5IGFA

Crystal structure of staphylococcal nuclease variant delta+phs t62h/v66d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMDQNAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H/V66D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igfA00
2EY6A 4KD4A 5JAVA 4F8MA 5DAUA 3NHHA 2PZWA 5C4ZA 5HURA 1F2ZA 3T13A 2F0VA 5E1FA 5NUCA 1SYDA 2EYFA 3MXPA 1F2YA 3EROA 2SNMA 1IHZA 3NP8A 3OMCA 3P1HA 5IGFA 5KYLA 4IUNA 5I9OA 3NUCA 4K14A 4KY6A 3D8GA 5DEHA 1KDAA 4WRDA 5F2DA 3TP7A 3SHLA 2SNSA 5IGDA 3NQTA 1EY4A 2EYMA 5I9PA 1TQOA 5C3WA 2PYKA 1EY8A 2QDBA 3LX0A 3QB3A 4KY5A 4DF7A 4IALA 2F0JA 2SOBA 4HMIA 5C3XA 3SK6A 1STAA 1JOKA 3SK4A 1SYBA 2OXPA 5C5MA 1A2UA 1SYGA 1NUCA 2KHSA 3SR1A 3TMEA 3PMFA 4IZ8A 1STNA 5M9OA 3TP6A 1JOQA 2F0SA 4OL7A 4HTHA 4KY7A 4KJOA 4B9WA 4PNYA 1STBA 5KRUA 5KYIA 5KGUA 3OWFA 5HGTA 4NKLA 1SYCA 1EYCA 3EVQA 4K5WA 4DU9A 4KJNA 1STGA 2F0WA 1KAAA 2F0PA 2PW5A 4QF4A 3SK5A 1STHA 3MVVA 5CV9A 5I6WA 1JORA 5EGTA 3HEJA 2RBMA 4K8JA 2EY2A 1KDCA 4KD3A 1NSNS 3D4WA 4H7BA 4NDXA 1ENAA 1F2MA 1U9RA 1EQVA 2KQ3A 5JOBA 3H6MA 5C6AA 4N9PA 1SYFA 4K2LA 5CV6A 1A2TA 2RKSA 3TP8A 4PMBA 4LAAA 5CR3A 3MEHA 4N9TA 2NUCA 1EZ8A 1SNQA 3D4DA 4R8NA 2F0UA 3D6CA 3DMUA 3MHBA 1EY9A 4DFAA 3EJIA 4J1MA 2PW7A 4J6HA 5K5PA 1SNDA 4NMZA 1ENCA 5ISRA 1EY6A 2O4XA 3NXWA 3BDCA 3OMGA 2EXZA 3QOLA 5IODA 4K5VA 2PZUA 4DGZA 3P75A 2M00A 4QMGA 5CV7A 4NP5A 1SNCA 2LKVA 5C4HA 5CGKA 5CV8A 1SNOA 4ME5A 1JOOA 1STYA 2EYHA 3OSOA 3V2TA 2OF1A 3E5SA 3TP5A 4K5XA 1EY5A 4ZUJA 2F0NA 3ITPA 4HMJA 2F0GA 5CV5A 4ZQ3A 5J1ZA 4G57A 5C5LA 2EYOA 2F0QA 4ODGA 3C1FA 2F0DA 4RKLA 5EKLA 1EZ6A 3ERQA 5CV4A 3S9WA 2EYJA 4S3SA 4QB4A 2EY5A 3RUZA 3C1EA 4K6DA 5CC4A 4F7XA 5IIFA 1TR5A 3T16A 1KABA 1II3A 5EKKA 4RKBA 3MZ5A 2F0EA 4EQOA 2F0TA 4KHVA 1TT2A 4K2KA 5IGCA 1SNPA 2F3VA 3U9OA 4KTAA 3HZXA 4EQPA 2HQEA 4ZUIA 2WACA 4PMCA 2F3WA 3DHQA 3QOJA 1RKNA 2F0MA 2F0OA 1SYEA 2ENBA 2RDFA 3BDLA 4WORA 4YIJA 4EVOA 5IGEA 2F0IA 3SK8A 3NK9A 1SNMA 1EYDA 2F0HA 1EY0A 1KDBA 4TRDA 3SXHA 5IGBA 2EYPA 2F0FA 1A3TA 2PQEA 5I6YA 5J22A 2F0KA 3R3OA 1EY7A 5E3FA 2F0LA 2PZTA 1A3UA 3VA5A 4EQNA 5IOCA 4E6IA 2EY1A 4KV6A 5J39A 4MIUA 1A3VA 2OEOA 4ID6A 5IGGA 2EYLA 4B9XA 4K8IA 1AEXA 5KEEA 5KIXA 4I65A 1EYAA
chains in the Genus database with same CATH superfamily
4L5RC 4A93H 3TS0A 5LMNL 3I4MG 4IFDH 2L9HA 3NSWA 3S2DH 3M4YA 4CGYB 2RVLA 2A19A 3OMCA 3PIP3 2RSOA 3KLSA 1PYBA 5CYUA 3J81c 3HOWB 4YCVA 3PUWA 1D8LA 1VQGA 3MFYA 2RA4A 3QB3A 2K32A 1E3PA 4IALA 2SOBA 4HMIA 1Q7YC 2HT1A 3SK4A 1SYBA 5TSSA 2AWNA 4RH6A 3SR1A 3TMEA 4IZ8A 1CK1A 2IHEA 2F0SA 4KJOA 3OWFA 5HGTA 3A54A 4YWKA 4V0BA 4K5WA 4BBRH 2ZJQA 3GTMB 5CMDA 1SN8A 1X32A 3PUVA 1PH6A 1T5XD 3X3MA 3PO2H 2FFKB 3U4VA 4A3IB 1WTOA 3HOYB 1TS4A 3GTJB 4DV6L 1V1PA 2ASBA 1I3QH 3TP8A 2KCNA 2R7ZB 3HKZG 2R92G 4XDXA 3OW7A 1SMYD 1STEA 4H44C 4LFBQ 4DR4L 4KKTA 2VQFQ 1QVCA 3OMGA 3PF4A 1E2VA 1SLJA 1G8ZD 2A6HD 4NP5A 2UUAL 3HKSA 2DNEA 3KF6B 4CJ2C 4HMJA 1U4LA 4PQXA 2EVBA 3T51B 4DV0Q 4ULLA 4DR5Q 4LUOA 1ZYRC 2G9HD 1ET6A 2R93G 2Z6KC 5J3BA 3VYRA 3A7AB 4OGQC 5IP9G 1NCVA 1T5EA 3CF5A 5ELNA 5FLXc 3W1BA 2F0OA 4WORA 2CWAA 1PRTD 1CHQD 3LGJA 4B3RL 3HOVB 1WVLA 1NR4A 1QG7A 4LF8Q 4GS3A 1Z7TA 4K0KQ 4RCOA 2QEJC 2YTYA 1VQKA 3IFDA 1J6QA 1Y1VH 4OO1H 1MIUA 2A1AA 2VY3A 4HIMA 3F2BA 1ILPA 5DAUA 1F2ZA 1K8MA 4C3HG 4IUUA 3ONAB 2EYFA 2UUBQ 1HTLD 3K5OA 1HUMA 2ICEC 3OIPA 1N34Q 1NE3A 3I4OA 4A3EG 1GM5A 3MA2B 1UEBA 3LX0A 2OT2A 3SK6A 4B3TL 4GKJQ 1VQHA 4R9WA 1JOKA 5IT9c 4DV4L 2JA6B 3H91A 1NUCA 5M9OA 3TP6A 2IHFA 2DGYA 3K57A 5HY6A 2CH4W 1RF2D 3BS1A 1DM0B 1IKMA 3EVQA 1GUGA 1QILA 2WAQB 1STGA 4IURA 4DV5L 1KAAA 1RCVD 1E1OA 2PI2A 1N32L 1JORA 1PRTB 4IN3A 1PFSA 1SXTA 3VDYA 1NSNS 2ZXOA 2MO1A 4NDXA 1CKNB 3Q8DA 2XWBB 3TN2A 3TRZA 4DK3C 3OIQA 4R1JA 2WP8J 2VQEQ 1BBUA 1GVPA 2B63B 4DV3Q 2HUGA 3EJIA 3J80L 4QIWB 3GV3A 2X6GA 4PZ8A 3NXWA 3BZCA 2UU9Q 2EXZA 1HCZA 4DV7L 1QOHA 2ZTDA 1F9QA 1C9OA 5M3FB 2MGSA 3GTGB 2EJFC 4LF6L 2JA8H 5C5LA 1JJCB 1QUQA 1E24A 4XT3B 2YU9B 1KRTA 1ET9A 3Q0AA 4IFDJ 4C56C 4RA8A 1JJGA 2F0EA 4GLAC 1YNXA 4A3JB 1MSHA 3KF8A 2A73B 4KTAA 1KC8C 1Q3LA 1XNQL 2BE5D 5L37A 3CHBD 1JOQA 1JCKB 4KHPL 3JAME 3A56A 2KCCA 4U68A 2HCIA 4OX9Q 1EYGA 4ZAIA 3CPWA 2F0HA 1EWCA 3PV0A 3D6WA 2N78A 1N33Q 1EIFA 2GN5A 3BVZA 1EY7A 1X54A 3R3OA 2F4VL 1XTCD 2X6LA 3I7FA 1A3VA 1GUTA 3KK7A 1BCPD 1XMOQ 1SMYC 3D0FA 4HCEA 1Y1WH 4DK6C 3RLNA 3EROA 4JBMA 5M5XH 3P1HA 3CC4A 4RGNA 4A3FG 4JI6L 1B53A 3GTPB 2SNSA 3NEMA 3NBIA 3T56B 4AH6A 4APVA 3RR5A 2E2HH 3QO2A 4JI3L 4IPCA 4AQYQ 5CORA 4EQ5A 4DKAC 3HOUH 3KF8B 3PMFA 1OXUA 2BOSA 2E5LL 4MN3A 4BXXG 2AUJD 1CA5A 3SEBA 2B8FA 1QJOA 4DU9A 1JJ2A 3I4MH 4JI0Q 3MVVA 4OXPA 1LTGD 3FPUB 2WIIB 4IOCA 4H7BA 1ENAA 2ZXRA 1PRTC 3DEOA 3M4QA 3AFPA 1VQIA 2I5LX 3PIPA 2HD3A 2HDLA 2Z4HA 3KOJA 3CCMA 2YTVA 3L2PA 1MHWC 4J1MA 2E8GA 2XRQD 4Q5VA 4H13C 5KNDA 4A3MG 2DY7A 1D1IA 3Q23A 1YNJD 4RMFA 3ZYYX 2MP1A 3CRLC 1CQFA 1IKLA 1GXDC 3E9IA 2J0TD 4JYAQ 3PUZA 2PPBC 2A6ED 5CV5A 4RGMA 4DR7L 2F0QA 1CKOA 1LO5D 1LT4D 1SMXA 4JOIC 4OELB 2JE6I 2Z8LA 3HOXB 1A6XA 2NZOA 1X56A 2CCZA 4KI0A 1CSPA 2JN4A 4OWTB 3Q24A 1ZKOA 3K7AB 2Q2TA 2N3SA 3UE0A 4QCLA 1VQAA 5A35A 3VR2A 4PZ6A 1G51A 1DOLA 1UE1A 1HR0W 2I5MX 4R4TA 3EBEA 3IKJA 4P2CB 4A93B 4OO1I 1LTBD 2NBFA 1YJ9A 3GTQH 4TRDA 3H3VH 2RHQB 2WFWA 3S2DB 2B39A 3PQIA 1A3UA 4GNXB 1HR0L 3ND8A 2XRSD 2EYLA 4GOPA 2Z9HA 5CV7A 4BY7G 4ZKBB 3PO3G 3T13A 2R93H 5JJIA 3I3CA 3JAMi 3HOZB 1IBMQ 4LF4Q 5FO8B 1L0WA 2CWPA 3W1GA 5I9PA 3LWEA 4QL5A 4BBRB 1IBKQ 4AYBG 1W6JA 3UI2A 1B3QA 2OXPA 4DAYA 1NMGA 1VQLA 3PO2B 4CKCA 5C0XG 2KHSA 3H15A 3RZDH 1TVXA 4N8FA 3G48A 4TSSA 4OL7A 4HTHA 4DUZQ 3EFXD 1I3QB 4KHZA 1LV9A 2EE1A 1DONA 2B3GA 3NWTA 4C3HH 2PMZE 1JE5A 1XNRL 2PQAA 4NXMQ 2E2IB 3FKIG 2J4XA 2SDFA 1D5ZC 1FJGQ 2AQ2B 4A3EH 2AQ3B 4R8NA 2K50A 1B4OA 5C4XG 2MJ8A 1LACA 4A3DH 4LFAL 1IL2A 3E6ZX 1ICFB 2RCNA 1V43A 1BCPC 5C44H 5T1IA 2JEBI 3NTIA 5IODA 1QWYA 3A8IE 4JVZA 4DGZA 3AYHB 4QMGA 1WTPA 1AZPA 4ME3A 2XTIA 1WD1A 1CTMA 1Q8IA 2XWJB 4B3MQ 3I4NG 3TQYA 3OWEB 4R4QA 4LF7Q 2A74C 3MFGA 3ITPA 4ZQ3A 2UXBL 1S72A 4LW1A 3H0GG 1KL9A 5EQ0A 4RGTA 2KJXA 4K6DA 1YITA 1I6HH 4CDDC 1XWEA 1LLRD 4F7XA 1BQQT 4X64L 1F9RA 5M3MH 2F0TA 2UXCQ 1TT2A 3TEHB 1FL0A 1TY0A 2HQEA 2ZM6L 3W2DA 1HNXL 2K5DA 2F0IA 4CKBA 1VF5C 5GQOA 1VQEA 3FDTA 5DNFA 1LTID 2EYPA 5IGBA 1EIYB 4HIDA 4FDBA 3UDIA 4KV6A 1PH1A 5JEAH 3D4RA 3HGBA 1WI5A 1KHIA 4DV1Q 4GNXC 2Z4IA 1F77A 1OXTA 1PV4A 4O42A 2XVSA 5EAYA 3CCRA 1C7YA 3FRPB 4R8IA 4G7HC 2EDGA 3N52A 1PZJD 1YBYA 4IJLA 4HJ5A 1I94L 4DUYQ 3J7A5 4X3KA 1WTVA 1OXSC 1MSGA 2H1EA 4DPGA 5K36G 3GTKH 1HJPA 1SE2A 1MJCA 3MEFA 2JP1A 3FEWX 1YIJA 1EU3A 1U4PA 1LT5D 2LXKA 5IWAQ 3M9BA 4A3GG 5I6WA 5E4WC 3R2IA 4JI5L 1JR0D 1RODA 3VYSA 4A3FH 4N8X1 3BYYB 1TIID 3OW2A 3NQIA 3MEHA 4PG3A 5ELOA 4DR3L 1SNQA 2O5JC 4EGVA 4PMWA 3CKIB 1ZYRD 2JA8B 3KLRA 3I8ZA 4NXNQ 4BXXH 1PFMA 5JPNC 3QOLA 1VQFA 3SE0A 4DAMA 1SNCA 3ND9A 1E22A 3VR5A 4K5XA 4KMUC 2HHHL 4UPAA 4JI7L 2K5VA 2LFNA 5BN5A 1JICA 3C1FA 2QCPX 4OHJA 5JJLA 3F2DA 2HIVA 3TS2A 1B44D 1TWCH 5IIFA 2K5NA 5GROA 1U5KA 4QGUA 1HRJA 1YVCA 4EQOA 5C4JH 4K2KA 1GUOA 5IGCA 5JVH3 3H3VI 1EU4A 5LMUQ 3J81E 2KBNA 3BDLA 4AYBE 4X62Q 4LMQD 5G3LD 1SBBB 3S14H 1D6EC 1SR3A 1I4GA 1HNWL 1Y1WB 1QB5D 4C1NK 1R4PB 5I6YA 2F0LA 3A7LA 1B9NA 4RWSC 5M5XB 1Q81C 1CI3M 1DXMA 1KLGD 3E0JA 2IL8A 1GOZA 3S1NH 4DR6L 2C35B 1DYQA 2KENA 3NHHA 2ATWA 2E2HB 2CH4A 5FLMH 3C3LA 2UUCL 3T53B 4DV2L 1IBLL 3HOUB 3QIAA 3FHWA 2KCMA 1N36Q 3I4MB 1AZQA 5LMNW 2LS01 1BBWA 1Y8NB 1FGUA 4C3JH 2ZJRA 4JI4Q 4RGOS 2XSCA 3D31A 1I5FA 4BY7H 5D65A 4KJNA 5BR8Q 2C5CA 5IT9L 2LMCB 1PTOH 3HEJA 4BA2I 1Y69U 5ELCA 4IJHA 5ELEA 1R9TH 5CV6A 2JXMB 4BA1I 1PDQA 3CP0A 1XMQQ 3AU7A 1EEID 3D6CA 5GAHC 3KF6A 2F4IA 1ENCA 5C0XH 1OO9B 2RHSB 1YJWA 4CDCC 3KUPA 3URYA 5FLXE 3OTOL 2P5ZX 4ME5A 3RMHA 3OSOA 2ZJPA 1V8QA 4L5QA 2OF1A 3E5SA 2Q8IB 1PH5A 2NVQH 4R4CA 2N88A 1MD2D 5LMNQ 3FKIH 3HP3A 2L12A 3IAYA 5JEAJ 4S3SA 4HIOA 4F87A 5CC4A 1TR5A 1KABA 1WOCA 1LT3D 5I4DA 4HIKA 2QGQA 3GTLB 1QVFA 3GTQB 1P8LA 3U58A 2NVXH 3S1MH 1EEFD 1HA5A 2I46A 3HZXA 2QEXA 2B2TA 3A8KE 4JI8L 4MTNA 2WB1E 4IPDA 2MHVA 1SNMA 4LUZA 1D2BA 4RHSA 1S3OA 1C0AA 4JBKA 2R93B 2HDMA 2HQLA 3VA5A 4A3IG 1Q82C 2K5QA 2PZTA 5LL6X 3H0GH 2EY1A 3HOYG 2OEOA 1ESFA 3TDQA 1HQMC 3BVMA 1FNUA 3DUZA 4L5TA 3UDGA 2BDNA 1EYAA 4DV6Q 1AE3A 4K0KL 2OCEA 1TWGH 4MZ9A 3J81i 1F2YA 3UDFA 5JJZA 3F1ZA 3QJYA 1VQBA 3RZDB 3SHLA 4I7ZC 1CM9A 4DR4Q 1SDFA 2D0OA 3WDNA 1WTHA 4DR1L 1WTWA 4C3HB 1NAPA 5C5MA 2IT1A 5DM73 2UUAQ 1CKNA 1OTCA 3GTOH 4KY7A 1RTNA 1G291 4PV1C 3CCUA 4A3EB 3AMUA 1CSQA 2EIFA 3IRBA 3DEPA 3GV6A 4QF4A 4DN4M 1AN8A 