5IOCA

Crystal structure of staphylococcal nuclease variant delta+phs v66h/v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66H/V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5iocA00
2KHSA 4ID6A 5HURA 4DGZA 1KDCA 4B9WA 4DFAA 2RBMA 1SYDA 2EYLA 3R3OA 4R8NA 5CV5A 4ZQ3A 3SK8A 2F0GA 2PZWA 3OMCA 5CV9A 4EVOA 4IUNA 3D8GA 5EGTA 4EQOA 3HZXA 2PZTA 4J1MA 4K8JA 5K5PA 2EY5A 2ENBA 5KEEA 1KDAA 3P1HA 4HMIA 3C1EA 4MIUA 4N9TA 5IGFA 4IZ8A 5IGDA 3NHHA 2F3WA 4I65A 4RKLA 1AEXA 2EYFA 2F0UA 2F0TA 4KHVA 4ZUIA 5C3WA 5I6YA 5IGEA 1SNOA 5CV8A 5C5LA 2EY6A 1EYAA 1SYCA 1TT2A 2F0VA 4J6HA 5IIFA 5CV7A 3MEHA 2LKVA 4K8IA 1A2UA 3S9WA 5ISRA 1STNA 3QOLA 4ME5A 3TP6A 4K5VA 5J22A 3OSOA 5I9PA 1STYA 4F8MA 1SNDA 3OMGA 3RUZA 3D6CA 1F2YA 1EQVA 4KTAA 5CR3A 4DU9A 3PMFA 2EY1A 2PW5A 4ODGA 1A3VA 4PMBA 4HMJA 5KIXA 2F0HA 3EVQA 5C3XA 2F0NA 4LAAA 4QF4A 5CV6A 5J1ZA 3SHLA 1EY9A 1IHZA 4KJOA 5KGUA 1JOKA 5I9OA 1STHA 4N9PA 2F0PA 3NXWA 3T16A 5IODA 2EYPA 4B9XA 4WRDA 3C1FA 1A3UA 4KJNA 3OWFA 3NUCA 5C4ZA 5JAVA 1EY5A 2SNSA 3MHBA 3SK6A 4EQNA 2EYHA 5KRUA 1SNCA 3SR1A 3V2TA 1EY0A 4E6IA 5NUCA 5KYLA 5CGKA 4DF7A 2F0LA 3QB3A 1SYGA 1EZ8A 3EROA 1KDBA 3MZ5A 1STGA 4IALA 2HQEA 2EYMA 2F0IA 4NP5A 5F2DA 2SOBA 5EKKA 5JOBA 2O4XA 5IOCA 3TP8A 3NQTA 3ITPA 2F0JA 3LX0A 2PZUA 1F2MA 3ERQA 4ZUJA 2KQ3A 3T13A 4F7XA 1EYCA 4H7BA 2EYJA 4KY6A 2OXPA 3TMEA 3HEJA 4TRDA 2EXZA 2NUCA 5IGGA 1JOOA 4RKBA 1KAAA 4K5XA 4K2LA 2QDBA 5DAUA 1ENCA 1A2TA 2F0DA 4S3SA 1JORA 1EY4A 1EY6A 2OEOA 4WORA 2F0QA 4YIJA 1NUCA 2F0WA 5C4HA 1KABA 3BDCA 3H6MA 4KY5A 3U9OA 4PMCA 3D4DA 4KD3A 3SXHA 2EYOA 3QOJA 2WACA 4QB4A 5CC4A 5I6WA 4PNYA 2F0KA 1SYEA 4G57A 1STAA 3D4WA 4KY7A 3MXPA 5CV4A 3DHQA 1ENAA 2M00A 4QMGA 5EKLA 1JOQA 4K6DA 2PQEA 5IGCA 1RKNA 5C5MA 1EY8A 5IGBA 3TP5A 1EY7A 2RKSA 4K5WA 2F0MA 5DEHA 4NKLA 1TQOA 2F0SA 1A3TA 4KD4A 4KV6A 3SK4A 3E5SA 1EZ6A 1SNPA 3BDLA 4HTHA 3TP7A 1F2ZA 5C6AA 1SNQA 3MVVA 4OL7A 1SYBA 4NDXA 2F0EA 4K2KA 3NK9A 3VA5A 5HGTA 2F3VA 1EYDA 5E1FA 1STBA 3P75A 2F0OA 2PW7A 2RDFA 4EQPA 5KYIA 3EJIA 4NMZA 5E3FA 2PYKA 1SYFA 2OF1A 3NP8A 2SNMA 1NSNS 1II3A 2F0FA 4K14A 2EY2A 5M9OA 1U9RA 1TR5A 1SNMA 5J39A 3SK5A 3DMUA
chains in the Genus database with same CATH superfamily
1EQTA 5K5PA 4N8FA 3VA7A 4NXNQ 2EJMA 4HJ8A 4J1MA 5J3BA 2IX0A 2VB2X 3P1HA 4YWMA 2FHTA 4WFN3 2F0TA 5IGEA 1VQBA 3H91A 2IHFA 1QB5D 2A73B 4AYBE 3I2ZA 3PO2H 1HA5A 3GV6A 1EQVA 5DLQE 3H09A 1J9OA 1AN8A 1PTOF 1GVPA 4LAAA 5CV6A 5CBEE 1O7ZA 4JVZA 3AMUA 1DD2A 1DCZA 5CBAE 1E0BA 4G7HC 1WCMB 4ZRZA 3PIOA 2D9UA 2MJ8A 2I0QA 3KBXA 1TWFB 3R8BA 4DNRB 1S72A 4B3ML 2K50A 2VZAA 5KYLA 4GNXB 1BQQT 2RDHA 4F88A 4JI3Q 3KF6B 3MZ5A 1LT6D 4JC0A 1OXXK 2ZJPA 3RZOH 4HEDA 1I94Q 4OWWB 4PZ7A 1LACA 4QGUA 5F2DA 3GTMB 5BR8L 4JI8L 3RN5A 2KHIA 3EA6A 2EDGA 3M85A 2A6HD 1EFWA 1E3PA 2CWPA 3Q24A 2MQHA 1BBXC 1CHPD 4WORA 1N33Q 1TWHH 2B2YC 5C4HA 1QNKA 4I7ZC 1EIYB 2B63B 1YJ9A 1A15A 3STBC 4P72A 1VQMA 3S17B 1UE5A 2WAQE 1VQLA 3MA2B 1OTCA 1Y1VB 1PFSA 4YCWA 1UAPA 5E7NA 3GTOH 2Q8TA 1XWEA 1E2WA 4NB3A 2I46A 1J5EQ 4LF5Q 4DR6Q 4NKLA 4R1JA 1WI5A 4KD4A 3M4PA 4X3SA 3BDLA 5IP9G 1ILPA 2LMCB 4OL7A 4IPHA 3S16H 4DN4M 2R92B 2PQAA 4BY1H 4R9WA 2F0OA 2VNUD 4BBRG 3KLSX 3NP8A 4J15A 1QOHA 1R9TH 2EY2A 3SVMA 1VQPA 4DK1A 1XNRL 2RBMA 1P8LA 1MJCA 5EPKA 3BU2A 3HKZG 2NVXH 2ZTDA 1TS5A 2VW9A 3K57A 1PTOD 3TRZA 2KCTA 2ATWA 3JAML 1D5MC 3CCVA 1D8LA 3U58A 3KJOA 3PO3B 3K5LA 4J6HA 3ZJYC 2RVLA 5JEAH 1STNA 4XT3B 4MTNA 4DV2L 1EUJA 1HUNA 1F9SA 1H9SB 2HD3A 4C56C 3RN2A 3PMFA 2XWJB 4HMJA 4O42A 1NJIC 2CQOA 4U68A 1BBWA 1WTVA 4BBSB 2F0PA 3VYSA 4B9XA 1HR0W 5FJ8G 4DAYA 3HOXH 1V1PA 2UU9Q 1QILA 3L7ZC 4C2MB 1CK1A 4DV3L 1N34L 4LF8Q 4X3TA 3PIP3 1NMFA 4X64Q 2R7ZG 4HJ9A 1ICFB 4K0KL 2HCIA 3NWTA 2F0JA 2Z6BA 2M2LA 3A54A 4KN7C 2DUDA 1B3QA 2DGYA 2K5VA 5IYCG 1YJWA 1A2TA 4JI2L 1HRJA 1KIXA 3L9AX 3LNNA 2FMMA 1X9NA 3NBHA 3SXHA 2EYOA 1YNNC 4RHRA 5CC4A 3CPWA 3A8KE 4PNYA 2PPBC 1B9NA 3F2DA 5EQ0A 4JI6Q 4LNQA 2NVTH 3C2PA 3W3AA 2MHVA 1YHBA 4A3KB 3BDOA 1WCMG 3S24A 4K5WA 3M4QA 3DUZA 4H02A 1Q12A 2IX3A 1FD7D 4DR1L 4L8JA 2I5MX 3PO2B 4IUUA 1PLFA 4P2CB 2B2YA 1IKMA 1W6JA 1BF4A 1HNWQ 1NTGA 1F77A 3NQIA 1ET9A 3KLWA 4JBWA 4HCSA 1K3RA 2HUGA 5M5YH 1S5BD 2RQXA 1WTHA 4FO2A 1W3SA 2EXDA 4KLKA 5CYUA 2PI2A 2E2IH 1YHAA 4RGOS 2CW0C 4HJ7A 1S5FD 3SDZA 1DXMA 4KHPL 2ZM6L 2CH4A 4I65A 3KF8A 4HIOA 2B63G 2TSSA 2SEBD 1SNOA 1PH1A 5LMNW 1AZQA 1R4PB 1E2VA 1Y1VG 2NBFA 4JCVE 4DK6C 1O78A 1WTQA 2UXDQ 4DR7Q 4DU9A 2WB1B 5M5WH 3E3XA 1A3VA 4ULLA 4IO9A 1N32L 2F0NA 4HIDA 1Q46A 1B8AA 4N9PA 4MZ9A 1NY4A 1TWHB 4DR2Q 4IN3A 1RTOA 5KRUA 1S5CD 1L1OA 1JWSD 1UE7A 2ZXRA 1F9PA 1SE3A 1ZEQX 3I91A 4DXFA 2B2UC 3PF4A 5JEAJ 1DZ1A 1G2TA 4POFA 3I4LA 4OHJA 5JJZA 3GTOB 2RCNA 3T13A 1O80A 1V43A 2MPMA 1S3OA 1AFPA 2QKIC 3H15A 2F4VL 4RKBA 2NVQH 1KLGD 1K0RA 2R7FA 1EY4A 4ZKBB 1RODA 1Q8IA 1KABA 2ZJRA 3U9OA 1PH7A 3K81C 1YJNA 2QGQA 4ABNA 4BY1B 4JPBW 4HJ5A 3D4WA 4CHTB 3FEWX 1VQKA 3GTKH 1G6ZA 1QUQA 4TKOB 2WINB 3UDIA 3HOYG 3F2BA 2B2WC 4CJ0B 2A8VA 1QG7A 4BBSG 3OW7A 1WFQA 1LV9A 1Q1BA 1MI2A 4AH6A 4K6DA 2NVXB 2Z0SA 3JAMc 5IGCA 3Q0AA 3A5ZB 4GLXA 2NZOA 4UHVA 4QY7A 2F0SA 4M8AA 4KV6A 5FLXL 4OIKA 3MC0B 2VUMG 1BKBA 4Y52H 5HGTA 3PUYA 1T5EA 5IP9H 1B1ZA 1EWIA 4XXEA 2AQ2B 4F87A 1G2SA 3K5MA 4O0AA 3S1RH 4NMZA 4Z9CB 4LWCA 1SNMA 4KKSA 4BBRH 5I6YA 2K75A 2B2TA 3D8GA 4FVMA 2PZTA 1K8OA 4N9TA 5C3WA 5C4JB 2BE5D 2YV5A 4IJHA 4JI4L 2BOSA 1BVSA 5CV8A 2EY6A 1Y8NB 3PQIA 1HZCA 3S9WA 4ME3A 1IL8A 1GKHA 2GA4B 5I2YA 3UDFA 3RZDH 5T1IA 4JI7Q 2HCCA 2RSNA 4A3KG 2ASBA 2VQEQ 2Q2HA 3HFZB 4JK1C 3DLLA 4JG2A 4ZYSA 4KJOA 1BR9A 2UUCL 3G6EA 4KJNA 1JR0D 1KTKA 5A2QL 5IT9E 1MJEA 3OWFA 4PG3A 5EAYA 5JAVA 2PQAB 2SNSA 3SK6A 2A6ED 1I6VC 5FJ8H 4NXML 4DF7A 4B3TQ 5ELEA 1HUMA 1QVGA 2D62A 1CSQA 1HNXQ 3I55A 1SJED 1S5DD 4NP5A 4BWGB 3GTLH 2R7ZH 2PNHA 3LX0A 3CQZH 4ZUJA 4RA8A 1EYCA 1LLRD 3K7UC 3TMEA 2J4XA 4FNFA 4K2LA 4JBMA 1EY6A 1BDOA 2A6HC 1UWVA 3GQBA 4KY5A 5IYCH 1RJTA 4WJWA 1VMCA 3ONAB 2F0KA 3PGZA 5GADC 2WB1G 1WTOA 2BDNA 5M5YB 1CA5A 3S1NB 2MNAA 4R8IA 1JOQA 3L0OA 4DAYB 1V1PB 4X66Q 2ES2A 5HGQA 4CKEA 5EPJA 3J7YW 1QZHA 1EOVA 2K01A 4NDXA 2UXCQ 1GJXA 2UUBQ 3NK9A 2F3VA 1IXRA 1A8VA 2BA0A 3K5OA 3VYRA 1STBA 2YTXA 4NXNL 2E5LQ 4EQPA 4A3CG 3EJIA 1AW7A 3R2TA 1D7QA 4LFBQ 4LJZC 1EU4A 1YBYA 5LL6X 4K14A 1U9RA 1WYDA 5A35A 1SE4A 4NPSA 1YI2A 1HTLD 1T5XD 3PCOB 3HGBA 4RWSC 5FO7B 4DNTB 3OMCA 3A7AB 2B2WA 2EY5A 5IYBG 2H4OA 4A3IG 5D3IB 5IGDA 3NBHB 1EFID 4L5RC 2EVBA 1PZID 3DXJC 2E74C 2G5DA 1T9HA 4LF4Q 1CI3M 5ISRA 3J7AF 3QOLA 4JOIC 1B9MA 4H0LC 3TP6A 3BVZA 3S17H 1D5XC 3RNUA 3M3YH 1Z47A 3CW2C 1X54A 4ZAIA 1Y1VH 1O7IA 2G9HD 2A5HA 4G7OC 2QEXA 2IWHA 3NXWA 1CKOA 4WRDA 4JI3L 4G7ZC 3J80L 1SE8A 2JP1A 3VR4A 1I94L 2I07B 2EE1A 3ERSX 3H3VC 2ZJQA 4IPCA 1VQFA 4ZCKA 5CGKA 2WFWA 1FYCA 1I3QH 2RF4A 5L37A 1KXLA 1EZ8A 1E22A 2IPKD 3X3NA 3GTKB 4R4TA 1XPRA 1N33L 1YZ6A 3CPFA 4UP8A 3CAMA 2FJ2A 5DM63 4A75A 2ICIA 4POGA 2EXZA 1JT8A 1TY2A 4XYQA 3IRBA 4BY7B 1PVOA 4XQJA 3GTPH 5LL6S 4QJFA 3BS1A 2R93G 4XQQA 1J5EL 4LF5L 1Y1WB 4DR6L 4BBRB 4NXMQ 1G51A 2D0PA 4PZ8A 2CFMA 4V0BA 3U9SA 1HZAA 1GUTA 1VMPA 2E8GA 3OOCA 5C5MA 3HOYH 1B2TA 4PZ6A 1HA6A 1OXVA 5KNBA 3RMHA 1EY7A 1VQ5A 4C1NK 5DNFA 4BBSH 3HKZB 3N52A 4RGNA 3MFGA 3E9HA 1JJGA 1A3TA 1E7ZA 1EZ6A 2OTJA 4C2MH 4DR4Q 1JMCA 3AU7A 3A7LA 1JE4A 2VUMH 5KYIA 4EX5A 1N9WA 1G91A 1AH9A 2JE6I 2RDGA 2F0QA 1XXGA 1CKNA 3H3VI 3DMUA 5HURA 1EQQA 1KDCA 1JWUD 3KUPA 4I7AA 4A3LG 3BZKA 5IT9c 1HJPA 2D2CC 1TWGB 2XRSD 3CCJA 4LF6Q 5FK9C 2E2HH 3TREA 1UUPA 3I4NB 1X32A 1PDQA 4C1NI 2F0VA 5CV7A 3UDXA 3OPOA 1QUQB 3HOWG 1G291 1D2BA 3GTLB 1FGBD 1JCKB 4PMWA 4KTAA 2OCEA 4DR3Q 2UU9L 2R7ZB 2FFKB 3CQZB 2EJGC 1MSGA 4LF8L 4X3KA 4A3KH 1B70B 1SMYD 1ZYRC 5KNCA 4LUOA 4X64L 2NYZD 1TIID 2KENA 4CJ2C 3P20A 1C4QA 1EU3A 1GUNA 3I3CA 3SR1A 1C7YA 2XNAC 4AYBG 2HDMA 2HQLA 4A3EG 2KA7A 5JPNC 4JOIA 2AUJD 4L6TB 1TY0A 4KY6A 2KVMA 1K9MC 4CKCA 1KAAA 4K5XA 3DEOA 4A3FB 4UDUC 4FF4A 2LXKA 5GAGC 1SN8A 3E0JA 1NMGA 1N36Q 4V190 4JI6L 4XDXA 4OO1G 2A68D 1L0WA 2M9VA 4HIMA 1QWYA 4ALPA 1BCPD 4TSSA 4NW2A 1RDPD 3DHQA 5TSSA 3BZDB 2PQEA 3S1MB 1IW7D 1XX8A 3W1GA 3QG1A 3IAYA 2G9DA 2RKSA 2MGSA 1HNWL 1LTID 1HTPA 4OX9Q 2B39A 4RCOA 4LF7Q 1C0AA 1OXTA 1IKLA 2ID0A 5BN5A 1PH6A 1AZPA 4DV4Q 3LGJA 1LT4D 1EYDA 4GN5A 3GTGH 3M3YB 2K7VA 2WAQG 1GD7A 5IP7G 3KLRA 4A3CH 2EJFC 3TBIB 2I5HA 4RCNA 3J80c 3D6WA 3CMAA 3ND9A 3AFPA 4PV1C 1I5FA 3S14H 4IURA 2GVAA 3TN2A 4BY7G 5HY6A 4ZUIA 1GHKA 2UXDL 4DR7L 2C5CA 3K80C 5IYBH 3QJYA 1I3QB 4A3IH 1SLJA 2LKVA 4ME5A 1PMRA 1Y1WG 3T1YQ 1STYA 3S2DH 2KHJA 5GAEC 1LTAD 2PW5A 3M9BA 4ODGA 1CHQD 4DR2L 1UEAB 5C3XA 