QOL A;  5IGE A;  2PZW A;  2O4X A;  4E6I A;  1EYA A;  3HEJ A;  4J6H A;  3SXH A;  4ODG A;  4F7X A;  3SR1 A;  4K8I A;  2HQE A;  4KD4 A;  4KY7 A;  2EY5 A;  5C5M A;  4YIJ A;  4F8M A;  2EXZ A;  2PQE A;  5CC4 A;  2F0E A;  2EYF A;  3BDC A;  2EYH A;  4N9P A;  1A2T A;  2F0V A;  2F0P A;  4B9X A;  4HTH A;  2F0Q A;  3NHH A;  3BDL A;  2F0T A;  3DMU A;  3MXP A;  2PZT A;  3QOJ A;  5ISR A;  4PMB A;  5J39 A;  5NUC A;  4HMI A;  1EY7 A;  3SK6 A;  1EZ6 A;  1SYF A;  1TT2 A;  4NKL A;  2F0K A;  5J1Z A;  2F0O A;  3TME A;  2F0W A;  2F0D A;  4KHV A;  5CV8 A;  1ENA A;  4EVO A;  3ITP A;  4MIU A;  5HUR A;  2SOB A;  5F2D A;  5KYI A;  5IOC A;  5J22 A;  2RBM A;  1KDB A;  2F0L A;  5JAV A;  3C1E A;  4WRD A;  1STG A;  4KJO A;  1EQV A;  5KYL A;  4I65 A;  3NK9 A;  4K5V A;  4K8J A;  2EY1 A;  4K5X A;  1KAA A;  1A3V A;  4KY5 A;  3P1H A;  5EKK A;  1NSN S;  1STA A;  3C1F A;  3LX0 A;  2F0J A;  2QDB A;  5CV6 A;  2F0U A;  2NUC A;  2F0H A;  4IUN A;  3EJI A;  2SNS A;  4KD3 A;  2RKS A;  4IZ8 A;  4TRD A;  5I9P A;  2PW7 A;  3D4D A;  5I6Y A;  3HZX A;  3NQT A;  1EY5 A;  2EY6 A;  3ERQ A;  4NMZ A;  3H6M A;  1SNC A;  3P75 A;  4PMC A;  2F0S A;  4WOR A;  4ZUI A;  4EQN A;  1F2M A;  2EYL A;  4IAL A;  2PZU A;  5JOB A;  3U9O A;  4KJN A;  4NDX A;  1F2Z A;  2F0F A;  3DHQ A;  3S9W A;  1TR5 A;  5IGB A;  5C6A A;  5CV7 A;  2RDF A;  4KV6 A;  4QF4 A;  5EKL A;  2F0G A;  3NUC A;  3D6C A;  4ZQ3 A;  1SYG A;  5HGT A;  1EY6 A;  1U9R A;  3SK4 A;  2EYO A;  1SNO A;  3OWF A;  5IGD A;  3SK5 A;  5IGC A;  1EY8 A;  4J1M A;  4PNY A;  5CV5 A;  2F0N A;  3SK8 A;  4K2K A;  5DAU A;  3TP8 A;  1KDC A;  1ENC A;  4S3S A;  5M9O A;  1SYD A;  3RUZ A;  1SND A;  1EY0 A;  1SNP A;  2PYK A;  4K2L A;  4QMG A;  5C4H A;  5I9O A;  1A3U A;  1EYC A;  1F2Y A;  2SNM A;  2EYM A;  3R3O A;  1SNM A;  4K6D A;  5CV4 A;  3QB3 A;  1STN A;  5IIF A;  5KIX A;  1EY4 A;  3TP5 A;  2LKV A;  3MHB A;  4LAA A;  4OL7 A;  4DU9 A;  1SYE A;  5IOD A;  2F3V A;  4KY6 A;  1NUC A;  1STH A;  2KQ3 A;  4DF7 A;  3MZ5 A;  4N9T A;  4K14 A;  3T13 A;  3T16 A;  1EY9 A;  5DEH A;  1A2U A;  1RKN A;  2OEO A;  4B9W A;  4DFA A;  2EY2 A;  5CV9 A;  1KAB A;  4K5W A;  4RKL A;  3NP8 A;  5C3X A;  2PW5 A;  3PMF A;  4ID6 A;  2EYJ A;  1AEX A;  1SYC A;  5C4Z A;  4G57 A;  2OXP A;  2KHS A;  3TP6 A;  5IGF A;  3D8G A;  4NP5 A;  5EGT A;  4HMJ A;  1II3 A;  1STB A;  3D4W A;  3MVV A;  3MEH A;  1TQO A;  3OMG A;  4QB4 A;  5C5L A;  2WAC A; 
#chains in the Genus database with same CATH topology
 4DV0 L;  1O78 A;  4DAP A;  4KKU A;  4UP7 A;  4RA8 A;  5KEE A;  4UP8 A;  1EZ8 A;  5BR8 Q;  1DYQ A;  3MC0 B;  3NXW A;  2JA7 H;  5IGE A;  1JOK A;  4XXE A;  3GTG B;  1EFI D;  1Q8I A;  3BZC A;  1JWU D;  4UHV A;  1U4M A;  1PTO F;  5A35 A;  2JA8 H;  2ZJR A;  2RF4 A;  3KYH C;  1WCM G;  1PFB A;  2XRQ D;  1Q8K A;  2EYH A;  4JI5 L;  3PF4 A;  4C1N K;  3S16 B;  3MXP A;  5FLX c;  4GZY C;  1KC8 C;  1TII D;  2VQE L;  1IBK Q;  1N8R C;  1AP0 A;  4DKA C;  1XNQ Q;  5J22 A;  1DXM A;  2C9O A;  4LF9 Q;  1KLU D;  4XYQ A;  3OIP A;  5C3E B;  1CM9 A;  2CKZ B;  4UY8 C;  1TWC H;  4QJF A;  2F03 A;  1KAA A;  2WFW A;  3KBX A;  3S2D H;  2PCF B;  1R4P B;  2NUC A;  1XMO Q;  1GJX A;  1EOT A;  5C0X J;  1CZG A;  2HIV A;  1QVG A;  1HFG A;  1HA5 A;  1YIT A;  1PH2 A;  2IL8 A;  4DV6 Q;  1QNK A;  4CGY B;  3GO5 A;  3F2C A;  1LLR D;  4RHS A;  3H94 A;  3RZD B;  3NUC A;  4L5S A;  1A63 A;  1EIH A;  2V4D A;  1JE4 A;  1EIY B;  3K5O A;  4JPB W;  3R8B A;  2KHI A;  4UAI A;  5CV5 A;  4O0A A;  5M9O A;  3RR5 A;  1RJT A;  4K2L A;  4NXM L;  2CQA A;  3NTK A;  4X6A H;  1HRJ A;  3KJP A;  3RN5 A;  1GUN A;  3ULP A;  1GM5 A;  2AMC B;  2UXD L;  1K8M A;  1ET6 A;  2JA7 G;  4XQN A;  2Z6K A;  1NY4 A;  2DY7 A;  1ZYR C;  1A2U A;  1RKN A;  4X64 L;  4BXX H;  2NTT A;  1S5B D;  4L6T B;  2PW5 A;  3PMF A;  1AEX A;  1MI2 A;  2OXP A;  2E2I B;  3FDT A;  3OTO Q;  5EPJ A;  1K28 A;  5C44 H;  1VF5 C;  1B2T A;  2B2V A;  1HR0 Q;  4Y7N H;  4P73 A;  4FF1 A;  2IY5 B;  1CT1 D;  3D3R A;  2G9H D;  1KRT A;  3KJO A;  3TZU A;  3GP7 A;  5KNB A;  3ERO A;  3A8J E;  1PV4 A;  4JI1 L;  4KLK A;  1HJP A;  1UE1 A;  4R8N A;  3F2B A;  3JAM E;  1PH6 A;  4GOP C;  2E5L L;  1JQY D;  4MNO A;  2JSO A;  5GAD C;  2CWA A;  4FNF A;  5C5M A;  1HNW L;  3E9I A;  4ZCK A;  1CKO A;  1DGS A;  2X69 A;  3RZO B;  2BA1 A;  4X3U A;  2KOL A;  1A2T A;  1BVS A;  1LAC A;  2B2U C;  3LWE A;  3PIO 3;  2NN6 I;  5J39 A;  4HMI A;  1VQI A;  2ZTC A;  3HG9 A;  1V43 A;  1XNR L;  4OWT B;  2WV6 D;  2F0D A;  1PHJ A;  4KHP L;  1JIC A;  4DV2 Q;  2C35 B;  1EU3 A;  4RH6 A;  2Z4I A;  4KJO A;  2PPB C;  3T56 B;  4C2M H;  3BU2 A;  3P1H A;  1LTR D;  1LT3 D;  3EJI A;  2F4I A;  3IRB A;  4ABN A;  1EFW A;  3L2P A;  4QIW E;  3DEP A;  1X9N A;  4MN3 A;  4ZUI A;  4Q5V A;  2JA9 A;  5LMN W;  4DV4 Q;  4P72 A;  4DR3 Q;  2F3I A;  2RDF A;  4LF8 Q;  2ZXP A;  2A69 C;  3H3V I;  2JA6 B;  3FEW X;  2AQ2 B;  3SK4 A;  2QF7 A;  5C44 G;  1VCI A;  1SFO H;  3K8A A;  5ELO A;  1AZP A;  3GTQ B;  4V0B A;  4J1M A;  2YU9 