3PF5A 1K0RA 1A62A 5EGTA 3ICEA 4FXDA 2B2YC 4A3DB 2Q8TA 4A3KH 1EQVA 5C44B 4JCVE 1V1OA 3BZDB 1TWAH 4N9TA 1VF7A 4YCWA 5EPKA 4DFAA 4EX5A 3MTSA 2OTJA 4JOIA 4OWWB 2JSOA 5EPLA 4B3RQ 2DNCA 2AUKA 1B7YB 3GO5A 4JPBW 3V2TA 1STYA 2JA7G 4A3GH 1I6HB 4HJ8A 3UE1A 4OIJA 4ZUJA 5M3MB 1X3QA 2CHBD 3J81j 4FF4A 4RCNA 4A3CG 1ML0D 1ILQA 2FMMA 5EJWA 1PH2A 3C46A 4CKEA 4KK7A 2EY5A 1TS2A 5E7NA 3M4OH 4MTKA 4C3IG 1GUSA 4LF5L 4X66L 1D7QA 2K7VA 5IYDG 2QF7A 5FO9B 3DWQA 2F3VA 4B3TQ 2VUMH 2PMZB 2WACA 4DV4Q 4EVOA 5C3EH 3H94A 1JQYD 1O7YA 5J22A 2A8VA 1VQMA 3MXNB 2CVRA 4DV5Q 3N6RA 1QCBD 5IYCH 1N32Q 1NBWA 4OX9L 4B9XA 3E9HA 5KIXA 4A3BH 1N8RC 1GUNA 2PZWA 1Y14B 2NVTH 2E74C 2B63G 2ZTCA 3J7YW 2FJ2A 4XT1B 4TKOB 4JI1L 2ZT9C 4UY8C 1MI2A 4O2DA 3NUCA 4KY6A 1XMOL 4UP7A 5IGDA 3S17H 4JBJA 1IZ6A 1YHQA 3GTKB 1TQOA 2XIWA 3AB9A 1KRSA 2KEEA 1CHPD 5FK9C 4DNRB 1AFPA 4JBWA 4XYOA 4DV7Q 2R61A 1SYGA 2E76C 2NVYH 1BUVT 5AJ3L 3FMCA 1KLUD 3BVGA 2O5IC 2DY8A 1KAWA 4A3FB 4LF6Q 4KN7C 1PZID 4LFCL 1EYCA 2I07B 2B2TC 1WFQA 3T1HL 1PHJA 3T4AC 3HKZE 3J80E 4FF2A 2EJGC 4JI2L 1XX8A 4BY1B 1EQTA 5C0XI 2QW7A 4NPSA 4DR2L 1XNQQ 2F0UA 4R4OA 1EY9A 3U9SA 4KHPQ 1TXYA 2KVMA 2R7DA 4YY3L 1X3GA 4XYQA 1PYSB 3S24A 1UE5A 3WOFA 1BO0A 4ZCKA 2F4VQ 3NTHA 2B29A 1G6ZA 5CGKA 2MNAA 1A15A 3BJUA 1HZCA 1TWCB 2F0NA 4XQJA 1CUKA 4FXKC 5C4JB 4GZYC 3ERQA 1CKMA 1VQ4A 5D3IB 1UNSA 1Q1EA 4JI6Q 3OOCA 2OQKA 1UE7A 2B8GA 4BBSG 5IYBG 3I55A 5JJKA 3M3YH 1GO3E 2MO0A 1SNPA 4GNXA 3CCEA 2GVBA 1MBYA 4JI3Q 4OEMB 1K0SA 2A68C 1S5CD 1RKNA 4YIJA 3JAMc 1LUZA 1PXUA 3S1NB 2E5LQ 3S15H 4V190 5JPMC 2LSSA 3SXHA 2PQEA 4O1NA 5DLQE 3J7ZC 5CBEE 4E6IA 1G91A 2CQAA 1XTDA 2R92H 3F8TA 3E3XA 1QE6A 1I6VC 3AQQA 4F8MA 2B2VA 4B3SL 3FP9A 2VNUD 1B8AA 5E1FA 3CMEA 4X65L 1I4PA 1M8AA 1VQOA 3CCVA 1U4MA 4C3JB 3KDFB 2K75A 3K5NA 3DLLA 3CCJA 3TZDA 4GN4B 4KY5A 4KKUA 4BY7B 4DF7A 2KHIA 2AKWB 2F0JA 1IW7D 1SE3A 1H9SA 3AFQA 4MNOA 1PTOB 3ZJYC 2LXJA 2O2LD 2VW9A 1R9TB 4B9WA 2F1MA 1STBA 3HFZB 2UXDL 3KFUA 2EOTA 3CRKC 5FJ8G 4DR7Q 3GP7A 1VMCA 1F2LA 1E0BA 1M90C 4A4IA 5CV9A 4AYBB 3PUYA 5IP9H 2EXDA 1L2FA 1U9RA 3CXCA 5JOBA 1CZWA 3H6MA 1FNVA 4N9PA 2ID0A 2QDLA 4PMBA 1GKHA 1Q90A 3QG1A 3DMUA 3S16H 1WTQA 2E2DC 1ZXTA 5K5PA 4POGA 1QZGA 1K8AC 2NVQB 3RLFA 2WKCA 3BDCA 3FKIB 1UUPA 3EN2A 4F88A 4P73A 5GADC 3J80i 5C4HA 2A69C 1B3AA 5HGQA 1HR0Q 4G7OC 1JOOA 2EYHA 4OONA 1H9SB 4H02A 1SRUA 1WYDA 4B08A 3NTKA 3UDXA 1AE2A 1E7ZA 3S1MB 1X65A 3HOZG 2B2WA 2MFIA 3S9WA 3G71A 2I5HA 1I50H 1DZ1A 1Q1BA 1PYWD 2IPKD 1M4VA 4BBRG 1F9PA 2AQ1B 1E2WA 4X3TA 1HXYD 4FP5D 4IPHA 2GVAA 3H0GB 2K33A 1XPUA 4G7ZC 2JA7H 1HTPA 4KLKA 4MHEA 3WOEA 2IY5B 1S5ED 1TWGB 2MUYA 2BH8A 4P74A 3A74A 4ID6A 1YHBA 2ZTEA 3RN2A 1MJEA 1XNRQ 2JK8A 5KEEA 4I65A 1RL2A 1V9PA 2PI2E 4C3IH 2EY6A 1WTRA 2XN9C 4GN5A 1PA6A 5HURA 3L0OA 5IYDH 1UWVA 4QUFA 2Y0SG 4J15A 3Q22A 1X6OA 4LFAQ 5KGUA 1Y1VB 1PH9A 3DXJC 2IX3A 3GTOB 3NQTA 2NN6G 1EY8A 3CW2C 1FR3A 1SJHD 2M2LA 5DM63 3VR4A 1EOTA 4A3KB 1YNND 2IW3A 4FO2A 1VQ5A 2GA4B 4P75A 2RSNA 1KQSA 3V96A 1I4XA 1TWAB 2F0PA 1STHA 1IYJB 2WB1B 2RBMA 5EKIA 3ULLA 2R7FA 4X64Q 1H9MA 1EFWA 1A2TA 2RKSA 3BG3A 4P72A 3P20A 3KBXA 2ZM6Q 5M5WH 1FYCA 3KJOA 4C2MH 1HNXQ 2PW7A 4A3GB 1Y8PB 2B2VC 1SNDA 3R2TA 4JV5L 4K5VA 3BU2A 3CQZH 1VDZA 3SVMA 5IP7G 1K73C 3M4OB 1SNOA 5LL6S 4DK1A 4IUQA 1VQ6A 1HHVA 2F0DA 3I91A 1EZ6A 1SJED 5CV4A 3S1QH 2VUMB 1IW7C 2EYJA 3RUZA 1Y8OB 1SSOA 5C3EB 3PSIA 2HIXA 2IJ0A 4TQUS 2SEBD 3W5OA 4CJ0B 4RKBA 3MWYW 3CU7A 4KHVA 1WJJA 1Q12A 1I94Q 1ESRA 2K5HA 3W3AA 4DXGA 1UEAB 3V05A 3G4SA 2F3WA 3DHQA 1PH3A 3C2PA 3AEVA 4QJFA 4GKKL 3KLSX 4A3BB 3NK9A 5A2QL 4X6AH 3NBHA 3R93A 1NY4A 1KDBA 2NVTB 1H95A 4FNFA 1ICWA 5LMUL 1X55A 1KIXA 1LABA 1HNZL 5J39A 4LF9L 4CJ1B 4JI5Q 2AWOA 4L63B 1B50A 3S17B 4KD4A 5JAVA 1VQJA 4BBSH 5C4ZA 3K7UC 3TREA 5IYBH 1A8VA 3U50C 4A3MH 1J5EL 2FINB 4DR3Q 1LYLA 5I2YA 4IUPA 4LK1C 3F2UA 2NVYB 4NW2A 2KOLA 3MXGA 2B2WC 1HH2P 1IXRA 3P7JA 2B2YA 4DNIA 1EUJA 1GHJA 5C3XA 1WTXA 1STAA 3RZOH 1DOKA 4YHHL 3T1YQ 3TZUA 2JA5G 3RNUA 3MXUA 5H1SE 3NENA 4K6LA 5KYIA 5KRUA 1HQRD 2HHHQ 4JI7Q 1YZ6A 1SYCA 4NKLA 3NBHB 2VB2X 3KJPA 4BWGB 3PUXA 4WFN3 3CCSA 1KNAA 3EA6A 2KQ3A 5T1GA 2Q2HA 2NUCA 2DUDA 3CCQA 3I70A 3DM3A 4YWLA 1IYVA 1Y1WG 4XIGS 3IL8A 3DM1A 3M85A 1HNWQ 1AH9A 3P75A 3PO3H 4BS9A 2KEDA 2R3ZA 1GD7A 3H09A 3M3YB 3GQBA 1EL0A 2EYOA 4ODGA 3A0JA 3VR3A 3HOUG 1I4HA 5ELDA 2UUCQ 4DV2Q 1IBLQ 1HFNA 3I4LA 4JC0A 2PCFB 2K01A 2Y0SE 4NB3A 3U4ZA 3S15B 1YNNC 1JB3A 5EKKA 1IYUA 1PTOF 3U9OA 4EQPA 1J9OA 3NWSA 3HKZB 1WCMG 2R92B 2BDOA 4Y52H 2K03A 4LFBL 2AMCB 1EYDA 1JC7A 4HN7A 2VQFL 5EBCA 2BH2A 1E2ZA 3G6JB 3K59A 4CDEC 5IE8A 3HOZH 1EOVA 3HOWG 1FNWA 2IX1A 5KNCA 2KA7A 5C4XH 2QILA 2FHTA 1LTAD 5FOBB 1S5FD 1D5XC 1BOSA 2NYZD 5NUCA 4DV0L 2XNAC 1IHZA 4DR5L 2V1CC 5CBAE 3D8GA 1X3EA 1KDAA 3I4NH 2L5TA 2EQSA 4ABNA 1PZKD 3K8AA 2ES2A 2PNHA 3OTOQ 2CW0D 5IT9E 2E2IH 4DA2A 2L15A 2PNRC 2FXQA 2WINB 3ERSX 4L6TB 2KECA 1BR9A 1JWUD 3KLWA 4PNYA 2R7ZG 4LF8L 2M9VA 3PCOB 4GLXA 4M1UB 3RD4A 4DAVA 1TS5A 4TVAB 1BDOA 3S16B 2I0QA 3O13A 1KXLA 1U4RA 2N55A 2E2JH 4CHTB 4ZLTF 5C6AA 2NN6H 2UUBL 2QKIC 1FD7D 1HA6A 1NJIC 4Z9CB 1VQNA 4JI8Q 1JWMD 1N34L 2ICIA 3RN5A 2NTTA 3LNNA 1SEBD 2O4XA 3A8JE 3I2ZA 1V1PB 4A3LG 4GKJL 1A0IA 2A68D 1I50B 5BN4A 5CV8A 1YJNA 1SE4A 4H0LC 3PGZA 1E1TA 1TY2A 1D1KA 2OTLA 4UHVA 1Z47A 1XPRA 2F0GA 4G57A 2IX0A 4IOAA 4RKLA 4ZYSA 2EZVA 1WD0A 4QY7A 3HOVG 4JK1C 1TWFH 2J7ZA 4A76A 3S2HH 3MZ5A 2JA7B 1VQDA 1NMFA 2TMPA 1W6KA 5K36H 1O7ZA 1GHKA 3MXNA 4C1NI 3EQLC 3A5ZB 4Y7NH 4DR1Q 2VQEL 4ZUIA 3BZKA 4DV3L 3J7AV 3QOJA 1CT1D 2RDFA 3K81C 1VQPA 5IP7H 5JVG3 4ZKCB 4HJAA 2CQOA 4C3IB 2UU9L 1K83H 2F0KA 3GDEA 1CZGA 5E3FA 4A3DG 3HG9A 3K58A 5ELFA 5M5YH 4XQNA 3JAML 5C44G 1MGSA 1AEXA 4KN4C 4L5SA 1PH7A 3SGIA 5GAEC 1EQRA 2JA6G 1SYDA 2E75C 3IFTA 2K05A 3H3VC 4IUNA 1EWIA 5F2DA 4CDFC 1LTLA 2D2CC 4IUVA 1K3BC 1YI2A 1EY4A 2WAQG 5C3WA 1F9SA 2PYKA 2RF4A 1HZ9A 1L1OA 4FF3A 4ZRZA 5M3MG 1A2UA 1NTGA 1HUNA 5EPJA 3PIO3 3I72A 1KNEA 3CCLA 1DGSA 1N33L 2K6AA 2D62A 2Z0SA 2L1BA 2A69D 5M5WB 1SE8A 2G9DA 4C2MB 4K8JA 3WWVA 2EY2A 4KD3A 4LF5Q 4X66Q 3CD6A 1KD1C 3STBD 2A5HA 1VQCA 1B70B 3GD7A 5JEAG 1TWHH 1EZ8A 5M3FG 3CQZB 2K28A 2RDHA 4LJZC 5C0XJ 2JA5H 2Q2IA 2DJFC 4FF1A 3BDOA 3SDZA 4AQYL 3S1QB 1JB7A 3DWAA 2D0PA 1SFOH 4DAPA 1L1OB 2MQHA 3TP5A 1FVIA 2HCCA 4A3JG 3MC0B 5J1ZA 4Q0FA 3VR6A 1GJXA 2G5DA 2F03A 1X3PA 4IFDI 4JI0L 3VYTA 2RQXA 4GN3B 4JI1Q 5GAGC 2CW0C 1Q86C 1X9NA 1EIGA 2CFMA 2OWOA 1Q8KA 3CMAA 1TKWB 2NZ1D 4U673 4UP9A 2EJMA 2A6HC 3OYYA 3HS0C 1QUQB 2BA0A 2VXWA 4YCUA 2DN8A 1S5BD 5AJ3Q 2JEAI 3BYTB 4O0AA 2LY7A 4L8JA 4BBSB 4LFCQ 1RD9D 4A3MB 1BNZA 4RG1A 3T1HQ 3KDFA 5FKAC 5IGGA 3S1RH 3CAMA 1K9MC 1C48A 4K8IA 4JYAL 2RCFA 4BY1G 1PTOD 4JI2Q 1A63A 1YHAA 5E4XA 3S14B 2F0VA 1VQ8A 3RZOB 2WKDA 3MXPA 3CPFA 3E0EA 2FMCA 4DR2Q 3NP8A 2JJQA 4JW0A 5I9OA 1BBXC 1S40A 4WRDA 1WCMH 2H4OA 1K8OA 2MPMA 1N9WA 4YY3Q 2N49A 2JQOA 1MKHA 1BCPB 2NTSA 4HR7B 3HOWH 1AW7A 1STNA 2RDGA 2JA9A 4XQQA 2K52A 2VL6A 3SK5A 2NN6I 1AP0A 1KDCA 3J80c 3D4WA 3A55A 1H9RA 4HCSA 3K5MA 5G3LF 1SYFA 4HJ7A 4LAAA 4I7AA 2XGTA 3D4DA 1VQ7A 3GTMH 3PO3B 1BF4A 1PVOA 1O80A 1IBML 4LF4L 4A3IH 1LM0A 4WJWA 4QUCA 2Z1CA 3K6OA 3GTJH 3HOYH 1EY6A 1ZEQX 4HAEA 2C9OA 5FLMG 2R7ZH 1IBKL 1UAPA 1JT8A 1U0LA 2PZUA 3HOXG 2K04A 2M00A 3JC66 4IQZA 4HJ9A 1EY5A 1CQVA 4RFBA 4DUZL 2BCOA 1UE6A 3GTLH 3Q6SA 1ENFA 1L1OC 4B3SQ 4POFA 2D9UA 5EKLA 4C3JG 4ILWA 5ELBA 4X65Q 5FO7B 4NXML 4M8AA 4A93G 3T16A 1LTRD 4IFDG 1H9JA 1II3A 1FJGL 3I73A 3EIVA 2CKZB 3OPOA 4HSPA 1XYIA 2D5DA 1OXVA 2WAQE 4A3LH 4LWCA 1I4RA 2K4KA 2ENBA 5C4XB 1QNUA 5BN3A 2KUMA 2UXDQ 1TU2B 4J8QA 3STBC 1C4QA 1A3TA 1SAPA 2F0FA 2NVXB 1VMPA 4EQNA 1K28A 2L0CA 4IO9A 4LUVA 3G6EA 4B3ML 1O7IA 1QVGA 4RHRA 1PMRA 4HSVA 4LF7L 3I4NB 1SROA 4QIWE 1EFID 4P71A 1PFNA 3J7AF 1LTSD 4A75A 3HOVH 3ULJA 1BKBA 4DXFA 3PO2G 5KYLA 1W3SA 1D5MC 2BE5C 4LNQA 1HPCA 3TP7A 5DEHA 3K80C 4AIMA 4G4KA 1NNXA 2UXCL 2B2UA 4GOPB 1XXGA 3QWNA 2BA1A 4A3CH 5AFWA 3M4PA 1PH4A 1JWSD 1KTKA 3NPPA 2IWHA 2Y0SB 3HRZC 4HEDA 2R6GA 3NELA 2E2JB 4UP8A 1DD2A 2ZXPA 3F2CA 5COYA 2F0WA 2NWGA 2PW5A 4IPGA 4RAUC 1VCIA 2JA6H 1CA6A 1W2BA 4DV1L 2NZHA 1O7LA 3K0XA 4DAYB 4FXGC 4GLVB 4K2LA 4DNTB 3LWUA 4UDUC 2QA4A 1YEZA 3MHBA 1PFBA 1K8GA 2V4DA 1EQQA 1LT6D 5ISRA 2PQAB 4WJ4A 4JG2A 2AHOB 1PTOC 1TS3A 4DUYL 2UXBQ 2OQ0A 4X3UA 4UAIA 2B63H 2LKVA 3PIOA 3G7LA 3A5UA 3L3OC 1V1QA 1PRTF 1TWFB 3S2HB 1O78A 3ULPA 1RIPA 4Y7NB 5IWAL 3M7GA 1Y1VG 4OO1G 4QB4A 3C1EA 5M3FH 1ASZA 2K14A 3GTGH 1FGBD 1C8CA 4X3SA 3DWPA 1K83B 3R8BA 2F3IA 1YNJC 4A3KG 2YU9H 4PMCA 1QNKA 2TSSA 1Z9FA 5M5YB 1DJRD 1B9MA 1JMCA 1B2TA 3SK8A 1LTTD 1BVSA 1Q46A 3M7NA 4NXNL 1HFGA 1EY0A 2A6EC 2YV5A 4A3JH 2NB0A 2EPBA 2WB1G 1H9KA 1RDPD 3J81L 5EBDA 1S4ZA 2F52A 2K1BA 1QZHA 2DJGC 4XTCS 3MAQA 1I4QA 2H5XA 2SNMA 5IGFA 3K0YA 2Q8RE 1G6PA 4K14A 3B6YA 5IY0A 4ALPA 1VQ9A 2EYMA 2Q2UA 2QDBA 4JV5Q 3NE5B 1S5DD 1GUWA 1ONLA 4CBVA 1RJTA 4GOPC 4DK0A 4PZ7A 4R4IA 2PO4A 2L11A 1XJVA 3GTPH 2X69A 4XXEA 4X62L 3I56A 3KBGA 2VUMG 4BY1H 1PH8A 3KYHC 2L55A 3OHXC 1NR2A 5C3EG 2Z6KA 1TWHB 3T1YL 3FPPA 1G2TA 5I2XA 4OWXB 2YTXA 2JA8G 2JA5B 4YWMA 1F2MA 1HZAA 1IL8A 1DOMA 1PLFA 1VS0A 1EWHA 3QR8A 5CR3A 5IYCG 1BXTA 2L4NA 2Z6BA 4A3BG 5D14A 1SFOB 2VZAA 3D3RA 3CC2A 4J6HA 4OIKA 4IUTA 4GKKQ 4NMZA 1ASYA 3L9AX 4WJ3M 1R4QB 1JE4A 2KHJA 1N36L 5D3DA 3CC7A 4KKSA 1XPOA 3X3NA 3VA7A 1HNZQ 3K5LA 4FYDA 2VS1A 4JI4L 4LF9Q 2B2UC 1L0XB 1RHPA 2ALYB 2JYOA 2KCTA 5BR8L 2K5WA 5FLXL 1L0YB 1J5EQ 4FVMA 3L7ZC 1OXXK 5LHY1 1J8IA 3FVQA 2VB3X 3VYUA 1B1ZA 1M1KC 1G2SA 5A2QE 1BCPF 1DCZA 1RTOA 1XMQL 2YYZA 3ER0A 4YHHQ 5FJ8H 3HOXH 2WV6D 1T9HA 2F0MA 3S1RB 1SYEA 1EIHA 5IGEA 1X3FA 1Z6HA 1P16A 4DR6Q 1HZBA 3K7AH 4QQBX 4ZK9B 5KNBA 3RLOA 5IOCA 4MIUA 1K3RA 2N8NA 1CFMA 1WCMB 3I90A 3TSSA 3TBIB
