5IGGA

Crystal structure of staphylococcal nuclease variant delta+phs v66h/i72e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKEEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/I72E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5iggA00
3V2TA 1STGA 2F0KA 4HMJA 2F0MA 4RKBA 3DMUA 4ZUIA 1JOQA 1EY7A 5IODA 1STBA 2F0VA 4S3SA 2PZUA 4ZQ3A 5EKKA 5IOCA 3MVVA 3OMCA 5CV4A 4DU9A 1II3A 5CV5A 5KGUA 2OEOA 4WRDA 5J39A 5KYLA 4EQNA 1ENAA 1KAAA 2F0GA 1SNQA 3BDCA 4K5WA 4KD3A 4NDXA 5EKLA 2OF1A 3MXPA 3S9WA 2PQEA 5IGEA 3DHQA 1SNDA 2EY5A 4N9PA 5EGTA 4OL7A 5IGCA 3SXHA 4K14A 2EYJA 2PYKA 5C6AA 2F0UA 4KV6A 3TP6A 2QDBA 5IGGA 1A3TA 1F2ZA 2F0PA 2EYMA 5C4HA 2F0TA 1STYA 2F0QA 5ISRA 2F0JA 2F0WA 1F2YA 2WACA 3P1HA 1NSNS 3EJIA 3NP8A 3TP8A 4DF7A 1TQOA 1SNCA 4J6HA 2EYPA 4LAAA 5CV6A 2F0NA 5I6WA 4KJOA 5CV8A 1A2UA 3OWFA 4MIUA 5E1FA 5KEEA 4KY5A 4KTAA 4I65A 4ZUJA 1SNPA 1EY5A 4ME5A 3E5SA 5M9OA 2EY1A 1EZ8A 2F0DA 2RBMA 1NUCA 4H7BA 5C5LA 1KDCA 4RKLA 4EQPA 3BDLA 5J22A 4F7XA 2M00A 2F0SA 2F3VA 5NUCA 3SHLA 3SK4A 3MZ5A 4K2KA 5F2DA 2LKVA 1SYEA 3RUZA 2HQEA 4K5XA 3D4WA 5C4ZA 3NXWA 1KDAA 2EY6A 1U9RA 1JORA 3R3OA 1SNOA 5IIFA 3VA5A 4KY7A 5KIXA 5IGDA 2F0EA 2EYOA 3EVQA 3HZXA 2PZWA 2EY2A 2O4XA 4EVOA 2F0FA 5K5PA 4KJNA 2KQ3A 4KHVA 3C1FA 1EY4A 2PW7A 4ODGA 3TP7A 1SYDA 1JOKA 2PW5A 4K8JA 1SYGA 1EY9A 3SK6A 5DEHA 3C1EA 3MHBA 3NUCA 4J1MA 3QOJA 1F2MA 2F0HA 1SYBA 3T13A 4NKLA 3ITPA 5CR3A 2KHSA 1A2TA 3SR1A 1EY0A 4B9XA 3OSOA 3TP5A 3NK9A 4G57A 5C5MA 1A3VA 3MEHA 5DAUA 3NQTA 2PZTA 3D6CA 2RDFA 4NMZA 1IHZA 2EYFA 4ID6A 3HEJA 3TMEA 4B9WA 4K5VA 4DGZA 1STNA 5CGKA 4E6IA 1RKNA 4QF4A 1EYCA 1STAA 1STHA 4TRDA 2RKSA 3EROA 5I9PA 5I9OA 3NHHA 5CV7A 4K6DA 4F8MA 1EZ6A 3LX0A 3SK5A 3PMFA 2ENBA 4K2LA 4YIJA 4EQOA 5JAVA 4N9TA 4NP5A 4PMCA 4QMGA 1KDBA 1SNMA 2F0OA 2F3WA 3QOLA 1AEXA 3D4DA 2EYLA 1SYFA 5J1ZA 5IGFA 2F0IA 1EQVA 3ERQA 1ENCA 1EY6A 1EYAA 1JOOA 4KY6A 3U9OA 3QB3A 3H6MA 3P75A 1KABA 5JOBA 3OMGA 4KD4A 5E3FA 5C3XA 4PNYA 3SK8A 5I6YA 4WORA 4IUNA 5C3WA 2F0LA 4DFAA 2EXZA 5CV9A 2OXPA 4HMIA 5HGTA 3T16A 4K8IA 5KRUA 3D8GA 1SYCA 4IALA 5KYIA 1A3UA 1EY8A 4PMBA 4R8NA 4IZ8A 4HTHA 4QB4A 1EYDA 2NUCA 2SOBA 5IGBA 2EYHA 1TT2A 2SNMA 2SNSA 5CC4A 1TR5A 5HURA
chains in the Genus database with same CATH superfamily
4IOCA 4IN3A 5IWAQ 3SE0A 1FYCA 2IL8A 4ZQ3A 5EJWA 4YHHQ 4JI4L 1K8MA 1VQHA 1HH2P 3C2PA 2E5LQ 3BDCA 2SEBD 4HR7B 3X3MA 4DV2L 2K5VA 4Y7NB 3J7A5 5IGGA 1A3TA 4JI0Q 2EJMA 2F0TA 2NN6I 1L0WA 1YJNA 3I4MH 2Q8IB 2YU9B 3KFUA 4HAEA 5CBAE 3A5UA 1PV4A 1E3PA 5BN5A 1NAPA 4A93H 3OWFA 4BY7G 4KK7A 1ICFB 3VR4A 4XQNA 2R92G 1J9OA 1N32L 4Q5VA 4XXEA 3TN2A 1HZBA 3KF8A 4H0LC 3CQZB 1G91A 1JQYD 1AZPA 1SYEA 2DJGC 2D5DA 1PTOC 4ZLTF 1L0YB 1Q3LA 2NN6H 1CT1D 4KY7A 3KF8B 2AMCB 3TRZA 2AQ1B 4HJ7A 4GN3B 1XWEA 2B29A 5JEAJ 4DN4M 4JG2A 4A3GH 3QOJA 1D2BA 4A3CH 3T4AC 3AQQA 1VQIA 3T51B 2RA4A 4JBWA 3Q24A 3UDGA 5FLXc 1PRTB 4EQOA 1DZ1A 2JA7H 2KBNA 4OX9Q 5GAEC 3GTLH 4JYAQ 3HOXG 3RZOH 4UHVA 2JN4A 1UUPA 1CI3M 2M9VA 3CRLC 3NTIA 4RCOA 1PRTD 2A6EC 4YCWA 2UXBQ 3A8IE 1EOVA 4DAVA 1GM5A 1HUNA 2H4OA 2UXDL 3CCEA 1EY8A 4JI1Q 5E4WC 1QVFA 1T5XD 4DV1L 2SNSA 4A3KG 4IFDJ 2BDNA 2XWJB 4L5QA 4S3SA 1SE8A 4NB3A 1WVLA 2PI2A 3GTOH 2LXJA 2MQHA 1SEBD 1SNQA 4K5WA 3BU2A 5LMUQ 3GQBA 1V1OA 3H91A 5IGCA 3DUZA 3J80E 2B63B 3TP6A 4G4KA 4JC0A 2UU9L 4XQQA 3RZDB 4BXXH 4MTNA 4IUUA 4MZ9A 5EPKA 5M5WB 4DV4L 1TU2B 1I4QA 2PCFB 1VQBA 5E1FA 5FLMH 2HCCA 4Y7NH 1SNPA 3S14H 3K81C 1VDZA 3A55A 1VQKA 3NSWA 2ZM6L 5M5YB 1TS4A 3JC66 4P71A 5JEAG 3ZYYX 3IL8A 4DK0A 2HDLA 3J80L 4JI4Q 1JJCB 1C9OA 2DY8A 1F9RA 2PW7A 3QO2A 1OXXK 3NWSA 3HOWB 4LFAL 1YI2A 3ER0A 1JJ2A 2AQ3B 4DNTB 3RLFA 4HIOA 4A3FH 1HCZA 2I07B 3HOUG 2E2DC 2EIFA 3TMEA 2QEXA 2X69A 1N32Q 2F3IA 1STAA 2RHSB 5C0XG 1I50B 1QE6A 2Z4HA 4A3IB 2PI2E 1EZ6A 1CSQA 1HR0W 4JI6L 1JC7A 4L5RC 2LY7A 2R61A 4JCVE 3E6ZX 3F2BA 2J7ZA 3PIOA 1EQVA 4X3KA 1JOOA 1EYAA 2R6GA 1LT3D 3H6MA 3SEBA 1XTCD 4ZYSA 4A4IA 5IYBG 1OXSC 2B2VA 3GTPH 1CA6A 4WJ4A 4IFDG 4HIDA 4RCNA 1Q81C 1DM0B 5K36G 4BA2I 4LWCA 1LACA 5KYIA 1RHPA 4R8NA 1G8ZD 1S40A 1Y8NB 3WOEA 2UUBL 3P20A 1GUTA 1JR0D 1STGA 4ZUIA 2K5NA 2I0QA 1S72A 1FVIA 1EU3A 2BE5D 4J8QA 5IYCH 1EL0A 4K0KL 5EKLA 1U4LA 2PQEA 1SE4A 2JA8G 1KHIA 3S17B 4KV6A 2AWNA 4X65L 1YJ9A 2Q8TA 2EYMA 4DV3L 1K3RA 2F0WA 2EVBA 2AKWB 1TQOA 2EYPA 4FP5D 1LT4D 3HOVB 1D5ZC 4DAMA 5KEEA 3MFGA 1SMYC 2UXDQ 4DR6L 4HSVA 3U4ZA 1J8IA 4DV1Q 3ND9A 5M5WH 5LMNW 2QCPX 1O80A 5M3MB 3KYHC 5C4ZA 4DV5L 4DV0Q 5C4XG 1H9KA 4TSSA 4P2CB 4A3JB 1NNXA 3CP0A 3TEHB 1KTKA 2NYZD 1MJCA 4EGVA 4Y52H 1E1TA 1JOKA 1UE6A 2PW5A 3K8AA 4LW1A 5ELOA 3PO2H 2VY3A 5M5YH 5COYA 5GAGC 1Q12A 2NZ1D 3R2IA 2IPKD 1SYBA 1HTPA 4A3LG 1XPRA 2UU9Q 1Y69U 3M4OB 1WYDA 3HOYG 1PH6A 3HP3A 4UP9A 2RDGA 2KCCA 2Y0SG 5DM73 4OO1I 4CJ2C 1F9QA 4GZYC 3M3YB 2OQKA 4DA2A 2PMZB 1A62A 2J4XA 5LL6S 2HD3A 3HOZB 3FPUB 5AFWA 1DOMA 3PMFA 4K2LA 4OELB 4YIJA 2WB1G 1IKMA 4DR3L 3A8JE 4NP5A 2ZM6Q 2F3WA 2A6HD 1U4MA 3NQIA 4A3EB 4LFBL 1GKHA 2DY7A 4IO9A 2ES2A 1KABA 2N55A 1I50H 1FL0A 4OHJA 3W2DA 3M4PA 4FF4A 4A3IH 1U0LA 1YHQA 2OTLA 2GN5A 1SAPA 4ZCKA 3K5MA 1HZCA 4LFAQ 4OO1H 4QCLA 4JOIC 2B2YA 2RF4A 4IZ8A 2R93G 2NUCA 3T1HL 3MTSA 4IUQA 2ATWA 2B3GA 3PUYA 3V96A 3J81c 1GO3E 4LUZA 2JXMB 1S5FD 4DU9A 1F77A 3VYSA 1C8CA 3J81j 4TQUS 4X3SA 2VUMB 1GVPA 3AFQA 4JI6Q 4MHEA 1E22A 3DEPA 2QA4A 3KUPA 1N33L 1J5EL 2EXDA 4XQJA 1YHAA 2VL6A 2E76C 1LUZA 1F2YA 1S5DD 1V9PA 4A3DG 3OIPA 4LAAA 1EFWA 4GN5A 4R1JA 2N8NA 2KOLA 3S17H 2RDHA 2WFWA 1C0AA 4KLKA 1WD1A 1T5EA 5NUCA 4HJ5A 1X3PA 2F3VA 1BVSA 2UUBQ 4ABNA 1XPOA 3TQYA 1U9RA 1G2TA 3CW2C 1SNOA 3M7GA 1K73C 5IT9E 2FHTA 4X3TA 2EY2A 4EVOA 1S4ZA 4K0KQ 1KIXA 3EBEA 3GD7A 4KHVA 1N9WA 1KRTA 1OXVA 2UXCL 4DR5L 1KNEA 5M3MH 3BVGA 3I73A 3K7AB 4X65Q 4RGNA 4DV3Q 3ITPA 4PG3A 4IOAA 1K3BC 4A3JH 1KQSA 2JA6B 1FNUA 4DV6L 2LSSA 1PA6A 1B2TA 1A15A 4BY7B 4E6IA 4QF4A 1YJWA 2FMCA 4TKOB 1M90C 4N8FA 4DR6Q 1TWGH 1TWCB 3NWTA 1TXYA 3M4OH 4ULLA 2N49A 3O13A 4BBRG 2A69C 5M5XB 2EYLA 3ONAB 1PRTF 2RCNA 3E9IA 3F8TA 3U9OA 4BY1G 4DV5Q 2DUDA 3M3YH 3OMGA 3HOZH 1G51A 1HNWL 5T1GA 2CCZA 5I6YA 2Q2TA 1OO9B 3DEOA 2L12A 1NE3A 3I8ZA 3UDFA 1ASZA 3FP9A 5KRUA 3MEFA 1Z7TA 2VS1A 4A3EH 4PMBA 3K59A 4CKBA 5IYDG 1V8QA 1TR5A 4OWTB 1HFGA 2NVQB 5EKKA 1H95A 2L1BA 2K50A 3PIPA 2EDGA 1FNWA 2ZT9C 1D6EC 1R9TH 3KDFA 2HDMA 1N36L 3TS2A 3A7LA 1TY0A 1VS0A 4XT1B 5EPLA 2KJXA 3M9BA 5JVH3 4DR3Q 1WD0A 1IKLA 2PPBC 1EIYB 4LFBQ 2A6HC 3FDTA 1SROA 3KDFB 3P1HA 1BQQT 1OXUA 1MGSA 1QWYA 1ZYRD 2K1BA 1XPUA 3T56B 1UNSA 4KJOA 2VUMH 3CC7A 4R4OA 4I65A 1M1KC 1ILPA 3E5SA 5M9OA 4N8X1 1EZ8A 4FVMA 2D62A 4KKUA 3LNNA 5L37A 1VQLA 4K2KA 4CHTB 4A3KB 1UAPA 4APVA 1WTXA 2AHOB 3NXWA 1IXRA 1KDAA 3PIO3 1U4RA 1IBKL 1GUWA 2MPMA 3LWEA 4TVAB 2F0FA 3PGZA 2GA4B 4GLVB 1MSGA 4BBSG 1HNXL 3RMHA 3NEMA 5C3EG 3PUWA 3CC2A 1N33Q 1J5EQ 2I5MX 2KVMA 2RQXA 4FDBA 2NB0A 3NPPA 1EY0A 3CCJA 3IKJA 3NK9A 1XTDA 4B9WA 4DK6C 1K28A 1DOKA 3JAMi 2RVLA 1ENFA 1SRUA 3K7AH 3SK5A 3DWAA 2UUCL 4JBJA 4PMCA 4QMGA 3J7AF 2ALYB 5J1ZA 2B39A 4ZKCB 1ENCA 2EQSA 4BY7H 2K75A 3FRPB 3L2PA 4JI1L 1ML0D 3I55A 5E3FA 5EBCA 1IBMQ 4IUNA 4X6AH 1CHQD 1E0BA 3A74A 1HFNA 5M5XH 1DXMA 3GTLB 4DR5Q 1O7ZA 1A3UA 2A8VA 5LHY1 2KCMA 4QL5A 5C4JB 4IUPA 2JP1A 4IJHA 1YNND 1L1OB 4DV6Q 4YWLA 5CV5A 2R7ZG 1KAAA 1NMFA 3PF4A 3K5OA 2JE6I 3NBHA 1B50A 4MNOA 1FR3A 1SNDA 4LF5L 4LF9L 2H1EA 5C6AA 3BG3A 4JI5L 1LABA 2MGSA 2NVQH 1F2LA 3GTJH 4GNXA 2F0QA 3GTOB 1A63A 1D8LA 3TP8A 3E0JA 4DXGA 2XVSA 1YHBA 4IPHA 2QKIC 1RTOA 1XJVA 2OT2A 5CV8A 4AYBG 3G7LA 2KECA 5A35A 4MIUA 3DLLA 1TVXA 3KK7A 4ZUJA 3GTGB 2IJ0A 4DR2Q 1AFPA 4GNXB 3HOXH 2HIVA 3ERSX 4IUVA 3IRBA 2LKVA 3BS1A 3PQIA 1K8GA 4GLXA 4JBKA 3S14B 1NR4A 1OXTA 1W6JA 4HJ8A 1CK1A 5ELEA 2FFKB 5LL6X 4A76A 1AZQA 3TP7A 4DNRB 1N36Q 2KHJA 1IYVA 5DLQE 1EY9A 3SK6A 4A3KH 1XNRQ 1YVCA 4H13C 1GHKA 3OWEB 3S2DB 3E3XA 1BCPF 4CGYB 2HIXA 2KHSA 3S15B 1BO0A 4C1NI 1JE4A 2D9UA 2R7DA 1QZHA 4RG1A 1FJGL 2ASBA 1MJEA 5DAUA 2MO1A 2QGQA 4DUZL 3UI2A 4ZK9B 1LYLA 2L5TA 2WV6D 1XNQQ 1QVGA 4A3FB 4IUTA 4CDDC 5JJKA 1AEXA 4L5TA 1GHJA 1PFNA 2JA9A 3BJUA 4H02A 2X6LA 2ZTDA 3RN2A 1SBBB 3QB3A 2Q2HA 5ELDA 1IBKQ 1PH4A 5C4XB 5KNDA 1IYUA 2BDOA 4C3HG 2E8GA 2OXPA 5FKAC 1HNXQ 1A8VA 3AYHB 2IX0A 3D8GA 3P7JA 2XRQD 2WAQB 4R9WA 3CPWA 5JEAH 2B2UA 5CC4A 1CHPD 3GTPB 4RKBA 1IL2A 4RAUC 3U4VA 4C2MB 1DGSA 5C0XJ 5JPMC 1X3GA 4L63B 5J39A 1WTWA 1RDPD 1X32A 3VDYA 3GTQB 2MUYA 1Q86C 1ASYA 3L0OA 5C4JH 2UUCQ 2OWOA 4KMUC 4G7OC 1DONA 3CC4A 3OTOL 2VZAA 4IFDI 3MXUA 1LTTD 2ICEC 4UPAA 5CV6A 4L5SA 1D5XC 3I70A 3M4QA 1HA5A 1PH2A 5JJIA 1EEFD 1EY5A 4DV0L 1NUCA 2MP1A 4RKLA 2XN9C 1ET6A 2WKCA 