B;  5JEA J;  5JJZ A;  2HDM A;  3ND8 A;  2R92 B;  4QMG A;  3PUV A;  4OEM B;  3QJY A;  1BBW A;  2G9D A;  4JI7 L;  1VQN A;  2I0Q A;  1BR9 A;  4IPH A;  1WTX A;  2J0T D;  1Y8N B;  4ZRZ A;  3PO2 B;  3I8Z A;  1K9M C;  2C5C A;  2ASB A;  4B9W A;  4POF A;  4KN4 C;  2EVB A;  3JAM i;  1TWG H;  4OO1 H;  3P7J A;  3QWN A;  2KHS A;  3KDF B;  2HUG A;  4X65 L;  1CFM A;  1YVC A;  2EOT A;  3AFQ A;  3D4W A;  3WOE A;  5C5L A;  1P16 A;  1I4P A;  3GTL H;  1YNX A;  4DR5 Q;  4FXG C;  4H44 C;  1O7I A;  2HIX A;  4KTA A;  1PMR A;  1K83 H;  1JOO A;  3HOY H;  4O1N A;  1NE3 A;  2BDN A;  2Q2I A;  3BZD B;  4R4O A;  4A3C H;  4BBS H;  2ENB A;  3K7A H;  3HKZ G;  2HCI A;  2PZW A;  1L0Y B;  2LXJ A;  2Z9H A;  5IYB H;  3S1M H;  2EQS A;  3SR1 A;  4KY7 A;  2DGY A;  4PZ8 A;  4KK7 A;  1XMQ Q;  3E0E A;  1QE6 A;  4LF4 Q;  1D5M C;  2F0E A;  4DXF A;  2KCM A;  4ZKC B;  4OWW B;  1V1Q A;  2DNC A;  3BVG A;  3QOJ A;  2K1B A;  2L55 A;  3B6Y A;  4PMW A;  3E9H A;  4GKK Q;  5D14 A;  2VB3 X;  1ASY A;  3ER0 A;  2NVX H;  4YCU A;  1FL0 A;  5M5X H;  2L1B A;  2FMM A;  2SOB A;  3WWV A;  5HY6 A;  2B3G A;  4CDD C;  3W2D A;  5C0X I;  3HOW G;  3VYR A;  2F0U A;  4BY7 B;  4DR4 L;  4O42 A;  4RWS C;  3DM3 A;  4IO9 A;  4A3F H;  5M5Y B;  2Z6K C;  2KCN A;  1MKH A;  1L1O B;  4N8F A;  1I94 L;  1F2M A;  1RL2 A;  2QEJ C;  3PUW A;  3UE0 A;  4IUQ A;  4C3H B;  1JT8 A;  1JE5 A;  5EKL A;  4KV6 A;  5D65 A;  2B2V C;  3K7U C;  1L1O A;  3KOJ A;  4POG A;  1C7Y A;  4CHT B;  1H9S B;  4L8J A;  3SK5 A;  5C4X H;  4BY1 G;  3Q0A A;  1LAB A;  4CJ0 B;  4B3S L;  1Q12 A;  1EQQ A;  3X3M A;  4A3B G;  4A3D H;  4FXD A;  1SJE D;  1H9S A;  1JMC A;  3BG3 A;  4QUC A;  3HOY G;  2QW7 A;  4LAA A;  4DU9 A;  3I55 A;  3BZK A;  3PCO B;  4KY6 A;  2MUY A;  5BN4 A;  1STH A;  4BBS G;  5M5W H;  4A3C G;  1DM0 B;  1ZXT A;  5DM7 3;  4BA2 I;  3T16 A;  2Y0S G;  5EQ0 A;  1IYU A;  2JE6 I;  2VXW A;  5C3X A;  4PQX A;  1XJV A;  2EXD A;  1TKW B;  2BE5 C;  2R3Z A;  4HMJ A;  3D0F A;  1JCK B;  4IOA A;  1QJO A;  2SDF A;  1E1O A;  3I91 A;  4DAV A;  1FNV A;  1X54 A;  4JYA Q;  1S4Z A;  2RHS B;  5CGK A;  2HHH Q;  1K8G A;  1VQB A;  2I5L X;  4DNI A;  3PO3 H;  5JEA G;  3A7L A;  2B29 A;  5CBE E;  1VQK A;  1Y8P B;  2EZV A;  1TWH B;  1I4H A;  1HQM C;  1SNQ A;  1HCZ A;  1Q3L A;  3J81 L;  1N33 Q;  3H0G H;  1B53 A;  3K57 A;  4IPG A;  3V96 A;  2DJG C;  4HJA A;  5BN5 A;  4A3G B;  2BOS A;  4QQB X;  1E24 A;  1OXX K;  1Y8O B;  3MEF A;  2JEA I;  3OWE B;  5A2Q E;  4B9X A;  2F0P A;  3FKI H;  3DMU A;  4UP9 A;  4DAM A;  1B1Z A;  4DK1 A;  3LNN A;  2BE5 D;  2F0O A;  3HOU H;  1JR0 D;  2R93 H;  1I50 B;  4DV1 L;  1VQ6 A;  1ENA A;  3GTP H;  5EBD A;  3S17 B;  3HS0 C;  1KDB A;  2B63 H;  3OHX C;  1H95 A;  4WRD A;  1UE5 A;  5GRO A;  4ZLT F;  3CMA A;  1WTR A;  1PH8 A;  1WCM B;  5C4X G;  1PRT C;  4BBR B;  1GD7 A;  1SRU A;  4KY5 A;  3F8T A;  1UUP A;  5EKK A;  3A8K E;  5FO9 B;  1JB3 A;  1B4O A;  1G2T A;  1K0R A;  1CQV A;  4AIM A;  1YEZ A;  3S1N H;  3M4O B;  2UXC L;  3HZX A;  2FXQ A;  2E2D C;  1PTO H;  2PZU A;  2F0F A;  4LNQ A;  4K0K L;  3S2H H;  4LFB L;  1LV9 A;  2A74 C;  3F1Z A;  4LMQ D;  1I4X A;  2EYO A;  4RCO A;  4JG2 A;  4C3J H;  2D62 A;  1X3G A;  1YZ6 A;  1KDC A;  4QUF A;  2E2H B;  3R3O A;  1HQR D;  2EYM A;  2OTL A;  5KNC A;  5KIX A;  5BR8 L;  1LUZ A;  2PQA B;  4A93 H;  1PRT D;  2AUJ D;  1QG7 A;  2K6A A;  1E22 A;  2IHF A;  1EY9 A;  1W2B A;  3H0G G;  4AYB G;  1E3P A;  2EY2 A;  4IPD A;  5CV9 A;  3U4Z A;  1A15 A;  1HTP A;  3S1R H;  3J7A F;  1SYC A;  3RN2 A;  2PQA A;  1O80 A;  4ZKB B;  5IP9 G;  5J3B A;  4YCW A;  3I72 A;  1VF7 A;  1EIG A;  2WAC A;  1YHQ A;  1RTO A;  1PA6 A;  4L5T A;  5T1I A;  3T51 B;  3A5U A;  2OWO A;  3OPO A;  3TP7 A;  1A3T A;  3EVQ A;  3HOU G;  2R93 G;  2XVS A;  4I7A A;  5M3M H;  1HUN A;  1EYD A;  2LS0 1;  3UDX A;  1XNQ L;  4EQP A;  3NBI A;  4LF9 L;  1DOK A;  1VQM A;  5LMN L;  2RCN A;  3U4V A;  3NTH A;  3CD6 A;  2BA0 A;  2VL6 A;  2VNU D;  4XTC S;  2NVQ H;  1ICW A;  3DWP A;  4A3J G;  3CC2 A;  3T1H Q;  5CBA E;  5CC4 A;  1TY0 A;  5C4J H;  4R8I A;  2EJG C;  2NTS A;  1VMC A;  1MHW C;  3FHW A;  1B3Q A;  1ASZ A;  4A3K H;  4DV5 Q;  4DV6 L;  1L1O C;  4B3R Q;  2DUD A;  3CCL A;  4EVO A;  3I7F A;  1W6J A;  2ZXO A;  5LMU Q;  3S2D B;  1LTG D;  4A3M H;  1EYG A;  1N32 Q;  2B8G A;  4X3K A;  1J8I A;  4F88 A;  1HTL D;  2E75 C;  1Y69 U;  4C3J G;  3BDO A;  1TU2 B;  2XN9 C;  4L63 B;  3LX0 A;  1YNJ C;  2F0J A;  2IX0 A;  4LF6 Q;  2RKS A;  3MFY A;  2EDG A;  1B9N A;  3MXN B;  3ERQ A;  3SVM A;  4EX5 A;  4FF3 A;  2TSS A;  2EYL A;  4A3I G;  4GLX A;  3S9W A;  1TR5 A;  4IUP A;  1IYJ B;  3MXN A;  1VQ7 A;  1B8A A;  5DAU A;  1IKL A;  1OTC A;  2EJM A;  2WKD A;  5LL6 X;  5M3M G;  3BJU A;  1EWI A;  5GQO A;  1NUC A;  1J5E Q;  3G48 A;  1YNJ D;  3J80 c;  5C44 B;  2UU9 Q;  4DFA A;  2QEX A;  1DD2 A;  2EIF A;  2JA5 G;  4HJ7 A;  1QVC A;  2MNA A;  5JVH 3;  1C0A A;  1LTS D;  1CSP A;  1TWA B;  1TWF B;  3I4L A;  3M3Y H;  2B2T A;  3H09 A;  3SE0 A;  3IL8 A;  4CDC