chains in the Genus database with same CATH topology
4IFDH 2L9HA 3NSWA 3M4YA 4CGYB 2RVLA 3OMCA 3PIP3 2RSOA 3KLSA 5CYUA 3HOWB 3PUWA 3MFYA 2RA4A 3QB3A 2K32A 4IALA 2SOBA 4HMIA 3SK4A 1SYBA 5TSSA 2AWNA 4RH6A 3SR1A 3TMEA 4IZ8A 1CK1A 2F0SA 4KJOA 3OWFA 5HGTA 3A54A 4V0BA 4K5WA 3GTMB 5CMDA 1X32A 3PUVA 1T5XD 3X3MA 2FFKB 4A3IB 1WTOA 3HOYB 1TS4A 3GTJB 1V1PA 3TP8A 2KCNA 2R7ZB 4XDXA 3OW7A 1SMYD 1STEA 4H44C 4KKTA 3OMGA 1E2VA 1G8ZD 2A6HD 4NP5A 2DNEA 4CJ2C 4HMJA 1U4LA 4PQXA 2EVBA 3T51B 4ULLA 1ZYRC 2G9HD 1ET6A 3VYRA 3A7AB 4OGQC 1NCVA 1T5EA 2F0OA 4WORA 1PRTD 1CHQD 3HOVB 1WVLA 1NR4A 1QG7A 1Z7TA 4RCOA 2QEJC 3IFDA 4OO1H 1ILPA 5DAUA 1F2ZA 1K8MA 4C3HG 4IUUA 3ONAB 2EYFA 1HTLD 3K5OA 1HUMA 2ICEC 3OIPA 3MA2B 3LX0A 2OT2A 3SK6A 4R9WA 1JOKA 2JA6B 3H91A 1NUCA 5M9OA 3TP6A 3K57A 1RF2D 3BS1A 1DM0B 1IKMA 3EVQA 1GUGA 1QILA 2WAQB 1STGA 4IURA 1KAAA 1RCVD 1JORA 1PRTB 4IN3A 1SXTA 1NSNS 2ZXOA 4NDXA 2XWBB 3TN2A 3OIQA 2WP8J 2B63B 2HUGA 3EJIA 3J80L 4QIWB 3GV3A 2X6GA 3NXWA 2EXZA 1HCZA 1QOHA 1F9QA 5M3FB 2MGSA 3GTGB 2EJFC 5C5LA 4XT3B 2YU9B 1ET9A 3Q0AA 4IFDJ 4C56C 4RA8A 2F0EA 4A3JB 1MSHA 3KF8A 2A73B 4KTAA 1Q3LA 2BE5D 3CHBD 1JOQA 1JCKB 3JAME 3A56A 2KCCA 4U68A 2HCIA 4ZAIA 2F0HA 1EWCA 3PV0A 3D6WA 3R3OA 3BVZA 1EY7A 1XTCD 2X6LA 1A3VA 1GUTA 3KK7A 1BCPD 1SMYC 4HCEA 3EROA 3P1HA 4RGNA 1B53A 3GTPB 2SNSA 3NBIA 3T56B 3QO2A 5CORA 3PMFA 1OXUA 2BOSA 4MN3A 2AUJD 1CA5A 3SEBA 2B8FA 1QJOA 4DU9A 3MVVA 1LTGD 3FPUB 2WIIB 4H7BA 1ENAA 2ZXRA 1PRTC 3DEOA 2HDLA 2Z4HA 4J1MA 2XRQD 4Q5VA 4H13C 5KNDA 2DY7A 1D1IA 3Q23A 1YNJD 3ZYYX 2MP1A 3CRLC 1CQFA 1IKLA 1GXDC 2J0TD 3PUZA 2PPBC 2A6ED 5CV5A 4RGMA 2F0QA 1LO5D 1LT4D 2JE6I 2Z8LA 3HOXB 1A6XA 4KI0A 3Q24A 1ZKOA 3K7AB 4QCLA 5A35A 3VR2A 1DOLA 3IKJA 4P2CB 4A93B 4OO1I 1LTBD 2NBFA 4TRDA 3S2DB 2B39A 1A3UA 3ND8A 2XRSD 2EYLA 5CV7A 4ZKBB 3T13A 3I3CA 3HOZB 5FO8B 5I9PA 3LWEA 4BBRB 1W6JA 3UI2A 2OXPA 4DAYA 3PO2B 4CKCA 5C0XG 2KHSA 1TVXA 4TSSA 4OL7A 4HTHA 3EFXD 1I3QB 4KHZA 1LV9A 2EE1A 1DONA 3NWTA 2E2IB 2J4XA 2SDFA 1D5ZC 2AQ2B 2AQ3B 4R8NA 1B4OA 2MJ8A 1LACA 3E6ZX 1V43A 1BCPC 5T1IA 2JEBI 3NTIA 5IODA 1QWYA 3A8IE 4DGZA 4QMGA 1WTPA 1AZPA 1WD1A 1CTMA 1Q8IA 2XWJB 3OWEB 2A74C 3MFGA 3ITPA 4ZQ3A 5EQ0A 4RGTA 2KJXA 4K6DA 4F7XA 1XWEA 1LLRD 1BQQT 1F9RA 2F0TA 1TT2A 1TY0A 2HQEA 3W2DA 2K5DA 2F0IA 4CKBA 1VF5C 3FDTA 5DNFA 1LTID 2EYPA 5IGBA 4KV6A 5JEAH 3D4RA 3HGBA 2Z4IA 1F77A 1OXTA 4O42A 2XVSA 3FRPB 4R8IA 4G7HC 2EDGA 3N52A 1PZJD 4X3KA 1WTVA 1OXSC 1MSGA 2H1EA 5K36G 1SE2A 2JP1A 3FEWX 1EU3A 1U4PA 1LT5D 5I6WA 5E4WC 3R2IA 1JR0D 1RODA 3VYSA 3BYYB 1TIID 3NQIA 3MEHA 2O5JC 1SNQA 4EGVA 4PMWA 3CKIB 1ZYRD 2JA8B 3KLRA 3I8ZA 1PFMA 5JPNC 3QOLA 3SE0A 1SNCA 3ND9A 3VR5A 4K5XA 4KMUC 2LFNA 5BN5A 1JICA 3C1FA 2QCPX 4OHJA 1B44D 5IIFA 1HRJA 4EQOA 4K2KA 1GUOA 5IGCA 5JVH3 1EU4A 3J81E 3BDLA 4LMQD 5G3LD 1SBBB 1D6EC 1I4GA 1Y1WB 1QB5D 4C1NK 1R4PB 5I6YA 2F0LA 3A7LA 1B9NA 4RWSC 5M5XB 1CI3M 1DXMA 1KLGD 3E0JA 2IL8A 1GOZA 1DYQA 3NHHA 2E2HB 3C3LA 3T53B 3HOUB 3QIAA 3I4MB 1AZQA 2LS01 1Y8NB 4RGOS 2XSCA 3D31A 5D65A 4KJNA 2C5CA 5IT9L 2LMCB 1PTOH 3HEJA 4BA2I 1Y69U 5ELCA 5ELEA 5CV6A 2JXMB 4BA1I 1PDQA 3AU7A 1EEID 3D6CA 2F4IA 1ENCA 5C0XH 1OO9B 3KUPA 3URYA 5FLXE 4ME5A 3RMHA 3OSOA 1V8QA 2OF1A 3E5SA 2Q8IB 2N88A 1MD2D 3HP3A 2L12A 3IAYA 5JEAJ 4S3SA 4F87A 5CC4A 1TR5A 1KABA 1LT3D 5I4DA 3GTLB 3GTQB 1EEFD 1HA5A 2I46A 3HZXA 2B2TA 3A8KE 2MHVA 1SNMA 1D2BA 4RHSA 2R93B 2HDMA 3VA5A 2K5QA 2PZTA 5LL6X 2EY1A 2OEOA 1ESFA 3TDQA 1HQMC 3BVMA 1FNUA 3DUZA 2BDNA 1EYAA 1F2YA 5JJZA 3QJYA 3RZDB 3SHLA 4I7ZC 1CM9A 1SDFA 3WDNA 1WTWA 4C3HB 1NAPA 5C5MA 2IT1A 5DM73 4KY7A 1RTNA 1G291 4PV1C 4A3EB 3AMUA 3DEPA 3GV6A 4QF4A 4DN4M 1AN8A 5EGTA 4FXDA 2B2YC 4A3DB 2Q8TA 1EQVA 5C44B 1V1OA 3BZDB 4N9TA 1VF7A 5EPKA 4DFAA 3MTSA 2JSOA 5EPLA 2DNCA 2AUKA 3GO5A 3V2TA 1STYA 1I6HB 4OIJA 4ZUJA 5M3MB 1X3QA 2CHBD 4FF4A 4RCNA 1ML0D 1ILQA 2FMMA 5EJWA 3C46A 4CKEA 4KK7A 2EY5A 1TS2A 4C3IG 1GUSA 2K7VA 2QF7A 5FO9B 3DWQA 2F3VA 2PMZB 2WACA 4EVOA 3H94A 1JQYD 1O7YA 5J22A 2CVRA 3N6RA 1QCBD 4B9XA 5KIXA 1GUNA 2PZWA 2E74C 3J7YW 2FJ2A 4XT1B 4TKOB 2ZT9C 1MI2A 3NUCA 4KY6A 5IGDA 3GTKB 1TQOA 2XIWA 3AB9A 2KEEA 1CHPD 5FK9C 4DNRB 1AFPA 4JBWA 4XYOA 2R61A 1SYGA 2E76C 1BUVT 3FMCA 1KLUD 3BVGA 2O5IC 2DY8A 4A3FB 4KN7C 1PZID 1EYCA 2I07B 2B2TC 3T4AC 3J80E 4FF2A 2EJGC 1XX8A 4BY1B 1EQTA 5C0XI 2F0UA 1EY9A 3U9SA 2KVMA 4XYQA 3WOFA 1BO0A 3NTHA 1G6ZA 5CGKA 1A15A 1TWCB 2F0NA 4XQJA 4FXKC 5C4JB 4GZYC 3ERQA 5D3IB 1UNSA 1Q1EA 3OOCA 2B8GA 1SNPA 1MBYA 2A68C 1S5CD 1RKNA 4YIJA 1PXUA 3S1NB 4V190 5JPMC 3SXHA 2PQEA 4O1NA 5CBEE 4E6IA 1G91A 2CQAA 1QE6A 1I6VC 4F8MA 2B2VA 2VNUD 5E1FA 1I4PA 1M8AA 1U4MA 4C3JB 3K5NA 3TZDA 4KY5A 4KKUA 4BY7B 4DF7A 2F0JA 1IW7D 1SE3A 1H9SA 1PTOB 2O2LD 1R9TB 4B9WA 2F1MA 1STBA 2EOTA 3CRKC 3GP7A 1VMCA 1F2LA 1E0BA 5CV9A 4AYBB 3PUYA 1U9RA 5JOBA 1CZWA 3H6MA 1FNVA 4N9PA 2ID0A 4PMBA 3QG1A 1Q90A 3DMUA 1WTQA 2E2DC 1ZXTA 5K5PA 2NVQB 3RLFA 2WKCA 3BDCA 3FKIB 1UUPA 4F88A 5C4HA 2A69C 1B3AA 4G7OC 1JOOA 2EYHA 1H9SB 4B08A 3NTKA 3S1MB 2B2WA 3S9WA 1DZ1A 1Q1BA 1PYWD 2IPKD 1M4VA 1F9PA 2AQ1B 1E2WA 4X3TA 1HXYD 4FP5D 3H0GB 2K33A 4G7ZC 1HTPA 4MHEA 3WOEA 1S5ED 1TWGB 2MUYA 4ID6A 5KEEA 4I65A 1WTRA 2EY6A 2XN9C 5HURA 4QUFA 3Q22A 5KGUA 1Y1VB 3DXJC 2IX3A 3GTOB 3NQTA 2NN6G 1EY8A 1FR3A 1SJHD 2M2LA 5DM63 3VR4A 1EOTA 4A3KB 1YNND 2IW3A 4FO2A 2GA4B 2RSNA 3V96A 1I4XA 1TWAB 2F0PA 1STHA 2WB1B 2RBMA 5EKIA 1H9MA 1A2TA 2RKSA 3BG3A 3P20A 3KBXA 1FYCA 2PW7A 4A3GB 1Y8PB 2B2VC 1SNDA 3R2TA 4K5VA 1VDZA 3SVMA 3M4OB 1SNOA 5LL6S 4DK1A 4IUQA 1HHVA 2F0DA 3I91A 1EZ6A 1SJED 5CV4A 2VUMB 1IW7C 2EYJA 3RUZA 1Y8OB 1SSOA 5C3EB 2IJ0A 4TQUS 2SEBD 4CJ0B 4RKBA 3MWYW 3CU7A 4KHVA 1Q12A 1ESRA 3W3AA 4DXGA 1UEAB 3V05A 2F3WA 3DHQA 3C2PA 3KLSX 4A3BB 3NK9A 5A2QL 3NBHA 3R93A 1KDBA 2NVTB 4FNFA 1ICWA 1LABA 5J39A 4CJ1B 2AWOA 4L63B 1B50A 3S17B 4KD4A 5JAVA 5C4ZA 2FINB 5I2YA 4IUPA 4LK1C 3F2UA 2NVYB 4NW2A 2KOLA 3MXGA 2B2WC 3P7JA 2B2YA 1GHJA 5C3XA 1WTXA 1STAA 1DOKA 3TZUA 3MXUA 5KYIA 4K6LA 5KRUA 1HQRD 4NKLA 1SYCA 2VB2X 4BWGB 3PUXA 4WFN3 1KNAA 3EA6A 2KQ3A 5T1GA 2NUCA 3I70A 1IYVA 4XIGS 3IL8A 3DM1A 3M85A 3P75A 4BS9A 2KEDA 2R3ZA 3H09A 3M3YB 3GQBA 1EL0A 2EYOA 4ODGA 3VR3A 1I4HA 5ELDA 1HFNA 3I4LA 2PCFB 2K01A 3S15B 1YNNC 1JB3A 5EKKA 1IYUA 1PTOF 3U9OA 4EQPA 1J9OA 3NWSA 3HKZB 2R92B 2BDOA 2K03A 1EYDA 1JC7A 4HN7A 5EBCA 1E2ZA 3G6JB 3K59A 1FNWA 2IX1A 5KNCA 2KA7A 2QILA 2FHTA 1LTAD 5FOBB 1S5FD 1D5XC 1BOSA 2NYZD 5NUCA 2XNAC 1IHZA 5CBAE 3D8GA 1KDAA 2L5TA 4ABNA 1PZKD 2CW0D 5IT9E 4DA2A 2PNRC 2WINB 4L6TB 2KECA 1BR9A 1JWUD 4PNYA 2M9VA 4M1UB 3RD4A 4DAVA 1TS5A 3S16B 1BDOA 3O13A 1U4RA 2N55A 4CHTB 4ZLTF 5C6AA 2NN6H 2QKIC 1FD7D 1HA6A 4Z9CB 1JWMD 2ICIA 2NTTA 3LNNA 1SEBD 2O4XA 3A8JE 1V1PB 2A68D 1I50B 5BN4A 5CV8A 1SE4A 4H0LC 1TY2A 1D1KA 1Z47A 2F0GA 4G57A 2IX0A 4RKLA 4ZYSA 2EZVA 1WD0A 4JK1C 2J7ZA 2JA7B 3MZ5A 2TMPA 1W6KA 5K36H 1O7ZA 1GHKA 3MXNA 4C1NI 3EQLC 4ZUIA 3J7AV 3QOJA 1CT1D 2RDFA 5JVG3 4ZKCB 4C3IB 2F0KA 5E3FA 1CZGA 3HG9A 3K58A 5ELFA 4XQNA 3JAML 1MGSA 1AEXA 4KN4C 1SYDA 2E75C 3IFTA 2K05A 3H3VC 4IUNA 5F2DA 2D2CC 4IUVA 1EY4A 5C3WA 1F9SA 2PYKA 4FF3A 4ZRZA 1A2UA 1HUNA 5EPJA 3PIO3 3I72A 1KNEA 2K6AA 2D62A 2L1BA 2A69D 5M5WB 2G9DA 4C2MB 4K8JA 2EY2A 4KD3A 2A5HA 3GD7A 5JEAG 1EZ8A 3CQZB 2K28A 2RDHA 4LJZC 5C0XJ 4FF1A 3BDOA 3SDZA 3S1QB 3DWAA 4DAPA 3TP5A 2HCCA 3MC0B 5J1ZA 4Q0FA 3VR6A 1GJXA 2F03A 1X3PA 4IFDI 3VYTA 2RQXA 2CW0C 1EIGA 1TKWB 2NZ1D 4U673 2EJMA 2A6HC 3HS0C 2BA0A 2VXWA 