3VYRA 1Z6HA 2ZTEA 2ZXPA 1SJHD 5KNBA 3J7ZC 5IYBH 3PF5A 2EJGC 2LS01 2E2JB 4IFDH 3GTGH 1VMPA 4M8AA 2WAQE 2JA5G 5K36H 1RL2A 3KJPA 4CKCA 4A93G 1GUGA 1W3SA 1C4QA 4IURA 2L15A 2A19A 1SYDA 3SDZA 4ALPA 4LF5Q 4LF9Q 4K8JA 4HIKA 5G3LF 2B8FA 4JI5Q 4RGTA 4LMQD 4GOPA 5CR3A 2ZJRA 1E24A 1Y1WG 3BDOA 2JK8A 1TWFB 2NN6G 4POFA 3J80i 2PZTA 3PO2B 1IHZA 5CGKA 2JA8H 4KN7C 4IPDA 2DNEA 4XYOA 4CDEC 3PIP3 3S2DH 3EROA 4GOPB 1G6PA 4QUCA 1SR3A 2KCTA 4K6DA 4JI7L 3S15H 3K0XA 2Z6KA 4A3GG 2A68D 1EIGA 2R7FA 3D4DA 2F4VL 3DM1A 1B44D 4A3BB 2TMPA 1KD1C 4KD4A 2HUGA 5C3XA 3E0EA 4WORA 2E74C 4YWKA 5IP7G 4OWXB 3G48A 4O1NA 5CV9A 5IP9G 4BWGB 3C3LA 2WINB 2NVXB 1GOZA 5BN3A 1FGBD 3OW7A 5FO9B 4IALA 4GS3A 1UE1A 1ICWA 1O7LA 2IHEA 2KUMA 2SNMA 1STEA 5C4XH 1OTCA 2O5IC 2F0KA 1FJGQ 1STBA 3OMCA 4DUZQ 4WRDA 1UEBA 2JJQA 2CH4A 4EQ5A 1S5CD 4A3LH 1B53A 1XX8A 3Q0AA 1SFOB 2K7VA 4BBRB 1PH3A 3HOYH 1AW7A 3PO3G 3MXGA 4C2MH 2NVTB 1SSOA 1B4OA 2FINB 2MJ8A 1G6ZA 3GTQH 2RSOA 5FLXE 1A2UA 4WJ3M 3HGBA 3AB9A 4ME5A 1F9SA 1S3OA 2X6GA 4I7ZC 3T1YL 4F7XA 1NR2A 1WCMG 4HJAA 3HS0C 5F2DA 1EFID 2CFMA 1GXDC 1P16A 1PXUA 1HRJA 1KC8C 1K0RA 4CBVA 5K5PA 3HKZB 1Q82C 2KQ3A 1FD7D 3URYA 2HCIA 3LWUA 1PRTC 5DEHA 3OTOQ 2I5LX 2E2JH 3HKSA 4PZ8A 1BBUA 3GDEA 2EYFA 1PZKD 5KNCA 1CKMA 1VQ6A 4K5VA 2HHHL 1STNA 2D0OA 1C7YA 1EYCA 1B70B 4RGOS 2E75C 4NXML 3QG1A 4F8MA 3LX0A 1ILQA 1MHWC 2KCNA 1BCPB 1WTPA 1UEAB 1RIPA 4A3DH 1B7YB 2F0OA 1UWVA 2EZVA 1TWFH 1JMCA 1SYFA 3M7NA 2F0IA 3FMCA 5JOBA 1TWGB 4QJFA 5C3WA 1BCPD 1GJXA 3CCUA 1JB7A 4KHPL 3NENA 3T53B 4K8IA 2LXKA 5C3EB 2L55A 1SLJA 2CWPA 4PV1C 4IPGA 4A3BH 1EYDA 3W3AA 1YBYA 5EQ0A 5IGBA 1BDOA 1FNVA 1TT2A 1N8RC 3S1NB 3CMEA 4C3IG 2ID0A 4NW2A 2NVXH 1HA6A 1VQ8A 5CMDA 1ZKOA 2VW9A 3W1GA 3VYUA 2F0GA 4JI8L 1G2SA 3S9WA 2G9DA 4JI7Q 1K8OA 2EPBA 3BVMA 3KLSX 4OL7A 4AIMA 5GADC 1BR9A 2PYKA 4DPGA 2Z0SA 4X3UA 3MXNA 2F4VQ 2Z9HA 2F0PA 3BVZA 2WIIB 1R9TB 2QEJC 2XSCA 3WOFA 1PFMA 2B2WA 2F0NA 1U5KA 1Y1VG 2KEDA 3S1MB 4A3MG 1SFOH 3BYTB 4KY5A 3I4NG 3MXNB 3N6RA 4BBRH 2HT1A 2QW7A 1X3EA 2CHBD 5J22A 2NVTH 2L0CA 3FKIG 4JV5L 1CM9A 2BA1A 3VR5A 1B9NA 3W5OA 1EU4A 5DM63 4K5XA 4A75A 2Z6KC 3R3OA 1JORA 1HZ9A 3V05A 2PZWA 3H0GG 3L7ZC 2PMZE 5IE8A 1MBYA 4ODGA 2B63G 5IYDH 4R4CA 2KENA 4PZ6A 2K32A 4F88A 2JEAI 4UY8C 4UDUC 2G9HD 4J1MA 1LV9A 1WTQA 4V0BA 5CBEE 1B3AA 1WTHA 3JAMc 1KXLA 3PSIA 5IODA 4AYBB 3WDNA 3HEJA 1EWIA 1STHA 3DM3A 2PNRC 2BE5C 3U50C 5HGQA 3NHHA 1MSHA 2F1MA 3T1YQ 3K5NA 2ENBA 1IBML 5JAVA 1TWAH 4LK1C 4DUYL 1SNMA 2YV5A 5IGFA 1G291 3F2DA 1EY6A 2B2VC 3CAMA 4AH6A 3HOWG 5G3LD 2NBFA 4B3RL 3F2CA 3T16A 1VQ7A 4B3SL 3RLOA 1JT8A 2IX3A 2N88A 2R92B 1LTRD 2E2HH 3DXJC 4AQYL 5IT9L 2F0MA 1HZAA 1WI5A 4Q0FA 2VQFL 5CV4A 1CQFA 1II3A 2HHHQ 5C3EH 4A3IG 1JCKB 1VQOA 1JWSD 5FJ8G 1WFQA 4NXMQ 4OO1G 1YNJD 2G5DA 3S1NH 2VQEL 2JQOA 4JW0A 3SXHA 1A6XA 3HRZC 1MKHA 1IW7D 1VF5C 4DR2L 2YTXA 1PZJD 1TWHH 1PYBA 5EPJA 3S16H 3CRKC 1RJTA 1I5FA 4KHPQ 1Q46A 2AQ2B 3GTJB 1JJGA 2CQOA 2F0DA 3D3RA 1O7YA 3MZ5A 5C44G 4QIWB 3S1MH 1XNRL 1PHJA 3L3OC 1XMQL 3EVQA 3HOXB 1EYGA 3ICEA 3EFXD 1BOSA 4JI8Q 1EY4A 1Y8PB 2O5JC 1U4PA 1HXYD 1PYSB 4HEDA 4H44C 4F87A 3J81E 4OEMB 3T13A 4P72A 1XNQL 4FYDA 3BZKA 2QDLA 1XXGA 4FNFA 3SR1A 1I6VC 3HOVG 3S1QH 3OSOA 3FPPA 1YNXA 2EE1A 3KLSA 4UP7A 2YTVA 5I9OA 3QJYA 1BBWA 3TZDA 4JV5Q 2IHFA 1D7QA 1E2ZA 1CSPA 3A8KE 1IL8A 1X55A 1L2FA 2EJFC 5E7NA 1AH9A 1DOLA 3J81L 2B2YC 3SK8A 4QY7A 4CJ0B 4HMIA 3EQLC 2B2WC 3SVMA 2UUAL 2AUKA 1H9JA 4BA1I 2GVBA 3H3VH 1SN8A 1QG7A 2MHVA 3D0FA 1HR0L 1Y1WB 2D0PA 2C35B 1LM0A 2KA7A 2F0VA 3M85A 2XWBB 2Z4IA 3MWYW 3HOZG 2BOSA 4KKSA 5KGUA 5IY0A 1I94Q 3OOCA 2FMMA 1ZEQX 3GP7A 2R92H 1CKOA 4NDXA 2EOTA 2OF1A 1V1QA 5IGEA 4B3ML 4J15A 4CDCC 1CKNA 4A3EG 1Q7YC 3AFPA 4DUYQ 1L1OA 2QDBA 1ONLA 2K03A 2F0JA 3DWQA 4HJ9A 2R3ZA 4B3RQ 1CKNB 4JPBW 4HCEA 3UDXA 3HOUB 1X9NA 4C1NK 2CH4W 5M3FG 4B3SQ 2Q8RE 3MFYA 1N34L 1EEID 4DK3C 4LF6Q 2NZOA 4AQYQ 4YCVA 1HHVA 1Y8OB 4UAIA 4C3HH 3K0YA 1IYJB 2K33A 2VQFQ 3VA5A 1I4XA 2I5HA 2VUMG 3Q23A 2FXQA 1X3QA 3KBXA 2L4NA 1CTMA 2VQEQ 2K14A 2A74C 3NUCA 1F2MA 2NWGA 3BZDB 1IW7C 4RA8A 4KHZA 4C3JG 3J80c 1PYWD 2MFIA 3I72A 5LMNL 3NELA 5D3IB 3D6CA 2RDFA 2NVYH 1EWCA 2TSSA 1A0IA 1TS3A 5A2QE 3TS0A 1KLUD 1YIJA 5I9PA 2D2CC 5GAHC 4XT3B 1PTOH 1WCMB 1I3QB 2JSOA 3C46A 4DR1L 4IQZA 1PVOA 2JA8B 3A0JA 2OQ0A 2ZXRA 1XMQQ 3P75A 4FXKC 4O0AA 1K9MC 5GROA 1D1KA 3KLWA 2PNHA 1ZYRC 1ET9A 4GLAC 3OYYA 4HIMA 4R8IA 2VNUD 2JA6G 5A2QL 1E2VA 3G6EA 2JA5H 3NTKA 4JI2L 2K6AA 5FOBB 4JVZA 2Z1CA 1MD2D 3K58A 3I3CA 5JPNC 2BCOA 1EWHA 2JEBI 3DHQA 2N78A 4N9PA 2EY5A 1EIHA 1Y1WH 1CZWA 3N52A 2FJ2A 4CKEA 4BS9A 1DYQA 3I4LA 2MNAA 2RCFA 3VA7A 1NBWA 1NSNS 4OWWB 4FF3A 5C0XI 4LNQA 3HOYB 4FXGC 1KLGD 2Y0SB 4EX5A 2K04A 4QGUA 2RBMA 4H7BA 5EBDA 2UUAQ 2F52A 4DXFA 3CPFA 1HR0Q 2K5WA 4C3IB 1JE5A 2HQEA 2WB1B 2XNAC 3CU7A 3ZJYC 5IP7H 3GTMH 2EY6A 5IP9H 3HOUH 4O2DA 2F0EA 4XIGS 1I6HB 3K6OA 4KJNA 1UE7A 5C0XH 5ELNA 1X56A 2F03A 4B3MQ 3I90A 3MHBA 1IBLL 2F0HA 1GUSA 1D1IA 4FF2A 1QCBD 2XGTA 1B9MA 2R93B 4P75A 1SMYD 4B9XA 1VF7A 4RWSC 3VR6A 3TZUA 1D5MC 1Y1VB 1ESRA 4A3MB 3AEVA 2PO4A 1VQNA 2ICIA 2DN8A 4ZAIA 3I4NB 1YNNC 3I4MG 1F9PA 1CFMA 4KKTA 5CV7A 1N34Q 3PO3H 1DJRD 1I4GA 3CCQA 1HNZL 2ZXOA 3FKIB 4QQBX 4N9TA 4PMWA 3QOLA 1VQEA 1M4VA 1TS2A 2Y0SE 3AU7A 1QILA 4DK1A 2K01A 1JWMD 4HCSA 1L1OC 1LT5D 1AP0A 4R4QA 3D4RA 5DNFA 1PFBA 1TIID 2LMCB 3H0GB 3RN5A 5CYUA 3DWPA 4A3DB 5CORA 5HY6A 1WCMH 1I3QH 2WB1E 2OTJA 1Z47A 3RD4A 1KAWA 3H15A 1X54A 4JOIA 3Q6SA 2B8GA 1KDCA 5HURA 3FVQA 2XRSD 3V2TA 4P74A 5LMNQ 3DMUA 4QUFA 1EUJA 3NBIA 4A3CG 2P5ZX 2QILA 3TREA 2C5CA 4IPCA 2YU9H 2VB2X 3S24A 4GNXC 4K14A 1MIUA 4DR1Q 4DV7L 1QJOA 4MN3A 1UE5A 1STYA 3QR8A 1SMXA 1PH9A 2XIWA 5EAYA 4X66L 2JA7G 2WACA 2LFNA 3NP8A 3GV3A 3CQZH 3BYYB 1VQ5A 1Q1EA 4J6HA 4YY3L 1Q8IA 1Z9FA 4DV2Q 4RHRA 2Z6BA 4DNIA 2CWAA 3KOJA 1LO5D 1LTID 1HUMA 3RNUA 5C5LA 1XMOL 1WJJA 5D65A 3SHLA 3SK4A 3HG9A 4JI3L 1CZGA 5I4DA 1ESFA 2CW0D 4GKJL 3K57A 4JI2Q 3RLNA 1I4HA 5KIXA 5IGDA 4BY1B 3U58A 2B2TA 4XYQA 5EKIA 1EQRA 1VMCA 3B6YA 2Z8LA 4C3IH 1HPCA 3C1EA 3VYTA 1VQPA 4POGA 4DAPA 1DD2A 4CDFC 4GKKL 1MI2A 2M2LA 3L9AX 4XTCS 1TS5A 1K83B 5D14A 1I6HH 1JB3A 3GO5A 3I4OA 3KJOA 1QOHA 2HQLA 3F1ZA 1H9RA 4ID6A 5H1SE 1PTOF 4BXXG 5I2XA 3D31A 1WTOA 1ZXTA 2IW3A 2OCEA 2R93H 5FLMG 1WTVA 1I4RA 5C44B 1Q90A 1KDBA 3H09A 4WJWA 1Y1VH 4A3MH 2I46A 2DNCA 3E9HA 3I4NH 5FLXL 1QNKA 4X62L 1QZGA 3MAQA 1GUOA 1TWAB 4O42A 2F0LA 4YWMA 1BUVT 5IT9c 3FKIH 3A54A 2B2UC 1VQ4A 4OXPA 4M1UB 1CQVA 1IBLQ 4HTHA 3UE0A 5ELCA 1AN8A 2YYZA 1CUKA 3AMUA 1PH5A 3UDIA 3KBGA 3H0GH 4DR4L 4ZRZA 1I4PA 1DCZA 2K05A 3ULPA 2B63H 1EIFA 3MVVA 3IAYA 2OEOA 4RGMA 4XDXA 5KYLA 2E2HB 4A3FG 4EQNA 4KD3A 3RZDH 2A69D 4R4IA 4PZ7A 1M8AA 5EGTA 5TSSA 1HNZQ 2MO0A 3IFDA 4B3TL 2DJFC 4BBSB 2N3SA 2YTYA 1F2ZA 5ISRA 3R2TA 2IWHA 1VQ9A 3CD6A 4LF7L 4LF4L 3EA6A 3EJIA 3S2HB 4DF7A 4NXNL 1W2BA 2A73B 3Q8DA 3HKZE 2JYOA 1BKBA 1NTGA 2WAQG 2J0TD 1LTSD 2EY1A 1TWHB 3RR5A 4EQPA 3BDLA 2M00A 1JWUD 4DV4Q 3UE1A 2L11A 3S16B 1L0XB 2K5DA 4HN7A 3HOWH 3G6JB 3R93A 2A68C 5IIFA 2VXWA 2WKDA 3HZXA 4RHSA 2NTTA 4LJZC 2IY5B 3CHBD 4GOPC 5J3BA 2K5HA 3NE5B 5IYCG 1K8AC 1SYGA 1YZ6A 4DV7Q 3QWNA 3K80C 3PV0A 2K4KA 4X66Q 1E1OA 2O2LD 3STBD 4BY1H 5FJ8H 1HJPA 4YY3Q 1E7ZA 1A3VA 5GQOA 5JJZA 4CJ1B 1SDFA 1RKNA 3PUVA 3SGIA 1EQQA 5M3FB 3PUXA 1XMOQ 1PLFA 2RSNA 1WOCA 3S1QB 4JI3Q 2R7ZB 2E2IB 3TSSA 1K83H 3GTKB 4GKJQ 4RMFA 3K5LA 2CW0C 3F2UA 1PDQA 2RHQB 1TY2A 3MC0B 2WP8J 1VQAA 4K6LA 4G7HC 1X65A 3X3NA 2BA0A 3KF6A 4DFAA 3KLRA 1HQRD 2EXZA 2AUJD 4YCUA 1PH1A 1KL9A 3I7FA 4X64L 5C44H 2ZJQA 2CVRA 4ME3A 1Q1BA 4LFCL 1SYCA 3LGJA 1I94L 4DAYA 4GKKQ 4RFBA 4UP8A 4C3JB 1GD7A 4U673 1HTLD 3PO2G 3KF6B 4HMJA 4LF8L 4HSPA 4OGQC 4DKAC 3CCMA 2PZUA 1LTBD 2C9OA 1WTRA 4DAYB 1ENAA 1NY4A 2BH8A 1VQJA 1SXTA 3MXPA 3U9SA 2IX1A 2V4DA 4RH6A 4C56C 5BR8L 2EYJA 3WWVA 3HOVH 4A3BG 2B2TC 1AE2A 1QVCA 1O78A 1RD9D 1J6QA 4OIKA 1CA5A 4X62Q 4DR7L 3G4SA 4WFN3 1SNCA 4LF6L 5I6WA 1B1ZA 5AJ3L 3I2ZA 4BBSH 2IT1A 1SJED 1RODA 4L8JA 1QB5D 4L6TB 4OIJA 4IJLA 2H5XA 2F0SA 3EN2A 5D3DA 5JJLA 1V1PA 3S2HH 1BBXC 1TKWB 2BH2A 3RUZA 4DR4Q 1PH7A 1EQTA 1LTAD 3D4WA 3S1RB 1VQMA 4AYBE 1PZID 2O4XA 1B3QA 1V1PB 4LUOA 2K28A 1YEZA 1P8LA 1SE2A 4LUVA 4B3TQ 1O7IA 4C3HB 3A5ZB 5ELFA 3J7AV 2VB3X 1BCPC 1IZ6A 1LT6D 3VR2A 4NKLA 3CCSA 1H9SA 4LF7Q 2XTIA 4LF4Q 1XYIA 1NMGA 5IWAL 3ULJA 2KHIA 3TP5A 4NXNQ 4G57A 5C5MA 3MEHA 1LTGD 4DGZA 3NQTA 4B08A 1K0SA 1E2WA 3OPOA 4NMZA 2CKZB 4YHHL 1R4PB 3BZCA 2E5LL 1H9SB 2DGYA 2K52A 3CKIB 3CCRA 1PMRA 3QIAA 1VQFA 5BN4A 2NVYB 3EIVA 1T9HA 4JI0L 3ERQA 1Y14B 1SE3A 3HKZG 2QF7A 3CXCA 4JBMA 4FF1A 1HQMC 5M3FH 1PTOB 3NTHA 1EOTA 2R7ZH 2E2IH 3M4YA 1AE3A 3GTKH 5HGTA 4G7ZC 4ILWA 3D6WA 1LLRD 1S5ED 4Z9CB 3K7UC 2SOBA 3G71A 4KN4C 3A56A 1QNUA 3H3VI 5ELBA 1PTOD 5M3MG 3STBC 1JOQA 1EY7A 1RCVD 3PCOB 1JICA 1VQGA 1PFSA 5IOCA 3J81i 3IFTA 1S5BD 4A3JG 3I4MB 3T1HQ 1KNAA 1RF2D 5FO7B 2JA5B 4JK1C 4C3JH 4A93B 3CMAA 2NZHA 1V43A 4QIWE 5FK9C 2F0UA 3I91A 2KEEA 4U68A 3JAME 3CCVA 5FO8B 5C4HA 1QUQA 1NCVA 5JVG3 1RTNA 3J7YW 3HFZB 1VCIA 4KTAA 2AWOA 4X64Q 2GVAA 4LFCQ 1QUQB 3OW2A 1BF4A 3H94A 4P73A 1B8AA 2F4IA 4LF8Q 3CCLA 3CF5A 4OX9L 4JYAL 4FXDA 4A3GB 1YITA 3ND8A 2ZJPA 2SDFA 4NPSA 2EYOA 2NTSA 1KRSA 2PQAA 2A5HA 1FGUA 2A6ED 3JAML 1C48A 3C1FA 1VQDA 5E4XA 2JA6H 2UXBL 3FHWA 3OHXC 1R4QB 5BR8Q 4KI0A 3GTMB 3Q22A 3ULLA 5I2YA 1PH8A 3S1RH 1H9MA 3VR3A 1GUNA 2PQAB 4MTKA 3MA2B 3TDQA 2JA7B 3OIQA 1TWCH 4DR7Q 1A2TA 1LTLA 3PUZA 1BNZA 3H3VC 2Q2IA 2UXCQ 5AJ3Q 3RZOB 1W6KA 1X6OA 2Q2UA 4TRDA 2RKSA 3I56A 4V190 5LMUL 4OONA 1VQCA 1X3FA 2V1CC 4R4TA 2ZTCA 4I7AA 1YNJC 4FO2A 3FEWX 1NJIC 4KY6A 2K5QA 3PO3B 4PNYA 1Q8KA 3TBIB 5T1IA 3W1BA 2A1AA 3GV6A 4PQXA 3R8BA 3A7AB 4GN4B 4QB4A 4ZKBB 1HNWQ 3NBHB 2L9HA 2EYHA 1BXTA 2CQAA