C;  4UPA A;  1DON A;  1FNU A;  4DK0 A;  5I6W A;  2FFK B;  1Y1W H;  4A3K G;  3A0J A;  1S5D D;  4EQO A;  4ME5 A;  3TEH B;  3HOZ B;  5KRU A;  3C2P A;  1RDP D;  4YWK A;  4DR7 Q;  5IP7 H;  2XSC A;  4JI3 L;  4JI0 Q;  2N8N A;  1Q1E A;  3PGZ A;  4OON A;  1OO9 B;  2D5D A;  2L11 A;  4E6I A;  3K0X A;  2ZXR A;  3UDF A;  2HQE A;  1F9P A;  1VQF A;  2FIN B;  2PQE A;  4A76 A;  1VQP A;  3J7A 5;  3HOX H;  1FGB D;  3S14 H;  4PZ7 A;  1LYL A;  2RSN A;  4JI4 L;  1FYC A;  3U9S A;  3HKZ B;  5E4X A;  3I90 A;  3UE1 A;  3FRP B;  3CCS A;  4C2M B;  5IT9 E;  4DR3 L;  1R4Q B;  2RBM A;  3ERS X;  2F0L A;  1B3A A;  2K28 A;  4I65 A;  4G4K A;  3NK9 A;  3OOC A;  3W5O A;  3GTO B;  3IFD A;  1SBB B;  4CJ1 B;  4DV3 Q;  1A3V A;  4B08 A;  4B3M L;  2NN6 H;  2BCO A;  3M4Q A;  4IZ8 A;  1XPO A;  3GDE A;  1C48 A;  2PW7 A;  1LTI D;  1PXU A;  2K5W A;  3P75 A;  4CKB A;  1ONL A;  4HAE A;  3W3A A;  1EWC A;  1PFS A;  1J9O A;  1PFM A;  3HOW B;  5IGB A;  4HED A;  3EQL C;  1B70 B;  4ZK9 B;  1K0S A;  1HXY D;  3H91 A;  3IKJ A;  2CW0 C;  2VY3 A;  1U9R A;  1SNO A;  4JV5 Q;  1EOV A;  2KVM A;  5IGD A;  1QZH A;  1D1I A;  5FLX E;  3TP8 A;  1KRS A;  3AMU A;  1GKH A;  2EE1 A;  1EY0 A;  4GN5 A;  4LUZ A;  2Z0S A;  2XTI A;  4DR6 L;  3TQY A;  4H02 A;  4MZ9 A;  3T1Y L;  4A3E H;  2NVT B;  2WAQ G;  1NMG A;  5DLQ E;  4RHR A;  2UXB Q;  1HNZ Q;  1FD7 D;  4H0L C;  5IP7 G;  1HFN A;  1LT5 D;  2Z8L A;  4JI2 Q;  3TS2 A;  4BY1 B;  3H15 A;  1R9T B;  3M4Y A;  2L12 A;  4G57 A;  1F2L A;  3MXU A;  3GTL B;  4A3B B;  3MTS A;  3L3O C;  1II3 A;  2VB2 X;  4LF4 L;  3HOX G;  1UWV A;  4ZUJ A;  1L0W A;  4BBS B;  4IOC A;  3FVQ A;  2CW0 D;  1XXG A;  3IFT A;  2Y0S B;  4X62 Q;  4GKK L;  3H3V C;  4LF7 L;  2CVR A;  4CJ2 C;  2E2J H;  4TKO B;  4DUZ Q;  1WTP A;  2IX3 A;  3M7N A;  3DUZ A;  2ICI A;  2L15 A;  4IUU A;  2R6G A;  1I5F A;  3ZYY X;  2NVY H;  5ELF A;  4X66 L;  3S15 B;  2JA8 G;  3PQI A;  1QB5 D;  4CBV A;  1JWM D;  3A56 A;  4KD4 A;  4IN3 A;  4YIJ A;  2EXZ A;  1MBY A;  4RFB A;  4MTK A;  1BCP C;  4L5R C;  1A62 A;  2F0V A;  1IL2 A;  2H4O A;  4HJ8 A;  2QKI C;  1EY7 A;  3BVZ A;  1W3S A;  2RVL A;  1KIX A;  1K3R A;  2D0P A;  1RIP A;  4GKJ Q;  1TS4 A;  1S5C D;  1DJR D;  1AZQ A;  4WJ4 A;  1EQV A;  2OQK A;  3VR4 A;  5M3F H;  1BBX C;  4IUV A;  1GUO A;  4K5X A;  5COR A;  3JAM c;  3KLW A;  1EUJ A;  1NSN S;  4GN4 B;  1V9P A;  3DEO A;  2E74 C;  4JW0 A;  4KD3 A;  4CKC A;  4HSV A;  1ZYR D;  1FVI A;  4A3E G;  1BQQ T;  1GUG A;  4YWL A;  1PYB A;  1VQH A;  4RMF A;  4IPC A;  3A55 A;  1AN8 A;  3G4S A;  3S1Q B;  1I4Q A;  2VZA A;  5I2Y A;  3GTJ B;  4YHH Q;  2K03 A;  1I6H B;  4GS3 A;  1E1T A;  1E7Z A;  2B2T C;  4XT1 B;  4ULL A;  4GN3 B;  2E8G A;  3VDY A;  5IGC A;  4AQY Q;  5EKI A;  1WD0 A;  1V8Q A;  3GV3 A;  4JYA L;  3PIO A;  1A3U A;  1EYC A;  2PMZ E;  1S40 A;  1EU4 A;  1CHP D;  4R1J A;  4OL7 A;  3FPU B;  2IW3 A;  3NQI A;  3CCR A;  2F52 A;  4Y52 H;  4BXX G;  2GVA A;  2WAQ E;  5DEH A;  3C46 A;  5HGQ A;  1Z47 A;  2N49 A;  4OIJ A;  3TRE A;  1PRT B;  2KCC A;  3KUP A;  4WFN 3;  4JI8 L;  2WB1 G;  1I3Q B;  2L5T A;  1IXR A;  4C3I B;  1G6Z A;  4JI6 Q;  3TS0 A;  1LM0 A;  4QCL A;  3JC6 6;  2OF1 A;  4AYB B;  1IKM A;  1Y1V B;  3AB9 A;  3S16 H;  3QOL A;  2B2W C;  4EGV A;  1HZB A;  1F77 A;  2KA7 A;  3V05 A;  2OCE A;  2KBN A;  4PV1 C;  2K50 A;  5C3E H;  2R93 B;  2EYF A;  4JI5 Q;  2B8F A;  3NHH A;  2CH4 A;  2A69 D;  3BDL A;  5K36 H;  3TDQ A;  2BH2 A;  5NUC A;  4DR1 Q;  3KLS X;  1MJE A;  3AEV A;  5D3D A;  1KXL A;  3J7Y W;  4RGM A;  1EWH A;  4A3J B;  1H9M A;  2AUK A;  1HR0 W;  2EY1 A;  4LFC L;  3RZD H;  3S24 A;  3GTK B;  5IWA Q;  2YV5 A;  1IYV A;  3C3L A;  1IL8 A;  4YY3 L;  3EBE A;  1HNX Q;  1IZ6 A;  2WIN B;  1IBL Q;  5C3W A;  4IUR A;  3AQQ A;  3Q23 A;  3CCU A;  1T5X D;  5EJW A;  2VW9 A;  4ZQ3 A;  2UUA L;  1QIL A;  1TS5 A;  1VQJ A;  2BH8 A;  1G51 A;  1G8Z D;  2NZ1 D;  1ZKO A;  1ET9 A;  1SYD A;  2RQX A;  4NXM Q;  2E2I H;  1F2Y A;  4A3I B;  2OTJ A;  1MJC A;  1ICF B;  3T4A C;  2UXD Q;  1VQ8 A;  3T13 A;  5AJ3 Q;  3A5Z B;  4APV A;  1KAB A;  4OO1 G;  2MQH A;  2PI2 E;  2Q2U A;  1C9O A;  3ND9 A;  1VQO A;  3LGJ A;  4G7Z C;  4NP5 A;  3ULL A;  4EQ5 A;  4XT3 B;  5JJI A;  5KND A;  2JXM B;  3T1H L;  2PNH A;  1SMX A;  1U5K A;  4QGU A;  5M3M B;  1BF4 A;  1Q46 A;  5CMD A;  2WB1 E;  5IYC H;  1YIJ A;  5K36 G;  2PNR C;  4DXG A;  1QZG A;  3R2I A;  3OSO A;  4OWX B;  2MGS A;  4B3R L;  3RZO H;  4IJH A;  5E3F A;  2JN4 A;  3L9A X;  1WYD A;  4JI1 Q;  2NVQ B;  2QGQ A;  1N36 Q;  2JA5 B;  5JJK A;  2AWN A;  3MWY W;  5LMU L;  1IHZ A;  3V2T A;  3Q24 A;  1YJW A;  4CDE C;  5IYB G;  2O4X A;  4KMU C;  2E5L Q;  3HEJ A;  1H9K A;  3CXC A;  1GXD C;  2EY5 A;  2DJF C;  5IY0 A;  4LF6 L;  4HN7 A;  1HNW Q;  2I5M X;  2NBF A;  4RGT A;  3I4N H;  1D6E C;  1S72 A;  3HGB A;  1TY2 A;  3BVM A;  2F0T A;  2HQL A;  3N6R A;  2K5V A;  2K4K A;  3SK6 A;  1SYF A;  3I4M B;  3CPF A;  3RLF A;  2L0C A;  2WP8 J;  4HCE A;  1EIF A;  1Q90 A;  5F2D A;  3W1G A;  3C1E A;  