2DN8A 1S5BD 2JEAI 3BYTB 2LY7A 4L8JA 4BBSB 1RD9D 4A3MB 1BNZA 5FKAC 5IGGA 1C48A 4K8IA 1PTOD 5E4XA 3S14B 2F0VA 3RZOB 2WKDA 3MXPA 2FMCA 3NP8A 5I9OA 1BBXC 4WRDA 2H4OA 1K8OA 2MPMA 1BCPB 2NTSA 4HR7B 1AW7A 1STNA 2RDGA 4XQQA 3SK5A 2NN6I 1AP0A 1KDCA 3D4WA 3A55A 1H9RA 4HCSA 3K5MA 5G3LF 1SYFA 4LAAA 3D4DA 3PO3B 1BF4A 1O80A 4WJWA 4QUCA 2Z1CA 3K6OA 1EY6A 1ZEQX 4HAEA 2C9OA 1UAPA 2PZUA 2K04A 2M00A 4IQZA 1EY5A 1CQVA 4RFBA 2BCOA 3Q6SA 1ENFA 2D9UA 5EKLA 4C3JG 4ILWA 5ELBA 5FO7B 4M8AA 3T16A 1LTRD 4IFDG 1H9JA 1II3A 3I73A 1XYIA 3OPOA 4HSPA 2D5DA 1OXVA 1I4RA 2ENBA 5C4XB 1QNUA 5BN3A 2KUMA 1TU2B 4J8QA 1C4QA 1SAPA 1A3TA 2F0FA 2NVXB 1VMPA 4EQNA 2L0CA 4RHRA 1PMRA 4HSVA 3I4NB 1EFID 1PFNA 3J7AF 1LTSD 4DXFA 5KYLA 2BE5C 1D5MC 1HPCA 3TP7A 5DEHA 4G4KA 2B2UA 1XXGA 3QWNA 2BA1A 5AFWA 1JWSD 1KTKA 3NPPA 2IWHA 2Y0SB 3HRZC 4HEDA 2R6GA 2E2JB 1DD2A 2ZXPA 5COYA 2F0WA 2NWGA 2PW5A 4RAUC 1VCIA 1CA6A 1O7LA 4FXGC 4K2LA 4DNTB 3LWUA 4UDUC 3MHBA 1PFBA 2V4DA 1LT6D 5ISRA 1PTOC 1TS3A 4X3UA 4UAIA 2LKVA 3G7LA 3L3OC 1PRTF 1TWFB 3S2HB 1O78A 4Y7NB 3M7GA 4OO1G 4QB4A 3C1EA 1FGBD 1C8CA 4X3SA 3DWPA 1K83B 3R8BA 1YNJC 4PMCA 1QNKA 2TSSA 5M5YB 1DJRD 1B9MA 1B2TA 3SK8A 1LTTD 3M7NA 1HFGA 1EY0A 2A6EC 2NB0A 2EPBA 1H9KA 1RDPD 3J81L 5EBDA 1S4ZA 2K1BA 4XTCS 3MAQA 1I4QA 2SNMA 5IGFA 3K0YA 2Q8RE 4K14A 2EYMA 2QDBA 3NE5B 1S5DD 1GUWA 1ONLA 4CBVA 1RJTA 4DK0A 2PO4A 2L11A 2X69A 4XXEA 3KBGA 2L55A 3OHXC 1NR2A 1TWHB 3FPPA 1G2TA 5I2XA 2JA5B 1F2MA 1IL8A 1DOMA 1PLFA 1EWHA 5CR3A 1BXTA 2L4NA 5D14A 1SFOB 3D3RA 4J6HA 4OIKA 4IUTA 4NMZA 3L9AX 1R4QB 1JE4A 5D3DA 4KKSA 3X3NA 3VA7A 4FYDA 3K5LA 2B2UC 1L0XB 1RHPA 2JYOA 2K5WA 5FLXL 1L0YB 4FVMA 3L7ZC 1OXXK 5LHY1 1J8IA 3FVQA 2VB3X 3VYUA 1B1ZA 1G2SA 5A2QE 1BCPF 1DCZA 1RTOA 2YYZA 2WV6D 3S1RB 2F0MA 1EIHA 1SYEA 5IGEA 1Z6HA 4ZK9B 5KNBA 5IOCA 4MIUA 1CFMA 1WCMB 3I90A 3TSSA 3TBIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY6 A;  4KD4 A;  5JAV A;  4F8M A;  5DAU A;  3NHH A;  2PZW A;  5C4Z A;  5HUR A;  1F2Z A;  3T13 A;  2F0V A;  5E1F A;  5NUC A;  1SYD A;  2EYF A;  3MXP A;  1F2Y A;  3ERO A;  2SNM A;  1IHZ A;  3NP8 A;  3OMC A;  3P1H A;  5IGF A;  5KYL A;  4IUN A;  5I9O A;  3NUC A;  4K14 A;  4KY6 A;  3D8G A;  5DEH A;  1KDA A;  4WRD A;  5F2D A;  3TP7 A;  3SHL A;  2SNS A;  5IGD A;  3NQT A;  1EY4 A;  2EYM A;  5I9P A;  1TQO A;  5C3W A;  2PYK A;  1EY8 A;  2QDB A;  3LX0 A;  3QB3 A;  4KY5 A;  4DF7 A;  4IAL A;  2F0J A;  2SOB A;  4HMI A;  5C3X A;  3SK6 A;  1STA A;  1JOK A;  3SK4 A;  1SYB A;  2OXP A;  5C5M A;  1A2U A;  1SYG A;  1NUC A;  2KHS A;  3SR1 A;  3TME A;  3PMF A;  4IZ8 A;  1STN A;  5M9O A;  3TP6 A;  1JOQ A;  2F0S A;  4OL7 A;  4HTH A;  4KY7 A;  4KJO A;  4B9W A;  4PNY A;  1STB A;  5KRU A;  5KYI A;  5KGU A;  3OWF A;  5HGT A;  4NKL A;  1SYC A;  1EYC A;  3EVQ A;  4K5W A;  4DU9 A;  4KJN A;  1STG A;  2F0W A;  1KAA A;  2F0P A;  2PW5 A;  4QF4 A;  3SK5 A;  1STH A;  3MVV A;  5CV9 A;  5I6W A;  1JOR A;  5EGT A;  3HEJ A;  2RBM A;  4K8J A;  2EY2 A;  1KDC A;  4KD3 A;  1NSN S;  3D4W A;  4H7B A;  4NDX A;  1ENA A;  1F2M A;  1U9R A;  1EQV A;  2KQ3 A;  5JOB A;  3H6M A;  5C6A A;  4N9P A;  1SYF A;  4K2L A;  5CV6 A;  1A2T A;  2RKS A;  3TP8 A;  4PMB A;  4LAA A;  5CR3 A;  3MEH A;  4N9T A;  2NUC A;  1EZ8 A;  1SNQ A;  3D4D A;  4R8N A;  2F0U A;  3D6C A;  3DMU A;  3MHB A;  1EY9 A;  4DFA A;  3EJI A;  4J1M A;  2PW7 A;  4J6H A;  5K5P A;  1SND A;  4NMZ A;  1ENC A;  5ISR A;  1EY6 A;  2O4X A;  3NXW A;  3BDC A;  3OMG A;  2EXZ A;  3QOL A;  5IOD A;  4K5V A;  2PZU A;  4DGZ A;  3P75 A;  2M00 A;  4QMG A;  5CV7 A;  4NP5 A;  1SNC A;  2LKV A;  5C4H A;  5CGK A;  5CV8 A;  1SNO A;  4ME5 A;  1JOO A;  1STY A;  2EYH A;  3OSO A;  3V2T A;  2OF1 A;  3E5S A;  3TP5 A;  4K5X A;  1EY5 A;  4ZUJ A;  2F0N A;  3ITP A;  4HMJ A;  2F0G A;  5CV5 A;  4ZQ3 A;  5J1Z A;  4G57 A;  5C5L A;  2EYO A;  2F0Q A;  4ODG A;  3C1F A;  2F0D A;  4RKL A;  5EKL A;  1EZ6 A;  3ERQ A;  5CV4 A;  3S9W A;  2EYJ A;  4S3S A;  4QB4 A;  2EY5 A;  3RUZ A;  3C1E A;  4K6D A;  5CC4 A;  4F7X A;  5IIF A;  1TR5 A;  3T16 A;  1KAB A;  1II3 A;  5EKK A;  4RKB A;  3MZ5 A;  2F0E A;  4EQO A;  2F0T A;  4KHV A;  1TT2 A;  4K2K A;  5IGC A;  1SNP A;  2F3V A;  3U9O A;  4KTA A;  3HZX A;  4EQP A;  2HQE A;  4ZUI A;  2WAC A;  4PMC A;  2F3W A;  3DHQ A;  3QOJ A;  1RKN A;  2F0M A;  2F0O A;  1SYE A;  2ENB A;  2RDF A;  3BDL A;  4WOR A;  4YIJ A;  4EVO A;  5IGE A;  2F0I A;  3SK8 A;  3NK9 A;  1SNM A;  1EYD A;  2F0H A;  1EY0 A;  1KDB A;  4TRD A;  3SXH A;  5IGB A;  2EYP A;  2F0F A;  1A3T A;  2PQE A;  5I6Y A;  5J22 A;  2F0K A;  3R3O A;  1EY7 A;  5E3F A;  2F0L A;  2PZT A;  1A3U A;  3VA5 A;  4EQN A;  5IOC A;  4E6I A;  2EY1 A;  4KV6 A;  5J39 A;  4MIU A;  1A3V A;  2OEO A;  4ID6 A;  5IGG A;  2EYL A;  4B9X A;  4K8I A;  1AEX A;  5KEE A;  5KIX A;  4I65 A;  1EYA A; 
#chains in the Genus database with same CATH topology
 4L5R C;  4A93 H;  3TS0 A;  5LMN L;  3I4M G;  4IFD H;  2L9H A;  3NSW A;  3S2D H;  3M4Y A;  4CGY B;  2RVL A;  2A19 A;  3OMC A;  3PIP 3;  2RSO A;  3KLS A;  1PYB A;  5CYU A;  3J81 c;  3HOW B;  4YCV A;  3PUW A;  1D8L A;  1VQG A;  3MFY A;  2RA4 A;  3QB3 A;  2K32 A;  1E3P A;  4IAL A;  2SOB A;  4HMI A;  1Q7Y C;  2HT1 A;  3SK4 A;  1SYB A;  5TSS A;  2AWN A;  4RH6 A;  3SR1 A;  3TME A;  4IZ8 A;  1CK1 A;  2IHE A;  2F0S A;  4KJO A;  3OWF A;  5HGT A;  3A54 A;  4YWK A;  4V0B A;  4K5W A;  4BBR H;  2ZJQ A;  3GTM B;  5CMD A;  1SN8 A;  1X32 A;  3PUV A;  1PH6 A;  1T5X D;  3X3M A;  3PO2 H;  2FFK B;  3U4V A;  4A3I B;  1WTO A;  3HOY B;  1TS4 A;  3GTJ B;  4DV6 L;  1V1P A;  2ASB A;  1I3Q H;  3TP8 A;  2KCN A;  2R7Z B;  3HKZ G;  2R92 G;  4XDX A;  3OW7 A;  1SMY D;  1STE A;  4H44 C;  4LFB Q;  4DR4 L;  4KKT A;  2VQF Q;  1QVC A;  3OMG A;  3PF4 A;  1E2V A;  1SLJ A;  1G8Z D;  2A6H D;  4NP5 A;  2UUA L;  3HKS A;  2DNE A;  3KF6 B;  4CJ2 C;  4HMJ A;  1U4L A;  4PQX A;  2EVB A;  3T51 B;  4DV0 Q;  4ULL A;  4DR5 Q;  4LUO A;  1ZYR C;  2G9H D;  1ET6 A;  2R93 G;  2Z6K C;  5J3B A;  3VYR A;  3A7A B;  4OGQ C;  5IP9 G;  1NCV A;  1T5E A;  3CF5 A;  5ELN A;  5FLX c;  3W1B A;  2F0O A;  4WOR A;  2CWA A;  1PRT D;  1CHQ D;  3LGJ A;  4B3R L;  3HOV B;  1WVL A;  1NR4 A;  1QG7 A;  4LF8 Q;  4GS3 A;  1Z7T A;  4K0K Q;  4RCO A;  2QEJ C;  2YTY A;  1VQK A;  3IFD A;  1J6Q A;  1Y1V H;  4OO1 H;  1MIU A;  2A1A A;  2VY3 A;  4HIM A;  3F2B A;  1ILP A;  5DAU A;  1F2Z A;  1K8M A;  4C3H G;  4IUU A;  3ONA B;  2EYF A;  2UUB Q;  1HTL D;  3K5O A;  1HUM A;  2ICE C;  3OIP A;  1N34 Q;  1NE3 A;  3I4O A;  4A3E G;  1GM5 A;  3MA2 B;  1UEB A;  3LX0 A;  2OT2 A;  3SK6 A;  4B3T L;  4GKJ Q;  1VQH A;  4R9W A;  1JOK A;  5IT9 c;  4DV4 L;  2JA6 B;  3H91 A;  1NUC A;  5M9O A;  3TP6 A;  2IHF A;  2DGY A;  3K57 A;  5HY6 A;  2CH4 W;  1RF2 D;  3BS1 A;  1DM0 B;  1IKM A;  3EVQ A;  1GUG A;  1QIL A;  2WAQ B;  1STG A;  4IUR A;  4DV5 L;  1KAA A;  1RCV D;  1E1O A;  2PI2 A;  1N32 L;  1JOR A;  1PRT B;  4IN3 A;  1PFS A;  1SXT A;  3VDY A;  1NSN S;  2ZXO A;  2MO1 A;  4NDX A;  1CKN B;  3Q8D A;  2XWB B;  3TN2 A;  3TRZ A;  4DK3 C;  3OIQ A;  4R1J A;  2WP8 J;  2VQE Q;  1BBU A;  1GVP A;  2B63 B;  4DV3 Q;  2HUG A;  3EJI A;  3J80 L;  4QIW B;  3GV3 A;  2X6G A;  4PZ8 A;  3NXW A;  3BZC A;  2UU9 Q;  2EXZ A;  1HCZ A;  4DV7 L;  1QOH A;  2ZTD A;  1F9Q A;  1C9O A;  5M3F B;  2MGS A;  3GTG B;  2EJF C;  4LF6 L;  2JA8 H;  5C5L A;  1JJC B;  1QUQ A;  1E24 A;  4XT3 B;  2YU9 B;  1KRT A;  1ET9 A;  3Q0A A;  4IFD J;  4C56 C;  4RA8 A;  1JJG A;  2F0E A;  4GLA C;  1YNX A;  4A3J B;  1MSH A;  3KF8 A;  2A73 B;  4KTA A;  1KC8 C;  1Q3L A;  1XNQ L;  2BE5 D;  5L37 A;  3CHB D;  1JOQ A;  1JCK B;  4KHP L;  3JAM E;  3A56 A;  2KCC A;  4U68 A;  2HCI A;  4OX9 Q;  1EYG A;  4ZAI A;  3CPW A;  2F0H A;  1EWC A;  3PV0 A;  3D6W A;  2N78 A;  1N33 Q;  1EIF A;  2GN5 A;  3BVZ A;  1EY7 A;  1X54 A;  3R3O A;  2F4V L;  1XTC D;  2X6L A;  3I7F A;  1A3V A;  1GUT A;  3KK7 A;  1BCP D;  1XMO Q;  1SMY C;  3D0F A;  4HCE A;  1Y1W H;  4DK6 C;  3RLN A;  3ERO A;  4JBM A;  5M5X H;  3P1H A;  3CC4 A;  4RGN A;  4A3F G;  4JI6 L;  1B53 A;  3GTP B;  2SNS A;  3NEM A;  3NBI A;  3T56 B;  4AH6 A;  4APV A;  3RR5 A;  2E2H H;  3QO2 A;  4JI3 L;  4IPC A;  4AQY Q;  5COR A;  4EQ5 A;  4DKA C;  3HOU H;  3KF8 B;  3PMF A;  1OXU A;  2BOS A;  2E5L L;  4MN3 A;  4BXX G;  2AUJ D;  1CA5 A;  3SEB A;  2B8F A;  1QJO A;  4DU9 A;  1JJ2 A;  3I4M H;  4JI0 Q;  3MVV A;  4OXP A;  1LTG D;  3FPU B;  2WII B;  4IOC A;  4H7B A;  1ENA A;  2ZXR A;  1PRT C;  3DEO A;  3M4Q A;  3AFP A;  1VQI A;  2I5L X;  3PIP