chains in the Genus database with same CATH topology
4IN3A 3SE0A 1FYCA 2IL8A 4ZQ3A 5EJWA 1K8MA 3C2PA 3BDCA 2SEBD 4HR7B 3X3MA 4Y7NB 5IGGA 1A3TA 2EJMA 2F0TA 2NN6I 2Q8IB 2YU9B 4HAEA 5CBAE 5BN5A 1NAPA 3OWFA 4KK7A 3VR4A 4XQNA 1J9OA 4Q5VA 4XXEA 3TN2A 3KF8A 4H0LC 3CQZB 1G91A 1JQYD 1AZPA 1SYEA 2D5DA 1PTOC 4ZLTF 1L0YB 1Q3LA 2NN6H 1CT1D 4KY7A 2AQ1B 1XWEA 5JEAJ 4DN4M 3QOJA 1D2BA 3T4AC 3T51B 2RA4A 4JBWA 3Q24A 1PRTB 4EQOA 1DZ1A 4RCOA 1UUPA 1CI3M 2M9VA 3CRLC 3NTIA 1PRTD 2A6EC 3A8IE 4DAVA 1HUNA 2H4OA 1EY8A 5E4WC 1T5XD 2SNSA 4IFDJ 2BDNA 2XWJB 4S3SA 1WVLA 1SEBD 1SNQA 4K5WA 3GQBA 1V1OA 3H91A 5IGCA 3DUZA 3J80E 2B63B 3TP6A 4G4KA 4XQQA 3RZDB 5EPKA 4IUUA 5M5WB 1TU2B 1I4QA 2PCFB 5E1FA 2HCCA 1SNPA 1VDZA 3A55A 3NSWA 5M5YB 1TS4A 5JEAG 3ZYYX 3IL8A 4DK0A 2HDLA 3J80L 2DY8A 1F9RA 2PW7A 3QO2A 1OXXK 3NWSA 3HOWB 2AQ3B 4DNTB 3RLFA 1HCZA 2I07B 2E2DC 3TMEA 2X69A 1STAA 5C0XG 1I50B 1QE6A 2Z4HA 4A3IB 1EZ6A 1JC7A 2LY7A 2R61A 3E6ZX 2J7ZA 1EQVA 4X3KA 1JOOA 1EYAA 2R6GA 1LT3D 3H6MA 3SEBA 1XTCD 4ZYSA 1OXSC 2B2VA 1CA6A 4IFDG 4RCNA 1DM0B 5K36G 4BA2I 5KYIA 1LACA 1RHPA 4R8NA 1G8ZD 1Y8NB 3WOEA 3P20A 1GUTA 1JR0D 1STGA 4ZUIA 1EU3A 2BE5D 4J8QA 1EL0A 5EKLA 1U4LA 2PQEA 1SE4A 3S17B 4KV6A 2AWNA 2Q8TA 2EYMA 2F0WA 2EVBA 1TQOA 2EYPA 4FP5D 1LT4D 3HOVB 1D5ZC 5KEEA 3MFGA 1SMYC 4HSVA 1J8IA 3ND9A 2QCPX 1O80A 5M3MB 5C4ZA 1H9KA 4TSSA 4P2CB 4A3JB 1KTKA 2NYZD 4EGVA 1JOKA 2PW5A 5COYA 1Q12A 2NZ1D 3R2IA 2IPKD 1SYBA 1HTPA 1Y69U 3M4OB 3HP3A 2RDGA 2KCCA 5DM73 4OO1I 4CJ2C 1F9QA 4GZYC 3M3YB 4DA2A 2PMZB 3HOZB 2J4XA 5LL6S 3FPUB 5AFWA 1DOMA 3PMFA 4K2LA 4YIJA 1IKMA 3A8JE 4NP5A 2F3WA 2A6HD 1U4MA 3NQIA 4A3EB 2DY7A 1KABA 2N55A 4OHJA 3W2DA 4FF4A 1SAPA 3K5MA 4OO1H 4QCLA 2B2YA 4IZ8A 2NUCA 3MTSA 4IUQA 3PUYA 3V96A 2JXMB 1S5FD 4DU9A 1F77A 3VYSA 1C8CA 4TQUS 4X3SA 2VUMB 4MHEA 3DEPA 3KUPA 4XQJA 2E76C 1F2YA 1S5DD 3OIPA 4LAAA 2KOLA 2RDHA 1WD1A 1T5EA 5NUCA 1X3PA 2F3VA 4ABNA 1U9RA 1G2TA 1SNOA 3M7GA 5IT9E 2FHTA 4X3TA 2EY2A 4EVOA 1S4ZA 3GD7A 4KHVA 1OXVA 1KNEA 3BVGA 3I73A 3K7AB 4RGNA 3ITPA 2JA6B 1FNUA 1B2TA 1A15A 4BY7B 4E6IA 4QF4A 2FMCA 4TKOB 1TWCB 3NWTA 4ULLA 3O13A 2A69C 5M5XB 2EYLA 3ONAB 1PRTF 3U9OA 3OMGA 5T1GA 5I6YA 1OO9B 3DEOA 2L12A 3I8ZA 5KRUA 1Z7TA 4PMBA 3K59A 4CKBA 1V8QA 1TR5A 1HFGA 2NVQB 5EKKA 2L1BA 2EDGA 1FNWA 2ZT9C 1D6EC 2HDMA 3A7LA 1TY0A 4XT1B 5EPLA 2KJXA 5JVH3 1WD0A 1IKLA 2PPBC 2A6HC 3FDTA 3P1HA 1BQQT 1OXUA 1MGSA 1QWYA 1ZYRD 2K1BA 3T56B 1UNSA 4KJOA 4I65A 1ILPA 3E5SA 5M9OA 1EZ8A 4FVMA 2D62A 4KKUA 3LNNA 4K2KA 4CHTB 4A3KB 1UAPA 1WTXA 3NXWA 1KDAA 3PIO3 1U4RA 1GUWA 2MPMA 3LWEA 2F0FA 2GA4B 1MSGA 3RMHA 3PUWA 2KVMA 2RQXA 2NB0A 3NPPA 1EY0A 3IKJA 3NK9A 4B9WA 1DOKA 2RVLA 1ENFA 3SK5A 3DWAA 4PMCA 4QMGA 3J7AF 5J1ZA 2B39A 4ZKCB 1ENCA 3FRPB 1ML0D 5E3FA 5EBCA 4IUNA 1CHQD 1E0BA 1HFNA 1DXMA 3GTLB 1O7ZA 1A3UA 5LHY1 5C4JB 4IUPA 2JP1A 1YNND 5CV5A 1KAAA 3K5OA 2JE6I 3NBHA 1B50A 1FR3A 1SNDA 2H1EA 5C6AA 3BG3A 1LABA 2MGSA 1F2LA 2F0QA 3GTOB 3TP8A 3E0JA 4DXGA 2XVSA 2QKIC 1RTOA 2OT2A 5CV8A 5A35A 3G7LA 2KECA 4MIUA 1TVXA 3KK7A 4ZUJA 3GTGB 2IJ0A 1AFPA 4IUVA 2LKVA 3BS1A 3S14B 1NR4A 1OXTA 1W6JA 1CK1A 5ELEA 2FFKB 5LL6X 1AZQA 3TP7A 4DNRB 1IYVA 1EY9A 3SK6A 4H13C 1GHKA 3OWEB 3S2DB 1BCPF 4CGYB 2KHSA 3S15B 1BO0A 4C1NI 1JE4A 2D9UA 5DAUA 3UI2A 4ZK9B 2L5TA 2WV6D 4A3FB 4IUTA 1AEXA 1GHJA 1PFNA 2X6LA 1SBBB 3QB3A 5ELDA 5C4XB 5KNDA 1IYUA 2BDOA 4C3HG 2OXPA 5FKAC 2IX0A 3D8GA 3P7JA 2XRQD 2WAQB 4R9WA 5JEAH 2B2UA 5CC4A 1CHPD 3GTPB 4RKBA 4RAUC 4C2MB 5C0XJ 5JPMC 4L63B 5J39A 1WTWA 1RDPD 1X32A 3GTQB 2MUYA 4KMUC 4G7OC 1DONA 4IFDI 3MXUA 1LTTD 2ICEC 5CV6A 1D5XC 3I70A 1HA5A 1EEFD 1EY5A 1NUCA 2MP1A 4RKLA 2XN9C 1ET6A 2WKCA 3VYRA 1Z6HA 2ZXPA 1SJHD 5KNBA 2EJGC 2LS01 2E2JB 4IFDH 1VMPA 4M8AA 5K36H 4CKCA 1GUGA 1C4QA 4IURA 3SDZA 1SYDA 4K8JA 5G3LF 2B8FA 4RGTA 4LMQD 5CR3A 3BDOA 1TWFB 2NN6G 2PZTA 3PO2B 5CGKA 1IHZA 4KN7C 2DNEA 4XYOA 3PIP3 3EROA 4QUCA 4K6DA 2A68D 1EIGA 3D4DA 3DM1A 1B44D 4A3BB 2TMPA 4KD4A 2HUGA 5C3XA 4WORA 2E74C 5CV9A 4O1NA 3C3LA 4BWGB 2WINB 2NVXB 1GOZA 5BN3A 1FGBD 3OW7A 5FO9B 4IALA 1ICWA 1O7LA 2SNMA 2KUMA 1STEA 2O5IC 2F0KA 1STBA 3OMCA 4WRDA 1S5CD 1B53A 1XX8A 3Q0AA 1SFOB 2K7VA 4BBRB 1AW7A 3MXGA 2NVTB 1SSOA 1B4OA 2FINB 2MJ8A 1G6ZA 2RSOA 5FLXE 1A2UA 3HGBA 3AB9A 4ME5A 1F9SA 2X6GA 4I7ZC 4F7XA 1NR2A 3HS0C 5F2DA 1EFID 1GXDC 1PXUA 1HRJA 4CBVA 5K5PA 3HKZB 2KQ3A 1FD7D 3URYA 2HCIA 3LWUA 1PRTC 5DEHA 5KNCA 2EYFA 1PZKD 4K5VA 1STNA 1EYCA 4RGOS 2E75C 3QG1A 4F8MA 3LX0A 1ILQA 2KCNA 1BCPB 1WTPA 1UEAB 2F0OA 2EZVA 1SYFA 3M7NA 2F0IA 3FMCA 5JOBA 1TWGB 5C3WA 1BCPD 1GJXA 3T53B 4K8IA 5C3EB 2L55A 4PV1C 1EYDA 3W3AA 5IGBA 5EQ0A 1BDOA 1FNVA 1TT2A 3S1NB 4C3IG 2ID0A 4NW2A 1HA6A 5CMDA 1ZKOA 3VYUA 2F0GA 1G2SA 3S9WA 2G9DA 1K8OA 2EPBA 3BVMA 3KLSX 4OL7A 1BR9A 2PYKA 4X3UA 3MXNA 2F0PA 3BVZA 2WIIB 1R9TB 2QEJC 2XSCA 3WOFA 1PFMA 2B2WA 2F0NA 2KEDA 3S1MB 3BYTB 4KY5A 3N6RA 2CHBD 5J22A 2L0CA 1CM9A 2BA1A 3VR5A 1B9NA 1EU4A 5DM63 4K5XA 1JORA 3R3OA 3V05A 2PZWA 3L7ZC 1MBYA 4ODGA 2K32A 4F88A 2JEAI 4UDUC 2G9HD 4J1MA 1LV9A 1WTQA 4V0BA 5CBEE 1B3AA 5IODA 4AYBB 3WDNA 3HEJA 1STHA 2PNRC 2BE5C 3NHHA 1MSHA 2F1MA 3K5NA 2ENBA 5JAVA 4LK1C 1SNMA 5IGFA 1G291 1EY6A 2B2VC 5G3LD 2NBFA 3T16A 2IX3A 2N88A 2R92B 1LTRD 3DXJC 5IT9L 2F0MA 4Q0FA 5CV4A 1CQFA 1II3A 1JCKB 1JWSD 4OO1G 1YNJD 1A6XA 3SXHA 3HRZC 1IW7D 1VF5C 1PZJD 5EPJA 3CRKC 1RJTA 2AQ2B 3GTJB 2F0DA 3D3RA 1O7YA 3MZ5A 4QIWB 3L3OC 3EVQA 3HOXB 3EFXD 1BOSA 1EY4A 1Y8PB 2O5JC 1U4PA 1HXYD 4HEDA 4F87A 4H44C 3J81E 3T13A 4FYDA 1XXGA 4FNFA 3SR1A 1I6VC 3OSOA 3FPPA 2EE1A 3KLSA 5I9OA 3QJYA 3TZDA 1E2ZA 3A8KE 1IL8A 2EJFC 1DOLA 3J81L 2B2YC 3SK8A 4CJ0B 4HMIA 3EQLC 2B2WC 3SVMA 2AUKA 1H9JA 4BA1I 1QG7A 2MHVA 1Y1WB 2KA7A 2F0VA 3M85A 2XWBB 2Z4IA 3MWYW 2BOSA 4KKSA 5KGUA 3OOCA 2FMMA 1ZEQX 3GP7A 4NDXA 2EOTA 2OF1A 5IGEA 2QDBA 1ONLA 2K03A 2F0JA 3DWQA 2R3ZA 4HCEA 3HOUB 4C1NK 2Q8RE 3MFYA 1EEID 1HHVA 1Y8OB 4UAIA 3K0YA 2K33A 3VA5A 1I4XA 3Q23A 1X3QA 3KBXA 2L4NA 1CTMA 2A74C 3NUCA 1F2MA 2NWGA 3BZDB 1IW7C 4RA8A 4KHZA 4C3JG 1PYWD 3I72A 5D3IB 3D6CA 2RDFA 2TSSA 1EWCA 1TS3A 5A2QE 1KLUD 5I9PA 2D2CC 4XT3B 1PTOH 1WCMB 1I3QB 2JSOA 3C46A 4IQZA 2JA8B 2ZXRA 3P75A 4FXKC 1D1KA 1ZYRC 1ET9A 4R8IA 2VNUD 5A2QL 1E2VA 3NTKA 2K6AA 5FOBB 2Z1CA 1MD2D 3K58A 3I3CA 5JPNC 2BCOA 1EWHA 2JEBI 3DHQA 1EIHA 4N9PA 2EY5A 1CZWA 3N52A 2FJ2A 4CKEA 4BS9A 1DYQA 3I4LA 3VA7A 1NSNS 4FF3A 5C0XI 3HOYB 4FXGC 1KLGD 2Y0SB 2K04A 2RBMA 4H7BA 5EBDA 4DXFA 2K5WA 4C3IB 2WB1B 2HQEA 2XNAC 3CU7A 2EY6A 2F0EA 4XIGS 1I6HB 3K6OA 4KJNA 5C0XH 2F03A 3I90A 3MHBA 2F0HA 1GUSA 1D1IA 4FF2A 1QCBD 1B9MA 2R93B 1SMYD 4B9XA 1VF7A 4RWSC 3VR6A 3TZUA 1D5MC 1Y1VB 1ESRA 4A3MB 2PO4A 2ICIA 2DN8A 4ZAIA 3I4NB 1YNNC 1F9PA 1CFMA 4KKTA 5CV7A 1DJRD 1I4GA 2ZXOA 3FKIB 4N9TA 4PMWA 3QOLA 1M4VA 1TS2A 3AU7A 4DK1A 1QILA 2K01A 1JWMD 4HCSA 1LT5D 1AP0A 3D4RA 5DNFA 1PFBA 1TIID 2LMCB 3H0GB 5CYUA 3DWPA 4A3DB 5CORA 1Z47A 3RD4A 3Q6SA 2B8GA 1KDCA 5HURA 3FVQA 2XRSD 3V2TA 3DMUA 4QUFA 3NBIA 2QILA 2C5CA 2VB2X 4K14A 1QJOA 4MN3A 1STYA 2XIWA 2WACA 2LFNA 3NP8A 3GV3A 3BYYB 1Q1EA 4J6HA 1Q8IA 4RHRA 1LO5D 1LTID 1HUMA 5C5LA 5D65A 3SHLA 3SK4A 3HG9A 5I4DA 1CZGA 1ESFA 2CW0D 3K57A 1I4HA 5KIXA 5IGDA 4BY1B 2B2TA 4XYQA 5EKIA 1VMCA 2Z8LA 1HPCA 3C1EA 3VYTA 4DAPA 1DD2A 1MI2A 2M2LA 3L9AX 4XTCS 1TS5A 1K83B 5D14A 1JB3A 3GO5A 1QOHA 1H9RA 4ID6A 1PTOF 5I2XA 3D31A 1WTOA 1ZXTA 2IW3A 1WTVA 1I4RA 5C44B 1Q90A 1KDBA 3H09A 4WJWA 2I46A 2DNCA 5FLXL 1QNKA 3MAQA 1GUOA 1TWAB 4O42A 2F0LA 