3E0J A;  1E2V A;  1STG A;  4K8J A;  1KTK A;  2NWG A;  4X3T A;  2JA6 H;  1Z6H A;  3DM1 A;  4A3F G;  2SNS A;  3GTM B;  3GTQ H;  4ME3 A;  4JCV E;  1G2S A;  3D4D A;  4HSP A;  2CQO A;  2IHE A;  1X55 A;  2R92 H;  2MO1 A;  4OGQ C;  1J5E L;  4TQU S;  2UUC Q;  4IAL A;  5GAG C;  3CME A;  2UU9 L;  3AYH B;  5FO8 B;  1HH2 P;  1RF2 D;  2MHV A;  1UEB A;  2OT2 A;  4NPS A;  3PIP 3;  2ZJP A;  4DR2 L;  3PO2 H;  1VS0 A;  2VS1 A;  3CQZ B;  2K52 A;  4JBW A;  3G71 A;  4A3D G;  4O2D A;  5CYU A;  4OX9 L;  3RMH A;  4JK1 C;  2E76 C;  4NW2 A;  1PFN A;  5EBC A;  4DR7 L;  3MZ5 A;  4HIK A;  3M3Y B;  2OEO A;  1AE2 A;  4RKL A;  2EYJ A;  5ELE A;  2Z6B A;  4NXN Q;  2JQO A;  1X3P A;  4QIW B;  3I4N G;  3X3N A;  2ZJQ A;  2VQF Q;  1FJG Q;  4M8A A;  4DNR B;  2LSS A;  3G6J B;  3ICE A;  4AH6 A;  5COY A;  3GD7 A;  5IE8 A;  2DNE A;  4QY7 A;  4CKE A;  3PO3 G;  4IFD H;  2F3W A;  5EAY A;  1CTM A;  1SE3 A;  2MO0 A;  2H1E A;  5E1F A;  1IBM Q;  3TRZ A;  1Z7T A;  1Z9F A;  4KN7 C;  3J81 E;  2YTY A;  4DV3 L;  3HOX B;  4J8Q A;  4JBJ A;  1X3Q A;  2KEC A;  3GQB A;  3VR2 A;  3Q8D A;  3NEL A;  2FHT A;  4RCN A;  1PTO C;  3FKI G;  2JA7 B;  2A6H C;  1YJN A;  2R92 G;  2PZT A;  4RG1 A;  2AHO B;  4BY7 H;  1IBK L;  1JC7 A;  3GV6 A;  3PUZ A;  5M5Y H;  3OYY A;  5HUR A;  2JA8 B;  2B63 G;  5KYI A;  3MFG A;  4JV5 L;  4LWC A;  4WJ3 M;  4TVA B;  4C3H H;  5IYD H;  3NE5 B;  2Z1C A;  4OXP A;  2G5D A;  2J4X A;  1TVX A;  1NCV A;  4R9W A;  4DR4 Q;  1M4V A;  2F0H A;  4IUN A;  1C8C A;  1XMO L;  3J80 L;  1LT4 D;  3N52 A;  2RHQ B;  4GLV B;  4EQN A;  2AWO A;  2R61 A;  2UXB L;  1PH5 A;  2ZTE A;  1B50 A;  3K58 A;  4NDX A;  1TXY A;  1TWC B;  1SE4 A;  4OHJ A;  3NEN A;  4NB3 A;  1BXT A;  2F0G A;  3IAY A;  3D6C A;  1PTO D;  5HGT A;  2A6H D;  1E2W A;  2YTX A;  1EY8 A;  4PG3 A;  4P71 A;  4A3E B;  1GHK A;  3UDI A;  3SK8 A;  1ENC A;  3K5L A;  1BCP B;  3PUY A;  3NEM A;  4IFD G;  3K0Y A;  2I46 A;  4CDF C;  4BA1 I;  4A93 G;  3MHB A;  1PYW D;  4BS9 A;  3VR6 A;  4DUZ L;  2KQ3 A;  4OEL B;  4KKS A;  1MSH A;  4Q0F A;  1JJG A;  1KNE A;  2IT1 A;  3OIQ A;  3J81 i;  4ID6 A;  1IW7 C;  5C4Z A;  3AU7 A;  2KED A;  3OTO L;  3MA2 B;  1HR0 L;  4QB4 A;  4S3S A;  5IIF A;  2RA4 A;  1OXT A;  5IGG A;  2VUM H;  4LUV A;  5JPM C;  4JVZ A;  3T53 B;  1VQ9 A;  3LWU A;  5ELN A;  1X6O A;  4A3G H;  1WOC A;  3M85 A;  2K14 A;  1SSO A;  3BYY B;  4Y7N B;  1VMP A;  3PSI A;  2AQ3 B;  3SXH A;  1I50 H;  1LO5 D;  1Q81 C;  5I4D A;  4HIM A;  4A3L H;  3S17 H;  4K8I A;  3F2U A;  1DOL A;  2A68 C;  1NJI C;  4XDX A;  4BBR H;  3J80 E;  2XWJ B;  2F0Q A;  1IW7 D;  3AFP A;  4LK1 C;  2K5Q A;  5FJ8 H;  1G6P A;  1PH7 A;  1PRT F;  3M4O H;  1BNZ A;  1V1P B;  1MGS A;  4A3M G;  4DV2 L;  2KCT A;  4H13 C;  2UUB Q;  2KEN A;  4FF4 A;  2Q2H A;  4AQY L;  5ELD A;  4OIK A;  4JC0 A;  1L0X B;  4FDB A;  2KJX A;  1V1P A;  2K01 A;  2D0O A;  3A54 A;  3ONA B;  2B2Y C;  2EJF C;  1FR3 A;  3F2D A;  4C1N I;  1D8L A;  1XTD A;  1EY5 A;  1Y14 B;  2Z4H A;  3CC7 A;  2XGT A;  2E2H H;  4FVM A;  1NAP A;  1PZJ D;  1YI2 A;  3U9O A;  1QCB D;  4DV4 L;  1Q82 C;  1HZA A;  2A68 D;  3I56 A;  2MFI A;  1EQT A;  4LF8 L;  1PH9 A;  4J15 A;  4DNT B;  2M9V A;  1SYG A;  1OXU A;  4GLA C;  4A4I A;  2B2W A;  4FO2 A;  2VUM G;  1SE2 A;  1SNP A;  4JI6 L;  3HOV H;  4K6D A;  4A3G G;  1QVF A;  2LKV A;  3KK7 A;  1SJH D;  1UAP A;  1SFO B;  4LFA Q;  2GVB A;  3VYS A;  1JB7 A;  4K5W A;  4A3L G;  3QR8 A;  5EPL A;  3TP6 A;  2WII B;  1WD1 A;  2QIL A;  1STE A;  2KEE A;  1N34 Q;  1STB A;  4JOI C;  3TSS A;  4BBR G;  1GO3 E;  1Y1W G;  3PV0 A;  1A8V A;  3J80 i;  4DR5 L;  4DR1 L;  1EEI D;  5FJ8 G;  1TWG B;  3STB C;  2K75 A;  3K81 C;  4QL5 A;  1E2Z A;  1YNN C;  3H3V H;  3I70 A;  3VYT A;  2K33 A;  5E7N A;  3JAM L;  5LMN Q;  3FMC A;  4KI0 A;  4LJZ C;  3FP9 A;  1OXV A;  3ZJY C;  2ICE C;  3EIV A;  2HDL A;  3SGI A;  5GAE C;  4HJ9 A;  4G7H C;  5IWA L;  1WTO A;  4FP5 D;  1XMQ L;  1K83 B;  1U0L A;  3HOY B;  1HNX L;  1IBL L;  3K7A B;  3NBH B;  2ZM6 Q;  1M8A A;  3S1M B;  1K73 C;  4MHE A;  3W1B A;  4LF5 Q;  5FO7 B;  4ZYS A;  4IUT A;  3NBH A;  1M1K C;  3SEB A;  2R7Z H;  2Q8T A;  1UEA B;  2JJQ A;  3STB D;  2XIW A;  1Q86 C;  4JBM A;  2QDB A;  5CV6 A;  2NN6 G;  3VR3 A;  3HOV G;  4R4C A;  1YNN D;  2NVX B;  2A6E C;  2N55 A;  3CU7 A;  2A73 B;  1V1O A;  3NWT A;  5M5X B;  1PH3 A;  1DCZ A;  1VQ5 A;  2EY6 A;  3RLN A;  1XTC D;  4DV7 Q;  1KD1 C;  2X6G A;  1WTQ A;  3DXJ C;  1GUT A;  5AJ3 L;  1F2Z A;  5JVG 3;  4YWM A;  4QF4 A;  1LTB D;  1I6V C;  3E3X A;  1EY6 A;  1SLJ A;  2XRS D;  4A3F B;  1UE6 A;  1VQE A;  1A0I A;  3Q22 A;  5H1S E;  1H9J A;  5CV4 A;  1CHQ D;  1STN A;  1TWA H;  1TWF H;  1Q1B A;  3TP5 A;  3MXG A;  1SYE A;  2BDO A;  3OW2 A;  4HCS A;  1N36 L;  4DF7 A;  1YBY A;  4RGO S;  5C4X B;  3KLS A;  3HOZ H;  3MAQ A;  5C0X H;  1PLF A;  1PZI D;  2A6E D;  3NP8 A;  1BCP D;  1AFP A;  3CHB D;  4A3D B;  3EN2 A;  2K5N A;  1UNS A;  2LFN A;  5LHY 1;  4X3S A;  1TQO A;  1VQG A;  4GNX B;  5TSS A;  2X6L A;  3HRZ C;  