5JAVA

Crystal structure of staphylococcal nuclease variant delta+phs y91d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLADIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS Y91D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5javA00
5JAVA 4S3SA 1A2UA 3OMGA 4B9XA 2OEOA 5DEHA 4KD4A 4DF7A 4IZ8A 1STYA 4ZUJA 2F0EA 2SNSA 3E5SA 3OMCA 4NP5A 3D6CA 4K6DA 3D4DA 4OL7A 1SNDA 2F0HA 3DMUA 4KHVA 3SK5A 5C4ZA 5IOCA 5KRUA 2SNMA 4DGZA 1SNCA 2EYFA 4E6IA 5C3WA 2EYPA 3VA5A 3MXPA 2NUCA 4EQNA 3MVVA 3NHHA 1EY4A 3P75A 1TR5A 5E3FA 1JORA 2OXPA 1A3TA 1JOOA 2F0UA 3MZ5A 5CV7A 4B9WA 3BDLA 1SYDA 3OSOA 4KY6A 5IODA 1ENCA 5KYIA 4HMIA 1F2ZA 1SYBA 2O4XA 1JOKA 4R8NA 5C4HA 5I9PA 4K5VA 3HZXA 1RKNA 2PZUA 4WRDA 1A3VA 2F0KA 5I9OA 3QB3A 5KYLA 4K8IA 2EY6A 3D4WA 3SR1A 3D8GA 1SYGA 2F0FA 1EY9A 5F2DA 3BDCA 4I65A 3SK6A 3NP8A 5KIXA 2EY5A 2F3WA 2KQ3A 2F0DA 1EY6A 2F0TA 3QOLA 4QF4A 5IIFA 4HMJA 1KABA 2EY2A 2F0SA 3MHBA 5CR3A 5ISRA 2RKSA 3R3OA 5K5PA 4K2KA 3NQTA 2RDFA 4IUNA 5C3XA 5IGEA 4K5XA 2F0IA 5CV4A 4RKLA 3V2TA 3C1EA 3T16A 4KY7A 1U9RA 2EYMA 1NSNS 5IGDA 1KDCA 2F0LA 3EVQA 3T13A 2EXZA 3C1FA 5J39A 3NK9A 1NUCA 4K2LA 4N9PA 4N9TA 2F0OA 4RKBA 4K14A 5EKKA 3RUZA 4H7BA 1TT2A 4ME5A 1STNA 3DHQA 2EYLA 3MEHA 2HQEA 4ODGA 4EQOA 4ID6A 1II3A 2WACA 1A2TA 5CC4A 2RBMA 4K8JA 4EQPA 5IGBA 4J1MA 4KTAA 2PW5A 4NKLA 2EYJA 5C5LA 4ZQ3A 1ENAA 1EZ8A 5CV9A 4F8MA 3OWFA 1SNOA 1JOQA 1SYEA 1SYCA 2EYHA 4PMBA 3SK4A 3TMEA 3P1HA 4J6HA 1EY7A 5HURA 3ERQA 3EJIA 4IALA 4PNYA 4ZUIA 5NUCA 1F2YA 5DAUA 5E1FA 1STBA 1EYCA 2PZTA 3NXWA 5J1ZA 3SHLA 3EROA 2ENBA 5CV5A 4KJNA 4G57A 4NDXA 3H6MA 2QDBA 5CV8A 2PZWA 1SNPA 5C6AA 4YIJA 1EY8A 1F2MA 2SOBA 2F0WA 3QOJA 4LAAA 5EGTA 3TP8A 1AEXA 1EYAA 1STAA 4QB4A 3LX0A 1STGA 3HEJA 3S9WA 1SNMA 5CV6A 3SK8A 2PQEA 1EY5A 1KAAA 4QMGA 2F0MA 3ITPA 5KEEA 2F0JA 4PMCA 5IGGA 2F0VA 1EY0A 2F0NA 4MIUA 1TQOA 4DFAA 2EY1A 5I6YA 2LKVA 1SYFA 1SNQA 2OF1A 3SXHA 2F0PA 3TP7A 1KDBA 2F0GA 2F0QA 4KD3A 1EYDA 4NMZA 4WORA 1EZ6A 5IGFA 4HTHA 2PYKA 5KGUA 5C5MA 2F3VA 2KHSA 3PMFA 4EVOA 3TP6A 3NUCA 4KJOA 2EYOA 1STHA 2M00A 1IHZA 5IGCA 4K5WA 4F7XA 5CGKA 5HGTA 4TRDA 4DU9A 5I6WA 1EQVA 4KV6A 3TP5A 5J22A 5JOBA 2PW7A 1A3UA 1KDAA 5EKLA 4KY5A 3U9OA 5M9OA
chains in the Genus database with same CATH superfamily
1IBKQ 4OIKA 3K5MA 1X32A 1N33Q 2X69A 1KL9A 3F1ZA 5L37A 5C0XH 2M9VA 4WJ3M 1TXYA 1DM0B 3HOZG 2ZTDA 2YYZA 1KNAA 4A3DH 4P73A 2IWHA 4TSSA 5E3FA 3K0YA 4BBRG 4BA1I 4BY1H 4N8X1 1I94L 3BDLA 4RFBA 3GV6A 5KYIA 3RN2A 3TZUA 2D0PA 3AQQA 4DR6L 1CZGA 1UAPA 5TSSA 1NAPA 4A3KG 2PMZB 3PGZA 5F2DA 4DKAC 4J15A 2NVYB 3N6RA 2EJFC 1O78A 2E2HH 5IE8A 3BVMA 5CR3A 2ZM6Q 3HOUB 3J7AV 3NQIA 1ET9A 3PO3H 2D0OA 5IGDA 1Z9FA 1HFNA 3IFDA 3RUZA 2FFKB 4HIKA 3TQYA 4QL5A 2K03A 5D3DA 2IJ0A 5IP7H 4DV7L 1LTAD 4HAEA 1HZBA 3VR2A 1L0WA 4JBWA 1K8OA 1IW7D 1YVCA 1RD9D 1TWGB 2KCMA 2K1BA 2V1CC 4HEDA 4QQBX 1O7ZA 4IALA 4XT1B 2NN6H 2BA1A 3S14B 1K83H 1S4ZA 3VR4A 3QOJA 3J7YW 3S1RH 2NZHA 1ZKOA 1ASYA 3SK8A 2UXDQ 1I3QH 3PF4A 4UP9A 4MIUA 1B8AA 1QG7A 5CORA 3VR6A 4A93H 5IGFA 2AQ2B 5KGUA 2UXCQ 4DXFA 3HOUG 4IPHA 1QNUA 2Z4HA 4HN7A 4AIMA 2OCEA 2R92H 3S15B 4K5WA 1I4HA 4JOIA 3H0GH 1K8MA 3M3YB 4XDXA 4H13C 1LTTD 2SNSA 2CQAA 3FKIB 1WVLA 4A3FH 2RHQB 3KF6B 3CPFA 3JC66 5EBDA 1YEZA 4KHVA 3VR3A 1EUJA 4JI8L 2IX1A 5M5YH 1GUGA 1Z47A 4ULLA 3T1YQ 3MVVA 2F03A 1JORA 1IKLA 4KY6A 3K5OA 1U4PA 2R3ZA 4LF9L 3FEWX 2F0KA 2VQEL 4IO9A 1X9NA 3F8TA 1SYGA 5GAEC 2FXQA 5JJZA 2Z6BA 4TQUS 5ELNA 5C44B 4DV1Q 1WTWA 4O2DA 1S5FD 2OT2A 4C56C 5CV4A 1EYGA 1VQGA 4A4IA 3HOXB 1AE3A 2F0LA 4DR4L 5J39A 1EFID 2I5HA 3D31A 2F0OA 2G9DA 2GA4B 4X3SA 1X65A 2VXWA 2TSSA 4A3BB 4ODGA 4Z9CB 2MJ8A 1B4OA 1SFOB 4DR7L 3FDTA 1EZ8A 4GKJQ 1A63A 3RD4A 2R7ZH 1JOQA 4KHPQ 1SYCA 5JJLA 1R4PB 4KI0A 4X65L 2Q2TA 2CW0C 4DUYQ 4DNRB 2A68C 1GOZA 2VUMB 2LXKA 3SHLA 2PO4A 2N55A 5LMUL 4IQZA 2JEBI 5A2QL 3H6MA 3R93A 3TP8A 3I4MH 2B2TC 4GOPB 4F87A 1K28A 1PH7A 1PTOH 2UUCL 1LTLA 3GTGB 4LF8L 1TWFH 3UI2A 4PMCA 5IYBG 3B6YA 3HKZB 4FXDA 1LABA 4BY7B 2F0QA 4KD3A 5C44G 1H9RA 1X56A 4L6TB 2CQOA 1NCVA 4IN3A 4OO1I 2JA5B 1IL2A 4NXNQ 1AZPA 1BBUA 1RCVD 4C3HH 3HOXG 1EQVA 4B3SQ 4BBSH 1ASZA 2UUAQ 1BBXC 3M4OH 3A5ZB 2VW9A 1MSHA 2A19A 1DD2A 2F1MA 3QG1A 1FNVA 2WB1B 4OL7A 4OX9Q 3NTKA 1SNCA 1SJHD 5C3WA 1LO5D 3HP3A 4A3LH 4IUTA 5JVG3 1OXTA 3K81C 2VUMG 1TR5A 3M7NA 5I2YA 2IHFA 4A3IH 1X3EA 2B2UC 5CYUA 3I4OA 3ULLA 1SYDA 3OSOA 2E75C 2HHHQ 3BDOA 4JV5Q 1F9PA 2JE6I 2N88A 2XNAC 3GTMH 1KAWA 5KYLA 4B3RL 1CZWA 1YNJC 2RCFA 3K7AH 1HCZA 4M8AA 2CKZB 1VQ5A 3JAME 2I07B 2EY2A 2IX3A 4JI3L 1S5BD 1LM0A 2B2YA 4C3IB 1D1IA 4BY7G 4LF6Q 1J8IA 3V2TA 3A7LA 3KLWA 4QGUA 2K05A 2JA5G 1I4PA 3BJUA 1HA6A 4N9TA 1D5ZC 4K14A 1FGBD 1S3OA 1IBKL 1NTGA 3PIO3 4B3ML 1HTPA 4TKOB 4J1MA 3WOFA 2UU9Q 4K0KQ 4DR5L 1TS5A 4F8MA 3H3VC 1VQFA 3KDFA 2WB1G 1HZCA 1PH5A 2A69D 1BCPC 1EYCA 5A35A 4KJNA 4CDFC 1S72A 2QDBA 3P7JA 4P71A 3NPPA 4BY1G 1AE2A 2G5DA 1I3QB 1QZHA 4DNIA 1PFNA 1TWHH 3H3VI 3T56B 3TEHB 2F0NA 1J6QA 1E2WA 1X3QA 2ZJRA 2I0QA 1P16A 2ZM6L 4CHTB 2F0GA 1V1OA 4IUVA 1EIFA 1PV4A 1KNEA 5IYCG 2K6AA 3AB9A 1KLGD 4R4OA 2E2JB 3HOYB 3VYSA 1EWCA 4DU9A 5I6WA 3TZDA 1PFSA 1I94Q 2RBMA 5JAVA 5C4XH 1W6JA 4V190 3RZOB 1PH2A 1LT4D 4HCSA 1L1OA 3D4DA 4FF4A 1SNDA 4UP7A 3SE0A 1PH3A 5C4ZA 3FHWA 5FJ8G 4AYBE 3P75A 4MTNA 1A3TA 4A3CG 1DZ1A 5GROA 2UXDL 3I4NH 2L11A 4NB3A 3V96A 4M1UB 2A1AA 1A8VA 2D9UA 2WKCA 3E3XA 2F0FA 1M4VA 4LWCA 4X3KA 1EOTA 3D0FA 1FJGL 2IT1A 2M2LA 3NENA 4OEMB 3R8BA 1KD1C 1PZID 4K5XA 4OIJA 4UAIA 4YHHL 3T13A 5IYDH 3G6JB 1HH2P 2RA4A 3E6ZX 1QCBD 1QVFA 3HOYG 1IYJB 3W1BA 1M90C 4OGQC 2ZXRA 1I50B 1A0IA 2K5DA 3OWFA 4CGYB 3TN2A 4ZK9B 5M3FB 1G291 1I4QA 3S16B 2WIIB 1CT1D 3EROA 3AMUA 2B2WA 2AWOA 4OONA 5D14A 1Y1WB 1TIID 3J80E 1B1ZA 1I4RA 2PNHA 1SNMA 1B44D 4Q5VA 1I4GA 5KNBA 1DCZA 4DV1L 2EZVA 2K32A 5ELCA 4RH6A 4CJ0B 1U4LA 1X3PA 2C9OA 1D8LA 2J4XA 4JI8Q 4DV3Q 1VQNA 3CW2C 4AQYQ 1WTVA 2OTLA 1N32L 1L0XB 4L5RC 3S2DH 2X6LA 1I6VC 5CGKA 1KRTA 5DNFA 3UDFA 3K57A 3KK7A 1Y8OB 4LK1C 1XTCD 1G6PA 2VB3X 3NEMA 4LF9Q 4DF7A 2VQEQ 4IZ8A 4GKJL 1CI3M 1X55A 2I46A 5IP9H 3IAYA 3SVMA 1U4RA 2R7ZG 1A62A 3BZDB 4KN7C 5IOCA 4DUYL 5KRUA 3C2PA 2R7FA 4YWKA 5CBAE 2E2IH 5M3FG 2A74C 1ML0D 3MXPA 2NUCA 1EQTA 4EQNA 5FLXL 4JK1C 1Q1EA 1HR0L 2Q8TA 4B9WA 4IFDI 4DR4Q 5IODA 4HIMA 1WCMB 3DEOA 1CSQA 1Y1WG 3L7ZC 3T1HL 4MN3A 4JVZA 4I65A 3PO2B 4DR7Q 1E0BA 3M9BA 2LS01 2G9HD 2ZXOA 5CBEE 3AFQA 3E9HA 2UUBL 3MHBA 4X65Q 3AFPA 1TY2A 2RF4A 2XWBB 1V9PA 4NW2A 2F0IA 3KF6A 4NXNL 2R93B 3TBIB 1KDCA 5LMUQ 4B3SL 3HOWB 2UUAL 1IYUA 4FNFA 3MEHA 5LMNW 1R9TB 1II3A 3S24A 5FLMH 3U4ZA 3PUYA 1E2ZA 1CKNB 5JVH3 1RIPA 4LF8Q 2JA7B 1HZ9A 5EPLA 4LFAQ 4PMBA 4ZRZA 3BZCA 3F2UA 1VF7A 1VQIA 1CQVA 1A6XA 4LF4L 1B53A 3GTQB 5J1ZA 2FINB 5CV5A 5I4DA 4IUQA 5K36H 5T1GA 2I5LX 2Q2HA 2HHHL 4JV5L 2HCIA 3I91A 1WCMG 1Q3LA 5DM63 3ICEA 2PQEA 3GV3A 3UE1A 1EFWA 1EY0A 3IL8A 1K3BC 5IT9L 2WFWA 1A15A 2JA8B 3U58A 3PO2G 1EYDA 4DV0L 1PYBA 3I2ZA 4BBRB 3PF5A 2ICIA 3DWPA 4O1NA 2R93G 1CKMA 3J7AF 1JWSD 3HOWG 5E1FA 1CKOA 1OXUA 4IFDH 1JJCB 1GM5A 3KJPA 1HFGA 4ZUJA 4JI2L 1UUPA 1B3AA 3OMCA 1WTOA 3W1GA 4C3JB 4Q0FA 3SGIA 1BO0A 3GTLH 3GTJH 2NN6I 2JA7G 2AQ1B 1KHIA 1U4MA 4RHRA 4A3EB 4RG1A 4CJ2C 3C46A 2Y0SB 1EEFD 1YI2A 2OXPA 4P72A 2K5QA 1ZEQX 3L9AX 3OPOA 3IRBA 3OIQA 5E7NA 4OO1G 3S2HH 2EPBA 4P74A 2A5HA 4ZYSA 4K5VA 3HZXA 3M4YA 5G3LD 2BCOA 2R61A 1TS3A 3CF5A 3G6EA 3DEPA 2YTXA 2ALYB 3SR1A 4B3MQ 2Q2IA 3CQZH 1PMRA 1SMYC 1T5EA 4DR5Q 3ZYYX 1UE6A 1IKMA 1KLUD 4WFN3 2JA8G 2LMCB 3HRZC 2EE1A 4IPGA 4JOIC 5C3XA 5DLQE 4KY7A 1DONA 1CHPD 4H02A 1ICWA 2HUGA 4RGMA 4C2MB 4HJ9A 