1BUVT 3A54A 2B2UC 4M1UB 1CQVA 4HTHA 5ELCA 1AN8A 2YYZA 3AMUA 3KBGA 4ZRZA 1I4PA 1DCZA 2K05A 3MVVA 3IAYA 2OEOA 4RGMA 4XDXA 5KYLA 2E2HB 4EQNA 4KD3A 2A69D 1M8AA 5EGTA 5TSSA 3IFDA 4BBSB 1F2ZA 5ISRA 3R2TA 2IWHA 3EA6A 3EJIA 3S2HB 4DF7A 2A73B 2JYOA 2J0TD 1LTSD 2EY1A 1TWHB 4EQPA 3BDLA 2M00A 1JWUD 2L11A 3S16B 1L0XB 2K5DA 4HN7A 3G6JB 3R93A 2A68C 5IIFA 2VXWA 2WKDA 3HZXA 4RHSA 2NTTA 4LJZC 3CHBD 3NE5B 1SYGA 3QWNA 3PV0A 2O2LD 1A3VA 5JJZA 4CJ1B 1SDFA 1RKNA 3PUVA 5M3FB 3PUXA 1PLFA 2RSNA 3S1QB 2R7ZB 2E2IB 3TSSA 3GTKB 3K5LA 2CW0C 3F2UA 1PDQA 1TY2A 3MC0B 2WP8J 4K6LA 4G7HC 3X3NA 2BA0A 4DFAA 3KLRA 1HQRD 2EXZA 2AUJD 2CVRA 1Q1BA 1SYCA 4DAYA 4RFBA 4C3JB 4U673 1HTLD 4HMJA 4HSPA 4OGQC 2PZUA 1LTBD 2C9OA 1WTRA 1ENAA 1SXTA 3MXPA 3U9SA 2IX1A 2V4DA 4RH6A 4C56C 2EYJA 2B2TC 1O78A 1RD9D 4OIKA 1CA5A 4WFN3 1SNCA 5I6WA 1B1ZA 2IT1A 1SJED 1RODA 4L8JA 1QB5D 4L6TB 4OIJA 2F0SA 5D3DA 1V1PA 1BBXC 1TKWB 3RUZA 1EQTA 1LTAD 3D4WA 3S1RB 1PZID 2O4XA 1V1PB 2K28A 1SE2A 4C3HB 5ELFA 3J7AV 2VB3X 1BCPC 3VR2A 1LT6D 4NKLA 1H9SA 1XYIA 3TP5A 4G57A 5C5MA 4DGZA 1LTGD 3MEHA 4B08A 3NQTA 1E2WA 3OPOA 4NMZA 1R4PB 1H9SB 3CKIB 1PMRA 3QIAA 5BN4A 2NVYB 3ERQA 1SE3A 2QF7A 4FF1A 1HQMC 1PTOB 3NTHA 1EOTA 3M4YA 5HGTA 4G7ZC 4ILWA 3D6WA 1LLRD 1S5ED 4Z9CB 2SOBA 4KN4C 3A56A 1QNUA 5ELBA 1PTOD 1JOQA 1EY7A 1RCVD 1JICA 5IOCA 3IFTA 1S5BD 3I4MB 1KNAA 1RF2D 5FO7B 2JA5B 4JK1C 4A93B 1V43A 5FK9C 2F0UA 3I91A 2KEEA 4U68A 3JAME 5FO8B 5C4HA 1NCVA 5JVG3 1RTNA 3J7YW 1VCIA 4KTAA 2AWOA 1BF4A 3H94A 2F4IA 4FXDA 4A3GB 3ND8A 2SDFA 2EYOA 2NTSA 2A5HA 2A6ED 3JAML 1C48A 3C1FA 5E4XA 3OHXC 1R4QB 4KI0A 3GTMB 3Q22A 5I2YA 1H9MA 3VR3A 1GUNA 3MA2B 3TDQA 2JA7B 3OIQA 1A2TA 3PUZA 1BNZA 3H3VC 3RZOB 1W6KA 4TRDA 2RKSA 4V190 1YNJC 4FO2A 3FEWX 4KY6A 2K5QA 3PO3B 4PNYA 3TBIB 5T1IA 3GV6A 4PQXA 3R8BA 3A7AB 4QB4A 4ZKBB 2L9HA 2EYHA 1BXTA 2CQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2T A;  1STG A;  2F0K A;  4HMJ A;  2F0M A;  4RKB A;  3DMU A;  4ZUI A;  1JOQ A;  1EY7 A;  5IOD A;  1STB A;  2F0V A;  4S3S A;  2PZU A;  4ZQ3 A;  5EKK A;  5IOC A;  3MVV A;  3OMC A;  5CV4 A;  4DU9 A;  1II3 A;  5CV5 A;  5KGU A;  2OEO A;  4WRD A;  5J39 A;  5KYL A;  4EQN A;  1ENA A;  1KAA A;  2F0G A;  1SNQ A;  3BDC A;  4K5W A;  4KD3 A;  4NDX A;  5EKL A;  2OF1 A;  3MXP A;  3S9W A;  2PQE A;  5IGE A;  3DHQ A;  1SND A;  2EY5 A;  4N9P A;  5EGT A;  4OL7 A;  5IGC A;  3SXH A;  4K14 A;  2EYJ A;  2PYK A;  5C6A A;  2F0U A;  4KV6 A;  3TP6 A;  2QDB A;  5IGG A;  1A3T A;  1F2Z A;  2F0P A;  2EYM A;  5C4H A;  2F0T A;  1STY A;  2F0Q A;  5ISR A;  2F0J A;  2F0W A;  1F2Y A;  2WAC A;  3P1H A;  1NSN S;  3EJI A;  3NP8 A;  3TP8 A;  4DF7 A;  1TQO A;  1SNC A;  4J6H A;  2EYP A;  4LAA A;  5CV6 A;  2F0N A;  5I6W A;  4KJO A;  5CV8 A;  1A2U A;  3OWF A;  4MIU A;  5E1F A;  5KEE A;  4KY5 A;  4KTA A;  4I65 A;  4ZUJ A;  1SNP A;  1EY5 A;  4ME5 A;  3E5S A;  5M9O A;  2EY1 A;  1EZ8 A;  2F0D A;  2RBM A;  1NUC A;  4H7B A;  5C5L A;  1KDC A;  4RKL A;  4EQP A;  3BDL A;  5J22 A;  4F7X A;  2M00 A;  2F0S A;  2F3V A;  5NUC A;  3SHL A;  3SK4 A;  3MZ5 A;  4K2K A;  5F2D A;  2LKV A;  1SYE A;  3RUZ A;  2HQE A;  4K5X A;  3D4W A;  5C4Z A;  3NXW A;  1KDA A;  2EY6 A;  1U9R A;  1JOR A;  3R3O A;  1SNO A;  5IIF A;  3VA5 A;  4KY7 A;  5KIX A;  5IGD A;  2F0E A;  2EYO A;  3EVQ A;  3HZX A;  2PZW A;  2EY2 A;  2O4X A;  4EVO A;  2F0F A;  5K5P A;  4KJN A;  2KQ3 A;  4KHV A;  3C1F A;  1EY4 A;  2PW7 A;  4ODG A;  3TP7 A;  1SYD A;  1JOK A;  2PW5 A;  4K8J A;  1SYG A;  1EY9 A;  3SK6 A;  5DEH A;  3C1E A;  3MHB A;  3NUC A;  4J1M A;  3QOJ A;  1F2M A;  2F0H A;  1SYB A;  3T13 A;  4NKL A;  3ITP A;  5CR3 A;  2KHS A;  1A2T A;  3SR1 A;  1EY0 A;  4B9X A;  3OSO A;  3TP5 A;  3NK9 A;  4G57 A;  5C5M A;  1A3V A;  3MEH A;  5DAU A;  3NQT A;  2PZT A;  3D6C A;  2RDF A;  4NMZ A;  1IHZ A;  2EYF A;  4ID6 A;  3HEJ A;  3TME A;  4B9W A;  4K5V A;  4DGZ A;  1STN A;  5CGK A;  4E6I A;  1RKN A;  4QF4 A;  1EYC A;  1STA A;  1STH A;  4TRD A;  2RKS A;  3ERO A;  5I9P A;  5I9O A;  3NHH A;  5CV7 A;  4K6D A;  4F8M A;  1EZ6 A;  3LX0 A;  3SK5 A;  3PMF A;  2ENB A;  4K2L A;  4YIJ A;  4EQO A;  5JAV A;  4N9T A;  4NP5 A;  4PMC A;  4QMG A;  1KDB A;  1SNM A;  2F0O A;  2F3W A;  3QOL A;  1AEX A;  3D4D A;  2EYL A;  1SYF A;  5J1Z A;  5IGF A;  2F0I A;  1EQV A;  3ERQ A;  1ENC A;  1EY6 A;  1EYA A;  1JOO A;  4KY6 A;  3U9O A;  3QB3 A;  3H6M A;  3P75 A;  1KAB A;  5JOB A;  3OMG A;  4KD4 A;  5E3F A;  5C3X A;  4PNY A;  3SK8 A;  5I6Y A;  4WOR A;  4IUN A;  5C3W A;  2F0L A;  4DFA A;  2EXZ A;  5CV9 A;  2OXP A;  4HMI A;  5HGT A;  3T16 A;  4K8I A;  5KRU A;  3D8G A;  1SYC A;  4IAL A;  5KYI A;  1A3U A;  1EY8 A;  4PMB A;  4R8N A;  4IZ8 A;  4HTH A;  4QB4 A;  1EYD A;  2NUC A;  2SOB A;  5IGB A;  2EYH A;  1TT2 A;  2SNM A;  2SNS A;  5CC4 A;  1TR5 A;  5HUR A; 
#chains in the Genus database with same CATH topology
 4IOC A;  4IN3 A;  5IWA Q;  3SE0 A;  1FYC A;  2IL8 A;  4ZQ3 A;  5EJW A;  4YHH Q;  4JI4 L;  1K8M A;  1VQH A;  1HH2 P;  3C2P A;  2E5L Q;  3BDC A;  2SEB D;  4HR7 B;  3X3M A;  4DV2 L;  2K5V A;  4Y7N B;  3J7A 5;  5IGG A;  1A3T A;  4JI0 Q;  2EJM A;  2F0T A;  2NN6 I;  1L0W A;  1YJN A;  3I4M H;  2Q8I B;  2YU9 B;  3KFU A;  4HAE A;  5CBA E;  3A5U A;  1PV4 A;  1E3P A;  5BN5 A;  1NAP A;  4A93 H;  3OWF A;  4BY7 G;  4KK7 A;  1ICF B;  3VR4 A;  4XQN A;  2R92 G;  1J9O A;  1N32 L;  4Q5V A;  4XXE A;  3TN2 A;  1HZB A;  3KF8 A;  4H0L C;  3CQZ B;  1G91 A;  1JQY D;  1AZP A;  1SYE A;  2DJG C;  2D5D A;  1PTO C;  4ZLT F;  1L0Y B;  1Q3L A;  2NN6 H;  1CT1 D;  4KY7 A;  3KF8 B;  2AMC B;  3TRZ A;  2AQ1 B;  4HJ7 A;  4GN3 B;  1XWE A;  2B29 A;  5JEA J;  4DN4 M;  4JG2 A;  4A3G H;  3QOJ A;  1D2B A;  4A3C H;  3T4A C;  3AQQ A;  1VQI A;  3T51 B;  2RA4 A;  4JBW A;  3Q24 A;  3UDG A;  5FLX c;  1PRT B;  4EQO A;  1DZ1 A;  2JA7 H;  2KBN A;  4OX9 Q;  5GAE C;  3GTL H;  4JYA Q;  3HOX G;  3RZO H;  4UHV A;  2JN4 A;  1UUP A;  1CI3 M;  2M9V A;  3CRL C;  3NTI A;  4RCO A;  1PRT D;  2A6E C;  4YCW A;  2UXB Q;  3A8I E;  1EOV A;  4DAV A;  1GM5 A;  1HUN A;  2H4O A;  2UXD L;  3CCE A;  1EY8 A;  4JI1 Q;  5E4W C;  1QVF A;  1T5X D;  4DV1 L;  2SNS A;  4A3K G;  4IFD J;  2BDN A;  2XWJ B;  4L5Q A;  4S3S A;  1SE8 A;  4NB3 A;  1WVL A;  2PI2 A;  3GTO H;  2LXJ A;  2MQH A;  1SEB D;  1SNQ A;  4K5W A;  3BU2 A;  5LMU Q;  3GQB A;  1V1O A;  3H91 A;  5IGC A;  3DUZ A;  3J80 E;  2B63 B;  3TP6 A;  4G4K A;  4JC0 A;  2UU9 L;  4XQQ A;  3RZD B;  4BXX H;  4MTN A;  4IUU A;  4MZ9 A;  5EPK A;  5M5W B;  4DV4 L;  1TU2 B;  1I4Q A;  2PCF B;  1VQB A;  5E1F A;  5FLM H;  2HCC A;  4Y7N H;  1SNP A;  3S14 H;  3K81 C;  1VDZ A;  3A55 A;  1VQK A;  3NSW A;  2ZM6 L;  5M5Y B;  1TS4 A;  3JC6 6;  4P71 A;  5JEA G;  3ZYY X;  3IL8 A;  4DK0 A;  2HDL A;  3J80 L;  4JI4 Q;  1JJC B;  1C9O A;  2DY8 A;  1F9R A;  2PW7 A;  3QO2 A;  1OXX K;  3NWS A;  3HOW B;  4LFA L;  1YI2 A;  3ER0 A;  1JJ2 A;  2AQ3 B;  4DNT B;  3RLF A;  4HIO A;  4A3F H;  1HCZ A;  2I07 B;  3HOU G;  2E2D C;  2EIF A;  3TME A;  2QEX A;  2X69 A;  1N32 Q;  2F3I A;  1STA A;  2RHS B;  5C0X G;  1I50 B;  1QE6 A;  2Z4H A;  4A3I B;  2PI2 E;  1EZ6 A;  1CSQ A;  1HR0 W;  4JI6 L;  1JC7 A;  4L5R C;  2LY7 A;  2R61 A;  4JCV E;  3E6Z X;  3F2B A;  2J7Z A;  3PIO A;  1EQV A;  4X3K A;  1JOO A;  1EYA A;  2R6G A;  1LT3 D;  3H6M A;  3SEB A;  1XTC D;  4ZYS A;  4A4I A;  5IYB G;  1OXS C;  2B2V A;  3GTP H;  1CA6 A;  4WJ4 A;  4IFD G;  4HID A;  4RCN A;  1Q81 C;  1DM0 B;  5K36 G;  4BA2 I;  4LWC A;  1LAC A;  5KYI A;  1RHP A;  4R8N A;  1G8Z D;  1S40 A;  1Y8N B;  3WOE A;  2UUB L;  3P20 A;  1GUT A;  1JR0 D;  1STG A;  4ZUI A;  2K5N A;  2I0Q A;  1S72 A;  1FVI A;  1EU3 A;  2BE5 D;  4J8Q A;  5IYC H;  1EL0 A;  4K0K L;  5EKL A;  1U4L A;  2PQE A;  1SE4 A;  2JA8 G;  1KHI A;  3S17 B;  4KV6 A;  2AWN A;  4X65 L;  1YJ9 A;  2Q8T A;  2EYM A;  4DV3 L;  1K3R A;  2F0W A;  2EVB A;  2AKW B;  1TQO A;  2EYP A;  4FP5 D;  1LT4 D;  3HOV B;  1D5Z C;  4DAM A;  5KEE A;  3MFG A;  1SMY C;  2UXD Q;  4DR6 L;  4HSV A;  3U4Z A;  1J8I A;  4DV1 Q;  3ND9 A;  5M5W H;  5LMN W;  2QCP X;  1O80 A;  5M3M B;  3KYH C;  5C4Z A;  4DV5 L;  4DV0 Q;  5C4X G;  1H9K A;  4TSS A;  4P2C B;  4A3J B;  1NNX A;  3CP0 A;  3TEH B;  1KTK A;  2NYZ D;  1MJC A;  4EGV A;  4Y52 H;  1E1T A;  1JOK A;  1UE6 A;  2PW5 A;  3K8A A;  4LW1 A;  5ELO A;  3PO2 H;  2VY3 A;  5M5Y H;  5COY A;  5GAG C;  1Q12 A;  2NZ1 D;  3R2I A;  2IPK D;  1SYB A;  1HTP A;  4A3L G;  1XPR A;  2UU9 Q;  1Y69 U;  3M4O B;  1WYD A;  3HOY G;  1PH6 A;  3HP3 A;  4UP9 A;  2RDG