5M5W B;  1JJ2 A;  4DN4 M;  2I5H A;  2NZO A;  4DPG A;  1XPU A;  2HHH L;  1I4G A;  5ELB A;  2IWH A;  2F0M A;  5K5P A;  4GNX A;  2XNA C;  1CI3 M;  3CCM A;  5CR3 A;  4I7Z C;  1SN8 A;  4H7B A;  4Z9C B;  4JI3 Q;  1J6Q A;  1N33 L;  3I4N B;  1DOM A;  2KUM A;  3HFZ B;  2R7Z G;  1U4R A;  1BOS A;  4DUY Q;  1LTL A;  4B3T Q;  5DM6 3;  3GTG H;  2F4V Q;  3PO3 B;  4DV0 Q;  1F9Q A;  2DN8 A;  3GTO H;  5FLM H;  4N9P A;  3VR5 A;  1LT6 D;  2ZT9 C;  1CK1 A;  4JI4 Q;  1K3B C;  2K04 A;  3H0G B;  3QG1 A;  3NWS A;  4DAY B;  2UUC L;  3TME A;  2J7Z A;  4R4T A;  4KHV A;  2HD3 A;  2TMP A;  5CV8 A;  4DK6 C;  2IPK D;  5M3F G;  1UE7 A;  4DAY A;  1BUV T;  1QOH A;  1TS2 A;  3QIA A;  3HOW H;  1W6K A;  3CC4 A;  3FKI B;  5E4W C;  5G3L D;  1WFQ A;  1CKM A;  4UDU C;  4B3M Q;  2CH4 W;  3CRK C;  2CHB D;  3HOU B;  2QDL A;  3GTP B;  1LTA D;  2N88 A;  1XX8 A;  4PMC A;  3H6M A;  2B63 B;  1WTH A;  1RCV D;  2N3S A;  2VQE Q;  3CCE A;  3HOZ G;  5C0X G;  4IQZ A;  2NZH A;  3D4R A;  1CSQ A;  2NVT H;  4NXN L;  1EQR A;  3U58 A;  3S1N B;  2VQF L;  1FJG L;  4BY1 H;  1R9T H;  1C4Q A;  2WKC A;  3RUZ A;  1SND A;  4A3B H;  2PYK A;  5I9O A;  1H9R A;  1PTO B;  4DR6 Q;  3KDF A;  3R93 A;  3T1Y Q;  4XQQ A;  1EY4 A;  1ESF A;  1ROD A;  3EFX D;  2M2L A;  3S2H B;  1Q7Y C;  2P5Z X;  1IBM L;  1O7Y A;  3ULJ A;  4C3J B;  4G7O C;  1X3E A;  3CCJ A;  2EPB A;  3KF6 B;  5EGT A;  1GHJ A;  1QWY A;  1L2F A;  2H5X A;  2Q2T A;  4A93 B;  3E5S A;  5FLM G;  1SEB D;  3S15 H;  3BYT B;  1WI5 A;  2YTV A;  2HT1 A;  3KF6 A;  4DGZ A;  1FNW A;  2F0I A;  3KF8 B;  1STY A;  2AKW B;  4TSS A;  4A75 A;  4LF7 Q;  2NYZ D;  1X56 A;  3KBG A;  5JEA H;  3BS1 A;  3NTI A;  3S1R B;  1GUW A;  2EYP A;  1QNU A;  1JOR A;  3SHL A;  3O13 A;  4RAU C;  5I9P A;  1QUQ B;  4X64 Q;  3NSW A;  3KF8 A;  1EYA A;  1BCP F;  4J6H A;  1XYI A;  1KQS A;  4X66 Q;  1E0B A;  1HZC A;  1ILQ A;  5BN3 A;  1QUQ A;  2K5H A;  1KNA A;  5C3E G;  3BDC A;  1EL0 A;  1VQD A;  5A2Q L;  1T9H A;  1NMF A;  4JBK A;  2MJ8 A;  1A6X A;  4DV5 L;  1XPR A;  1WJJ A;  4YCV A;  5J1Z A;  2F0W A;  3TN2 A;  1B7Y B;  1AW7 A;  3K59 A;  4FF2 A;  2JYO A;  2K05 A;  5L37 A;  1N32 L;  3S1Q H;  2QCP X;  5C4J B;  3GTJ H;  4K5V A;  3EA6 A;  4A3K B;  2ES2 A;  4V19 0;  1I6H H;  3E6Z X;  2LXK A;  2NB0 A;  2RDG A;  2CCZ A;  2F1M A;  4BWG B;  1BDO A;  3NQT A;  4L5Q A;  1P8L A;  4P2C B;  4A3M B;  2SEB D;  4WOR A;  4RGN A;  3HKS A;  4R4I A;  4ILW A;  1XNR Q;  2YYZ A;  1S3O A;  1K8A C;  2PO4 A;  3A7A B;  4KHP Q;  2CFM A;  1HPC A;  3VA7 A;  2OQ0 A;  1U4P A;  2I07 B;  1BO0 A;  3OWF A;  1D5X C;  2MPM A;  4IFD J;  4PNY A;  4OO1 I;  2F0N A;  2A1A A;  2ID0 A;  1SAP A;  1LTT D;  5G3L F;  1ML0 D;  1S5F D;  3CCQ A;  4LUO A;  2LY7 A;  1F9S A;  2RCF A;  3VYU A;  1O7Z A;  4GNX C;  2ALY B;  3QB3 A;  2YU9 H;  1NTG A;  1I3Q H;  1U4L A;  1GVP A;  5IOD A;  1AH9 A;  3G7L A;  4C3I H;  5EPK A;  3K6O A;  4KKT A;  2IX1 A;  1VQA A;  3I4O A;  1D5Z C;  3DWQ A;  1N9W A;  3HKZ E;  2FJ2 A;  2VUM B;  2GA4 B;  1D2B A;  1G29 1;  1Y1V H;  4JI8 Q;  1XWE A;  5IP9 H;  1ENF A;  3MVV A;  2RSO A;  3MEH A;  3OMG A;  2RDH A;  5FKA C;  4K6L A;  1HUM A;  5IYC G;  1K8O A;  1SYB A;  4M1U B;  3OMC A;  2LMC B;  5AFW A;  4JI7 Q;  1PYS B;  2D9U A;  3CPW A;  1PVO A;  1CUK A;  2B2Y A;  4F87 A;  1KDA A;  3PIP A;  4JI0 L;  4P75 A;  4HR7 B;  2UUB L;  1FGU A;  4HID A;  3G6E A;  3WDN A;  4F7X A;  2PMZ B;  4DA2 A;  1Y1W B;  3CW2 C;  4X65 Q;  2O2L D;  4U67 3;  4F8M A;  4A3J H;  2K7V A;  3Q6S A;  4LW1 A;  1KHI A;  2WAQ B;  2JEB I;  4HTH A;  3GTK H;  1MIU A;  2QA4 A;  2FMC A;  3RD4 A;  4NKL A;  2F0K A;  2B39 A;  2A5H A;  3ITP A;  3NPP A;  1ILP A;  1VDZ A;  1CZW A;  2Q8I B;  1MSG A;  5JAV A;  5D3I B;  1T5E A;  2IJ0 A;  1PH1 A;  1KAW A;  4LFC Q;  3S14 B;  5FOB B;  2K5D A;  2V1C C;  3J81 c;  1STA A;  2JA6 G;  3CRL C;  4PZ6 A;  3J7Z C;  4YY3 Q;  1G91 A;  2D2C C;  3I3C A;  5I2X A;  1BKB A;  1WTV A;  3K5M A;  3U50 C;  5I6Y A;  2Q8R E;  4JOI A;  5GAH C;  4C3I G;  2F0S A;  3SDZ A;  4LFA L;  4A3I H;  3M4P A;  3DHQ A;  2ATW A;  1SRO A;  1GUS A;  4WJW A;  2O5J C;  5JJL A;  2Y0S E;  1SXT A;  4KHZ A;  1PZK D;  2UUA Q;  3HOV B;  1Y1V G;  5JPN C;  1WVL A;  3PO2 G;  4ALP A;  1N34 L;  5LL6 S;  1CQF A;  3M9B A;  4P74 A;  4K2K A;  1M90 C;  1B44 D;  1KLG D;  2AQ1 B;  5C4H A;  1JJC B;  3M7G A;  1HHV A;  2SNM A;  1DZ1 A;  1HA6 A;  1SNM A;  4FXK C;  4C56 C;  3CKI B;  2L9H A;  1SDF A;  1I94 Q;  3PF5 A;  1JWS D;  4DK3 C;  4N9T A;  4K14 A;  1NR4 A;  1HNZ L;  3TZD A;  3URY A;  4JI2 L;  1OXS C;  5T1G A;  1EEF D;  4XIG S;  5DNF A;  2JA5 H;  3QO2 A;  1MD2 D;  3TBI B;  5KYL A;  1ESR A;  3UDG A;  4B3S Q;  3RNU A;  1CKN B;  5KGU A;  4RKB A;  2M00 A;  2ZM6 L;  4X62 L;  3KFU A;  3J81 j;  1RD9 D;  1O7L A;  1RHP A;  1JOQ A;  1CKN A;  3VA5 A;  3CCV A;  3I2Z A;  4HIO A;  1B9M A;  4ZAI A;  4LF5 L;  1PH4 A;  3I4M H;  1KL9 A;  4ODG A;  4IJL A;  1TWH H;  3I73 A;  3P20 A;  1YJ9 A;  1HZ9 A;  3A74 A;  2XWB B;  1VQC A;  3UI2 A;  4HJ5 A;  3RLO