4DR3L 4HIDA 2EYLA 2J0TD 3GTPB 1VMPA 3ND8A 3S1QH 5CC4A 1H95A 3SDZA 5C4XG 3MFGA 4GKKQ 1WFQA 4WJWA 3J81i 2NWGA 5H1SE 1ENAA 4DAMA 2JA6H 4DAYB 2B63B 3P1HA 4C3JG 5HURA 2YU9B 3E9IA 3AYHB 4A3GH 1TWCB 2AQ3B 4A3EG 4G57A 1JQYD 3A8IE 2Y0SG 2NVQH 1FNUA 4LAAA 1GVPA 1WTXA 2NTSA 3Q6SA 1STGA 1DOMA 2XWJB 1HQRD 4UPAA 5EKIA 1KAAA 3MTSA 2NZ1D 2A73B 1MGSA 3D4RA 4A3MB 4YWMA 4L5QA 2DY7A 2BH8A 2WP8J 1CFMA 1CA6A 1JT8A 3NTHA 2F3VA 1OXSC 2RHSB 3A7AB 4EX5A 2CH4A 3CKIB 5IGCA 4BS9A 3IKJA 3PIP3 1M8AA 1NR4A 3KLSX 1HXYD 4DV2Q 2K04A 3GTKH 2KOLA 3CCJA 2PW7A 1A3UA 1T5XD 1KDAA 5EKLA 3VYTA 2BDNA 3OMGA 1PTOC 4JI1L 4P75A 5GAGC 2F4IA 2CCZA 4RAUC 4OXPA 5BN5A 1TKWB 3D6CA 4R1JA 1YZ6A 1JB3A 1FJGQ 2EYFA 2IW3A 2B63G 2A6ED 2IPKD 3J81L 1SE3A 3QO2A 3TS2A 4CKCA 3K59A 3NWSA 1SBBB 4LFCQ 3PUVA 4YHHQ 3CPWA 1NMFA 1JE5A 1ZYRC 1G2SA 1CM9A 4A3JB 1Y14B 1VCIA 4YY3L 1UNSA 3OW2A 2BOSA 2EY5A 2E2DC 1XNRL 2EJMA 4A3MG 1M1KC 4DV3L 4AQYL 4R4CA 3S17B 2B2VA 1TWAB 1Z6HA 2QF7A 2VY3A 1NUCA 4RKBA 3RLOA 2JN4A 1QUQB 4DV6L 1T9HA 2PQAB 3ERSX 4PZ6A 1SMYD 3K58A 4FVMA 3ZJYC 4GLAC 4ZQ3A 3S1NH 1JCKB 1PLFA 3H91A 3CD6A 2B39A 4JI4Q 1MHWC 3GTOH 2SEBD 2B8FA 1FGUA 2XRQD 1N32Q 1MKHA 3S1MB 4Y7NH 4WJ4A 2RDHA 1EYAA 3LX0A 3K5LA 4QIWB 3TDQA 1MI2A 1D6EC 5CV6A 4A3JG 3J81j 4FF2A 2B2YC 5KEEA 3JAML 1XMQL 3KOJA 1VQKA 1PRTC 3HKZE 2VS1A 1NY4A 2QGQA 4WORA 3RZDB 2WKDA 5C5MA 1ET6A 4DV4Q 4KJOA 2EYOA 2K52A 5HGTA 4A76A 1GD7A 1O80A 1HR0Q 1HHVA 3P20A 2KENA 4APVA 4KY5A 5M9OA 3HOVH 1F9RA 1Y1VB 4ZKBB 4QUCA 2JXMB 4U673 3T1HQ 2WB1E 4LFAL 1I6HH 4BXXG 1VQ4A 5M3MH 2KCTA 3CU7A 4E6IA 1I5FA 2UUBQ 3TRZA 1OXXK 2UXBL 5C4JB 1YNXA 2K14A 5ELEA 5IWAL 1PXUA 1E22A 1SYBA 1PTOD 5EQ0A 4WRDA 2VZAA 1WJJA 4DK0A 3D4WA 1HTLD 1PYWD 1PH8A 5E4XA 1EY9A 1K8GA 5C3EH 1VQOA 3F2DA 1XMOQ 1LACA 1RJTA 4O42A 1GHKA 1FD7D 2HIVA 4A3DB 4DAVA 4LF4Q 3KF8B 3T16A 4LFBL 4BY1B 5FO8B 5BR8L 1YHQA 1V1PA 1ZYRD 1UE5A 4RA8A 3IFTA 2PCFB 1TT2A 3NELA 2DJFC 1L1OC 1YHAA 1V8QA 2XVSA 3BG3A 1Y1VG 3CCEA 4MHEA 2E2HB 3K5NA 1VMCA 1VQ8A 3ERQA 4OWTB 2WAQB 4LUOA 1ESRA 2PZTA 1D2BA 4DV0Q 3EA6A 3PO3B 2HDMA 3I73A 3UE0A 2KECA 2YTYA 2F0WA 3RNUA 2DUDA 2E8GA 1SE2A 1EOVA 3HEJA 1K3RA 1PH6A 4FXGC 1C48A 1RTNA 1TS2A 1SXTA 3CXCA 3FVQA 1XYIA 4KKTA 5IGGA 4PG3A 5ELFA 1TQOA 4DFAA 5C0XG 4N8FA 4JI2Q 1UE7A 1SNQA 4GNXA 3CCVA 4RHSA 2DN8A 3TP7A 1WYDA 3FP9A 4NMZA 5GADC 4HJ8A 2AHOB 1K83B 4A3DG 1VQ7A 5A2QE 3ULJA 3S1RB 2NVXH 2CVRA 1XJVA 4DR1L 1V1QA 3KUPA 5IY0A 1X3GA 1VQMA 1AN8A 4GKKL 1PRTD 2NVTH 5J3BA 1DOLA 3M4QA 2CW0D 2B2WC 2A68D 1AH9A 4A93B 2KEEA 2AWNA 3PUWA 5DM73 1BVSA 3QWNA 3M85A 3NHHA 2WAQG 4A3GG 3X3MA 1HA5A 2R92B 3CC4A 3PO3G 2GVBA 2H1EA 3J80L 3DUZA 5E4WC 3H0GB 5I9PA 1WD0A 4POGA 4DR3Q 2PZUA 3PQIA 1ICFB 4OHJA 4LUVA 3M7GA 2MHVA 5IP7G 3FPPA 2K33A 3D8GA 1BKBA 3NP8A 4A3FB 5JJIA 4QF4A 3HOZH 5M5YB 3L3OC 4GN4B 2NN6G 1C7YA 2Q2UA 2YV5A 5EBCA 3LGJA 1NSNS 2Z1CA 3MC0B 5M5XH 4DV2L 1QNKA 1E3PA 3CC7A 2PPBC 1GUSA 4A3KH 4EGVA 4G7ZC 5IGBA 1Z7TA 1VQHA 2QA4A 2JP1A 1RHPA 3SK4A 1EU4A 1VQAA 3RLFA 2B3GA 5M5WH 4A93G 1HRJA 4IFDJ 1TY0A 4LFCL 2L1BA 5C6AA 2KEDA 2R92G 1LUZA 2SOBA 2O2LD 1H9SB 3I7FA 2K4KA 4X62L 2OWOA 3MXUA 2A6HC 1NBWA 4UHVA 3H0GG 4GN5A 4XQQA 4X3TA 4KLKA 4MNOA 4C1NI 1JICA 2F0MA 1YNJD 4KKUA 4JI1Q 2R7ZB 1D1KA 2RSNA 2EY1A 3H15A 4FO2A 4A3FG 1JJ2A 3BVGA 1SROA 3PCOB 3CMEA 4AYBB 1C9OA 4HTHA 2HQLA 2LXJA 3CCUA 1BDOA 2VNUD 3STBC 1VQBA 2ZTEA 1FNWA 3PMFA 4DAYA 3TP6A 2M00A 2JQOA 3I4MB 4TRDA 3C3LA 2KHIA 5C0XJ 1RF2D 5EJWA 1C4QA 4RGOS 1PTOB 1J5EQ 2QCPX 1DJRD 2XSCA 1XWEA 4YY3Q 2KHJA 1XNQL 1TWFB 1I6HB 2O5JC 4JI0L 4IJLA 4MZ9A 2NVYH 4L63B 3I3CA 2F0HA 1BCPD 1XNRQ 3VA5A 3LWUA 2IHEA 1CQFA 4JI4L 3HOUH 1EY4A 1ILQA 3KBGA 3TSSA 1S5CD 2HIXA 4LF7L 4C3HB 5CV7A 4BBSB 3M4OB 2TMPA 2O4XA 2L12A 4UY8C 2B8GA 4DK1A 2O5IC 4DV6Q 2AUKA 1JJGA 5D3IB 2F3WA 1PFMA 2F0DA 3CCLA 3DXJC 1TWGH 4LF5Q 2JEAI 5ISRA 3R3OA 5FLXc 4DV4L 2QKIC 2RDFA 4AYBG 3KYHC 3S14H 1ONLA 1JC7A 4A3IB 1AP0A 3EVQA 3VA7A 4GN3B 2VB2X 2EXZA 2XN9C 2H4OA 3I4MG 3LNNA 3RLNA 3GTMB 4EQOA 3CCMA 2OQKA 3WWVA 3EQLC 1F9SA 1NE3A 3K7AB 1CHQD 2EYHA 1XMQQ 5JPNC 1S5ED 3FPUB 2FJ2A 4J6HA 3G48A 3I70A 4CDEC 1GUWA 1UEAB 1B7YB 1MD2D 1DYQA 3G4SA 5CV8A 3S15H 2ZT9C 3WDNA 1KTKA 1VF5C 4QB4A 4C3HG 4BBSG 3S9WA 1Q12A 1SR3A 4R4IA 4HJAA 1NMGA 3EN2A 3M3YH 4BA2I 4JI5L 1PRTB 1STEA 4QY7A 1QUQA 2F0JA 1N36L 2F0VA 1XMOL 2EVBA 2N78A 3FKIH 5C3EG 1ILPA 4DN4M 2F0PA 1SDFA 1P8LA 4I7AA 1FYCA 4A3LG 4K6LA 4DNTB 1Q8KA 1Q90A 1IHZA 4OWXB 2UXBQ 5FKAC 2C35B 3N52A 3VR5A 1SEBD 4A3IG 1Y8NB 4KV6A 5JOBA 4GLVB 5IWAQ 2CHBD 1AFPA 1C0AA 1X54A 3U9OA 3KDFB 2GN5A 4PZ8A 1A2UA 1TWHB 2L0CA 1HUMA 3URYA 5G3LF 5IYBH 4X3UA 3GD7A 5IT9c 5C44H 3H09A 1VQLA 3R2IA 1X6OA 2K5NA 3STBD 3DLLA 2ASBA 1D5XC 4GZYC 2K28A 4DUZQ 1VQ6A 2CWAA 5BN3A 1SSOA 3A8KE 1OO9B 1OTCA 3GO5A 3I72A 3CCQA 2L15A 3HOXH 5AJ3L 3MZ5A 4LFBQ 1O7LA 3CRLC 3QJYA 5BR8Q 1BNZA 4HMIA 1J9OA 2MQHA 5C4HA 2CFMA 1RL2A 3UDXA 4KHZA 2BA0A 3NWTA 5LMNL 1QVGA 4A3BH 5C4XB 5T1IA 4JI7Q 4K8IA 3GP7A 1SFOH 3FMCA 4GOPA 5EPKA 3SK6A 3WOEA 1I4XA 1NNXA 2KQ3A 1EY6A 4JYAL 1FVIA 3MXNB 1LTBD 3T4AC 1SLJA 4YCUA 5K5PA 2VUMH 5FLXE 1DGSA 3EFXD 3T53B 1UE1A 1L1OB 4UP8A 4IPDA 3I4NB 3KJOA 1PHJA 1A2TA 3BS1A 1H9MA 2PMZE 2E74C 2JJQA 4KTAA 3GTGH 5C5LA 1QJOA 5CV9A 3G71A 3PV0A 3U50C 3EJIA 4BY7H 1JR0D 1F2YA 4QCLA 2NB0A 1STBA 3NBIA 1MJEA 3EBEA 2JA5H 1JWMD 4DR2L 4RCOA 4LMQD 1SNPA 3CP0A 2KBNA 3UDIA 3K80C 4HR7B 1SAPA 1B2TA 2AUJD 3KF8A 2DY8A 4FP5D 4ILWA 1YHBA 3PIOA 4DR1Q 4ALPA 3K6OA 4JG2A 5I6YA 2B2VC 3W3AA 1N8RC 1WI5A 1BCPB 3BVZA 4IPCA 2JSOA 2WINB 2F52A 2LFNA 2QILA 2NYZD 4H0LC 4CDCC 1WTQA 1EIGA 3TP5A 2Z8LA 2XGTA 1TVXA 4L5TA 1PFBA 3I4NG 5DEHA 1B9NA 3DM3A 1LTRD 1S5DD 4JBKA 2MP1A 4B3TL 4YCVA 5IT9E 3SK5A 3FRPB 1PYSB 2EYPA 2E5LQ 5KNCA 5IYCH 4C3IH 3L2PA 3K0XA 1QB5D 5BN4A 2KJXA 4X64L 3S2DB 1GXDC 4FYDA 5COYA 4IUPA 2F0UA 3BU2A 3A56A 4IJHA 4GLXA 5IYDG 2F4VL 2D62A 1EQQA 4RMFA 1A3VA 4TVAB 3Q22A 1W3SA 2FHTA 2EY6A 3PUZA 2D5DA 2IY5B 5KIXA 2KUMA 2Z6KA 1BBWA 2K5HA 4HMJA 4ZKCB 5FJ8H 2E2IB 2K01A 4X66Q 3J81c 5JEAH 3NQTA 5IGEA 3OOCA 3C1EA 5D65A 3CMAA 1IBLL 3F2BA 4A3CH 1JWUD 3NK9A 4K2LA 4N9PA 3A5UA 4PZ7A 2R6GA 4ME5A 3JAMi 1TU2B 1J5EL 1JE4A 1STNA 4J8QA 4HJ7A 3ONAB 1KQSA 3RR5A 4X62Q 3CAMA 4QUFA 4G7OC 3NE5B 4KK7A 4UDUC 1OXVA 1YJWA 2CH4W 2Z4IA 4JI6L 1HNXQ 1GUNA 3KLRA 3OYYA 1E24A 1Q8IA 2XTIA 4JBJA 1ENFA 1Q81C 1LT3D 3A74A 2BE5C 2PZWA 4YIJA 1EY8A 3QIAA 4RCNA 2E2JH 5EGTA 3HOYH 3SEBA 1WOCA 4QIWE 2HT1A 5AFWA 3OTOL 1N9WA 3ER0A 1EY5A 3CHBD 3A8JE 4JBMA 1LYLA 3RZOH 1UWVA 1SMXA 1XNQQ 1BXTA 2LKVA 5IP9G 4JI0Q 1SYFA 2QDLA 3SXHA 4LF5L 3R2TA 4DPGA 1G8ZD 2PYKA 2RCNA 2KHSA 1PZKD 3QR8A 2JYOA 4NPSA 3RMHA 4LUZA 4F7XA 2HCCA 1QE6A 4LF7Q 4B08A 1E1TA 5KNDA 2BH2A 3ULPA 1VS0A 1IZ6A 2ES2A 3I4LA 2OEOA 1PTOF 3DWAA 1YITA 1H9SA 3JAMc 3CRKC 1LTID 3E5SA 4HCEA 3OIPA 3DMUA 1TS4A 1IBMQ 4NXML 1HNZL 1IYVA 2E76C 2L5TA 4P2CB 2A69C 2MO0A 3OWEB 2IL8A 3VYRA 1WTRA 4XQNA 4F88A 1PH1A 1JOKA 2XIWA 2K5VA 4DV5L 1QZGA 1BF4A 1RKNA 2PI2A 1PVOA 4GNXC 5FLMG 1HPCA 1I50H 3BDCA 3T51B 3GTLB 1KIXA 3QOLA 3FKIG 1N34L 2X6GA 5EAYA 3GTJB 1E1OA 5M3FH 1F9QA 2Z9HA 1VQ9A 3G7LA 5FO7B 1E2VA 3S16H 1SE8A 2EOTA 4KMUC 2EIFA 1Q7YC 1MBYA 1VQEA 4IUNA 3J81E 4XYQA 2H5XA 1Q82C 3KFUA 2EYMA 3NBHB 1PH9A 3C1FA 1MIUA 1Q1BA 2PNRC 3S2HB 5K36G 1E7ZA 3HFZB 5EKKA 4H7BA 1Y1WH 1B50A 3DHQA 5FK9C 2HQEA 1X3FA 2OQ0A 4ID6A 1XPRA 4NKLA 4JW0A 4LW1A 2NZOA 2SDFA 3CQZB 1XPUA 4U68A 1YIJA 4JI5Q 1N36Q 2V4DA 2A8VA 1SRUA 2AMCB 5NUCA 2WAQE 4PNYA 4DUZL 5DAUA 3X3NA 1PA6A 1LTSD 1K9MC 4FDBA 2QEJC 1GJXA 1DXMA 1BUVT 1ZXTA 4X6AH 4G4KA 2MNAA 3O13A 3S1QB 4A3BG 4JI7L 2F3IA 