A;  2KCC A;  2Y0S G;  5DM7 3;  4OO1 I;  4CJ2 C;  1F9Q A;  4GZY C;  3M3Y B;  2OQK A;  4DA2 A;  2PMZ B;  1A62 A;  2J4X A;  5LL6 S;  2HD3 A;  3HOZ B;  3FPU B;  5AFW A;  1DOM A;  3PMF A;  4K2L A;  4OEL B;  4YIJ A;  2WB1 G;  1IKM A;  4DR3 L;  3A8J E;  4NP5 A;  2ZM6 Q;  2F3W A;  2A6H D;  1U4M A;  3NQI A;  4A3E B;  4LFB L;  1GKH A;  2DY7 A;  4IO9 A;  2ES2 A;  1KAB A;  2N55 A;  1I50 H;  1FL0 A;  4OHJ A;  3W2D A;  3M4P A;  4FF4 A;  4A3I H;  1U0L A;  1YHQ A;  2OTL A;  2GN5 A;  1SAP A;  4ZCK A;  3K5M A;  1HZC A;  4LFA Q;  4OO1 H;  4QCL A;  4JOI C;  2B2Y A;  2RF4 A;  4IZ8 A;  2R93 G;  2NUC A;  3T1H L;  3MTS A;  4IUQ A;  2ATW A;  2B3G A;  3PUY A;  3V96 A;  3J81 c;  1GO3 E;  4LUZ A;  2JXM B;  1S5F D;  4DU9 A;  1F77 A;  3VYS A;  1C8C A;  3J81 j;  4TQU S;  4X3S A;  2VUM B;  1GVP A;  3AFQ A;  4JI6 Q;  4MHE A;  1E22 A;  3DEP A;  2QA4 A;  3KUP A;  1N33 L;  1J5E L;  2EXD A;  4XQJ A;  1YHA A;  2VL6 A;  2E76 C;  1LUZ A;  1F2Y A;  1S5D D;  1V9P A;  4A3D G;  3OIP A;  4LAA A;  1EFW A;  4GN5 A;  4R1J A;  2N8N A;  2KOL A;  3S17 H;  2RDH A;  2WFW A;  1C0A A;  4KLK A;  1WD1 A;  1T5E A;  5NUC A;  4HJ5 A;  1X3P A;  2F3V A;  1BVS A;  2UUB Q;  4ABN A;  1XPO A;  3TQY A;  1U9R A;  1G2T A;  3CW2 C;  1SNO A;  3M7G A;  1K73 C;  5IT9 E;  2FHT A;  4X3T A;  2EY2 A;  4EVO A;  1S4Z A;  4K0K Q;  1KIX A;  3EBE A;  3GD7 A;  4KHV A;  1N9W A;  1KRT A;  1OXV A;  2UXC L;  4DR5 L;  1KNE A;  5M3M H;  3BVG A;  3I73 A;  3K7A B;  4X65 Q;  4RGN A;  4DV3 Q;  3ITP A;  4PG3 A;  4IOA A;  1K3B C;  4A3J H;  1KQS A;  2JA6 B;  1FNU A;  4DV6 L;  2LSS A;  1PA6 A;  1B2T A;  1A15 A;  4BY7 B;  4E6I A;  4QF4 A;  1YJW A;  2FMC A;  4TKO B;  1M90 C;  4N8F A;  4DR6 Q;  1TWG H;  1TWC B;  3NWT A;  1TXY A;  3M4O H;  4ULL A;  2N49 A;  3O13 A;  4BBR G;  2A69 C;  5M5X B;  2EYL A;  3ONA B;  1PRT F;  2RCN A;  3E9I A;  3F8T A;  3U9O A;  4BY1 G;  4DV5 Q;  2DUD A;  3M3Y H;  3OMG A;  3HOZ H;  1G51 A;  1HNW L;  5T1G A;  2CCZ A;  5I6Y A;  2Q2T A;  1OO9 B;  3DEO A;  2L12 A;  1NE3 A;  3I8Z A;  3UDF A;  1ASZ A;  3FP9 A;  5KRU A;  3MEF A;  1Z7T A;  2VS1 A;  4A3E H;  4PMB A;  3K59 A;  4CKB A;  5IYD G;  1V8Q A;  1TR5 A;  4OWT B;  1HFG A;  2NVQ B;  5EKK A;  1H95 A;  2L1B A;  2K50 A;  3PIP A;  2EDG A;  1FNW A;  2ZT9 C;  1D6E C;  1R9T H;  3KDF A;  2HDM A;  1N36 L;  3TS2 A;  3A7L A;  1TY0 A;  1VS0 A;  4XT1 B;  5EPL A;  2KJX A;  3M9B A;  5JVH 3;  4DR3 Q;  1WD0 A;  1IKL A;  2PPB C;  1EIY B;  4LFB Q;  2A6H C;  3FDT A;  1SRO A;  3KDF B;  3P1H A;  1BQQ T;  1OXU A;  1MGS A;  1QWY A;  1ZYR D;  2K1B A;  1XPU A;  3T56 B;  1UNS A;  4KJO A;  2VUM H;  3CC7 A;  4R4O A;  4I65 A;  1M1K C;  1ILP A;  3E5S A;  5M9O A;  4N8X 1;  1EZ8 A;  4FVM A;  2D62 A;  4KKU A;  3LNN A;  5L37 A;  1VQL A;  4K2K A;  4CHT B;  4A3K B;  1UAP A;  4APV A;  1WTX A;  2AHO B;  3NXW A;  1IXR A;  1KDA A;  3PIO 3;  1U4R A;  1IBK L;  1GUW A;  2MPM A;  3LWE A;  4TVA B;  2F0F A;  3PGZ A;  2GA4 B;  4GLV B;  1MSG A;  4BBS G;  1HNX L;  3RMH A;  3NEM A;  5C3E G;  3PUW A;  3CC2 A;  1N33 Q;  1J5E Q;  2I5M X;  2KVM A;  2RQX A;  4FDB A;  2NB0 A;  3NPP A;  1EY0 A;  3CCJ A;  3IKJ A;  3NK9 A;  1XTD A;  4B9W A;  4DK6 C;  1K28 A;  1DOK A;  3JAM i;  2RVL A;  1ENF A;  1SRU A;  3K7A H;  3SK5 A;  3DWA A;  2UUC L;  4JBJ A;  4PMC A;  4QMG A;  3J7A F;  2ALY B;  5J1Z A;  2B39 A;  4ZKC B;  1ENC A;  2EQS A;  4BY7 H;  2K75 A;  3FRP B;  3L2P A;  4JI1 L;  1ML0 D;  3I55 A;  5E3F A;  5EBC A;  1IBM Q;  4IUN A;  4X6A H;  1CHQ D;  1E0B A;  3A74 A;  1HFN A;  5M5X H;  1DXM A;  3GTL B;  4DR5 Q;  1O7Z A;  1A3U A;  2A8V A;  5LHY 1;  2KCM A;  4QL5 A;  5C4J B;  4IUP A;  2JP1 A;  4IJH A;  1YNN D;  1L1O B;  4DV6 Q;  4YWL A;  5CV5 A;  2R7Z G;  1KAA A;  1NMF A;  3PF4 A;  3K5O A;  2JE6 I;  3NBH A;  1B50 A;  4MNO A;  1FR3 A;  1SND A;  4LF5 L;  4LF9 L;  2H1E A;  5C6A A;  3BG3 A;  4JI5 L;  1LAB A;  2MGS A;  2NVQ H;  1F2L A;  3GTJ H;  4GNX A;  2F0Q A;  3GTO B;  1A63 A;  1D8L A;  3TP8 A;  3E0J A;  4DXG A;  2XVS A;  1YHB A;  4IPH A;  2QKI C;  1RTO A;  1XJV A;  2OT2 A;  5CV8 A;  4AYB G;  3G7L A;  2KEC A;  5A35 A;  4MIU A;  3DLL A;  1TVX A;  3KK7 A;  4ZUJ A;  3GTG B;  2IJ0 A;  4DR2 Q;  1AFP A;  4GNX B;  3HOX H;  2HIV A;  3ERS X;  4IUV A;  3IRB A;  2LKV A;  3BS1 A;  3PQI A;  1K8G A;  4GLX A;  4JBK A;  3S14 B;  1NR4 A;  1OXT A;  1W6J A;  4HJ8 A;  1CK1 A;  5ELE A;  2FFK B;  5LL6 X;  4A76 A;  1AZQ A;  3TP7 A;  4DNR B;  1N36 Q;  2KHJ A;  1IYV A;  5DLQ E;  1EY9 A;  3SK6 A;  4A3K H;  1XNR Q;  1YVC A;  4H13 C;  1GHK A;  3OWE B;  3S2D B;  3E3X A;  1BCP F;  4CGY B;  2HIX A;  2KHS A;  3S15 B;  1BO0 A;  4C1N I;  1JE4 A;  2D9U A;  2R7D A;  1QZH A;  4RG1 A;  1FJG L;  2ASB A;  1MJE A;  5DAU A;  2MO1 A;  2QGQ A;  4DUZ L;  3UI2 A;  4ZK9 B;  1LYL A;  2L5T A;  2WV6 D;  1XNQ Q;  1QVG A;  4A3F B;  4IUT A;  4CDD C;  5JJK A;  1AEX A;  4L5T A;  1GHJ A;  1PFN A;  2JA9 A;  3BJU A;  4H02 A;  2X6L A;  2ZTD A;  3RN2 A;  1SBB B;  3QB3 A;  2Q2H A;  5ELD A;  1IBK Q;  1PH4 A;  5C4X B;  5KND A;  1IYU A;  2BDO A;  4C3H G;  2E8G A;  2OXP A;  5FKA C;  1HNX Q;  1A8V A;  3AYH B;  2IX0 A;  3D8G A;  3P7J A;  2XRQ D;  2WAQ B;  4R9W A;  3CPW A;  5JEA H;  2B2U A;  5CC4 A;  1CHP D;  3GTP B;  4RKB A;  1IL2 A;  4RAU C;  3U4V A;  4C2M B;  1DGS A;  5C0X J;  5JPM C;  1X3G A;  4L63 B;  5J39 A;  1WTW A;  1RDP D;  1X32 A;  3VDY A;  3GTQ B;  2MUY A;  1Q86 C;  1ASY A;  3L0O A;  5C4J H;  2UUC Q;  2OWO A;  4KMU C;  4G7O C;  1DON A;  3CC4 A;  3OTO L;  2VZA A;  4IFD I;  3MXU A;  1LTT D;  2ICE C;  4UPA A;  5CV6 A;  4L5S A;  1D5X C;  3I70 A;  3M4Q A;  1HA5 A;  1PH2 A;  5JJI A;  1EEF D;  1EY5 A;  4DV0 L;  1NUC A;  2MP1 A;  4RKL A;  2XN9 C;  1ET6 A;  2WKC A;  3VYR A;  1Z6H A;  2ZTE A;  2ZXP A;  1SJH D;  5KNB A;  3J7Z C;  5IYB H;  3PF5 A;  2EJG C;  2LS0 1;  2E2J B;  4IFD H;  3GTG H;  1VMP A;  4M8A A;  2WAQ E;  2JA5 G;  5K36 H;  1RL2 A;  3KJP A;  4CKC A;  4A93 G;  1GUG A;  1W3S A;  1C4Q A;  4IUR A;  2L15 A;  2A19 A;  1SYD A;  3SDZ A;  4ALP A;  4LF5 Q;  4LF9 Q;  4K8J A;  4HIK A;  5G3L F;  2B8F A;  4JI5 Q;  4RGT A;  4LMQ D;  4GOP A;  5CR3 A;  2ZJR A;  1E24 A;  1Y1W G;  3BDO A;  2JK8 A;  1TWF B;  2NN6 G;  4POF A;  3J80 i;  2PZT A;  3PO2 B;  1IHZ A;  5CGK A;  2JA8 H;  4KN7 C;  4IPD A;  2DNE A;  4XYO A;  4CDE C;  3PIP 3;  3S2D H;  3ERO A;  4GOP B;  1G6P A;  4QUC A;  1SR3 A;  2KCT A;  4K6D A;  4JI7 L;  3S15 H;  3K0X A;  2Z6K A;  4A3G G;  2A68 D;  1EIG A;  2R7F A;  3D4D A;  2F4V L;  3DM1 A;  1B44 D;  4A3B B;  2TMP A;  1KD1 C;  4KD4 A;  2HUG A;  5C3X A;  3E0E A;  4WOR A;  2E74 C;  4YWK A;  5IP7 G;  4OWX B;  3G48 A;  4O1N A;  5CV9 A;  5IP9 G;  4BWG B;  3C3L A;  2WIN B;  2NVX B;  1GOZ A;  5BN3 A;  1FGB D;  3OW7 A;  5FO9 B;  4IAL A;  4GS3 A;  1UE1 A;  1ICW A;  1O7L A;  2IHE A;  2KUM A;  2SNM A;  1STE A;  5C4X H;  1OTC A;  2O5I C;  2F0K A;  1FJG Q;  1STB A;  3OMC A;  4DUZ Q;  4WRD A;  1UEB A;  2JJQ A;  2CH4 A;  4EQ5 A;  1S5C D;  4A3L H;  1B53 A;  1XX8 A;  3Q0A A;  1SFO B;  2K7V A;  4BBR B;  1PH3 A;  3HOY H;  1AW7 A;  3PO3 G;  3MXG A;  4C2M H;  2NVT B;  1SSO A;  1B4O A;  2FIN B;  2MJ8 A;  1G6Z A;  3GTQ H;  2RSO A;  5FLX E;  1A2U A;  4WJ3 M;  3HGB A;  3AB9 A;  4ME5 A;  1F9S A;  1S3O A;  2X6G A;  4I7Z C;  3T1Y L;  4F7X A;  1NR2 A;  1WCM G;  4HJA A;  3HS0 C;  5F2D A;  1EFI D;  2CFM A;  1GXD C;  1P16 A;  1PXU A;  1HRJ A;  1KC8 C;  1K0R A;  4CBV A;  5K5P A;  3HKZ B;  1Q82 C;  2KQ3 A;  1FD7 D;  3URY A;  2HCI A;  3LWU A;  1PRT C;  5DEH A;  3OTO Q;  2I5L X;  2E2J H;  3HKS A;  4PZ8 A;  1BBU A;  3GDE A;  2EYF A;  1PZK D;  5KNC A;  1CKM A;  1VQ6 A;  4K5V A;  2HHH L;  1STN A;  2D0O A;  1C7Y A;  1EYC A;  1B70 B;  4RGO S;  2E75 C;  4NXM L;  3QG1 A;  4F8M A;  3LX0 A;  1ILQ A;  1MHW C;  2KCN A;  1BCP B;  1WTP A;  1UEA B;  1RIP A;  4A3D H;  1B7Y B;  2F0O A;  1UWV A;  2EZV A;  1TWF H;  1JMC A;  1SYF A;  3M7N A;  2F0I A;  3FMC A;  5JOB A;  1TWG B;  4QJF A;  5C3W A;  1BCP D;  1GJX A;  3CCU A;  1JB7 A;  4KHP L;  3NEN A;  3T53 B;  4K8I A;  2LXK A;  5C3E B;  2L55 A;  1SLJ A;  2CWP A;  4PV1 C;  4IPG A;  4A3B H;  1EYD A;  3W3A A;  1YBY A;  5EQ0 A;  5IGB A;  1BDO A;  1FNV A;  1TT2 A;  1N8R C;  3S1N B;  3CME A;  4C3I G;  2ID0 A;  4NW2 A;  2NVX H;  1HA6 A;  1VQ8 A;  5CMD A;  1ZKO A;  2VW9 A;  3W1G A;  3VYU A;  2F0G A;  4JI8 L;  1G2S A;  3S9W A;  2G9D A;  4JI7 Q;  1K8O A;  2EPB A;  3BVM A;  3KLS X;  4OL7 A;  4AIM A;  5GAD C;  1BR9 A;  2PYK A;  4DPG A;  2Z0S A;  4X3U A;  3MXN A;  2F4V Q;  2Z9H