A;  2HD3 A;  2HDL A;  2Z4H A;  3KOJ A;  3CCM A;  2YTV A;  3L2P A;  1MHW C;  4J1M A;  2E8G A;  2XRQ D;  4Q5V A;  4H13 C;  5KND A;  4A3M G;  2DY7 A;  1D1I A;  3Q23 A;  1YNJ D;  4RMF A;  3ZYY X;  2MP1 A;  3CRL C;  1CQF A;  1IKL A;  1GXD C;  3E9I A;  2J0T D;  4JYA Q;  3PUZ A;  2PPB C;  2A6E D;  5CV5 A;  4RGM A;  4DR7 L;  2F0Q A;  1CKO A;  1LO5 D;  1LT4 D;  1SMX A;  4JOI C;  4OEL B;  2JE6 I;  2Z8L A;  3HOX B;  1A6X A;  2NZO A;  1X56 A;  2CCZ A;  4KI0 A;  1CSP A;  2JN4 A;  4OWT B;  3Q24 A;  1ZKO A;  3K7A B;  2Q2T A;  2N3S A;  3UE0 A;  4QCL A;  1VQA A;  5A35 A;  3VR2 A;  4PZ6 A;  1G51 A;  1DOL A;  1UE1 A;  1HR0 W;  2I5M X;  4R4T A;  3EBE A;  3IKJ A;  4P2C B;  4A93 B;  4OO1 I;  1LTB D;  2NBF A;  1YJ9 A;  3GTQ H;  4TRD A;  3H3V H;  2RHQ B;  2WFW A;  3S2D B;  2B39 A;  3PQI A;  1A3U A;  4GNX B;  1HR0 L;  3ND8 A;  2XRS D;  2EYL A;  4GOP A;  2Z9H A;  5CV7 A;  4BY7 G;  4ZKB B;  3PO3 G;  3T13 A;  2R93 H;  5JJI A;  3I3C A;  3JAM i;  3HOZ B;  1IBM Q;  4LF4 Q;  5FO8 B;  1L0W A;  2CWP A;  3W1G A;  5I9P A;  3LWE A;  4QL5 A;  4BBR B;  1IBK Q;  4AYB G;  1W6J A;  3UI2 A;  1B3Q A;  2OXP A;  4DAY A;  1NMG A;  1VQL A;  3PO2 B;  4CKC A;  5C0X G;  2KHS A;  3H15 A;  3RZD H;  1TVX A;  4N8F A;  3G48 A;  4TSS A;  4OL7 A;  4HTH A;  4DUZ Q;  3EFX D;  1I3Q B;  4KHZ A;  1LV9 A;  2EE1 A;  1DON A;  2B3G A;  3NWT A;  4C3H H;  2PMZ E;  1JE5 A;  1XNR L;  2PQA A;  4NXM Q;  2E2I B;  3FKI G;  2J4X A;  2SDF A;  1D5Z C;  1FJG Q;  2AQ2 B;  4A3E H;  2AQ3 B;  4R8N A;  2K50 A;  1B4O A;  5C4X G;  2MJ8 A;  1LAC A;  4A3D H;  4LFA L;  1IL2 A;  3E6Z X;  1ICF B;  2RCN A;  1V43 A;  1BCP C;  5C44 H;  5T1I A;  2JEB I;  3NTI A;  5IOD A;  1QWY A;  3A8I E;  4JVZ A;  4DGZ A;  3AYH B;  4QMG A;  1WTP A;  1AZP A;  4ME3 A;  2XTI A;  1WD1 A;  1CTM A;  1Q8I A;  2XWJ B;  4B3M Q;  3I4N G;  3TQY A;  3OWE B;  4R4Q A;  4LF7 Q;  2A74 C;  3MFG A;  3ITP A;  4ZQ3 A;  2UXB L;  1S72 A;  4LW1 A;  3H0G G;  1KL9 A;  5EQ0 A;  4RGT A;  2KJX A;  4K6D A;  1YIT A;  1I6H H;  4CDD C;  1XWE A;  1LLR D;  4F7X A;  1BQQ T;  4X64 L;  1F9R A;  5M3M H;  2F0T A;  2UXC Q;  1TT2 A;  3TEH B;  1FL0 A;  1TY0 A;  2HQE A;  2ZM6 L;  3W2D A;  1HNX L;  2K5D A;  2F0I A;  4CKB A;  1VF5 C;  5GQO A;  1VQE A;  3FDT A;  5DNF A;  1LTI D;  2EYP A;  5IGB A;  1EIY B;  4HID A;  4FDB A;  3UDI A;  4KV6 A;  1PH1 A;  5JEA H;  3D4R A;  3HGB A;  1WI5 A;  1KHI A;  4DV1 Q;  4GNX C;  2Z4I A;  1F77 A;  1OXT A;  1PV4 A;  4O42 A;  2XVS A;  5EAY A;  3CCR A;  1C7Y A;  3FRP B;  4R8I A;  4G7H C;  2EDG A;  3N52 A;  1PZJ D;  1YBY A;  4IJL A;  4HJ5 A;  1I94 L;  4DUY Q;  3J7A 5;  4X3K A;  1WTV A;  1OXS C;  1MSG A;  2H1E A;  4DPG A;  5K36 G;  3GTK H;  1HJP A;  1SE2 A;  1MJC A;  3MEF A;  2JP1 A;  3FEW X;  1YIJ A;  1EU3 A;  1U4P A;  1LT5 D;  2LXK A;  5IWA Q;  3M9B A;  4A3G G;  5I6W A;  5E4W C;  3R2I A;  4JI5 L;  1JR0 D;  1ROD A;  3VYS A;  4A3F H;  4N8X 1;  3BYY B;  1TII D;  3OW2 A;  3NQI A;  3MEH A;  4PG3 A;  5ELO A;  4DR3 L;  1SNQ A;  2O5J C;  4EGV A;  4PMW A;  3CKI B;  1ZYR D;  2JA8 B;  3KLR A;  3I8Z A;  4NXN Q;  4BXX H;  1PFM A;  5JPN C;  3QOL A;  1VQF A;  3SE0 A;  4DAM A;  1SNC A;  3ND9 A;  1E22 A;  3VR5 A;  4K5X A;  4KMU C;  2HHH L;  4UPA A;  4JI7 L;  2K5V A;  2LFN A;  5BN5 A;  1JIC A;  3C1F A;  2QCP X;  4OHJ A;  5JJL A;  3F2D A;  2HIV A;  3TS2 A;  1B44 D;  1TWC H;  5IIF A;  2K5N A;  5GRO A;  1U5K A;  4QGU A;  1HRJ A;  1YVC A;  4EQO A;  5C4J H;  4K2K A;  1GUO A;  5IGC A;  5JVH 3;  3H3V I;  1EU4 A;  5LMU Q;  3J81 E;  2KBN A;  3BDL A;  4AYB E;  4X62 Q;  4LMQ D;  5G3L D;  1SBB B;  3S14 H;  1D6E C;  1SR3 A;  1I4G A;  1HNW L;  1Y1W B;  1QB5 D;  4C1N K;  1R4P B;  5I6Y A;  2F0L A;  3A7L A;  1B9N A;  4RWS C;  5M5X B;  1Q81 C;  1CI3 M;  1DXM A;  1KLG D;  3E0J A;  2IL8 A;  1GOZ A;  3S1N H;  4DR6 L;  2C35 B;  1DYQ A;  2KEN A;  3NHH A;  2ATW A;  2E2H B;  2CH4 A;  5FLM H;  3C3L A;  2UUC L;  3T53 B;  4DV2 L;  1IBL L;  3HOU B;  3QIA A;  3FHW A;  2KCM A;  1N36 Q;  3I4M B;  1AZQ A;  5LMN W;  2LS0 1;  1BBW A;  1Y8N B;  1FGU A;  4C3J H;  2ZJR A;  4JI4 Q;  4RGO S;  2XSC A;  3D31 A;  1I5F A;  4BY7 H;  5D65 A;  4KJN A;  5BR8 Q;  2C5C A;  5IT9 L;  2LMC B;  1PTO H;  3HEJ A;  4BA2 I;  1Y69 U;  5ELC A;  4IJH A;  5ELE A;  1R9T H;  5CV6 A;  2JXM B;  4BA1 I;  1PDQ A;  3CP0 A;  1XMQ Q;  3AU7 A;  1EEI D;  3D6C A;  5GAH C;  3KF6 A;  2F4I A;  1ENC A;  5C0X H;  1OO9 B;  2RHS B;  1YJW A;  4CDC C;  3KUP A;  3URY A;  5FLX E;  3OTO L;  2P5Z X;  4ME5 A;  3RMH A;  3OSO A;  2ZJP A;  1V8Q A;  4L5Q A;  2OF1 A;  3E5S A;  2Q8I B;  1PH5 A;  2NVQ H;  4R4C A;  2N88 A;  1MD2 D;  5LMN Q;  3FKI H;  3HP3 A;  2L12 A;  3IAY A;  5JEA J;  4S3S A;  4HIO A;  4F87 A;  5CC4 A;  1TR5 A;  1KAB A;  1WOC A;  1LT3 D;  5I4D A;  4HIK A;  2QGQ A;  3GTL B;  1QVF A;  3GTQ B;  1P8L A;  3U58 A;  2NVX H;  3S1M H;  1EEF D;  1HA5 A;  2I46 A;  3HZX A;  2QEX A;  2B2T A;  3A8K E;  4JI8 L;  4MTN A;  2WB1 E;  4IPD A;  2MHV A;  1SNM A;  4LUZ A;  1D2B A;  4RHS A;  1S3O A;  1C0A A;  4JBK A;  2R93 B;  2HDM A;  2HQL A;  3VA5 A;  4A3I G;  1Q82 C;  2K5Q A;  2PZT A;  5LL6 X;  3H0G H;  2EY1 A;  3HOY G;  2OEO A;  1ESF A;  3TDQ A;  1HQM C;  3BVM A;  1FNU A;  3DUZ A;  4L5T A;  3UDG A;  2BDN A;  1EYA A;  4DV6 Q;  1AE3 A;  4K0K L;  2OCE A;  1TWG H;  4MZ9 A;  3J81 i;  1F2Y A;  3UDF A;  5JJZ A;  3F1Z A;  3QJY A;  1VQB A;  3RZD B;  3SHL A;  4I7Z C;  1CM9 A;  4DR4 Q;  1SDF A;  2D0O A;  3WDN A;  1WTH A;  4DR1 L;  1WTW A;  4C3H B;  1NAP A;  5C5M A;  2IT1 A;  5DM7 3;  2UUA Q;  1CKN A;  1OTC A;  3GTO H;  4KY7 A;  1RTN A;  1G29 1;  4PV1 C;  3CCU A;  4A3E B;  3AMU A;  1CSQ A;  2EIF A;  3IRB A;  3DEP A;  3GV6 A;  4QF4 A;  4DN4 M;  1AN8 A;  3PF5 A;  1K0R A;  1A62 A;  5EGT A;  3ICE A;  4FXD A;  2B2Y C;  4A3D B;  2Q8T A;  4A3K H;  1EQV A;  5C44 B;  4JCV E;  1V1O A;  3BZD B;  1TWA H;  4N9T A;  1VF7 A;  4YCW A;  5EPK A;  4DFA A;  4EX5 A;  3MTS A;  2OTJ A;  4JOI A;  4OWW B;  2JSO A;  5EPL A;  4B3R Q;  2DNC A;  2AUK A;  1B7Y B;  3GO5 A;  4JPB W;  3V2T A;  1STY A;  2JA7 G;  4A3G H;  1I6H B;  4HJ8 A;  3UE1 A;  4OIJ A;  4ZUJ A;  5M3M B;  1X3Q A;  2CHB D;  3J81 j;  4FF4 A;  4RCN A;  4A3C G;  1ML0 D;  1ILQ A;  2FMM A;  5EJW A;  1PH2 A;  3C46 A;  4CKE A;  4KK7 A;  2EY5 A;  1TS2 A;  5E7N A;  3M4O H;  4MTK A;  4C3I G;  1GUS A;  4LF5 L;  4X66 L;  1D7Q A;  2K7V A;  5IYD G;  2QF7 A;  5FO9 B;  3DWQ A;  2F3V A;  4B3T Q;  2VUM H;  2PMZ B;  2WAC A;  4DV4 Q;  4EVO A;  5C3E H;  3H94 A;  1JQY D;  1O7Y A;  5J22 A;  2A8V A;  1VQM A;  3MXN B;  2CVR A;  4DV5 Q;  3N6R A;  1QCB D;  5IYC H;  1N32 Q;  1NBW A;  4OX9 L;  4B9X A;  3E9H A;  5KIX A;  4A3B H;  1N8R C;  1GUN A;  2PZW A;  1Y14 B;  2NVT H;  2E74 C;  2B63 G;  2ZTC A;  3J7Y W;  2FJ2 A;  4XT1 B;  4TKO B;  4JI1 L;  2ZT9 C;  4UY8 C;  1MI2 A;  4O2D A;  3NUC A;  4KY6 A;  1XMO L;  4UP7 A;  5IGD A;  3S17 H;  4JBJ A;  1IZ6 A;  1YHQ A;  3GTK B;  1TQO A;  2XIW A;  3AB9 A;  1KRS A;  2KEE A;  1CHP D;  5FK9 C;  4DNR B;  1AFP A;  4JBW A;  4XYO A;  4DV7 Q;  2R61 A;  1SYG A;  2E76 C;  2NVY H;  1BUV T;  5AJ3 L;  3FMC A;  1KLU D;  3BVG A;  2O5I C;  2DY8 A;  1KAW A;  4A3F B;  4LF6 Q;  4KN7 C;  1PZI D;  4LFC L;  1EYC A;  2I07 B;  2B2T C;  1WFQ A;  3T1H L;  1PHJ A;  3T4A C;  3HKZ E;  3J80 E;  4FF2 A;  2EJG C;  4JI2 L;  1XX8 A;  4BY1 B;  1EQT A;  5C0X I;  2QW7 A;  4NPS A;  4DR2 L;  1XNQ Q;  2F0U A;  4R4O A;  1EY9 A;  3U9S A;  4KHP Q;  1TXY A;  2KVM A;  2R7D A;  4YY3 L;  1X3G A;  4XYQ A;  1PYS B;  3S24 A;  1UE5 A;  3WOF A;  1BO0 A;  4ZCK A;  2F4V Q;  3NTH A;  2B29 A;  1G6Z A;  5CGK A;  2MNA A;  1A15 A;  3BJU A;  1HZC A;  1TWC B;  2F0N A;  4XQJ A;  1CUK A;  4FXK C;  5C4J B;  4GZY C;  3ERQ A;  1CKM A;  1VQ4 A;  5D3I B;  1UNS A;  1Q1E A;  4JI6 Q;  3OOC A;  2OQK A;  1UE7 A;  2B8G A;  4BBS G;  5IYB G;  3I55 A;  5JJK A;  3M3Y H;  1GO3 E;  2MO0 A;  1SNP A;  4GNX A;  3CCE A;  2GVB A;  1MBY A;  4JI3 Q;  4OEM B;  1K0S A;  2A68 C;  1S5C D;  1RKN A;  4YIJ A;  3JAM c;  1LUZ A;  1PXU A;  3S1N B;  2E5L Q;  3S15 H;  4V19 0;  5JPM C;  2LSS A;  3SXH A;  2PQE A;  4O1N A;  5DLQ E;  3J7Z C;  5CBE E;  4E6I A;  1G91 A;  2CQA A;  1XTD A;  2R92 H;  3F8T A;  3E3X A;  1QE6 A;  1I6V C;  3AQQ A;  4F8M A;  2B2V A;  4B3S L;  3FP9 A;  2VNU D;  1B8A A;  5E1F A;  3CME A;  4X65 L;  1I4P A;  1M8A A;  1VQO A;  3CCV A;  1U4M A;  4C3J B;  3KDF B;  2K75 A;  3K5N A;  3DLL A;  3CCJ A;  3TZD A;  4GN4 B;  4KY5 A;  4KKU A;  4BY7 B;  4DF7 A;  2KHI A;  2AKW B;  2F0J A;  1IW7 