4IFDG 2ICEC 2GVAA 1VQPA 3MEFA 2JA6B 1PRTF 1CK1A 3Q0AA 1KDBA 3J80i 1HZAA 1B70B 1EZ6A 4DK6C 1O7YA 2BE5D 4A3GB 2HDLA 3D3RA 4EVOA 4DA2A 1BR9A 2NVQB 4Y52H 4LNQA 5AJ3Q 3U9SA 1WCMH 1G2TA 3NSWA 5LMNQ 3BYTB 1VDZA 1STYA 2LY7A 1HNWQ 1PDQA 3TREA 2RDGA 3PO2H 1EIHA 2KCCA 4OWWB 1D7QA 2XRSD 3J7A5 1H9JA 3HKZG 4DGZA 4XTCS 2NBFA 4JYAQ 1CKNA 3NTIA 3AU7A 2QEXA 4R4QA 3D6WA 2R93H 3RN5A 4FXKC 1F77A 3GTKB 3HOWH 1ENCA 3PUXA 1WD1A 4V0BA 2VQFQ 1N33L 1R9TH 2L9HA 3UDGA 2B2TA 1YBYA 1BQQT 2JA7H 1ESFA 2WV6D 2JA6G 4H44C 2F0SA 1YJ9A 2BDOA 3OHXC 1QILA 3GTQH 4K2KA 2QW7A 3TS0A 4HSPA 4RKLA 1K8AC 1NR2A 4OO1H 1LLRD 4DR2Q 2N8NA 3J80c 4POFA 1UEBA 4GS3A 1GUTA 4ABNA 4CJ1B 3MXGA 2WACA 1B9MA 1YNNC 2YTVA 2MUYA 1HUNA 2JK8A 4HSVA 4IOAA 2HD3A 1LT5D 1SNOA 2KA7A 1SYEA 5LL6S 1XTDA 3TMEA 2JA8H 1PH4A 4JPBW 4L5SA 4ZUIA 4CDDC 3I90A 2E5LL 2L55A 3A54A 2ZTCA 4C1NK 4CKEA 4C3IG 2ENBA 3MAQA 4BBRH 2FMMA 2KVMA 1K0RA 5ELDA 4I7ZC 3MXNA 1JB7A 1AEXA 1STAA 4IUUA 1Q46A 3HGBA 3PSIA 4DR6Q 4KKSA 1MSGA 2B2UA 4QMGA 2NTTA 1IXRA 3S1NB 1Q86C 1CTMA 2L4NA 2R7DA 4ZLTF 4C3JH 3K7UC 1L0YB 4OELB 4B3TQ 1GKHA 4X66L 4FF1A 4A3EH 5JEAG 1AZQA 1BCPF 3GTOB 2ZXPA 2PI2E 1V43A 4X64Q 3DWQA 2Z0SA 2DJGC 4Y7NB 3I55A 1QVCA 1F2LA 3V05A 3W5OA 2EXDA 4DAPA 2MFIA 1YJNA 2F4VQ 4S3SA 2Q8IB 4B9XA 4DV7Q 4KD4A 2C5CA 3ND9A 4NP5A 1RODA 1NJIC 1SJED 1LT6D 1HNXL 4ZCKA 4L8JA 2SNMA 2N49A 2UXCL 2AKWB 2J7ZA 4RGTA 4CBVA 1AW7A 1HJPA 3OW7A 1EL0A 2RVLA 1WTHA 1IBLQ 1KXLA 3PIPA 1KC8C 5CMDA 1F2ZA 4C2MH 1EU3A 3HOVB 3GTPH 3M4PA 5I9OA 1GHJA 3MFYA 3QB3A 1EWHA 4XIGS 4R4TA 3AEVA 2DNEA 5I2XA 3H3VH 5IIFA 2F0TA 3A55A 1KABA 5M3MB 2B63H 4JI6Q 5LL6X 3T1YL 2K50A 2YU9H 1TWCH 2CWPA 1HR0W 1U9RA 1RTOA 1GUOA 5EPJA 4PV1C 1VQCA 3OTOQ 4MTKA 2PW5A 2EYJA 4YCWA 5C3EB 4XT3B 2DGYA 1EQRA 4R8IA 4A3MH 1GO3E 2IX0A 1IBML 2MGSA 4YWLA 2I5MX 3CCRA 4RGNA 3H94A 4BWGB 1L2FA 1F2MA 3Q8DA 4JCVE 3E0JA 3E0EA 1PZJD 4LJZC 4JC0A 4GOPC 1YNND 1C8CA 5FO9B 1U0LA 2P5ZX 1D5MC 2JA9A 1K0SA 3HOVG 1U5KA 2RQXA 3I8ZA 3ITPA 4KHPL 1MJCA 1VQJA 4O0AA 2OF1A 1V1PB 4R9WA 1EIYB 5M3MG 4RWSC 2RSOA 4XXEA 4NXMQ 4PMWA 1HNZQ 4DXGA 1R4QB 3NUCA 2D2CC 1O7IA 2KCNA 2FMCA 4A3JH 1G91A 4DV5Q 1Y69U 5FOBB 3DM1A 2MPMA 5JEAJ 1Y8PB 3CC2A 2F0EA 4K6DA 1LV9A 5HY6A 2PQAA 3L0OA 1N34Q 3MA2B 1EWIA 3HG9A 3LWEA 2ZJQA 3KLSA 1EEID 3S17H 1S40A 4XYOA 1SE4A 1TWAH 2B29A 4PQXA 1JOOA 2NVXB 2A6HD 1G51A 4R8NA 3U4VA 4XQJA 2N3SA 1KRSA 4GNXB 5C0XI 1RDPD 2UUCQ 5LHY1 2NVTB 4OX9L 1FR3A 4BXXH 2EJGC 1W2BA 4HJ5A 1B3QA 3J7ZC 2MO1A 5ELOA 1IW7C 4DK3C 5JJKA 2RKSA 1QWYA 1W6KA 3A0JA 1XPOA 1H9KA 2Y0SE 1G6ZA 2ATWA 2K75A 4G7HC 5ELBA 2LSSA 5JPMC 3S1MH 2OTJA 1XX8A 3VDYA 3HS0C 3BZKA 1DOKA 1LTGD 2EDGA 3CCSA 3EIVA 4K8JA 5GQOA 4EQPA 4HIOA 1IL8A 1HNWL 1HQMC 3I56A 3HOZB 4CKBA 3GQBA 3MWYW 1EY7A 3F2CA 1CA5A 3GDEA 1CSPA 4LF6L 3HKSA 4KN4C 2ZJPA 3NXWA 4AH6A 1FL0A 3RZDH 5HGQA 2A6EC 4NDXA 5M5XB 2DNCA 4FF3A 2K5WA 4IOCA 2VL6A 4QJFA 2VQFL 3Q24A 3VYUA 1K73C 4A3KB 1VQDA 1SN8A 2Z6KC 4A75A 4EQ5A 1XXGA 3NBHA 1Y1VH 3Q23A 2UU9L 4K0KL 3K8AA 4B3RQ 2Q8RE 1QOHA 2EQSA 1CUKA 3KBXA 5M5WB 3W2DA 1JMCA 5GAHC 4JI3Q 4IURA 2K7VA 1BOSA 4ME3A 5C4JH 3BYYB 1STHA 1WTPA 4ZAIA 2ID0A 5J22A
chains in the Genus database with same CATH topology
4OIKA 3K5MA 1X32A 2X69A 5C0XH 2M9VA 1DM0B 2YYZA 1KNAA 2IWHA 4TSSA 5E3FA 3K0YA 4BA1I 3BDLA 4RFBA 3GV6A 5KYIA 3TZUA 1CZGA 1UAPA 5TSSA 1NAPA 2PMZB 5F2DA 2NVYB 3N6RA 2EJFC 1O78A 3BVMA 5CR3A 3HOUB 3J7AV 3NQIA 1ET9A 5IGDA 1HFNA 3IFDA 3RUZA 2FFKB 2K03A 5D3DA 2IJ0A 1LTAD 4HAEA 3VR2A 4JBWA 1K8OA 1IW7D 1RD9D 1TWGB 2K1BA 4HEDA 1O7ZA 4IALA 4XT1B 2NN6H 2BA1A 3S14B 1S4ZA 3VR4A 3QOJA 3J7YW 1ZKOA 3SK8A 4MIUA 1QG7A 5CORA 3VR6A 5IGFA 2AQ2B 5KGUA 4DXFA 1QNUA 2Z4HA 4HN7A 3S15B 4K5WA 1I4HA 1K8MA 3M3YB 4XDXA 4H13C 1LTTD 2SNSA 2CQAA 3FKIB 1WVLA 3VR3A 5EBDA 4KHVA 2IX1A 1GUGA 1Z47A 4ULLA 3MVVA 2F03A 1JORA 1IKLA 4KY6A 3K5OA 1U4PA 2R3ZA 3FEWX 2F0KA 1SYGA 5JJZA 4TQUS 5C44B 1WTWA 1S5FD 2OT2A 4C56C 5CV4A 3HOXB 2F0LA 5J39A 1EFID 3D31A 2F0OA 2G9DA 2GA4B 4X3SA 2VXWA 2TSSA 4A3BB 4ODGA 4Z9CB 2MJ8A 1B4OA 1SFOB 3FDTA 1EZ8A 3RD4A 1JOQA 1SYCA 1R4PB 4KI0A 2CW0C 4DNRB 2A68C 1GOZA 2VUMB 3SHLA 2PO4A 2N55A 4IQZA 2JEBI 5A2QL 3H6MA 3R93A 3TP8A 2B2TC 4F87A 1PTOH 3GTGB 3UI2A 4PMCA 3HKZB 4FXDA 1LABA 4BY7B 2F0QA 4KD3A 1H9RA 4L6TB 1NCVA 4IN3A 4OO1I 2JA5B 1AZPA 1RCVD 1EQVA 1BBXC 1MSHA 1DD2A 2F1MA 3QG1A 1FNVA 2WB1B 4OL7A 3NTKA 1SNCA 1SJHD 5C3WA 1LO5D 3HP3A 4IUTA 5JVG3 1OXTA 1TR5A 3M7NA 5I2YA 2B2UC 5CYUA 1SYDA 3OSOA 2E75C 3BDOA 1F9PA 2JE6I 2N88A 2XNAC 5KYLA 1CZWA 1YNJC 1HCZA 4M8AA 3JAME 2I07B 2EY2A 2IX3A 1S5BD 2B2YA 4C3IB 1D1IA 1J8IA 3V2TA 3A7LA 2K05A 1I4PA 1HA6A 4N9TA 1D5ZC 4K14A 1FGBD 3PIO3 1HTPA 4TKOB 4J1MA 3WOFA 1TS5A 4F8MA 3H3VC 2A69D 1BCPC 1EYCA 5A35A 4KJNA 2QDBA 3P7JA 3NPPA 1I3QB 1PFNA 3T56B 2F0NA 1E2WA 1X3QA 4CHTB 2F0GA 1V1OA 4IUVA 1KNEA 2K6AA 3AB9A 1KLGD 2E2JB 3HOYB 3VYSA 1EWCA 4DU9A 5I6WA 3TZDA 2RBMA 5JAVA 1W6JA 4V190 3RZOB 1LT4D 4HCSA 3D4DA 4FF4A 1SNDA 3SE0A 5C4ZA 3P75A 1A3TA 1DZ1A 2L11A 3V96A 4M1UB 2D9UA 2WKCA 2F0FA 1M4VA 4X3KA 1EOTA 2IT1A 2M2LA 3R8BA 1PZID 4K5XA 4OIJA 4UAIA 3T13A 3G6JB 2RA4A 3E6ZX 1QCBD 4OGQC 2ZXRA 1I50B 2K5DA 3OWFA 4CGYB 3TN2A 4ZK9B 5M3FB 1G291 1I4QA 3S16B 2WIIB 1CT1D 3EROA 3AMUA 2B2WA 2AWOA 5D14A 1Y1WB 1TIID 3J80E 1B1ZA 1I4RA 1SNMA 1B44D 4Q5VA 1I4GA 5KNBA 1DCZA 2EZVA 2K32A 5ELCA 4RH6A 4CJ0B 1U4LA 1X3PA 2C9OA 2J4XA 1WTVA 1L0XB 2X6LA 1I6VC 5CGKA 5DNFA 3K57A 3KK7A 1Y8OB 4LK1C 1XTCD 2VB3X 4DF7A 4IZ8A 1CI3M 2I46A 3IAYA 3SVMA 1U4RA 3BZDB 4KN7C 5IOCA 5KRUA 3C2PA 5CBAE 2A74C 1ML0D 3MXPA 2NUCA 1EQTA 4EQNA 5FLXL 4JK1C 1Q1EA 2Q8TA 4B9WA 4IFDI 5IODA 1WCMB 3DEOA 3L7ZC 4MN3A 4I65A 3PO2B 1E0BA 2LS01 2G9HD 2ZXOA 5CBEE 3MHBA 1TY2A 2XWBB 4NW2A 2F0IA 2R93B 3TBIB 1KDCA 3HOWB 1IYUA 4FNFA 3MEHA 1R9TB 1II3A 3PUYA 1E2ZA 5JVH3 2JA7B 5EPLA 4PMBA 4ZRZA 3F2UA 1VF7A 1CQVA 1A6XA 1B53A 3GTQB 5J1ZA 2FINB 5CV5A 5I4DA 4IUQA 5K36H 5T1GA 2HCIA 3I91A 1Q3LA 5DM63 2PQEA 3GV3A 1EY0A 3IL8A 5IT9L 1A15A 2JA8B 1EYDA 4BBRB 2ICIA 3DWPA 4O1NA 3J7AF 1JWSD 5E1FA 1OXUA 4IFDH 1HFGA 4ZUJA 1UUPA 1B3AA 3OMCA 1WTOA 4C3JB 4Q0FA 1BO0A 2NN6I 2AQ1B 1U4MA 4RHRA 4A3EB 4CJ2C 3C46A 2Y0SB 1EEFD 2OXPA 2K5QA 1ZEQX 3L9AX 3OPOA 3OIQA 4OO1G 2EPBA 2A5HA 4ZYSA 4K5VA 3HZXA 3M4YA 5G3LD 2BCOA 2R61A 1TS3A 3DEPA 3SR1A 1PMRA 1SMYC 1T5EA 3ZYYX 1IKMA 1KLUD 4WFN3 2LMCB 3HRZC 2EE1A 5C3XA 4KY7A 1DONA 1CHPD 1ICWA 2HUGA 4RGMA 4C2MB 2EYLA 2J0TD 3GTPB 1VMPA 3ND8A 5CC4A 3SDZA 3MFGA 4WJWA 2NWGA 1ENAA 2B63B 3P1HA 4C3JG 5HURA 2YU9B 1TWCB 2AQ3B 4G57A 1JQYD 3A8IE 1FNUA 4LAAA 1WTXA 2NTSA 3Q6SA 1STGA 1DOMA 2XWJB 1HQRD 5EKIA 1KAAA 3MTSA 2NZ1D 2A73B 1MGSA 3D4RA 4A3MB 2DY7A 2WP8J 1CFMA 1CA6A 3NTHA 2F3VA 1OXSC 3A7AB 3CKIB 5IGCA 4BS9A 3IKJA 3PIP3 1M8AA 1NR4A 3KLSX 1HXYD 2K04A 2KOLA 2PW7A 1A3UA 1T5XD 1KDAA 5EKLA 3VYTA 2BDNA 3OMGA 1PTOC 2F4IA 4RAUC 5BN5A 1TKWB 3D6CA 1JB3A 2EYFA 2IW3A 2A6ED 2IPKD 3J81L 1SE3A 3QO2A 4CKCA 3K59A 3NWSA 1SBBB 3PUVA 1ZYRC 1G2SA 1CM9A 4A3JB 1VCIA 1UNSA 2BOSA 2EY5A 2E2DC 2EJMA 3S17B 2B2VA 1TWAB 1Z6HA 2QF7A 1NUCA 4RKBA 1SMYD 3K58A 4FVMA 4ZQ3A 1JCKB 1PLFA 3H91A 2B39A 2SEBD 2B8FA 2XRQD 3S1MB 2RDHA 1EYAA 3LX0A 3K5LA 4QIWB 3TDQA 1MI2A 1D6EC 5CV6A 4FF2A 2B2YC 5KEEA 3JAML 1PRTC 4WORA 3RZDB 2WKDA 5C5MA 1ET6A 4KJOA 2EYOA 5HGTA 1O80A 1HHVA 3P20A 4KY5A 5M9OA 1F9RA 1Y1VB 4ZKBB 4QUCA 2JXMB 4U673 3CU7A 4E6IA 1OXXK 5C4JB 5ELEA 1PXUA 1SYBA 1PTOD 5EQ0A 4WRDA 4DK0A 3D4WA 1HTLD 1PYWD 5E4XA 1EY9A 1LACA 1RJTA 4O42A 1GHKA 1FD7D 4A3DB 4DAVA 3T16A 4BY1B 5FO8B 1V1PA 1ZYRD 4RA8A 3IFTA 2PCFB 1TT2A 1V8QA 2XVSA 3BG3A 4MHEA 2E2HB 3K5NA 1VMCA 3ERQA 