A;  2F0P A;  3BVZ A;  2WII B;  1R9T B;  2QEJ C;  2XSC A;  3WOF A;  1PFM A;  2B2W A;  2F0N A;  1U5K A;  1Y1V G;  2KED A;  3S1M B;  4A3M G;  1SFO H;  3BYT B;  4KY5 A;  3I4N G;  3MXN B;  3N6R A;  4BBR H;  2HT1 A;  2QW7 A;  1X3E A;  2CHB D;  5J22 A;  2NVT H;  2L0C A;  3FKI G;  4JV5 L;  1CM9 A;  2BA1 A;  3VR5 A;  1B9N A;  3W5O A;  1EU4 A;  5DM6 3;  4K5X A;  4A75 A;  2Z6K C;  3R3O A;  1JOR A;  1HZ9 A;  3V05 A;  2PZW A;  3H0G G;  3L7Z C;  2PMZ E;  5IE8 A;  1MBY A;  4ODG A;  2B63 G;  5IYD H;  4R4C A;  2KEN A;  4PZ6 A;  2K32 A;  4F88 A;  2JEA I;  4UY8 C;  4UDU C;  2G9H D;  4J1M A;  1LV9 A;  1WTQ A;  4V0B A;  5CBE E;  1B3A A;  1WTH A;  3JAM c;  1KXL A;  3PSI A;  5IOD A;  4AYB B;  3WDN A;  3HEJ A;  1EWI A;  1STH A;  3DM3 A;  2PNR C;  2BE5 C;  3U50 C;  5HGQ A;  3NHH A;  1MSH A;  2F1M A;  3T1Y Q;  3K5N A;  2ENB A;  1IBM L;  5JAV A;  1TWA H;  4LK1 C;  4DUY L;  1SNM A;  2YV5 A;  5IGF A;  1G29 1;  3F2D A;  1EY6 A;  2B2V C;  3CAM A;  4AH6 A;  3HOW G;  5G3L D;  2NBF A;  4B3R L;  3F2C A;  3T16 A;  1VQ7 A;  4B3S L;  3RLO A;  1JT8 A;  2IX3 A;  2N88 A;  2R92 B;  1LTR D;  2E2H H;  3DXJ C;  4AQY L;  5IT9 L;  2F0M A;  1HZA A;  1WI5 A;  4Q0F A;  2VQF L;  5CV4 A;  1CQF A;  1II3 A;  2HHH Q;  5C3E H;  4A3I G;  1JCK B;  1VQO A;  1JWS D;  5FJ8 G;  1WFQ A;  4NXM Q;  4OO1 G;  1YNJ D;  2G5D A;  3S1N H;  2VQE L;  2JQO A;  4JW0 A;  3SXH A;  1A6X A;  3HRZ C;  1MKH A;  1IW7 D;  1VF5 C;  4DR2 L;  2YTX A;  1PZJ D;  1TWH H;  1PYB A;  5EPJ A;  3S16 H;  3CRK C;  1RJT A;  1I5F A;  4KHP Q;  1Q46 A;  2AQ2 B;  3GTJ B;  1JJG A;  2CQO A;  2F0D A;  3D3R A;  1O7Y A;  3MZ5 A;  5C44 G;  4QIW B;  3S1M H;  1XNR L;  1PHJ A;  3L3O C;  1XMQ L;  3EVQ A;  3HOX B;  1EYG A;  3ICE A;  3EFX D;  1BOS A;  4JI8 Q;  1EY4 A;  1Y8P B;  2O5J C;  1U4P A;  1HXY D;  1PYS B;  4HED A;  4H44 C;  4F87 A;  3J81 E;  4OEM B;  3T13 A;  4P72 A;  1XNQ L;  4FYD A;  3BZK A;  2QDL A;  1XXG A;  4FNF A;  3SR1 A;  1I6V C;  3HOV G;  3S1Q H;  3OSO A;  3FPP A;  1YNX A;  2EE1 A;  3KLS A;  4UP7 A;  2YTV A;  5I9O A;  3QJY A;  1BBW A;  3TZD A;  4JV5 Q;  2IHF A;  1D7Q A;  1E2Z A;  1CSP A;  3A8K E;  1IL8 A;  1X55 A;  1L2F A;  2EJF C;  5E7N A;  1AH9 A;  1DOL A;  3J81 L;  2B2Y C;  3SK8 A;  4QY7 A;  4CJ0 B;  4HMI A;  3EQL C;  2B2W C;  3SVM A;  2UUA L;  2AUK A;  1H9J A;  4BA1 I;  2GVB A;  3H3V H;  1SN8 A;  1QG7 A;  2MHV A;  3D0F A;  1HR0 L;  1Y1W B;  2D0P A;  2C35 B;  1LM0 A;  2KA7 A;  2F0V A;  3M85 A;  2XWB B;  2Z4I A;  3MWY W;  3HOZ G;  2BOS A;  4KKS A;  5KGU A;  5IY0 A;  1I94 Q;  3OOC A;  2FMM A;  1ZEQ X;  3GP7 A;  2R92 H;  1CKO A;  4NDX A;  2EOT A;  2OF1 A;  1V1Q A;  5IGE A;  4B3M L;  4J15 A;  4CDC C;  1CKN A;  4A3E G;  1Q7Y C;  3AFP A;  4DUY Q;  1L1O A;  2QDB A;  1ONL A;  2K03 A;  2F0J A;  3DWQ A;  4HJ9 A;  2R3Z A;  4B3R Q;  1CKN B;  4JPB W;  4HCE A;  3UDX A;  3HOU B;  1X9N A;  4C1N K;  2CH4 W;  5M3F G;  4B3S Q;  2Q8R E;  3MFY A;  1N34 L;  1EEI D;  4DK3 C;  4LF6 Q;  2NZO A;  4AQY Q;  4YCV A;  1HHV A;  1Y8O B;  4UAI A;  4C3H H;  3K0Y A;  1IYJ B;  2K33 A;  2VQF Q;  3VA5 A;  1I4X A;  2I5H A;  2VUM G;  3Q23 A;  2FXQ A;  1X3Q A;  3KBX A;  2L4N A;  1CTM A;  2VQE Q;  2K14 A;  2A74 C;  3NUC A;  1F2M A;  2NWG A;  3BZD B;  1IW7 C;  4RA8 A;  4KHZ A;  4C3J G;  3J80 c;  1PYW D;  2MFI A;  3I72 A;  5LMN L;  3NEL A;  5D3I B;  3D6C A;  2RDF A;  2NVY H;  1EWC A;  2TSS A;  1A0I A;  1TS3 A;  5A2Q E;  3TS0 A;  1KLU D;  1YIJ A;  5I9P A;  2D2C C;  5GAH C;  4XT3 B;  1PTO H;  1WCM B;  1I3Q B;  2JSO A;  3C46 A;  4DR1 L;  4IQZ A;  1PVO A;  2JA8 B;  3A0J A;  2OQ0 A;  2ZXR A;  1XMQ Q;  3P75 A;  4FXK C;  4O0A A;  1K9M C;  5GRO A;  1D1K A;  3KLW A;  2PNH A;  1ZYR C;  1ET9 A;  4GLA C;  3OYY A;  4HIM A;  4R8I A;  2VNU D;  2JA6 G;  5A2Q L;  1E2V A;  3G6E A;  2JA5 H;  3NTK A;  4JI2 L;  2K6A A;  5FOB B;  4JVZ A;  2Z1C A;  1MD2 D;  3K58 A;  3I3C A;  5JPN C;  2BCO A;  1EWH A;  2JEB I;  3DHQ A;  2N78 A;  4N9P A;  2EY5 A;  1EIH A;  1Y1W H;  1CZW A;  3N52 A;  2FJ2 A;  4CKE A;  4BS9 A;  1DYQ A;  3I4L A;  2MNA A;  2RCF A;  3VA7 A;  1NBW A;  1NSN S;  4OWW B;  4FF3 A;  5C0X I;  4LNQ A;  3HOY B;  4FXG C;  1KLG D;  2Y0S B;  4EX5 A;  2K04 A;  4QGU A;  2RBM A;  4H7B A;  5EBD A;  2UUA Q;  2F52 A;  4DXF A;  3CPF A;  1HR0 Q;  2K5W A;  4C3I B;  1JE5 A;  2HQE A;  2WB1 B;  2XNA C;  3CU7 A;  3ZJY C;  5IP7 H;  3GTM H;  2EY6 A;  5IP9 H;  3HOU H;  4O2D A;  2F0E A;  4XIG S;  1I6H B;  3K6O A;  4KJN A;  1UE7 A;  5C0X H;  5ELN A;  1X56 A;  2F03 A;  4B3M Q;  3I90 A;  3MHB A;  1IBL L;  2F0H A;  1GUS A;  1D1I A;  4FF2 A;  1QCB D;  2XGT A;  1B9M A;  2R93 B;  4P75 A;  1SMY D;  4B9X A;  1VF7 A;  4RWS C;  3VR6 A;  3TZU A;  1D5M C;  1Y1V B;  1ESR A;  4A3M B;  3AEV A;  2PO4 A;  1VQN A;  2ICI A;  2DN8 A;  4ZAI A;  3I4N B;  1YNN C;  3I4M G;  1F9P A;  1CFM A;  4KKT A;  5CV7 A;  1N34 Q;  3PO3 H;  1DJR D;  1I4G A;  3CCQ A;  1HNZ L;  2ZXO A;  3FKI B;  4QQB X;  4N9T A;  4PMW A;  3QOL A;  1VQE A;  1M4V A;  1TS2 A;  2Y0S E;  3AU7 A;  1QIL A;  4DK1 A;  2K01 A;  1JWM D;  4HCS A;  1L1O C;  1LT5 D;  1AP0 A;  4R4Q A;  3D4R A;  5DNF A;  1PFB A;  1TII D;  2LMC B;  3H0G B;  3RN5 A;  5CYU A;  3DWP A;  4A3D B;  5COR A;  5HY6 A;  1WCM H;  1I3Q H;  2WB1 E;  2OTJ A;  1Z47 A;  3RD4 A;  1KAW A;  3H15 A;  1X54 A;  4JOI A;  3Q6S A;  2B8G A;  1KDC A;  5HUR A;  3FVQ A;  2XRS D;  3V2T A;  4P74 A;  5LMN Q;  3DMU A;  4QUF A;  1EUJ A;  3NBI A;  4A3C G;  2P5Z X;  2QIL A;  3TRE A;  2C5C A;  4IPC A;  2YU9 H;  2VB2 X;  3S24 A;  4GNX C;  4K14 A;  1MIU A;  4DR1 Q;  4DV7 L;  1QJO A;  4MN3 A;  1UE5 A;  1STY A;  3QR8 A;  1SMX A;  1PH9 A;  2XIW A;  5EAY A;  4X66 L;  2JA7 G;  2WAC A;  2LFN A;  3NP8 A;  3GV3 A;  3CQZ H;  3BYY B;  1VQ5 A;  1Q1E A;  4J6H A;  4YY3 L;  1Q8I A;  1Z9F A;  4DV2 Q;  4RHR A;  2Z6B A;  4DNI A;  2CWA A;  3KOJ A;  1LO5 D;  1LTI D;  1HUM A;  3RNU A;  5C5L A;  1XMO L;  1WJJ A;  5D65 A;  3SHL A;  3SK4 A;  3HG9 A;  4JI3 L;  1CZG A;  5I4D A;  1ESF A;  2CW0 D;  4GKJ L;  3K57 A;  4JI2 Q;  3RLN A;  1I4H A;  5KIX A;  5IGD A;  4BY1 B;  3U58 A;  2B2T A;  4XYQ A;  5EKI A;  1EQR A;  1VMC A;  3B6Y A;  2Z8L A;  4C3I H;  1HPC A;  3C1E A;  3VYT A;  1VQP A;  4POG A;  4DAP A;  1DD2 A;  4CDF C;  4GKK L;  1MI2 A;  2M2L A;  3L9A X;  4XTC S;  1TS5 A;  1K83 B;  5D14 A;  1I6H H;  1JB3 A;  3GO5 A;  3I4O A;  3KJO A;  1QOH A;  2HQL A;  3F1Z A;  1H9R A;  4ID6 A;  5H1S E;  1PTO F;  4BXX G;  5I2X A;  3D31 A;  1WTO A;  1ZXT A;  2IW3 A;  2OCE A;  2R93 H;  5FLM G;  1WTV A;  1I4R A;  5C44 B;  1Q90 A;  1KDB A;  3H09 A;  4WJW A;  1Y1V H;  4A3M H;  2I46 A;  2DNC A;  3E9H A;  3I4N H;  5FLX L;  1QNK A;  4X62 L;  1QZG A;  3MAQ A;  1GUO A;  1TWA B;  4O42 A;  2F0L A;  4YWM A;  1BUV T;  5IT9 c;  3FKI H;  3A54 A;  2B2U C;  1VQ4 A;  4OXP A;  4M1U B;  1CQV A;  1IBL Q;  4HTH A;  3UE0 A;  5ELC A;  1AN8 A;  2YYZ A;  1CUK A;  3AMU A;  1PH5 A;  3UDI A;  3KBG A;  3H0G H;  4DR4 L;  4ZRZ A;  1I4P A;  1DCZ A;  2K05 A;  3ULP A;  2B63 H;  1EIF A;  3MVV A;  3IAY A;  2OEO A;  4RGM A;  4XDX A;  5KYL A;  2E2H B;  4A3F G;  4EQN A;  4KD3 A;  3RZD H;  2A69 D;  4R4I A;  4PZ7 A;  1M8A A;  5EGT A;  5TSS A;  1HNZ Q;  2MO0 A;  3IFD A;  4B3T L;  2DJF C;  4BBS B;  2N3S A;  2YTY A;  1F2Z A;  5ISR A;  3R2T A;  2IWH A;  1VQ9 A;  3CD6 A;  4LF7 L;  4LF4 L;  3EA6 A;  3EJI A;  3S2H B;  4DF7 A;  4NXN L;  1W2B A;  2A73 B;  3Q8D A;  3HKZ E;  2JYO A;  1BKB A;  1NTG A;  2WAQ G;  2J0T D;  1LTS D;  2EY1 A;  1TWH B;  3RR5 A;  4EQP A;  3BDL A;  2M00 A;  1JWU D;  4DV4 Q;  3UE1 A;  2L11 A;  3S16 B;  1L0X B;  2K5D A;  4HN7 A;  3HOW H;  3G6J B;  3R93 A;  2A68 C;  5IIF A;  2VXW A;  2WKD A;  3HZX A;  4RHS A;  2NTT A;  4LJZ C;  2IY5 B;  3CHB D;  4GOP C;  5J3B A;  2K5H A;  3NE5 B;  5IYC G;  1K8A C;  1SYG A;  1YZ6 A;  4DV7 Q;  3QWN A;  3K80 C;  3PV0 A;  2K4K A;  4X66 Q;  1E1O A;  2O2L D;  3STB D;  4BY1 H;  5FJ8 H;  1HJP A;  4YY3 Q;  1E7Z A;  1A3V A;  5GQO A;  5JJZ A;  4CJ1 B;  1SDF A;  1RKN A;  3PUV A;  3SGI A;  1EQQ A;  5M3F B;  3PUX A;  1XMO Q;  1PLF A;  2RSN A;  1WOC A;  3S1Q B;  4JI3 Q;  2R7Z B;  2E2I B;  3TSS A;  1K83 H;  3GTK B;  4GKJ Q;  4RMF A;  3K5L A;  2CW0 C;  3F2U A;  1PDQ A;  2RHQ B;  1TY2 A;  3MC0 B;  2WP8 J;  1VQA A;  4K6L A;  4G7H C;  1X65 A;  3X3N A;  2BA0 A;  3KF6 A;  4DFA A;  3KLR A;  1HQR D;  2EXZ A;  2AUJ D;  4YCU A;  1PH1 A;  1KL9 A;  3I7F A;  4X64 L;  5C44 H;  2ZJQ A;  2CVR A;  4ME3 A;  1Q1B A;  4LFC L;  1SYC A;  3LGJ A;  1I94 L;  4DAY A;  4GKK Q;  4RFB