5J22A

Crystal structure of staphylococcal nuclease variant delta+phs l103d at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEADVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L103D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5j22A00
1EQVA 4EQPA 3SK6A 4K2KA 3TP5A 4OL7A 5EGTA 2PQEA 1EY7A 4HMIA 4WORA 5M9OA 1STAA 4K14A 2F0HA 4QMGA 4IALA 3NQTA 1EY5A 3TP7A 4E6IA 4RKLA 5NUCA 2EY1A 3SK4A 4F7XA 4PMCA 4LAAA 4PMBA 3QOLA 2F0OA 5CV6A 4DU9A 1A3UA 2EYLA 2KHSA 4ODGA 1A2TA 2F0JA 3MXPA 3OSOA 2F0FA 5CV9A 3P75A 2F0NA 5IGEA 3D8GA 1EY9A 4B9XA 5DAUA 2QDBA 1TR5A 2O4XA 5C4HA 5KYIA 1EZ8A 1F2MA 1EY4A 2F0SA 3NK9A 3TP8A 2SNMA 3SK5A 5IIFA 1U9RA 2PZTA 5I9PA 4YIJA 1JOOA 2F3WA 4NDXA 1IHZA 2RKSA 4N9TA 4K5XA 4K6DA 4KJNA 4ZUJA 3U9OA 5ISRA 3MZ5A 1NUCA 2KQ3A 2RBMA 3MVVA 5CV7A 5IGBA 3HZXA 3H6MA 4F8MA 2F0VA 2NUCA 5C6AA 1SYCA 4S3SA 5E3FA 3SXHA 5KIXA 4HTHA 5F2DA 2EYFA 1SYBA 1KDCA 5EKLA 3ERQA 1SNMA 4HMJA 4J1MA 4ZQ3A 3OMGA 4KY7A 2F0IA 3E5SA 2PW5A 3EVQA 1A3TA 3D6CA 4KV6A 5KRUA 4I65A 1SYDA 2HQEA 2F0LA 4NP5A 4TRDA 5IGCA 3OMCA 4ID6A 3R3OA 1SYGA 1TT2A 3TMEA 2EYHA 2EYMA 3P1HA 3T16A 5CV8A 3DMUA 4RKBA 1JOQA 4EVOA 2PZUA 2F0GA 3NUCA 2EXZA 4KY5A 4NKLA 1ENCA 4KHVA 3TP6A 2F0UA 3D4WA 4ME5A 1SNDA 5C5LA 1ENAA 3QOJA 4K2LA 5E1FA 4KTAA 3BDCA 1A3VA 3DHQA 1F2YA 5IODA 3OWFA 4QF4A 3BDLA 3C1FA 1KAAA 3EJIA 2F0PA 3RUZA 1EZ6A 5I6WA 2OF1A 1STGA 2PZWA 2M00A 5IGDA 2F0MA 1JORA 3QB3A 2EYPA 1KABA 3HEJA 3EROA 1RKNA 3VA5A 4KD4A 5C3WA 5J39A 2F0WA 4K8IA 5C5MA 5C4ZA 5KGUA 3NP8A 5IOCA 4H7BA 5C3XA 2EYOA 4NMZA 5K5PA 5J22A 2F3VA 2LKVA 4DFAA 4R8NA 1F2ZA 4PNYA 2OEOA 1II3A 2ENBA 5CGKA 2F0DA 1EYAA 3PMFA 4G57A 4KJOA 4B9WA 2F0QA 3SK8A 1STYA 3SR1A 3MEHA 4KD3A 1AEXA 3V2TA 4DF7A 4ZUIA 3S9WA 2SOBA 4N9PA 2RDFA 5EKKA 4EQOA 5JOBA 5I6YA 1EYDA 2F0KA 4QB4A 1JOKA 2F0EA 4WRDA 1STBA 1SYFA 5IGFA 2SNSA 4K5VA 5HGTA 5CC4A 5KEEA 2F0TA 3D4DA 5CR3A 4K5WA 5I9OA 5HURA 2WACA 1STHA 3MHBA 3SHLA 1SNQA 2EY5A 1A2UA 1TQOA 1EY6A 1SNPA 2EY2A 5IGGA 2EYJA 5CV5A 2OXPA 2PW7A 4DGZA 1KDBA 1EY0A 1EYCA 2PYKA 3LX0A 1SNCA 1SYEA 4IZ8A 4J6HA 4IUNA 5J1ZA 1EY8A 5KYLA 4KY6A 3NXWA 4MIUA 5DEHA 3NHHA 3ITPA 1KDAA 1SNOA 2EY6A 4K8JA 5CV4A 3T13A 5JAVA 3C1EA 4EQNA 1STNA 1NSNS
chains in the Genus database with same CATH superfamily
5H1SE 2JA6H 3M4OH 3CC2A 3J81E 4IALA 2N8NA 4E6IA 4XYOA 4JI6L 4DV1L 2RHSB 4DR7Q 3FKIB 3CC4A 2SEBD 2JP1A 4A76A 2IHFA 3OTOL 5LMNL 2ATWA 3J81j 4EX5A 1MJCA 4JI1Q 3S1NB 1BVSA 3IRBA 3S1QB 4OHJA 1I6VC 2QDBA 2WB1G 3MAQA 1U4MA 1UE6A 5IP7G 1X3QA 1IHZA 3KLWA 4A3JG 1XMOL 2KQ3A 4F87A 4DAYB 4JI5Q 1QE6A 3PUZA 1S5DD 4A3CG 1QVCA 1C48A 4HAEA 1N8RC 3EQLC 2KUMA 1FL0A 1BCPF 5IT9E 2F0IA 1HNWL 1WTPA 3PIO3 1VDZA 1BXTA 4C3HG 1E2WA 5IGCA 5ELDA 4ID6A 4H0LC 3E6ZX 1VQMA 5IP7H 5DLQE 3P1HA 1TWHH 3PUWA 4A3JH 3T53B 3NUCA 1TWFB 1NR2A 4DR7L 3FRPB 1XPUA 4A3CH 3DXJC 3BDCA 1SEBD 4O2DA 4JI1L 3CMEA 1F9SA 2RVLA 1XTDA 5EBCA 4C3HH 5GQOA 3FVQA 2XN9C 3KJPA 1KQSA 3Q23A 1CK1A 1CQVA 5C3XA 2JEAI 4PNYA 5E4WC 4P72A 1BNZA 1FYCA 2BOSA 2A68D 4RWSC 1T5EA 4YWMA 1TWGB 2PCFB 4LFBQ 1G291 4PMWA 4IOAA 2HDLA 4WRDA 4HJ9A 1CSPA 4LF8Q 1DM0B 1P16A 1WCMG 3DWAA 1I4XA 3I2ZA 3K5OA 4DNIA 3FHWA 3NTHA 3J7YW 4PG3A 1EY0A 2OQKA 1LT3D 1EIHA 1EY8A 4HIOA 4KY6A 4X3SA 2K52A 1QNUA 4IURA 3M3YB 5CBAE 1WCMH 2UUCQ 2JA7B 1HHVA 4B3TQ 3CCEA 5JJZA 1STAA 1JJ2A 2J0TD 4G7ZC 4C56C 4A3EG 3PQIA 4IJLA 2BA0A 4X64Q 1HPCA 2AHOB 1B3QA 4TVAB 4JBJA 3MXPA 3OSOA 4LFBL 5IGEA 3BU2A 2HD3A 4LF8L 5DAUA 2YTYA 4DV7Q 4J8QA 3I4LA 3S14B 2B63B 3I4NB 4KJNA 4K6DA 1YI2A 1YHAA 1FNUA 4EQ5A 3GTJB 4RGNA 4A3EH 5C6AA 3J80E 1XX8A 1E22A 1ESFA 1I50B 1PH4A 3K0YA 2EYFA 2ZXPA 1X6OA 3ERQA 1X55A 4HMJA 4LF4Q 2IT1A 3K7AH 3OMGA 3RN5A 5BR8Q 4OIKA 2UUCL 4B3TL 4DXGA 3R3OA 4N8FA 2NVQH 4HJAA 2EOTA 2IHEA 3BDOA 2PZUA 2OQ0A 2QF7A 3D4WA 3IKJA 4LMQD 1Z6HA 4KTAA 5L37A 4R4OA 2UUAQ 3L2PA 3EJIA 3TZUA 3TEHB 1EL0A 4OWWB 1HUNA 4DV7L 4ZK9B 4DV4Q 2QCPX 1Q90A 4GOPA 5J39A 4WJ4A 1PXUA 5D14A 1Y1VB 3KJOA 1G8ZD 2EPBA 2HUGA 2EJMA 1R4QB 4GNXA 2RDHA 3NTKA 5E4XA 4Y7NB 1B70B 4RA8A 2F0QA 2NVYB 2XIWA 4IJHA 4A3IB 2B2UC 4LF4L 3CD6A 2A8VA 2I5MX 5BR8L 3H0GG 4JI7Q 1JOKA 1V1OA 5HGTA 2EIFA 1PFMA 3CRKC 2VS1A 1VQCA 1BOSA 1EY6A 1NJIC 2NTSA 2G5DA 2UUAL 1EYCA 1QZHA 1SYEA 3SGIA 4DXFA 3GTPH 5CMDA 3D4RA 3H0GH 5IY0A 2WIIB 4GN3B 3ZJYC 1MBYA 2VUMB 3C1EA 2N78A 3ULJA 3HG9A 4CHTB 1X3GA 2VQFQ 4JYAQ 2B3GA 1EQVA 1LTRD 3FP9A 2UXBQ 4BY7G 5EGTA 5M9OA 4BBRG 3NBIA 4IPCA 4JBKA 1PYSB 3ZYYX 2MUYA 1KIXA 1PRTD 4JC0A 1D1KA 4JI7L 3I73A 3S2DB 1Y14B 3HOUG 1U4RA 3NQIA 1EWHA 4DV5Q 1U9RA 4RMFA 1K0SA 4BY7H 3PO2G 1PRTB 1QUQB 4BBRH 4C1NK 1ILPA 1NUCA 3H6MA 2K5NA 1K8MA 3H91A 1NMGA 4UY8C 5E3FA 3CKIB 3T51B 1SNMA 3L0OA 1EQTA 4UPAA 2L55A 4ZQ3A 4KY7A 1HNXQ 1GJXA 2VQFL 4JYAL 3FPPA 3HOUH 4BBSH 4AYBG 2UXBL 2QDLA 4Q5VA 5J3BA 4A3DB 3T16A 3ERSX 1KRTA 3PO2H 3MXNA 4EVOA 3CRLC 1OXTA 3TP6A 1EWIA 2O5IC 4UP7A 1A3VA 1BO0A 2BE5D 4GS3A 3OWFA 3BDLA 1KAAA 4CJ1B 1B9MA 2L4NA 1DOKA 3LWEA 1STGA 2PZWA 4C3IB 4DV5L 5C3EB 1T5XD 1DXMA 2WV6D 1KD1C 4HSPA 1AZPA 1FVIA 1GHKA 5J22A 3GTLB 1CZGA 1O7YA 1Q8IA 1MKHA 1ASYA 1HNXL 4R4IA 4IFDI 4O0AA 3WOEA 2CHBD 2N88A 4QB4A 3TN2A 4DAMA 1QILA 3FDTA 4NPSA 1DZ1A 3MHBA 3SHLA 1TQOA 2CVRA 4QGUA 2QA4A 2EY2A 1VMCA 2MHVA 4RH6A 2DUDA 4Z9CB 3DM1A 1SNCA 3PGZA 1E2VA 1HFNA 4DUZQ 1TWCH 1D8LA 2WKCA 3ITPA 3Q8DA 4CGYB 2HCCA 1Z7TA 1TXYA 1FNWA 4NXMQ 1LUZA 2MNAA 4K2KA 1GO3E 4OL7A 1KC8C 3CQZH 1VQ9A 1EY7A 2K7VA 4CDFC 3AYHB 3UDGA 2JA5B 4RGOS 1DYQA 4I7AA 5CV6A 4JG2A 5IYBH 1NY4A 1PLFA 2AQ1B 3RLNA 4C3HB 1G2SA 1EIGA 1M1KC 4CKEA 3NBHB 3HOWG 4DK3C 4QJFA 1WTXA 1QG7A 4UP8A 2NVTH 3KF6A 2I46A 4HSVA 4CJ2C 4F8MA 3OIPA 1VQIA 4DUZL 1N33Q 3BG3A 2F4IA 3EN2A 3NE5B 1S5ED 3E5SA 3EVQA 4NXML 5ELNA 1SYDA 2Z6KA 2UXCQ 3HOWH 2F1MA 1VS0A 2EYHA 2EYMA 3BVMA 3EFXD 1ML0D 1ENAA 4ABNA 3I8ZA 1HZ9A 2R93B 3A5UA 1VF7A 2OF1A 1C4QA 1U5KA 2F0WA 3BZDB 1SFOB 2ZJQA 4A3GB 3MXGA 1JE4A 3U58A 4KKTA 4DR1Q 1EUJA 4DPGA 3M7NA 4KJOA 4OGQC 1N33L 1IL2A 4G7OC 1ONLA 1WTHA 5EQ0A 3NELA 1LT6D 5I6YA 1RIPA 2UXCL 2AKWB 3N52A 5FOBB 3Q0AA 2M9VA 2SNSA 4JBWA 5CC4A 2JN4A 2ES2A 1DOMA 2MFIA 4IPGA 5EBDA 1L0WA 2E5LQ 1IYVA 1X65A 2V4DA 3LX0A 3WWVA 2NBFA 1L1OB 2H1EA 3EA6A 1EQQA 4JV5Q 1ASZA 3S1RB 3A8IE 1I4HA 1V1PA 4DR1L 3WOFA 3STBD 2ICIA 2ZT9C 4X66Q 1Q1BA 4PMCA 4PMBA 4MHEA 1SE3A 3CU7A 1NTGA 1ZEQX 1FJGQ 2IX3A 1LM0A 3K81C 4QY7A 3NK9A 2LSSA 4A3KG 3RZOB 1I94Q 3T1HQ 1HR0W 3VYUA 4BY1G 1J6QA 3F2DA 3HS0C 3I4OA 3I91A 1L0XB 2E5LL 4X3TA 2B2TA 2UU9Q 1LTAD 1SYBA 3SEBA 4JV5L 3KBXA 2E75C 2QGQA 4HN7A 1NNXA 2I0QA 1S4ZA 4PZ7A 3HOYG 3K59A 3H3VC 2J7ZA 4A3KH 2Z8LA 3J7AF 3C3LA 4X66L 2MO0A 4BY1H 4CKBA 2EXZA 4V190 2K33A 4IPHA 1GKHA 4JI8Q 1FJGL 1NCVA 1GOZA 2L12A 4KK7A 3PSIA 3GTGB 4K0KQ 2L0CA 2K05A 1EZ6A 5I6WA 3KUPA 4PV1C 3VDYA 1I94L 3HOYH 1E7ZA 4IUTA 2JA9A 1VCIA 2CH4A 4BA2I 4NW2A 3JC66 1OXXK 3EBEA 3PO3G 1AEXA 3S2HB 4Y52H 1RJTA 4BXXG 4NB3A 2Q2TA 2XSCA 2AQ2B 2Q8RE 2YV5A 1SYFA 4FXGC 3KDFA 4A3FG 5C4XG 3S16H 5HURA 4DA2A 1X3EA 1O78A 3G6JB 3PIP3 2B8FA 4JI8L 3UI2A 5FLMG 1S5BD 2O2LD 3P20A 5CV5A 2PW7A 3U9SA 4LW1A 5GADC 4LF9Q 2A5HA 1PV4A 3PO3H 4K0KL 1PTOF 5J1ZA 4LF5Q 4C3JG 4BXXH 4IUVA 3T13A 4K8JA 1HJPA 1KAWA 3A7AB 3K5LA 5C4XH 4A3FH 2PI2A 2CCZA 3JAML 5BN5A 1QWYA 5FLMH 2F4VQ 3D31A 5EKIA 3VYTA 4FF2A 5IYCG 4A75A 4AYBB 4C3JH 1KNAA 2F0FA 5CV9A 1QCBD 3T4AC 1EFWA 1WI5A 5C4JB 2E2HB 2NYZD 3J7AV 4OO1I 2VB3X 1TR5A 1PH3A 1BKBA 1Z47A 5AJ3Q 4N9TA 1OXUA 5IGBA 5CV7A 4ZRZA 3TDQA 4LF9L 5A2QL 2R7ZB 1BR9A 3UE1A 1F9QA 4LF5L 2C5CA 3Q22A 5IYCH 2K5QA 1BCPD 5D3IB 1EEFD 4U68A 4I65A 2VZAA 4TRDA 3AFPA 4FF4A 2HHHQ 3DMUA 2MPMA 3GDEA 1JOQA 2F4VL 3S1MH 1ENCA 4CDCC 2LMCB 2NN6I 2B39A 1I6HH 4X62Q 5E7NA 3CCLA 4DR3Q 2EJFC 1UEBA 5KNDA 1YIJA 1SMYC 2PQAA 2ZJRA 3GTMB 5AJ3L 1RKNA 5C4ZA 4ZKBB 2WB1E 4UDUC 1XPOA 4FXDA 2EDGA 4R8NA 4V0BA 3GTKH 1II3A 2ENBA 4MN3A 2NWGA 1HZAA 5M5XB 1VQGA 2YU9B 4FF3A 2K14A 1TWAB 4DR2Q 3M4QA 5JOBA 2XRQD 2HCIA 2FMMA 3DLLA 4K5VA 2A69D 2N55A 2HHHL 2CW0D 1XTCD 2K04A 3PUYA 1H9SA 5ELCA 1XPRA 2FHTA 4GLAC 1S40A 4O1NA 4GLXA 4X62L 4DR3L 2G9HD 2HQLA 1I4RA 1B3AA 4DNRB 3H3VI 4OO1G 2EY6A 1JWUD 2R92B 4R4CA 1IKMA 4QIWE 1O7ZA 2EE1A 5DM73 5DNFA 4A4IA 4EQPA 1S72A 1CSQA 4WORA 4KHPQ 4ME3A 5JJIA 5NUCA 2VW9A 2JK8A 3HGBA 3I4MB 1ET6A 5JPMC 4DR2L 4XXEA 1WTVA 2ZTDA 1WTRA 2F0NA 4UHVA 5ELEA 1VQ7A 4OO1H 5LHY1 5KNCA 1EY4A 1B1ZA 4QQBX 4P75A 1CUKA 1VQJA 4LF7Q 3K80C 4MNOA 3GQBA 3MVVA 4GKKQ 4HEDA 2NN6G 2B2UA 2KCCA 1QNKA 4R9WA 4HTHA 1HR0Q 1IW7D 1KDCA 4L63B 3CCSA 2RQXA 2MP1A 1F77A 3NWTA 4KV6A 5BN3A 1MSHA 4XQNA 3S17H 1WTQA 3KYHC 2Q2HA 4DV3Q 4KHPL 2F0GA 1UE7A 1B9NA 3VA7A 5C44G 1VQBA 