A;  2E2J B;  1SMY C;  2HCC A;  3L7Z C;  1NBW A;  1X32 A;  3HP3 A;  1NR2 A;  4XQJ A;  1NNX A;  5ISR A;  4BY7 G;  3DWA A;  4PMB A;  3A8I E;  4DV7 L;  1EZ6 A;  3D6W A;  1TT2 A;  3GTM H;  2NVY B;  5IT9 L;  2R7Z B;  3K5N A;  4GKJ L;  4MIU A;  1VQ4 A;  2ZTD A;  4GOP B;  1PDQ A;  5IOC A;  2R7D A;  1SR3 A;  2A19 A;  2PI2 A;  2WB1 B;  3CAM A;  4C3H G;  5IYD G;  1D7Q A;  2O5I C;  1YHB A;  3C1F A;  4GOP A;  4TRD A;  1D1K A;  2R7F A;  3R2T A;  3J7A V;  1WCM H;  3PUX A;  3D31 A;  4U68 A;  3CQZ H;  4NMZ A;  2JK8 A;  1SNC A;  2DY8 A;  5M3F B;  4IFD I;  5JOB A;  4YHH L;  4KJN A;  1GOZ A;  5FK9 C;  2B2U A;  4DV1 Q;  1SMY D;  5C6A A;  5CV7 A;  1WTW A;  2N78 A;  1X3F A;  4R4Q A;  4AYB E;  3L0O A;  1TS3 A;  4MTN A;  4DR2 Q;  3WOF A;  5FLX L;  3KLR A;  3DLL A;  1X65 A;  1VQL A;  5ELC A;  4OX9 Q;  1ZEQ X;  1F9R A;  2K32 A;  2UXC Q;  1I4R A;  3FPP A;  1YHA A;  2GN5 A;  2A8V A;  1BBU A;  2F3V A;  2CWP A;  3K80 C;  3CF5 A;  2JP1 A;  3CP0 A;  2L4N A;  1CA5 A;  3I4M G;  4K0K Q;  4LFB Q;  1CA6 A;  4XYO A;  1S5E D;  4N8X 1;  4DUY L;  5IGF A;  1SE8 A;  3D8G A;  3OW7 A;  2KHJ A;  1AE3 A;  5IT9 c;  2MP1 A;  1RTN A;  4FYD A;  4B3T L;  2F4V L; 
#chains in the Genus database with same CATH homology
 1O78 A;  4DAP A;  4KKU A;  4RA8 A;  5KEE A;  1EZ8 A;  1DYQ A;  3MC0 B;  3NXW A;  5IGE A;  1JOK A;  4XXE A;  3GTG B;  1EFI D;  1Q8I A;  1JWU D;  1U4M A;  1PTO F;  5A35 A;  1PFB A;  2XRQ D;  2EYH A;  4C1N K;  3S16 B;  3MXP A;  4GZY C;  1TII D;  1AP0 A;  5J22 A;  1DXM A;  2C9O A;  1KLU D;  4XYQ A;  3OIP A;  5C3E B;  1CM9 A;  2F03 A;  1KAA A;  3KBX A;  2PCF B;  1R4P B;  2NUC A;  1GJX A;  1EOT A;  5C0X J;  1CZG A;  1HFG A;  1HA5 A;  2IL8 A;  1QNK A;  4CGY B;  3GO5 A;  1LLR D;  4RHS A;  3H94 A;  3RZD B;  3NUC A;  1EIH A;  2V4D A;  1JE4 A;  3K5O A;  3R8B A;  4UAI A;  5CV5 A;  5M9O A;  1RJT A;  4K2L A;  2CQA A;  3NTK A;  1HRJ A;  1GUN A;  1K8M A;  1ET6 A;  4XQN A;  2DY7 A;  1ZYR C;  1A2U A;  1RKN A;  2NTT A;  1S5B D;  4L6T B;  2PW5 A;  3PMF A;  1AEX A;  1MI2 A;  2OXP A;  2E2I B;  3FDT A;  5EPJ A;  1VF5 C;  1B2T A;  2B2V A;  4FF1 A;  1CT1 D;  3D3R A;  2G9H D;  3TZU A;  3GP7 A;  5KNB A;  3ERO A;  3A8J E;  4R8N A;  3JAM E;  1JQY D;  2JSO A;  4FNF A;  5C5M A;  3RZO B;  2X69 A;  2BA1 A;  4X3U A;  2KOL A;  1A2T A;  1LAC A;  2B2U C;  3LWE A;  3PIO 3;  2NN6 I;  5J39 A;  4HMI A;  3HG9 A;  1V43 A;  2WV6 D;  2F0D A;  1JIC A;  1EU3 A;  4RH6 A;  2Z4I A;  4KJO A;  2PPB C;  3T56 B;  3P1H A;  1LTR D;  1LT3 D;  3EJI A;  2F4I A;  4ABN A;  3DEP A;  4MN3 A;  4ZUI A;  4Q5V A;  2RDF A;  2ZXP A;  2A69 C;  2JA6 B;  3FEW X;  2AQ2 B;  3SK4 A;  2QF7 A;  1VCI A;  1AZP A;  3GTQ B;  4V0B A;  4J1M A;  2YU9 B;  5JEA J;  5JJZ A;  2HDM A;  3ND8 A;  2R92 B;  4QMG A;  3PUV A;  3QJY A;  2G9D A;  1BR9 A;  1WTX A;  2J0T D;  1Y8N B;  4ZRZ A;  3PO2 B;  3I8Z A;  2C5C A;  4B9W A;  4KN4 C;  2EVB A;  4OO1 H;  3P7J A;  3QWN A;  2KHS A;  2HUG A;  1CFM A;  2EOT A;  3D4W A;  3WOE A;  5C5L A;  1I4P A;  4FXG C;  4H44 C;  4KTA A;  1PMR A;  1JOO A;  4O1N A;  2BDN A;  3BZD B;  2ENB A;  2HCI A;  2PZW A;  1L0Y B;  3SR1 A;  4KY7 A;  4KK7 A;  1QE6 A;  1D5M C;  2F0E A;  4DXF A;  4ZKC B;  2DNC A;  3BVG A;  3QOJ A;  2K1B A;  2L55 A;  4PMW A;  5D14 A;  2VB3 X;  2L1B A;  2FMM A;  2SOB A;  3W2D A;  5C0X I;  3VYR A;  2F0U A;  4BY7 B;  4O42 A;  4RWS C;  5M5Y B;  2KCN A;  1F2M A;  2QEJ C;  3PUW A;  4IUQ A;  4C3H B;  5EKL A;  4KV6 A;  5D65 A;  2B2V C;  4CHT B;  1H9S B;  4L8J A;  3SK5 A;  3Q0A A;  1LAB A;  4CJ0 B;  1Q12 A;  3X3M A;  4FXD A;  1SJE D;  1H9S A;  3BG3 A;  4QUC A;  4LAA A;  4DU9 A;  4KY6 A;  5BN4 A;  2MUY A;  1STH A;  1DM0 B;  5DM7 3;  1ZXT A;  4BA2 I;  3T16 A;  5EQ0 A;  1IYU A;  2JE6 I;  2VXW A;  5C3X A;  4PQX A;  1TKW B;  2BE5 C;  2R3Z A;  4HMJ A;  1JCK B;  1QJO A;  2SDF A;  3I91 A;  4DAV A;  1FNV A;  1S4Z A;  5CGK A;  5JEA G;  3A7L A;  5CBE E;  1Y8P B;  2EZV A;  1TWH B;  1I4H A;  1HQM C;  1SNQ A;  1HCZ A;  1Q3L A;  3J81 L;  1B53 A;  3K57 A;  3V96 A;  5BN5 A;  4A3G B;  2BOS A;  1OXX K;  1Y8O B;  2JEA I;  3OWE B;  5A2Q E;  4B9X A;  2F0P A;  3DMU A;  1B1Z A;  4DK1 A;  3LNN A;  2BE5 D;  2F0O A;  1JR0 D;  1I50 B;  1ENA A;  5EBD A;  3S17 B;  3HS0 C;  1KDB A;  3OHX C;  4WRD A;  4ZLT F;  1WTR A;  1WCM B;  1PRT C;  4BBR B;  4KY5 A;  1UUP A;  5EKK A;  3A8K E;  5FO9 B;  1JB3 A;  1B4O A;  1G2T A;  1CQV A;  3M4O B;  3HZX A;  2E2D C;  1PTO H;  2PZU A;  2F0F A;  1LV9 A;  2A74 C;  4LMQ D;  1I4X A;  2EYO A;  4RCO A;  2D62 A;  1KDC A;  4QUF A;  2E2H B;  3R3O A;  1HQR D;  2EYM A;  5KNC A;  5KIX A;  1PRT D;  2AUJ D;  1QG7 A;  2K6A A;  1EY9 A;  2EY2 A;  5CV9 A;  1A15 A;  1HTP A;  3J7A F;  1SYC A;  1O80 A;  4ZKB B;  3I72 A;  1VF7 A;  1EIG A;  2WAC A;  1RTO A;  3T51 B;  5T1I A;  3OPO A;  3TP7 A;  1A3T A;  3EVQ A;  2XVS A;  1HUN A;  1EYD A;  2LS0 1;  4EQP A;  3NBI A;  1DOK A;  3NTH A;  2BA0 A;  2VNU D;  4XTC S;  1ICW A;  3DWP A;  5CBA E;  5CC4 A;  1TY0 A;  4R8I A;  2EJG C;  2NTS A;  