4QF4A 3MAQA 1KRSA 1VQAA 1IHZA 4OO1I 1JOKA 1F9RA 1MIUA 3JAME 5GAHC 1KRTA 2F03A 5JPMC 3EQLC 2WV6D 4CBVA 3S15H 1IBLQ 1GOZA 3GTPB 3H3VH 1PYSB 2EOTA 2E76C 1D5ZC 3QB3A 1SYGA 1C48A 2PNRC 5E4XA 4EGVA 2EPBA 2F0IA 5BN3A 5M3FG 2E2JH 4C3HH 2O4XA 5IOCA 1W6KA 1TWAB 1F2MA 1G6PA 4BS9A 2KQ3A 3Q23A 3HOYB 2CCZA 4TRDA 3T1HQ 3RD4A 4JBKA 2JA8G 2QDBA 3CKIB 4LF9Q 3I4NG 4IQZA 1D6EC 1U5KA 4LFAQ 5C4JH 3J7A5 2VUMB 2ZTCA 1VQHA 2RA4A 1A63A 2AQ1B 4AQYQ 2R93H 2IW3A 3TS0A 1RKNA 1BBUA 2Y0SE 5JVG3 1DOLA 1K83H 3CCQA 2UXBQ 1TQOA 2E2HB 1H9RA 1EIHA 4ZLTF 3AFQA 2A69D 5E1FA 1VCIA 2PW7A 2ZT9C 2OF1A 4JV5Q 1X3EA 1PYWD 3I4MG 4Q0FA 1SYDA 1CSPA 4ILWA 2F0GA 2PZWA 1PRTC 4A3FG 1BNZA 1ET6A 1HZ9A 5FLMG 4TQUS 2XGTA 4HMIA 4G4KA 3NHHA 3HP3A 4JI7L 4A3LH 4C3JG 2VQEL 3IFDA 3PIPA 2FMCA 2R3ZA 2GVBA 3B6YA 3MEHA 2JJQA 5IWAQ 1CZWA 3JAMi 1VQJA 2RSOA 1TKWB 1SMXA 3W5OA 3HOWH 3SHLA 3K59A 3S1NH 4UAIA 5I9OA 1DYQA 2JA9A 1STHA 4B3TL 3FPPA 4DAVA 3HOUH 2B8GA 2K5NA 1JWMD 2LXJA 1HNXL 4YHHQ 3PUXA 3PUZA 2VXWA 1EIGA 3R2IA 2A19A 4L5SA 1STGA 4IFDI 2BCOA 2F3IA 1X56A 1CKNB 4B3RQ 2VQFQ 3CCEA 5M5XH 1Q3LA 4CJ1B 1L0YB 1JC7A 3M7GA 2JN4A 4A3EH 5IGGA 1UE1A 4A76A 2RHSB 4R4IA 5DAUA 5EBCA 2F0DA 3T4AC 1K73C 4R4OA 2PO4A 1Q81C 5D3DA 1WD0A 1EEID 1OO9B 2JXMB 3Q8DA 2Q8IB 2IY5B 1IBKQ 4OO1H 5I6WA 3I70A 3GTGB 1WTWA 1IBMQ 1D1KA 3OWEB 1RTNA 4X66L 1ENAA 3QO2A 5E4WC 4JI5Q 2UXCL 3S14B 2UUBL 4JI0Q 3I4OA 2BH2A 1CFMA 2F0MA 2E5LL 2QCPX 1VS0A 1VQ6A 1VQNA 4FDBA 1CM9A 1VF5C 4DXGA 4LFBL 1QCBD 3E5SA 4QUCA 3TP7A 1F2ZA 2CKZB 4A3IB 2Z4HA 3P75A 5E3FA 2PYKA 3S2DB 4L5TA 2B2VC 2K05A 3MEFA 4UP9A 4R8NA 5C6AA 2AWOA 4IUNA 2Z4IA 4Q5VA 4BXXG 5IP7H 4GOPC 4LF4L 2ZTEA 3GO5A 2DJGC 2F3WA 4RKLA 3CP0A 3D4RA 2KCNA 3K5NA 3S15B 3H0GH 3ZYYX 4BY7H 1EYAA 1TT2A 1SSOA 2IT1A 2K04A 1TVXA 2IX1A 3NSWA 3J81L 1F2YA 4DV7Q 4C3HB 1FR3A 1XMQQ 2E2JB 1JJCB 5I4DA 4DK3C 4YY3Q 1Y1WH 2L5TA 4A4IA 4B08A 4UPAA 1JB7A 2F4IA 2OQ0A 3K8AA 4JI1Q 4OWXB 4CGYB 4DV0Q 1KL9A 3RLNA 1H9JA 5AJ3Q 2H1EA 2QDLA 2EYHA 1PZJD 3BYYB 3MXUA 3QR8A 5NUCA 4J8QA 1I4GA 3GDEA 1VQCA 1CA6A 2K1BA 4IALA 4A93G 2L12A 4IUTA 2PMZE 4FXGC 1KHIA 5ELOA 2O5IC 2R93B 5I2XA 3TP8A 1AE2A 2AUKA 4F7XA 2EYJA 1PV4A 5EBDA 5M3FH 1S5ED 5A2QE 1NR4A 3M4YA 3JC66 1K83B 4EQOA 3KFUA 3FKIG 1P16A 3HG9A 3VDYA 1TWGH 2JA8H 1LTGD 3H6MA 2R61A 1RCVD 4DPGA 1GUWA 4KD3A 4GKKQ 3I4NH 2QEJC 1SYEA 2JSOA 3FP9A 2A68C 3URYA 1Y8PB 1UEBA 1IZ6A 1E1OA 1BCPC 5DM73 2M00A 3CCRA 4DR4L 1L0XB 4OELB 1PH4A 2O2LD 2ZXOA 3BZCA 5FO9B 2NZ1D 2YYZA 4IFDH 4GN3B 4KI0A 3VR3A 4LK1C 2ALYB 2DN8A 1S4ZA 3CCUA 1HPCA 4CDDC 2Q8RE 1V9PA 1IL2A 2SNMA 4RHSA 2XWBB 4YWLA 3HOWB 4LF6L 3K0YA 3FHWA 4B9WA 4DFAA 1A0IA 2NTSA 2B2UA 3HOUB 3EFXD 4DV6Q 5CORA 3I4MH 1EWHA 1HCZA 1ESRA 1Q82C 2UUAQ 1NR2A 4A3FH 5CMDA 4DR5Q 5FLMH 4DR3L 3OTOQ 2WKCA 3W1BA 5LMUQ 1SYCA 1FGUA 5IIFA 1Z7TA 2RHQB 1A2UA 4OGQC 1KNEA 1HH2P 2NVYB 4C3JH 3LWUA 4APVA 1BOSA 3E0EA 4R4CA 5M5XB 4QIWE 3A56A 1C8CA 4AYBB 2HHHQ 1H9KA 3N6RA 4A3MB 4A3EB 5EKIA 2B2VA 3S1MH 4CDFC 5LMNL 3BVMA 4JBJA 2YTVA 3TS2A 4HSPA 4GOPA 5COYA 1EY0A 3M7NA 2MO0A 1PTOC 4UP7A 1B3AA 1KDBA 2WKDA 4A3JB 1FNWA 1FNUA 2C9OA 2YU9B 2X6GA 1N36L 3VYUA 3ULJA 2PZUA 4GS3A 1NCVA 2QF7A 3J80E 1VQEA 2Q2IA 2XTIA 3G4SA 2MFIA 1JJ2A 2WIIB 1Q90A 1WTRA 5D14A 1KAWA 4U673 3TZUA 1LTRD 2JYOA 2NN6G 4H44C 4C3HG 1AE3A 1I6HH 4KY7A 3WWVA 3MXPA 3CRKC 2F52A 2CW0D 1ILQA 4OX9L 2WAQB 3UDGA 4LF7L 1FL0A 5EKLA 3CCLA 1ZKOA 4TVAB 4DV4L 5FLXc 5DEHA 3HOZG 1YNXA 1LABA 2JQOA 1PHJA 2LSSA 2A1AA 1ML0D 3H0GB 1SYBA 1U4LA 1HR0Q 5M3MG 4K2KA 1XJVA 3VR2A 3L3OC 4P74A 3J81c 1GHJA 4LFCQ 1K28A 2E2DC 1UE6A 2JA6B 1I50H 3MFYA 1HZBA 5J39A 1SFOB 2KHSA 1SBBB 2DY8A 5C4ZA 2EYLA 4LUVA 5CV5A 4ZQ3A 3SK8A 2NTTA 1M1KC 4FXKC 1TWAH 5EGTA 5JVH3 4RAUC 5IGFA 4O2DA 3C3LA 3T1YL 1AEXA 1EWCA 4BXXH 4KHVA 3I90A 3UE0A 4IFDJ 4X6AH 4IUVA 4HJAA 4CDCC 2BH8A 5J22A 3KOJA 3OMGA 2CQAA 4QL5A 1SJHD 4DUYQ 1PH3A 1SAPA 1NBWA 3KBGA 3DWPA 5M3FB 3RLFA 1IBLL 3F2UA 2HDLA 3I73A 3J7ZC 2NN6I 2AMCB 3CC4A 2JA8B 3MHBA 2N8NA 1NAPA 3UE1A 4E6IA 1PH5A 2QW7A 4LUZA 2PCFB 3J80i 2KOLA 3T1HL 3G7LA 1KQSA 5ELFA 4LF9L 1ZXTA 1LUZA 4A93H 4LFAL 3ERQA 3HOUG 3QWNA 1X65A 4H7BA 1GO3E 2OXPA 2L1BA 2N49A 5FO8B 1J6QA 4A3DG 4WJ3M 1Z9FA 2Y0SB 3NBIA 3FKIH 4AQYL 1GUSA 2N88A 1SDFA 3BVGA 4RG1A 3KK7A 1B44D 3J7AV 5K36G 1UNSA 5LMNQ 3Q22A 2KBNA 4A3MG 2UXBL 3D31A 4H13C 2MP1A 1U4RA 2Z6KC 4X65Q 1YNJD 1G8ZD 2JK8A 2L15A 1QNUA 4IOCA 3I4MB 3HOVB 2WP8J 1PRTB 2EZVA 1PXUA 2CWAA 3TQYA 1PA6A 4JV5L 1SNPA 2HIXA 4JYAQ 4HIKA 3DM1A 4X3UA 1ICWA 2OTLA 4A3JG 1DJRD 4C3JB 3GTQH 2JA7B 1I4PA 1C9OA 1RD9D 4GN4B 2AWNA 3NTHA 1X3PA 4DA2A 4DUZQ 3HZXA 4C3IG 1KDAA 4MIUA 5IWAL 3CU7A 4R4QA 4FP5D 3KLSA 5C5LA 4IJLA 1KD1C 3KJPA 2BDOA 1FVIA 3TEHB 4FF3A 1XNQQ 3WOEA 4RMFA 1CZGA 3DWAA 5I9PA 2QA4A 1N8RC 2B8FA 1VQ9A 4P75A 2F0HA 4YHHL 1LTLA 1E2ZA 5J1ZA 5C0XG 2V4DA 4DV5Q 1CTMA 3T16A 3ULPA 1W2BA 2KCCA 2KEEA 1X3GA 2JA5B 4OXPA 5EPLA 3H0GG 4CDEC 2IL8A 4A3BG 4B3RL 2VQFL 2F1MA 4Y7NB 1VDZA 3V2TA 1OXUA 1IYVA 2JA6G 1SROA 3PV0A 4B3SQ 2L9HA 2PI2E 4DAPA 1I6HB 5C3EG 4GKJQ 1JB3A 1PTOH 2BE5C 2DNCA 1BO0A 1PH2A 1FJGQ 2FINB 1LT5D 1WOCA 3TSSA 3CCSA 4P73A 2OWOA 1U0LA 3F1ZA 1IBKL 1ENCA 1JORA 1IBML 5C4XB 1LTBD 2F0WA 3D0FA 3LWEA 1D1IA 3GP7A 1PH9A 3DWQA 1K8AC 1XTDA 2K4KA 1IYJB 4QB4A 4JI5L 2VS1A 1I50B 4JI0L 3F8TA 1QE6A 1GUOA 1LO5D 3CXCA 3CD6A 1Q1EA 1DOMA 2A6EC 2NN6H 1HNZQ 2VY3A 2NB0A 3HKZE 4QMGA 4L63B 2Z8LA 5G3LF 1I4HA 3IL8A 1L1OC 4GOPB 1XMOQ 1HQRD 3BJUA 3CCMA 3D3RA 1KC8C 3HOZH 2KEDA 3OHXC 3VR6A 1ONLA 2I5LX 2DNEA 4DV1Q 3CRLC 1QVFA 5C0XI 3A5UA 3G48A 1GUGA 5M3MH 2OT2A 5C44G 4CKBA 5M9OA 1K0SA 4DGZA 1U4MA 3J81j 1WD1A 2K14A 3R3OA 4FYDA 4IFDG 1LYLA 2K6AA 4A3GB 4K8JA 1QZGA 2ENBA 3FMCA 3C1EA 2K5HA 2KCMA 2Y0SG 2Z6KA 4KK7A 3M4OH 3A8JE 4IPGA 4DV7L 3SGIA 1XMQL 2H5XA 4YY3L 3ULLA 5IYDG 1TWCH 1PFBA 4K8IA 3X3MA 1NNXA 4DK0A 3S2HH 1ASZA 4JI1L 4F8MA 4DV0L 5FKAC 4A93B 2YTYA 3MXNA 4YWKA 3AB9A 5AJ3L 2R6GA 1X3QA 3OW2A 4P71A 4DNIA 3HOVG 1HFNA 2PMZB 1PZKD 3U4ZA 5IODA 3IFTA 1HXYD 4FF1A 2B29A 3FKIB 3NEMA 3I72A 3OYYA 4EQNA 2JA7G 1VQIA 4QUFA 1VF7A 1O7LA 4OWTB 4OONA 5IY0A 2HQEA 2EYMA 2GN5A 2B2TC 1GM5A 4B3MQ 2XN9C 3CMEA 2IHEA 5EKKA 5JOBA 4HAEA 2ICEC 4MN3A 1BCPB 2MO1A 4GKKL 2XIWA 2VL6A 1CT1D 1RHPA 2AKWB 4JI8Q 5BR8Q 4YIJA 1X6OA 4IUPA 4IOAA 4GNXC 3A8IE 5G3LD 1DONA 3U50C 2Q2TA 4A3DH 2WACA 1I4RA 2LFNA 5T1GA 3GTQB 4RGMA 3G71A 1MGSA 5ELBA 1VQ8A 1XPUA 5CV4A 2NVYH 3OIPA 3NELA 1Y14B 5K36H 4A3MH 2JA5G 1PYBA 3Q6SA 3ICEA 3O13A 4KMUC 1B53A 2K03A 4HTHA 1H9MA 5ELDA 3KDFA 2F0EA 2K33A 3VA5A 3RZOB 4XTCS 1S40A 3KYHC 3WOFA 1GXDC 3PUVA 4DV6L 1SYFA 1ZYRD 1NSNS 1II3A 4RH6A 1U4PA 4A3JH 2UUAL 4DR5L 2YU9H 3MWYW 2Z1CA 3GV3A 3OTOL 5D65A 1EIFA 5EJWA 1X3FA 5CV9A 3U4VA 4EVOA 3GTJH 4QIWB 2K5WA 2VB3X 5LMUL 1JE5A 4LW1A 5C4XG 1I4QA 2K28A 4IZ8A 3E9IA 2R92G 2F0UA 2DY7A 1XNRQ 1BUVT 4C3IH 4DKAC 1R4QB 1NE3A 4FXDA 2J7ZA 2HHHL 1EQRA 1SEBD 1KNAA 3K7AH 1VQ7A 1STEA 3A55A 1PTOB 4K5VA 1VQ4A 3FVQA 3OIQA 2XRQD 4QQBX 1KLUD 4PMBA 3EVQA 1HFGA 1DOKA 1WJJA 1EY9A 1Q7YC 3V05A 2LY7A 2O5JC 4DV2Q 1EEFD 3RLOA 1VQDA 1WVLA 3K58A 3PO3G 4KKTA 5FLXE 5C0XH 2ZXPA 3TZDA 1CKMA 4HCEA 3S16B 2HIVA 3CHBD 3FDTA 4A3BH 4X62L 2DJFC 3J81E 1ENFA 1ASYA 1R9TB 2SOBA 4DV3Q 1N34Q 2JA6H 3NQTA 5C3EH 4A3GG 1SFOH 3HEJA 3STBD 3AQQA 4K0KQ 2Z9HA 5FOBB 3PSIA 2OEOA 1TS2A 2NZHA 4ZK9B 3HOZB 3SEBA 4BA1I 1SMYC 5AFWA 4JI2Q 5M3MB 1M90C 3S1QH 3T51B 5KNDA 5GQOA 1B50A 4QCLA 1RIPA 4MTKA 1HR0L 1V1OA 2P5ZX 3HOXB 1EY8A 1TS4A 3M4OB 1Z6HA 2J0TD 4LFCL 2L4NA 1PRTF 4KN4C 1SNQA 1YNJC 3MVVA 2JEAI 3HS0C 4WJ4A 1TWCB 2X6LA 1LTSD 1DGSA 3S2HB 4GNXA 1Y8OB 4HSVA 2TMPA 3VR5A 3KF6A 2JEBI 4DR1Q 1A62A 1TR5A 2AQ3B 3SK5A 2NWGA 2KJXA 3NTIA 4OIJA 1K8MA 3A74A 5C44H 3C46A 1QVCA 5KEEA 1XTCD 3NTKA 5IT9L 1AP0A 3PO2G 5JJKA 4DUYL 4HN7A 1IW7C 3EN2A 1H95A 2NVTB 1WTPA 4KHPQ 2ZM6Q 1LM0A 3OSOA 5IYDH 3VYTA 2BA1A 1SNDA 1YHQA 3EIVA 5ELCA 5CR3A 1B4OA 2EY1A 1MBYA 1YEZA 2L0CA 1EOTA 1VQOA 1J8IA 2K32A 2SDFA 1V1QA 1DM0B 2L55A 3SE0A 4FF2A 3AYHB 1ESFA 4MNOA 1A3UA 5GROA 3HOVH 3J81i 1A6XA 4RFBA 3NUCA 1OXSC 1N32Q 1YIJA 2HT1A 4A3DB 2K52A 5ELNA 3UI2A 4KHZA 2A74C 2L11A 3CF5A 2WB1E 3A0JA 4XT1B 5BN4A 2N55A 4N8X1 2JA7H 2N78A 4M1UB 3K6OA 1MHWC 5H1SE 2E2IB 1XPOA 3NWSA 3HKSA 1EYGA 2NUCA 3ER0A 4GLAC 1YNND 1WCMH 4S3SA 1SR3A 2RCFA 1Q8KA 1TWFH 1JICA 1NUCA 5C0XJ 4PMCA 3D4DA 3MTSA 2F4VQ 1M8AA 4PQXA 4X65L 1PRTD 2IJ0A 1MD2D 3MXNB 5M5WB 3G6JB 1YITA 3GTMH 2QILA 4GZYC 1JQYD 2K5QA 1H9SA 2AHOB 1CUKA 4JYAL 4X62Q 3GTJB 3IKJA 3NE5B 5IGBA 2C35B 4MHEA 3MXGA 3TP5A 1Q86C 5IE8A 1M4VA 2JA5H 4C3IB 3GD7A 4BY1G 2K5DA 3E6ZX 3EBEA 4Y7NH 2B63H 3K7AB 1K8GA 4UY8C 4DAMA 3BYTB 4DUZL 1L2FA 3FRPB 4XQNA 4RGTA 2CHBD 2D0OA 4GLVB 3F2CA 3P7JA 2N3SA 3H94A 1E24A 2XSCA 2Q2UA 3CC2A 4ID6A 3AEVA 1SE2A 3PUWA 3DM3A 2CH4W 1Y69U 2NVQB 1SRUA 1XNQL 3NPPA 1TS3A 2EYFA 4XIGS 2MUYA 2R7DA 5JEAG 1QJOA 5C4XH 5JJLA 4A3BB 2R92H 3I8ZA 3W2DA 4HR7B 2XVSA 2CVRA 4DV5L 3RR5A 1TXYA 1RF2D 1CQVA 3RUZA 4JI4Q 3D6CA 1LTTD 1MKHA 2A69C 2X69A 5C3EB 3WDNA 5KIXA 3HOXG 4XYOA 3I7FA 5KGUA 3KF8B 1F9QA 2B3GA 2EYPA 3QIAA 1I4XA 3NENA 4EQ5A 3PF5A 3C1FA 4B3SL 3KDFB 4GKJL 1EY5A 1FJGL 3R93A 1SNCA 3PO3H 2V1CC 1F2LA 2UUCQ 1FNVA 2F0LA 3S1RB 4L5QA 3EROA 3S1QB 4K6LA 2OQKA 2FXQA 1K3BC 4IUQA 2KECA 3ITPA 1BXTA 1RL2A 1SXTA 1PH8A 1MSHA 3ND8A 1V8QA 1JOOA 4LMQD 4A3GH 2E75C 1BCPF 1X55A 1L1OB 4ZKCB 3BDCA 1O7YA 1HNZL 1YVCA 2EIFA 1E1TA 3QOJA 3L2PA 3FPUB 2EQSA 4G57A 3RZDB 1STAA 5JJIA 1WTXA 4IPDA 3T56B 1XMOL 1TU2B 1B7YB 3TDQA 4OEMB 5C44B 1XYIA 3K0XA 1EL0A 4KKUA 3V96A 4YCVA 1PFNA 2LS01 4DV1L 1IYUA 3PIO3 3SK4A 3HRZC 5LHY1 4O1NA 4BA2I 1PFMA 1VQGA 3BG3A 1HHVA 2RDFA 3DEPA 1LT3D 3CC7A 3T53B 4AIMA 2KUMA 2D5DA 2F0FA 4YCUA 1HQMC 4JW0A 3I56A 1CQFA