A;  4UP8 A;  4C3J B;  1GD7 A;  4U67 3;  1HTL D;  3PO2 G;  3KF6 B;  4HMJ A;  4LF8 L;  4HSP A;  4OGQ C;  4DKA C;  3CCM A;  2PZU A;  1LTB D;  2C9O A;  1WTR A;  4DAY B;  1ENA A;  1NY4 A;  2BH8 A;  1VQJ A;  1SXT A;  3MXP A;  3U9S A;  2IX1 A;  2V4D A;  4RH6 A;  4C56 C;  5BR8 L;  2EYJ A;  3WWV A;  3HOV H;  4A3B G;  2B2T C;  1AE2 A;  1QVC A;  1O78 A;  1RD9 D;  1J6Q A;  4OIK A;  1CA5 A;  4X62 Q;  4DR7 L;  3G4S A;  4WFN 3;  1SNC A;  4LF6 L;  5I6W A;  1B1Z A;  5AJ3 L;  3I2Z A;  4BBS H;  2IT1 A;  1SJE D;  1ROD A;  4L8J A;  1QB5 D;  4L6T B;  4OIJ A;  4IJL A;  2H5X A;  2F0S A;  3EN2 A;  5D3D A;  5JJL A;  1V1P A;  3S2H H;  1BBX C;  1TKW B;  2BH2 A;  3RUZ A;  4DR4 Q;  1PH7 A;  1EQT A;  1LTA D;  3D4W A;  3S1R B;  1VQM A;  4AYB E;  1PZI D;  2O4X A;  1B3Q A;  1V1P B;  4LUO A;  2K28 A;  1YEZ A;  1P8L A;  1SE2 A;  4LUV A;  4B3T Q;  1O7I A;  4C3H B;  3A5Z B;  5ELF A;  3J7A V;  2VB3 X;  1BCP C;  1IZ6 A;  1LT6 D;  3VR2 A;  4NKL A;  3CCS A;  1H9S A;  4LF7 Q;  2XTI A;  4LF4 Q;  1XYI A;  1NMG A;  5IWA L;  3ULJ A;  2KHI A;  3TP5 A;  4NXN Q;  4G57 A;  5C5M A;  3MEH A;  1LTG D;  4DGZ A;  3NQT A;  4B08 A;  1K0S A;  1E2W A;  3OPO A;  4NMZ A;  2CKZ B;  4YHH L;  1R4P B;  3BZC A;  2E5L L;  1H9S B;  2DGY A;  2K52 A;  3CKI B;  3CCR A;  1PMR A;  3QIA A;  1VQF A;  5BN4 A;  2NVY B;  3EIV A;  1T9H A;  4JI0 L;  3ERQ A;  1Y14 B;  1SE3 A;  3HKZ G;  2QF7 A;  3CXC A;  4JBM A;  4FF1 A;  1HQM C;  5M3F H;  1PTO B;  3NTH A;  1EOT A;  2R7Z H;  2E2I H;  3M4Y A;  1AE3 A;  3GTK H;  5HGT A;  4G7Z C;  4ILW A;  3D6W A;  1LLR D;  1S5E D;  4Z9C B;  3K7U C;  2SOB A;  3G71 A;  4KN4 C;  3A56 A;  1QNU A;  3H3V I;  5ELB A;  1PTO D;  5M3M G;  3STB C;  1JOQ A;  1EY7 A;  1RCV D;  3PCO B;  1JIC A;  1VQG A;  1PFS A;  5IOC A;  3J81 i;  3IFT A;  1S5B D;  4A3J G;  3I4M B;  3T1H Q;  1KNA A;  1RF2 D;  5FO7 B;  2JA5 B;  4JK1 C;  4C3J H;  4A93 B;  3CMA A;  2NZH A;  1V43 A;  4QIW E;  5FK9 C;  2F0U A;  3I91 A;  2KEE A;  4U68 A;  3JAM E;  3CCV A;  5FO8 B;  5C4H A;  1QUQ A;  1NCV A;  5JVG 3;  1RTN A;  3J7Y W;  3HFZ B;  1VCI A;  4KTA A;  2AWO A;  4X64 Q;  2GVA A;  4LFC Q;  1QUQ B;  3OW2 A;  1BF4 A;  3H94 A;  4P73 A;  1B8A A;  2F4I A;  4LF8 Q;  3CCL A;  3CF5 A;  4OX9 L;  4JYA L;  4FXD A;  4A3G B;  1YIT A;  3ND8 A;  2ZJP A;  2SDF A;  4NPS A;  2EYO A;  2NTS A;  1KRS A;  2PQA A;  2A5H A;  1FGU A;  2A6E D;  3JAM L;  1C48 A;  3C1F A;  1VQD A;  5E4X A;  2JA6 H;  2UXB L;  3FHW A;  3OHX C;  1R4Q B;  5BR8 Q;  4KI0 A;  3GTM B;  3Q22 A;  3ULL A;  5I2Y A;  1PH8 A;  3S1R H;  1H9M A;  3VR3 A;  1GUN A;  2PQA B;  4MTK A;  3MA2 B;  3TDQ A;  2JA7 B;  3OIQ A;  1TWC H;  4DR7 Q;  1A2T A;  1LTL A;  3PUZ A;  1BNZ A;  3H3V C;  2Q2I A;  2UXC Q;  5AJ3 Q;  3RZO B;  1W6K A;  1X6O A;  2Q2U A;  4TRD A;  2RKS A;  3I56 A;  4V19 0;  5LMU L;  4OON A;  1VQC A;  1X3F A;  2V1C C;  4R4T A;  2ZTC A;  4I7A A;  1YNJ C;  4FO2 A;  3FEW X;  1NJI C;  4KY6 A;  2K5Q A;  3PO3 B;  4PNY A;  1Q8K A;  3TBI B;  5T1I A;  3W1B A;  2A1A A;  3GV6 A;  4PQX A;  3R8B A;  3A7A B;  4GN4 B;  4QB4 A;  4ZKB B;  1HNW Q;  3NBH B;  2L9H A;  2EYH A;  1BXT A;  2CQA A; 
#chains in the Genus database with same CATH homology
 4IN3 A;  3SE0 A;  1FYC A;  2IL8 A;  4ZQ3 A;  5EJW A;  1K8M A;  3C2P A;  3BDC A;  2SEB D;  4HR7 B;  3X3M A;  4Y7N B;  5IGG A;  1A3T A;  2EJM A;  2F0T A;  2NN6 I;  2Q8I B;  2YU9 B;  4HAE A;  5CBA E;  5BN5 A;  1NAP A;  3OWF A;  4KK7 A;  3VR4 A;  4XQN A;  1J9O A;  4Q5V A;  4XXE A;  3TN2 A;  3KF8 A;  4H0L C;  3CQZ B;  1G91 A;  1JQY D;  1AZP A;  1SYE A;  2D5D A;  1PTO C;  4ZLT F;  1L0Y B;  1Q3L A;  2NN6 H;  1CT1 D;  4KY7 A;  2AQ1 B;  1XWE A;  5JEA J;  4DN4 M;  3QOJ A;  1D2B A;  3T4A C;  3T51 B;  2RA4 A;  4JBW A;  3Q24 A;  1PRT B;  4EQO A;  1DZ1 A;  4RCO A;  1UUP A;  1CI3 M;  2M9V A;  3CRL C;  3NTI A;  1PRT D;  2A6E C;  3A8I E;  4DAV A;  1HUN A;  2H4O A;  1EY8 A;  5E4W C;  1T5X D;  2SNS A;  4IFD J;  2BDN A;  2XWJ B;  4S3S A;  1WVL A;  1SEB D;  1SNQ A;  4K5W A;  3GQB A;  1V1O A;  3H91 A;  5IGC A;  3DUZ A;  3J80 E;  2B63 B;  3TP6 A;  4G4K A;  4XQQ A;  3RZD B;  5EPK A;  4IUU A;  5M5W B;  1TU2 B;  1I4Q A;  2PCF B;  5E1F A;  2HCC A;  1SNP A;  1VDZ A;  3A55 A;  3NSW A;  5M5Y B;  1TS4 A;  5JEA G;  3ZYY X;  3IL8 A;  4DK0 A;  2HDL A;  3J80 L;  2DY8 A;  1F9R A;  2PW7 A;  3QO2 A;  1OXX K;  3NWS A;  3HOW B;  2AQ3 B;  4DNT B;  3RLF A;  1HCZ A;  2I07 B;  2E2D C;  3TME A;  2X69 A;  1STA A;  5C0X G;  1I50 B;  1QE6 A;  2Z4H A;  4A3I B;  1EZ6 A;  1JC7 A;  2LY7 A;  2R61 A;  3E6Z X;  2J7Z A;  1EQV A;  4X3K A;  1JOO A;  1EYA A;  2R6G A;  1LT3 D;  3H6M A;  3SEB A;  1XTC D;  4ZYS A;  1OXS C;  2B2V A;  1CA6 A;  4IFD G;  4RCN A;  1DM0 B;  5K36 G;  4BA2 I;  5KYI A;  1LAC A;  1RHP A;  4R8N A;  1G8Z D;  1Y8N B;  3WOE A;  3P20 A;  1GUT A;  1JR0 D;  1STG A;  4ZUI A;  1EU3 A;  2BE5 D;  4J8Q A;  1EL0 A;  5EKL A;  1U4L A;  2PQE A;  1SE4 A;  3S17 B;  4KV6 A;  2AWN A;  2Q8T A;  2EYM A;  2F0W A;  2EVB A;  1TQO A;  2EYP A;  4FP5 D;  1LT4 D;  3HOV B;  1D5Z C;  5KEE A;  3MFG A;  1SMY C;  4HSV A;  1J8I A;  3ND9 A;  2QCP X;  1O80 A;  5M3M B;  5C4Z A;  1H9K A;  4TSS A;  4P2C B;  4A3J B;  1KTK A;  2NYZ D;  4EGV A;  1JOK A;  2PW5 A;  5COY A;  1Q12 A;  2NZ1 D;  3R2I A;  2IPK D;  1SYB A;  1HTP A;  1Y69 U;  3M4O B;  3HP3 A;  2RDG A;  2KCC A;  5DM7 3;  4OO1 I;  4CJ2 C;  1F9Q A;  4GZY C;  3M3Y B;  4DA2 A;  2PMZ B;  3HOZ B;  2J4X A;  5LL6 S;  3FPU B;  5AFW A;  1DOM A;  3PMF A;  4K2L A;  4YIJ A;  1IKM A;  3A8J E;  4NP5 A;  2F3W A;  2A6H D;  1U4M A;  3NQI A;  4A3E B;  2DY7 A;  1KAB A;  2N55 A;  4OHJ A;  3W2D A;  4FF4 A;  1SAP A;  3K5M A;  4OO1 H;  4QCL A;  2B2Y A;  4IZ8 A;  2NUC A;  3MTS A;  4IUQ A;  3PUY A;  3V96 A;  2JXM B;  1S5F D;  4DU9 A;  1F77 A;  3VYS A;  1C8C A;  4TQU S;  4X3S A;  2VUM B;  4MHE A;  3DEP A;  3KUP A;  4XQJ A;  2E76 C;  1F2Y A;  1S5D D;  3OIP A;  4LAA A;  2KOL A;  2RDH A;  1WD1 A;  1T5E A;  5NUC A;  1X3P A;  2F3V A;  4ABN A;  1U9R A;  1G2T A;  1SNO A;  3M7G A;  5IT9 E;  2FHT A;  4X3T A;  2EY2 A;  4EVO A;  1S4Z A;  3GD7 A;  4KHV A;  1OXV A;  1KNE A;  3BVG A;  3I73 A;  3K7A B;  4RGN A;  3ITP A;  2JA6 B;  1FNU A;  1B2T A;  1A15 A;  4BY7 B;  4E6I A;  4QF4 A;  2FMC A;  4TKO B;  1TWC B;  3NWT A;  4ULL A;  3O13 A;  2A69 C;  5M5X B;  2EYL A;  3ONA B;  1PRT F;  3U9O A;  3OMG A;  5T1G A;  5I6Y A;  1OO9 B;  3DEO A;  2L12 A;  3I8Z A;  5KRU A;  1Z7T A;  4PMB A;  3K59 A;  4CKB A;  1V8Q A;  1TR5 A;  1HFG A;  2NVQ B;  5EKK A;  2L1B A;  2EDG A;  1FNW A;  2ZT9 C;  1D6E C;  2HDM A;  3A7L A;  1TY0 A;  4XT1 B;  5EPL A;  2KJX A;  5JVH 3;  1WD0 A;  1IKL A;  2PPB C;  2A6H C;  3FDT A;  3P1H A;  1BQQ T;  1OXU A;  1MGS A;  1QWY A;  1ZYR D;  2K1B A;  3T56 B;  1UNS A;  4KJO A;  4I65 A;  1ILP A;  3E5S A;  5M9O A;  1EZ8 A;  4FVM A;  2D62 A;  4KKU A;  3LNN A;  4K2K A;  4CHT B;  4A3K B;  1UAP A;  1WTX A;  3NXW A;  1KDA A;  3PIO 3;  1U4R A;  1GUW A;  2MPM A;  3LWE A;  2F0F A;  2GA4 B;  1MSG A;  3RMH A;  3PUW A;  2KVM A;  2RQX A;  2NB0 A;  3NPP A;  1EY0 A;  3IKJ A;  3NK9 A;  4B9W A;  1DOK A;  2RVL A;  1ENF A;  3SK5 A;  3DWA A;  4PMC A;  4QMG A;  3J7A F;  5J1Z A;  2B39 A;  4ZKC B;  1ENC A;  3FRP B;  1ML0 D;  5E3F A;  5EBC A;  4IUN A;  1CHQ D;  1E0B A;  1HFN A;  1DXM A;  3GTL B;  1O7Z A;  1A3U A;  5LHY 1;  5C4J B;  4IUP A;  2JP1 A;  1YNN D;  5CV5 A;  1KAA A;  3K5O A;  2JE6 I;  3NBH A;  1B50 A;  1FR3 A;  1SND A;  2H1E A;  5C6A A;  3BG3 A;  1LAB A;  2MGS A;  1F2L A;  2F0Q A;  3GTO B;  3TP8 A;  3E0J A;  4DXG A;  2XVS A;  2QKI C;  1RTO A;  2OT2 A;  5CV8 A;  5A35 A;  3G7L A;  2KEC A;  4MIU A;  1TVX A;  3KK7 A;  4ZUJ A;  3GTG B;  2IJ0 A;  1AFP A;  4IUV A;  2LKV A;  3BS1 A;  3S14 B;  1NR4 A;  1OXT A;  1W6J A;  1CK1 A;  5ELE A;  2FFK B;  5LL6 X;  1AZQ A;  3TP7 A;  4DNR B;  1IYV A;  1EY9 A;  3SK6 A;  4H13 C;  1GHK A;  3OWE B;  3S2D B;  1BCP F;  4CGY B;  2KHS A;  3S15 B;  1BO0 A;  4C1N I;  1JE4 A;  2D9U A;  5DAU A;  3UI2 A;  4ZK9 B;  2L5T A;  2WV6 D;  4A3F B;  4IUT A;  1AEX A;  1GHJ A;  1PFN A;  2X6L A;  1SBB B;  3QB3 A;  5ELD A;  5C4X B;  5KND A;  1IYU A;  2BDO A;  4C3H G;  2OXP A;  5FKA C;  2IX0 A;  3D8G A;  3P7J A;  2XRQ D;  2WAQ B;  4R9W A;  5JEA H;  2B2U A;  5CC4 A;  1CHP D;  3GTP B;  4RKB A;  4RAU C;  4C2M B;  5C0X J;  5JPM C;  4L63 B;  5J39 A;  1WTW A;  1RDP D;  1X32 A;  3GTQ B;  2MUY A;  4KMU C;  4G7O C;  1DON A;  4IFD I;  3MXU A;  1LTT D;  2ICE C;  5CV6 A;  1D5X C;  3I70 A;  1HA5 A;  1EEF D;  1EY5 