2A68C 2F0UA 2NN6H 3HOZG 1MIUA 1SNDA 2K75A 1I4GA 2X6GA 3F2CA 4H44C 4PZ8A 3UDFA 1YNJC 1SDFA 3TRZA 1L0YB 5GROA 5FLXc 4JCVE 4L8JA 3BJUA 1A8VA 4LF7L 1V43A 4K8IA 4GKJQ 3NP8A 4LUVA 1SRUA 4GKKL 1CKNA 2K6AA 2CQAA 4NMZA 5K5PA 4B3SQ 5C44H 3HOXB 1H9KA 3HOZH 2Z4IA 1SJED 1JJCB 2RSOA 1HR0L 3I70A 3PMFA 1N32Q 2WP8J 3KF8A 3W1GA 4RFBA 4DF7A 4A3MB 3S24A 1KNEA 3E9IA 1PVOA 1U4LA 4DV3L 1UNSA 1R9TH 1VQ8A 5IGFA 2FJ2A 5G3LD 1HA6A 4XIGS 3U50C 3W5OA 1PYWD 2XRSD 2WACA 2RDGA 4ZCKA 2I5LX 2E76C 1IKLA 4IN3A 5IWAQ 2MO1A 2K32A 2PYKA 1GUSA 5HY6A 4IZ8A 3PIPA 4G4KA 1N36Q 1STEA 2IWHA 3H3VH 4A3KB 4C2MB 1KL9A 5ELBA 4I7ZC 2KVMA 4M8AA 4GKJL 1NSNS 4A93B 4B3SL 3L7ZC 1RD9D 2PQEA 2RF4A 2I5HA 4K14A 1K83B 2F0HA 1JE5A 4CBVA 1BQQT 1CA5A 1N32L 5G3LF 2LY7A 4F7XA 1M8AA 3QOLA 3DWPA 1A2TA 1PDQA 2A6ED 2L5TA 3N6RA 4PQXA 2KBNA 3RR5A 5KYIA 3OHXC 2P5ZX 1PHJA 1AE2A 2IPKD 1PH7A 3U9OA 1I3QB 5EPKA 3UDXA 3TSSA 2RBMA 5IWAL 4XTCS 1PZKD 4KLKA 3OOCA 4RAUC 1IZ6A 1CTMA 3TS0A 1JR0D 5KIXA 3VYSA 1N36L 3U4ZA 4KKSA 1M4VA 3HKZG 3I3CA 4J1MA 2PO4A 5JEAG 1O7LA 3S16B 2E2JH 1PZID 2F0LA 1TT2A 3TMEA 4GOPB 4DAPA 1YNNC 5IP9G 4BBSG 4KY5A 5JVG3 4GNXB 1LV9A 1PTOH 2WAQG 1GHJA 3GTQH 1DCZA 3ND9A 5M3MG 1SE4A 4UP9A 2E2IH 2B2VC 2DN8A 3RUZA 3HOVG 1V9PA 5JEAH 3QWNA 1WJJA 1PH6A 1B4OA 1TS2A 2ID0A 3RZDH 4DR4Q 5IOCA 2Y0SG 5IP9H 2BDNA 2LKVA 3NENA 1PH2A 1PFNA 2B29A 2GVBA 1STYA 2RCNA 4KD3A 1HFGA 4DK0A 1GUGA 5M3MH 2AUJD 3HOVH 1U0LA 2BA1A 1BF4A 3AEVA 3CPFA 4DKAC 2L11A 2F0KA 5M5WH 2F0EA 3JAME 2Z0SA 5K36G 5M5YB 1HQRD 4K5WA 1BDOA 2JA6B 4WJ3M 3M4OB 4AYBE 4OWTB 1AFPA 2RA4A 1PRTC 3J81c 1EIFA 1MI2A 3CPWA 3GTOH 4M1UB 1UEAB 2CH4W 1ICWA 2A19A 4DN4M 2QEXA 3QO2A 3J81i 1GD7A 2R61A 3R8BA 3E9HA 3S1MB 4EGVA 4DR4L 5K36H 1SN8A 5JJLA 3MA2B 3A55A 5A2QE 3TREA 1J8IA 1EYGA 1PH8A 2L15A 4QMGA 1ZYRC 4RKLA 1I6HB 5M3FG 4LK1C 2EY1A 1XXGA 2QW7A 4ODGA 1A62A 1JCKB 3VR3A 1XYIA 4JI0Q 2O4XA 5IYBG 2WB1B 4DV2Q 1LO5D 1SBBB 3R2IA 5IT9c 2D0OA 2XWJB 1TWHB 3MXNB 4A3JB 2AMCB 2JSOA 1XWEA 2BE5C 3F1ZA 5M3FH 2XWBB 3W3AA 2KOLA 3GO5A 2NUCA 4RCNA 1NMFA 3H15A 5T1IA 3S1NH 1AP0A 4JI3Q 3MFGA 3S1QH 1FNVA 2LXKA 1UE1A 5FK9C 4DR6Q 3QIAA 1CI3M 3AB9A 1RHPA 2K5WA 1YBYA 3A56A 1V1QA 3D0FA 1RODA 3CCRA 3MTSA 1VQ4A 5DM63 3DHQA 5JEAJ 3NPPA 5IODA 4YY3Q 5EPLA 1Q1EA 4JI0L 2F0PA 4QIWB 1LTBD 1SE8A 4OX9Q 3K8AA 5IGDA 1C7YA 2LFNA 4DV2L 2KECA 1KABA 1SXTA 1LTSD 1Q12A 3QR8A 3CF5A 3L9AX 1K8AC 1TWFH 1C9OA 1WFQA 1HTPA 5FJ8G 1F2ZA 4RGMA 3SK8A 4JI3L 3I90A 3V2TA 2X69A 4HIKA 4DR6L 1CZWA 3ULPA 1STBA 4H13C 4IFDG 5LL6X 1WVLA 3P7JA 1RTOA 1WCMB 5I9OA 2JA8G 1SLJA 4IQZA 5FJ8H 3M4YA 2Z4HA 5IGGA 1IYJB 2KJXA 4YY3L 3OYYA 4PZ6A 4P74A 1PA6A 2L1BA 1KDBA 2IY5B 4OX9L 1TWGH 5KYLA 5I2YA 1TS5A 4OONA 2EVBA 4FP5D 2UXDL 4IFDH 2JA7G 1I4PA 2JA8H 3J7A5 3CW2C 1CQFA 3TP7A 3KF6B 3SK4A 4A3EB 1GUOA 1SAPA 4ZLTF 3BZCA 1PMRA 3T56B 1WD0A 3D8GA 1EY9A 3K7AB 4HR7B 3M3YH 1HZCA 3BVGA 1HTLD 2F0SA 2Z9HA 2ZTCA 2B63G 1N34Q 2JA7H 2ZXOA 2FMCA 4LUOA 3I4NG 1YEZA 3KBGA 2BCOA 5ISRA 2NVQB 2RHQB 1AE3A 3IL8A 3J80i 1DGSA 3HZXA 1Y8PB 2BH2A 3I56A 3FPUB 1CM9A 5EKLA 4IUUA 2IX1A 2MGSA 3TQYA 3X3MA 1HNZQ 3D6CA 2VY3A 5KRUA 4DR5Q 3S14H 1GUNA 2B63H 1F9RA 3I4NH 3F2BA 3D3RA 2XTIA 4RKBA 3GTJH 2DGYA 4YCVA 2KEEA 1I50H 3QOJA 1G51A 2KCMA 4A3BG 3C1FA 4HCSA 4NXNQ 2AWNA 2MQHA 5CYUA 1L1OC 3B6YA 1N34L 2B2WC 1RDPD 4FXKC 1RL2A 1Y1VG 1E3PA 2VB2X 1XNRQ 3T1YQ 3G4SA 4JW0A 4X6AH 4A3BH 4A3IG 1SMXA 4LNQA 1A15A 4L5QA 1TVXA 5BN4A 1HNZL 2Z1CA 4YHHQ 4N9PA 4EQOA 3GTPB 4GZYC 2EQSA 5C0XI 4DR5L 3H0GB 4JI4L 3AQQA 2BH8A 5KEEA 1RTNA 1V1PB 1Y1VH 1STHA 3GV6A 1XNQQ 2ZJPA 1K73C 5EAYA 1Q7YC 1N9WA 1NAPA 2NVYH 3TBIB 4DGZA 4A3IH 1PTOD 4NXNL 1X54A 2NVXH 1CKMA 1A0IA 4IFDJ 4O42A 2VUMG 4DAVA 1JWSD 2CFMA 3CP0A 1VMPA 1D1IA 3I72A 1VF5C 1T9HA 2EXDA 4BY7B 4JI2Q 1YHQA 4FNFA 4BBRB 4AIMA 3T1YL 1XNRL 3OW2A 4IPDA 3M4PA 2QILA 1M90C 3SDZA 3I7FA 4YHHL 2F0JA 2JXMB 2YTXA 2VUMH 1D5XC 1CFMA 2IL8A 1I4QA 2A6HD 3HOUB 4BBSB 3NTIA 1K3RA 3TP8A 4DV0L 1KHIA 4P2CB 4NDXA 1XNQL 2WAQB 4ZUJA 3UE0A 4HJ7A 3PO2B 2PNHA 1JQYD 1C0AA 1TIID 2A74C 1GUWA 1SYCA 5JJKA 1C8CA 5F2DA 4L6TB 1YITA 1Q82C 4DK1A 3S2DH 1CT1D 3BZKA 1A3TA 3MEFA 1E24A 3AFQA 1K8OA 3ICEA 4A3DG 1SYGA 2KHJA 4JI2L 3OPOA 3V96A 3TS2A 4DAYA 3LGJA 3RN2A 1JT8A 5C5LA 3JAMi 1HA5A 5IE8A 4DUYQ 2ASBA 1Q86C 4QF4A 1LABA 1DONA 1PFBA 3HKSA 5C0XG 4C3IG 1BBXC 1Q46A 2F0MA 1EU3A 3IAYA 5C3EG 3HEJA 2C35B 3DEOA 1CHQD 4A3DH 5LMUQ 3CCUA 5FO7B 1S3OA 4L5RC 4DK6C 2F0DA 4DV6Q 5GAEC 1ET9A 4CJ0B 4RHSA 1K9MC 1BCPB 1X3PA 3NSWA 4XDXA 1VQ5A 1Y1WG 2RDFA 4C3IH 5C0XH 3TZDA 1TWCB 1OXVA 5C3EH 3KK7A 3GD7A 4ZAIA 4JBMA 5M3FB 4XYQA 4HIMA 3M9BA 3CQZB 4AH6A 3GTLH 2WKDA 2C9OA 2EYJA 4DUYL 3VR2A 2F3IA 5JVH3 4POFA 3DUZA 4FVMA 1X32A 3CXCA 4JOIC 4RGTA 4APVA 1Y1WH 2D0PA 2N49A 1O80A 5CV4A 1O7IA 1AW7A 5M5YH 1EOVA 2GVAA 1ILQA 5LMUL 4JVZA 3RMHA 4GLVB 3TP5A 2KENA 2K5VA 3AU7A 4HMIA 1IL8A 4WFN3 3NQTA 4DV6L 2JA5G 4FYDA 3M7GA 2PMZE 2HIVA 2NVTB 1IBKQ 1MJEA 4CDDC 1BCPC 4DU9A 1A3UA 2EYLA 2LS01 1HCZA 4F88A 4MZ9A 4P71A 4HIDA 1IYUA 3VR6A 1WTOA 1WYDA 4B9XA 1P8LA 1F2MA 2B2YC 2IW3A 3HOWB 3HP3A 4TKOB 4YIJA 3A7LA 3E0EA 1HXYD 2JA5H 2K03A 2DY8A 1TY0A 4OWXB 1QVGA 3DEPA 2IX0A 4R4TA 2PPBC 4JI5L 3QG1A 1EFID 2PQAB 4NP5A 1TU2B 2K1BA 4OXPA 5D65A 4N8X1 2A73B 5CV8A 4ILWA 1IBKL 1BUVT 1NBWA 1RF2D 1D5ZC 3KLRA 2R93G 3SVMA 3BYTB 1YNJD 1F9PA 2A69C 4BA1I 2CW0C 1ZXTA 1E1TA 3A54A 2JA8B 1I5FA 2EYPA 1SE2A 2Q8IB 1D5MC 4A3GG 1KXLA 1HUMA 1MD2D 1H9SB 4H7BA 4GN4B 2EYOA 1FGBD 4KN7C 2ALYB 1VQPA 1HZBA 2OEOA 3KLSX 4HCEA 5A35A 4B9WA 5C0XJ 2LXJA 2R93H 4X3KA 1PH1A 1LTTD 2Q8TA 1K28A 1IBMQ 1X3FA 5FO8B 4ULLA 2SOBA 3S9WA 5EKKA 1MSGA 3PCOB 3RD4A 1FR3A 3RLOA 3D4DA 1A63A 1SFOH 4A3GH 2B8GA 4GN5A 3AMUA 1SJHD 2XNAC 3A5ZB 2EY5A 1A2UA 1YZ6A 2X6LA 4QL5A 1W2BA 1R4PB 4J6HA 4FDBA 3RNUA 5DEHA 3NXWA 5FLXL 2OTJA 3SK6A 2AUKA 1DD2A 3K7UC 1MHWC 1G2TA 4H02A 1EY5A 3CCJA 3G6EA 4L5TA 2VNUD 1IW7C 1KLGD 2PNRC 1QOHA 1Y8OB 2F0OA 1W6JA 2B2VA 1G6ZA 1IBML 1PYBA 4YCWA 1YNXA 2CWAA 1XJVA 3S1RH 1ICFB 1VQKA 3SK5A 1EOTA 2D9UA 5I9PA 2D62A 3OWEB 4X64L 3S15H 2XVSA 3M85A 4A3BB 1GM5A 3LWUA 1BBUA 3DM3A 4BY1B 3J7ZC 4S3SA 3R2TA 1DOLA 3PUXA 4R1JA 3SXHA 2GN5A 2RSNA 3O13A 2VXWA 4OELB 2FFKB 3W2DA 2HDMA 5I2XA 1K3BC 1YVCA 2XGTA 4KMUC 2EZVA 3RZOH 3HOYB 2JQOA 1G6PA 1YNND 1QUQA 2QKIC 4UAIA 1CKNB 3MWYW 3URYA 1Q81C 4NKLA 2NZOA 4KHVA 2NVXB 2H5XA 1OXSC 4K2LA 5E1FA 4R8IA 2F03A 3K58A 2OTLA 3KF8B 1DJRD 1JWMD 2ZTEA 3C46A 5IYDG 4RG1A 2Q2IA 1OTCA 4POGA 1JC7A 1Y8NB 3OW7A 1F2LA 5C5MA 5KGUA 2JEBI 1B50A 1Q3LA 4CDEC 3K5MA 5CGKA 1B44D 4DV4L 4IO9A 4MTKA 3GTGH 2DNCA 3MEHA 3PO3B 4B08A 1D7QA 1VQHA 4ZUIA 1LT5D 5IYDH 2NZ1D 3CCVA 3IFTA 3HKZE 1U4PA 3K6OA 2IJ0A 2K4KA 4A3FB 5C4XB 2AQ3B 4RCOA 1AH9A 1FGUA 3Q6SA 1X9NA 2A6EC 1QB5D 2SDFA 3S2HH 1XMQQ 2WAQE 1LYLA 4B3RQ 4C3JB 1Y69U 5JAVA 1SNOA 4G7HC 1YJWA 3H09A 1J5EQ 3I55A 5LL6S 1EIYB 1STNA 4ALPA 2ZXRA 2OCEA 3G48A 2E2DC 1ZYRD 4GOPC 2E8GA 1H9JA 5KNBA 2KCTA 2Y0SE 4LAAA 1UUPA 1H95A 2KHIA 4KHZA 4GNXC 2O5JC 1PRTF 4X65Q 2KA7A 1EU4A 2A1AA 4HJ8A 1LLRD 3PIOA 4XQQA 2SNMA 3NEMA 2PZTA 2K5DA 2RKSA 1B53A 3CHBD 1TS3A 2R7ZG 2F0VA 5AFWA 3J81L 1XMQL 2H4OA 4IOCA 1D2BA 3SE0A 1HQMC 4B3RL 2RCFA 4KKUA 2KCNA 2ICEC 2K5HA 3FKIG 5C4JH 1J5EL 2E2HH 1UAPA 1VQ6A 2PW5A 1K0RA 3G71A 2I07B 3NBHA 2OWOA 1HRJA 3OMCA 2FINB 2Z6BA 2HT1A 3G7LA 1VQDA 2R7ZH 3CMAA 5I4DA 3PF4A 3CAMA 3GTKB 1BBWA 3BVZA 3VYRA 1Y1WB 2N3SA 4X65L 1PZJD 1WTWA 3ULLA 2PI2E 3FKIH 4J15A 2M00A 3PF5A 3NWSA 3QB3A 3E0JA 1JICA 3MXUA 5IT9L 3FMCA 2DJGC 5FO9B 3GP7A 2K50A 2PMZB 4CKCA 1S5CD 5D3DA 2F3VA 4DFAA 5LMNW 4Q0FA 3C2PA 3V05A 4K6LA 4RHRA 4BWGB 3UDIA 4AQYQ 3CCQA 4DNTB 3A0JA 2R3ZA 2VQEQ 1YHBA 3GTMH 1QJOA 2HIXA 3CCMA 1RCVD 5CR3A 3LNNA 3HRZC 2EJGC 5CBEE 1SNQA 2G9DA 5M5XH 1FD7D 2KEDA 2YU9H 2UXDQ 1NE3A 1JB7A 1SR3A 1QZGA 1TWAH 4IUNA 1S5FD 4MIUA 3K57A 1KDAA 2R92G 2VL6A 1GVPA 2D2CC 3DWQA 4OIJA 3R93A 1IBLQ 4QCLA 3WDNA 1PH9A 3I4MG 2OT2A 1HH2P 1IXRA 3IFDA 4AQYL 2KHSA 2UUBQ 4TQUS 1W6KA 2VQEL 1L1OA 2B2WA 1H9MA 1VQLA 3OIQA 2YYZA 2R92H 4YCUA 3KOJA 3A8KE 1EZ8A 3F2UA 3S17B 1JOOA 1L2FA 5T1GA 4K5XA 3MZ5A 4LFCQ 3I4MH 4FO2A 5EJWA 4R4QA 2NTTA 3KLSA 5CORA 1YJNA 1WOCA 4LF6Q 1G91A 4QUCA 3D6WA 2R7FA 1IBLL 1WD1A 3EIVA 4A3LG 3J80c 3K0XA 1CA6A 5C44B 1VQOA 2UUBL 3HOZB 5COYA 3L3OC 1LT4D 3QJYA 4P73A 4LJZC 3J80L 1EWCA 1JORA 1PFSA 3EROA 1R9TB 3VA5A 3E3XA 4IUPA 4A3LH 5C3WA 4LFCL 1TS4A 1E0BA 1E2ZA 3HOXG 4C1NI 3X3NA 2V1CC 4JI4Q 5TSSA 1EYAA 3ND8A 1PH5A 1TY2A 1AZQA 3MFYA 1LACA 5FLXE 4A3MG 4LF6L 2CWPA 4ZYSA 4XT1B 2ZM6Q 1VQFA 3ER0A 1Z9FA 3S15B 4WJWA 2F52A 1B8AA 2F0TA 3U4VA 4BS9A 4QUFA 4FF1A 1J9OA 2Z6KC 2DNEA 3HOXH 2FXQA 1SNPA 2DJFC 1QVFA 4TSSA 1V8QA 4A3MH 5GAHC 2JJQA 1VQAA 4EQNA 4A93G 2WFWA 4MTNA 1VQNA 2AWOA 4OEMB 1YJ9A 3KFUA 2L9HA 5JPNC 4LFAQ 3STBC 3W1BA 3GV3A 5FKAC 4DV0Q 4KN4C 1KRSA 1ESRA 2R6GA 2J4XA 1GXDC 1SSOA 2ZM6L 1UWVA 4Y7NH 3BS1A 2E74C 1CKOA 2YTVA 3P75A 3BYYB 4C2MH 4LUZA 5C4HA 4A93H 3A74A 5ELOA 3RLFA 4B3MQ 5IIFA 2E2JB 2BDOA 2F3WA 1K83H 4XQJA 2Q2UA 1H9RA 2D5DA 1ZKOA 3MC0B 1PTOB 3GTQB 3ONAB 3H94A 4LWCA 3T1HL 3K5NA 3HKZB 4YWKA 2E2IB 1NR4A 1W3SA 1AN8A 2HQEA 3HFZB 3FEWX 2DY7A 1D6EC 2UU9L 1I3QH 1UE5A 3RZDB 4LFAL 4ZKCB 5ELFA 4ME5A 1X56A 1EEID 4JOIA 3PUVA 5GAGC 1GUTA 1F2YA 3CC7A 1JMCA 4L5SA 2NB0A 5M3MB 2NZHA 3HOVB 4U673 4B3ML 5M5WB 1JB3A 1JJGA 1TKWB 4KD4A 3VR5A 1KLUD 2Y0SB 1SROA 1B7YB 2CKZB 2M2LA 3JAMc 1B2TA 1PTOC 1ENFA 1A6XA 4G57A 1E1OA 4JI6Q 2TSSA 4YWLA 3SR1A 2WINB 4DV1Q 2TMPA 5EPJA 3GTOB 4JPBW 1K8GA 3F8TA 2MJ8A 2B2TC 3PV0A 3OTOQ 2B2YA 2K01A 5LMNQ 1EYDA 2R7DA 4X3UA 2JYOA 2K28A 2CQOA 2JA6G 1SMYD 4HJ5A 4JK1C 1XMOQ 4XT3B 1LTLA 3KDFB 2GA4B 3Q24A 1OO9B 3A8JE 2OXPA 1LTID 1CHPD 1KTKA 4KI0A 1VQEA 1Q8KA 1LTGD 4IUQA 2A6HC 2JE6I 3NHHA 2QEJC 1EQRA 5HGQA 1HNWQ 1MGSA 3VR4A