chains in the Genus database with same CATH topology
1EQTA 5K5PA 3VA7A 2EJMA 4J1MA 2IX0A 2VB2X 3P1HA 2FHTA 4WFN3 2F0TA 5IGEA 3H91A 1QB5D 2A73B 1HA5A 3GV6A 1EQVA 3H09A 1J9OA 1AN8A 1PTOF 4LAAA 5CV6A 5CBEE 1O7ZA 3AMUA 1DD2A 1DCZA 5CBAE 1E0BA 4G7HC 1WCMB 4ZRZA 2D9UA 2MJ8A 3KBXA 1TWFB 3R8BA 4DNRB 5KYLA 1BQQT 2RDHA 4F88A 3MZ5A 1LT6D 1OXXK 4HEDA 1LACA 5F2DA 3GTMB 3EA6A 2EDGA 3M85A 2A6HD 3Q24A 1BBXC 1CHPD 4WORA 2B2YC 5C4HA 1QNKA 4I7ZC 2B63B 1A15A 3S17B 3MA2B 1Y1VB 1UAPA 2Q8TA 1XWEA 1E2WA 2I46A 4NKLA 4KD4A 4X3SA 3BDLA 1ILPA 2LMCB 4OL7A 4DN4M 2R92B 4R9WA 2F0OA 2VNUD 3KLSX 3NP8A 1QOHA 2EY2A 3SVMA 4DK1A 2RBMA 5EPKA 1TS5A 3K57A 1PTOD 3JAML 1D5MC 3PO3B 3K5LA 4J6HA 2RVLA 5JEAH 1STNA 4XT3B 1HUNA 1F9SA 1H9SB 4C56C 3PMFA 2XWJB 4HMJA 4O42A 4U68A 1WTVA 4BBSB 2F0PA 3VYSA 4B9XA 4DAYA 1V1PA 1QILA 3L7ZC 4C2MB 1CK1A 4X3TA 3PIP3 2HCIA 3NWTA 2F0JA 3A54A 2M2LA 4KN7C 1A2TA 1HRJA 3L9AX 3LNNA 2FMMA 3NBHA 3SXHA 2EYOA 1YNNC 4RHRA 5CC4A 3A8KE 4PNYA 2PPBC 1B9NA 5EQ0A 3C2PA 3W3AA 2MHVA 4A3KB 3BDOA 4K5WA 3DUZA 1Q12A 2IX3A 1FD7D 4L8JA 3PO2B 4IUUA 1PLFA 4P2CB 2B2YA 1IKMA 1W6JA 1BF4A 1F77A 3NQIA 1ET9A 4JBWA 4HCSA 2HUGA 1S5BD 2RQXA 4FO2A 5CYUA 4RGOS 2CW0C 1S5FD 3SDZA 1DXMA 4I65A 3KF8A 2TSSA 2SEBD 1SNOA 1AZQA 1R4PB 1E2VA 2NBFA 1O78A 1WTQA 4DU9A 2WB1B 1A3VA 4ULLA 2F0NA 4N9PA 1TWHB 4IN3A 1RTOA 5KRUA 1S5CD 1JWSD 2ZXRA 1F9PA 1SE3A 1ZEQX 3I91A 4DXFA 2B2UC 5JEAJ 1DZ1A 1G2TA 3I4LA 4OHJA 5JJZA 3GTOB 3T13A 1O80A 1V43A 2MPMA 1AFPA 2QKIC 4RKBA 1KLGD 1EY4A 4ZKBB 1RODA 1Q8IA 1KABA 3U9OA 4ABNA 4BY1B 3D4WA 4CHTB 3FEWX 1G6ZA 4TKOB 2WINB 2B2WC 4CJ0B 1QG7A 3OW7A 1LV9A 1Q1BA 1MI2A 2NVXB 4K6DA 3Q0AA 5IGCA 2F0SA 4M8AA 4KV6A 5FLXL 4OIKA 3MC0B 5HGTA 3PUYA 1T5EA 1B1ZA 4XXEA 2AQ2B 4F87A 1G2SA 3K5MA 4NMZA 4Z9CB 1SNMA 4KKSA 5I6YA 2B2TA 3D8GA 4FVMA 2PZTA 1K8OA 4N9TA 5C3WA 5C4JB 2BE5D 2BOSA 5CV8A 2EY6A 1Y8NB 3S9WA 1IL8A 2GA4B 5I2YA 5T1IA 2HCCA 2RSNA 4JK1C 4ZYSA 4KJOA 1BR9A 4KJNA 1JR0D 1KTKA 5A2QL 5IT9E 3OWFA 5JAVA 2SNSA 3SK6A 2A6ED 1I6VC 4DF7A 5ELEA 1HUMA 2D62A 1SJED 1S5DD 4NP5A 4BWGB 3LX0A 4ZUJA 4RA8A 1EYCA 1LLRD 3TMEA 2J4XA 4FNFA 4K2LA 1EY6A 1BDOA 2A6HC 3GQBA 4KY5A 1RJTA 4WJWA 1VMCA 3ONAB 2F0KA 1WTOA 2BDNA 5M5YB 1CA5A 3S1NB 4R8IA 1JOQA 1V1PB 4CKEA 5EPJA 3J7YW 2K01A 4NDXA 1GJXA 3NK9A 2F3VA 3K5OA 2BA0A 3VYRA 1STBA 4EQPA 3EJIA 1AW7A 3R2TA 4LJZC 1EU4A 5LL6X 4K14A 1U9RA 5A35A 1SE4A 1HTLD 1T5XD 3HGBA 4RWSC 5FO7B 4DNTB 3OMCA 3A7AB 2B2WA 2EY5A 2H4OA 5D3IB 5IGDA 1EFID 2EVBA 1PZID 3DXJC 2E74C 3J7AF 1CI3M 5ISRA 3QOLA 1B9MA 4H0LC 3TP6A 3BVZA 1D5XC 1Z47A 4ZAIA 2G9HD 2A5HA 4G7OC 2IWHA 3NXWA 4WRDA 4G7ZC 3J80L 2JP1A 3VR4A 2I07B 2EE1A 3H3VC 5CGKA 1FYCA 1EZ8A 2IPKD 3X3NA 3GTKB 2FJ2A 5DM63 2ICIA 2EXZA 1TY2A 4XYQA 4BY7B 4XQJA 5LL6S 3BS1A 4XQQA 1Y1WB 4BBRB 4V0BA 3U9SA 1GUTA 1VMPA 3OOCA 5C5MA 1B2TA 1HA6A 1OXVA 5KNBA 3RMHA 1EY7A 4C1NK 5DNFA 3HKZB 3N52A 4RGNA 3MFGA 1A3TA 1EZ6A 3AU7A 3A7LA 1JE4A 5KYIA 1G91A 2JE6I 2RDGA 2F0QA 1XXGA 3DMUA 5HURA 1KDCA 1JWUD 3KUPA 2D2CC 1TWGB 2XRSD 5FK9C 1UUPA 3I4NB 1X32A 1PDQA 4C1NI 2F0VA 5CV7A 3OPOA 1G291 1D2BA 3GTLB 1FGBD 1JCKB 4PMWA 4KTAA 2R7ZB 2FFKB 3CQZB 2EJGC 1MSGA 4X3KA 1SMYD 1ZYRC 5KNCA 2NYZD 1TIID 4CJ2C 3P20A 1C4QA 1EU3A 1GUNA 3I3CA 3SR1A 2XNAC 2HDMA 2KA7A 5JPNC 2AUJD 4L6TB 1TY0A 4KY6A 2KVMA 4CKCA 1KAAA 4K5XA 3DEOA 4A3FB 4UDUC 4FF4A 4V190 3E0JA 4XDXA 4OO1G 2A68D 2M9VA 1QWYA 1BCPD 4TSSA 4NW2A 1RDPD 3DHQA 5TSSA 3BZDB 2PQEA 3S1MB 1IW7D 1XX8A 3QG1A 3IAYA 2G9DA 2RKSA 2MGSA 1LTID 1HTPA 2B39A 4RCOA 1OXTA 1IKLA 2ID0A 5BN5A 1AZPA 1LT4D 1EYDA 3M3YB 2K7VA 3KLRA 2EJFC 3TBIB 4RCNA 3D6WA 3ND9A 4PV1C 4IURA 3TN2A 4ZUIA 1GHKA 2C5CA 3QJYA 1I3QB 2LKVA 4ME5A 1PMRA 1STYA 1LTAD 2PW5A 4ODGA 1CHQD 1UEAB 5C3XA 4QF4A 3MAQA 4OO1I 1IHZA 1JOKA 1F9RA 3JAME 2F03A 5JPMC 3EQLC 2WV6D 4CBVA 1GOZA 3GTPB 2EOTA 2E76C 1D5ZC 3QB3A 1SYGA 1C48A 2PNRC 5E4XA 4EGVA 2EPBA 2F0IA 5BN3A 2O4XA 5IOCA 1W6KA 1TWAB 1F2MA 4BS9A 2KQ3A 3Q23A 3HOYB 4TRDA 3RD4A 2QDBA 3CKIB 4IQZA 1D6EC 2VUMB 2RA4A 2AQ1B 2IW3A 1RKNA 5JVG3 1DOLA 1TQOA 2E2HB 1H9RA 1EIHA 4ZLTF 2A69D 5E1FA 1VCIA 2PW7A 2ZT9C 2OF1A 1PYWD 4Q0FA 1SYDA 4ILWA 2F0GA 2PZWA 1PRTC 1BNZA 1ET6A 4TQUS 4HMIA 4G4KA 3NHHA 3HP3A 4C3JG 3IFDA 2FMCA 2R3ZA 3MEHA 1CZWA 2RSOA 1TKWB 3SHLA 3K59A 4UAIA 5I9OA 1DYQA 1STHA 3FPPA 4DAVA 2B8GA 1JWMD 3PUXA 3PUZA 2VXWA 1EIGA 3R2IA 1STGA 4IFDI 2BCOA 1Q3LA 4CJ1B 1L0YB 1JC7A 3M7GA 5IGGA 5DAUA 5EBCA 2F0DA 3T4AC 2PO4A 5D3DA 1WD0A 1EEID 1OO9B 2JXMB 2Q8IB 4OO1H 5I6WA 3I70A 3GTGB 1WTWA 1D1KA 3OWEB 1RTNA 1ENAA 3QO2A 5E4WC 3S14B 1CFMA 2F0MA 2QCPX 1CM9A 1VF5C 4DXGA 1QCBD 3E5SA 4QUCA 3TP7A 1F2ZA 4A3IB 2Z4HA 3P75A 5E3FA 2PYKA 3S2DB 2B2VC 2K05A 4R8NA 5C6AA 2AWOA 4IUNA 2Z4IA 4Q5VA 3GO5A 2F3WA 4RKLA 3D4RA 2KCNA 3K5NA 3S15B 3ZYYX 1EYAA 1TT2A 1SSOA 2IT1A 2K04A 1TVXA 2IX1A 3NSWA 3J81L 1F2YA 2E2JB 4C3HB 1FR3A 5I4DA 2L5TA 4B08A 2F4IA 4CGYB 1H9JA 2H1EA 2EYHA 1PZJD 3BYYB 3MXUA 5NUCA 4J8QA 1I4GA 1CA6A 2K1BA 4IALA 2L12A 4IUTA 4FXGC 2O5IC 2R93B 5I2XA 3TP8A 2AUKA 4F7XA 2EYJA 5EBDA 1S5ED 5A2QE 1NR4A 3M4YA 1K83B 4EQOA 3HG9A 1GUWA 1LTGD 3H6MA 2R61A 1RCVD 4KD3A 2QEJC 1SYEA 2JSOA 2A68C 3URYA 1Y8PB 1BCPC 5DM73 2M00A 1L0XB 2O2LD 2ZXOA 5FO9B 2NZ1D 2YYZA 4IFDH 4KI0A 3VR3A 4LK1C 2DN8A 1S4ZA 1HPCA 2Q8RE 2SNMA 4RHSA 2XWBB 3HOWB 3K0YA 4B9WA 4DFAA 2NTSA 2B2UA 3HOUB 3EFXD 5CORA 1EWHA 1HCZA 1ESRA 1NR2A 5CMDA 2WKCA 1SYCA 5IIFA 1Z7TA 1A2UA 4OGQC 1KNEA 2NVYB 3LWUA 1BOSA 5M5XB 1C8CA 3A56A 4AYBB 1H9KA 3N6RA 4A3MB 4A3EB 5EKIA 2B2VA 3BVMA 4HSPA 5COYA 1EY0A 3M7NA 1PTOC 1B3AA 1KDBA 2WKDA 4A3JB 1FNWA 1FNUA 2C9OA 2YU9B 2X6GA 3VYUA 2PZUA 1NCVA 2QF7A 3J80E 2WIIB 1Q90A 1WTRA 5D14A 4U673 3TZUA 1LTRD 2JYOA 2NN6G 4H44C 4C3HG 4KY7A 3MXPA 3CRKC 2CW0D 1ILQA 2WAQB 5EKLA 1ZKOA 5DEHA 1LABA 1ML0D 3H0GB 1SYBA 1U4LA 4K2KA 3VR2A 3L3OC 1GHJA 2E2DC 2JA6B 3MFYA 5J39A 1SFOB 2KHSA 5C4ZA 1SBBB 2DY8A 2EYLA 5CV5A 4ZQ3A 3SK8A 2NTTA 4FXKC 5EGTA 5JVH3 4RAUC 5IGFA 3C3LA 1AEXA 1EWCA 4KHVA 3I90A 4IFDJ 4IUVA 5J22A 3OMGA 2CQAA 1SJHD 1SAPA 3DWPA 3KBGA 5M3FB 3RLFA 3F2UA 2HDLA 3I73A 2NN6I 2JA8B 3MHBA 1NAPA 4E6IA 2PCFB 2KOLA 3G7LA 5ELFA 1ZXTA 3ERQA 3QWNA 4H7BA 2OXPA 2L1BA 5FO8B 2Y0SB 3NBIA 1GUSA 2N88A 1SDFA 3BVGA 3KK7A 1B44D 3J7AV 5K36G 1UNSA 3Q22A 3D31A 4H13C 2MP1A 1U4RA 1YNJD 1G8ZD 3I4MB 1QNUA 3HOVB 2WP8J 1PRTB 2EZVA 1PXUA 1SNPA 3DM1A 4X3UA 1ICWA 1DJRD 4C3JB 2JA7B 1I4PA 1RD9D 2AWNA 3NTHA 1X3PA 4DA2A 3HZXA 4C3IG 1KDAA 4MIUA 3CU7A 4FP5D 3KLSA 5C5LA 4FF3A 2BDOA 3WOEA 1CZGA 3DWAA 5I9PA 2B8FA 2F0HA 5J1ZA 1E2ZA 5C0XG 2V4DA 1CTMA 3T16A 2KCCA 2KEEA 2JA5B 5EPLA 2IL8A 2F1MA 4Y7NB 1VDZA 3V2TA 1OXUA 1IYVA 3PV0A 2L9HA 4DAPA 1I6HB 1JB3A 1PTOH 2BE5C 2DNCA 1BO0A 2FINB 1LT5D 3TSSA 1ENCA 1JORA 5C4XB 1LTBD 2F0WA 3LWEA 1D1IA 3GP7A 3DWQA 4QB4A 1I50B 1QE6A 1GUOA 1LO5D 1Q1EA 1DOMA 2A6EC 2NN6H 2NB0A 4QMGA 4L63B 2Z8LA 5G3LF 1I4HA 3IL8A 1HQRD 3D3RA 2KEDA 3OHXC 3VR6A 1ONLA 2DNEA 3CRLC 5C0XI 1GUGA 2OT2A 4CKBA 5M9OA 4DGZA 1U4MA 1WD1A 3R3OA 4FYDA 4IFDG 2K6AA 4A3GB 4K8JA 2ENBA 3FMCA 3C1EA 4KK7A 3A8JE 1PFBA 4K8IA 3X3MA 4DK0A 4F8MA 5FKAC 4A93B 3MXNA 3AB9A 2R6GA 1X3QA 1HFNA 2PMZB 1PZKD 5IODA 3IFTA 1HXYD 4FF1A 3FKIB 3I72A 4EQNA 4QUFA 1VF7A 1O7LA 2HQEA 2EYMA 2B2TC 2XN9C 5EKKA 5JOBA 4HAEA 2ICEC 4MN3A 1BCPB 2XIWA 1CT1D 1RHPA 4YIJA 4IUPA 3A8IE 5G3LD 1DONA 2WACA 1I4RA 2LFNA 5T1GA 3GTQB 4RGMA 1MGSA 5ELBA 5CV4A 3OIPA 5K36H 3Q6SA 3O13A 4KMUC 1B53A 2K03A 4HTHA 1H9MA 5ELDA 2F0EA 2K33A 3VA5A 3RZOB 4XTCS 3WOFA 1GXDC 3PUVA 1SYFA 1ZYRD 1NSNS 1II3A 4RH6A 1U4PA 