2WAQB 1ESRA 2PZTA 1D2BA 3EA6A 3PO3B 2HDMA 3I73A 2KECA 2F0WA 1SE2A 3HEJA 1C48A 1RTNA 4FXGC 1TS2A 1SXTA 3FVQA 1XYIA 4KKTA 5IGGA 5ELFA 1TQOA 4DFAA 5C0XG 1SNQA 4RHSA 2DN8A 3TP7A 4NMZA 1K83B 5A2QE 3S1RB 2CVRA 3KUPA 1AN8A 1PRTD 1DOLA 2CW0D 2B2WC 2A68D 4A93B 2KEEA 2AWNA 3PUWA 5DM73 3QWNA 3M85A 3NHHA 3X3MA 1HA5A 2R92B 2H1EA 3J80L 3DUZA 5E4WC 3H0GB 5I9PA 1WD0A 2PZUA 4OHJA 3M7GA 2MHVA 3FPPA 2K33A 3D8GA 3NP8A 4A3FB 4QF4A 5M5YB 3L3OC 2NN6G 5EBCA 1NSNS 2Z1CA 3MC0B 1QNKA 2PPBC 1GUSA 4EGVA 4G7ZC 5IGBA 1Z7TA 2JP1A 1RHPA 3SK4A 1EU4A 3RLFA 1HRJA 4IFDJ 1TY0A 2L1BA 5C6AA 2KEDA 2SOBA 2O2LD 1H9SB 3MXUA 2A6HC 4XQQA 4X3TA 4C1NI 1JICA 2F0MA 1YNJD 4KKUA 2R7ZB 1D1KA 2RSNA 2EY1A 4FO2A 3BVGA 4AYBB 4HTHA 2VNUD 1BDOA 1FNWA 3PMFA 4DAYA 3TP6A 2M00A 3I4MB 4TRDA 3C3LA 5C0XJ 1RF2D 5EJWA 1C4QA 4RGOS 1PTOB 2QCPX 1DJRD 2XSCA 1XWEA 1TWFB 1I6HB 2O5JC 4L63B 3I3CA 2F0HA 1BCPD 3VA5A 3LWUA 1CQFA 1EY4A 1ILQA 3KBGA 3TSSA 1S5CD 4C3HB 5CV7A 4BBSB 3M4OB 2TMPA 2O4XA 2L12A 2B8GA 4DK1A 2O5IC 2AUKA 5D3IB 2F3WA 1PFMA 2F0DA 3DXJC 2JEAI 5ISRA 3R3OA 2QKIC 2RDFA 1ONLA 1JC7A 4A3IB 1AP0A 3EVQA 3VA7A 2VB2X 2EXZA 2XN9C 2H4OA 3LNNA 3GTMB 4EQOA 3EQLC 1F9SA 3K7AB 1CHQD 2EYHA 5JPNC 1S5ED 3FPUB 2FJ2A 4J6HA 3I70A 1GUWA 1UEAB 1MD2D 1DYQA 5CV8A 2ZT9C 3WDNA 1KTKA 1VF5C 4QB4A 4C3HG 3S9WA 1Q12A 4BA2I 1PRTB 1STEA 2F0JA 2F0VA 2EVBA 1ILPA 4DN4M 2F0PA 1SDFA 1FYCA 4K6LA 4DNTB 1Q90A 1IHZA 5FKAC 3N52A 3VR5A 1SEBD 1Y8NB 4KV6A 5JOBA 2CHBD 1AFPA 3U9OA 1A2UA 1TWHB 2L0CA 1HUMA 3URYA 5G3LF 4X3UA 3GD7A 3H09A 3R2IA 1D5XC 4GZYC 2K28A 5BN3A 1SSOA 3A8KE 1OO9B 3GO5A 3I72A 3MZ5A 1O7LA 3CRLC 3QJYA 1BNZA 4HMIA 1J9OA 5C4HA 4KHZA 2BA0A 3NWTA 5C4XB 5T1IA 4K8IA 3GP7A 3FMCA 5EPKA 3SK6A 3WOEA 1I4XA 2KQ3A 1EY6A 3T4AC 1LTBD 5K5PA 5FLXE 3EFXD 3T53B 3I4NB 1A2TA 3BS1A 1H9MA 2E74C 4KTAA 5C5LA 1QJOA 5CV9A 3PV0A 3EJIA 1JR0D 1F2YA 4QCLA 2NB0A 1STBA 3NBIA 1JWMD 4RCOA 4LMQD 1SNPA 4HR7B 1SAPA 1B2TA 2AUJD 3KF8A 2DY8A 4FP5D 4ILWA 3K6OA 5I6YA 2B2VC 3W3AA 1BCPB 3BVZA 2JSOA 2WINB 2LFNA 2QILA 2NYZD 4H0LC 1WTQA 1EIGA 3TP5A 2Z8LA 1TVXA 1PFBA 5DEHA 1B9NA 1LTRD 1S5DD 2MP1A 5IT9E 3SK5A 3FRPB 2EYPA 5KNCA 1QB5D 5BN4A 2KJXA 3S2DB 1GXDC 4FYDA 5COYA 4IUPA 2F0UA 3A56A 2D62A 1A3VA 3Q22A 2FHTA 2EY6A 3PUZA 2D5DA 5KIXA 2KUMA 4HMJA 4ZKCB 2E2IB 2K01A 5JEAH 3NQTA 5IGEA 3OOCA 3C1EA 5D65A 1JWUD 3NK9A 4K2LA 4N9PA 2R6GA 4ME5A 1TU2B 1JE4A 1STNA 4J8QA 3ONAB 4QUFA 4G7OC 3NE5B 4KK7A 4UDUC 1OXVA 2Z4IA 1GUNA 3KLRA 1Q8IA 1ENFA 1LT3D 2BE5C 2PZWA 4YIJA 1EY8A 3QIAA 4RCNA 5EGTA 3SEBA 5AFWA 1EY5A 3CHBD 3A8JE 1BXTA 2LKVA 1SYFA 3SXHA 3R2TA 1G8ZD 2PYKA 2KHSA 1PZKD 3RMHA 2JYOA 4F7XA 2HCCA 1QE6A 4B08A 5KNDA 3I4LA 2OEOA 1PTOF 3DWAA 1H9SA 3CRKC 1LTID 3E5SA 4HCEA 3OIPA 3DMUA 1TS4A 1IYVA 2E76C 2L5TA 4P2CB 2A69C 3OWEB 2IL8A 3VYRA 1WTRA 4XQNA 4F88A 1JOKA 2XIWA 1BF4A 1RKNA 1HPCA 3BDCA 3T51B 3GTLB 3QOLA 3GTJB 2X6GA 1F9QA 3G7LA 5FO7B 1E2VA 2EOTA 4KMUC 1MBYA 4IUNA 3J81E 4XYQA 2EYMA 5K36G 3C1FA 1Q1BA 2PNRC 3S2HB 5EKKA 4H7BA 1B50A 3DHQA 5FK9C 2HQEA 4ID6A 4NKLA 2SDFA 3CQZB 4U68A 2V4DA 5NUCA 4PNYA 5DAUA 3X3NA 1LTSD 2QEJC 1GJXA 1DXMA 1BUVT 1ZXTA 4G4KA 3O13A 3S1QB 4IFDG 2ICEC 2JA6B 1PRTF 1CK1A 3Q0AA 1KDBA 1EZ6A 1O7YA 2BE5D 4A3GB 2HDLA 3D3RA 4EVOA 4DA2A 1BR9A 2NVQB 3U9SA 1G2TA 3NSWA 3BYTB 1VDZA 1STYA 2LY7A 1PDQA 2RDGA 1EIHA 2KCCA 2XRSD 1H9JA 4DGZA 4XTCS 2NBFA 3NTIA 3AU7A 3D6WA 4FXKC 1F77A 3GTKB 1ENCA 3PUXA 1WD1A 4V0BA 2L9HA 2B2TA 1BQQT 1ESFA 2WV6D 4H44C 2F0SA 2BDOA 3OHXC 1QILA 4K2KA 4HSPA 4RKLA 1NR2A 4OO1H 1LLRD 1GUTA 4ABNA 4CJ1B 3MXGA 2WACA 1B9MA 1YNNC 2MUYA 1HUNA 4HSVA 1LT5D 1SNOA 2KA7A 1SYEA 5LL6S 3TMEA 4ZUIA 3I90A 2L55A 3A54A 4C1NK 4CKEA 4C3IG 2ENBA 3MAQA 2FMMA 2KVMA 5ELDA 4I7ZC 3MXNA 1AEXA 1STAA 4IUUA 3HGBA 4KKSA 1MSGA 2B2UA 4QMGA 2NTTA 3S1NB 1CTMA 2L4NA 4ZLTF 1L0YB 4FF1A 5JEAG 1AZQA 1BCPF 3GTOB 2ZXPA 1V43A 3DWQA 4Y7NB 1F2LA 3V05A 4DAPA 4S3SA 2Q8IB 4B9XA 4KD4A 2C5CA 3ND9A 4NP5A 1RODA 1SJED 1LT6D 4L8JA 2SNMA 2J7ZA 4RGTA 4CBVA 1AW7A 3OW7A 1EL0A 2RVLA 5CMDA 1F2ZA 1EU3A 3HOVB 5I9OA 1GHJA 3MFYA 3QB3A 1EWHA 4XIGS 2DNEA 5I2XA 5IIFA 2F0TA 3A55A 1KABA 5M3MB 5LL6X 1U9RA 1RTOA 1GUOA 5EPJA 4PV1C 2PW5A 2EYJA 5C3EB 4XT3B 4R8IA 2IX0A 2MGSA 4RGNA 3H94A 4BWGB 1F2MA 3E0JA 1PZJD 4LJZC 1YNND 1C8CA 5FO9B 1D5MC 2RQXA 3I8ZA 3ITPA 2OF1A 1V1PB 4R9WA 4RWSC 2RSOA 4XXEA 4PMWA 4DXGA 1R4QB 3NUCA 2D2CC 2KCNA 2FMCA 1G91A 1Y69U 5FOBB 3DM1A 2MPMA 5JEAJ 1Y8PB 2F0EA 4K6DA 1LV9A 3MA2B 3LWEA 3HG9A 3KLSA 1EEID 4XYOA 1SE4A 4PQXA 1JOOA 2NVXB 2A6HD 4R8NA 4XQJA 5C0XI 1RDPD 5LHY1 2NVTB 1FR3A 2EJGC 1IW7C 2RKSA 1QWYA 1W6KA 1H9KA 1G6ZA 4G7HC 5ELBA 5JPMC 1XX8A 3HS0C 1DOKA 1LTGD 2EDGA 4EQPA 4K8JA 1IL8A 1HQMC 3HOZB 4CKBA 3GQBA 3MWYW 1EY7A 1CA5A 4KN4C 3NXWA 2A6EC 4NDXA 5M5XB 2DNCA 4FF3A 2K5WA 3Q24A 3VYUA 4A3KB 1XXGA 3NBHA 3Q23A 2Q8RE 1QOHA 3KBXA 5M5WB 3W2DA 4IURA 2K7VA 1BOSA 3BYYB 1STHA 1WTPA 4ZAIA 2ID0A 5J22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JAV A;  4S3S A;  1A2U A;  3OMG A;  4B9X A;  2OEO A;  5DEH A;  4KD4 A;  4DF7 A;  4IZ8 A;  1STY A;  4ZUJ A;  2F0E A;  2SNS A;  3E5S A;  3OMC A;  4NP5 A;  3D6C A;  4K6D A;  3D4D A;  4OL7 A;  1SND A;  2F0H A;  3DMU A;  4KHV A;  3SK5 A;  5C4Z A;  5IOC A;  5KRU A;  2SNM A;  4DGZ A;  1SNC A;  2EYF A;  4E6I A;  5C3W A;  2EYP A;  3VA5 A;  3MXP A;  2NUC A;  4EQN A;  3MVV A;  3NHH A;  1EY4 A;  3P75 A;  1TR5 A;  5E3F A;  1JOR A;  2OXP A;  1A3T A;  1JOO A;  2F0U A;  3MZ5 A;  5CV7 A;  4B9W A;  3BDL A;  1SYD A;  3OSO A;  4KY6 A;  5IOD A;  1ENC A;  5KYI A;  4HMI A;  1F2Z A;  1SYB A;  2O4X A;  1JOK A;  4R8N A;  5C4H A;  5I9P A;  4K5V A;  3HZX A;  1RKN A;  2PZU A;  4WRD A;  1A3V A;  2F0K A;  5I9O A;  3QB3 A;  5KYL A;  4K8I A;  2EY6 A;  3D4W A;  3SR1 A;  3D8G A;  1SYG A;  2F0F A;  1EY9 A;  5F2D A;  3BDC A;  4I65 A;  3SK6 A;  3NP8 A;  5KIX A;  2EY5 A;  2F3W A;  2KQ3 A;  2F0D A;  1EY6 A;  2F0T A;  3QOL A;  4QF4 A;  5IIF A;  4HMJ A;  1KAB A;  2EY2 A;  2F0S A;  3MHB A;  5CR3 A;  5ISR A;  2RKS A;  3R3O A;  5K5P A;  4K2K A;  3NQT A;  2RDF A;  4IUN A;  5C3X A;  5IGE A;  4K5X A;  2F0I A;  5CV4 A;  4RKL A;  3V2T A;  3C1E A;  3T16 A;  4KY7 A;  1U9R A;  2EYM A;  1NSN S;  5IGD A;  1KDC A;  2F0L A;  3EVQ A;  3T13 A;  2EXZ A;  3C1F A;  5J39 A;  3NK9 A;  1NUC A;  4K2L A;  4N9P A;  4N9T A;  2F0O A;  4RKB A;  4K14 A;  5EKK A;  3RUZ A;  4H7B A;  1TT2 A;  4ME5 A;  1STN A;  3DHQ A;  2EYL A;  3MEH A;  2HQE A;  4ODG A;  4EQO A;  4ID6 A;  1II3 A;  2WAC A;  1A2T A;  5CC4 A;  2RBM A;  4K8J A;  4EQP A;  5IGB A;  4J1M A;  4KTA A;  2PW5 A;  4NKL A;  2EYJ A;  5C5L A;  4ZQ3 A;  1ENA A;  1EZ8 A;  5CV9 A;  4F8M A;  3OWF A;  1SNO A;  1JOQ A;  1SYE A;  1SYC A;  2EYH A;  4PMB A;  3SK4 A;  3TME A;  3P1H A;  4J6H A;  1EY7 A;  5HUR A;  3ERQ A;  3EJI A;  4IAL A;  4PNY A;  4ZUI A;  5NUC A;  1F2Y A;  5DAU A;  5E1F A;  1STB A;  1EYC A;  2PZT A;  3NXW A;  5J1Z A;  3SHL A;  3ERO A;  2ENB A;  5CV5 A;  4KJN A;  4G57 A;  4NDX A;  3H6M A;  2QDB A;  5CV8 A;  2PZW A;  1SNP A;  5C6A A;  4YIJ A;  1EY8 A;  1F2M A;  2SOB A;  2F0W A;  3QOJ A;  4LAA A;  5EGT A;  3TP8 A;  1AEX A;  1EYA A;  1STA A;  4QB4 A;  3LX0 A;  1STG A;  3HEJ A;  3S9W A;  1SNM A;  5CV6 A;  3SK8 A;  2PQE A;  1EY5 A;  1KAA A;  4QMG A;  2F0M A;  3ITP A;  5KEE A;  2F0J A;  4PMC A;  5IGG A;  2F0V A;  1EY0 A;  2F0N A;  4MIU A;  1TQO A;  4DFA A;  2EY1 A;  5I6Y A;  2LKV A;  1SYF A;  1SNQ A;  2OF1 A;  3SXH A;  2F0P A;  3TP7 A;  1KDB A;  2F0G A;  2F0Q A;  4KD3 A;  1EYD A;  4NMZ A;  4WOR A;  1EZ6 A;  5IGF A;  4HTH A;  2PYK A;  5KGU A;  5C5M A;  2F3V A;  2KHS A;  3PMF A;  4EVO A;  3TP6 A;  3NUC A;  4KJO A;  2EYO A;  1STH A;  2M00 A;  1IHZ A;  5IGC A;  4K5W A;  4F7X A;  5CGK A;  5HGT A;  4TRD A;  4DU9 A;  5I6W A;  1EQV A;  4KV6 A;  3TP5 A;  5J22 A;  5JOB A;  2PW7 A;  1A3U A;  1KDA A;  5EKL A;  4KY5 A;  3U9O A;  5M9O A; 