chains in the Genus database with same CATH topology
3J81E 4IALA 4E6IA 4XYOA 3FKIB 2SEBD 2JP1A 3S1NB 3S1QB 4OHJA 1I6VC 2QDBA 3MAQA 1U4MA 1X3QA 1IHZA 2KQ3A 4F87A 1QE6A 3PUZA 1S5DD 1C48A 4HAEA 3EQLC 2KUMA 1BCPF 5IT9E 2F0IA 1WTPA 3PIO3 1VDZA 1BXTA 4C3HG 1E2WA 5IGCA 5ELDA 4ID6A 4H0LC 3E6ZX 3P1HA 3PUWA 3T53B 3NUCA 1TWFB 1NR2A 3FRPB 3DXJC 3BDCA 1SEBD 1F9SA 2RVLA 5EBCA 3FVQA 2XN9C 3Q23A 1CK1A 1CQVA 5C3XA 2JEAI 4PNYA 5E4WC 1BNZA 1FYCA 2BOSA 2A68D 4RWSC 1T5EA 1TWGB 2PCFB 1G291 4PMWA 2HDLA 4WRDA 1DM0B 3DWAA 1I4XA 3K5OA 3NTHA 3J7YW 1EY0A 1LT3D 1EIHA 1EY8A 4KY6A 4X3SA 1QNUA 4IURA 3M3YB 5CBAE 2JA7B 1HHVA 5JJZA 1STAA 2J0TD 4G7ZC 4C56C 2BA0A 1HPCA 3MXPA 3OSOA 5IGEA 5DAUA 4J8QA 3I4LA 3S14B 2B63B 3I4NB 4KJNA 4K6DA 1FNUA 3GTJB 4RGNA 5C6AA 3J80E 1XX8A 1ESFA 1I50B 3K0YA 2EYFA 2ZXPA 3ERQA 4HMJA 2IT1A 3OMGA 4OIKA 4DXGA 3R3OA 2EOTA 3BDOA 2PZUA 2QF7A 3D4WA 3IKJA 4LMQD 1Z6HA 4KTAA 3EJIA 3TZUA 1EL0A 1HUNA 4ZK9B 2QCPX 1Q90A 5J39A 1PXUA 5D14A 1Y1VB 1G8ZD 2EPBA 2HUGA 2EJMA 1R4QB 2RDHA 3NTKA 5E4XA 4Y7NB 4RA8A 2F0QA 2NVYB 2XIWA 4A3IB 2B2UC 1JOKA 1V1OA 5HGTA 1PFMA 3CRKC 1BOSA 1EY6A 2NTSA 1EYCA 1SYEA 4DXFA 5CMDA 3D4RA 2WIIB 1MBYA 2VUMB 3C1EA 3HG9A 4CHTB 1EQVA 1LTRD 5EGTA 5M9OA 3NBIA 3ZYYX 2MUYA 1PRTD 1D1KA 3I73A 3S2DB 1U4RA 3NQIA 1EWHA 1U9RA 1PRTB 4C1NK 1ILPA 1NUCA 3H6MA 1K8MA 3H91A 5E3FA 3CKIB 3T51B 1SNMA 1EQTA 2L55A 4ZQ3A 4KY7A 1GJXA 3FPPA 4Q5VA 4A3DB 3T16A 3MXNA 4EVOA 3CRLC 1OXTA 3TP6A 2O5IC 1A3VA 1BO0A 2BE5D 3OWFA 3BDLA 1KAAA 4CJ1B 1B9MA 2L4NA 1DOKA 3LWEA 1STGA 2PZWA 4C3IB 5C3EB 1T5XD 1DXMA 2WV6D 4HSPA 1AZPA 1GHKA 5J22A 3GTLB 1CZGA 1O7YA 1Q8IA 4IFDI 3WOEA 2CHBD 2N88A 4QB4A 3TN2A 1QILA 3FDTA 1DZ1A 3MHBA 3SHLA 1TQOA 2CVRA 2EY2A 1VMCA 2MHVA 4RH6A 4Z9CB 3DM1A 1SNCA 1E2VA 1HFNA 2WKCA 3ITPA 4CGYB 2HCCA 1Z7TA 1FNWA 4K2KA 4OL7A 1EY7A 2K7VA 2JA5B 4RGOS 1DYQA 5CV6A 1PLFA 2AQ1B 4C3HB 1G2SA 1EIGA 4CKEA 1WTXA 1QG7A 2I46A 4HSVA 4CJ2C 4F8MA 3OIPA 3BG3A 2F4IA 3NE5B 1S5ED 3E5SA 3EVQA 1SYDA 2F1MA 2EYHA 2EYMA 3BVMA 3EFXD 1ML0D 1ENAA 4ABNA 3I8ZA 2R93B 1VF7A 2OF1A 1C4QA 2F0WA 3BZDB 1SFOB 4A3GB 3MXGA 1JE4A 4KKTA 3M7NA 4KJOA 4OGQC 4G7OC 1ONLA 5EQ0A 1LT6D 5I6YA 3N52A 5FOBB 3Q0AA 2M9VA 2SNSA 4JBWA 5CC4A 1DOMA 5EBDA 1IYVA 2V4DA 3LX0A 2NBFA 2H1EA 3EA6A 3S1RB 3A8IE 1I4HA 1V1PA 3WOFA 2ICIA 2ZT9C 1Q1BA 4PMCA 4PMBA 4MHEA 1SE3A 3CU7A 1ZEQX 2IX3A 3NK9A 3RZOB 3VYUA 3HS0C 3I91A 1L0XB 4X3TA 2B2TA 1LTAD 1SYBA 3SEBA 3KBXA 2E75C 4HN7A 1S4ZA 3K59A 3H3VC 2J7ZA 2Z8LA 3J7AF 3C3LA 4CKBA 2EXZA 4V190 2K33A 1NCVA 1GOZA 2L12A 4KK7A 3GTGB 2L0CA 2K05A 1EZ6A 5I6WA 3KUPA 4PV1C 4IUTA 1VCIA 4BA2I 4NW2A 1OXXK 1AEXA 3S2HB 1RJTA 2XSCA 2AQ2B 2Q8RE 1SYFA 4FXGC 5HURA 4DA2A 1O78A 3G6JB 3PIP3 2B8FA 3UI2A 1S5BD 2O2LD 3P20A 5CV5A 2PW7A 3U9SA 2A5HA 1PTOF 5J1ZA 4C3JG 4IUVA 3T13A 4K8JA 3A7AB 3K5LA 3JAML 5BN5A 1QWYA 3D31A 5EKIA 3VYTA 4FF2A 4AYBB 1KNAA 2F0FA 5CV9A 1QCBD 3T4AC 5C4JB 2E2HB 2NYZD 3J7AV 4OO1I 2VB3X 1TR5A 1Z47A 4N9TA 1OXUA 5IGBA 5CV7A 4ZRZA 3TDQA 5A2QL 2R7ZB 1BR9A 1F9QA 2C5CA 3Q22A 2K5QA 1BCPD 5D3IB 1EEFD 4U68A 4I65A 4TRDA 4FF4A 3DMUA 2MPMA 1JOQA 1ENCA 2LMCB 2NN6I 2B39A 2EJFC 5KNDA 1SMYC 3GTMB 1RKNA 5C4ZA 4ZKBB 4UDUC 4FXDA 2EDGA 4R8NA 4V0BA 1II3A 2ENBA 4MN3A 2NWGA 5M5XB 2YU9B 4FF3A 1TWAB 5JOBA 2XRQD 2HCIA 2FMMA 4K5VA 2A69D 2N55A 2CW0D 1XTCD 2K04A 3PUYA 1H9SA 5ELCA 2FHTA 4O1NA 2G9HD 1I4RA 1B3AA 4DNRB 4OO1G 2EY6A 1JWUD 2R92B 1IKMA 1O7ZA 2EE1A 5DM73 5DNFA 4EQPA 4WORA 5NUCA 3HGBA 3I4MB 1ET6A 5JPMC 4XXEA 1WTVA 1WTRA 2F0NA 5ELEA 4OO1H 5LHY1 5KNCA 1EY4A 1B1ZA 3GQBA 3MVVA 4HEDA 2NN6G 2B2UA 2KCCA 1QNKA 4R9WA 4HTHA 1IW7D 1KDCA 4L63B 2RQXA 2MP1A 1F77A 3NWTA 4KV6A 5BN3A 1MSHA 4XQNA 1WTQA 2F0GA 3VA7A 1B9NA 2A68C 2F0UA 2NN6H 1SNDA 1I4GA 2X6GA 4H44C 1YNJC 1SDFA 1L0YB 4L8JA 1V43A 4K8IA 3NP8A 2K6AA 2CQAA 4NMZA 5K5PA 3HOXB 1H9KA 2Z4IA 1SJED 2RSOA 3I70A 3PMFA 2WP8J 3KF8A 4RFBA 4DF7A 4A3MB 1KNEA 1U4LA 1UNSA 5IGFA 2FJ2A 5G3LD 1HA6A 4XIGS 1PYWD 2XRSD 2WACA 2RDGA 2E76C 1IKLA 4IN3A 2K32A 2PYKA 1GUSA 4IZ8A 4G4KA 1STEA 2IWHA 4A3KB 4C2MB 5ELBA 4I7ZC 2KVMA 4M8AA 4A93B 1NSNS 3L7ZC 1RD9D 2PQEA 4K14A 1K83B 2F0HA 4CBVA 1CA5A 1BQQT 5G3LF 2LY7A 4F7XA 1M8AA 3QOLA 3DWPA 1A2TA 1PDQA 2A6ED 2L5TA 3N6RA 4PQXA 5KYIA 3OHXC 2IPKD 3U9OA 1I3QB 5EPKA 3TSSA 2RBMA 4XTCS 1PZKD 3OOCA 4RAUC 1CTMA 1JR0D 5KIXA 3VYSA 4KKSA 1M4VA 3I3CA 4J1MA 2PO4A 5JEAG 1O7LA 3S16B 1PZID 2F0LA 1TT2A 3TMEA 4DAPA 1YNNC 4KY5A 5JVG3 1LV9A 1PTOH 1GHJA 1DCZA 3ND9A 1SE4A 2B2VC 2DN8A 3RUZA 5JEAH 3QWNA 1B4OA 1TS2A 2ID0A 5IOCA 2BDNA 2LKVA 1PFNA 1STYA 4KD3A 4DK0A 1HFGA 1GUGA 2AUJD 2BA1A 1BF4A 2L11A 2F0KA 2F0EA 3JAME 5K36G 5M5YB 1HQRD 4K5WA 1BDOA 2JA6B 3M4OB 1AFPA 2RA4A 1PRTC 1MI2A 4M1UB 1UEAB 1ICWA 4DN4M 3QO2A 2R61A 3R8BA 5K36H 3S1MB 4EGVA 3MA2B 3A55A 5A2QE 1J8IA 4QMGA 1ZYRC 4RKLA 1I6HB 4LK1C 2EY1A 1XXGA 4ODGA 1JCKB 3VR3A 1XYIA 2O4XA 2WB1B 1LO5D 1SBBB 3R2IA 2XWJB 1TWHB 4A3JB 2JSOA 1XWEA 2BE5C 2XWBB 3W3AA 2KOLA 3GO5A 2NUCA 4RCNA 5T1IA 1AP0A 3MFGA 1FNVA 5FK9C 3QIAA 1CI3M 3AB9A 1RHPA 2K5WA 3A56A 1RODA 3MTSA 5DM63 3DHQA 5JEAJ 3NPPA 5IODA 5EPLA 1Q1EA 2F0PA 4QIWB 1LTBD 5IGDA 2LFNA 2KECA 1KABA 1SXTA 1LTSD 1Q12A 3L9AX 1HTPA 1F2ZA 4RGMA 3SK8A 3I90A 3V2TA 2X69A 1CZWA 1STBA 4H13C 4IFDG 5LL6X 1WVLA 3P7JA 1RTOA 1WCMB 5I9OA 4IQZA 3M4YA 2Z4HA 5IGGA 2KJXA 2L1BA 1KDBA 5KYLA 5I2YA 1TS5A 2EVBA 4FP5D 4IFDH 1I4PA 1CQFA 3TP7A 3SK4A 4A3EB 1GUOA 1SAPA 4ZLTF 1PMRA 3T56B 1WD0A 3D8GA 1EY9A 3K7AB 4HR7B 3BVGA 1HTLD 2F0SA 2ZXOA 2FMCA 5ISRA 3KBGA 2BCOA 2NVQB 3IL8A 3HZXA 1Y8PB 3FPUB 1CM9A 5EKLA 4IUUA 2IX1A 2MGSA 3X3MA 3D6CA 5KRUA 1GUNA 1F9RA 3D3RA 4RKBA 2KEEA 3QOJA 3C1FA 4HCSA 2AWNA 5CYUA 2B2WC 1RDPD 4FXKC 2VB2X 1A15A 1TVXA 5BN4A 3GTPB 2Z1CA 4GZYC 4N9PA 4EQOA 5C0XI 3H0GB 5KEEA 1RTNA 1V1PB 1STHA 3GV6A 1NAPA 3TBIB 4DGZA 1PTOD 4IFDJ 4O42A 4DAVA 1JWSD 1VMPA 1D1IA 3I72A 1VF5C 4BY7B 4FNFA 4BBRB 2QILA 3SDZA 2F0JA 2JXMB 1D5XC 1CFMA 2IL8A 1I4QA 2A6HD 3HOUB 4BBSB 3NTIA 3TP8A 4P2CB 4NDXA 2WAQB 4ZUJA 3PO2B 1JQYD 1TIID 2A74C 1GUWA 1SYCA 1C8CA 5F2DA 4L6TB 4DK1A 1CT1D 1A3TA 1K8OA 1SYGA 3OPOA 3V96A 4DAYA 5C5LA 1HA5A 4QF4A 1LABA 1DONA 1PFBA 5C0XG 4C3IG 1BBXC 2F0MA 1EU3A 3IAYA 3HEJA 3DEOA 1CHQD 5FO7B 2F0DA 1ET9A 4CJ0B 4RHSA 1BCPB 1X3PA 3NSWA 4XDXA 2RDFA 5C0XH 3TZDA 1TWCB 1OXVA 3KK7A 3GD7A 4ZAIA 5M3FB 4XYQA 3CQZB 2WKDA 2C9OA 2EYJA 3VR2A 5JVH3 3DUZA 4FVMA 1X32A 4RGTA 1O80A 5CV4A 1AW7A 1ILQA 3RMHA 3TP5A 3AU7A 4HMIA 1IL8A 4WFN3 3NQTA 4FYDA 2NVTB 3M7GA 1BCPC 4DU9A 1A3UA 2EYLA 2LS01 1HCZA 4F88A 1IYUA 3VR6A 1WTOA 4B9XA 1F2MA 2B2YC 2IW3A 3HOWB 3HP3A 4TKOB 4YIJA 3A7LA 1HXYD 2K03A 2DY8A 1TY0A 3DEPA 2IX0A 2PPBC 3QG1A 1EFID 4NP5A 1TU2B 2K1BA 5D65A 2A73B 5CV8A 4ILWA 1BUVT 1RF2D 1D5ZC 3KLRA 3SVMA 3BYTB 1YNJD 1F9PA 2A69C 4BA1I 2CW0C 1ZXTA 3A54A 2JA8B 2EYPA 1SE2A 2Q8IB 1D5MC 1HUMA 1MD2D 4H7BA 1H9SB 2EYOA 1FGBD 4KN7C 2OEOA 3KLSX 4HCEA 5A35A 4B9WA 5C0XJ 4X3KA 1LTTD 2Q8TA 5FO8B 4ULLA 2SOBA 3S9WA 5EKKA 1MSGA 3RD4A 1FR3A 3D4DA 2B8GA 3AMUA 1SJHD 2XNAC 2EY5A 1A2UA 2X6LA 1R4PB 4J6HA 5DEHA 3NXWA 5FLXL 3SK6A 2AUKA 1DD2A 1G2TA 1EY5A 2VNUD 1IW7C 1KLGD 2PNRC 1QOHA 1Y8OB 2F0OA 1W6JA 2B2VA 1G6ZA 3SK5A 1EOTA 2D9UA 5I9PA 2D62A 3OWEB 2XVSA 3M85A 4A3BB 3LWUA 4BY1B 4S3SA 3R2TA 1DOLA 3PUXA 3SXHA 2RSNA 3O13A 2VXWA 2FFKB 3W2DA 2HDMA 5I2XA 4KMUC 2EZVA 3HOYB 1YNND 2QKIC 4UAIA 3MWYW 3URYA 4NKLA 4KHVA 2NVXB 1OXSC 4K2LA 5E1FA 4R8IA 2F03A 3K58A 1DJRD 1JWMD 3C46A 1JC7A 1Y8NB 3OW7A 1F2LA 5C5MA 5KGUA 2JEBI 1B50A 