3GV3A 2Z1CA 3MWYW 5D65A 5EJWA 5CV9A 4EVOA 4QIWB 2K5WA 2VB3X 1I4QA 2K28A 4IZ8A 2F0UA 2DY7A 1BUVT 1R4QB 4FXDA 2J7ZA 1SEBD 1KNAA 1STEA 3A55A 1PTOB 4K5VA 3FVQA 3OIQA 2XRQD 1KLUD 4PMBA 3EVQA 1HFGA 1DOKA 1EY9A 3V05A 2LY7A 2O5JC 1EEFD 1WVLA 3K58A 4KKTA 5FLXE 5C0XH 2ZXPA 3TZDA 4HCEA 3S16B 3CHBD 3FDTA 3J81E 1ENFA 1R9TB 2SOBA 3NQTA 3HEJA 5FOBB 2OEOA 1TS2A 4ZK9B 3HOZB 3SEBA 4BA1I 1SMYC 5AFWA 5M3MB 3T51B 5KNDA 1B50A 4QCLA 1V1OA 3HOXB 1EY8A 1TS4A 3M4OB 1Z6HA 2J0TD 2L4NA 1PRTF 4KN4C 1SNQA 1YNJC 3MVVA 2JEAI 3HS0C 1TWCB 2X6LA 1LTSD 3S2HB 1Y8OB 4HSVA 2TMPA 3VR5A 2JEBI 1TR5A 2AQ3B 3SK5A 2NWGA 2KJXA 3NTIA 4OIJA 1K8MA 3C46A 5KEEA 1XTCD 3NTKA 5IT9L 1AP0A 4HN7A 1IW7C 2NVTB 1WTPA 3OSOA 3VYTA 2BA1A 1SNDA 5ELCA 5CR3A 1B4OA 2EY1A 1MBYA 2L0CA 1J8IA 1EOTA 2K32A 2SDFA 1DM0B 2L55A 3SE0A 4FF2A 1ESFA 1A3UA 1A6XA 4RFBA 3NUCA 1OXSC 4A3DB 3UI2A 4KHZA 2A74C 2L11A 4XT1B 5BN4A 2N55A 4M1UB 3K6OA 2E2IB 3NWSA 2NUCA 1YNND 4S3SA 1JICA 1NUCA 5C0XJ 4PMCA 3D4DA 3MTSA 1M8AA 4PQXA 1PRTD 2IJ0A 1MD2D 5M5WB 3G6JB 2QILA 4GZYC 1JQYD 2K5QA 1H9SA 3GTJB 3IKJA 3NE5B 5IGBA 4MHEA 3MXGA 3TP5A 1M4VA 4C3IB 3GD7A 2K5DA 3E6ZX 3K7AB 3BYTB 3FRPB 4XQNA 4RGTA 2CHBD 3P7JA 3H94A 2XSCA 4ID6A 1SE2A 3PUWA 1Y69U 2NVQB 3NPPA 1TS3A 2EYFA 4XIGS 2MUYA 5JEAG 1QJOA 4A3BB 3I8ZA 3W2DA 4HR7B 2XVSA 2CVRA 1RF2D 1CQVA 3RUZA 3D6CA 1LTTD 2A69C 2X69A 5C3EB 3WDNA 5KIXA 4XYOA 5KGUA 1F9QA 3QIAA 2EYPA 1I4XA 3C1FA 1EY5A 3R93A 1SNCA 1F2LA 1FNVA 2F0LA 3S1RB 3EROA 3S1QB 4K6LA 4IUQA 2KECA 3ITPA 1BXTA 1SXTA 1MSHA 3ND8A 1V8QA 1JOOA 4LMQD 2E75C 1BCPF 4ZKCB 3BDCA 1O7YA 3QOJA 3FPUB 4G57A 3RZDB 1STAA 1WTXA 3T56B 1TU2B 3TDQA 5C44B 1XYIA 1EL0A 4KKUA 3V96A 1PFNA 2LS01 1IYUA 3PIO3 3SK4A 3HRZC 5LHY1 4O1NA 4BA2I 1PFMA 3BG3A 1HHVA 2RDFA 3DEPA 1LT3D 3T53B 2KUMA 2D5DA 2F0FA 1HQMC 1CQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHS A;  4ID6 A;  5HUR A;  4DGZ A;  1KDC A;  4B9W A;  4DFA A;  2RBM A;  1SYD A;  2EYL A;  3R3O A;  4R8N A;  5CV5 A;  4ZQ3 A;  3SK8 A;  2F0G A;  2PZW A;  3OMC A;  5CV9 A;  4EVO A;  4IUN A;  3D8G A;  5EGT A;  4EQO A;  3HZX A;  2PZT A;  4J1M A;  4K8J A;  5K5P A;  2EY5 A;  2ENB A;  5KEE A;  1KDA A;  3P1H A;  4HMI A;  3C1E A;  4MIU A;  4N9T A;  5IGF A;  4IZ8 A;  5IGD A;  3NHH A;  2F3W A;  4I65 A;  4RKL A;  1AEX A;  2EYF A;  2F0U A;  2F0T A;  4KHV A;  4ZUI A;  5C3W A;  5I6Y A;  5IGE A;  1SNO A;  5CV8 A;  5C5L A;  2EY6 A;  1EYA A;  1SYC A;  1TT2 A;  2F0V A;  4J6H A;  5IIF A;  5CV7 A;  3MEH A;  2LKV A;  4K8I A;  1A2U A;  3S9W A;  5ISR A;  1STN A;  3QOL A;  4ME5 A;  3TP6 A;  4K5V A;  5J22 A;  3OSO A;  5I9P A;  1STY A;  4F8M A;  1SND A;  3OMG A;  3RUZ A;  3D6C A;  1F2Y A;  1EQV A;  4KTA A;  5CR3 A;  4DU9 A;  3PMF A;  2EY1 A;  2PW5 A;  4ODG A;  1A3V A;  4PMB A;  4HMJ A;  5KIX A;  2F0H A;  3EVQ A;  5C3X A;  2F0N A;  4LAA A;  4QF4 A;  5CV6 A;  5J1Z A;  3SHL A;  1EY9 A;  1IHZ A;  4KJO A;  5KGU A;  1JOK A;  5I9O A;  1STH A;  4N9P A;  2F0P A;  3NXW A;  3T16 A;  5IOD A;  2EYP A;  4B9X A;  4WRD A;  3C1F A;  1A3U A;  4KJN A;  3OWF A;  3NUC A;  5C4Z A;  5JAV A;  1EY5 A;  2SNS A;  3MHB A;  3SK6 A;  4EQN A;  2EYH A;  5KRU A;  1SNC A;  3SR1 A;  3V2T A;  1EY0 A;  4E6I A;  5NUC A;  5KYL A;  5CGK A;  4DF7 A;  2F0L A;  3QB3 A;  1SYG A;  1EZ8 A;  3ERO A;  1KDB A;  3MZ5 A;  1STG A;  4IAL A;  2HQE A;  2EYM A;  2F0I A;  4NP5 A;  5F2D A;  2SOB A;  5EKK A;  5JOB A;  2O4X A;  5IOC A;  3TP8 A;  3NQT A;  3ITP A;  2F0J A;  3LX0 A;  2PZU A;  1F2M A;  3ERQ A;  4ZUJ A;  2KQ3 A;  3T13 A;  4F7X A;  1EYC A;  4H7B A;  2EYJ A;  4KY6 A;  2OXP A;  3TME A;  3HEJ A;  4TRD A;  2EXZ A;  2NUC A;  5IGG A;  1JOO A;  4RKB A;  1KAA A;  4K5X A;  4K2L A;  2QDB A;  5DAU A;  1ENC A;  1A2T A;  2F0D A;  4S3S A;  1JOR A;  1EY4 A;  1EY6 A;  2OEO A;  4WOR A;  2F0Q A;  4YIJ A;  1NUC A;  2F0W A;  5C4H A;  1KAB A;  3BDC A;  3H6M A;  4KY5 A;  3U9O A;  4PMC A;  3D4D A;  4KD3 A;  3SXH A;  2EYO A;  3QOJ A;  2WAC A;  4QB4 A;  5CC4 A;  5I6W A;  4PNY A;  2F0K A;  1SYE A;  4G57 A;  1STA A;  3D4W A;  4KY7 A;  3MXP A;  5CV4 A;  3DHQ A;  1ENA A;  2M00 A;  4QMG A;  5EKL A;  1JOQ A;  4K6D A;  2PQE A;  5IGC A;  1RKN A;  5C5M A;  1EY8 A;  5IGB A;  3TP5 A;  1EY7 A;  2RKS A;  4K5W A;  2F0M A;  5DEH A;  4NKL A;  1TQO A;  2F0S A;  1A3T A;  4KD4 A;  4KV6 A;  3SK4 A;  3E5S A;  1EZ6 A;  1SNP A;  3BDL A;  4HTH A;  3TP7 A;  1F2Z A;  5C6A A;  1SNQ A;  3MVV A;  4OL7 A;  1SYB A;  4NDX A;  2F0E A;  4K2K A;  3NK9 A;  3VA5 A;  5HGT A;  2F3V A;  1EYD A;  5E1F A;  1STB A;  3P75 A;  2F0O A;  2PW7 A;  2RDF A;  4EQP A;  5KYI A;  3EJI A;  4NMZ A;  5E3F A;  2PYK A;  1SYF A;  2OF1 A;  3NP8 A;  2SNM A;  1NSN S;  1II3 A;  2F0F A;  4K14 A;  2EY2 A;  5M9O A;  1U9R A;  1TR5 A;  1SNM A;  5J39 A;  3SK5 A;  3DMU A; 
#chains in the Genus database with same CATH topology
 1EQT A;  5K5P A;  4N8F A;  3VA7 A;  4NXN Q;  2EJM A;  4HJ8 A;  4J1M A;  5J3B A;  2IX0 A;  2VB2 X;  3P1H A;  4YWM A;  2FHT A;  4WFN 3;  2F0T A;  5IGE A;  1VQB A;  3H91 A;  2IHF A;  1QB5 D;  2A73 B;  4AYB E;  3I2Z A;  3PO2 H;  1HA5 A;  3GV6 A;  1EQV A;  5DLQ E;  3H09 A;  1J9O A;  1AN8 A;  1PTO F;  1GVP A;  4LAA A;  5CV6 A;  5CBE E;  1O7Z A;  4JVZ A;  3AMU A;  1DD2 A;  1DCZ A;  5CBA E;  1E0B A;  4G7H C;  1WCM B;  4ZRZ A;  3PIO A;  2D9U A;  2MJ8 A;  2I0Q A;  3KBX A;  1TWF B;  3R8B A;  4DNR B;  1S72 A;  4B3M L;  2K50 A;  2VZA A;  5KYL A;  4GNX B;  1BQQ T;  2RDH A;  4F88 A;  4JI3 Q;  3KF6 B;  3MZ5 A;  1LT6 D;  4JC0 A;  1OXX K;  2ZJP A;  3RZO H;  4HED A;  1I94 Q;  4OWW B;  4PZ7 A;  1LAC A;  4QGU A;  5F2D A;  3GTM B;  5BR8 L;  4JI8 L;  3RN5 A;  2KHI A;  3EA6 A;  2EDG A;  3M85 A;  2A6H D;  1EFW A;  1E3P A;  2CWP A;  3Q24 A;  2MQH A;  1BBX C;  1CHP D;  4WOR A;  1N33 Q;  1TWH H;  2B2Y C;  5C4H A;  1QNK A;  4I7Z C;  1EIY B;  2B63 B;  1YJ9 A;  1A15 A;  3STB C;  4P72 A;  1VQM A;  3S17 B;  1UE5 A;  2WAQ E;  1VQL A;  3MA2 B;  1OTC A;  1Y1V B;  1PFS A;  4YCW A;  1UAP A;  5E7N A;  3GTO H;  2Q8T A;  1XWE A;  1E2W A;  4NB3 A;  2I46 A;  1J5E Q;  4LF5 Q;  4DR6 Q;  4NKL A;  4R1J A;  1WI5 A;  4KD4 A;  3M4P A;  4X3S A;  3BDL A;  5IP9 G;  1ILP A;  2LMC B;  4OL7 A;  4IPH A;  3S16 H;  4DN4 M;  2R92 B;  2PQA A;  4BY1 H;  4R9W A;  2F0O A;  2VNU D;  4BBR G;  3KLS X;  3NP8 A;  4J15 A;  1QOH A;  1R9T H;  2EY2 A;  3SVM A;  1VQP A;  4DK1 A;  1XNR L;  2RBM A;  1P8L A;  1MJC A;  5EPK A;  3BU2 A;  3HKZ G;  2NVX H;  2ZTD A;  1TS5 A;  2VW9 A;  3K57 A;  1PTO D;  3TRZ A;  2KCT A;  2ATW A;  3JAM L;  1D5M C;  3CCV A;  1D8L A;  3U58 A;  3KJO A;  3PO3 B;  3K5L A;  4J6H A;  3ZJY C;  2RVL A;  5JEA H;  1STN A;  4XT3 B;  4MTN A;  4DV2 L;  1EUJ A;  1HUN A;  1F9S A;  1H9S B;  2HD3 A;  4C56 C;  3RN2 A;  3PMF A;  2XWJ B;  4HMJ A;  4O42 A;  1NJI C;  2CQO A;  4U68 A;  1BBW A;  1WTV A;  4BBS B;  2F0P A;  3VYS A;  4B9X A;  1HR0 W;  5FJ8 G;  4DAY A;  3HOX H;  1V1P A;  2UU9 Q;  1QIL A;  3L7Z C;  4C2M B;  1CK1 A;  4DV3 L;  1N34 L;  4LF8 Q;  4X3T A;  3PIP 3;  1NMF A;  4X64 Q;  2R7Z G;  4HJ9 A;  1ICF B;  4K0K L;  2HCI A;  3NWT A;  2F0J A;  2Z6B A;  2M2L A;  3A54 A;  4KN7 C;  2DUD A;  1B3Q A;  2DGY A;  2K5V A;  5IYC G;  1YJW A;  1A2T A;  4JI2 L;  1HRJ A;  1KIX A;  3L9A X;  3LNN A;  2FMM A;  1X9N A;  3NBH A;  3SXH A;  2EYO A;  1YNN C;  4RHR A;  5CC4 A;  3CPW A;  3A8K E;  4PNY A;  2PPB C;  1B9N A;  3F2D A;  5EQ0 A;  4JI6 Q;  4LNQ A;  2NVT H;  3C2P A;  3W3A A;  2MHV A;  1YHB A;  4A3K B;  3BDO A;  1WCM G;  3S24 A;  4K5W A;  3M4Q A;  3DUZ A;  4H02 A;  1Q12 A;  2IX3 A;  1FD7 D;  4DR1 L;  4L8J A;  2I5M X;  3PO2 B;  4IUU A;  1PLF A;  4P2C B;  2B2Y A;  1IKM A;  1W6J A;  1BF4 A;  1HNW Q;  1NTG A;  1F77 A;  3NQI A;  1ET9 A;  3KLW A;  4JBW A;  4HCS A;  1K3R A;  2HUG A;  5M5Y H;  1S5B D;  2RQX A;  1WTH A;  4FO2 A;  1W3S A;  2EXD A;  4KLK A;  5CYU A;  2PI2 A;  2E2I H;  1YHA A;  4RGO S;  2CW0 C;  4HJ7 A;  1S5F D;  3SDZ A;  1DXM A;  4KHP L;  2ZM6 L;  2CH4 A;  4I65 A;  3KF8 A;  4HIO A;  2B63 G;  2TSS A;  2SEB D;  1SNO A;  1PH1 A;  5LMN W;  1AZQ A;  1R4P B;  1E2V A;  1Y1V G;  2NBF A;  4JCV E;  4DK6 C;  1O78 A;  1WTQ A;  2UXD Q;  4DR7 Q;  4DU9 A;  2WB1 B;  5M5W H;  3E3X A;  1A3V A;  4ULL A;  4IO9 A;  1N32 L;  2F0N A;  4HID A;  1Q46 A;  1B8A A;  4N9P A;  4MZ9 A;  1NY4 A;  1TWH B;  4DR2 Q;  4IN3 A;  1RTO A;  5KRU A;  1S5C D;  1L1O A;  1JWS D;  1UE7 A;  2ZXR A;  1F9P A;  1SE3 A;  1ZEQ X;  3I91 A;  4DXF A;  2B2U C;  3PF4 A;  5JEA J;  1DZ1 A;  1G2T A;  4POF A;  3I4L A;  4OHJ A;  5JJZ A;  3GTO B;  