#chains in the Genus database with same CATH topology
 1IBK Q;  4OIK A;  3K5M A;  1X32 A;  1N33 Q;  2X69 A;  1KL9 A;  3F1Z A;  5L37 A;  5C0X H;  2M9V A;  4WJ3 M;  1TXY A;  1DM0 B;  3HOZ G;  2ZTD A;  2YYZ A;  1KNA A;  4A3D H;  4P73 A;  2IWH A;  4TSS A;  5E3F A;  3K0Y A;  4BBR G;  4BA1 I;  4BY1 H;  4N8X 1;  1I94 L;  3BDL A;  4RFB A;  3GV6 A;  5KYI A;  3RN2 A;  3TZU A;  2D0P A;  3AQQ A;  4DR6 L;  1CZG A;  1UAP A;  5TSS A;  1NAP A;  4A3K G;  2PMZ B;  3PGZ A;  5F2D A;  4DKA C;  4J15 A;  2NVY B;  3N6R A;  2EJF C;  1O78 A;  2E2H H;  5IE8 A;  3BVM A;  5CR3 A;  2ZM6 Q;  3HOU B;  3J7A V;  3NQI A;  1ET9 A;  3PO3 H;  2D0O A;  5IGD A;  1Z9F A;  1HFN A;  3IFD A;  3RUZ A;  2FFK B;  4HIK A;  3TQY A;  4QL5 A;  2K03 A;  5D3D A;  2IJ0 A;  5IP7 H;  4DV7 L;  1LTA D;  4HAE A;  1HZB A;  3VR2 A;  1L0W A;  4JBW A;  1K8O A;  1IW7 D;  1YVC A;  1RD9 D;  1TWG B;  2KCM A;  2K1B A;  2V1C C;  4HED A;  4QQB X;  1O7Z A;  4IAL A;  4XT1 B;  2NN6 H;  2BA1 A;  3S14 B;  1K83 H;  1S4Z A;  3VR4 A;  3QOJ A;  3J7Y W;  3S1R H;  2NZH A;  1ZKO A;  1ASY A;  3SK8 A;  2UXD Q;  1I3Q H;  3PF4 A;  4UP9 A;  4MIU A;  1B8A A;  1QG7 A;  5COR A;  3VR6 A;  4A93 H;  5IGF A;  2AQ2 B;  5KGU A;  2UXC Q;  4DXF A;  3HOU G;  4IPH A;  1QNU A;  2Z4H A;  4HN7 A;  4AIM A;  2OCE A;  2R92 H;  3S15 B;  4K5W A;  1I4H A;  4JOI A;  3H0G H;  1K8M A;  3M3Y B;  4XDX A;  4H13 C;  1LTT D;  2SNS A;  2CQA A;  3FKI B;  1WVL A;  4A3F H;  2RHQ B;  3KF6 B;  3CPF A;  3JC6 6;  5EBD A;  1YEZ A;  4KHV A;  3VR3 A;  1EUJ A;  4JI8 L;  2IX1 A;  5M5Y H;  1GUG A;  1Z47 A;  4ULL A;  3T1Y Q;  3MVV A;  2F03 A;  1JOR A;  1IKL A;  4KY6 A;  3K5O A;  1U4P A;  2R3Z A;  4LF9 L;  3FEW X;  2F0K A;  2VQE L;  4IO9 A;  1X9N A;  3F8T A;  1SYG A;  5GAE C;  2FXQ A;  5JJZ A;  2Z6B A;  4TQU S;  5ELN A;  5C44 B;  4DV1 Q;  1WTW A;  4O2D A;  1S5F D;  2OT2 A;  4C56 C;  5CV4 A;  1EYG A;  1VQG A;  4A4I A;  3HOX B;  1AE3 A;  2F0L A;  4DR4 L;  5J39 A;  1EFI D;  2I5H A;  3D31 A;  2F0O A;  2G9D A;  2GA4 B;  4X3S A;  1X65 A;  2VXW A;  2TSS A;  4A3B B;  4ODG A;  4Z9C B;  2MJ8 A;  1B4O A;  1SFO B;  4DR7 L;  3FDT A;  1EZ8 A;  4GKJ Q;  1A63 A;  3RD4 A;  2R7Z H;  1JOQ A;  4KHP Q;  1SYC A;  5JJL A;  1R4P B;  4KI0 A;  4X65 L;  2Q2T A;  2CW0 C;  4DUY Q;  4DNR B;  2A68 C;  1GOZ A;  2VUM B;  2LXK A;  3SHL A;  2PO4 A;  2N55 A;  5LMU L;  4IQZ A;  2JEB I;  5A2Q L;  3H6M A;  3R93 A;  3TP8 A;  3I4M H;  2B2T C;  4GOP B;  4F87 A;  1K28 A;  1PH7 A;  1PTO H;  2UUC L;  1LTL A;  3GTG B;  4LF8 L;  1TWF H;  3UI2 A;  4PMC A;  5IYB G;  3B6Y A;  3HKZ B;  4FXD A;  1LAB A;  4BY7 B;  2F0Q A;  4KD3 A;  5C44 G;  1H9R A;  1X56 A;  4L6T B;  2CQO A;  1NCV A;  4IN3 A;  4OO1 I;  2JA5 B;  1IL2 A;  4NXN Q;  1AZP A;  1BBU A;  1RCV D;  4C3H H;  3HOX G;  1EQV A;  4B3S Q;  4BBS H;  1ASZ A;  2UUA Q;  1BBX C;  3M4O H;  3A5Z B;  2VW9 A;  1MSH A;  2A19 A;  1DD2 A;  2F1M A;  3QG1 A;  1FNV A;  2WB1 B;  4OL7 A;  4OX9 Q;  3NTK A;  1SNC A;  1SJH D;  5C3W A;  1LO5 D;  3HP3 A;  4A3L H;  4IUT A;  5JVG 3;  1OXT A;  3K81 C;  2VUM G;  1TR5 A;  3M7N A;  5I2Y A;  2IHF A;  4A3I H;  1X3E A;  2B2U C;  5CYU A;  3I4O A;  3ULL A;  1SYD A;  3OSO A;  2E75 C;  2HHH Q;  3BDO A;  4JV5 Q;  1F9P A;  2JE6 I;  2N88 A;  2XNA C;  3GTM H;  1KAW A;  5KYL A;  4B3R L;  1CZW A;  1YNJ C;  2RCF A;  3K7A H;  1HCZ A;  4M8A A;  2CKZ B;  1VQ5 A;  3JAM E;  2I07 B;  2EY2 A;  2IX3 A;  4JI3 L;  1S5B D;  1LM0 A;  2B2Y A;  4C3I B;  1D1I A;  4BY7 G;  4LF6 Q;  1J8I A;  3V2T A;  3A7L A;  3KLW A;  4QGU A;  2K05 A;  2JA5 G;  1I4P A;  3BJU A;  1HA6 A;  4N9T A;  1D5Z C;  4K14 A;  1FGB D;  1S3O A;  1IBK L;  1NTG A;  3PIO 3;  4B3M L;  1HTP A;  4TKO B;  4J1M A;  3WOF A;  2UU9 Q;  4K0K Q;  4DR5 L;  1TS5 A;  4F8M A;  3H3V C;  1VQF A;  3KDF A;  2WB1 G;  1HZC A;  1PH5 A;  2A69 D;  1BCP C;  1EYC A;  5A35 A;  4KJN A;  4CDF C;  1S72 A;  2QDB A;  3P7J A;  4P71 A;  3NPP A;  4BY1 G;  1AE2 A;  2G5D A;  1I3Q B;  1QZH A;  4DNI A;  1PFN A;  1TWH H;  3H3V I;  3T56 B;  3TEH B;  2F0N A;  1J6Q A;  1E2W A;  1X3Q A;  2ZJR A;  2I0Q A;  1P16 A;  2ZM6 L;  4CHT B;  2F0G A;  1V1O A;  4IUV A;  1EIF A;  1PV4 A;  1KNE A;  5IYC G;  2K6A A;  3AB9 A;  1KLG D;  4R4O A;  2E2J B;  3HOY B;  3VYS A;  1EWC A;  4DU9 A;  5I6W A;  3TZD A;  1PFS A;  1I94 Q;  2RBM A;  5JAV A;  5C4X H;  1W6J A;  4V19 0;  3RZO B;  1PH2 A;  1LT4 D;  4HCS A;  1L1O A;  3D4D A;  4FF4 A;  1SND A;  4UP7 A;  3SE0 A;  1PH3 A;  5C4Z A;  3FHW A;  5FJ8 G;  4AYB E;  3P75 A;  4MTN A;  1A3T A;  4A3C G;  1DZ1 A;  5GRO A;  2UXD L;  3I4N H;  2L11 A;  4NB3 A;  3V96 A;  4M1U B;  2A1A A;  1A8V A;  2D9U A;  2WKC A;  3E3X A;  2F0F A;  1M4V A;  4LWC A;  4X3K A;  1EOT A;  3D0F A;  1FJG L;  2IT1 A;  2M2L A;  3NEN A;  4OEM B;  3R8B A;  1KD1 C;  1PZI D;  4K5X A;  4OIJ A;  4UAI A;  4YHH L;  3T13 A;  5IYD H;  3G6J B;  1HH2 P;  2RA4 A;  3E6Z X;  1QCB D;  1QVF A;  3HOY G;  1IYJ B;  3W1B A;  1M90 C;  4OGQ C;  2ZXR A;  1I50 B;  1A0I A;  2K5D A;  3OWF A;  4CGY B;  3TN2 A;  4ZK9 B;  5M3F B;  1G29 1;  1I4Q A;  3S16 B;  2WII B;  1CT1 D;  3ERO A;  3AMU A;  2B2W A;  2AWO A;  4OON A;  5D14 A;  1Y1W B;  1TII D;  3J80 E;  1B1Z A;  1I4R A;  2PNH A;  1SNM A;  1B44 D;  4Q5V A;  1I4G A;  5KNB A;  1DCZ A;  4DV1 L;  2EZV A;  2K32 A;  5ELC A;  4RH6 A;  4CJ0 B;  1U4L A;  1X3P A;  2C9O A;  1D8L A;  2J4X A;  4JI8 Q;  4DV3 Q;  1VQN A;  3CW2 C;  4AQY Q;  1WTV A;  2OTL A;  1N32 L;  1L0X B;  4L5R C;  3S2D H;  2X6L A;  1I6V C;  5CGK A;  1KRT A;  5DNF A;  3UDF A;  3K57 A;  3KK7 A;  1Y8O B;  4LK1 C;  1XTC D;  1G6P A;  2VB3 X;  3NEM A;  4LF9 Q;  4DF7 A;  2VQE Q;  4IZ8 A;  4GKJ L;  1CI3 M;  1X55 A;  2I46 A;  5IP9 H;  3IAY A;  3SVM A;  1U4R A;  2R7Z G;  1A62 A;  3BZD B;  4KN7 C;  5IOC A;  4DUY L;  5KRU A;  3C2P A;  2R7F A;  4YWK A;  5CBA E;  2E2I H;  5M3F G;  2A74 C;  1ML0 D;  3MXP A;  2NUC A;  1EQT A;  4EQN A;  5FLX L;  4JK1 C;  1Q1E A;  1HR0 L;  2Q8T A;  4B9W A;  4IFD I;  4DR4 Q;  5IOD A;  4HIM A;  1WCM B;  3DEO A;  1CSQ A;  1Y1W G;  3L7Z C;  3T1H L;  4MN3 A;  4JVZ A;  4I65 A;  3PO2 B;  4DR7 Q;  1E0B A;  3M9B A;  2LS0 1;  2G9H D;  2ZXO A;  5CBE E;  3AFQ A;  3E9H A;  2UUB L;  3MHB A;  4X65 Q;  3AFP A;  1TY2 A;  2RF4 A;  2XWB B;  1V9P A;  4NW2 A;  2F0I A;  3KF6 A;  4NXN L;  2R93 B;  3TBI B;  1KDC A;  5LMU Q;  4B3S L;  3HOW B;  2UUA L;  1IYU A;  4FNF A;  3MEH A;  5LMN W;  1R9T B;  1II3 A;  3S24 A;  5FLM H;  3U4Z A;  3PUY A;  1E2Z A;  1CKN B;  5JVH 3;  1RIP A;  4LF8 Q;  2JA7 B;  1HZ9 A;  5EPL A;  4LFA Q;  4PMB A;  4ZRZ A;  3BZC A;  3F2U A;  1VF7 A;  1VQI A;  1CQV A;  1A6X A;  4LF4 L;  1B53 A;  3GTQ B;  5J1Z A;  2FIN B;  5CV5 A;  5I4D A;  4IUQ A;  5K36 H;  5T1G A;  2I5L X;  2Q2H A;  2HHH L;  4JV5 L;  2HCI A;  3I91 A;  1WCM G;  1Q3L A;  5DM6 3;  3ICE A;  2PQE A;  3GV3 A;  3UE1 A;  1EFW A;  1EY0 A;  3IL8 A;  1K3B C;  5IT9 L;  2WFW A;  1A15 A;  2JA8 B;  3U58 A;  3PO2 G;  1EYD A;  4DV0 L;  1PYB A;  3I2Z A;  4BBR B;  3PF5 A;  2ICI A;  3DWP A;  4O1N A;  2R93 G;  1CKM A;  3J7A F;  1JWS D;  3HOW G;  5E1F A;  1CKO A;  1OXU A;  4IFD H;  1JJC B;  1GM5 A;  3KJP A;  1HFG A;  4ZUJ A;  4JI2 L;  1UUP A;  1B3A A;  3OMC A;  1WTO A;  3W1G A;  4C3J B;  4Q0F