1VMC A;  4EVO A;  1W6J A;  2ZXO A;  3S2D B;  1LTG D;  2B8G A;  4X3K A;  1J8I A;  4F88 A;  1HTL D;  2E75 C;  1Y69 U;  4C3J G;  3BDO A;  1TU2 B;  2XN9 C;  4L63 B;  3LX0 A;  1YNJ C;  2F0J A;  2IX0 A;  2RKS A;  3MFY A;  2EDG A;  1B9N A;  3ERQ A;  3SVM A;  4FF3 A;  2TSS A;  2EYL A;  3S9W A;  1TR5 A;  4IUP A;  3MXN A;  5DAU A;  1IKL A;  2EJM A;  2WKD A;  5LL6 X;  1NUC A;  1YNJ D;  5C44 B;  4DFA A;  1DD2 A;  5JVH 3;  1LTS D;  1TWA B;  3I4L A;  1TWF B;  2B2T A;  3H09 A;  3SE0 A;  3IL8 A;  1DON A;  1FNU A;  4DK0 A;  5I6W A;  2FFK B;  1S5D D;  4EQO A;  4ME5 A;  3HOZ B;  5KRU A;  3C2P A;  1RDP D;  2XSC A;  1Q1E A;  1OO9 B;  2D5D A;  2L11 A;  4E6I A;  2ZXR A;  2HQE A;  1F9P A;  2FIN B;  2PQE A;  1FGB D;  2RSN A;  1FYC A;  3U9S A;  3HKZ B;  5E4X A;  3I90 A;  3FRP B;  4C2M B;  5IT9 E;  1R4Q B;  2RBM A;  2F0L A;  1B3A A;  2K28 A;  4I65 A;  4G4K A;  3NK9 A;  3OOC A;  3GTO B;  3IFD A;  1SBB B;  4CJ1 B;  1A3V A;  4B08 A;  2NN6 H;  2BCO A;  4IZ8 A;  1C48 A;  2PW7 A;  1LTI D;  1PXU A;  2K5W A;  3P75 A;  4CKB A;  1ONL A;  4HAE A;  3W3A A;  1EWC A;  1J9O A;  1PFM A;  3HOW B;  5IGB A;  4HED A;  3EQL C;  4ZK9 B;  1HXY D;  3H91 A;  3IKJ A;  2CW0 C;  1U9R A;  1SNO A;  2KVM A;  5IGD A;  1D1I A;  5FLX E;  3TP8 A;  3AMU A;  2EE1 A;  1EY0 A;  2NVT B;  4RHR A;  1FD7 D;  4H0L C;  1HFN A;  1LT5 D;  2Z8L A;  4BY1 B;  1R9T B;  3M4Y A;  2L12 A;  4G57 A;  1F2L A;  3MXU A;  3GTL B;  4A3B B;  3MTS A;  3L3O C;  1II3 A;  2VB2 X;  4ZUJ A;  4BBS B;  3FVQ A;  2CW0 D;  1XXG A;  3IFT A;  2Y0S B;  3H3V C;  2CVR A;  4CJ2 C;  4TKO B;  1WTP A;  2IX3 A;  3M7N A;  3DUZ A;  2ICI A;  4IUU A;  2R6G A;  3ZYY X;  5ELF A;  3S15 B;  1QB5 D;  4CBV A;  1JWM D;  3A56 A;  4KD4 A;  4IN3 A;  4YIJ A;  2EXZ A;  1MBY A;  4RFB A;  1BCP C;  2F0V A;  2H4O A;  2QKI C;  1EY7 A;  3BVZ A;  2RVL A;  1TS4 A;  1S5C D;  1DJR D;  1AZQ A;  1EQV A;  3VR4 A;  1BBX C;  4IUV A;  1GUO A;  4K5X A;  5COR A;  1NSN S;  3DEO A;  2E74 C;  4KD3 A;  4CKC A;  4HSV A;  1ZYR D;  1BQQ T;  1GUG A;  3A55 A;  1AN8 A;  3S1Q B;  1I4Q A;  5I2Y A;  3GTJ B;  2K03 A;  1I6H B;  2B2T C;  4XT1 B;  4ULL A;  5IGC A;  5EKI A;  1WD0 A;  1V8Q A;  3GV3 A;  1A3U A;  1EYC A;  1EU4 A;  1CHP D;  4OL7 A;  3FPU B;  2IW3 A;  3NQI A;  5DEH A;  3C46 A;  1Z47 A;  4OIJ A;  4WFN 3;  1PRT B;  2KCC A;  3KUP A;  1I3Q B;  2L5T A;  4C3I B;  1G6Z A;  4QCL A;  2OF1 A;  4AYB B;  1IKM A;  1Y1V B;  3AB9 A;  3QOL A;  2B2W C;  4EGV A;  1F77 A;  2KA7 A;  3V05 A;  4PV1 C;  2R93 B;  2EYF A;  2B8F A;  2A69 D;  3BDL A;  3NHH A;  5K36 H;  3TDQ A;  5NUC A;  3KLS X;  5D3D A;  3J7Y W;  4RGM A;  1EWH A;  4A3J B;  1H9M A;  2AUK A;  2EY1 A;  3GTK B;  1IYV A;  3C3L A;  1IL8 A;  2WIN B;  5C3W A;  4IUR A;  3Q23 A;  1T5X D;  5EJW A;  4ZQ3 A;  1QIL A;  1TS5 A;  1G8Z D;  2NZ1 D;  1ZKO A;  1SYD A;  1ET9 A;  2RQX A;  1F2Y A;  4A3I B;  3T4A C;  3T13 A;  1KAB A;  4OO1 G;  3ND9 A;  4G7Z C;  4NP5 A;  4XT3 B;  5KND A;  2JXM B;  5M3M B;  1BF4 A;  5CMD A;  5K36 G;  2PNR C;  4DXG A;  3R2I A;  3OSO A;  2MGS A;  5E3F A;  3L9A X;  2NVQ B;  2JA5 B;  2AWN A;  3MWY W;  1IHZ A;  3V2T A;  3Q24 A;  2O4X A;  4KMU C;  3HEJ A;  1H9K A;  1GXD C;  2EY5 A;  4HN7 A;  2NBF A;  4RGT A;  1D6E C;  3HGB A;  1TY2 A;  3BVM A;  2F0T A;  3N6R A;  3SK6 A;  1SYF A;  3I4M B;  3RLF A;  2L0C A;  2WP8 J;  4HCE A;  1Q90 A;  5F2D A;  3C1E A;  3E0J A;  1E2V A;  1STG A;  4K8J A;  1KTK A;  2NWG A;  4X3T A;  1Z6H A;  3DM1 A;  2SNS A;  3GTM B;  1G2S A;  3D4D A;  4HSP A;  4OGQ C;  4TQU S;  4IAL A;  5FO8 B;  1RF2 D;  2MHV A;  2OT2 A;  3PIP 3;  3CQZ B;  4JBW A;  5CYU A;  3RMH A;  4JK1 C;  2E76 C;  4NW2 A;  1PFN A;  5EBC A;  3MZ5 A;  3M3Y B;  2OEO A;  4RKL A;  2EYJ A;  5ELE A;  1X3P A;  4QIW B;  3X3N A;  4M8A A;  4DNR B;  3G6J B;  5COY A;  3GD7 A;  2DNE A;  4CKE A;  4IFD H;  2F3W A;  1CTM A;  1SE3 A;  2H1E A;  5E1F A;  1Z7T A;  4KN7 C;  3J81 E;  3HOX B;  4J8Q A;  1X3Q A;  2KEC A;  3GQB A;  3VR2 A;  2FHT A;  4RCN A;  1PTO C;  2JA7 B;  2A6H C;  2PZT A;  1JC7 A;  3GV6 A;  3PUZ A;  2JA8 B;  5HUR A;  5KYI A;  3MFG A;  3NE5 B;  2Z1C A;  2J4X A;  1TVX A;  1NCV A;  4R9W A;  1M4V A;  2F0H A;  4IUN A;  1C8C A;  3J80 L;  1LT4 D;  3N52 A;  4EQN A;  2AWO A;  2R61 A;  1B50 A;  3K58 A;  4NDX A;  1TWC B;  1SE4 A;  4OHJ A;  1BXT A;  2F0G A;  3IAY A;  3D6C A;  1PTO D;  5HGT A;  2A6H D;  1E2W A;  1EY8 A;  4A3E B;  1GHK A;  3SK8 A;  1ENC A;  3K5L A;  1BCP B;  3PUY A;  4IFD G;  3K0Y A;  2I46 A;  4BA1 I;  3MHB A;  1PYW D;  4BS9 A;  3VR6 A;  2KQ3 A;  4KKS A;  1MSH A;  4Q0F A;  1KNE A;  2IT1 A;  3OIQ A;  4ID6 A;  1IW7 C;  5C4Z A;  3AU7 A;  2KED A;  3MA2 B;  4QB4 A;  4S3S A;  5IIF A;  2RA4 A;  1OXT A;  5IGG A;  5JPM C;  3T53 B;  3LWU A;  3M85 A;  1SSO A;  3BYY B;  4Y7N B;  1VMP A;  2AQ3 B;  3SXH A;  1LO5 D;  5I4D A;  4K8I A;  3F2U A;  1DOL A;  2A68 C;  4XDX A;  3J80 E;  2XWJ B;  2F0Q A;  1IW7 D;  4LK1 C;  2K5Q A;  1PRT F;  1BNZ A;  1V1P B;  1MGS A;  4H13 C;  4FF4 A;  5ELD A;  4OIK A;  1L0X B;  