2RCN A;  3T13 A;  1O80 A;  1V43 A;  2MPM A;  1S3O A;  1AFP A;  2QKI C;  3H15 A;  2F4V L;  4RKB A;  2NVQ H;  1KLG D;  1K0R A;  2R7F A;  1EY4 A;  4ZKB B;  1ROD A;  1Q8I A;  1KAB A;  2ZJR A;  3U9O A;  1PH7 A;  3K81 C;  1YJN A;  2QGQ A;  4ABN A;  4BY1 B;  4JPB W;  4HJ5 A;  3D4W A;  4CHT B;  3FEW X;  1VQK A;  3GTK H;  1G6Z A;  1QUQ A;  4TKO B;  2WIN B;  3UDI A;  3HOY G;  3F2B A;  2B2W C;  4CJ0 B;  2A8V A;  1QG7 A;  4BBS G;  3OW7 A;  1WFQ A;  1LV9 A;  1Q1B A;  1MI2 A;  4AH6 A;  4K6D A;  2NVX B;  2Z0S A;  3JAM c;  5IGC A;  3Q0A A;  3A5Z B;  4GLX A;  2NZO A;  4UHV A;  4QY7 A;  2F0S A;  4M8A A;  4KV6 A;  5FLX L;  4OIK A;  3MC0 B;  2VUM G;  1BKB A;  4Y52 H;  5HGT A;  3PUY A;  1T5E A;  5IP9 H;  1B1Z A;  1EWI A;  4XXE A;  2AQ2 B;  4F87 A;  1G2S A;  3K5M A;  4O0A A;  3S1R H;  4NMZ A;  4Z9C B;  4LWC A;  1SNM A;  4KKS A;  4BBR H;  5I6Y A;  2K75 A;  2B2T A;  3D8G A;  4FVM A;  2PZT A;  1K8O A;  4N9T A;  5C3W A;  5C4J B;  2BE5 D;  2YV5 A;  4IJH A;  4JI4 L;  2BOS A;  1BVS A;  5CV8 A;  2EY6 A;  1Y8N B;  3PQI A;  1HZC A;  3S9W A;  4ME3 A;  1IL8 A;  1GKH A;  2GA4 B;  5I2Y A;  3UDF A;  3RZD H;  5T1I A;  4JI7 Q;  2HCC A;  2RSN A;  4A3K G;  2ASB A;  2VQE Q;  2Q2H A;  3HFZ B;  4JK1 C;  3DLL A;  4JG2 A;  4ZYS A;  4KJO A;  1BR9 A;  2UUC L;  3G6E A;  4KJN A;  1JR0 D;  1KTK A;  5A2Q L;  5IT9 E;  1MJE A;  3OWF A;  4PG3 A;  5EAY A;  5JAV A;  2PQA B;  2SNS A;  3SK6 A;  2A6E D;  1I6V C;  5FJ8 H;  4NXM L;  4DF7 A;  4B3T Q;  5ELE A;  1HUM A;  1QVG A;  2D62 A;  1CSQ A;  1HNX Q;  3I55 A;  1SJE D;  1S5D D;  4NP5 A;  4BWG B;  3GTL H;  2R7Z H;  2PNH A;  3LX0 A;  3CQZ H;  4ZUJ A;  4RA8 A;  1EYC A;  1LLR D;  3K7U C;  3TME A;  2J4X A;  4FNF A;  4K2L A;  4JBM A;  1EY6 A;  1BDO A;  2A6H C;  1UWV A;  3GQB A;  4KY5 A;  5IYC H;  1RJT A;  4WJW A;  1VMC A;  3ONA B;  2F0K A;  3PGZ A;  5GAD C;  2WB1 G;  1WTO A;  2BDN A;  5M5Y B;  1CA5 A;  3S1N B;  2MNA A;  4R8I A;  1JOQ A;  3L0O A;  4DAY B;  1V1P B;  4X66 Q;  2ES2 A;  5HGQ A;  4CKE A;  5EPJ A;  3J7Y W;  1QZH A;  1EOV A;  2K01 A;  4NDX A;  2UXC Q;  1GJX A;  2UUB Q;  3NK9 A;  2F3V A;  1IXR A;  1A8V A;  2BA0 A;  3K5O A;  3VYR A;  1STB A;  2YTX A;  4NXN L;  2E5L Q;  4EQP A;  4A3C G;  3EJI A;  1AW7 A;  3R2T A;  1D7Q A;  4LFB Q;  4LJZ C;  1EU4 A;  1YBY A;  5LL6 X;  4K14 A;  1U9R A;  1WYD A;  5A35 A;  1SE4 A;  4NPS A;  1YI2 A;  1HTL D;  1T5X D;  3PCO B;  3HGB A;  4RWS C;  5FO7 B;  4DNT B;  3OMC A;  3A7A B;  2B2W A;  2EY5 A;  5IYB G;  2H4O A;  4A3I G;  5D3I B;  5IGD A;  3NBH B;  1EFI D;  4L5R C;  2EVB A;  1PZI D;  3DXJ C;  2E74 C;  2G5D A;  1T9H A;  4LF4 Q;  1CI3 M;  5ISR A;  3J7A F;  3QOL A;  4JOI C;  1B9M A;  4H0L C;  3TP6 A;  3BVZ A;  3S17 H;  1D5X C;  3RNU A;  3M3Y H;  1Z47 A;  3CW2 C;  1X54 A;  4ZAI A;  1Y1V H;  1O7I A;  2G9H D;  2A5H A;  4G7O C;  2QEX A;  2IWH A;  3NXW A;  1CKO A;  4WRD A;  4JI3 L;  4G7Z C;  3J80 L;  1SE8 A;  2JP1 A;  3VR4 A;  1I94 L;  2I07 B;  2EE1 A;  3ERS X;  3H3V C;  2ZJQ A;  4IPC A;  1VQF A;  4ZCK A;  5CGK A;  2WFW A;  1FYC A;  1I3Q H;  2RF4 A;  5L37 A;  1KXL A;  1EZ8 A;  1E22 A;  2IPK D;  3X3N A;  3GTK B;  4R4T A;  1XPR A;  1N33 L;  1YZ6 A;  3CPF A;  4UP8 A;  3CAM A;  2FJ2 A;  5DM6 3;  4A75 A;  2ICI A;  4POG A;  2EXZ A;  1JT8 A;  1TY2 A;  4XYQ A;  3IRB A;  4BY7 B;  1PVO A;  4XQJ A;  3GTP H;  5LL6 S;  4QJF A;  3BS1 A;  2R93 G;  4XQQ A;  1J5E L;  4LF5 L;  1Y1W B;  4DR6 L;  4BBR B;  4NXM Q;  1G51 A;  2D0P A;  4PZ8 A;  2CFM A;  4V0B A;  3U9S A;  1HZA A;  1GUT A;  1VMP A;  2E8G A;  3OOC A;  5C5M A;  3HOY H;  1B2T A;  4PZ6 A;  1HA6 A;  1OXV A;  5KNB A;  3RMH A;  1EY7 A;  1VQ5 A;  4C1N K;  5DNF A;  4BBS H;  3HKZ B;  3N52 A;  4RGN A;  3MFG A;  3E9H A;  1JJG A;  1A3T A;  1E7Z A;  1EZ6 A;  2OTJ A;  4C2M H;  4DR4 Q;  1JMC A;  3AU7 A;  3A7L A;  1JE4 A;  2VUM H;  5KYI A;  4EX5 A;  1N9W A;  1G91 A;  1AH9 A;  2JE6 I;  2RDG A;  2F0Q A;  1XXG A;  1CKN A;  3H3V I;  3DMU A;  5HUR A;  1EQQ A;  1KDC A;  1JWU D;  3KUP A;  4I7A A;  4A3L G;  3BZK A;  5IT9 c;  1HJP A;  2D2C C;  1TWG B;  2XRS D;  3CCJ A;  4LF6 Q;  5FK9 C;  2E2H H;  3TRE A;  1UUP A;  3I4N B;  1X32 A;  1PDQ A;  4C1N I;  2F0V A;  5CV7 A;  3UDX A;  3OPO A;  1QUQ B;  3HOW G;  1G29 1;  1D2B A;  3GTL B;  1FGB D;  1JCK B;  4PMW A;  4KTA A;  2OCE A;  4DR3 Q;  2UU9 L;  2R7Z B;  2FFK B;  3CQZ B;  2EJG C;  1MSG A;  4LF8 L;  4X3K A;  4A3K H;  1B70 B;  1SMY D;  1ZYR C;  5KNC A;  4LUO A;  4X64 L;  2NYZ D;  1TII D;  2KEN A;  4CJ2 C;  3P20 A;  1C4Q A;  1EU3 A;  1GUN A;  3I3C A;  3SR1 A;  1C7Y A;  2XNA C;  4AYB G;  2HDM A;  2HQL A;  4A3E G;  2KA7 A;  5JPN C;  4JOI A;  2AUJ D;  4L6T B;  1TY0 A;  4KY6 A;  2KVM A;  1K9M C;  4CKC A;  1KAA A;  4K5X A;  3DEO A;  4A3F B;  4UDU C;  4FF4 A;  2LXK A;  5GAG C;  1SN8 A;  3E0J A;  1NMG A;  1N36 Q;  4V19 0;  4JI6 L;  4XDX A;  4OO1 G;  2A68 D;  1L0W A;  2M9V A;  4HIM A;  1QWY A;  4ALP A;  1BCP D;  4TSS A;  4NW2 A;  1RDP D;  3DHQ A;  5TSS A;  3BZD B;  2PQE A;  3S1M B;  1IW7 D;  1XX8 A;  3W1G A;  3QG1 A;  3IAY A;  2G9D A;  2RKS A;  2MGS A;  1HNW L;  1LTI D;  1HTP A;  4OX9 Q;  2B39 A;  4RCO A;  4LF7 Q;  1C0A A;  1OXT A;  1IKL A;  2ID0 A;  5BN5 A;  1PH6 A;  1AZP A;  4DV4 Q;  3LGJ A;  1LT4 D;  1EYD A;  4GN5 A;  3GTG H;  3M3Y B;  2K7V A;  2WAQ G;  1GD7 A;  5IP7 G;  3KLR A;  4A3C H;  2EJF C;  3TBI B;  2I5H A;  4RCN A;  3J80 c;  3D6W A;  3CMA A;  3ND9 A;  3AFP A;  4PV1 C;  1I5F A;  3S14 H;  4IUR A;  2GVA A;  3TN2 A;  4BY7 G;  5HY6 A;  4ZUI A;  1GHK A;  2UXD L;  4DR7 L;  2C5C A;  3K80 C;  5IYB H;  3QJY A;  1I3Q B;  4A3I H;  1SLJ A;  2LKV A;  4ME5 A;  1PMR A;  1Y1W G;  3T1Y Q;  1STY A;  3S2D H;  2KHJ A;  5GAE C;  1LTA D;  2PW5 A;  3M9B A;  4ODG A;  1CHQ D;  4DR2 L;  1UEA B;  5C3X A;  4QF4 A;  3MAQ A;  1KRS A;  1VQA A;  1IHZ A;  4OO1 I;  1JOK A;  1F9R A;  1MIU A;  3JAM E;  5GAH C;  1KRT A;  2F03 A;  5JPM C;  3EQL C;  2WV6 D;  4CBV A;  3S15 H;  1IBL Q;  1GOZ A;  3GTP B;  3H3V H;  1PYS B;  2EOT A;  2E76 C;  1D5Z C;  3QB3 A;  1SYG A;  1C48 A;  2PNR C;  5E4X A;  4EGV A;  2EPB A;  2F0I A;  5BN3 A;  5M3F G;  2E2J H;  4C3H H;  2O4X A;  5IOC A;  1W6K A;  1TWA B;  1F2M A;  1G6P A;  4BS9 A;  2KQ3 A;  3Q23 A;  3HOY B;  2CCZ A;  4TRD A;  3T1H Q;  3RD4 A;  4JBK A;  2JA8 G;  2QDB A;  3CKI B;  4LF9 Q;  3I4N G;  4IQZ A;  1D6E C;  1U5K A;  4LFA Q;  5C4J H;  3J7A 5;  2VUM B;  2ZTC A;  1VQH A;  2RA4 A;  1A63 A;  2AQ1 B;  4AQY Q;  2R93 H;  2IW3 A;  3TS0 A;  1RKN A;  1BBU A;  2Y0S E;  5JVG 3;  1DOL A;  1K83 H;  3CCQ A;  2UXB Q;  1TQO A;  2E2H B;  1H9R A;  1EIH A;  4ZLT F;  3AFQ A;  2A69 D;  5E1F A;  1VCI A;  2PW7 A;  2ZT9 C;  2OF1 A;  4JV5 Q;  1X3E A;  1PYW D;  3I4M G;  4Q0F A;  1SYD A;  1CSP A;  4ILW A;  2F0G A;  2PZW A;  1PRT C;  4A3F G;  1BNZ A;  1ET6 A;  1HZ9 A;  5FLM G;  4TQU S;  2XGT A;  4HMI A;  4G4K A;  3NHH A;  3HP3 A;  4JI7 L;  4A3L H;  4C3J G;  2VQE L;  3IFD A;  3PIP A;  2FMC A;  2R3Z A;  2GVB A;  3B6Y A;  3MEH A;  2JJQ A;  5IWA Q;  1CZW A;  3JAM i;  1VQJ A;  2RSO A;  1TKW B;  1SMX A;  3W5O A;  3HOW H;  3SHL A;  3K59 A;  3S1N H;  4UAI A;  5I9O A;  1DYQ A;  2JA9 A;  1STH A;  4B3T L;  3FPP A;  4DAV A;  3HOU H;  2B8G A;  2K5N A;  1JWM D;  2LXJ A;  1HNX L;  4YHH Q;  3PUX A;  3PUZ A;  2VXW A;  1EIG A;  3R2I A;  2A19 A;  4L5S A;  1STG A;  4IFD I;  2BCO A;  2F3I A;  1X56 A;  1CKN B;  4B3R Q;  2VQF Q;  3CCE A;  5M5X H;  1Q3L A;  4CJ1 B;  1L0Y B;  1JC7 A;  3M7G A;  2JN4 A;  4A3E H;  5IGG A;  1UE1 A;  4A76 A;  2RHS B;  4R4I A;  5DAU A;  5EBC A;  2F0D A;  3T4A C;  1K73 C;  4R4O A;  2PO4 A;  1Q81 C;  5D3D A;  1WD0 A;  1EEI D;  1OO9 B;  2JXM B;  3Q8D A;  2Q8I B;  2IY5 B;  1IBK Q;  4OO1 H;  5I6W A;  3I70 A;  3GTG B;  1WTW A;  1IBM Q;  1D1K A;  3OWE B;  1RTN A;  4X66 L;  1ENA A;  3QO2 A;  5E4W C;  4JI5 Q;  2UXC L;  3S14 B;  2UUB L;  4JI0 Q;  3I4O A;  2BH2 A;  1CFM A;  2F0M A;  2E5L L;  2QCP X;  1VS0 A;  1VQ6 A;  1VQN A;  4FDB A;  1CM9 A;  1VF5 C;  4DXG A;  4LFB L;  1QCB D;  3E5S A;  4QUC A;  3TP7 A;  1F2Z A;  2CKZ B;  4A3I B;  2Z4H A;  3P75 A;  5E3F A;  2PYK A;  3S2D B;  4L5T A;  2B2V C;  2K05 A;  3MEF A;  4UP9 A;  4R8N A;  5C6A A;  2AWO A;  4IUN A;  2Z4I A;  4Q5V A;  4BXX G;  5IP7 H;  4GOP C;  4LF4 L;  2ZTE A;  3GO5 A;  2DJG C;  2F3W A;  4RKL A;  3CP0 A;  3D4R A;  2KCN A;  3K5N A;  3S15 B;  3H0G H;  3ZYY X;  4BY7 H;  1EYA A;  1TT2 A;  1SSO A;  2IT1 A;  2K04 A;  1TVX A;  2IX1 A;  3NSW A;  3J81 L;  1F2Y A;  4DV7 Q;  4C3H B;  1FR3 A;  1XMQ Q;  