A;  3SGI A;  1BO0 A;  3GTL H;  3GTJ H;  2NN6 I;  2JA7 G;  2AQ1 B;  1KHI A;  1U4M A;  4RHR A;  4A3E B;  4RG1 A;  4CJ2 C;  3C46 A;  2Y0S B;  1EEF D;  1YI2 A;  2OXP A;  4P72 A;  2K5Q A;  1ZEQ X;  3L9A X;  3OPO A;  3IRB A;  3OIQ A;  5E7N A;  4OO1 G;  3S2H H;  2EPB A;  4P74 A;  2A5H A;  4ZYS A;  4K5V A;  3HZX A;  3M4Y A;  5G3L D;  2BCO A;  2R61 A;  1TS3 A;  3CF5 A;  3G6E A;  3DEP A;  2YTX A;  2ALY B;  3SR1 A;  4B3M Q;  2Q2I A;  3CQZ H;  1PMR A;  1SMY C;  1T5E A;  4DR5 Q;  3ZYY X;  1UE6 A;  1IKM A;  1KLU D;  4WFN 3;  2JA8 G;  2LMC B;  3HRZ C;  2EE1 A;  4IPG A;  4JOI C;  5C3X A;  5DLQ E;  4KY7 A;  1DON A;  1CHP D;  4H02 A;  1ICW A;  2HUG A;  4RGM A;  4C2M B;  4HJ9 A;  4DR3 L;  4HID A;  2EYL A;  2J0T D;  3GTP B;  1VMP A;  3ND8 A;  3S1Q H;  5CC4 A;  1H95 A;  3SDZ A;  5C4X G;  3MFG A;  4GKK Q;  1WFQ A;  4WJW A;  3J81 i;  2NWG A;  5H1S E;  1ENA A;  4DAM A;  2JA6 H;  4DAY B;  2B63 B;  3P1H A;  4C3J G;  5HUR A;  2YU9 B;  3E9I A;  3AYH B;  4A3G H;  1TWC B;  2AQ3 B;  4A3E G;  4G57 A;  1JQY D;  3A8I E;  2Y0S G;  2NVQ H;  1FNU A;  4LAA A;  1GVP A;  1WTX A;  2NTS A;  3Q6S A;  1STG A;  1DOM A;  2XWJ B;  1HQR D;  4UPA A;  5EKI A;  1KAA A;  3MTS A;  2NZ1 D;  2A73 B;  1MGS A;  3D4R A;  4A3M B;  4YWM A;  4L5Q A;  2DY7 A;  2BH8 A;  2WP8 J;  1CFM A;  1CA6 A;  1JT8 A;  3NTH A;  2F3V A;  1OXS C;  2RHS B;  3A7A B;  4EX5 A;  2CH4 A;  3CKI B;  5IGC A;  4BS9 A;  3IKJ A;  3PIP 3;  1M8A A;  1NR4 A;  3KLS X;  1HXY D;  4DV2 Q;  2K04 A;  3GTK H;  2KOL A;  3CCJ A;  2PW7 A;  1A3U A;  1T5X D;  1KDA A;  5EKL A;  3VYT A;  2BDN A;  3OMG A;  1PTO C;  4JI1 L;  4P75 A;  5GAG C;  2F4I A;  2CCZ A;  4RAU C;  4OXP A;  5BN5 A;  1TKW B;  3D6C A;  4R1J A;  1YZ6 A;  1JB3 A;  1FJG Q;  2EYF A;  2IW3 A;  2B63 G;  2A6E D;  2IPK D;  3J81 L;  1SE3 A;  3QO2 A;  3TS2 A;  4CKC A;  3K59 A;  3NWS A;  1SBB B;  4LFC Q;  3PUV A;  4YHH Q;  3CPW A;  1NMF A;  1JE5 A;  1ZYR C;  1G2S A;  1CM9 A;  4A3J B;  1Y14 B;  1VCI A;  4YY3 L;  1UNS A;  3OW2 A;  2BOS A;  2EY5 A;  2E2D C;  1XNR L;  2EJM A;  4A3M G;  1M1K C;  4DV3 L;  4AQY L;  4R4C A;  3S17 B;  2B2V A;  1TWA B;  1Z6H A;  2QF7 A;  2VY3 A;  1NUC A;  4RKB A;  3RLO A;  2JN4 A;  1QUQ B;  4DV6 L;  1T9H A;  2PQA B;  3ERS X;  4PZ6 A;  1SMY D;  3K58 A;  4FVM A;  3ZJY C;  4GLA C;  4ZQ3 A;  3S1N H;  1JCK B;  1PLF A;  3H91 A;  3CD6 A;  2B39 A;  4JI4 Q;  1MHW C;  3GTO H;  2SEB D;  2B8F A;  1FGU A;  2XRQ D;  1N32 Q;  1MKH A;  3S1M B;  4Y7N H;  4WJ4 A;  2RDH A;  1EYA A;  3LX0 A;  3K5L A;  4QIW B;  3TDQ A;  1MI2 A;  1D6E C;  5CV6 A;  4A3J G;  3J81 j;  4FF2 A;  2B2Y C;  5KEE A;  3JAM L;  1XMQ L;  3KOJ A;  1VQK A;  1PRT C;  3HKZ E;  2VS1 A;  1NY4 A;  2QGQ A;  4WOR A;  3RZD B;  2WKD A;  5C5M A;  1ET6 A;  4DV4 Q;  4KJO A;  2EYO A;  2K52 A;  5HGT A;  4A76 A;  1GD7 A;  1O80 A;  1HR0 Q;  1HHV A;  3P20 A;  2KEN A;  4APV A;  4KY5 A;  5M9O A;  3HOV H;  1F9R A;  1Y1V B;  4ZKB B;  4QUC A;  2JXM B;  4U67 3;  3T1H Q;  2WB1 E;  4LFA L;  1I6H H;  4BXX G;  1VQ4 A;  5M3M H;  2KCT A;  3CU7 A;  4E6I A;  1I5F A;  2UUB Q;  3TRZ A;  1OXX K;  2UXB L;  5C4J B;  1YNX A;  2K14 A;  5ELE A;  5IWA L;  1PXU A;  1E22 A;  1SYB A;  1PTO D;  5EQ0 A;  4WRD A;  2VZA A;  1WJJ A;  4DK0 A;  3D4W A;  1HTL D;  1PYW D;  1PH8 A;  5E4X A;  1EY9 A;  1K8G A;  5C3E H;  1VQO A;  3F2D A;  1XMO Q;  1LAC A;  1RJT A;  4O42 A;  1GHK A;  1FD7 D;  2HIV A;  4A3D B;  4DAV A;  4LF4 Q;  3KF8 B;  3T16 A;  4LFB L;  4BY1 B;  5FO8 B;  5BR8 L;  1YHQ A;  1V1P A;  1ZYR D;  1UE5 A;  4RA8 A;  3IFT A;  2PCF B;  1TT2 A;  3NEL A;  2DJF C;  1L1O C;  1YHA A;  1V8Q A;  2XVS A;  3BG3 A;  1Y1V G;  3CCE A;  4MHE A;  2E2H B;  3K5N A;  1VMC A;  1VQ8 A;  3ERQ A;  4OWT B;  2WAQ B;  4LUO A;  1ESR A;  2PZT A;  1D2B A;  4DV0 Q;  3EA6 A;  3PO3 B;  2HDM A;  3I73 A;  3UE0 A;  2KEC A;  2YTY A;  2F0W A;  3RNU A;  2DUD A;  2E8G A;  1SE2 A;  1EOV A;  3HEJ A;  1K3R A;  1PH6 A;  4FXG C;  1C48 A;  1RTN A;  1TS2 A;  1SXT A;  3CXC A;  3FVQ A;  1XYI A;  4KKT A;  5IGG A;  4PG3 A;  5ELF A;  1TQO A;  4DFA A;  5C0X G;  4N8F A;  4JI2 Q;  1UE7 A;  1SNQ A;  4GNX A;  3CCV A;  4RHS A;  2DN8 A;  3TP7 A;  1WYD A;  3FP9 A;  4NMZ A;  5GAD C;  4HJ8 A;  2AHO B;  1K83 B;  4A3D G;  1VQ7 A;  5A2Q E;  3ULJ A;  3S1R B;  2NVX H;  2CVR A;  1XJV A;  4DR1 L;  1V1Q A;  3KUP A;  5IY0 A;  1X3G A;  1VQM A;  1AN8 A;  4GKK L;  1PRT D;  2NVT H;  5J3B A;  1DOL A;  3M4Q A;  2CW0 D;  2B2W C;  2A68 D;  1AH9 A;  4A93 B;  2KEE A;  2AWN A;  3PUW A;  5DM7 3;  1BVS A;  3QWN A;  3M85 A;  3NHH A;  2WAQ G;  4A3G G;  3X3M A;  1HA5 A;  2R92 B;  3CC4 A;  3PO3 G;  2GVB A;  2H1E A;  3J80 L;  3DUZ A;  5E4W C;  3H0G B;  5I9P A;  1WD0 A;  4POG A;  4DR3 Q;  2PZU A;  3PQI A;  1ICF B;  4OHJ A;  4LUV A;  3M7G A;  2MHV A;  5IP7 G;  3FPP A;  2K33 A;  3D8G A;  1BKB A;  3NP8 A;  4A3F B;  5JJI A;  4QF4 A;  3HOZ H;  5M5Y B;  3L3O C;  4GN4 B;  2NN6 G;  1C7Y A;  2Q2U A;  2YV5 A;  5EBC A;  3LGJ A;  1NSN S;  2Z1C A;  3MC0 B;  5M5X H;  4DV2 L;  1QNK A;  1E3P A;  3CC7 A;  2PPB C;  1GUS A;  4A3K H;  4EGV A;  4G7Z C;  5IGB A;  1Z7T A;  1VQH A;  2QA4 A;  2JP1 A;  1RHP A;  3SK4 A;  1EU4 A;  1VQA A;  3RLF A;  2B3G A;  5M5W H;  4A93 G;  1HRJ A;  4IFD J;  1TY0 A;  4LFC L;  2L1B A;  5C6A A;  2KED A;  2R92 G;  1LUZ A;  2SOB A;  2O2L D;  1H9S B;  3I7F A;  2K4K A;  4X62 L;  2OWO A;  3MXU A;  2A6H C;  1NBW A;  4UHV A;  3H0G G;  4GN5 A;  4XQQ A;  4X3T A;  4KLK A;  4MNO A;  4C1N I;  1JIC A;  2F0M A;  1YNJ D;  4KKU A;  4JI1 Q;  2R7Z B;  1D1K A;  2RSN A;  2EY1 A;  3H15 A;  4FO2 A;  4A3F G;  1JJ2 A;  3BVG A;  1SRO A;  3PCO B;  3CME A;  4AYB B;  1C9O A;  4HTH A;  2HQL A;  2LXJ A;  3CCU A;  1BDO A;  2VNU D;  3STB C;  1VQB A;  2ZTE A;  1FNW A;  3PMF A;  4DAY A;  3TP6 A;  2M00 A;  2JQO A;  3I4M B;  4TRD A;  3C3L A;  2KHI A;  5C0X J;  1RF2 D;  5EJW A;  1C4Q A;  4RGO S;  1PTO B;  1J5E Q;  2QCP X;  1DJR D;  2XSC A;  1XWE A;  4YY3 Q;  2KHJ A;  1XNQ L;  1TWF B;  1I6H B;  2O5J C;  4JI0 L;  4IJL A;  4MZ9 A;  2NVY H;  4L63 B;  3I3C A;  2F0H A;  1BCP D;  1XNR Q;  3VA5 A;  3LWU A;  2IHE A;  1CQF A;  4JI4 L;  3HOU H;  1EY4 A;  1ILQ A;  3KBG A;  3TSS A;  1S5C D;  2HIX A;  4LF7 L;  4C3H B;  5CV7 A;  4BBS B;  3M4O B;  2TMP A;  2O4X A;  2L12 A;  4UY8 C;  2B8G A;  4DK1 A;  2O5I C;  4DV6 Q;  2AUK A;  1JJG A;  5D3I B;  2F3W A;  1PFM A;  2F0D A;  3CCL A;  3DXJ C;  1TWG H;  4LF5 Q;  2JEA I;  5ISR A;  3R3O A;  5FLX c;  4DV4 L;  2QKI C;  2RDF A;  4AYB G;  3KYH C;  3S14 H;  1ONL A;  1JC7 A;  4A3I B;  1AP0 A;  3EVQ A;  3VA7 A;  4GN3 B;  2VB2 X;  2EXZ A;  2XN9 C;  2H4O A;  3I4M G;  3LNN A;  3RLN A;  3GTM B;  4EQO A;  3CCM A;  2OQK A;  3WWV A;  3EQL C;  1F9S A;  1NE3 A;  3K7A B;  1CHQ D;  2EYH A;  1XMQ Q;  5JPN C;  1S5E D;  3FPU B;  2FJ2 A;  4J6H A;  3G48 A;  3I70 A;  4CDE C;  1GUW A;  1UEA B;  1B7Y B;  1MD2 D;  1DYQ A;  3G4S A;  5CV8 A;  3S15 H;  2ZT9 C;  3WDN A;  1KTK A;  1VF5 C;  4QB4 A;  4C3H G;  4BBS G;  3S9W A;  1Q12 A;  1SR3 A;  4R4I A;  4HJA A;  1NMG A;  3EN2 A;  3M3Y H;  4BA2 I;  4JI5 L;  1PRT B;  1STE A;  4QY7 A;  1QUQ A;  2F0J A;  1N36 L;  2F0V A;  1XMO L;  2EVB A;  2N78 A;  3FKI H;  5C3E G;  1ILP A;  4DN4 M;  2F0P A;  1SDF A;  1P8L A;  4I7A A;  1FYC A;  4A3L G;  4K6L A;  4DNT B;  1Q8K A;  1Q90 A;  1IHZ A;  4OWX B;  2UXB Q;  5FKA C;  2C35 B;  3N52 A;  3VR5 A;  1SEB D;  4A3I G;  1Y8N B;  4KV6 A;  5JOB A;  4GLV B;  5IWA Q;  2CHB D;  1AFP A;  1C0A A;  1X54 A;  3U9O A;  3KDF B;  2GN5 A;  4PZ8 A;  