1Q3LA 3K5MA 5CGKA 1B44D 2DNCA 3MEHA 3PO3B 4B08A 4ZUIA 1LT5D 2NZ1D 3IFTA 1U4PA 3K6OA 2IJ0A 4A3FB 5C4XB 2AQ3B 4RCOA 3Q6SA 2A6EC 1QB5D 2SDFA 4C3JB 1Y69U 5JAVA 1SNOA 4G7HC 3H09A 5LL6S 1STNA 2ZXRA 2E2DC 1ZYRD 1H9JA 5KNBA 4LAAA 1UUPA 4KHZA 2O5JC 1PRTF 2KA7A 1EU4A 1LLRD 4XQQA 2SNMA 2PZTA 2K5DA 2RKSA 1B53A 3CHBD 1TS3A 2F0VA 5AFWA 3J81L 2H4OA 1D2BA 3SE0A 1HQMC 4KKUA 2KCNA 2ICEC 1UAPA 2PW5A 2I07B 3NBHA 1HRJA 3OMCA 2FINB 3G7LA 5I4DA 3GTKB 3BVZA 3VYRA 1Y1WB 1PZJD 1WTWA 2M00A 3NWSA 3QB3A 3E0JA 1JICA 3MXUA 5IT9L 3FMCA 5FO9B 3GP7A 2PMZB 4CKCA 5D3DA 1S5CD 2F3VA 4DFAA 4Q0FA 3C2PA 3V05A 4K6LA 4RHRA 4BWGB 4DNTB 2R3ZA 1QJOA 1RCVD 5CR3A 3LNNA 3HRZC 2EJGC 5CBEE 1SNQA 2G9DA 1FD7D 2KEDA 4IUNA 1S5FD 4MIUA 3K57A 1KDAA 2D2CC 3DWQA 4OIJA 3R93A 4QCLA 3WDNA 2OT2A 3IFDA 2KHSA 4TQUS 1W6KA 2B2WA 1H9MA 3OIQA 2YYZA 3A8KE 1EZ8A 3F2UA 3S17B 1JOOA 5T1GA 4K5XA 3MZ5A 4FO2A 5EJWA 2NTTA 3KLSA 5CORA 1G91A 4QUCA 3D6WA 1WD1A 1CA6A 5C44B 3HOZB 5COYA 3L3OC 1LT4D 3QJYA 4LJZC 3J80L 1EWCA 1JORA 3EROA 1R9TB 3VA5A 4IUPA 5C3WA 1TS4A 1E0BA 1E2ZA 4C1NI 3X3NA 5TSSA 1EYAA 3ND8A 1TY2A 1AZQA 3MFYA 1LACA 5FLXE 4ZYSA 4XT1B 3S15B 4WJWA 2F0TA 4BS9A 4QUFA 4FF1A 1J9OA 2DNEA 1SNPA 4TSSA 1V8QA 4EQNA 2AWOA 2L9HA 5JPNC 3GV3A 5FKAC 4KN4C 1ESRA 2R6GA 2J4XA 1GXDC 1SSOA 3BS1A 2E74C 3P75A 3BYYB 5C4HA 3RLFA 5IIFA 2E2JB 2BDOA 2F3WA 4XQJA 1H9RA 2D5DA 1ZKOA 3MC0B 1PTOB 3GTQB 3ONAB 3H94A 3K5NA 3HKZB 2E2IB 1NR4A 1AN8A 2HQEA 3FEWX 2DY7A 1D6EC 3RZDB 4ZKCB 5ELFA 4ME5A 1EEID 3PUVA 1GUTA 1F2YA 2NB0A 5M3MB 3HOVB 4U673 5M5WB 1JB3A 1TKWB 4KD4A 3VR5A 1KLUD 2Y0SB 2M2LA 1B2TA 1PTOC 1ENFA 1A6XA 4G57A 2TSSA 3SR1A 2WINB 2TMPA 5EPJA 3GTOB 2MJ8A 2B2TC 3PV0A 2B2YA 2K01A 1EYDA 4X3UA 2JYOA 2K28A 1SMYD 4JK1C 4XT3B 2GA4B 3Q24A 1OO9B 3A8JE 2OXPA 1LTID 1CHPD 1KTKA 4KI0A 1LTGD 4IUQA 2A6HC 2JE6I 3NHHA 2QEJC 1MGSA 3VR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQV A;  4EQP A;  3SK6 A;  4K2K A;  3TP5 A;  4OL7 A;  5EGT A;  2PQE A;  1EY7 A;  4HMI A;  4WOR A;  5M9O A;  1STA A;  4K14 A;  2F0H A;  4QMG A;  4IAL A;  3NQT A;  1EY5 A;  3TP7 A;  4E6I A;  4RKL A;  5NUC A;  2EY1 A;  3SK4 A;  4F7X A;  4PMC A;  4LAA A;  4PMB A;  3QOL A;  2F0O A;  5CV6 A;  4DU9 A;  1A3U A;  2EYL A;  2KHS A;  4ODG A;  1A2T A;  2F0J A;  3MXP A;  3OSO A;  2F0F A;  5CV9 A;  3P75 A;  2F0N A;  5IGE A;  3D8G A;  1EY9 A;  4B9X A;  5DAU A;  2QDB A;  1TR5 A;  2O4X A;  5C4H A;  5KYI A;  1EZ8 A;  1F2M A;  1EY4 A;  2F0S A;  3NK9 A;  3TP8 A;  2SNM A;  3SK5 A;  5IIF A;  1U9R A;  2PZT A;  5I9P A;  4YIJ A;  1JOO A;  2F3W A;  4NDX A;  1IHZ A;  2RKS A;  4N9T A;  4K5X A;  4K6D A;  4KJN A;  4ZUJ A;  3U9O A;  5ISR A;  3MZ5 A;  1NUC A;  2KQ3 A;  2RBM A;  3MVV A;  5CV7 A;  5IGB A;  3HZX A;  3H6M A;  4F8M A;  2F0V A;  2NUC A;  5C6A A;  1SYC A;  4S3S A;  5E3F A;  3SXH A;  5KIX A;  4HTH A;  5F2D A;  2EYF A;  1SYB A;  1KDC A;  5EKL A;  3ERQ A;  1SNM A;  4HMJ A;  4J1M A;  4ZQ3 A;  3OMG A;  4KY7 A;  2F0I A;  3E5S A;  2PW5 A;  3EVQ A;  1A3T A;  3D6C A;  4KV6 A;  5KRU A;  4I65 A;  1SYD A;  2HQE A;  2F0L A;  4NP5 A;  4TRD A;  5IGC A;  3OMC A;  4ID6 A;  3R3O A;  1SYG A;  1TT2 A;  3TME A;  2EYH A;  2EYM A;  3P1H A;  3T16 A;  5CV8 A;  3DMU A;  4RKB A;  1JOQ A;  4EVO A;  2PZU A;  2F0G A;  3NUC A;  2EXZ A;  4KY5 A;  4NKL A;  1ENC A;  4KHV A;  3TP6 A;  2F0U A;  3D4W A;  4ME5 A;  1SND A;  5C5L A;  1ENA A;  3QOJ A;  4K2L A;  5E1F A;  4KTA A;  3BDC A;  1A3V A;  3DHQ A;  1F2Y A;  5IOD A;  3OWF A;  4QF4 A;  3BDL A;  3C1F A;  1KAA A;  3EJI A;  2F0P A;  3RUZ A;  1EZ6 A;  5I6W A;  2OF1 A;  1STG A;  2PZW A;  2M00 A;  5IGD A;  2F0M A;  1JOR A;  3QB3 A;  2EYP A;  1KAB A;  3HEJ A;  3ERO A;  1RKN A;  3VA5 A;  4KD4 A;  5C3W A;  5J39 A;  2F0W A;  4K8I A;  5C5M A;  5C4Z A;  5KGU A;  3NP8 A;  5IOC A;  4H7B A;  5C3X A;  2EYO A;  4NMZ A;  5K5P A;  5J22 A;  2F3V A;  2LKV A;  4DFA A;  4R8N A;  1F2Z A;  4PNY A;  2OEO A;  1II3 A;  2ENB A;  5CGK A;  2F0D A;  1EYA A;  3PMF A;  4G57 A;  4KJO A;  4B9W A;  2F0Q A;  3SK8 A;  1STY A;  3SR1 A;  3MEH A;  4KD3 A;  1AEX A;  3V2T A;  4DF7 A;  4ZUI A;  3S9W A;  2SOB A;  4N9P A;  2RDF A;  5EKK A;  4EQO A;  5JOB A;  5I6Y A;  1EYD A;  2F0K A;  4QB4 A;  1JOK A;  2F0E A;  4WRD A;  1STB A;  1SYF A;  5IGF A;  2SNS A;  4K5V A;  5HGT A;  5CC4 A;  5KEE A;  2F0T A;  3D4D A;  5CR3 A;  4K5W A;  5I9O A;  5HUR A;  2WAC A;  1STH A;  3MHB A;  3SHL A;  1SNQ A;  2EY5 A;  1A2U A;  1TQO A;  1EY6 A;  1SNP A;  2EY2 A;  5IGG A;  2EYJ A;  5CV5 A;  2OXP A;  2PW7 A;  4DGZ A;  1KDB A;  1EY0 A;  1EYC A;  2PYK A;  3LX0 A;  1SNC A;  1SYE A;  4IZ8 A;  4J6H A;  4IUN A;  5J1Z A;  1EY8 A;  5KYL A;  4KY6 A;  3NXW A;  4MIU A;  5DEH A;  3NHH A;  3ITP A;  1KDA A;  1SNO A;  2EY6 A;  4K8J A;  5CV4 A;  3T13 A;  5JAV A;  3C1E A;  4EQN A;  1STN A;  1NSN S; 
#chains in the Genus database with same CATH topology
 5H1S E;  2JA6 H;  3M4O H;  3CC2 A;  3J81 E;  4IAL A;  2N8N A;  4E6I A;  4XYO A;  4JI6 L;  4DV1 L;  2RHS B;  4DR7 Q;  3FKI B;  3CC4 A;  2SEB D;  2JP1 A;  4A76 A;  2IHF A;  3OTO L;  5LMN L;  2ATW A;  3J81 j;  4EX5 A;  1MJC A;  4JI1 Q;  3S1N B;  1BVS A;  3IRB A;  3S1Q B;  4OHJ A;  1I6V C;  2QDB A;  2WB1 G;  3MAQ A;  1U4M A;  1UE6 A;  5IP7 G;  1X3Q A;  1IHZ A;  3KLW A;  4A3J G;  1XMO L;  2KQ3 A;  4F87 A;  4DAY B;  4JI5 Q;  1QE6 A;  3PUZ A;  1S5D D;  4A3C G;  1QVC A;  1C48 A;  4HAE A;  1N8R C;  3EQL C;  2KUM A;  1FL0 A;  1BCP F;  5IT9 E;  2F0I A;  1HNW L;  1WTP A;  3PIO 3;  1VDZ A;  1BXT A;  4C3H G;  1E2W A;  5IGC A;  5ELD A;  4ID6 A;  4H0L C;  3E6Z X;  1VQM A;  5IP7 H;  5DLQ E;  3P1H A;  1TWH H;  3PUW A;  4A3J H;  3T53 B;  3NUC A;  1TWF B;  1NR2 A;  4DR7 L;  3FRP B;  1XPU A;  4A3C H;  3DXJ C;  3BDC A;  1SEB D;  4O2D A;  4JI1 L;  3CME A;  1F9S A;  2RVL A;  1XTD A;  5EBC A;  4C3H H;  5GQO A;  3FVQ A;  2XN9 C;  3KJP A;  1KQS A;  3Q23 A;  1CK1 A;  1CQV A;  5C3X A;  2JEA I;  4PNY A;  5E4W C;  4P72 A;  1BNZ A;  1FYC A;  2BOS A;  2A68 D;  4RWS C;  1T5E A;  4YWM A;  1TWG B;  2PCF B;  4LFB Q;  1G29 1;  4PMW A;  4IOA A;  2HDL A;  4WRD A;  4HJ9 A;  1CSP A;  4LF8 Q;  1DM0 B;  1P16 A;  1WCM G;  3DWA A;  1I4X A;  3I2Z A;  3K5O A;  4DNI A;  3FHW A;  3NTH A;  3J7Y W;  4PG3 A;  1EY0 A;  2OQK A;  1LT3 D;  1EIH A;  1EY8 A;  4HIO A;  4KY6 A;  4X3S A;  2K52 A;  1QNU A;  4IUR A;  3M3Y B;  5CBA E;  1WCM H;  2UUC Q;  2JA7 B;  1HHV A;  4B3T Q;  3CCE A;  5JJZ A;  1STA A;  1JJ2 A;  2J0T D;  4G7Z C;  4C56 C;  4A3E G;  3PQI A;  4IJL A;  2BA0 A;  4X64 Q;  1HPC A;  2AHO B;  1B3Q A;  4TVA B;  4JBJ A;  3MXP A;  3OSO A;  4LFB L;  5IGE A;  3BU2 A;  2HD3 A;  4LF8 L;  5DAU A;  2YTY A;  4DV7 Q;  4J8Q A;  3I4L A;  3S14 B;  2B63 B;  3I4N B;  4KJN A;  4K6D A;  1YI2 A;  1YHA A;  1FNU A;  4EQ5 A;  3GTJ B;  4RGN A;  4A3E H;  5C6A A;  3J80 E;  1XX8 A;  1E22 A;  1ESF A;  1I50 B;  1PH4 A;  3K0Y A;  2EYF A;  2ZXP A;  1X6O A;  3ERQ A;  1X55 A;  4HMJ A;  4LF4 Q;  2IT1 A;  3K7A H;  3OMG A;  3RN5 A;  5BR8 Q;  4OIK A;  2UUC L;  4B3T L;  4DXG A;  3R3O A;  4N8F A;  2NVQ H;  4HJA A;  2EOT A;  2IHE A;  3BDO A;  2PZU A;  2OQ0 A;  2QF7 A;  3D4W A;  3IKJ A;  4LMQ D;  1Z6H A;  4KTA A;  5L37 A;  4R4O A;  2UUA Q;  3L2P A;  3EJI A;  3TZU A;  3TEH B;  1EL0 A;  4OWW B;  1HUN A;  4DV7 L;  4ZK9 B;  4DV4 Q;  2QCP X;  1Q90 A;  4GOP A;  5J39 A;  4WJ4 A;  1PXU A;  5D14 A;  1Y1V B;  3KJO A;  1G8Z D;  2EPB A;  2HUG A;  2EJM A;  1R4Q B;  4GNX A;  2RDH A;  3NTK A;  5E4X A;  4Y7N B;  1B70 B;  4RA8 A;  2F0Q A;  2NVY B;  2XIW A;  4IJH A;  4A3I B;  2B2U C;  4LF4 L;  3CD6 A;  2A8V A;  2I5M X;  5BR8 L;  3H0G G;  4JI7 Q;  1JOK A;  1V1O A;  5HGT A;  2EIF A;  1PFM A;  3CRK C;  2VS1 A;  1VQC A;  1BOS A;  1EY6 A;  1NJI C;  2NTS A;  2G5D A;  2UUA L;  1EYC A;  1QZH A;  1SYE A;  3SGI A;  4DXF A;  3GTP H;  5CMD A;  3D4R A;  3H0G H;  5IY0 A;  2WII B;  4GN3 B;  3ZJY C;  1MBY A;  2VUM B;  3C1E A;  2N78 A;  3ULJ A;  3HG9 A;  4CHT B;  1X3G A;  2VQF Q;  4JYA Q;  2B3G A;  1EQV A;  1LTR D;  3FP9 A;  2UXB Q;  4BY7 G;  5EGT A;  5M9O A;  4BBR G;  3NBI A;  4IPC A;  4JBK A;  1PYS B;  3ZYY X;  2MUY A;  1KIX A;  1PRT D;  4JC0 A;  1D1K A;  4JI7 L;  3I73 A;  3S2D B;  1Y14 B;  3HOU G;  1U4R A;  3NQI A;  1EWH A;  4DV5 Q;  1U9R A;  4RMF A;  1K0S A;  4BY7 H;  3PO2 G;  1PRT B;  1QUQ B;  4BBR H;  4C1N K;  1ILP A;  1NUC A;  3H6M A;  2K5N A;  1K8M A;  3H91 A;  1NMG A;  4UY8 C;  5E3F A;  3CKI B;  3T51 B;  1SNM A;  3L0O A;  1EQT A;  4UPA A;  2L55 A;  4ZQ3 A;  4KY7 A;  1HNX Q;  1GJX A;  2VQF L;  4JYA