2E2J B;  1JJC B;  5I4D A;  4DK3 C;  4YY3 Q;  1Y1W H;  2L5T A;  4A4I A;  4B08 A;  4UPA A;  1JB7 A;  2F4I A;  2OQ0 A;  3K8A A;  4JI1 Q;  4OWX B;  4CGY B;  4DV0 Q;  1KL9 A;  3RLN A;  1H9J A;  5AJ3 Q;  2H1E A;  2QDL A;  2EYH A;  1PZJ D;  3BYY B;  3MXU A;  3QR8 A;  5NUC A;  4J8Q A;  1I4G A;  3GDE A;  1VQC A;  1CA6 A;  2K1B A;  4IAL A;  4A93 G;  2L12 A;  4IUT A;  2PMZ E;  4FXG C;  1KHI A;  5ELO A;  2O5I C;  2R93 B;  5I2X A;  3TP8 A;  1AE2 A;  2AUK A;  4F7X A;  2EYJ A;  1PV4 A;  5EBD A;  5M3F H;  1S5E D;  5A2Q E;  1NR4 A;  3M4Y A;  3JC6 6;  1K83 B;  4EQO A;  3KFU A;  3FKI G;  1P16 A;  3HG9 A;  3VDY A;  1TWG H;  2JA8 H;  1LTG D;  3H6M A;  2R61 A;  1RCV D;  4DPG A;  1GUW A;  4KD3 A;  4GKK Q;  3I4N H;  2QEJ C;  1SYE A;  2JSO A;  3FP9 A;  2A68 C;  3URY A;  1Y8P B;  1UEB A;  1IZ6 A;  1E1O A;  1BCP C;  5DM7 3;  2M00 A;  3CCR A;  4DR4 L;  1L0X B;  4OEL B;  1PH4 A;  2O2L D;  2ZXO A;  3BZC A;  5FO9 B;  2NZ1 D;  2YYZ A;  4IFD H;  4GN3 B;  4KI0 A;  3VR3 A;  4LK1 C;  2ALY B;  2DN8 A;  1S4Z A;  3CCU A;  1HPC A;  4CDD C;  2Q8R E;  1V9P A;  1IL2 A;  2SNM A;  4RHS A;  2XWB B;  4YWL A;  3HOW B;  4LF6 L;  3K0Y A;  3FHW A;  4B9W A;  4DFA A;  1A0I A;  2NTS A;  2B2U A;  3HOU B;  3EFX D;  4DV6 Q;  5COR A;  3I4M H;  1EWH A;  1HCZ A;  1ESR A;  1Q82 C;  2UUA Q;  1NR2 A;  4A3F H;  5CMD A;  4DR5 Q;  5FLM H;  4DR3 L;  3OTO Q;  2WKC A;  3W1B A;  5LMU Q;  1SYC A;  1FGU A;  5IIF A;  1Z7T A;  2RHQ B;  1A2U A;  4OGQ C;  1KNE A;  1HH2 P;  2NVY B;  4C3J H;  3LWU A;  4APV A;  1BOS A;  3E0E A;  4R4C A;  5M5X B;  4QIW E;  3A56 A;  1C8C A;  4AYB B;  2HHH Q;  1H9K A;  3N6R A;  4A3M B;  4A3E B;  5EKI A;  2B2V A;  3S1M H;  4CDF C;  5LMN L;  3BVM A;  4JBJ A;  2YTV A;  3TS2 A;  4HSP A;  4GOP A;  5COY A;  1EY0 A;  3M7N A;  2MO0 A;  1PTO C;  4UP7 A;  1B3A A;  1KDB A;  2WKD A;  4A3J B;  1FNW A;  1FNU A;  2C9O A;  2YU9 B;  2X6G A;  1N36 L;  3VYU A;  3ULJ A;  2PZU A;  4GS3 A;  1NCV A;  2QF7 A;  3J80 E;  1VQE A;  2Q2I A;  2XTI A;  3G4S A;  2MFI A;  1JJ2 A;  2WII B;  1Q90 A;  1WTR A;  5D14 A;  1KAW A;  4U67 3;  3TZU A;  1LTR D;  2JYO A;  2NN6 G;  4H44 C;  4C3H G;  1AE3 A;  1I6H H;  4KY7 A;  3WWV A;  3MXP A;  3CRK C;  2F52 A;  2CW0 D;  1ILQ A;  4OX9 L;  2WAQ B;  3UDG A;  4LF7 L;  1FL0 A;  5EKL A;  3CCL A;  1ZKO A;  4TVA B;  4DV4 L;  5FLX c;  5DEH A;  3HOZ G;  1YNX A;  1LAB A;  2JQO A;  1PHJ A;  2LSS A;  2A1A A;  1ML0 D;  3H0G B;  1SYB A;  1U4L A;  1HR0 Q;  5M3M G;  4K2K A;  1XJV A;  3VR2 A;  3L3O C;  4P74 A;  3J81 c;  1GHJ A;  4LFC Q;  1K28 A;  2E2D C;  1UE6 A;  2JA6 B;  1I50 H;  3MFY A;  1HZB A;  5J39 A;  1SFO B;  2KHS A;  1SBB B;  2DY8 A;  5C4Z A;  2EYL A;  4LUV A;  5CV5 A;  4ZQ3 A;  3SK8 A;  2NTT A;  1M1K C;  4FXK C;  1TWA H;  5EGT A;  5JVH 3;  4RAU C;  5IGF A;  4O2D A;  3C3L A;  3T1Y L;  1AEX A;  1EWC A;  4BXX H;  4KHV A;  3I90 A;  3UE0 A;  4IFD J;  4X6A H;  4IUV A;  4HJA A;  4CDC C;  2BH8 A;  5J22 A;  3KOJ A;  3OMG A;  2CQA A;  4QL5 A;  1SJH D;  4DUY Q;  1PH3 A;  1SAP A;  1NBW A;  3KBG A;  3DWP A;  5M3F B;  3RLF A;  1IBL L;  3F2U A;  2HDL A;  3I73 A;  3J7Z C;  2NN6 I;  2AMC B;  3CC4 A;  2JA8 B;  3MHB A;  2N8N A;  1NAP A;  3UE1 A;  4E6I A;  1PH5 A;  2QW7 A;  4LUZ A;  2PCF B;  3J80 i;  2KOL A;  3T1H L;  3G7L A;  1KQS A;  5ELF A;  4LF9 L;  1ZXT A;  1LUZ A;  4A93 H;  4LFA L;  3ERQ A;  3HOU G;  3QWN A;  1X65 A;  4H7B A;  1GO3 E;  2OXP A;  2L1B A;  2N49 A;  5FO8 B;  1J6Q A;  4A3D G;  4WJ3 M;  1Z9F A;  2Y0S B;  3NBI A;  3FKI H;  4AQY L;  1GUS A;  2N88 A;  1SDF A;  3BVG A;  4RG1 A;  3KK7 A;  1B44 D;  3J7A V;  5K36 G;  1UNS A;  5LMN Q;  3Q22 A;  2KBN A;  4A3M G;  2UXB L;  3D31 A;  4H13 C;  2MP1 A;  1U4R A;  2Z6K C;  4X65 Q;  1YNJ D;  1G8Z D;  2JK8 A;  2L15 A;  1QNU A;  4IOC A;  3I4M B;  3HOV B;  2WP8 J;  1PRT B;  2EZV A;  1PXU A;  2CWA A;  3TQY A;  1PA6 A;  4JV5 L;  1SNP A;  2HIX A;  4JYA Q;  4HIK A;  3DM1 A;  4X3U A;  1ICW A;  2OTL A;  4A3J G;  1DJR D;  4C3J B;  3GTQ H;  2JA7 B;  1I4P A;  1C9O A;  1RD9 D;  4GN4 B;  2AWN A;  3NTH A;  1X3P A;  4DA2 A;  4DUZ Q;  3HZX A;  4C3I G;  1KDA A;  4MIU A;  5IWA L;  3CU7 A;  4R4Q A;  4FP5 D;  3KLS A;  5C5L A;  4IJL A;  1KD1 C;  3KJP A;  2BDO A;  1FVI A;  3TEH B;  4FF3 A;  1XNQ Q;  3WOE A;  4RMF A;  1CZG A;  3DWA A;  5I9P A;  2QA4 A;  1N8R C;  2B8F A;  1VQ9 A;  4P75 A;  2F0H A;  4YHH L;  1LTL A;  1E2Z A;  5J1Z A;  5C0X G;  2V4D A;  4DV5 Q;  1CTM A;  3T16 A;  3ULP A;  1W2B A;  2KCC A;  2KEE A;  1X3G A;  2JA5 B;  4OXP A;  5EPL A;  3H0G G;  4CDE C;  2IL8 A;  4A3B G;  4B3R L;  2VQF L;  2F1M A;  4Y7N B;  1VDZ A;  3V2T A;  1OXU A;  1IYV A;  2JA6 G;  1SRO A;  3PV0 A;  4B3S Q;  2L9H A;  2PI2 E;  4DAP A;  1I6H B;  5C3E G;  4GKJ Q;  1JB3 A;  1PTO H;  2BE5 C;  2DNC A;  1BO0 A;  1PH2 A;  1FJG Q;  2FIN B;  1LT5 D;  1WOC A;  3TSS A;  3CCS A;  4P73 A;  2OWO A;  1U0L A;  3F1Z A;  1IBK L;  1ENC A;  1JOR A;  1IBM L;  5C4X B;  1LTB D;  2F0W A;  3D0F A;  3LWE A;  1D1I A;  3GP7 A;  1PH9 A;  3DWQ A;  1K8A C;  1XTD A;  2K4K A;  1IYJ B;  4QB4 A;  4JI5 L;  2VS1 A;  1I50 B;  4JI0 L;  3F8T A;  1QE6 A;  1GUO A;  1LO5 D;  3CXC A;  3CD6 A;  1Q1E A;  1DOM A;  2A6E C;  2NN6 H;  1HNZ Q;  2VY3 A;  2NB0 A;  3HKZ E;  4QMG A;  4L63 B;  2Z8L A;  5G3L F;  1I4H A;  3IL8 A;  1L1O C;  4GOP B;  1XMO Q;  1HQR D;  3BJU A;  3CCM A;  3D3R A;  1KC8 C;  3HOZ H;  2KED A;  3OHX C;  3VR6 A;  1ONL A;  2I5L X;  2DNE A;  4DV1 Q;  3CRL C;  1QVF A;  5C0X I;  3A5U A;  3G48 A;  1GUG A;  5M3M H;  2OT2 A;  5C44 G;  4CKB A;  5M9O A;  1K0S A;  4DGZ A;  1U4M A;  3J81 j;  1WD1 A;  2K14 A;  3R3O A;  4FYD A;  4IFD G;  1LYL A;  2K6A A;  4A3G B;  4K8J A;  1QZG A;  2ENB A;  3FMC A;  3C1E A;  2K5H A;  2KCM A;  2Y0S G;  2Z6K A;  4KK7 A;  3M4O H;  3A8J E;  4IPG A;  4DV7 L;  3SGI A;  1XMQ L;  2H5X A;  4YY3 L;  3ULL A;  5IYD G;  1TWC H;  1PFB A;  4K8I A;  3X3M A;  1NNX A;  4DK0 A;  3S2H H;  1ASZ A;  4JI1 L;  4F8M A;  4DV0 L;  5FKA C;  4A93 B;  2YTY A;  3MXN A;  4YWK A;  3AB9 A;  5AJ3 L;  2R6G A;  1X3Q A;  3OW2 A;  4P71 A;  4DNI A;  3HOV G;  1HFN A;  2PMZ B;  1PZK D;  3U4Z A;  5IOD A;  3IFT A;  1HXY D;  4FF1 A;  2B29 A;  3FKI B;  3NEM A;  3I72 A;  3OYY A;  4EQN A;  2JA7 G;  1VQI A;  4QUF A;  1VF7 A;  1O7L A;  4OWT B;  4OON A;  5IY0 A;  2HQE A;  2EYM A;  2GN5 A;  2B2T C;  1GM5 A;  4B3M Q;  2XN9 C;  3CME A;  2IHE A;  5EKK A;  5JOB A;  4HAE A;  2ICE C;  4MN3 A;  1BCP B;  2MO1 A;  4GKK L;  2XIW A;  2VL6 A;  1CT1 D;  1RHP A;  2AKW B;  4JI8 Q;  5BR8 Q;  4YIJ A;  1X6O A;  4IUP A;  4IOA A;  4GNX C;  3A8I E;  5G3L D;  1DON A;  3U50 C;  2Q2T A;  4A3D H;  2WAC A;  1I4R A;  2LFN A;  5T1G A;  3GTQ B;  4RGM A;  3G71 A;  1MGS A;  5ELB A;  1VQ8 A;  1XPU A;  5CV4 A;  2NVY H;  3OIP A;  3NEL A;  1Y14 B;  5K36 H;  4A3M H;  2JA5 G;  1PYB A;  3Q6S A;  3ICE A;  3O13 A;  4KMU C;  1B53 A;  2K03 A;  4HTH A;  1H9M A;  5ELD A;  3KDF A;  2F0E A;  2K33 A;  3VA5 A;  3RZO B;  4XTC S;  1S40 A;  3KYH C;  3WOF A;  1GXD C;  3PUV A;  4DV6 L;  1SYF A;  1ZYR D;  1NSN S;  1II3 A;  4RH6 A;  1U4P A;  4A3J H;  2UUA L;  4DR5 L;  2YU9 H;  3MWY W;  2Z1C A;  3GV3 A;  3OTO L;  5D65 A;  1EIF A;  5EJW A;  1X3F A;  5CV9 A;  3U4V A;  4EVO A;  3GTJ H;  4QIW B;  2K5W A;  2VB3 X;  5LMU L;  1JE5 A;  4LW1 A;  5C4X G;  1I4Q A;  2K28 A;  4IZ8 A;  3E9I A;  2R92 G;  2F0U A;  2DY7 A;  1XNR Q;  1BUV T;  4C3I H;  4DKA C;  1R4Q B;  1NE3 A;  4FXD A;  2J7Z A;  2HHH L;  1EQR A;  1SEB D;  1KNA A;  3K7A H;  1VQ7 A;  1STE A;  3A55 A;  1PTO B;  4K5V A;  1VQ4 A;  3FVQ A;  3OIQ A;  2XRQ D;  4QQB X;  1KLU D;  4PMB A;  3EVQ A;  1HFG A;  1DOK A;  1WJJ A;  1EY9 A;  1Q7Y C;  3V05 A;  2LY7 A;  2O5J C;  4DV2 Q;  1EEF D;  3RLO A;  1VQD A;  1WVL A;  3K58 A;  3PO3 G;  4KKT A;  5FLX E;  5C0X H;  2ZXP A;  3TZD A;  1CKM A;  4HCE A;  3S16 B;  2HIV A;  3CHB D;  3FDT A;  4A3B H;  4X62 L;  2DJF C;  3J81 E;  1ENF A;  1ASY A;  1R9T B;  2SOB A;  4DV3 Q;  1N34 Q;  2JA6 H;  3NQT A;  5C3E H;  4A3G G;  1SFO H;  3HEJ A;  3STB D;  3AQQ A;  4K0K Q;  2Z9H A;  5FOB B;  3PSI A;  2OEO A;  1TS2 A;  2NZH A;  4ZK9 B;  3HOZ B;  3SEB A;  4BA1 I;  1SMY C;  5AFW A;  4JI2 Q;  5M3M B;  1M90 C;  3S1Q H;  3T51 B;  5KND A;  5GQO A;  1B50 A;  4QCL A;  1RIP A;  4MTK A;  1HR0 L;  1V1O A;  2P5Z X;  3HOX B;  1EY8 A;  1TS4 A;  3M4O B;  1Z6H A;  2J0T D;  4LFC L;  2L4N A;  1PRT F;  4KN4 C;  1SNQ A;  1YNJ C;  3MVV A;  2JEA I;  3HS0 C;  4WJ4 A;  1TWC B;  2X6L A;  1LTS D;  1DGS A;  3S2H B;  4GNX A;  1Y8O B;  4HSV