1A2U A;  1TWH B;  2L0C A;  1HUM A;  3URY A;  5G3L F;  5IYB H;  4X3U A;  3GD7 A;  5IT9 c;  5C44 H;  3H09 A;  1VQL A;  3R2I A;  1X6O A;  2K5N A;  3STB D;  3DLL A;  2ASB A;  1D5X C;  4GZY C;  2K28 A;  4DUZ Q;  1VQ6 A;  2CWA A;  5BN3 A;  1SSO A;  3A8K E;  1OO9 B;  1OTC A;  3GO5 A;  3I72 A;  3CCQ A;  2L15 A;  3HOX H;  5AJ3 L;  3MZ5 A;  4LFB Q;  1O7L A;  3CRL C;  3QJY A;  5BR8 Q;  1BNZ A;  4HMI A;  1J9O A;  2MQH A;  5C4H A;  2CFM A;  1RL2 A;  3UDX A;  4KHZ A;  2BA0 A;  3NWT A;  5LMN L;  1QVG A;  4A3B H;  5C4X B;  5T1I A;  4JI7 Q;  4K8I A;  3GP7 A;  1SFO H;  3FMC A;  4GOP A;  5EPK A;  3SK6 A;  3WOE A;  1I4X A;  1NNX A;  2KQ3 A;  1EY6 A;  4JYA L;  1FVI A;  3MXN B;  1LTB D;  3T4A C;  1SLJ A;  4YCU A;  5K5P A;  2VUM H;  5FLX E;  1DGS A;  3EFX D;  3T53 B;  1UE1 A;  1L1O B;  4UP8 A;  4IPD A;  3I4N B;  3KJO A;  1PHJ A;  1A2T A;  3BS1 A;  1H9M A;  2PMZ E;  2E74 C;  2JJQ A;  4KTA A;  3GTG H;  5C5L A;  1QJO A;  5CV9 A;  3G71 A;  3PV0 A;  3U50 C;  3EJI A;  4BY7 H;  1JR0 D;  1F2Y A;  4QCL A;  2NB0 A;  1STB A;  3NBI A;  1MJE A;  3EBE A;  2JA5 H;  1JWM D;  4DR2 L;  4RCO A;  4LMQ D;  1SNP A;  3CP0 A;  2KBN A;  3UDI A;  3K80 C;  4HR7 B;  1SAP A;  1B2T A;  2AUJ D;  3KF8 A;  2DY8 A;  4FP5 D;  4ILW A;  1YHB A;  3PIO A;  4DR1 Q;  4ALP A;  3K6O A;  4JG2 A;  5I6Y A;  2B2V C;  3W3A A;  1N8R C;  1WI5 A;  1BCP B;  3BVZ A;  4IPC A;  2JSO A;  2WIN B;  2F52 A;  2LFN A;  2QIL A;  2NYZ D;  4H0L C;  4CDC C;  1WTQ A;  1EIG A;  3TP5 A;  2Z8L A;  2XGT A;  1TVX A;  4L5T A;  1PFB A;  3I4N G;  5DEH A;  1B9N A;  3DM3 A;  1LTR D;  1S5D D;  4JBK A;  2MP1 A;  4B3T L;  4YCV A;  5IT9 E;  3SK5 A;  3FRP B;  1PYS B;  2EYP A;  2E5L Q;  5KNC A;  5IYC H;  4C3I H;  3L2P A;  3K0X A;  1QB5 D;  5BN4 A;  2KJX A;  4X64 L;  3S2D B;  1GXD C;  4FYD A;  5COY A;  4IUP A;  2F0U A;  3BU2 A;  3A56 A;  4IJH A;  4GLX A;  5IYD G;  2F4V L;  2D62 A;  1EQQ A;  4RMF A;  1A3V A;  4TVA B;  3Q22 A;  1W3S A;  2FHT A;  2EY6 A;  3PUZ A;  2D5D A;  2IY5 B;  5KIX A;  2KUM A;  2Z6K A;  1BBW A;  2K5H A;  4HMJ A;  4ZKC B;  5FJ8 H;  2E2I B;  2K01 A;  4X66 Q;  3J81 c;  5JEA H;  3NQT A;  5IGE A;  3OOC A;  3C1E A;  5D65 A;  3CMA A;  1IBL L;  3F2B A;  4A3C H;  1JWU D;  3NK9 A;  4K2L A;  4N9P A;  3A5U A;  4PZ7 A;  2R6G A;  4ME5 A;  3JAM i;  1TU2 B;  1J5E L;  1JE4 A;  1STN A;  4J8Q A;  4HJ7 A;  3ONA B;  1KQS A;  3RR5 A;  4X62 Q;  3CAM A;  4QUF A;  4G7O C;  3NE5 B;  4KK7 A;  4UDU C;  1OXV A;  1YJW A;  2CH4 W;  2Z4I A;  4JI6 L;  1HNX Q;  1GUN A;  3KLR A;  3OYY A;  1E24 A;  1Q8I A;  2XTI A;  4JBJ A;  1ENF A;  1Q81 C;  1LT3 D;  3A74 A;  2BE5 C;  2PZW A;  4YIJ A;  1EY8 A;  3QIA A;  4RCN A;  2E2J H;  5EGT A;  3HOY H;  3SEB A;  1WOC A;  4QIW E;  2HT1 A;  5AFW A;  3OTO L;  1N9W A;  3ER0 A;  1EY5 A;  3CHB D;  3A8J E;  4JBM A;  1LYL A;  3RZO H;  1UWV A;  1SMX A;  1XNQ Q;  1BXT A;  2LKV A;  5IP9 G;  4JI0 Q;  1SYF A;  2QDL A;  3SXH A;  4LF5 L;  3R2T A;  4DPG A;  1G8Z D;  2PYK A;  2RCN A;  2KHS A;  1PZK D;  3QR8 A;  2JYO A;  4NPS A;  3RMH A;  4LUZ A;  4F7X A;  2HCC A;  1QE6 A;  4LF7 Q;  4B08 A;  1E1T A;  5KND A;  2BH2 A;  3ULP A;  1VS0 A;  1IZ6 A;  2ES2 A;  3I4L A;  2OEO A;  1PTO F;  3DWA A;  1YIT A;  1H9S A;  3JAM c;  3CRK C;  1LTI D;  3E5S A;  4HCE A;  3OIP A;  3DMU A;  1TS4 A;  1IBM Q;  4NXM L;  1HNZ L;  1IYV A;  2E76 C;  2L5T A;  4P2C B;  2A69 C;  2MO0 A;  3OWE B;  2IL8 A;  3VYR A;  1WTR A;  4XQN A;  4F88 A;  1PH1 A;  1JOK A;  2XIW A;  2K5V A;  4DV5 L;  1QZG A;  1BF4 A;  1RKN A;  2PI2 A;  1PVO A;  4GNX C;  5FLM G;  1HPC A;  1I50 H;  3BDC A;  3T51 B;  3GTL B;  1KIX A;  3QOL A;  3FKI G;  1N34 L;  2X6G A;  5EAY A;  3GTJ B;  1E1O A;  5M3F H;  1F9Q A;  2Z9H A;  1VQ9 A;  3G7L A;  5FO7 B;  1E2V A;  3S16 H;  1SE8 A;  2EOT A;  4KMU C;  2EIF A;  1Q7Y C;  1MBY A;  1VQE A;  4IUN A;  3J81 E;  4XYQ A;  2H5X A;  1Q82 C;  3KFU A;  2EYM A;  3NBH B;  1PH9 A;  3C1F A;  1MIU A;  1Q1B A;  2PNR C;  3S2H B;  5K36 G;  1E7Z A;  3HFZ B;  5EKK A;  4H7B A;  1Y1W H;  1B50 A;  3DHQ A;  5FK9 C;  2HQE A;  1X3F A;  2OQ0 A;  4ID6 A;  1XPR A;  4NKL A;  4JW0 A;  4LW1 A;  2NZO A;  2SDF A;  3CQZ B;  1XPU A;  4U68 A;  1YIJ A;  4JI5 Q;  1N36 Q;  2V4D A;  2A8V A;  1SRU A;  2AMC B;  5NUC A;  2WAQ E;  4PNY A;  4DUZ L;  5DAU A;  3X3N A;  1PA6 A;  1LTS D;  1K9M C;  4FDB A;  2QEJ C;  1GJX A;  1DXM A;  1BUV T;  1ZXT A;  4X6A H;  4G4K A;  2MNA A;  3O13 A;  3S1Q B;  4A3B G;  4JI7 L;  2F3I A;  4IFD G;  2ICE C;  2GVA A;  1VQP A;  3MEF A;  2JA6 B;  1PRT F;  1CK1 A;  3Q0A A;  1KDB A;  3J80 i;  1HZA A;  1B70 B;  1EZ6 A;  4DK6 C;  1O7Y A;  2BE5 D;  4A3G B;  2HDL A;  3D3R A;  4EVO A;  4DA2 A;  1BR9 A;  2NVQ B;  4Y52 H;  4LNQ A;  5AJ3 Q;  3U9S A;  1WCM H;  1G2T A;  3NSW A;  5LMN Q;  3BYT B;  1VDZ A;  1STY A;  2LY7 A;  1HNW Q;  1PDQ A;  3TRE A;  2RDG A;  3PO2 H;  1EIH A;  2KCC A;  4OWW B;  1D7Q A;  2XRS D;  3J7A 5;  1H9J A;  3HKZ G;  4DGZ A;  4XTC S;  2NBF A;  4JYA Q;  1CKN A;  3NTI A;  3AU7 A;  2QEX A;  4R4Q A;  3D6W A;  2R93 H;  3RN5 A;  4FXK C;  1F77 A;  3GTK B;  3HOW H;  1ENC A;  3PUX A;  1WD1 A;  4V0B A;  2VQF Q;  1N33 L;  1R9T H;  2L9H A;  3UDG A;  2B2T A;  1YBY A;  1BQQ T;  2JA7 H;  1ESF A;  2WV6 D;  2JA6 G;  4H44 C;  2F0S A;  1YJ9 A;  2BDO A;  3OHX C;  1QIL A;  3GTQ H;  4K2K A;  2QW7 A;  3TS0 A;  4HSP A;  4RKL A;  1K8A C;  1NR2 A;  4OO1 H;  1LLR D;  4DR2 Q;  2N8N A;  3J80 c;  4POF A;  1UEB A;  4GS3 A;  1GUT A;  4ABN A;  4CJ1 B;  3MXG A;  2WAC A;  1B9M A;  1YNN C;  2YTV A;  2MUY A;  1HUN A;  2JK8 A;  4HSV A;  4IOA A;  2HD3 A;  1LT5 D;  1SNO A;  2KA7 A;  1SYE A;  5LL6 S;  1XTD A;  3TME A;  2JA8 H;  1PH4 A;  4JPB W;  4L5S A;  4ZUI A;  4CDD C;  3I90 A;  2E5L L;  2L55 A;  3A54 A;  2ZTC A;  4C1N K;  4CKE A;  4C3I G;  2ENB A;  3MAQ A;  4BBR H;  2FMM A;  2KVM A;  1K0R A;  5ELD A;  4I7Z C;  3MXN A;  1JB7 A;  1AEX A;  1STA A;  4IUU A;  1Q46 A;  3HGB A;  3PSI A;  4DR6 Q;  4KKS A;  1MSG A;  2B2U A;  4QMG A;  2NTT A;  1IXR A;  3S1N B;  1Q86 C;  1CTM A;  2L4N A;  2R7D A;  4ZLT F;  4C3J H;  3K7U C;  1L0Y B;  4OEL B;  4B3T Q;  1GKH A;  4X66 L;  4FF1 A;  4A3E H;  5JEA G;  1AZQ A;  1BCP F;  3GTO B;  2ZXP A;  2PI2 E;  1V43 A;  4X64 Q;  3DWQ A;  2Z0S A;  2DJG C;  4Y7N B;  3I55 A;  1QVC A;  1F2L A;  3V05 A;  3W5O A;  2EXD A;  4DAP A;  2MFI A;  1YJN A;  2F4V Q;  4S3S A;  2Q8I B;  4B9X A;  4DV7 Q;  4KD4 A;  2C5C A;  3ND9 A;  4NP5 A;  1ROD A;  1NJI C;  1SJE D;  1LT6 D;  1HNX L;  4ZCK A;  4L8J A;  2SNM A;  2N49 A;  2UXC L;  2AKW B;  2J7Z A;  4RGT A;  4CBV A;  1AW7 A;  1HJP A;  3OW7 A;  1EL0 A;  2RVL A;  1WTH A;  1IBL Q;  1KXL A;  3PIP A;  1KC8 C;  5CMD A;  1F2Z A;  4C2M H;  1EU3 A;  3HOV B;  3GTP H;  3M4P A;  5I9O A;  1GHJ A;  3MFY A;  3QB3 A;  1EWH A;  4XIG S;  4R4T A;  3AEV A;  2DNE A;  5I2X A;  3H3V H;  5IIF A;  2F0T A;  3A55 A;  1KAB A;  5M3M B;  2B63 H;  4JI6 Q;  5LL6 X;  3T1Y L;  2K50 A;  2YU9 H;  1TWC H;  2CWP A;  1HR0 W;  1U9R A;  1RTO A;  1GUO A;  5EPJ A;  4PV1 C;  1VQC A;  3OTO Q;  4MTK A;  2PW5 A;  2EYJ A;  4YCW A;  5C3E B;  4XT3 B;  2DGY A;  1EQR A;  4R8I A;  4A3M H;  1GO3 E;  2IX0 A;  1IBM L;  2MGS A;  4YWL A;  2I5M X;  3CCR A;  4RGN A;  3H94 A;  4BWG B;  1L2F A;  1F2M A;  3Q8D A;  4JCV E;  3E0J A;  3E0E A;  1PZJ D;  4LJZ C;  4JC0 A;  4GOP C;  1YNN D;  1C8C A;  5FO9 B;  1U0L A;  2P5Z X;  1D5M C;  2JA9 A;  1K0S A;  3HOV G;  1U5K A;  2RQX A;  3I8Z A;  3ITP A;  4KHP L;  1MJC A;  1VQJ A;  4O0A A;  2OF1 A;  1V1P B;  4R9W A;  1EIY B;  