L;  3FPP A;  3HOU H;  4BBS H;  4AYB G;  2UXB L;  2QDL A;  4Q5V A;  5J3B A;  4A3D B;  3T16 A;  3ERS X;  1KRT A;  3PO2 H;  3MXN A;  4EVO A;  3CRL C;  1OXT A;  3TP6 A;  1EWI A;  2O5I C;  4UP7 A;  1A3V A;  1BO0 A;  2BE5 D;  4GS3 A;  3OWF A;  3BDL A;  1KAA A;  4CJ1 B;  1B9M A;  2L4N A;  1DOK A;  3LWE A;  1STG A;  2PZW A;  4C3I B;  4DV5 L;  5C3E B;  1T5X D;  1DXM A;  2WV6 D;  1KD1 C;  4HSP A;  1AZP A;  1FVI A;  1GHK A;  5J22 A;  3GTL B;  1CZG A;  1O7Y A;  1Q8I A;  1MKH A;  1ASY A;  1HNX L;  4R4I A;  4IFD I;  4O0A A;  3WOE A;  2CHB D;  2N88 A;  4QB4 A;  3TN2 A;  4DAM A;  1QIL A;  3FDT A;  4NPS A;  1DZ1 A;  3MHB A;  3SHL A;  1TQO A;  2CVR A;  4QGU A;  2QA4 A;  2EY2 A;  1VMC A;  2MHV A;  4RH6 A;  2DUD A;  4Z9C B;  3DM1 A;  1SNC A;  3PGZ A;  1E2V A;  1HFN A;  4DUZ Q;  1TWC H;  1D8L A;  2WKC A;  3ITP A;  3Q8D A;  4CGY B;  2HCC A;  1Z7T A;  1TXY A;  1FNW A;  4NXM Q;  1LUZ A;  2MNA A;  4K2K A;  1GO3 E;  4OL7 A;  1KC8 C;  3CQZ H;  1VQ9 A;  1EY7 A;  2K7V A;  4CDF C;  3AYH B;  3UDG A;  2JA5 B;  4RGO S;  1DYQ A;  4I7A A;  5CV6 A;  4JG2 A;  5IYB H;  1NY4 A;  1PLF A;  2AQ1 B;  3RLN A;  4C3H B;  1G2S A;  1EIG A;  1M1K C;  4CKE A;  3NBH B;  3HOW G;  4DK3 C;  4QJF A;  1WTX A;  1QG7 A;  4UP8 A;  2NVT H;  3KF6 A;  2I46 A;  4HSV A;  4CJ2 C;  4F8M A;  3OIP A;  1VQI A;  4DUZ L;  1N33 Q;  3BG3 A;  2F4I A;  3EN2 A;  3NE5 B;  1S5E D;  3E5S A;  3EVQ A;  4NXM L;  5ELN A;  1SYD A;  2Z6K A;  2UXC Q;  3HOW H;  2F1M A;  1VS0 A;  2EYH A;  2EYM A;  3BVM A;  3EFX D;  1ML0 D;  1ENA A;  4ABN A;  3I8Z A;  1HZ9 A;  2R93 B;  3A5U A;  1VF7 A;  2OF1 A;  1C4Q A;  1U5K A;  2F0W A;  3BZD B;  1SFO B;  2ZJQ A;  4A3G B;  3MXG A;  1JE4 A;  3U58 A;  4KKT A;  4DR1 Q;  1EUJ A;  4DPG A;  3M7N A;  4KJO A;  4OGQ C;  1N33 L;  1IL2 A;  4G7O C;  1ONL A;  1WTH A;  5EQ0 A;  3NEL A;  1LT6 D;  5I6Y A;  1RIP A;  2UXC L;  2AKW B;  3N52 A;  5FOB B;  3Q0A A;  2M9V A;  2SNS A;  4JBW A;  5CC4 A;  2JN4 A;  2ES2 A;  1DOM A;  2MFI A;  4IPG A;  5EBD A;  1L0W A;  2E5L Q;  1IYV A;  1X65 A;  2V4D A;  3LX0 A;  3WWV A;  2NBF A;  1L1O B;  2H1E A;  3EA6 A;  1EQQ A;  4JV5 Q;  1ASZ A;  3S1R B;  3A8I E;  1I4H A;  1V1P A;  4DR1 L;  3WOF A;  3STB D;  2ICI A;  2ZT9 C;  4X66 Q;  1Q1B A;  4PMC A;  4PMB A;  4MHE A;  1SE3 A;  3CU7 A;  1NTG A;  1ZEQ X;  1FJG Q;  2IX3 A;  1LM0 A;  3K81 C;  4QY7 A;  3NK9 A;  2LSS A;  4A3K G;  3RZO B;  1I94 Q;  3T1H Q;  1HR0 W;  3VYU A;  4BY1 G;  1J6Q A;  3F2D A;  3HS0 C;  3I4O A;  3I91 A;  1L0X B;  2E5L L;  4X3T A;  2B2T A;  2UU9 Q;  1LTA D;  1SYB A;  3SEB A;  4JV5 L;  3KBX A;  2E75 C;  2QGQ A;  4HN7 A;  1NNX A;  2I0Q A;  1S4Z A;  4PZ7 A;  3HOY G;  3K59 A;  3H3V C;  2J7Z A;  4A3K H;  2Z8L A;  3J7A F;  3C3L A;  4X66 L;  2MO0 A;  4BY1 H;  4CKB A;  2EXZ A;  4V19 0;  2K33 A;  4IPH A;  1GKH A;  4JI8 Q;  1FJG L;  1NCV A;  1GOZ A;  2L12 A;  4KK7 A;  3PSI A;  3GTG B;  4K0K Q;  2L0C A;  2K05 A;  1EZ6 A;  5I6W A;  3KUP A;  4PV1 C;  3VDY A;  1I94 L;  3HOY H;  1E7Z A;  4IUT A;  2JA9 A;  1VCI A;  2CH4 A;  4BA2 I;  4NW2 A;  3JC6 6;  1OXX K;  3EBE A;  3PO3 G;  1AEX A;  3S2H B;  4Y52 H;  1RJT A;  4BXX G;  4NB3 A;  2Q2T A;  2XSC A;  2AQ2 B;  2Q8R E;  2YV5 A;  1SYF A;  4FXG C;  3KDF A;  4A3F G;  5C4X G;  3S16 H;  5HUR A;  4DA2 A;  1X3E A;  1O78 A;  3G6J B;  3PIP 3;  2B8F A;  4JI8 L;  3UI2 A;  5FLM G;  1S5B D;  2O2L D;  3P20 A;  5CV5 A;  2PW7 A;  3U9S A;  4LW1 A;  5GAD C;  4LF9 Q;  2A5H A;  1PV4 A;  3PO3 H;  4K0K L;  1PTO F;  5J1Z A;  4LF5 Q;  4C3J G;  4BXX H;  4IUV A;  3T13 A;  4K8J A;  1HJP A;  1KAW A;  3A7A B;  3K5L A;  5C4X H;  4A3F H;  2PI2 A;  2CCZ A;  3JAM L;  5BN5 A;  1QWY A;  5FLM H;  2F4V Q;  3D31 A;  5EKI A;  3VYT A;  4FF2 A;  5IYC G;  4A75 A;  4AYB B;  4C3J H;  1KNA A;  2F0F A;  5CV9 A;  1QCB D;  3T4A C;  1EFW A;  1WI5 A;  5C4J B;  2E2H B;  2NYZ D;  3J7A V;  4OO1 I;  2VB3 X;  1TR5 A;  1PH3 A;  1BKB A;  1Z47 A;  5AJ3 Q;  4N9T A;  1OXU A;  5IGB A;  5CV7 A;  4ZRZ A;  3TDQ A;  4LF9 L;  5A2Q L;  2R7Z B;  1BR9 A;  3UE1 A;  1F9Q A;  4LF5 L;  2C5C A;  3Q22 A;  5IYC H;  2K5Q A;  1BCP D;  5D3I B;  1EEF D;  4U68 A;  4I65 A;  2VZA A;  4TRD A;  3AFP A;  4FF4 A;  2HHH Q;  3DMU A;  2MPM A;  3GDE A;  1JOQ A;  2F4V L;  3S1M H;  1ENC A;  4CDC C;  2LMC B;  2NN6 I;  2B39 A;  1I6H H;  4X62 Q;  5E7N A;  3CCL A;  4DR3 Q;  2EJF C;  1UEB A;  5KND A;  1YIJ A;  1SMY C;  2PQA A;  2ZJR A;  3GTM B;  5AJ3 L;  1RKN A;  5C4Z A;  4ZKB B;  2WB1 E;  4UDU C;  1XPO A;  4FXD A;  2EDG A;  4R8N A;  4V0B A;  3GTK H;  1II3 A;  2ENB A;  4MN3 A;  2NWG A;  1HZA A;  5M5X B;  1VQG A;  2YU9 B;  4FF3 A;  2K14 A;  1TWA B;  4DR2 Q;  3M4Q A;  5JOB A;  2XRQ D;  2HCI A;  2FMM A;  3DLL A;  4K5V A;  2A69 D;  2N55 A;  2HHH L;  2CW0 D;  1XTC D;  2K04 A;  3PUY A;  1H9S A;  5ELC A;  1XPR A;  2FHT A;  4GLA C;  1S40 A;  4O1N A;  4GLX A;  4X62 L;  4DR3 L;  2G9H D;  2HQL A;  1I4R A;  1B3A A;  4DNR B;  3H3V I;  4OO1 G;  2EY6 A;  1JWU D;  2R92 B;  4R4C A;  1IKM A;  4QIW E;  1O7Z A;  2EE1 A;  5DM7 3;  5DNF A;  4A4I A;  4EQP A;  1S72 A;  1CSQ A;  4WOR A;  4KHP Q;  4ME3 A;  5JJI A;  5NUC A;  2VW9 A;  2JK8 A;  3HGB A;  3I4M B;  1ET6 A;  5JPM C;  4DR2 L;  4XXE A;  1WTV A;  2ZTD A;  1WTR A;  2F0N A;  4UHV A;  5ELE A;  1VQ7 A;  4OO1 H;  5LHY 1;  5KNC A;  1EY4 A;  1B1Z A;  4QQB X;  4P75 A;  1CUK A;  1VQJ A;  4LF7 Q;  3K80 C;  4MNO A;  3GQB A;  3MVV A;  4GKK Q;  4HED A;  2NN6 G;  2B2U A;  2KCC A;  1QNK A;  4R9W A;  4HTH A;  1HR0 Q;  1IW7 D;  1KDC A;  4L63 B;  3CCS A;  2RQX A;  2MP1 A;  1F77 A;  3NWT A;  4KV6 A;  5BN3 A;  1MSH A;  4XQN A;  3S17 H;  1WTQ A;  3KYH C;  2Q2H A;  4DV3 Q;  4KHP L;  2F0G A;  1UE7 A;  1B9N A;  3VA7 A;  5C44 G;  1VQB A;  2A68 C;  2F0U A;  2NN6 H;  3HOZ G;  1MIU A;  1SND A;  2K75 A;  1I4G A;  2X6G A;  3F2C A;  4H44 C;  4PZ8 A;  3UDF A;  1YNJ C;  1SDF A;  3TRZ A;  1L0Y B;  5GRO A;  5FLX c;  4JCV E;  4L8J A;  3BJU A;  1A8V A;  4LF7 L;  1V43 A;  4K8I A;  4GKJ Q;  3NP8 A;  4LUV A;  1SRU A;  4GKK L;  1CKN A;  2K6A A;  2CQA A;  4NMZ A;  5K5P A;  4B3S Q;  5C44 H;  3HOX B;  1H9K A;  3HOZ H;  2Z4I A;  1SJE D;  1JJC B;  2RSO A;  1HR0 L;  3I70 A;  3PMF A;  1N32 Q;  2WP8 J;  3KF8 A;  3W1G A;  4RFB A;  4DF7 A;  4A3M B;  3S24 A;  1KNE A;  3E9I A;  1PVO A;  1U4L A;  4DV3 L;  1UNS A;  1R9T H;  1VQ8 A;  5IGF A;  2FJ2 A;  5G3L D;  1HA6 A;  4XIG S;  3U50 C;  3W5O A;  1PYW D;  2XRS D;  2WAC A;  2RDG A;  4ZCK A;  2I5L X;  2E76 C;  1IKL A;  4IN3 A;  5IWA Q;  2MO1 A;  2K32 A;  2PYK A;  1GUS A;  5HY6 A;  4IZ8 A;  3PIP A;  4G4K A;  1N36 Q;  1STE A;  2IWH A;  3H3V H;  4A3K B;  4C2M B;  1KL9 A;  5ELB A;  4I7Z C;  2KVM A;  4M8A A;  4GKJ L;  1NSN S;  4A93 B;  4B3S L;  3L7Z C;  1RD9 D;  2PQE A;  2RF4 A;  2I5H A;  4K14 A;  1K83 B;  2F0H A;  1JE5 A;  4CBV A;  1BQQ T;  1CA5 A;  1N32 L;  5G3L F;  2LY7 A;  4F7X A;  1M8A A;  3QOL A;  3DWP A;  1A2T A;  1PDQ A;  2A6E D;  2L5T A;  3N6R A;  4PQX A;  2KBN A;  3RR5 A;  5KYI A;  3OHX C;  2P5Z X;  1PHJ A;  1AE2 A;  2IPK D;  1PH7 A;  3U9O A;  1I3Q B;  5EPK A;  3UDX A;  3TSS A;  2RBM A;  5IWA L;  4XTC S;  1PZK D;  4KLK A;  3OOC A;  4RAU C;  1IZ6 A;  1CTM A;  3TS0 A;  1JR0 D;  5KIX A;  3VYS A;  1N36 L;  3U4Z A;  4KKS A;  1M4V A;  3HKZ G;  3I3C A;  4J1M A;  2PO4 A;  5JEA G;  1O7L A;  3S16 B;  2E2J H;  1PZI D;  2F0L A;  1TT2 A;  3TME A;  4GOP B;  4DAP A;  1YNN C;  5IP9 G;  4BBS G;  4KY5 A;  5JVG 3;  4GNX B;  1LV9 A;  1PTO H;  2WAQ G;  1GHJ A;  3GTQ H;  1DCZ A;  3ND9 A;  5M3M G;  1SE4 A;  4UP9 A;  2E2I H;  2B2V C;  2DN8 A;  3RUZ A;  3HOV G;  1V9P A;  5JEA H;  3QWN A;  1WJJ A;  1PH6 A;  1B4O A;  1TS2 A;  2ID0 A;  3RZD H;  4DR4 Q;  5IOC A;  2Y0S G;  5IP9 H;  2BDN A;  2LKV A;  3NEN A;  1PH2 A;  1PFN A;  2B29 A;  2GVB A;  1STY A;  2RCN A;  4KD3 A;  1HFG A;  4DK0 A;  1GUG A;  5M3M H;  2AUJ D;  3HOV H;  1U0L A;  2BA1 A;  1BF4 A;  3AEV A;  3CPF A;  4DKA C;  2L11 A;  2F0K A;  5M5W H;  2F0E A;  3JAM E;  2Z0S A;  5K36 G;  5M5Y B;  1HQR D;  4K5W A;  1BDO A;  2JA6 B;  4WJ3 M;  3M4O B;  4AYB E;  4OWT B;  1AFP A;  2RA4 A;  1PRT C;  3J81 c;  1EIF A;  1MI2 A;  3CPW A;  3GTO H;  4M1U B;  1UEA B;  2CH4 W;  1ICW A;  2A19 A;  4DN4 M;  2QEX A;  3QO2 A;  3J81 i;  1GD7 A;  2R61 A;  3R8B A;  3E9H A;  3S1M B;  4EGV A;  4DR4 L;  5K36 H;  1SN8 A;  5JJL A;  3MA2 B;  3A55 A;  5A2Q E;  3TRE A;  1J8I A;  1EYG A;  1PH8 A;  2L15 A;  4QMG A;  1ZYR C;  4RKL A;  1I6H B;  5M3F G;  4LK1 C;  2EY1 A;  1XXG A;  2QW7 A;  4ODG A;  1A62 A;  1JCK B;  3VR3 