A;  2TMP A;  3VR5 A;  3KF6 A;  2JEB I;  4DR1 Q;  1A62 A;  1TR5 A;  2AQ3 B;  3SK5 A;  2NWG A;  2KJX A;  3NTI A;  4OIJ A;  1K8M A;  3A74 A;  5C44 H;  3C46 A;  1QVC A;  5KEE A;  1XTC D;  3NTK A;  5IT9 L;  1AP0 A;  3PO2 G;  5JJK A;  4DUY L;  4HN7 A;  1IW7 C;  3EN2 A;  1H95 A;  2NVT B;  1WTP A;  4KHP Q;  2ZM6 Q;  1LM0 A;  3OSO A;  5IYD H;  3VYT A;  2BA1 A;  1SND A;  1YHQ A;  3EIV A;  5ELC A;  5CR3 A;  1B4O A;  2EY1 A;  1MBY A;  1YEZ A;  2L0C A;  1EOT A;  1VQO A;  1J8I A;  2K32 A;  2SDF A;  1V1Q A;  1DM0 B;  2L55 A;  3SE0 A;  4FF2 A;  3AYH B;  1ESF A;  4MNO A;  1A3U A;  5GRO A;  3HOV H;  3J81 i;  1A6X A;  4RFB A;  3NUC A;  1OXS C;  1N32 Q;  1YIJ A;  2HT1 A;  4A3D B;  2K52 A;  5ELN A;  3UI2 A;  4KHZ A;  2A74 C;  2L11 A;  3CF5 A;  2WB1 E;  3A0J A;  4XT1 B;  5BN4 A;  2N55 A;  4N8X 1;  2JA7 H;  2N78 A;  4M1U B;  3K6O A;  1MHW C;  5H1S E;  2E2I B;  1XPO A;  3NWS A;  3HKS A;  1EYG A;  2NUC A;  3ER0 A;  4GLA C;  1YNN D;  1WCM H;  4S3S A;  1SR3 A;  2RCF A;  1Q8K A;  1TWF H;  1JIC A;  1NUC A;  5C0X J;  4PMC A;  3D4D A;  3MTS A;  2F4V Q;  1M8A A;  4PQX A;  4X65 L;  1PRT D;  2IJ0 A;  1MD2 D;  3MXN B;  5M5W B;  3G6J B;  1YIT A;  3GTM H;  2QIL A;  4GZY C;  1JQY D;  2K5Q A;  1H9S A;  2AHO B;  1CUK A;  4JYA L;  4X62 Q;  3GTJ B;  3IKJ A;  3NE5 B;  5IGB A;  2C35 B;  4MHE A;  3MXG A;  3TP5 A;  1Q86 C;  5IE8 A;  1M4V A;  2JA5 H;  4C3I B;  3GD7 A;  4BY1 G;  2K5D A;  3E6Z X;  3EBE A;  4Y7N H;  2B63 H;  3K7A B;  1K8G A;  4UY8 C;  4DAM A;  3BYT B;  4DUZ L;  1L2F A;  3FRP B;  4XQN A;  4RGT A;  2CHB D;  2D0O A;  4GLV B;  3F2C A;  3P7J A;  2N3S A;  3H94 A;  1E24 A;  2XSC A;  2Q2U A;  3CC2 A;  4ID6 A;  3AEV A;  1SE2 A;  3PUW A;  3DM3 A;  2CH4 W;  1Y69 U;  2NVQ B;  1SRU A;  1XNQ L;  3NPP A;  1TS3 A;  2EYF A;  4XIG S;  2MUY A;  2R7D A;  5JEA G;  1QJO A;  5C4X H;  5JJL A;  4A3B B;  2R92 H;  3I8Z A;  3W2D A;  4HR7 B;  2XVS A;  2CVR A;  4DV5 L;  3RR5 A;  1TXY A;  1RF2 D;  1CQV A;  3RUZ A;  4JI4 Q;  3D6C A;  1LTT D;  1MKH A;  2A69 C;  2X69 A;  5C3E B;  3WDN A;  5KIX A;  3HOX G;  4XYO A;  3I7F A;  5KGU A;  3KF8 B;  1F9Q A;  2B3G A;  2EYP A;  3QIA A;  1I4X A;  3NEN A;  4EQ5 A;  3PF5 A;  3C1F A;  4B3S L;  3KDF B;  4GKJ L;  1EY5 A;  1FJG L;  3R93 A;  1SNC A;  3PO3 H;  2V1C C;  1F2L A;  2UUC Q;  1FNV A;  2F0L A;  3S1R B;  4L5Q A;  3ERO A;  3S1Q B;  4K6L A;  2OQK A;  2FXQ A;  1K3B C;  4IUQ A;  2KEC A;  3ITP A;  1BXT A;  1RL2 A;  1SXT A;  1PH8 A;  1MSH A;  3ND8 A;  1V8Q A;  1JOO A;  4LMQ D;  4A3G H;  2E75 C;  1BCP F;  1X55 A;  1L1O B;  4ZKC B;  3BDC A;  1O7Y A;  1HNZ L;  1YVC A;  2EIF A;  1E1T A;  3QOJ A;  3L2P A;  3FPU B;  2EQS A;  4G57 A;  3RZD B;  1STA A;  5JJI A;  1WTX A;  4IPD A;  3T56 B;  1XMO L;  1TU2 B;  1B7Y B;  3TDQ A;  4OEM B;  5C44 B;  1XYI A;  3K0X A;  1EL0 A;  4KKU A;  3V96 A;  4YCV A;  1PFN A;  2LS0 1;  4DV1 L;  1IYU A;  3PIO 3;  3SK4 A;  3HRZ C;  5LHY 1;  4O1N A;  4BA2 I;  1PFM A;  1VQG A;  3BG3 A;  1HHV A;  2RDF A;  3DEP A;  1LT3 D;  3CC7 A;  3T53 B;  4AIM A;  2KUM A;  2D5D A;  2F0F A;  4YCU A;  1HQM C;  4JW0 A;  3I56 A;  1CQF A; 
#chains in the Genus database with same CATH homology
 1EQT A;  5K5P A;  3VA7 A;  2EJM A;  4J1M A;  2IX0 A;  2VB2 X;  3P1H A;  2FHT A;  4WFN 3;  2F0T A;  5IGE A;  3H91 A;  1QB5 D;  2A73 B;  1HA5 A;  3GV6 A;  1EQV A;  3H09 A;  1J9O A;  1AN8 A;  1PTO F;  4LAA A;  5CV6 A;  5CBE E;  1O7Z A;  3AMU A;  1DD2 A;  1DCZ A;  5CBA E;  1E0B A;  4G7H C;  1WCM B;  4ZRZ A;  2D9U A;  2MJ8 A;  3KBX A;  1TWF B;  3R8B A;  4DNR B;  5KYL A;  1BQQ T;  2RDH A;  4F88 A;  3MZ5 A;  1LT6 D;  1OXX K;  4HED A;  1LAC A;  5F2D A;  3GTM B;  3EA6 A;  2EDG A;  3M85 A;  2A6H D;  3Q24 A;  1BBX C;  1CHP D;  4WOR A;  2B2Y C;  5C4H A;  1QNK A;  4I7Z C;  2B63 B;  1A15 A;  3S17 B;  3MA2 B;  1Y1V B;  1UAP A;  2Q8T A;  1XWE A;  1E2W A;  2I46 A;  4NKL A;  4KD4 A;  4X3S A;  3BDL A;  1ILP A;  2LMC B;  4OL7 A;  4DN4 M;  2R92 B;  4R9W A;  2F0O A;  2VNU D;  3KLS X;  3NP8 A;  1QOH A;  2EY2 A;  3SVM A;  4DK1 A;  2RBM A;  5EPK A;  1TS5 A;  3K57 A;  1PTO D;  3JAM L;  1D5M C;  3PO3 B;  3K5L A;  4J6H A;  2RVL A;  5JEA H;  1STN A;  4XT3 B;  1HUN A;  1F9S A;  1H9S B;  4C56 C;  3PMF A;  2XWJ B;  4HMJ A;  4O42 A;  4U68 A;  1WTV A;  4BBS B;  2F0P A;  3VYS A;  4B9X A;  4DAY A;  1V1P A;  1QIL A;  3L7Z C;  4C2M B;  1CK1 A;  4X3T A;  3PIP 3;  2HCI A;  3NWT A;  2F0J A;  3A54 A;  2M2L A;  4KN7 C;  1A2T A;  1HRJ A;  3L9A X;  3LNN A;  2FMM A;  3NBH A;  3SXH A;  2EYO A;  1YNN C;  4RHR A;  5CC4 A;  3A8K E;  4PNY A;  2PPB C;  1B9N A;  5EQ0 A;  3C2P A;  3W3A A;  2MHV A;  4A3K B;  3BDO A;  4K5W A;  3DUZ A;  1Q12 A;  2IX3 A;  1FD7 D;  4L8J A;  3PO2 B;  4IUU A;  1PLF A;  4P2C B;  2B2Y A;  1IKM A;  1W6J A;  1BF4 A;  1F77 A;  3NQI A;  1ET9 A;  4JBW A;  4HCS A;  2HUG A;  1S5B D;  2RQX A;  4FO2 A;  5CYU A;  4RGO S;  2CW0 C;  1S5F D;  3SDZ A;  1DXM A;  4I65 A;  3KF8 A;  2TSS A;  2SEB D;  1SNO A;  1AZQ A;  1R4P B;  1E2V A;  2NBF A;  1O78 A;  1WTQ A;  4DU9 A;  2WB1 B;  1A3V A;  4ULL A;  2F0N A;  4N9P A;  1TWH B;  4IN3 A;  1RTO A;  5KRU A;  1S5C D;  1JWS D;  2ZXR A;  1F9P A;  1SE3 A;  1ZEQ X;  3I91 A;  4DXF A;  2B2U C;  5JEA J;  1DZ1 A;  1G2T A;  3I4L A;  4OHJ A;  5JJZ A;  3GTO B;  3T13 A;  1O80 A;  1V43 A;  2MPM A;  1AFP A;  2QKI C;  4RKB A;  1KLG D;  1EY4 A;  4ZKB B;  1ROD A;  1Q8I A;  1KAB A;  3U9O A;  4ABN A;  4BY1 B;  3D4W A;  4CHT B;  3FEW X;  1G6Z A;  4TKO B;  2WIN B;  2B2W C;  4CJ0 B;  1QG7 A;  3OW7 A;  1LV9 A;  1Q1B A;  1MI2 A;  2NVX B;  4K6D A;  3Q0A A;  5IGC A;  2F0S A;  4M8A A;  4KV6 A;  5FLX L;  4OIK A;  3MC0 B;  5HGT A;  3PUY A;  1T5E A;  1B1Z A;  4XXE A;  2AQ2 B;  4F87 A;  1G2S A;  3K5M A;  4NMZ A;  4Z9C B;  1SNM A;  4KKS A;  5I6Y A;  2B2T A;  3D8G A;  4FVM A;  2PZT A;  1K8O A;  4N9T A;  5C3W A;  5C4J B;  2BE5 D;  2BOS A;  5CV8 A;  2EY6 A;  1Y8N B;  3S9W A;  1IL8 A;  2GA4 B;  5I2Y A;  5T1I A;  2HCC A;  2RSN A;  4JK1 C;  4ZYS A;  4KJO A;  1BR9 A;  4KJN A;  1JR0 D;  1KTK A;  5A2Q L;  5IT9 E;  3OWF A;  5JAV A;  2SNS A;  3SK6 A;  2A6E D;  1I6V C;  4DF7 A;  5ELE A;  1HUM A;  2D62 A;  1SJE D;  1S5D D;  4NP5 A;  4BWG B;  3LX0 A;  4ZUJ A;  4RA8 A;  1EYC A;  1LLR D;  3TME A;  2J4X A;  4FNF A;  4K2L A;  1EY6 A;  1BDO A;  2A6H C;  3GQB A;  4KY5 A;  1RJT A;  4WJW A;  1VMC A;  3ONA B;  2F0K A;  1WTO A;  2BDN A;  5M5Y B;  1CA5 A;  3S1N B;  4R8I A;  1JOQ A;  1V1P B;  4CKE A;  5EPJ A;  3J7Y W;  2K01 A;  4NDX A;  1GJX A;  3NK9 A;  2F3V A;  3K5O A;  2BA0 A;  3VYR A;  1STB A;  4EQP A;  3EJI A;  1AW7 A;  3R2T A;  4LJZ C;  1EU4 A;  5LL6 X;  4K14 A;  1U9R A;  5A35 A;  1SE4 A;  1HTL D;  1T5X D;  3HGB A;  4RWS C;  5FO7 B;  4DNT B;  3OMC A;  3A7A B;  2B2W A;  2EY5 A;  2H4O A;  5D3I B;  5IGD A;  1EFI D;  2EVB A;  1PZI D;  3DXJ C;  2E74 C;  3J7A F;  1CI3 M;  5ISR A;  3QOL A;  1B9M A;  4H0L C;  3TP6 A;  3BVZ A;  1D5X C;  1Z47 A;  4ZAI A;  2G9H D;  2A5H A;  4G7O C;  2IWH A;  3NXW A;  4WRD A;  4G7Z C;  3J80 L;  2JP1 A;  3VR4 A;  2I07 B;  2EE1 A;  3H3V C;  5CGK A;  1FYC A;  1EZ8 A;  2IPK D;  3X3N A;  3GTK B;  2FJ2 A;  5DM6 3;  2ICI A;  2EXZ A;  1TY2 A;  4XYQ A;  4BY7 B;  4XQJ A;  5LL6 S;  3BS1 A;  4XQQ A;  1Y1W B;  4BBR B;  4V0B A;  3U9S A;  1GUT A;  1VMP A;  3OOC A;  5C5M A;  1B2T A;  1HA6 A;  1OXV A;  5KNB A;  3RMH A;  1EY7 A;  4C1N K;  5DNF A;  3HKZ B;  3N52 A;  4RGN A;  3MFG A;  1A3T A;  1EZ6 A;  3AU7 A;  3A7L A;  1JE4 A;  5KYI A;  1G91 A;  2JE6 I;  2RDG A;  2F0Q A;  1XXG A;  3DMU A;  5HUR A;  1KDC A;  1JWU D;  3KUP A;  2D2C C;  1TWG B;  2XRS D;  5FK9 C;  1UUP A;  3I4N B;  1X32 A;  1PDQ A;  4C1N I;  2F0V A;  5CV7 A;  3OPO A;  1G29 1;  1D2B A;  3GTL B;  1FGB D;  1JCK B;  4PMW A;  4KTA A;  2R7Z B;  2FFK B;  3CQZ B;  2EJG C;  1MSG A;  4X3K A;  1SMY D;  1ZYR C;  5KNC A;  2NYZ D;  1TII D;  4CJ2 C;  3P20 A;  1C4Q A;  1EU3 A;  1GUN A;  3I3C A;  3SR1 A;  2XNA C;  2HDM A;  2KA7 A;  5JPN C;  2AUJ D;  4L6T B;  1TY0 A;  4KY6 A;  2KVM A;  4CKC A;  1KAA A;  4K5X A;  3DEO A;  4A3F B;  4UDU C;  4FF4 A;  4V19 0;  3E0J A;  4XDX A;  4OO1 G;  2A68 D;  2M9V A;  1QWY A;  1BCP D;  4TSS A;  4NW2 A;  1RDP D;  3DHQ A;  5TSS A;  3BZD B;  2PQE A;  3S1M B;  1IW7 D;  1XX8 A;  3QG1 A;  3IAY A;  2G9D A;  2RKS A;  2MGS A;  1LTI D;  1HTP A;  2B39 A;  4RCO A;  1OXT A;  1IKL A;  2ID0 A;  5BN5 A;  1AZP A;  1LT4 D;  1EYD A;  3M3Y B;  2K7V A;  3KLR A;  2EJF C;  3TBI B;  4RCN A;  3D6W A;  3ND9 A;  4PV1 C;  4IUR A;  3TN2 