A;  1NUC A;  2MP1 A;  4RKL A;  2XN9 C;  1ET6 A;  2WKC A;  3VYR A;  1Z6H A;  2ZXP A;  1SJH D;  5KNB A;  2EJG C;  2LS0 1;  2E2J B;  4IFD H;  1VMP A;  4M8A A;  5K36 H;  4CKC A;  1GUG A;  1C4Q A;  4IUR A;  3SDZ A;  1SYD A;  4K8J A;  5G3L F;  2B8F A;  4RGT A;  4LMQ D;  5CR3 A;  3BDO A;  1TWF B;  2NN6 G;  2PZT A;  3PO2 B;  5CGK A;  1IHZ A;  4KN7 C;  2DNE A;  4XYO A;  3PIP 3;  3ERO A;  4QUC A;  4K6D A;  2A68 D;  1EIG A;  3D4D A;  3DM1 A;  1B44 D;  4A3B B;  2TMP A;  4KD4 A;  2HUG A;  5C3X A;  4WOR A;  2E74 C;  5CV9 A;  4O1N A;  3C3L A;  4BWG B;  2WIN B;  2NVX B;  1GOZ A;  5BN3 A;  1FGB D;  3OW7 A;  5FO9 B;  4IAL A;  1ICW A;  1O7L A;  2SNM A;  2KUM A;  1STE A;  2O5I C;  2F0K A;  1STB A;  3OMC A;  4WRD A;  1S5C D;  1B53 A;  1XX8 A;  3Q0A A;  1SFO B;  2K7V A;  4BBR B;  1AW7 A;  3MXG A;  2NVT B;  1SSO A;  1B4O A;  2FIN B;  2MJ8 A;  1G6Z A;  2RSO A;  5FLX E;  1A2U A;  3HGB A;  3AB9 A;  4ME5 A;  1F9S A;  2X6G A;  4I7Z C;  4F7X A;  1NR2 A;  3HS0 C;  5F2D A;  1EFI D;  1GXD C;  1PXU A;  1HRJ A;  4CBV A;  5K5P A;  3HKZ B;  2KQ3 A;  1FD7 D;  3URY A;  2HCI A;  3LWU A;  1PRT C;  5DEH A;  5KNC A;  2EYF A;  1PZK D;  4K5V A;  1STN A;  1EYC A;  4RGO S;  2E75 C;  3QG1 A;  4F8M A;  3LX0 A;  1ILQ A;  2KCN A;  1BCP B;  1WTP A;  1UEA B;  2F0O A;  2EZV A;  1SYF A;  3M7N A;  2F0I A;  3FMC A;  5JOB A;  1TWG B;  5C3W A;  1BCP D;  1GJX A;  3T53 B;  4K8I A;  5C3E B;  2L55 A;  4PV1 C;  1EYD A;  3W3A A;  5IGB A;  5EQ0 A;  1BDO A;  1FNV A;  1TT2 A;  3S1N B;  4C3I G;  2ID0 A;  4NW2 A;  1HA6 A;  5CMD A;  1ZKO A;  3VYU A;  2F0G A;  1G2S A;  3S9W A;  2G9D A;  1K8O A;  2EPB A;  3BVM A;  3KLS X;  4OL7 A;  1BR9 A;  2PYK A;  4X3U A;  3MXN A;  2F0P A;  3BVZ A;  2WII B;  1R9T B;  2QEJ C;  2XSC A;  3WOF A;  1PFM A;  2B2W A;  2F0N A;  2KED A;  3S1M B;  3BYT B;  4KY5 A;  3N6R A;  2CHB D;  5J22 A;  2L0C A;  1CM9 A;  2BA1 A;  3VR5 A;  1B9N A;  1EU4 A;  5DM6 3;  4K5X A;  1JOR A;  3R3O A;  3V05 A;  2PZW A;  3L7Z C;  1MBY A;  4ODG A;  2K32 A;  4F88 A;  2JEA I;  4UDU C;  2G9H D;  4J1M A;  1LV9 A;  1WTQ A;  4V0B A;  5CBE E;  1B3A A;  5IOD A;  4AYB B;  3WDN A;  3HEJ A;  1STH A;  2PNR C;  2BE5 C;  3NHH A;  1MSH A;  2F1M A;  3K5N A;  2ENB A;  5JAV A;  4LK1 C;  1SNM A;  5IGF A;  1G29 1;  1EY6 A;  2B2V C;  5G3L D;  2NBF A;  3T16 A;  2IX3 A;  2N88 A;  2R92 B;  1LTR D;  3DXJ C;  5IT9 L;  2F0M A;  4Q0F A;  5CV4 A;  1CQF A;  1II3 A;  1JCK B;  1JWS D;  4OO1 G;  1YNJ D;  1A6X A;  3SXH A;  3HRZ C;  1IW7 D;  1VF5 C;  1PZJ D;  5EPJ A;  3CRK C;  1RJT A;  2AQ2 B;  3GTJ B;  2F0D A;  3D3R A;  1O7Y A;  3MZ5 A;  4QIW B;  3L3O C;  3EVQ A;  3HOX B;  3EFX D;  1BOS A;  1EY4 A;  1Y8P B;  2O5J C;  1U4P A;  1HXY D;  4HED A;  4F87 A;  4H44 C;  3J81 E;  3T13 A;  4FYD A;  1XXG A;  4FNF A;  3SR1 A;  1I6V C;  3OSO A;  3FPP A;  2EE1 A;  3KLS A;  5I9O A;  3QJY A;  3TZD A;  1E2Z A;  3A8K E;  1IL8 A;  2EJF C;  1DOL A;  3J81 L;  2B2Y C;  3SK8 A;  4CJ0 B;  4HMI A;  3EQL C;  2B2W C;  3SVM A;  2AUK A;  1H9J A;  4BA1 I;  1QG7 A;  2MHV A;  1Y1W B;  2KA7 A;  2F0V A;  3M85 A;  2XWB B;  2Z4I A;  3MWY W;  2BOS A;  4KKS A;  5KGU A;  3OOC A;  2FMM A;  1ZEQ X;  3GP7 A;  4NDX A;  2EOT A;  2OF1 A;  5IGE A;  2QDB A;  1ONL A;  2K03 A;  2F0J A;  3DWQ A;  2R3Z A;  4HCE A;  3HOU B;  4C1N K;  2Q8R E;  3MFY A;  1EEI D;  1HHV A;  1Y8O B;  4UAI A;  3K0Y A;  2K33 A;  3VA5 A;  1I4X A;  3Q23 A;  1X3Q A;  3KBX A;  2L4N A;  1CTM A;  2A74 C;  3NUC A;  1F2M A;  2NWG A;  3BZD B;  1IW7 C;  4RA8 A;  4KHZ A;  4C3J G;  1PYW D;  3I72 A;  5D3I B;  3D6C A;  2RDF A;  2TSS A;  1EWC A;  1TS3 A;  5A2Q E;  1KLU D;  5I9P A;  2D2C C;  4XT3 B;  1PTO H;  1WCM B;  1I3Q B;  2JSO A;  3C46 A;  4IQZ A;  2JA8 B;  2ZXR A;  3P75 A;  4FXK C;  1D1K A;  1ZYR C;  1ET9 A;  4R8I A;  2VNU D;  5A2Q L;  1E2V A;  3NTK A;  2K6A A;  5FOB B;  2Z1C A;  1MD2 D;  3K58 A;  3I3C A;  5JPN C;  2BCO A;  1EWH A;  2JEB I;  3DHQ A;  1EIH A;  4N9P A;  2EY5 A;  1CZW A;  3N52 A;  2FJ2 A;  4CKE A;  4BS9 A;  1DYQ A;  3I4L A;  3VA7 A;  1NSN S;  4FF3 A;  5C0X I;  3HOY B;  4FXG C;  1KLG D;  2Y0S B;  2K04 A;  2RBM A;  4H7B A;  5EBD A;  4DXF A;  2K5W A;  4C3I B;  2WB1 B;  2HQE A;  2XNA C;  3CU7 A;  2EY6 A;  2F0E A;  4XIG S;  1I6H B;  3K6O A;  4KJN A;  5C0X H;  2F03 A;  3I90 A;  3MHB A;  2F0H A;  1GUS A;  1D1I A;  4FF2 A;  1QCB D;  1B9M A;  2R93 B;  1SMY D;  4B9X A;  1VF7 A;  4RWS C;  3VR6 A;  3TZU A;  1D5M C;  1Y1V B;  1ESR A;  4A3M B;  2PO4 A;  2ICI A;  2DN8 A;  4ZAI A;  3I4N B;  1YNN C;  1F9P A;  1CFM A;  4KKT A;  5CV7 A;  1DJR D;  1I4G A;  2ZXO A;  3FKI B;  4N9T A;  4PMW A;  3QOL A;  1M4V A;  1TS2 A;  3AU7 A;  4DK1 A;  1QIL A;  2K01 A;  1JWM D;  4HCS A;  1LT5 D;  1AP0 A;  3D4R A;  5DNF A;  1PFB A;  1TII D;  2LMC B;  3H0G B;  5CYU A;  3DWP A;  4A3D B;  5COR A;  1Z47 A;  3RD4 A;  3Q6S A;  2B8G A;  1KDC A;  5HUR A;  3FVQ A;  2XRS D;  3V2T A;  3DMU A;  4QUF A;  3NBI A;  2QIL A;  2C5C A;  2VB2 X;  4K14 A;  1QJO A;  4MN3 A;  1STY A;  2XIW A;  2WAC A;  2LFN A;  3NP8 A;  3GV3 A;  3BYY B;  1Q1E A;  4J6H A;  1Q8I A;  4RHR A;  1LO5 D;  1LTI D;  1HUM A;  5C5L A;  5D65 A;  3SHL A;  3SK4 A;  3HG9 A;  5I4D A;  1CZG A;  1ESF A;  2CW0 D;  3K57 A;  1I4H A;  5KIX A;  5IGD A;  4BY1 B;  2B2T A;  4XYQ A;  5EKI A;  1VMC A;  2Z8L A;  1HPC A;  3C1E A;  3VYT A;  4DAP A;  1DD2 A;  1MI2 A;  2M2L A;  3L9A X;  4XTC S;  1TS5 A;  1K83 B;  5D14 A;  1JB3 A;  3GO5 A;  1QOH A;  1H9R A;  4ID6 A;  1PTO F;  5I2X A;  3D31 A;  1WTO A;  1ZXT A;  2IW3 A;  1WTV A;  1I4R A;  5C44 B;  1Q90 A;  1KDB A;  3H09 A;  4WJW A;  2I46 A;  2DNC A;  5FLX L;  1QNK A;  3MAQ A;  1GUO A;  1TWA B;  4O42 A;  2F0L A;  1BUV T;  3A54 A;  2B2U C;  4M1U B;  1CQV A;  4HTH A;  5ELC A;  1AN8 A;  2YYZ A;  3AMU A;  3KBG A;  4ZRZ A;  1I4P A;  1DCZ A;  2K05 A;  3MVV A;  3IAY A;  2OEO A;  4RGM A;  4XDX A;  5KYL A;  2E2H B;  4EQN A;  4KD3 A;  2A69 D;  1M8A A;  5EGT A;  5TSS A;  3IFD A;  4BBS B;  1F2Z A;  5ISR A;  3R2T A;  2IWH A;  3EA6 A;  3EJI A;  3S2H B;  4DF7 A;  2A73 B;  2JYO A;  2J0T D;  1LTS D;  2EY1 A;  1TWH B;  4EQP A;  3BDL A;  2M00 A;  1JWU D;  2L11 A;  3S16 B;  1L0X B;  2K5D A;  4HN7 A;  3G6J B;  3R93 A;  2A68 C;  5IIF A;  2VXW A;  2WKD A;  3HZX A;  4RHS A;  2NTT A;  4LJZ C;  3CHB D;  3NE5 B;  1SYG A;  3QWN A;  3PV0 A;  2O2L D;  1A3V A;  5JJZ A;  4CJ1 B;  1SDF A;  1RKN A;  3PUV A;  5M3F B;  3PUX A;  1PLF A;  2RSN A;  3S1Q B;  2R7Z B;  2E2I B;  3TSS A;  3GTK B;  3K5L A;  2CW0 C;  3F2U A;  1PDQ A;  1TY2 A;  3MC0 B;  2WP8 J;  4K6L A;  4G7H C;  3X3N A;  2BA0 A;  4DFA A;  3KLR A;  1HQR D;  2EXZ A;  2AUJ D;  2CVR A;  1Q1B A;  1SYC A;  4DAY A;  4RFB A;  4C3J B;  4U67 3;  1HTL D;  4HMJ A;  4HSP A;  4OGQ C;  2PZU A;  1LTB D;  2C9O A;  1WTR A;  1ENA A;  1SXT A;  3MXP A;  3U9S A;  2IX1 A;  2V4D A;  4RH6 A;  4C56 C;  2EYJ A;  2B2T C;  1O78 A;  1RD9 D;  4OIK A;  1CA5 A;  4WFN 3;  1SNC A;  5I6W A;  1B1Z A;  2IT1 A;  1SJE D;  1ROD A;  4L8J A;  1QB5 D;  4L6T B;  4OIJ A;  2F0S A;  5D3D A;  1V1P A;  1BBX C;  1TKW B;  3RUZ A;  1EQT A;  1LTA D;  3D4W A;  3S1R B;  1PZI D;  2O4X A;  1V1P B;  2K28 A;  1SE2 A;  4C3H B;  5ELF A;  3J7A V;  2VB3 X;  1BCP C;  3VR2 A;  1LT6 D;  4NKL A;  1H9S A;  1XYI A;  3TP5 A;  4G57 A;  5C5M A;  4DGZ A;  1LTG D;  3MEH A;  4B08 A;  3NQT A;  1E2W A;  3OPO A;  4NMZ A;  1R4P B;  1H9S B;  3CKI B;  1PMR A;  3QIA A;  5BN4 A;  2NVY B;  3ERQ A;  1SE3 A;  2QF7 A;  4FF1 A;  1HQM C;  1PTO B;  3NTH A;  1EOT A;  3M4Y A;  5HGT A;  4G7Z C;  4ILW A;  3D6W A;  1LLR D;  1S5E D;  4Z9C B;  2SOB A;  4KN4 C;  3A56 A;  1QNU A;  5ELB A;  1PTO D;  1JOQ A;  1EY7 A;  1RCV D;  1JIC A;  5IOC A;  3IFT A;  1S5B D;  3I4M B;  1KNA A;  1RF2 D;  5FO7 B;  2JA5 B;  4JK1 C;  4A93 B;  1V43 A;  5FK9 C;  2F0U A;  3I91 A;  2KEE A;  4U68 A;  3JAM E;  5FO8 B;  5C4H A;  1NCV A;  5JVG 3;  1RTN A;  3J7Y W;  1VCI A;  4KTA A;  2AWO A;  1BF4 A;  3H94 A;  2F4I A;  4FXD A;  4A3G B;  3ND8 A;  2SDF A;  2EYO A;  2NTS A;  2A5H A;  2A6E D;  3JAM L;  1C48 A;  3C1F A;  5E4X A;  3OHX C;  1R4Q B;  4KI0 A;  3GTM B;  3Q22 A;  5I2Y A;  1H9M A;  3VR3 A;  1GUN A;  3MA2 B;  3TDQ A;  2JA7 B;  3OIQ A;  1A2T A;  3PUZ A;  1BNZ A;  3H3V C;  3RZO B;  1W6K A;  4TRD A;  2RKS A;  4V19 0;  1YNJ C;  4FO2 A;  3FEW X;  4KY6 A;  2K5Q A;  3PO3 B;  4PNY A;  3TBI B;  5T1I A;  3GV6 A;  4PQX A;  3R8B A;  3A7A B;  4QB4 A;  4ZKB B;  2L9H A;  2EYH A;  1BXT A;  2CQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...