D;  1SE3 A;  1H9S A;  3AFQ A;  4MNO A;  1PTO B;  3ZJY C;  2LXJ A;  2O2L D;  2VW9 A;  1R9T B;  4B9W A;  2F1M A;  1STB A;  3HFZ B;  2UXD L;  3KFU A;  2EOT A;  3CRK C;  5FJ8 G;  4DR7 Q;  3GP7 A;  1VMC A;  1F2L A;  1E0B A;  1M90 C;  4A4I A;  5CV9 A;  4AYB B;  3PUY A;  5IP9 H;  2EXD A;  1L2F A;  1U9R A;  3CXC A;  5JOB A;  1CZW A;  3H6M A;  1FNV A;  4N9P A;  2ID0 A;  2QDL A;  4PMB A;  1GKH A;  1Q90 A;  3QG1 A;  3DMU A;  3S16 H;  1WTQ A;  2E2D C;  1ZXT A;  5K5P A;  4POG A;  1QZG A;  1K8A C;  2NVQ B;  3RLF A;  2WKC A;  3BDC A;  3FKI B;  1UUP A;  3EN2 A;  4F88 A;  4P73 A;  5GAD C;  3J80 i;  5C4H A;  2A69 C;  1B3A A;  5HGQ A;  1HR0 Q;  4G7O C;  1JOO A;  2EYH A;  4OON A;  1H9S B;  4H02 A;  1SRU A;  1WYD A;  4B08 A;  3NTK A;  3UDX A;  1AE2 A;  1E7Z A;  3S1M B;  1X65 A;  3HOZ G;  2B2W A;  2MFI A;  3S9W A;  3G71 A;  2I5H A;  1I50 H;  1DZ1 A;  1Q1B A;  1PYW D;  2IPK D;  1M4V A;  4BBR G;  1F9P A;  2AQ1 B;  1E2W A;  4X3T A;  1HXY D;  4FP5 D;  4IPH A;  2GVA A;  3H0G B;  2K33 A;  1XPU A;  4G7Z C;  2JA7 H;  1HTP A;  4KLK A;  4MHE A;  3WOE A;  2IY5 B;  1S5E D;  1TWG B;  2MUY A;  2BH8 A;  4P74 A;  3A74 A;  4ID6 A;  1YHB A;  2ZTE A;  3RN2 A;  1MJE A;  1XNR Q;  2JK8 A;  5KEE A;  4I65 A;  1RL2 A;  1V9P A;  2PI2 E;  4C3I H;  2EY6 A;  1WTR A;  2XN9 C;  4GN5 A;  1PA6 A;  5HUR A;  3L0O A;  5IYD H;  1UWV A;  4QUF A;  2Y0S G;  4J15 A;  3Q22 A;  1X6O A;  4LFA Q;  5KGU A;  1Y1V B;  1PH9 A;  3DXJ C;  2IX3 A;  3GTO B;  3NQT A;  2NN6 G;  1EY8 A;  3CW2 C;  1FR3 A;  1SJH D;  2M2L A;  5DM6 3;  3VR4 A;  1EOT A;  4A3K B;  1YNN D;  2IW3 A;  4FO2 A;  1VQ5 A;  2GA4 B;  4P75 A;  2RSN A;  1KQS A;  3V96 A;  1I4X A;  1TWA B;  2F0P A;  1STH A;  1IYJ B;  2WB1 B;  2RBM A;  5EKI A;  3ULL A;  2R7F A;  4X64 Q;  1H9M A;  1EFW A;  1A2T A;  2RKS A;  3BG3 A;  4P72 A;  3P20 A;  3KBX A;  2ZM6 Q;  5M5W H;  1FYC A;  3KJO A;  4C2M H;  1HNX Q;  2PW7 A;  4A3G B;  1Y8P B;  2B2V C;  1SND A;  3R2T A;  4JV5 L;  4K5V A;  3BU2 A;  3CQZ H;  1VDZ A;  3SVM A;  5IP7 G;  1K73 C;  3M4O B;  1SNO A;  5LL6 S;  4DK1 A;  4IUQ A;  1VQ6 A;  1HHV A;  2F0D A;  3I91 A;  1EZ6 A;  1SJE D;  5CV4 A;  3S1Q H;  2VUM B;  1IW7 C;  2EYJ A;  3RUZ A;  1Y8O B;  1SSO A;  5C3E B;  3PSI A;  2HIX A;  2IJ0 A;  4TQU S;  2SEB D;  3W5O A;  4CJ0 B;  4RKB A;  3MWY W;  3CU7 A;  4KHV A;  1WJJ A;  1Q12 A;  1I94 Q;  1ESR A;  2K5H A;  3W3A A;  4DXG A;  1UEA B;  3V05 A;  3G4S A;  2F3W A;  3DHQ A;  1PH3 A;  3C2P A;  3AEV A;  4QJF A;  4GKK L;  3KLS X;  4A3B B;  3NK9 A;  5A2Q L;  4X6A H;  3NBH A;  3R93 A;  1NY4 A;  1KDB A;  2NVT B;  1H95 A;  4FNF A;  1ICW A;  5LMU L;  1X55 A;  1KIX A;  1LAB A;  1HNZ L;  5J39 A;  4LF9 L;  4CJ1 B;  4JI5 Q;  2AWO A;  4L63 B;  1B50 A;  3S17 B;  4KD4 A;  5JAV A;  1VQJ A;  4BBS H;  5C4Z A;  3K7U C;  3TRE A;  5IYB H;  1A8V A;  3U50 C;  4A3M H;  1J5E L;  2FIN B;  4DR3 Q;  1LYL A;  5I2Y A;  4IUP A;  4LK1 C;  3F2U A;  2NVY B;  4NW2 A;  2KOL A;  3MXG A;  2B2W C;  1HH2 P;  1IXR A;  3P7J A;  2B2Y A;  4DNI A;  1EUJ A;  1GHJ A;  5C3X A;  1WTX A;  1STA A;  3RZO H;  1DOK A;  4YHH L;  3T1Y Q;  3TZU A;  2JA5 G;  3RNU A;  3MXU A;  5H1S E;  3NEN A;  4K6L A;  5KYI A;  5KRU A;  1HQR D;  2HHH Q;  4JI7 Q;  1YZ6 A;  1SYC A;  4NKL A;  3NBH B;  2VB2 X;  3KJP A;  4BWG B;  3PUX A;  4WFN 3;  3CCS A;  1KNA A;  3EA6 A;  2KQ3 A;  5T1G A;  2Q2H A;  2NUC A;  2DUD A;  3CCQ A;  3I70 A;  3DM3 A;  4YWL A;  1IYV A;  1Y1W G;  4XIG S;  3IL8 A;  3DM1 A;  3M85 A;  1HNW Q;  1AH9 A;  3P75 A;  3PO3 H;  4BS9 A;  2KED A;  2R3Z A;  1GD7 A;  3H09 A;  3M3Y B;  3GQB A;  1EL0 A;  2EYO A;  4ODG A;  3A0J A;  3VR3 A;  3HOU G;  1I4H A;  5ELD A;  2UUC Q;  4DV2 Q;  1IBL Q;  1HFN A;  3I4L A;  4JC0 A;  2PCF B;  2K01 A;  2Y0S E;  4NB3 A;  3U4Z A;  3S15 B;  1YNN C;  1JB3 A;  5EKK A;  1IYU A;  1PTO F;  3U9O A;  4EQP A;  1J9O A;  3NWS A;  3HKZ B;  1WCM G;  2R92 B;  2BDO A;  4Y52 H;  2K03 A;  4LFB L;  2AMC B;  1EYD A;  1JC7 A;  4HN7 A;  2VQF L;  5EBC A;  2BH2 A;  1E2Z A;  3G6J B;  3K59 A;  4CDE C;  5IE8 A;  3HOZ H;  1EOV A;  3HOW G;  1FNW A;  2IX1 A;  5KNC A;  2KA7 A;  5C4X H;  2QIL A;  2FHT A;  1LTA D;  5FOB B;  1S5F D;  1D5X C;  1BOS A;  2NYZ D;  5NUC A;  4DV0 L;  2XNA C;  1IHZ A;  4DR5 L;  2V1C C;  5CBA E;  3D8G A;  1X3E A;  1KDA A;  3I4N H;  2L5T A;  2EQS A;  4ABN A;  1PZK D;  3K8A A;  2ES2 A;  2PNH A;  3OTO Q;  2CW0 D;  5IT9 E;  2E2I H;  4DA2 A;  2L15 A;  2PNR C;  2FXQ A;  2WIN B;  3ERS X;  4L6T B;  2KEC A;  1BR9 A;  1JWU D;  3KLW A;  4PNY A;  2R7Z G;  4LF8 L;  2M9V A;  3PCO B;  4GLX A;  4M1U B;  3RD4 A;  4DAV A;  1TS5 A;  4TVA B;  1BDO A;  3S16 B;  2I0Q A;  3O13 A;  1KXL A;  1U4R A;  2N55 A;  2E2J H;  4CHT B;  4ZLT F;  5C6A A;  2NN6 H;  2UUB L;  2QKI C;  1FD7 D;  1HA6 A;  1NJI C;  4Z9C B;  1VQN A;  4JI8 Q;  1JWM D;  1N34 L;  2ICI A;  3RN5 A;  2NTT A;  3LNN A;  1SEB D;  2O4X A;  3A8J E;  3I2Z A;  1V1P B;  4A3L G;  4GKJ L;  1A0I A;  2A68 D;  1I50 B;  5BN4 A;  5CV8 A;  1YJN A;  1SE4 A;  4H0L C;  3PGZ A;  1E1T A;  1TY2 A;  1D1K A;  2OTL A;  4UHV A;  1Z47 A;  1XPR A;  2F0G A;  4G57 A;  2IX0 A;  4IOA A;  4RKL A;  4ZYS A;  2EZV A;  1WD0 A;  4QY7 A;  3HOV G;  4JK1 C;  1TWF H;  2J7Z A;  4A76 A;  3S2H H;  3MZ5 A;  2JA7 B;  1VQD A;  1NMF A;  2TMP A;  1W6K A;  5K36 H;  1O7Z A;  1GHK A;  3MXN A;  4C1N I;  3EQL C;  3A5Z B;  4Y7N H;  4DR1 Q;  2VQE L;  4ZUI A;  3BZK A;  4DV3 L;  3J7A V;  3QOJ A;  1CT1 D;  2RDF A;  3K81 C;  1VQP A;  5IP7 H;  5JVG 3;  4ZKC B;  4HJA A;  2CQO A;  4C3I B;  2UU9 L;  1K83 H;  2F0K A;  3GDE A;  1CZG A;  5E3F A;  4A3D G;  3HG9 A;  3K58 A;  5ELF A;  5M5Y H;  4XQN A;  3JAM L;  5C44 G;  1MGS A;  1AEX A;  4KN4 C;  4L5S A;  1PH7 A;  3SGI A;  5GAE C;  1EQR A;  2JA6 G;  1SYD A;  2E75 C;  3IFT A;  2K05 A;  3H3V C;  4IUN A;  1EWI A;  5F2D A;  4CDF C;  1LTL A;  2D2C C;  4IUV A;  1K3B C;  1YI2 A;  1EY4 A;  2WAQ G;  5C3W A;  1F9S A;  2PYK A;  2RF4 A;  1HZ9 A;  1L1O A;  4FF3 A;  4ZRZ A;  5M3M G;  1A2U A;  1NTG A;  1HUN A;  5EPJ A;  3PIO 3;  3I72 A;  1KNE A;  3CCL A;  1DGS A;  1N33 L;  2K6A A;  2D62 A;  2Z0S A;  2L1B A;  2A69 D;  5M5W B;  1SE8 A;  2G9D A;  4C2M B;  4K8J A;  3WWV A;  2EY2 A;  4KD3 A;  4LF5 Q;  4X66 Q;  3CD6 A;  1KD1 C;  3STB D;  2A5H A;  1VQC A;  1B70 B;  3GD7 A;  5JEA G;  1TWH H;  1EZ8 A;  5M3F G;  3CQZ B;  2K28 A;  2RDH A;  4LJZ C;  5C0X J;  2JA5 H;  2Q2I A;  2DJF C;  4FF1 A;  3BDO A;  3SDZ A;  4AQY L;  3S1Q B;  1JB7 A;  3DWA A;  2D0P A;  1SFO H;  4DAP A;  1L1O B;  2MQH A;  3TP5 A;  1FVI A;  2HCC A;  4A3J G;  3MC0 B;  5J1Z A;  4Q0F A;  3VR6 A;  1GJX A;  2G5D A;  2F03 A;  1X3P A;  4IFD I;  4JI0 L;  3VYT A;  2RQX A;  4GN3 B;  4JI1 Q;  5GAG C;  2CW0 C;  1Q86 C;  1X9N A;  1EIG A;  2CFM A;  2OWO A;  1Q8K A;  3CMA A;  1TKW B;  2NZ1 D;  4U67 3;  4UP9 A;  2EJM A;  2A6H C;  3OYY A;  3HS0 C;  1QUQ B;  2BA0 A;  2VXW A;  4YCU A;  2DN8 A;  1S5B D;  5AJ3 Q;  2JEA I;  3BYT B;  4O0A A;  2LY7 A;  4L8J A;  4BBS B;  4LFC Q;  1RD9 D;  4A3M B;  1BNZ A;  4RG1 A;  3T1H Q;  3KDF A;  5FKA C;  5IGG A;  3S1R H;  3CAM A;  1K9M C;  1C48 A;  4K8I A;  4JYA L;  2RCF A;  4BY1 G;  1PTO D;  4JI2 Q;  1A63 A;  1YHA A;  5E4X A;  3S14 B;  2F0V A;  1VQ8 A;  3RZO B;  2WKD A;  3MXP A;  3CPF A;  3E0E A;  2FMC A;  4DR2 Q;  3NP8 A;  2JJQ A;  4JW0 A;  5I9O A;  1BBX C;  1S40 A;  4WRD A;  1WCM H;  2H4O A;  1K8O A;  2MPM A;  1N9W A;  4YY3 Q;  2N49 A;  2JQO A;  1MKH A;  1BCP B;  2NTS A;  4HR7 B;  3HOW H;  1AW7 A;  1STN A;  2RDG A;  2JA9 A;  4XQQ A;  2K52 A;  2VL6 A;  3SK5 A;  2NN6 I;  1AP0 A;  1KDC A;  3J80 c;  3D4W A;  3A55 A;  1H9R A;  4HCS A;  3K5M A;  5G3L F;  1SYF A;  4HJ7 A;  4LAA A;  4I7A A;  2XGT A;  3D4D A;  1VQ7 A;  3GTM H;  3PO3 B;  1BF4 A;  1PVO A;  1O80 A;  1IBM L;  4LF4 L;  4A3I H;  1LM0 A;  4WJW A;  4QUC A;  2Z1C A;  3K6O A;  3GTJ H;  3HOY H;  1EY6 A;  1ZEQ X;  4HAE A;  2C9O A;  5FLM G;  2R7Z H;  1IBK L;  1UAP A;  1JT8 A;  1U0L A;  2PZU A;  3HOX G;  2K04 A;  2M00 A;  3JC6 6;  4IQZ A;  4HJ9 A;  1EY5 A;  1CQV A;  4RFB A;  4DUZ L;  2BCO A;  1UE6 A;  3GTL H;  3Q6S A;  1ENF A;  1L1O C;  4B3S Q;  4POF A;  2D9U A;  5EKL A;  4C3J G;  4ILW A;  5ELB A;  4X65 Q;  5FO7 B;  4NXM L;  4M8A A;  4A93 G;  3T16 A;  1LTR D;  4IFD G;  1H9J A;  1II3 A;  1FJG L;  3I73 A;  3EIV A;  2CKZ B;  3OPO A;  4HSP A;  1XYI A;  2D5D A;  1OXV A;  2WAQ E;  4A3L H;  4LWC A;  1I4R A;  2K4K A;  2ENB A;  5C4X B;  1QNU A;  5BN3 A;  2KUM A;  2UXD Q;  1TU2 B;  4J8Q A;  3STB C;  1C4Q A;  1A3T A;  1SAP