A;  4ZUI A;  1GHK A;  2C5C A;  3QJY A;  1I3Q B;  2LKV A;  4ME5 A;  1PMR A;  1STY A;  1LTA D;  2PW5 A;  4ODG A;  1CHQ D;  1UEA B;  5C3X A;  4QF4 A;  3MAQ A;  4OO1 I;  1IHZ A;  1JOK A;  1F9R A;  3JAM E;  2F03 A;  5JPM C;  3EQL C;  2WV6 D;  4CBV A;  1GOZ A;  3GTP B;  2EOT A;  2E76 C;  1D5Z C;  3QB3 A;  1SYG A;  1C48 A;  2PNR C;  5E4X A;  4EGV A;  2EPB A;  2F0I A;  5BN3 A;  2O4X A;  5IOC A;  1W6K A;  1TWA B;  1F2M A;  4BS9 A;  2KQ3 A;  3Q23 A;  3HOY B;  4TRD A;  3RD4 A;  2QDB A;  3CKI B;  4IQZ A;  1D6E C;  2VUM B;  2RA4 A;  2AQ1 B;  2IW3 A;  1RKN A;  5JVG 3;  1DOL A;  1TQO A;  2E2H B;  1H9R A;  1EIH A;  4ZLT F;  2A69 D;  5E1F A;  1VCI A;  2PW7 A;  2ZT9 C;  2OF1 A;  1PYW D;  4Q0F A;  1SYD A;  4ILW A;  2F0G A;  2PZW A;  1PRT C;  1BNZ A;  1ET6 A;  4TQU S;  4HMI A;  4G4K A;  3NHH A;  3HP3 A;  4C3J G;  3IFD A;  2FMC A;  2R3Z A;  3MEH A;  1CZW A;  2RSO A;  1TKW B;  3SHL A;  3K59 A;  4UAI A;  5I9O A;  1DYQ A;  1STH A;  3FPP A;  4DAV A;  2B8G A;  1JWM D;  3PUX A;  3PUZ A;  2VXW A;  1EIG A;  3R2I A;  1STG A;  4IFD I;  2BCO A;  1Q3L A;  4CJ1 B;  1L0Y B;  1JC7 A;  3M7G A;  5IGG A;  5DAU A;  5EBC A;  2F0D A;  3T4A C;  2PO4 A;  5D3D A;  1WD0 A;  1EEI D;  1OO9 B;  2JXM B;  2Q8I B;  4OO1 H;  5I6W A;  3I70 A;  3GTG B;  1WTW A;  1D1K A;  3OWE B;  1RTN A;  1ENA A;  3QO2 A;  5E4W C;  3S14 B;  1CFM A;  2F0M A;  2QCP X;  1CM9 A;  1VF5 C;  4DXG A;  1QCB D;  3E5S A;  4QUC A;  3TP7 A;  1F2Z A;  4A3I B;  2Z4H A;  3P75 A;  5E3F A;  2PYK A;  3S2D B;  2B2V C;  2K05 A;  4R8N A;  5C6A A;  2AWO A;  4IUN A;  2Z4I A;  4Q5V A;  3GO5 A;  2F3W A;  4RKL A;  3D4R A;  2KCN A;  3K5N A;  3S15 B;  3ZYY X;  1EYA A;  1TT2 A;  1SSO A;  2IT1 A;  2K04 A;  1TVX A;  2IX1 A;  3NSW A;  3J81 L;  1F2Y A;  2E2J B;  4C3H B;  1FR3 A;  5I4D A;  2L5T A;  4B08 A;  2F4I A;  4CGY B;  1H9J A;  2H1E A;  2EYH A;  1PZJ D;  3BYY B;  3MXU A;  5NUC A;  4J8Q A;  1I4G A;  1CA6 A;  2K1B A;  4IAL A;  2L12 A;  4IUT A;  4FXG C;  2O5I C;  2R93 B;  5I2X A;  3TP8 A;  2AUK A;  4F7X A;  2EYJ A;  5EBD A;  1S5E D;  5A2Q E;  1NR4 A;  3M4Y A;  1K83 B;  4EQO A;  3HG9 A;  1GUW A;  1LTG D;  3H6M A;  2R61 A;  1RCV D;  4KD3 A;  2QEJ C;  1SYE A;  2JSO A;  2A68 C;  3URY A;  1Y8P B;  1BCP C;  5DM7 3;  2M00 A;  1L0X B;  2O2L D;  2ZXO A;  5FO9 B;  2NZ1 D;  2YYZ A;  4IFD H;  4KI0 A;  3VR3 A;  4LK1 C;  2DN8 A;  1S4Z A;  1HPC A;  2Q8R E;  2SNM A;  4RHS A;  2XWB B;  3HOW B;  3K0Y A;  4B9W A;  4DFA A;  2NTS A;  2B2U A;  3HOU B;  3EFX D;  5COR A;  1EWH A;  1HCZ A;  1ESR A;  1NR2 A;  5CMD A;  2WKC A;  1SYC A;  5IIF A;  1Z7T A;  1A2U A;  4OGQ C;  1KNE A;  2NVY B;  3LWU A;  1BOS A;  5M5X B;  1C8C A;  3A56 A;  4AYB B;  1H9K A;  3N6R A;  4A3M B;  4A3E B;  5EKI A;  2B2V A;  3BVM A;  4HSP A;  5COY A;  1EY0 A;  3M7N A;  1PTO C;  1B3A A;  1KDB A;  2WKD A;  4A3J B;  1FNW A;  1FNU A;  2C9O A;  2YU9 B;  2X6G A;  3VYU A;  2PZU A;  1NCV A;  2QF7 A;  3J80 E;  2WII B;  1Q90 A;  1WTR A;  5D14 A;  4U67 3;  3TZU A;  1LTR D;  2JYO A;  2NN6 G;  4H44 C;  4C3H G;  4KY7 A;  3MXP A;  3CRK C;  2CW0 D;  1ILQ A;  2WAQ B;  5EKL A;  1ZKO A;  5DEH A;  1LAB A;  1ML0 D;  3H0G B;  1SYB A;  1U4L A;  4K2K A;  3VR2 A;  3L3O C;  1GHJ A;  2E2D C;  2JA6 B;  3MFY A;  5J39 A;  1SFO B;  2KHS A;  5C4Z A;  1SBB B;  2DY8 A;  2EYL A;  5CV5 A;  4ZQ3 A;  3SK8 A;  2NTT A;  4FXK C;  5EGT A;  5JVH 3;  4RAU C;  5IGF A;  3C3L A;  1AEX A;  1EWC A;  4KHV A;  3I90 A;  4IFD J;  4IUV A;  5J22 A;  3OMG A;  2CQA A;  1SJH D;  1SAP A;  3DWP A;  3KBG A;  5M3F B;  3RLF A;  3F2U A;  2HDL A;  3I73 A;  2NN6 I;  2JA8 B;  3MHB A;  1NAP A;  4E6I A;  2PCF B;  2KOL A;  3G7L A;  5ELF A;  1ZXT A;  3ERQ A;  3QWN A;  4H7B A;  2OXP A;  2L1B A;  5FO8 B;  2Y0S B;  3NBI A;  1GUS A;  2N88 A;  1SDF A;  3BVG A;  3KK7 A;  1B44 D;  3J7A V;  5K36 G;  1UNS A;  3Q22 A;  3D31 A;  4H13 C;  2MP1 A;  1U4R A;  1YNJ D;  1G8Z D;  3I4M B;  1QNU A;  3HOV B;  2WP8 J;  1PRT B;  2EZV A;  1PXU A;  1SNP A;  3DM1 A;  4X3U A;  1ICW A;  1DJR D;  4C3J B;  2JA7 B;  1I4P A;  1RD9 D;  2AWN A;  3NTH A;  1X3P A;  4DA2 A;  3HZX A;  4C3I G;  1KDA A;  4MIU A;  3CU7 A;  4FP5 D;  3KLS A;  5C5L A;  4FF3 A;  2BDO A;  3WOE A;  1CZG A;  3DWA A;  5I9P A;  2B8F A;  2F0H A;  5J1Z A;  1E2Z A;  5C0X G;  2V4D A;  1CTM A;  3T16 A;  2KCC A;  2KEE A;  2JA5 B;  5EPL A;  2IL8 A;  2F1M A;  4Y7N B;  1VDZ A;  3V2T A;  1OXU A;  1IYV A;  3PV0 A;  2L9H A;  4DAP A;  1I6H B;  1JB3 A;  1PTO H;  2BE5 C;  2DNC A;  1BO0 A;  2FIN B;  1LT5 D;  3TSS A;  1ENC A;  1JOR A;  5C4X B;  1LTB D;  2F0W A;  3LWE A;  1D1I A;  3GP7 A;  3DWQ A;  4QB4 A;  1I50 B;  1QE6 A;  1GUO A;  1LO5 D;  1Q1E A;  1DOM A;  2A6E C;  2NN6 H;  2NB0 A;  4QMG A;  4L63 B;  2Z8L A;  5G3L F;  1I4H A;  3IL8 A;  1HQR D;  3D3R A;  2KED A;  3OHX C;  3VR6 A;  1ONL A;  2DNE A;  3CRL C;  5C0X I;  1GUG A;  2OT2 A;  4CKB A;  5M9O A;  4DGZ A;  1U4M A;  1WD1 A;  3R3O A;  4FYD A;  4IFD G;  2K6A A;  4A3G B;  4K8J A;  2ENB A;  3FMC A;  3C1E A;  4KK7 A;  3A8J E;  1PFB A;  4K8I A;  3X3M A;  4DK0 A;  4F8M A;  5FKA C;  4A93 B;  3MXN A;  3AB9 A;  2R6G A;  1X3Q A;  1HFN A;  2PMZ B;  1PZK D;  5IOD A;  3IFT A;  1HXY D;  4FF1 A;  3FKI B;  3I72 A;  4EQN A;  4QUF A;  1VF7 A;  1O7L A;  2HQE A;  2EYM A;  2B2T C;  2XN9 C;  5EKK A;  5JOB A;  4HAE A;  2ICE C;  4MN3 A;  1BCP B;  2XIW A;  1CT1 D;  1RHP A;  4YIJ A;  4IUP A;  3A8I E;  5G3L D;  1DON A;  2WAC A;  1I4R A;  2LFN A;  5T1G A;  3GTQ B;  4RGM A;  1MGS A;  5ELB A;  5CV4 A;  3OIP A;  5K36 H;  3Q6S A;  3O13 A;  4KMU C;  1B53 A;  2K03 A;  4HTH A;  1H9M A;  5ELD A;  2F0E A;  2K33 A;  3VA5 A;  3RZO B;  4XTC S;  3WOF A;  1GXD C;  3PUV A;  1SYF A;  1ZYR D;  1NSN S;  1II3 A;  4RH6 A;  1U4P A;  3GV3 A;  2Z1C A;  3MWY W;  5D65 A;  5EJW A;  5CV9 A;  4EVO A;  4QIW B;  2K5W A;  2VB3 X;  1I4Q A;  2K28 A;  4IZ8 A;  2F0U A;  2DY7 A;  1BUV T;  1R4Q B;  4FXD A;  2J7Z A;  1SEB D;  1KNA A;  1STE A;  3A55 A;  1PTO B;  4K5V A;  3FVQ A;  3OIQ A;  2XRQ D;  1KLU D;  4PMB A;  3EVQ A;  1HFG A;  1DOK A;  1EY9 A;  3V05 A;  2LY7 A;  2O5J C;  1EEF D;  1WVL A;  3K58 A;  4KKT A;  5FLX E;  5C0X H;  2ZXP A;  3TZD A;  4HCE A;  3S16 B;  3CHB D;  3FDT A;  3J81 E;  1ENF A;  1R9T B;  2SOB A;  3NQT A;  3HEJ A;  5FOB B;  2OEO A;  1TS2 A;  4ZK9 B;  3HOZ B;  3SEB A;  4BA1 I;  1SMY C;  5AFW A;  5M3M B;  3T51 B;  5KND A;  1B50 A;  4QCL A;  1V1O A;  3HOX B;  1EY8 A;  1TS4 A;  3M4O B;  1Z6H A;  2J0T D;  2L4N A;  1PRT F;  4KN4 C;  1SNQ A;  1YNJ C;  3MVV A;  2JEA I;  3HS0 C;  1TWC B;  2X6L A;  1LTS D;  3S2H B;  1Y8O B;  4HSV A;  2TMP A;  3VR5 A;  2JEB I;  1TR5 A;  2AQ3 B;  3SK5 A;  2NWG A;  2KJX A;  3NTI A;  4OIJ A;  1K8M A;  3C46 A;  5KEE A;  1XTC D;  3NTK A;  5IT9 L;  1AP0 A;  4HN7 A;  1IW7 C;  2NVT B;  1WTP A;  3OSO A;  3VYT A;  2BA1 A;  1SND A;  5ELC A;  5CR3 A;  1B4O A;  2EY1 A;  1MBY A;  2L0C A;  1J8I A;  1EOT A;  2K32 A;  2SDF A;  1DM0 B;  2L55 A;  3SE0 A;  4FF2 A;  1ESF A;  1A3U A;  1A6X A;  4RFB A;  3NUC A;  1OXS C;  4A3D B;  3UI2 A;  4KHZ A;  2A74 C;  2L11 A;  4XT1 B;  5BN4 A;  2N55 A;  4M1U B;  3K6O A;  2E2I B;  3NWS A;  2NUC A;  1YNN D;  4S3S A;  1JIC A;  1NUC A;  5C0X J;  4PMC A;  3D4D A;  3MTS A;  1M8A A;  4PQX A;  1PRT D;  2IJ0 A;  1MD2 D;  5M5W B;  3G6J B;  2QIL A;  4GZY C;  1JQY D;  2K5Q A;  1H9S A;  3GTJ B;  3IKJ A;  3NE5 B;  5IGB A;  4MHE A;  3MXG A;  3TP5 A;  1M4V A;  4C3I B;  3GD7 A;  2K5D A;  3E6Z X;  3K7A B;  3BYT B;  3FRP B;  4XQN A;  4RGT A;  2CHB D;  3P7J A;  3H94 A;  2XSC A;  4ID6 A;  1SE2 A;  3PUW A;  1Y69 U;  2NVQ B;  3NPP A;  1TS3 A;  2EYF A;  4XIG S;  2MUY A;  5JEA G;  1QJO A;  4A3B B;  3I8Z A;  3W2D A;  4HR7 B;  2XVS A;  2CVR A;  1RF2 D;  1CQV A;  3RUZ A;  3D6C A;  1LTT D;  2A69 C;  2X69 A;  5C3E B;  3WDN A;  5KIX A;  4XYO A;  5KGU A;  1F9Q A;  3QIA A;  2EYP A;  1I4X A;  3C1F A;  1EY5 A;  3R93 A;  1SNC A;  1F2L A;  1FNV A;  2F0L A;  3S1R B;  3ERO A;  3S1Q B;  4K6L A;  4IUQ A;  2KEC A;  3ITP A;  1BXT A;  1SXT A;  1MSH A;  3ND8 A;  1V8Q A;  1JOO A;  4LMQ D;  2E75 C;  1BCP F;  4ZKC B;  3BDC A;  1O7Y A;  3QOJ A;  3FPU B;  4G57 A;  3RZD B;  1STA A;  1WTX A;  3T56 B;  1TU2 B;  3TDQ A;  5C44 B;  1XYI A;  1EL0 A;  4KKU A;  3V96 A;  1PFN A;  2LS0 1;  1IYU A;  3PIO 3;  3SK4 A;  3HRZ C;  5LHY 1;  4O1N A;  4BA2 I;  1PFM A;  3BG3 A;  1HHV A;  2RDF A;  3DEP A;  1LT3 D;  3T53 B;  2KUM A;  2D5D A;  2F0F A;  1HQM C;  1CQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...