A;  1XYI A;  4JI0 Q;  2O4X A;  5IYB G;  2WB1 B;  4DV2 Q;  1LO5 D;  1SBB B;  3R2I A;  5IT9 c;  2D0O A;  2XWJ B;  1TWH B;  3MXN B;  4A3J B;  2AMC B;  2JSO A;  1XWE A;  2BE5 C;  3F1Z A;  5M3F H;  2XWB B;  3W3A A;  2KOL A;  3GO5 A;  2NUC A;  4RCN A;  1NMF A;  3H15 A;  5T1I A;  3S1N H;  1AP0 A;  4JI3 Q;  3MFG A;  3S1Q H;  1FNV A;  2LXK A;  1UE1 A;  5FK9 C;  4DR6 Q;  3QIA A;  1CI3 M;  3AB9 A;  1RHP A;  2K5W A;  1YBY A;  3A56 A;  1V1Q A;  3D0F A;  1ROD A;  3CCR A;  3MTS A;  1VQ4 A;  5DM6 3;  3DHQ A;  5JEA J;  3NPP A;  5IOD A;  4YY3 Q;  5EPL A;  1Q1E A;  4JI0 L;  2F0P A;  4QIW B;  1LTB D;  1SE8 A;  4OX9 Q;  3K8A A;  5IGD A;  1C7Y A;  2LFN A;  4DV2 L;  2KEC A;  1KAB A;  1SXT A;  1LTS D;  1Q12 A;  3QR8 A;  3CF5 A;  3L9A X;  1K8A C;  1TWF H;  1C9O A;  1WFQ A;  1HTP A;  5FJ8 G;  1F2Z A;  4RGM A;  3SK8 A;  4JI3 L;  3I90 A;  3V2T A;  2X69 A;  4HIK A;  4DR6 L;  1CZW A;  3ULP A;  1STB A;  4H13 C;  4IFD G;  5LL6 X;  1WVL A;  3P7J A;  1RTO A;  1WCM B;  5I9O A;  2JA8 G;  1SLJ A;  4IQZ A;  5FJ8 H;  3M4Y A;  2Z4H A;  5IGG A;  1IYJ B;  2KJX A;  4YY3 L;  3OYY A;  4PZ6 A;  4P74 A;  1PA6 A;  2L1B A;  1KDB A;  2IY5 B;  4OX9 L;  1TWG H;  5KYL A;  5I2Y A;  1TS5 A;  4OON A;  2EVB A;  4FP5 D;  2UXD L;  4IFD H;  2JA7 G;  1I4P A;  2JA8 H;  3J7A 5;  3CW2 C;  1CQF A;  3TP7 A;  3KF6 B;  3SK4 A;  4A3E B;  1GUO A;  1SAP A;  4ZLT F;  3BZC A;  1PMR A;  3T56 B;  1WD0 A;  3D8G A;  1EY9 A;  3K7A B;  4HR7 B;  3M3Y H;  1HZC A;  3BVG A;  1HTL D;  2F0S A;  2Z9H A;  2ZTC A;  2B63 G;  1N34 Q;  2JA7 H;  2ZXO A;  2FMC A;  4LUO A;  3I4N G;  1YEZ A;  3KBG A;  2BCO A;  5ISR A;  2NVQ B;  2RHQ B;  1AE3 A;  3IL8 A;  3J80 i;  1DGS A;  3HZX A;  1Y8P B;  2BH2 A;  3I56 A;  3FPU B;  1CM9 A;  5EKL A;  4IUU A;  2IX1 A;  2MGS A;  3TQY A;  3X3M A;  1HNZ Q;  3D6C A;  2VY3 A;  5KRU A;  4DR5 Q;  3S14 H;  1GUN A;  2B63 H;  1F9R A;  3I4N H;  3F2B A;  3D3R A;  2XTI A;  4RKB A;  3GTJ H;  2DGY A;  4YCV A;  2KEE A;  1I50 H;  3QOJ A;  1G51 A;  2KCM A;  4A3B G;  3C1F A;  4HCS A;  4NXN Q;  2AWN A;  2MQH A;  5CYU A;  1L1O C;  3B6Y A;  1N34 L;  2B2W C;  1RDP D;  4FXK C;  1RL2 A;  1Y1V G;  1E3P A;  2VB2 X;  1XNR Q;  3T1Y Q;  3G4S A;  4JW0 A;  4X6A H;  4A3B H;  4A3I G;  1SMX A;  4LNQ A;  1A15 A;  4L5Q A;  1TVX A;  5BN4 A;  1HNZ L;  2Z1C A;  4YHH Q;  4N9P A;  4EQO A;  3GTP B;  4GZY C;  2EQS A;  5C0X I;  4DR5 L;  3H0G B;  4JI4 L;  3AQQ A;  2BH8 A;  5KEE A;  1RTN A;  1V1P B;  1Y1V H;  1STH A;  3GV6 A;  1XNQ Q;  2ZJP A;  1K73 C;  5EAY A;  1Q7Y C;  1N9W A;  1NAP A;  2NVY H;  3TBI B;  4DGZ A;  4A3I H;  1PTO D;  4NXN L;  1X54 A;  2NVX H;  1CKM A;  1A0I A;  4IFD J;  4O42 A;  2VUM G;  4DAV A;  1JWS D;  2CFM A;  3CP0 A;  1VMP A;  1D1I A;  3I72 A;  1VF5 C;  1T9H A;  2EXD A;  4BY7 B;  4JI2 Q;  1YHQ A;  4FNF A;  4BBR B;  4AIM A;  3T1Y L;  1XNR L;  3OW2 A;  4IPD A;  3M4P A;  2QIL A;  1M90 C;  3SDZ A;  3I7F A;  4YHH L;  2F0J A;  2JXM B;  2YTX A;  2VUM H;  1D5X C;  1CFM A;  2IL8 A;  1I4Q A;  2A6H D;  3HOU B;  4BBS B;  3NTI A;  1K3R A;  3TP8 A;  4DV0 L;  1KHI A;  4P2C B;  4NDX A;  1XNQ L;  2WAQ B;  4ZUJ A;  3UE0 A;  4HJ7 A;  3PO2 B;  2PNH A;  1JQY D;  1C0A A;  1TII D;  2A74 C;  1GUW A;  1SYC A;  5JJK A;  1C8C A;  5F2D A;  4L6T B;  1YIT A;  1Q82 C;  4DK1 A;  3S2D H;  1CT1 D;  3BZK A;  1A3T A;  3MEF A;  1E24 A;  3AFQ A;  1K8O A;  3ICE A;  4A3D G;  1SYG A;  2KHJ A;  4JI2 L;  3OPO A;  3V96 A;  3TS2 A;  4DAY A;  3LGJ A;  3RN2 A;  1JT8 A;  5C5L A;  3JAM i;  1HA5 A;  5IE8 A;  4DUY Q;  2ASB A;  1Q86 C;  4QF4 A;  1LAB A;  1DON A;  1PFB A;  3HKS A;  5C0X G;  4C3I G;  1BBX C;  1Q46 A;  2F0M A;  1EU3 A;  3IAY A;  5C3E G;  3HEJ A;  2C35 B;  3DEO A;  1CHQ D;  4A3D H;  5LMU Q;  3CCU A;  5FO7 B;  1S3O A;  4L5R C;  4DK6 C;  2F0D A;  4DV6 Q;  5GAE C;  1ET9 A;  4CJ0 B;  4RHS A;  1K9M C;  1BCP B;  1X3P A;  3NSW A;  4XDX A;  1VQ5 A;  1Y1W G;  2RDF A;  4C3I H;  5C0X H;  3TZD A;  1TWC B;  1OXV A;  5C3E H;  3KK7 A;  3GD7 A;  4ZAI A;  4JBM A;  5M3F B;  4XYQ A;  4HIM A;  3M9B A;  3CQZ B;  4AH6 A;  3GTL H;  2WKD A;  2C9O A;  2EYJ A;  4DUY L;  3VR2 A;  2F3I A;  5JVH 3;  4POF A;  3DUZ A;  4FVM A;  1X32 A;  3CXC A;  4JOI C;  4RGT A;  4APV A;  1Y1W H;  2D0P A;  2N49 A;  1O80 A;  5CV4 A;  1O7I A;  1AW7 A;  5M5Y H;  1EOV A;  2GVA A;  1ILQ A;  5LMU L;  4JVZ A;  3RMH A;  4GLV B;  3TP5 A;  2KEN A;  2K5V A;  3AU7 A;  4HMI A;  1IL8 A;  4WFN 3;  3NQT A;  4DV6 L;  2JA5 G;  4FYD A;  3M7G A;  2PMZ E;  2HIV A;  2NVT B;  1IBK Q;  1MJE A;  4CDD C;  1BCP C;  4DU9 A;  1A3U A;  2EYL A;  2LS0 1;  1HCZ A;  4F88 A;  4MZ9 A;  4P71 A;  4HID A;  1IYU A;  3VR6 A;  1WTO A;  1WYD A;  4B9X A;  1P8L A;  1F2M A;  2B2Y C;  2IW3 A;  3HOW B;  3HP3 A;  4TKO B;  4YIJ A;  3A7L A;  3E0E A;  1HXY D;  2JA5 H;  2K03 A;  2DY8 A;  1TY0 A;  4OWX B;  1QVG A;  3DEP A;  2IX0 A;  4R4T A;  2PPB C;  4JI5 L;  3QG1 A;  1EFI D;  2PQA B;  4NP5 A;  1TU2 B;  2K1B A;  4OXP A;  5D65 A;  4N8X 1;  2A73 B;  5CV8 A;  4ILW A;  1IBK L;  1BUV T;  1NBW A;  1RF2 D;  1D5Z C;  3KLR A;  2R93 G;  3SVM A;  3BYT B;  1YNJ D;  1F9P A;  2A69 C;  4BA1 I;  2CW0 C;  1ZXT A;  1E1T A;  3A54 A;  2JA8 B;  1I5F A;  2EYP A;  1SE2 A;  2Q8I B;  1D5M C;  4A3G G;  1KXL A;  1HUM A;  1MD2 D;  1H9S B;  4H7B A;  4GN4 B;  2EYO A;  1FGB D;  4KN7 C;  2ALY B;  1VQP A;  1HZB A;  2OEO A;  3KLS X;  4HCE A;  5A35 A;  4B9W A;  5C0X J;  2LXJ A;  2R93 H;  4X3K A;  1PH1 A;  1LTT D;  2Q8T A;  1K28 A;  1IBM Q;  1X3F A;  5FO8 B;  4ULL A;  2SOB A;  3S9W A;  5EKK A;  1MSG A;  3PCO B;  3RD4 A;  1FR3 A;  3RLO A;  3D4D A;  1A63 A;  1SFO H;  4A3G H;  2B8G A;  4GN5 A;  3AMU A;  1SJH D;  2XNA C;  3A5Z B;  2EY5 A;  1A2U A;  1YZ6 A;  2X6L A;  4QL5 A;  1W2B A;  1R4P B;  4J6H A;  4FDB A;  3RNU A;  5DEH A;  3NXW A;  5FLX L;  2OTJ A;  3SK6 A;  2AUK A;  1DD2 A;  3K7U C;  1MHW C;  1G2T A;  4H02 A;  1EY5 A;  3CCJ A;  3G6E A;  4L5T A;  2VNU D;  1IW7 C;  1KLG D;  2PNR C;  1QOH A;  1Y8O B;  2F0O A;  1W6J A;  2B2V A;  1G6Z A;  1IBM L;  1PYB A;  4YCW A;  1YNX A;  2CWA A;  1XJV A;  3S1R H;  1ICF B;  1VQK A;  3SK5 A;  1EOT A;  2D9U A;  5I9P A;  2D62 A;  3OWE B;  4X64 L;  3S15 H;  2XVS A;  3M85 A;  4A3B B;  1GM5 A;  3LWU A;  1BBU A;  3DM3 A;  4BY1 B;  3J7Z C;  4S3S A;  3R2T A;  1DOL A;  3PUX A;  4R1J A;  3SXH A;  2GN5 A;  2RSN A;  3O13 A;  2VXW A;  4OEL B;  2FFK B;  3W2D A;  2HDM A;  5I2X A;  1K3B C;  1YVC A;  2XGT A;  4KMU C;  2EZV A;  3RZO H;  3HOY B;  2JQO A;  1G6P A;  1YNN D;  1QUQ A;  2QKI C;  4UAI A;  1CKN B;  3MWY W;  3URY A;  1Q81 C;  4NKL A;  2NZO A;  4KHV A;  2NVX B;  2H5X A;  1OXS C;  4K2L A;  5E1F A;  4R8I A;  2F03 A;  3K58 A;  2OTL A;  3KF8 B;  1DJR D;  1JWM D;  2ZTE A;  3C46 A;  5IYD G;  4RG1 A;  2Q2I A;  1OTC A;  4POG A;  1JC7 A;  1Y8N B;  3OW7 A;  1F2L A;  5C5M A;  5KGU A;  2JEB I;  1B50 A;  1Q3L A;  4CDE C;  3K5M A;  5CGK A;  1B44 D;  4DV4 L;  4IO9 A;  4MTK A;  3GTG H;  2DNC A;  3MEH A;  3PO3 B;  4B08 A;  1D7Q A;  1VQH A;  4ZUI A;  1LT5 D;  5IYD H;  2NZ1 D;  3CCV A;  3IFT A;  3HKZ E;  1U4P A;  3K6O A;  2IJ0 A;  2K4K A;  4A3F B;  5C4X B;  2AQ3 B;  4RCO A;  1AH9 A;  1FGU A;  3Q6S A;  1X9N A;  2A6E C;  1QB5 D;  2SDF A;  3S2H H;  1XMQ Q;  2WAQ E;  1LYL A;  4B3R Q;  4C3J B;  1Y69 U;  5JAV A;  1SNO A;  4G7H C;  1YJW A;  3H09 A;  1J5E Q;  3I55 A;  5LL6 S;  1EIY B;  1STN A;  4ALP A;  2ZXR A;  2OCE A;  3G48 A;  2E2D C;  1ZYR D;  4GOP C;  2E8G A;  1H9J A;  5KNB A;  2KCT A;  2Y0S E;  4LAA A;  1UUP A;  1H95 A;  2KHI A;  4KHZ A;  4GNX C;  2O5J C;  1PRT F;  4X65 Q;  2KA7 A;  1EU4 A;  2A1A A;  4HJ8 A;  1LLR D;  3PIO A;  4XQQ A;  2SNM A;  3NEM A;  2PZT A;  2K5D A;  2RKS A;  1B53 A;  3CHB D;  1TS3 A;  2R7Z G;  2F0V A;  5AFW A;  3J81 L;  1XMQ L;  2H4O A;  4IOC A;  1D2B A;  3SE0 A;  1HQM C;  4B3R L;  2RCF A;  4KKU A;  2KCN A;  2ICE C;  2K5H A;  3FKI G;  5C4J H;  1J5E L;  2E2H H;  1UAP A;  1VQ6 A;  2PW5 A;  1K0R A;  3G71 A;  2I07 B;  3NBH A;  2OWO A;  1HRJ A;  3OMC A;  2FIN B;  2Z6B A;  2HT1 A;  3G7L A;  1VQD A;  2R7Z H;  3CMA A;  5I4D A;  3PF4 A;  3CAM A;  3GTK B;  1BBW A;  3BVZ A;  3VYR A;  1Y1W B;  2N3S A;  4X65 L;  1PZJ D;  1WTW A;  3ULL A;  2PI2 E;  3FKI H;  4J15 A;  2M00 A;  3PF5 A;  3NWS A;  3QB3 A;  3E0J A;  1JIC A;  3MXU A;  5IT9 L;  3FMC A;  2DJG C;  5FO9 B;  3GP7 A;  2K50 A;  2PMZ B;  4CKC A;  1S5C D;  5D3D A;  2F3V A;  4DFA A;  5LMN W;  4Q0F A;  3C2P A;  3V05 A;  4K6L A;  4RHR A;  4BWG B;  3UDI A;  4AQY Q;  3CCQ A;  4DNT B;  3A0J A;  2R3Z