A;  2F0F A;  2NVX B;  1VMP A;  4EQN A;  1K28 A;  2L0C A;  4IO9 A;  4LUV A;  3G6E A;  4B3M L;  1O7I A;  1QVG A;  4RHR A;  1PMR A;  4HSV A;  4LF7 L;  3I4N B;  1SRO A;  4QIW E;  1EFI D;  4P71 A;  1PFN A;  3J7A F;  1LTS D;  4A75 A;  3HOV H;  3ULJ A;  1BKB A;  4DXF A;  3PO2 G;  5KYL A;  1W3S A;  1D5M C;  2BE5 C;  4LNQ A;  1HPC A;  3TP7 A;  5DEH A;  3K80 C;  4AIM A;  4G4K A;  1NNX A;  2UXC L;  2B2U A;  4GOP B;  1XXG A;  3QWN A;  2BA1 A;  4A3C H;  5AFW A;  3M4P A;  1PH4 A;  1JWS D;  1KTK A;  3NPP A;  2IWH A;  2Y0S B;  3HRZ C;  4HED A;  2R6G A;  3NEL A;  2E2J B;  4UP8 A;  1DD2 A;  2ZXP A;  3F2C A;  5COY A;  2F0W A;  2NWG A;  2PW5 A;  4IPG A;  4RAU C;  1VCI A;  2JA6 H;  1CA6 A;  1W2B A;  4DV1 L;  2NZH A;  1O7L A;  3K0X A;  4DAY B;  4FXG C;  4GLV B;  4K2L A;  4DNT B;  3LWU A;  4UDU C;  2QA4 A;  1YEZ A;  3MHB A;  1PFB A;  1K8G A;  2V4D A;  1EQQ A;  1LT6 D;  5ISR A;  2PQA B;  4WJ4 A;  4JG2 A;  2AHO B;  1PTO C;  1TS3 A;  4DUY L;  2UXB Q;  2OQ0 A;  4X3U A;  4UAI A;  2B63 H;  2LKV A;  3PIO A;  3G7L A;  3A5U A;  3L3O C;  1V1Q A;  1PRT F;  1TWF B;  3S2H B;  1O78 A;  3ULP A;  1RIP A;  4Y7N B;  5IWA L;  3M7G A;  1Y1V G;  4OO1 G;  4QB4 A;  3C1E A;  5M3F H;  1ASZ A;  2K14 A;  3GTG H;  1FGB D;  1C8C A;  4X3S A;  3DWP A;  1K83 B;  3R8B A;  2F3I A;  1YNJ C;  4A3K G;  2YU9 H;  4PMC A;  1QNK A;  2TSS A;  1Z9F A;  5M5Y B;  1DJR D;  1B9M A;  1JMC A;  1B2T A;  3SK8 A;  1LTT D;  1BVS A;  1Q46 A;  3M7N A;  4NXN L;  1HFG A;  1EY0 A;  2A6E C;  2YV5 A;  4A3J H;  2NB0 A;  2EPB A;  2WB1 G;  1H9K A;  1RDP D;  3J81 L;  5EBD A;  1S4Z A;  2F52 A;  2K1B A;  1QZH A;  2DJG C;  4XTC S;  3MAQ A;  1I4Q A;  2H5X A;  2SNM A;  5IGF A;  3K0Y A;  2Q8R E;  1G6P A;  4K14 A;  3B6Y A;  5IY0 A;  4ALP A;  1VQ9 A;  2EYM A;  2Q2U A;  2QDB A;  4JV5 Q;  3NE5 B;  1S5D D;  1GUW A;  1ONL A;  4CBV A;  1RJT A;  4GOP C;  4DK0 A;  4PZ7 A;  4R4I A;  2PO4 A;  2L11 A;  1XJV A;  3GTP H;  2X69 A;  4XXE A;  4X62 L;  3I56 A;  3KBG A;  2VUM G;  4BY1 H;  1PH8 A;  3KYH C;  2L55 A;  3OHX C;  1NR2 A;  5C3E G;  2Z6K A;  1TWH B;  3T1Y L;  3FPP A;  1G2T A;  5I2X A;  4OWX B;  2YTX A;  2JA8 G;  2JA5 B;  4YWM A;  1F2M A;  1HZA A;  1IL8 A;  1DOM A;  1PLF A;  1VS0 A;  1EWH A;  3QR8 A;  5CR3 A;  5IYC G;  1BXT A;  2L4N A;  2Z6B A;  4A3B G;  5D14 A;  1SFO B;  2VZA A;  3D3R A;  3CC2 A;  4J6H A;  4OIK A;  4IUT A;  4GKK Q;  4NMZ A;  1ASY A;  3L9A X;  4WJ3 M;  1R4Q B;  1JE4 A;  2KHJ A;  1N36 L;  5D3D A;  3CC7 A;  4KKS A;  1XPO A;  3X3N A;  3VA7 A;  1HNZ Q;  3K5L A;  4FYD A;  2VS1 A;  4JI4 L;  4LF9 Q;  2B2U C;  1L0X B;  1RHP A;  2ALY B;  2JYO A;  2KCT A;  5BR8 L;  2K5W A;  5FLX L;  1L0Y B;  1J5E Q;  4FVM A;  3L7Z C;  1OXX K;  5LHY 1;  1J8I A;  3FVQ A;  2VB3 X;  3VYU A;  1B1Z A;  1M1K C;  1G2S A;  5A2Q E;  1BCP F;  1DCZ A;  1RTO A;  1XMQ L;  2YYZ A;  3ER0 A;  4YHH Q;  5FJ8 H;  3HOX H;  2WV6 D;  1T9H A;  2F0M A;  3S1R B;  1SYE A;  1EIH A;  5IGE A;  1X3F A;  1Z6H A;  1P16 A;  4DR6 Q;  1HZB A;  3K7A H;  4QQB X;  4ZK9 B;  5KNB A;  3RLO A;  5IOC A;  4MIU A;  1K3R A;  2N8N A;  1CFM A;  1WCM B;  3I90 A;  3TSS A;  3TBI B; 
#chains in the Genus database with same CATH homology
 4IFD H;  2L9H A;  3NSW A;  3M4Y A;  4CGY B;  2RVL A;  3OMC A;  3PIP 3;  2RSO A;  3KLS A;  5CYU A;  3HOW B;  3PUW A;  3MFY A;  2RA4 A;  3QB3 A;  2K32 A;  4IAL A;  2SOB A;  4HMI A;  3SK4 A;  1SYB A;  5TSS A;  2AWN A;  4RH6 A;  3SR1 A;  3TME A;  4IZ8 A;  1CK1 A;  2F0S A;  4KJO A;  3OWF A;  5HGT A;  3A54 A;  4V0B A;  4K5W A;  3GTM B;  5CMD A;  1X32 A;  3PUV A;  1T5X D;  3X3M A;  2FFK B;  4A3I B;  1WTO A;  3HOY B;  1TS4 A;  3GTJ B;  1V1P A;  3TP8 A;  2KCN A;  2R7Z B;  4XDX A;  3OW7 A;  1SMY D;  1STE A;  4H44 C;  4KKT A;  3OMG A;  1E2V A;  1G8Z D;  2A6H D;  4NP5 A;  2DNE A;  4CJ2 C;  4HMJ A;  1U4L A;  4PQX A;  2EVB A;  3T51 B;  4ULL A;  1ZYR C;  2G9H D;  1ET6 A;  3VYR A;  3A7A B;  4OGQ C;  1NCV A;  1T5E A;  2F0O A;  4WOR A;  1PRT D;  1CHQ D;  3HOV B;  1WVL A;  1NR4 A;  1QG7 A;  1Z7T A;  4RCO A;  2QEJ C;  3IFD A;  4OO1 H;  1ILP A;  5DAU A;  1F2Z A;  1K8M A;  4C3H G;  4IUU A;  3ONA B;  2EYF A;  1HTL D;  3K5O A;  1HUM A;  2ICE C;  3OIP A;  3MA2 B;  3LX0 A;  2OT2 A;  3SK6 A;  4R9W A;  1JOK A;  2JA6 B;  3H91 A;  1NUC A;  5M9O A;  3TP6 A;  3K57 A;  1RF2 D;  3BS1 A;  1DM0 B;  1IKM A;  3EVQ A;  1GUG A;  1QIL A;  2WAQ B;  1STG A;  4IUR A;  1KAA A;  1RCV D;  1JOR A;  1PRT B;  4IN3 A;  1SXT A;  1NSN S;  2ZXO A;  4NDX A;  2XWB B;  3TN2 A;  3OIQ A;  2WP8 J;  2B63 B;  2HUG A;  3EJI A;  3J80 L;  4QIW B;  3GV3 A;  2X6G A;  3NXW A;  2EXZ A;  1HCZ A;  1QOH A;  1F9Q A;  5M3F B;  2MGS A;  3GTG B;  2EJF C;  5C5L A;  4XT3 B;  2YU9 B;  1ET9 A;  3Q0A A;  4IFD J;  4C56 C;  4RA8 A;  2F0E A;  4A3J B;  1MSH A;  3KF8 A;  2A73 B;  4KTA A;  1Q3L A;  2BE5 D;  3CHB D;  1JOQ A;  1JCK B;  3JAM E;  3A56 A;  2KCC A;  4U68 A;  2HCI A;  4ZAI A;  2F0H A;  1EWC A;  3PV0 A;  3D6W A;  3R3O A;  3BVZ A;  1EY7 A;  1XTC D;  2X6L A;  1A3V A;  1GUT A;  3KK7 A;  1BCP D;  1SMY C;  4HCE A;  3ERO A;  3P1H A;  4RGN A;  1B53 A;  3GTP B;  2SNS A;  3NBI A;  3T56 B;  3QO2 A;  5COR A;  3PMF A;  1OXU A;  2BOS A;  4MN3 A;  2AUJ D;  1CA5 A;  3SEB A;  2B8F A;  1QJO A;  4DU9 A;  3MVV A;  1LTG D;  3FPU B;  2WII B;  4H7B A;  1ENA A;  2ZXR A;  1PRT C;  3DEO A;  2HDL A;  2Z4H A;  4J1M A;  2XRQ D;  4Q5V A;  4H13 C;  5KND A;  2DY7 A;  1D1I A;  3Q23 A;  1YNJ D;  3ZYY X;  2MP1 A;  3CRL C;  1CQF A;  1IKL A;  1GXD C;  2J0T D;  3PUZ A;  2PPB C;  2A6E D;  5CV5 A;  4RGM A;  2F0Q A;  1LO5 D;  1LT4 D;  2JE6 I;  2Z8L A;  3HOX B;  1A6X A;  4KI0 A;  3Q24 A;  1ZKO A;  3K7A B;  4QCL A;  5A35 A;  3VR2 A;  1DOL A;  3IKJ A;  4P2C B;  4A93 B;  4OO1 I;  1LTB D;  2NBF A;  4TRD A;  3S2D B;  2B39 A;  1A3U A;  3ND8 A;  2XRS D;  2EYL A;  5CV7 A;  4ZKB B;  3T13 A;  3I3C A;  3HOZ B;  5FO8 B;  5I9P A;  3LWE A;  4BBR B;  1W6J A;  3UI2 A;  2OXP A;  4DAY A;  3PO2 B;  4CKC A;  5C0X G;  2KHS A;  1TVX A;  4TSS A;  4OL7 A;  4HTH A;  3EFX D;  1I3Q B;  4KHZ A;  1LV9 A;  2EE1 A;  1DON A;  3NWT A;  2E2I B;  2J4X A;  2SDF A;  1D5Z C;  2AQ2 B;  2AQ3 B;  4R8N A;  1B4O A;  2MJ8 A;  1LAC A;  3E6Z X;  1V43 A;  1BCP C;  5T1I A;  2JEB I;  3NTI A;  5IOD A;  1QWY A;  3A8I E;  4DGZ A;  4QMG A;  1WTP A;  1AZP A;  1WD1 A;  1CTM A;  1Q8I A;  2XWJ B;  3OWE B;  2A74 C;  3MFG A;  3ITP A;  4ZQ3 A;  5EQ0 A;  4RGT A;  2KJX A;  4K6D A;  4F7X A;  1XWE A;  1LLR D;  1BQQ T;  1F9R A;  2F0T A;  1TT2 A;  1TY0 A;  2HQE A;  3W2D A;  2K5D A;  2F0I A;  4CKB A;  1VF5 C;  3FDT A;  5DNF A;  1LTI D;  2EYP A;  5IGB A;  4KV6 A;  5JEA H;  3D4R A;  3HGB A;  2Z4I A;  1F77 A;  1OXT A;  4O42 A;  2XVS A;  3FRP B;  4R8I A;  4G7H C;  2EDG A;  3N52 A;  1PZJ D;  4X3K A;  1WTV A;  1OXS C;  1MSG A;  2H1E A;  5K36 G;  1SE2 A;  2JP1 A;  3FEW X;  1EU3 A;  1U4P A;  1LT5 D;  5I6W A;  5E4W C;  3R2I A;  1JR0 D;  1ROD A;  3VYS A;  3BYY B;  1TII D;  3NQI A;  3MEH A;  2O5J C;  1SNQ A;  4EGV A;  4PMW A;  3CKI B;  1ZYR D;  2JA8 B;  3KLR A;  3I8Z A;  1PFM A;  5JPN C;  3QOL A;  3SE0 A;  1SNC A;  3ND9 A;  3VR5 A;  4K5X A;  4KMU C;  2LFN A;  5BN5 A;  1JIC A;  3C1F A;  2QCP X;  4OHJ A;  1B44 D;  5IIF A;  1HRJ A;  4EQO A;  4K2K A;  1GUO A;  5IGC A;  5JVH 3;  1EU4 A;  3J81 E;  3BDL A;  4LMQ D;  5G3L D;  1SBB B;  1D6E C;  1I4G A;  1Y1W B;  1QB5 D;  4C1N K;  1R4P B;  5I6Y A;  2F0L A;  3A7L A;  1B9N A;  4RWS C;  5M5X B;  1CI3 M;  1DXM A;  1KLG D;  3E0J A;  2IL8 A;  1GOZ A;  1DYQ A;  3NHH A;  2E2H B;  3C3L A;  3T53 B;  3HOU B;  3QIA A;  3I4M B;  1AZQ A;  2LS0 1;  1Y8N B;  4RGO S;  2XSC A;  3D31 A;  5D65 A;  4KJN A;  2C5C A;  5IT9 L;  2LMC B;  1PTO H;  3HEJ A;  4BA2 I;  1Y69 U;  5ELC A;  5ELE A;  5CV6 A;  2JXM B;  4BA1 I;  1PDQ A;  3AU7 A;  1EEI D;  3D6C A;  2F4I A;  1ENC A;  5C0X H;  1OO9 B;  3KUP A;  3URY A;  5FLX E;  4ME5 A;  3RMH A;  3OSO A;  1V8Q A;  2OF1 A;  3E5S A;  2Q8I B;  2N88 A;  1MD2 D;  3HP3 A;  2L12 A;  3IAY A;  5JEA J;  4S3S A;  4F87 A;  5CC4 A;  1TR5 A;  1KAB A;  1LT3 D;  5I4D A;  3GTL B;  3GTQ B;  1EEF D;  1HA5 A;  2I46 A;  3HZX A;  2B2T A;  3A8K E;  2MHV A;  1SNM A;  1D2B A;  4RHS A;  2R93 B;  2HDM A;  3VA5 A;  2K5Q A;  2PZT A;  5LL6 X;  2EY1 A;  2OEO A;  1ESF A;  3TDQ A;  1HQM C;  3BVM A;  1FNU A;  3DUZ A;  2BDN A;  1EYA A;  1F2Y A;  5JJZ A;  3QJY A;  3RZD B;  3SHL A;  4I7Z C;  1CM9 A;  1SDF A;  3WDN A;  1WTW A;  4C3H B;  1NAP A;  5C5M A;  2IT1 A;  5DM7 3;  4KY7 A;  1RTN A;  1G29 1;  4PV1 