2KJX A;  1V1P A;  2K01 A;  3A54 A;  3ONA B;  2B2Y C;  2EJF C;  1FR3 A;  4C1N I;  1EY5 A;  2Z4H A;  4FVM A;  1NAP A;  1PZJ D;  3U9O A;  1QCB D;  2A68 D;  1EQT A;  4DNT B;  2M9V A;  1SYG A;  1OXU A;  2B2W A;  4FO2 A;  1SE2 A;  1SNP A;  4K6D A;  2LKV A;  3KK7 A;  1SJH D;  1UAP A;  1SFO B;  3VYS A;  4K5W A;  5EPL A;  3TP6 A;  2WII B;  1WD1 A;  2QIL A;  1STE A;  2KEE A;  1STB A;  3TSS A;  3PV0 A;  1EEI D;  1TWG B;  1E2Z A;  1YNN C;  3VYT A;  3I70 A;  2K33 A;  3JAM L;  3FMC A;  4KI0 A;  4LJZ C;  1OXV A;  2ICE C;  2HDL A;  4G7H C;  1WTO A;  4FP5 D;  1K83 B;  3HOY B;  3K7A B;  1M8A A;  3S1M B;  4MHE A;  5FO7 B;  4ZYS A;  4IUT A;  3NBH A;  3SEB A;  2Q8T A;  1UEA B;  2XIW A;  2QDB A;  5CV6 A;  2NN6 G;  3VR3 A;  1YNN D;  2NVX B;  2A6E C;  2N55 A;  3CU7 A;  2A73 B;  1V1O A;  3NWT A;  5M5X B;  1DCZ A;  2EY6 A;  1XTC D;  2X6G A;  1WTQ A;  3DXJ C;  1GUT A;  1F2Z A;  5JVG 3;  4QF4 A;  1LTB D;  1I6V C;  1EY6 A;  2XRS D;  4A3F B;  3Q22 A;  1H9J A;  5CV4 A;  1CHQ D;  1STN A;  1Q1B A;  3TP5 A;  3MXG A;  1SYE A;  2BDO A;  4HCS A;  4DF7 A;  4RGO S;  5C4X B;  3KLS A;  3MAQ A;  5C0X H;  1PLF A;  1PZI D;  2A6E D;  3NP8 A;  1BCP D;  1AFP A;  3CHB D;  4A3D B;  1UNS A;  2LFN A;  5LHY 1;  4X3S A;  1TQO A;  5TSS A;  2X6L A;  3HRZ C;  5M5W B;  4DN4 M;  1I4G A;  5ELB A;  2IWH A;  2F0M A;  5K5P A;  2XNA C;  1CI3 M;  5CR3 A;  4I7Z C;  4H7B A;  4Z9C B;  3I4N B;  1DOM A;  2KUM A;  1U4R A;  1BOS A;  5DM6 3;  3PO3 B;  1F9Q A;  2DN8 A;  4N9P A;  3VR5 A;  1LT6 D;  2ZT9 C;  1CK1 A;  2K04 A;  3H0G B;  3QG1 A;  3NWS A;  3TME A;  2J7Z A;  4KHV A;  2TMP A;  5CV8 A;  2IPK D;  4DAY A;  1BUV T;  1QOH A;  1TS2 A;  3QIA A;  1W6K A;  3FKI B;  5E4W C;  5G3L D;  4UDU C;  3CRK C;  2CHB D;  3HOU B;  3GTP B;  1LTA D;  2N88 A;  1XX8 A;  4PMC A;  3H6M A;  2B63 B;  1RCV D;  5C0X G;  4IQZ A;  3D4R A;  3S1N B;  1C4Q A;  2WKC A;  3RUZ A;  1SND A;  2PYK A;  5I9O A;  1PTO B;  1H9R A;  3R93 A;  4XQQ A;  1EY4 A;  1ESF A;  1ROD A;  3EFX D;  2M2L A;  3S2H B;  1O7Y A;  4C3J B;  4G7O C;  2EPB A;  5EGT A;  1GHJ A;  1QWY A;  4A93 B;  3E5S A;  1SEB D;  3BYT B;  4DGZ A;  1FNW A;  2F0I A;  1STY A;  4TSS A;  2NYZ D;  3KBG A;  3BS1 A;  5JEA H;  3S1R B;  3NTI A;  1GUW A;  2EYP A;  1QNU A;  1JOR A;  3SHL A;  3O13 A;  4RAU C;  5I9P A;  3NSW A;  3KF8 A;  1EYA A;  1BCP F;  4J6H A;  1XYI A;  1E0B A;  1ILQ A;  5BN3 A;  1KNA A;  3BDC A;  1EL0 A;  5A2Q L;  2MJ8 A;  1A6X A;  5J1Z A;  2F0W A;  3TN2 A;  1AW7 A;  3K59 A;  4FF2 A;  2JYO A;  2K05 A;  2QCP X;  5C4J B;  4K5V A;  3EA6 A;  4A3K B;  4V19 0;  3E6Z X;  2NB0 A;  2RDG A;  2F1M A;  4BWG B;  1BDO A;  3NQT A;  4P2C B;  4A3M B;  2SEB D;  4WOR A;  4RGN A;  4ILW A;  2YYZ A;  2PO4 A;  3A7A B;  1HPC A;  3VA7 A;  1U4P A;  2I07 B;  1BO0 A;  3OWF A;  1D5X C;  2MPM A;  4IFD J;  4PNY A;  4OO1 I;  2F0N A;  2ID0 A;  5G3L F;  1SAP A;  1LTT D;  1ML0 D;  1S5F D;  2LY7 A;  1F9S A;  3VYU A;  1O7Z A;  3QB3 A;  1U4L A;  5IOD A;  3G7L A;  5EPK A;  3K6O A;  4KKT A;  2IX1 A;  1D5Z C;  3DWQ A;  2FJ2 A;  2VUM B;  2GA4 B;  1D2B A;  1G29 1;  1XWE A;  1ENF A;  3MVV A;  2RSO A;  3MEH A;  3OMG A;  2RDH A;  5FKA C;  4K6L A;  1HUM A;  1K8O A;  1SYB A;  4M1U B;  3OMC A;  2LMC B;  5AFW A;  2D9U A;  2B2Y A;  4F87 A;  1KDA A;  4HR7 B;  3WDN A;  4F7X A;  2PMZ B;  4DA2 A;  1Y1W B;  2O2L D;  4U67 3;  4F8M A;  2K7V A;  3Q6S A;  2WAQ B;  2JEB I;  4HTH A;  2FMC A;  3RD4 A;  4NKL A;  2F0K A;  2B39 A;  2A5H A;  3ITP A;  3NPP A;  1ILP A;  1VDZ A;  1CZW A;  2Q8I B;  1MSG A;  5JAV A;  5D3I B;  1T5E A;  2IJ0 A;  3S14 B;  5FOB B;  2K5D A;  1STA A;  3CRL C;  1G91 A;  2D2C C;  3I3C A;  5I2X A;  1WTV A;  3K5M A;  5I6Y A;  2Q8R E;  4C3I G;  2F0S A;  3SDZ A;  3DHQ A;  1GUS A;  4WJW A;  2O5J C;  1SXT A;  4KHZ A;  1PZK D;  3HOV B;  5JPN C;  1WVL A;  5LL6 S;  1CQF A;  4K2K A;  1B44 D;  1KLG D;  2AQ1 B;  5C4H A;  3M7G A;  1HHV A;  2SNM A;  1DZ1 A;  1HA6 A;  1SNM A;  4FXK C;  4C56 C;  3CKI B;  2L9H A;  1SDF A;  1JWS D;  4N9T A;  4K14 A;  1NR4 A;  3TZD A;  3URY A;  1OXS C;  5T1G A;  1EEF D;  4XIG S;  5DNF A;  3QO2 A;  1MD2 D;  3TBI B;  5KYL A;  1ESR A;  5KGU A;  4RKB A;  2M00 A;  1RD9 D;  1O7L A;  1RHP A;  1JOQ A;  3VA5 A;  1B9M A;  4ZAI A;  4ODG A;  3I73 A;  3P20 A;  2XWB B;  3UI2 A;  2E2J B;  1SMY C;  2HCC A;  3L7Z C;  1X32 A;  3HP3 A;  1NR2 A;  4XQJ A;  5ISR A;  3DWA A;  4PMB A;  3A8I E;  1EZ6 A;  3D6W A;  1TT2 A;  2NVY B;  5IT9 L;  2R7Z B;  3K5N A;  4MIU A;  1PDQ A;  5IOC A;  2WB1 B;  4C3H G;  2O5I C;  3C1F A;  4TRD A;  1D1K A;  3R2T A;  3J7A V;  3PUX A;  3D31 A;  4U68 A;  4NMZ A;  1SNC A;  2DY8 A;  5M3F B;  4IFD I;  5JOB A;  4KJN A;  1GOZ A;  5FK9 C;  2B2U A;  1SMY D;  5C6A A;  5CV7 A;  1WTW A;  1TS3 A;  3WOF A;  5FLX L;  3KLR A;  5ELC A;  1ZEQ X;  1F9R A;  2K32 A;  1I4R A;  3FPP A;  2F3V A;  2JP1 A;  2L4N A;  1CA5 A;  1CA6 A;  4XYO A;  1S5E D;  5IGF A;  3OW7 A;  3D8G A;  2MP1 A;  1RTN A;  4FYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...