A;  2VQE Q;  1YHB A;  3GTM H;  1QJO A;  2HIX A;  3CCM A;  1RCV D;  5CR3 A;  3LNN A;  3HRZ C;  2EJG C;  5CBE E;  1SNQ A;  2G9D A;  5M5X H;  1FD7 D;  2KED A;  2YU9 H;  2UXD Q;  1NE3 A;  1JB7 A;  1SR3 A;  1QZG A;  1TWA H;  4IUN A;  1S5F D;  4MIU A;  3K57 A;  1KDA A;  2R92 G;  2VL6 A;  1GVP A;  2D2C C;  3DWQ A;  4OIJ A;  3R93 A;  1IBL Q;  4QCL A;  3WDN A;  1PH9 A;  3I4M G;  2OT2 A;  1HH2 P;  1IXR A;  3IFD A;  4AQY L;  2KHS A;  2UUB Q;  4TQU S;  1W6K A;  2VQE L;  1L1O A;  2B2W A;  1H9M A;  1VQL A;  3OIQ A;  2YYZ A;  2R92 H;  4YCU A;  3KOJ A;  3A8K E;  1EZ8 A;  3F2U A;  3S17 B;  1JOO A;  1L2F A;  5T1G A;  4K5X A;  3MZ5 A;  4LFC Q;  3I4M H;  4FO2 A;  5EJW A;  4R4Q A;  2NTT A;  3KLS A;  5COR A;  1YJN A;  1WOC A;  4LF6 Q;  1G91 A;  4QUC A;  3D6W A;  2R7F A;  1IBL L;  1WD1 A;  3EIV A;  4A3L G;  3J80 c;  3K0X A;  1CA6 A;  5C44 B;  1VQO A;  2UUB L;  3HOZ B;  5COY A;  3L3O C;  1LT4 D;  3QJY A;  4P73 A;  4LJZ C;  3J80 L;  1EWC A;  1JOR A;  1PFS A;  3ERO A;  1R9T B;  3VA5 A;  3E3X A;  4IUP A;  4A3L H;  5C3W A;  4LFC L;  1TS4 A;  1E0B A;  1E2Z A;  3HOX G;  4C1N I;  3X3N A;  2V1C C;  4JI4 Q;  5TSS A;  1EYA A;  3ND8 A;  1PH5 A;  1TY2 A;  1AZQ A;  3MFY A;  1LAC A;  5FLX E;  4A3M G;  4LF6 L;  2CWP A;  4ZYS A;  4XT1 B;  2ZM6 Q;  1VQF A;  3ER0 A;  1Z9F A;  3S15 B;  4WJW A;  2F52 A;  1B8A A;  2F0T A;  3U4V A;  4BS9 A;  4QUF A;  4FF1 A;  1J9O A;  2Z6K C;  2DNE A;  3HOX H;  2FXQ A;  1SNP A;  2DJF C;  1QVF A;  4TSS A;  1V8Q A;  4A3M H;  5GAH C;  2JJQ A;  1VQA A;  4EQN A;  4A93 G;  2WFW A;  4MTN A;  1VQN A;  2AWO A;  4OEM B;  1YJ9 A;  3KFU A;  2L9H A;  5JPN C;  4LFA Q;  3STB C;  3W1B A;  3GV3 A;  5FKA C;  4DV0 Q;  4KN4 C;  1KRS A;  1ESR A;  2R6G A;  2J4X A;  1GXD C;  1SSO A;  2ZM6 L;  1UWV A;  4Y7N H;  3BS1 A;  2E74 C;  1CKO A;  2YTV A;  3P75 A;  3BYY B;  4C2M H;  4LUZ A;  5C4H A;  4A93 H;  3A74 A;  5ELO A;  3RLF A;  4B3M Q;  5IIF A;  2E2J B;  2BDO A;  2F3W A;  1K83 H;  4XQJ A;  2Q2U A;  1H9R A;  2D5D A;  1ZKO A;  3MC0 B;  1PTO B;  3GTQ B;  3ONA B;  3H94 A;  4LWC A;  3T1H L;  3K5N A;  3HKZ B;  4YWK A;  2E2I B;  1NR4 A;  1W3S A;  1AN8 A;  2HQE A;  3HFZ B;  3FEW X;  2DY7 A;  1D6E C;  2UU9 L;  1I3Q H;  1UE5 A;  3RZD B;  4LFA L;  4ZKC B;  5ELF A;  4ME5 A;  1X56 A;  1EEI D;  4JOI A;  3PUV A;  5GAG C;  1GUT A;  1F2Y A;  3CC7 A;  1JMC A;  4L5S A;  2NB0 A;  5M3M B;  2NZH A;  3HOV B;  4U67 3;  4B3M L;  5M5W B;  1JB3 A;  1JJG A;  1TKW B;  4KD4 A;  3VR5 A;  1KLU D;  2Y0S B;  1SRO A;  1B7Y B;  2CKZ B;  2M2L A;  3JAM c;  1B2T A;  1PTO C;  1ENF A;  1A6X A;  4G57 A;  1E1O A;  4JI6 Q;  2TSS A;  4YWL A;  3SR1 A;  2WIN B;  4DV1 Q;  2TMP A;  5EPJ A;  3GTO B;  4JPB W;  1K8G A;  3F8T A;  2MJ8 A;  2B2T C;  3PV0 A;  3OTO Q;  2B2Y A;  2K01 A;  5LMN Q;  1EYD A;  2R7D A;  4X3U A;  2JYO A;  2K28 A;  2CQO A;  2JA6 G;  1SMY D;  4HJ5 A;  4JK1 C;  1XMO Q;  4XT3 B;  1LTL A;  3KDF B;  2GA4 B;  3Q24 A;  1OO9 B;  3A8J E;  2OXP A;  1LTI D;  1CHP D;  1KTK A;  4KI0 A;  1VQE A;  1Q8K A;  1LTG D;  4IUQ A;  2A6H C;  2JE6 I;  3NHH A;  2QEJ C;  1EQR A;  5HGQ A;  1HNW Q;  1MGS A;  3VR4 A; 
#chains in the Genus database with same CATH homology
 3J81 E;  4IAL A;  4E6I A;  4XYO A;  3FKI B;  2SEB D;  2JP1 A;  3S1N B;  3S1Q B;  4OHJ A;  1I6V C;  2QDB A;  3MAQ A;  1U4M A;  1X3Q A;  1IHZ A;  2KQ3 A;  4F87 A;  1QE6 A;  3PUZ A;  1S5D D;  1C48 A;  4HAE A;  3EQL C;  2KUM A;  1BCP F;  5IT9 E;  2F0I A;  1WTP A;  3PIO 3;  1VDZ A;  1BXT A;  4C3H G;  1E2W A;  5IGC A;  5ELD A;  4ID6 A;  4H0L C;  3E6Z X;  3P1H A;  3PUW A;  3T53 B;  3NUC A;  1TWF B;  1NR2 A;  3FRP B;  3DXJ C;  3BDC A;  1SEB D;  1F9S A;  2RVL A;  5EBC A;  3FVQ A;  2XN9 C;  3Q23 A;  1CK1 A;  1CQV A;  5C3X A;  2JEA I;  4PNY A;  5E4W C;  1BNZ A;  1FYC A;  2BOS A;  2A68 D;  4RWS C;  1T5E A;  1TWG B;  2PCF B;  1G29 1;  4PMW A;  2HDL A;  4WRD A;  1DM0 B;  3DWA A;  1I4X A;  3K5O A;  3NTH A;  3J7Y W;  1EY0 A;  1LT3 D;  1EIH A;  1EY8 A;  4KY6 A;  4X3S A;  1QNU A;  4IUR A;  3M3Y B;  5CBA E;  2JA7 B;  1HHV A;  5JJZ A;  1STA A;  2J0T D;  4G7Z C;  4C56 C;  2BA0 A;  1HPC A;  3MXP A;  3OSO A;  5IGE A;  5DAU A;  4J8Q A;  3I4L A;  3S14 B;  2B63 B;  3I4N B;  4KJN A;  4K6D A;  1FNU A;  3GTJ B;  4RGN A;  5C6A A;  3J80 E;  1XX8 A;  1ESF A;  1I50 B;  3K0Y A;  2EYF A;  2ZXP A;  3ERQ A;  4HMJ A;  2IT1 A;  3OMG A;  4OIK A;  4DXG A;  3R3O A;  2EOT A;  3BDO A;  2PZU A;  2QF7 A;  3D4W A;  3IKJ A;  4LMQ D;  1Z6H A;  4KTA A;  3EJI A;  3TZU A;  1EL0 A;  1HUN A;  4ZK9 B;  2QCP X;  1Q90 A;  5J39 A;  1PXU A;  5D14 A;  1Y1V B;  1G8Z D;  2EPB A;  2HUG A;  2EJM A;  1R4Q B;  2RDH A;  3NTK A;  5E4X A;  4Y7N B;  4RA8 A;  2F0Q A;  2NVY B;  2XIW A;  4A3I B;  2B2U C;  1JOK A;  1V1O A;  5HGT A;  1PFM A;  3CRK C;  1BOS A;  1EY6 A;  2NTS A;  1EYC A;  1SYE A;  4DXF A;  5CMD A;  3D4R A;  2WII B;  1MBY A;  2VUM B;  3C1E A;  3HG9 A;  4CHT B;  1EQV A;  1LTR D;  5EGT A;  5M9O A;  3NBI A;  3ZYY X;  2MUY A;  1PRT D;  1D1K A;  3I73 A;  3S2D B;  1U4R A;  3NQI A;  1EWH A;  1U9R A;  1PRT B;  4C1N K;  1ILP A;  1NUC A;  3H6M A;  1K8M A;  3H91 A;  5E3F A;  3CKI B;  3T51 B;  1SNM A;  1EQT A;  2L55 A;  4ZQ3 A;  4KY7 A;  1GJX A;  3FPP A;  4Q5V A;  4A3D B;  3T16 A;  3MXN A;  4EVO A;  3CRL C;  1OXT A;  3TP6 A;  2O5I C;  1A3V A;  1BO0 A;  2BE5 D;  3OWF A;  3BDL A;  1KAA A;  4CJ1 B;  1B9M A;  2L4N A;  1DOK A;  3LWE A;  1STG A;  2PZW A;  4C3I B;  5C3E B;  1T5X D;  1DXM A;  2WV6 D;  4HSP A;  1AZP A;  1GHK A;  5J22 A;  3GTL B;  1CZG A;  1O7Y A;  1Q8I A;  4IFD I;  3WOE A;  2CHB D;  2N88 A;  4QB4 A;  3TN2 A;  1QIL A;  3FDT A;  1DZ1 A;  3MHB A;  3SHL A;  1TQO A;  2CVR A;  2EY2 A;  1VMC A;  2MHV A;  4RH6 A;  4Z9C B;  3DM1 A;  1SNC A;  1E2V A;  1HFN A;  2WKC A;  3ITP A;  4CGY B;  2HCC A;  1Z7T A;  1FNW A;  4K2K A;  4OL7 A;  1EY7 A;  2K7V A;  2JA5 B;  4RGO S;  1DYQ A;  5CV6 A;  1PLF A;  2AQ1 B;  4C3H B;  1G2S A;  1EIG A;  4CKE A;  1WTX A;  1QG7 A;  2I46 A;  4HSV A;  4CJ2 C;  4F8M A;  3OIP A;  3BG3 A;  2F4I A;  3NE5 B;  1S5E D;  3E5S A;  3EVQ A;  1SYD A;  2F1M A;  2EYH A;  2EYM A;  3BVM A;  3EFX D;  1ML0 D;  1ENA A;  4ABN A;  3I8Z A;  2R93 B;  1VF7 A;  2OF1 A;  1C4Q A;  2F0W A;  3BZD B;  1SFO B;  4A3G B;  3MXG A;  1JE4 A;  4KKT A;  3M7N A;  4KJO A;  4OGQ C;  4G7O C;  1ONL A;  5EQ0 A;  1LT6 D;  5I6Y A;  3N52 A;  5FOB B;  3Q0A A;  2M9V A;  2SNS A;  4JBW A;  5CC4 A;  1DOM A;  5EBD A;  1IYV A;  2V4D A;  3LX0 A;  2NBF A;  2H1E A;  3EA6 A;  3S1R B;  3A8I E;  1I4H A;  1V1P A;  3WOF A;  2ICI A;  2ZT9 C;  1Q1B A;  4PMC A;  4PMB A;  4MHE A;  1SE3 A;  3CU7 A;  1ZEQ X;  2IX3 A;  3NK9 A;  3RZO B;  3VYU A;  3HS0 C;  3I91 A;  1L0X B;  4X3T A;  2B2T A;  1LTA D;  1SYB A;  3SEB A;  3KBX A;  2E75 C;  4HN7 A;  1S4Z A;  3K59 A;  3H3V C;  2J7Z A;  2Z8L A;  3J7A F;  3C3L A;  4CKB A;  2EXZ A;  4V19 0;  2K33 A;  1NCV A;  1GOZ A;  2L12 A;  4KK7 A;  3GTG B;  2L0C A;  2K05 A;  1EZ6 A;  5I6W A;  3KUP A;  4PV1 C;  4IUT A;  1VCI A;  4BA2 I;  4NW2 A;  1OXX K;  1AEX A;  3S2H B;  1RJT A;  2XSC A;  2AQ2 B;  2Q8R E;  1SYF A;  4FXG C;  5HUR A;  4DA2 A;  1O78 A;  3G6J B;  3PIP 3;  2B8F A;  3UI2 A;  1S5B D;  2O2L D;  3P20 A;  5CV5 A;  2PW7 A;  3U9S A;  2A5H A;  1PTO F;  5J1Z A;  4C3J G;  4IUV A;  3T13 A;  4K8J A;  3A7A B;  3K5L A;  3JAM L;  5BN5 A;  1QWY A;  3D31 A;  5EKI A;  3VYT A;  4FF2 A;  4AYB B;  1KNA A;  2F0F A;  5CV9 A;  1QCB D;  3T4A C;  5C4J B;  2E2H B;  2NYZ D;  3J7A V;  4OO1 I;  2VB3 X;  1TR5 A;  1Z47 A;  4N9T A;  1OXU A;  5IGB A;  5CV7 A;  4ZRZ A;  3TDQ A;  5A2Q L;  2R7Z B;  1BR9 A;  1F9Q A;  2C5C A;  3Q22 A;  2K5Q A;  1BCP D;  5D3I B;  1EEF D;  4U68 A;  4I65 A;  4TRD A;  4FF4 A;  3DMU A;  2MPM A;  1JOQ A;  1ENC A;  2LMC B;  2NN6 I;  2B39 A;  2EJF C;  5KND A;  1SMY C;  3GTM B;  1RKN A;  5C4Z A;  4ZKB B;  4UDU C;  4FXD A;  2EDG A;  4R8N A;  4V0B A;  1II3 A;  2ENB A;  4MN3 A;  2NWG A;  5M5X B;  2YU9 B;  4FF3 A;  1TWA B;  5JOB A;  2XRQ D;  2HCI A;  2FMM A;  4K5V A;  2A69 D;  2N55 A;  2CW0 D;  1XTC D;  2K04 A;  3PUY A;  1H9S A;  5ELC A;  2FHT A;  4O1N A;  2G9H D;  1I4R A;  1B3A A;  4DNR B;  4OO1 G;  2EY6 A;  1JWU D;  2R92 B;  1IKM A;  1O7Z A;  2EE1 A;  5DM7 3;  5DNF A;  4EQP A;  4WOR A;  5NUC A;  3HGB A;  3I4M B;  1ET6 A;  5JPM C;  4XXE A;  1WTV A;  1WTR A;  2F0N A;  5ELE A;  4OO1 H;  5LHY 1;  5KNC A;  1EY4 A;  1B1Z A;  3GQB A;  3MVV A;  4HED A;  2NN6 G;  2B2U A;  2KCC A;  1QNK A;  4R9W A;  4HTH A;  1IW7 D;  1KDC A;  4L63 