C;  4A3E B;  3AMU A;  3DEP A;  3GV6 A;  4QF4 A;  4DN4 M;  1AN8 A;  5EGT A;  4FXD A;  2B2Y C;  4A3D B;  2Q8T A;  1EQV A;  5C44 B;  1V1O A;  3BZD B;  4N9T A;  1VF7 A;  5EPK A;  4DFA A;  3MTS A;  2JSO A;  5EPL A;  2DNC A;  2AUK A;  3GO5 A;  3V2T A;  1STY A;  1I6H B;  4OIJ A;  4ZUJ A;  5M3M B;  1X3Q A;  2CHB D;  4FF4 A;  4RCN A;  1ML0 D;  1ILQ A;  2FMM A;  5EJW A;  3C46 A;  4CKE A;  4KK7 A;  2EY5 A;  1TS2 A;  4C3I G;  1GUS A;  2K7V A;  2QF7 A;  5FO9 B;  3DWQ A;  2F3V A;  2PMZ B;  2WAC A;  4EVO A;  3H94 A;  1JQY D;  1O7Y A;  5J22 A;  2CVR A;  3N6R A;  1QCB D;  4B9X A;  5KIX A;  1GUN A;  2PZW A;  2E74 C;  3J7Y W;  2FJ2 A;  4XT1 B;  4TKO B;  2ZT9 C;  1MI2 A;  3NUC A;  4KY6 A;  5IGD A;  3GTK B;  1TQO A;  2XIW A;  3AB9 A;  2KEE A;  1CHP D;  5FK9 C;  4DNR B;  1AFP A;  4JBW A;  4XYO A;  2R61 A;  1SYG A;  2E76 C;  1BUV T;  3FMC A;  1KLU D;  3BVG A;  2O5I C;  2DY8 A;  4A3F B;  4KN7 C;  1PZI D;  1EYC A;  2I07 B;  2B2T C;  3T4A C;  3J80 E;  4FF2 A;  2EJG C;  1XX8 A;  4BY1 B;  1EQT A;  5C0X I;  2F0U A;  1EY9 A;  3U9S A;  2KVM A;  4XYQ A;  3WOF A;  1BO0 A;  3NTH A;  1G6Z A;  5CGK A;  1A15 A;  1TWC B;  2F0N A;  4XQJ A;  4FXK C;  5C4J B;  4GZY C;  3ERQ A;  5D3I B;  1UNS A;  1Q1E A;  3OOC A;  2B8G A;  1SNP A;  1MBY A;  2A68 C;  1S5C D;  1RKN A;  4YIJ A;  1PXU A;  3S1N B;  4V19 0;  5JPM C;  3SXH A;  2PQE A;  4O1N A;  5CBE E;  4E6I A;  1G91 A;  2CQA A;  1QE6 A;  1I6V C;  4F8M A;  2B2V A;  2VNU D;  5E1F A;  1I4P A;  1M8A A;  1U4M A;  4C3J B;  3K5N A;  3TZD A;  4KY5 A;  4KKU A;  4BY7 B;  4DF7 A;  2F0J A;  1IW7 D;  1SE3 A;  1H9S A;  1PTO B;  2O2L D;  1R9T B;  4B9W A;  2F1M A;  1STB A;  2EOT A;  3CRK C;  3GP7 A;  1VMC A;  1F2L A;  1E0B A;  5CV9 A;  4AYB B;  3PUY A;  1U9R A;  5JOB A;  1CZW A;  3H6M A;  1FNV A;  4N9P A;  2ID0 A;  4PMB A;  3QG1 A;  1Q90 A;  3DMU A;  1WTQ A;  2E2D C;  1ZXT A;  5K5P A;  2NVQ B;  3RLF A;  2WKC A;  3BDC A;  3FKI B;  1UUP A;  4F88 A;  5C4H A;  2A69 C;  1B3A A;  4G7O C;  1JOO A;  2EYH A;  1H9S B;  4B08 A;  3NTK A;  3S1M B;  2B2W A;  3S9W A;  1DZ1 A;  1Q1B A;  1PYW D;  2IPK D;  1M4V A;  1F9P A;  2AQ1 B;  1E2W A;  4X3T A;  1HXY D;  4FP5 D;  3H0G B;  2K33 A;  4G7Z C;  1HTP A;  4MHE A;  3WOE A;  1S5E D;  1TWG B;  2MUY A;  4ID6 A;  5KEE A;  4I65 A;  1WTR A;  2EY6 A;  2XN9 C;  5HUR A;  4QUF A;  3Q22 A;  5KGU A;  1Y1V B;  3DXJ C;  2IX3 A;  3GTO B;  3NQT A;  2NN6 G;  1EY8 A;  1FR3 A;  1SJH D;  2M2L A;  5DM6 3;  3VR4 A;  1EOT A;  4A3K B;  1YNN D;  2IW3 A;  4FO2 A;  2GA4 B;  2RSN A;  3V96 A;  1I4X A;  1TWA B;  2F0P A;  1STH A;  2WB1 B;  2RBM A;  5EKI A;  1H9M A;  1A2T A;  2RKS A;  3BG3 A;  3P20 A;  3KBX A;  1FYC A;  2PW7 A;  4A3G B;  1Y8P B;  2B2V C;  1SND A;  3R2T A;  4K5V A;  1VDZ A;  3SVM A;  3M4O B;  1SNO A;  5LL6 S;  4DK1 A;  4IUQ A;  1HHV A;  2F0D A;  3I91 A;  1EZ6 A;  1SJE D;  5CV4 A;  2VUM B;  1IW7 C;  2EYJ A;  3RUZ A;  1Y8O B;  1SSO A;  5C3E B;  2IJ0 A;  4TQU S;  2SEB D;  4CJ0 B;  4RKB A;  3MWY W;  3CU7 A;  4KHV A;  1Q12 A;  1ESR A;  3W3A A;  4DXG A;  1UEA B;  3V05 A;  2F3W A;  3DHQ A;  3C2P A;  3KLS X;  4A3B B;  3NK9 A;  5A2Q L;  3NBH A;  3R93 A;  1KDB A;  2NVT B;  4FNF A;  1ICW A;  1LAB A;  5J39 A;  4CJ1 B;  2AWO A;  4L63 B;  1B50 A;  3S17 B;  4KD4 A;  5JAV A;  5C4Z A;  2FIN B;  5I2Y A;  4IUP A;  4LK1 C;  3F2U A;  2NVY B;  4NW2 A;  2KOL A;  3MXG A;  2B2W C;  3P7J A;  2B2Y A;  1GHJ A;  5C3X A;  1WTX A;  1STA A;  1DOK A;  3TZU A;  3MXU A;  5KYI A;  4K6L A;  5KRU A;  1HQR D;  4NKL A;  1SYC A;  2VB2 X;  4BWG B;  3PUX A;  4WFN 3;  1KNA A;  3EA6 A;  2KQ3 A;  5T1G A;  2NUC A;  3I70 A;  1IYV A;  4XIG S;  3IL8 A;  3DM1 A;  3M85 A;  3P75 A;  4BS9 A;  2KED A;  2R3Z A;  3H09 A;  3M3Y B;  3GQB A;  1EL0 A;  2EYO A;  4ODG A;  3VR3 A;  1I4H A;  5ELD A;  1HFN A;  3I4L A;  2PCF B;  2K01 A;  3S15 B;  1YNN C;  1JB3 A;  5EKK A;  1IYU A;  1PTO F;  3U9O A;  4EQP A;  1J9O A;  3NWS A;  3HKZ B;  2R92 B;  2BDO A;  2K03 A;  1EYD A;  1JC7 A;  4HN7 A;  5EBC A;  1E2Z A;  3G6J B;  3K59 A;  1FNW A;  2IX1 A;  5KNC A;  2KA7 A;  2QIL A;  2FHT A;  1LTA D;  5FOB B;  1S5F D;  1D5X C;  1BOS A;  2NYZ D;  5NUC A;  2XNA C;  1IHZ A;  5CBA E;  3D8G A;  1KDA A;  2L5T A;  4ABN A;  1PZK D;  2CW0 D;  5IT9 E;  4DA2 A;  2PNR C;  2WIN B;  4L6T B;  2KEC A;  1BR9 A;  1JWU D;  4PNY A;  2M9V A;  4M1U B;  3RD4 A;  4DAV A;  1TS5 A;  3S16 B;  1BDO A;  3O13 A;  1U4R A;  2N55 A;  4CHT B;  4ZLT F;  5C6A A;  2NN6 H;  2QKI C;  1FD7 D;  1HA6 A;  4Z9C B;  1JWM D;  2ICI A;  2NTT A;  3LNN A;  1SEB D;  2O4X A;  3A8J E;  1V1P B;  2A68 D;  1I50 B;  5BN4 A;  5CV8 A;  1SE4 A;  4H0L C;  1TY2 A;  1D1K A;  1Z47 A;  2F0G A;  4G57 A;  2IX0 A;  4RKL A;  4ZYS A;  2EZV A;  1WD0 A;  4JK1 C;  2J7Z A;  2JA7 B;  3MZ5 A;  2TMP A;  1W6K A;  5K36 H;  1O7Z A;  1GHK A;  3MXN A;  4C1N I;  3EQL C;  4ZUI A;  3J7A V;  3QOJ A;  1CT1 D;  2RDF A;  5JVG 3;  4ZKC B;  4C3I B;  2F0K A;  5E3F A;  1CZG A;  3HG9 A;  3K58 A;  5ELF A;  4XQN A;  3JAM L;  1MGS A;  1AEX A;  4KN4 C;  1SYD A;  2E75 C;  3IFT A;  2K05 A;  3H3V C;  4IUN A;  5F2D A;  2D2C C;  4IUV A;  1EY4 A;  5C3W A;  1F9S A;  2PYK A;  4FF3 A;  4ZRZ A;  1A2U A;  1HUN A;  5EPJ A;  3PIO 3;  3I72 A;  1KNE A;  2K6A A;  2D62 A;  2L1B A;  2A69 D;  5M5W B;  2G9D A;  4C2M B;  4K8J A;  2EY2 A;  4KD3 A;  2A5H A;  3GD7 A;  5JEA G;  1EZ8 A;  3CQZ B;  2K28 A;  2RDH A;  4LJZ C;  5C0X J;  4FF1 A;  3BDO A;  3SDZ A;  3S1Q B;  3DWA A;  4DAP A;  3TP5 A;  2HCC A;  3MC0 B;  5J1Z A;  4Q0F A;  3VR6 A;  1GJX A;  2F03 A;  1X3P A;  4IFD I;  3VYT A;  2RQX A;  2CW0 C;  1EIG A;  1TKW B;  2NZ1 D;  4U67 3;  2EJM A;  2A6H C;  3HS0 C;  2BA0 A;  2VXW A;  2DN8 A;  1S5B D;  2JEA I;  3BYT B;  2LY7 A;  4L8J A;  4BBS B;  1RD9 D;  4A3M B;  1BNZ A;  5FKA C;  5IGG A;  1C48 A;  4K8I A;  1PTO D;  5E4X A;  3S14 B;  2F0V A;  3RZO B;  2WKD A;  3MXP A;  2FMC A;  3NP8 A;  5I9O A;  1BBX C;  4WRD A;  2H4O A;  1K8O A;  2MPM A;  1BCP B;  2NTS A;  4HR7 B;  1AW7 A;  1STN A;  2RDG A;  4XQQ A;  3SK5 A;  2NN6 I;  1AP0 A;  1KDC A;  3D4W A;  3A55 A;  1H9R A;  4HCS A;  3K5M A;  5G3L F;  1SYF A;  4LAA A;  3D4D A;  3PO3 B;  1BF4 A;  1O80 A;  4WJW A;  4QUC A;  2Z1C A;  3K6O A;  1EY6 A;  1ZEQ X;  4HAE A;  2C9O A;  1UAP A;  2PZU A;  2K04 A;  2M00 A;  4IQZ A;  1EY5 A;  1CQV A;  4RFB A;  2BCO A;  3Q6S A;  1ENF A;  2D9U A;  5EKL A;  4C3J G;  4ILW A;  5ELB A;  5FO7 B;  4M8A A;  3T16 A;  1LTR D;  4IFD G;  1H9J A;  1II3 A;  3I73 A;  1XYI A;  3OPO A;  4HSP A;  2D5D A;  1OXV A;  1I4R A;  2ENB A;  5C4X B;  1QNU A;  5BN3 A;  2KUM A;  1TU2 B;  4J8Q A;  1C4Q A;  1SAP A;  1A3T A;  2F0F A;  2NVX B;  1VMP A;  4EQN A;  2L0C A;  4RHR A;  1PMR A;  4HSV A;  3I4N B;  1EFI D;  1PFN A;  3J7A F;  1LTS D;  4DXF A;  5KYL A;  2BE5 C;  1D5M C;  1HPC A;  3TP7 A;  5DEH A;  4G4K A;  2B2U A;  1XXG A;  3QWN A;  2BA1 A;  5AFW A;  1JWS D;  1KTK A;  3NPP A;  2IWH A;  2Y0S B;  3HRZ C;  4HED A;  2R6G A;  2E2J B;  1DD2 A;  2ZXP A;  5COY A;  2F0W A;  2NWG A;  2PW5 A;  4RAU C;  1VCI A;  1CA6 A;  1O7L A;  4FXG C;  4K2L A;  4DNT B;  3LWU A;  4UDU C;  3MHB A;  1PFB A;  2V4D A;  1LT6 D;  5ISR A;  1PTO C;  1TS3 A;  4X3U A;  4UAI A;  2LKV A;  3G7L A;  3L3O C;  1PRT F;  1TWF B;  3S2H B;  1O78 A;  4Y7N B;  3M7G A;  4OO1 G;  4QB4 A;  3C1E A;  1FGB D;  1C8C A;  4X3S A;  3DWP A;  1K83 B;  3R8B A;  1YNJ C;  4PMC A;  1QNK A;  2TSS A;  5M5Y B;  1DJR D;  1B9M A;  1B2T A;  3SK8 A;  1LTT D;  3M7N A;  1HFG A;  1EY0 A;  2A6E C;  2NB0 A;  2EPB A;  1H9K A;  1RDP D;  3J81 L;  5EBD A;  1S4Z A;  2K1B A;  4XTC S;  3MAQ A;  1I4Q A;  2SNM A;  5IGF A;  3K0Y A;  2Q8R E;  4K14 A;  2EYM A;  2QDB A;  3NE5 B;  1S5D D;  1GUW A;  1ONL A;  4CBV A;  1RJT A;  4DK0 A;  2PO4 A;  2L11 A;  2X69 A;  4XXE A;  3KBG A;  2L55 A;  3OHX C;  1NR2 A;  1TWH B;  3FPP A;  1G2T A;  5I2X A;  2JA5 B;  1F2M A;  1IL8 A;  1DOM A;  1PLF A;  1EWH A;  5CR3 A;  1BXT A;  2L4N A;  5D14 A;  1SFO B;  3D3R A;  4J6H A;  4OIK A;  4IUT A;  4NMZ A;  3L9A X;  1R4Q B;  1JE4 A;  5D3D A;  4KKS A;  3X3N A;  3VA7 A;  4FYD A;  3K5L A;  2B2U C;  1L0X B;  1RHP A;  2JYO A;  2K5W A;  5FLX L;  1L0Y B;  4FVM A;  3L7Z C;  1OXX K;  5LHY 1;  1J8I A;  3FVQ A;  2VB3 X;  3VYU A;  1B1Z A;  1G2S A;  5A2Q E;  1BCP F;  1DCZ A;  1RTO A;  2YYZ A;  2WV6 D;  3S1R B;  2F0M A;  1EIH A;  1SYE A;  5IGE A;  1Z6H A;  4ZK9 B;  5KNB A;  5IOC A;  4MIU A;  1CFM A;  1WCM B;  3I90 A;  3TSS A;  3TBI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...