B;  2RQX A;  2MP1 A;  1F77 A;  3NWT A;  4KV6 A;  5BN3 A;  1MSH A;  4XQN A;  1WTQ A;  2F0G A;  3VA7 A;  1B9N A;  2A68 C;  2F0U A;  2NN6 H;  1SND A;  1I4G A;  2X6G A;  4H44 C;  1YNJ C;  1SDF A;  1L0Y B;  4L8J A;  1V43 A;  4K8I A;  3NP8 A;  2K6A A;  2CQA A;  4NMZ A;  5K5P A;  3HOX B;  1H9K A;  2Z4I A;  1SJE D;  2RSO A;  3I70 A;  3PMF A;  2WP8 J;  3KF8 A;  4RFB A;  4DF7 A;  4A3M B;  1KNE A;  1U4L A;  1UNS A;  5IGF A;  2FJ2 A;  5G3L D;  1HA6 A;  4XIG S;  1PYW D;  2XRS D;  2WAC A;  2RDG A;  2E76 C;  1IKL A;  4IN3 A;  2K32 A;  2PYK A;  1GUS A;  4IZ8 A;  4G4K A;  1STE A;  2IWH A;  4A3K B;  4C2M B;  5ELB A;  4I7Z C;  2KVM A;  4M8A A;  4A93 B;  1NSN S;  3L7Z C;  1RD9 D;  2PQE A;  4K14 A;  1K83 B;  2F0H A;  4CBV A;  1CA5 A;  1BQQ T;  5G3L F;  2LY7 A;  4F7X A;  1M8A A;  3QOL A;  3DWP A;  1A2T A;  1PDQ A;  2A6E D;  2L5T A;  3N6R A;  4PQX A;  5KYI A;  3OHX C;  2IPK D;  3U9O A;  1I3Q B;  5EPK A;  3TSS A;  2RBM A;  4XTC S;  1PZK D;  3OOC A;  4RAU C;  1CTM A;  1JR0 D;  5KIX A;  3VYS A;  4KKS A;  1M4V A;  3I3C A;  4J1M A;  2PO4 A;  5JEA G;  1O7L A;  3S16 B;  1PZI D;  2F0L A;  1TT2 A;  3TME A;  4DAP A;  1YNN C;  4KY5 A;  5JVG 3;  1LV9 A;  1PTO H;  1GHJ A;  1DCZ A;  3ND9 A;  1SE4 A;  2B2V C;  2DN8 A;  3RUZ A;  5JEA H;  3QWN A;  1B4O A;  1TS2 A;  2ID0 A;  5IOC A;  2BDN A;  2LKV A;  1PFN A;  1STY A;  4KD3 A;  4DK0 A;  1HFG A;  1GUG A;  2AUJ D;  2BA1 A;  1BF4 A;  2L11 A;  2F0K A;  2F0E A;  3JAM E;  5K36 G;  5M5Y B;  1HQR D;  4K5W A;  1BDO A;  2JA6 B;  3M4O B;  1AFP A;  2RA4 A;  1PRT C;  1MI2 A;  4M1U B;  1UEA B;  1ICW A;  4DN4 M;  3QO2 A;  2R61 A;  3R8B A;  5K36 H;  3S1M B;  4EGV A;  3MA2 B;  3A55 A;  5A2Q E;  1J8I A;  4QMG A;  1ZYR C;  4RKL A;  1I6H B;  4LK1 C;  2EY1 A;  1XXG A;  4ODG A;  1JCK B;  3VR3 A;  1XYI A;  2O4X A;  2WB1 B;  1LO5 D;  1SBB B;  3R2I A;  2XWJ B;  1TWH B;  4A3J B;  2JSO A;  1XWE A;  2BE5 C;  2XWB B;  3W3A A;  2KOL A;  3GO5 A;  2NUC A;  4RCN A;  5T1I A;  1AP0 A;  3MFG A;  1FNV A;  5FK9 C;  3QIA A;  1CI3 M;  3AB9 A;  1RHP A;  2K5W A;  3A56 A;  1ROD A;  3MTS A;  5DM6 3;  3DHQ A;  5JEA J;  3NPP A;  5IOD A;  5EPL A;  1Q1E A;  2F0P A;  4QIW B;  1LTB D;  5IGD A;  2LFN A;  2KEC A;  1KAB A;  1SXT A;  1LTS D;  1Q12 A;  3L9A X;  1HTP A;  1F2Z A;  4RGM A;  3SK8 A;  3I90 A;  3V2T A;  2X69 A;  1CZW A;  1STB A;  4H13 C;  4IFD G;  5LL6 X;  1WVL A;  3P7J A;  1RTO A;  1WCM B;  5I9O A;  4IQZ A;  3M4Y A;  2Z4H A;  5IGG A;  2KJX A;  2L1B A;  1KDB A;  5KYL A;  5I2Y A;  1TS5 A;  2EVB A;  4FP5 D;  4IFD H;  1I4P A;  1CQF A;  3TP7 A;  3SK4 A;  4A3E B;  1GUO A;  1SAP A;  4ZLT F;  1PMR A;  3T56 B;  1WD0 A;  3D8G A;  1EY9 A;  3K7A B;  4HR7 B;  3BVG A;  1HTL D;  2F0S A;  2ZXO A;  2FMC A;  5ISR A;  3KBG A;  2BCO A;  2NVQ B;  3IL8 A;  3HZX A;  1Y8P B;  3FPU B;  1CM9 A;  5EKL A;  4IUU A;  2IX1 A;  2MGS A;  3X3M A;  3D6C A;  5KRU A;  1GUN A;  1F9R A;  3D3R A;  4RKB A;  2KEE A;  3QOJ A;  3C1F A;  4HCS A;  2AWN A;  5CYU A;  2B2W C;  1RDP D;  4FXK C;  2VB2 X;  1A15 A;  1TVX A;  5BN4 A;  3GTP B;  2Z1C A;  4GZY C;  4N9P A;  4EQO A;  5C0X I;  3H0G B;  5KEE A;  1RTN A;  1V1P B;  1STH A;  3GV6 A;  1NAP A;  3TBI B;  4DGZ A;  1PTO D;  4IFD J;  4O42 A;  4DAV A;  1JWS D;  1VMP A;  1D1I A;  3I72 A;  1VF5 C;  4BY7 B;  4FNF A;  4BBR B;  2QIL A;  3SDZ A;  2F0J A;  2JXM B;  1D5X C;  1CFM A;  2IL8 A;  1I4Q A;  2A6H D;  3HOU B;  4BBS B;  3NTI A;  3TP8 A;  4P2C B;  4NDX A;  2WAQ B;  4ZUJ A;  3PO2 B;  1JQY D;  1TII D;  2A74 C;  1GUW A;  1SYC A;  1C8C A;  5F2D A;  4L6T B;  4DK1 A;  1CT1 D;  1A3T A;  1K8O A;  1SYG A;  3OPO A;  3V96 A;  4DAY A;  5C5L A;  1HA5 A;  4QF4 A;  1LAB A;  1DON A;  1PFB A;  5C0X G;  4C3I G;  1BBX C;  2F0M A;  1EU3 A;  3IAY A;  3HEJ A;  3DEO A;  1CHQ D;  5FO7 B;  2F0D A;  1ET9 A;  4CJ0 B;  4RHS A;  1BCP B;  1X3P A;  3NSW A;  4XDX A;  2RDF A;  5C0X H;  3TZD A;  1TWC B;  1OXV A;  3KK7 A;  3GD7 A;  4ZAI A;  5M3F B;  4XYQ A;  3CQZ B;  2WKD A;  2C9O A;  2EYJ A;  3VR2 A;  5JVH 3;  3DUZ A;  4FVM A;  1X32 A;  4RGT A;  1O80 A;  5CV4 A;  1AW7 A;  1ILQ A;  3RMH A;  3TP5 A;  3AU7 A;  4HMI A;  1IL8 A;  4WFN 3;  3NQT A;  4FYD A;  2NVT B;  3M7G A;  1BCP C;  4DU9 A;  1A3U A;  2EYL A;  2LS0 1;  1HCZ A;  4F88 A;  1IYU A;  3VR6 A;  1WTO A;  4B9X A;  1F2M A;  2B2Y C;  2IW3 A;  3HOW B;  3HP3 A;  4TKO B;  4YIJ A;  3A7L A;  1HXY D;  2K03 A;  2DY8 A;  1TY0 A;  3DEP A;  2IX0 A;  2PPB C;  3QG1 A;  1EFI D;  4NP5 A;  1TU2 B;  2K1B A;  5D65 A;  2A73 B;  5CV8 A;  4ILW A;  1BUV T;  1RF2 D;  1D5Z C;  3KLR A;  3SVM A;  3BYT B;  1YNJ D;  1F9P A;  2A69 C;  4BA1 I;  2CW0 C;  1ZXT A;  3A54 A;  2JA8 B;  2EYP A;  1SE2 A;  2Q8I B;  1D5M C;  1HUM A;  1MD2 D;  4H7B A;  1H9S B;  2EYO A;  1FGB D;  4KN7 C;  2OEO A;  3KLS X;  4HCE A;  5A35 A;  4B9W A;  5C0X J;  4X3K A;  1LTT D;  2Q8T A;  5FO8 B;  4ULL A;  2SOB A;  3S9W A;  5EKK A;  1MSG A;  3RD4 A;  1FR3 A;  3D4D A;  2B8G A;  3AMU A;  1SJH D;  2XNA C;  2EY5 A;  1A2U A;  2X6L A;  1R4P B;  4J6H A;  5DEH A;  3NXW A;  5FLX L;  3SK6 A;  2AUK A;  1DD2 A;  1G2T A;  1EY5 A;  2VNU D;  1IW7 C;  1KLG D;  2PNR C;  1QOH A;  1Y8O B;  2F0O A;  1W6J A;  2B2V A;  1G6Z A;  3SK5 A;  1EOT A;  2D9U A;  5I9P A;  2D62 A;  3OWE B;  2XVS A;  3M85 A;  4A3B B;  3LWU A;  4BY1 B;  4S3S A;  3R2T A;  1DOL A;  3PUX A;  3SXH A;  2RSN A;  3O13 A;  2VXW A;  2FFK B;  3W2D A;  2HDM A;  5I2X A;  4KMU C;  2EZV A;  3HOY B;  1YNN D;  2QKI C;  4UAI A;  3MWY W;  3URY A;  4NKL A;  4KHV A;  2NVX B;  1OXS C;  4K2L A;  5E1F A;  4R8I A;  2F03 A;  3K58 A;  1DJR D;  1JWM D;  3C46 A;  1JC7 A;  1Y8N B;  3OW7 A;  1F2L A;  5C5M A;  5KGU A;  2JEB I;  1B50 A;  1Q3L A;  3K5M A;  5CGK A;  1B44 D;  2DNC A;  3MEH A;  3PO3 B;  4B08 A;  4ZUI A;  1LT5 D;  2NZ1 D;  3IFT A;  1U4P A;  3K6O A;  2IJ0 A;  4A3F B;  5C4X B;  2AQ3 B;  4RCO A;  3Q6S A;  2A6E C;  1QB5 D;  2SDF A;  4C3J B;  1Y69 U;  5JAV A;  1SNO A;  4G7H C;  3H09 A;  5LL6 S;  1STN A;  2ZXR A;  2E2D C;  1ZYR D;  1H9J A;  5KNB A;  4LAA A;  1UUP A;  4KHZ A;  2O5J C;  1PRT F;  2KA7 A;  1EU4 A;  1LLR D;  4XQQ A;  2SNM A;  2PZT A;  2K5D A;  2RKS A;  1B53 A;  3CHB D;  1TS3 A;  2F0V A;  5AFW A;  3J81 L;  2H4O A;  1D2B A;  3SE0 A;  1HQM C;  4KKU A;  2KCN A;  2ICE C;  1UAP A;  2PW5 A;  2I07 B;  3NBH A;  1HRJ A;  3OMC A;  2FIN B;  3G7L A;  5I4D A;  3GTK B;  3BVZ A;  3VYR A;  1Y1W B;  1PZJ D;  1WTW A;  2M00 A;  3NWS A;  3QB3 A;  3E0J A;  1JIC A;  3MXU A;  5IT9 L;  3FMC A;  5FO9 B;  3GP7 A;  2PMZ B;  4CKC A;  5D3D A;  1S5C D;  2F3V A;  4DFA A;  4Q0F A;  3C2P A;  3V05 A;  4K6L A;  4RHR A;  4BWG B;  4DNT B;  2R3Z A;  1QJO A;  1RCV D;  5CR3 A;  3LNN A;  3HRZ C;  2EJG C;  5CBE E;  1SNQ A;  2G9D A;  1FD7 D;  2KED A;  4IUN A;  1S5F D;  4MIU A;  3K57 A;  1KDA A;  2D2C C;  3DWQ A;  4OIJ A;  3R93 A;  4QCL A;  3WDN A;  2OT2 A;  3IFD A;  2KHS A;  4TQU S;  1W6K A;  2B2W A;  1H9M A;  3OIQ A;  2YYZ A;  3A8K E;  1EZ8 A;  3F2U A;  3S17 B;  1JOO A;  5T1G A;  4K5X A;  3MZ5 A;  4FO2 A;  5EJW A;  2NTT A;  3KLS A;  5COR A;  1G91 A;  4QUC A;  3D6W A;  1WD1 A;  1CA6 A;  5C44 B;  3HOZ B;  5COY A;  3L3O C;  1LT4 D;  3QJY A;  4LJZ C;  3J80 L;  1EWC A;  1JOR A;  3ERO A;  1R9T B;  3VA5 A;  4IUP A;  5C3W A;  1TS4 A;  1E0B A;  1E2Z A;  4C1N I;  3X3N A;  5TSS A;  1EYA A;  3ND8 A;  1TY2 A;  1AZQ A;  3MFY A;  1LAC A;  5FLX E;  4ZYS A;  4XT1 B;  3S15 B;  4WJW A;  2F0T A;  4BS9 A;  4QUF A;  4FF1 A;  1J9O A;  2DNE A;  1SNP A;  4TSS A;  1V8Q A;  4EQN A;  2AWO A;  2L9H A;  5JPN C;  3GV3 A;  5FKA C;  4KN4 C;  1ESR A;  2R6G A;  2J4X A;  1GXD C;  1SSO A;  3BS1 A;  2E74 C;  3P75 A;  3BYY B;  5C4H A;  3RLF A;  5IIF A;  2E2J B;  2BDO A;  2F3W A;  4XQJ A;  1H9R A;  2D5D A;  1ZKO A;  3MC0 B;  1PTO B;  3GTQ B;  3ONA B;  3H94 A;  3K5N A;  3HKZ B;  2E2I B;  1NR4 A;  1AN8 A;  2HQE A;  3FEW X;  2DY7 A;  1D6E C;  3RZD B;  4ZKC B;  5ELF A;  4ME5 A;  1EEI D;  3PUV A;  1GUT A;  1F2Y A;  2NB0 A;  5M3M B;  3HOV B;  4U67 3;  5M5W B;  1JB3 A;  1TKW B;  4KD4 A;  3VR5 A;  1KLU D;  2Y0S B;  2M2L A;  1B2T A;  1PTO C;  1ENF A;  1A6X A;  4G57 A;  2TSS A;  3SR1 A;  2WIN B;  2TMP A;  5EPJ A;  3GTO B;  2MJ8 A;  2B2T C;  3PV0 A;  2B2Y A;  2K01 A;  1EYD A;  4X3U A;  2JYO A;  2K28 A;  1SMY D;  4JK1 C;  4XT3 B;  2GA4 B;  3Q24 A;  1OO9 B;  3A8J E;  2OXP A;  1LTI D;  1CHP D;  1KTK A;  4KI0 A;  1LTG D;  4IUQ A;  2A6H C;  2JE6 I;  3NHH A;  2QEJ C;  1MGS A;  3VR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...