5M3M G;  4RWS C;  2RSO A;  4XXE A;  4NXM Q;  4PMW A;  1HNZ Q;  4DXG A;  1R4Q B;  3NUC A;  2D2C C;  1O7I A;  2KCN A;  2FMC A;  4A3J H;  1G91 A;  4DV5 Q;  1Y69 U;  5FOB B;  3DM1 A;  2MPM A;  5JEA J;  1Y8P B;  3CC2 A;  2F0E A;  4K6D A;  1LV9 A;  5HY6 A;  2PQA A;  3L0O A;  1N34 Q;  3MA2 B;  1EWI A;  3HG9 A;  3LWE A;  2ZJQ A;  3KLS A;  1EEI D;  3S17 H;  1S40 A;  4XYO A;  1SE4 A;  1TWA H;  2B29 A;  4PQX A;  1JOO A;  2NVX B;  2A6H D;  1G51 A;  4R8N A;  3U4V A;  4XQJ A;  2N3S A;  1KRS A;  4GNX B;  5C0X I;  1RDP D;  2UUC Q;  5LHY 1;  2NVT B;  4OX9 L;  1FR3 A;  4BXX H;  2EJG C;  1W2B A;  4HJ5 A;  1B3Q A;  3J7Z C;  2MO1 A;  5ELO A;  1IW7 C;  4DK3 C;  5JJK A;  2RKS A;  1QWY A;  1W6K A;  3A0J A;  1XPO A;  1H9K A;  2Y0S E;  1G6Z A;  2ATW A;  2K75 A;  4G7H C;  5ELB A;  2LSS A;  5JPM C;  3S1M H;  2OTJ A;  1XX8 A;  3VDY A;  3HS0 C;  3BZK A;  1DOK A;  1LTG D;  2EDG A;  3CCS A;  3EIV A;  4K8J A;  5GQO A;  4EQP A;  4HIO A;  1IL8 A;  1HNW L;  1HQM C;  3I56 A;  3HOZ B;  4CKB A;  3GQB A;  3MWY W;  1EY7 A;  3F2C A;  1CA5 A;  3GDE A;  1CSP A;  4LF6 L;  3HKS A;  4KN4 C;  2ZJP A;  3NXW A;  4AH6 A;  1FL0 A;  3RZD H;  5HGQ A;  2A6E C;  4NDX A;  5M5X B;  2DNC A;  4FF3 A;  2K5W A;  4IOC A;  2VL6 A;  4QJF A;  2VQF L;  3Q24 A;  3VYU A;  1K73 C;  4A3K B;  1VQD A;  1SN8 A;  2Z6K C;  4A75 A;  4EQ5 A;  1XXG A;  3NBH A;  1Y1V H;  3Q23 A;  2UU9 L;  4K0K L;  3K8A A;  4B3R Q;  2Q8R E;  1QOH A;  2EQS A;  1CUK A;  3KBX A;  5M5W B;  3W2D A;  1JMC A;  5GAH C;  4JI3 Q;  4IUR A;  2K7V A;  1BOS A;  4ME3 A;  5C4J H;  3BYY B;  1STH A;  1WTP A;  4ZAI A;  2ID0 A;  5J22 A; 
#chains in the Genus database with same CATH homology
 4OIK A;  3K5M A;  1X32 A;  2X69 A;  5C0X H;  2M9V A;  1DM0 B;  2YYZ A;  1KNA A;  2IWH A;  4TSS A;  5E3F A;  3K0Y A;  4BA1 I;  3BDL A;  4RFB A;  3GV6 A;  5KYI A;  3TZU A;  1CZG A;  1UAP A;  5TSS A;  1NAP A;  2PMZ B;  5F2D A;  2NVY B;  3N6R A;  2EJF C;  1O78 A;  3BVM A;  5CR3 A;  3HOU B;  3J7A V;  3NQI A;  1ET9 A;  5IGD A;  1HFN A;  3IFD A;  3RUZ A;  2FFK B;  2K03 A;  5D3D A;  2IJ0 A;  1LTA D;  4HAE A;  3VR2 A;  4JBW A;  1K8O A;  1IW7 D;  1RD9 D;  1TWG B;  2K1B A;  4HED A;  1O7Z A;  4IAL A;  4XT1 B;  2NN6 H;  2BA1 A;  3S14 B;  1S4Z A;  3VR4 A;  3QOJ A;  3J7Y W;  1ZKO A;  3SK8 A;  4MIU A;  1QG7 A;  5COR A;  3VR6 A;  5IGF A;  2AQ2 B;  5KGU A;  4DXF A;  1QNU A;  2Z4H A;  4HN7 A;  3S15 B;  4K5W A;  1I4H A;  1K8M A;  3M3Y B;  4XDX A;  4H13 C;  1LTT D;  2SNS A;  2CQA A;  3FKI B;  1WVL A;  3VR3 A;  5EBD A;  4KHV A;  2IX1 A;  1GUG A;  1Z47 A;  4ULL A;  3MVV A;  2F03 A;  1JOR A;  1IKL A;  4KY6 A;  3K5O A;  1U4P A;  2R3Z A;  3FEW X;  2F0K A;  1SYG A;  5JJZ A;  4TQU S;  5C44 B;  1WTW A;  1S5F D;  2OT2 A;  4C56 C;  5CV4 A;  3HOX B;  2F0L A;  5J39 A;  1EFI D;  3D31 A;  2F0O A;  2G9D A;  2GA4 B;  4X3S A;  2VXW A;  2TSS A;  4A3B B;  4ODG A;  4Z9C B;  2MJ8 A;  1B4O A;  1SFO B;  3FDT A;  1EZ8 A;  3RD4 A;  1JOQ A;  1SYC A;  1R4P B;  4KI0 A;  2CW0 C;  4DNR B;  2A68 C;  1GOZ A;  2VUM B;  3SHL A;  2PO4 A;  2N55 A;  4IQZ A;  2JEB I;  5A2Q L;  3H6M A;  3R93 A;  3TP8 A;  2B2T C;  4F87 A;  1PTO H;  3GTG B;  3UI2 A;  4PMC A;  3HKZ B;  4FXD A;  1LAB A;  4BY7 B;  2F0Q A;  4KD3 A;  1H9R A;  4L6T B;  1NCV A;  4IN3 A;  4OO1 I;  2JA5 B;  1AZP A;  1RCV D;  1EQV A;  1BBX C;  1MSH A;  1DD2 A;  2F1M A;  3QG1 A;  1FNV A;  2WB1 B;  4OL7 A;  3NTK A;  1SNC A;  1SJH D;  5C3W A;  1LO5 D;  3HP3 A;  4IUT A;  5JVG 3;  1OXT A;  1TR5 A;  3M7N A;  5I2Y A;  2B2U C;  5CYU A;  1SYD A;  3OSO A;  2E75 C;  3BDO A;  1F9P A;  2JE6 I;  2N88 A;  2XNA C;  5KYL A;  1CZW A;  1YNJ C;  1HCZ A;  4M8A A;  3JAM E;  2I07 B;  2EY2 A;  2IX3 A;  1S5B D;  2B2Y A;  4C3I B;  1D1I A;  1J8I A;  3V2T A;  3A7L A;  2K05 A;  1I4P A;  1HA6 A;  4N9T A;  1D5Z C;  4K14 A;  1FGB D;  3PIO 3;  1HTP A;  4TKO B;  4J1M A;  3WOF A;  1TS5 A;  4F8M A;  3H3V C;  2A69 D;  1BCP C;  1EYC A;  5A35 A;  4KJN A;  2QDB A;  3P7J A;  3NPP A;  1I3Q B;  1PFN A;  3T56 B;  2F0N A;  1E2W A;  1X3Q A;  4CHT B;  2F0G A;  1V1O A;  4IUV A;  1KNE A;  2K6A A;  3AB9 A;  1KLG D;  2E2J B;  3HOY B;  3VYS A;  1EWC A;  4DU9 A;  5I6W A;  3TZD A;  2RBM A;  5JAV A;  1W6J A;  4V19 0;  3RZO B;  1LT4 D;  4HCS A;  3D4D A;  4FF4 A;  1SND A;  3SE0 A;  5C4Z A;  3P75 A;  1A3T A;  1DZ1 A;  2L11 A;  3V96 A;  4M1U B;  2D9U A;  2WKC A;  2F0F A;  1M4V A;  4X3K A;  1EOT A;  2IT1 A;  2M2L A;  3R8B A;  1PZI D;  4K5X A;  4OIJ A;  4UAI A;  3T13 A;  3G6J B;  2RA4 A;  3E6Z X;  1QCB D;  4OGQ C;  2ZXR A;  1I50 B;  2K5D A;  3OWF A;  4CGY B;  3TN2 A;  4ZK9 B;  5M3F B;  1G29 1;  1I4Q A;  3S16 B;  2WII B;  1CT1 D;  3ERO A;  3AMU A;  2B2W A;  2AWO A;  5D14 A;  1Y1W B;  1TII D;  3J80 E;  1B1Z A;  1I4R A;  1SNM A;  1B44 D;  4Q5V A;  1I4G A;  5KNB A;  1DCZ A;  2EZV A;  2K32 A;  5ELC A;  4RH6 A;  4CJ0 B;  1U4L A;  1X3P A;  2C9O A;  2J4X A;  1WTV A;  1L0X B;  2X6L A;  1I6V C;  5CGK A;  5DNF A;  3K57 A;  3KK7 A;  1Y8O B;  4LK1 C;  1XTC D;  2VB3 X;  4DF7 A;  4IZ8 A;  1CI3 M;  2I46 A;  3IAY A;  3SVM A;  1U4R A;  3BZD B;  4KN7 C;  5IOC A;  5KRU A;  3C2P A;  5CBA E;  2A74 C;  1ML0 D;  3MXP A;  2NUC A;  1EQT A;  4EQN A;  5FLX L;  4JK1 C;  1Q1E A;  2Q8T A;  4B9W A;  4IFD I;  5IOD A;  1WCM B;  3DEO A;  3L7Z C;  4MN3 A;  4I65 A;  3PO2 B;  1E0B A;  2LS0 1;  2G9H D;  2ZXO A;  5CBE E;  3MHB A;  1TY2 A;  2XWB B;  4NW2 A;  2F0I A;  2R93 B;  3TBI B;  1KDC A;  3HOW B;  1IYU A;  4FNF A;  3MEH A;  1R9T B;  1II3 A;  3PUY A;  1E2Z A;  5JVH 3;  2JA7 B;  5EPL A;  4PMB A;  4ZRZ A;  3F2U A;  1VF7 A;  1CQV A;  1A6X A;  1B53 A;  3GTQ B;  5J1Z A;  2FIN B;  5CV5 A;  5I4D A;  4IUQ A;  5K36 H;  5T1G A;  2HCI A;  3I91 A;  1Q3L A;  5DM6 3;  2PQE A;  3GV3 A;  1EY0 A;  3IL8 A;  5IT9 L;  1A15 A;  2JA8 B;  1EYD A;  4BBR B;  2ICI A;  3DWP A;  4O1N A;  3J7A F;  1JWS D;  5E1F A;  1OXU A;  4IFD H;  1HFG A;  4ZUJ A;  1UUP A;  1B3A A;  3OMC A;  1WTO A;  4C3J B;  4Q0F A;  1BO0 A;  2NN6 I;  2AQ1 B;  1U4M A;  4RHR A;  4A3E B;  4CJ2 C;  3C46 A;  2Y0S B;  1EEF D;  2OXP A;  2K5Q A;  1ZEQ X;  3L9A X;  3OPO A;  3OIQ A;  4OO1 G;  2EPB A;  2A5H A;  4ZYS A;  4K5V A;  3HZX A;  3M4Y A;  5G3L D;  2BCO A;  2R61 A;  1TS3 A;  3DEP A;  3SR1 A;  1PMR A;  1SMY C;  1T5E A;  3ZYY X;  1IKM A;  1KLU D;  4WFN 3;  2LMC B;  3HRZ C;  2EE1 A;  5C3X A;  4KY7 A;  1DON A;  1CHP D;  1ICW A;  2HUG A;  4RGM A;  4C2M B;  2EYL A;  2J0T D;  3GTP B;  1VMP A;  3ND8 A;  5CC4 A;  3SDZ A;  3MFG A;  4WJW A;  2NWG A;  1ENA A;  2B63 B;  3P1H A;  4C3J G;  5HUR A;  2YU9 B;  1TWC B;  2AQ3 B;  4G57 A;  1JQY D;  3A8I E;  1FNU A;  4LAA A;  1WTX A;  2NTS A;  3Q6S A;  1STG A;  1DOM A;  2XWJ B;  1HQR D;  5EKI A;  1KAA A;  3MTS A;  2NZ1 D;  2A73 B;  1MGS A;  3D4R A;  4A3M B;  2DY7 A;  2WP8 J;  1CFM A;  1CA6 A;  3NTH A;  2F3V A;  1OXS C;  3A7A B;  3CKI B;  5IGC A;  4BS9 A;  3IKJ A;  3PIP 3;  1M8A A;  1NR4 A;  3KLS X;  1HXY D;  2K04 A;  2KOL A;  2PW7 A;  1A3U A;  1T5X D;  1KDA A;  5EKL A;  3VYT A;  2BDN A;  3OMG A;  1PTO C;  2F4I A;  4RAU C;  5BN5 A;  1TKW B;  3D6C A;  1JB3 A;  2EYF A;  2IW3 A;  2A6E D;  2IPK D;  3J81 L;  1SE3 A;  3QO2 A;  4CKC A;  3K59 A;  3NWS A;  1SBB B;  3PUV A;  1ZYR C;  1G2S A;  1CM9 A;  4A3J B;  1VCI A;  1UNS A;  2BOS A;  2EY5 A;  2E2D C;  2EJM A;  3S17 B;  2B2V A;  1TWA B;  1Z6H A;  2QF7 A;  1NUC A;  4RKB A;  1SMY D;  3K58 A;  4FVM A;  4ZQ3 A;  1JCK B;  1PLF A;  3H91 A;  2B39 A;  2SEB D;  2B8F A;  2XRQ D;  3S1M B;  2RDH A;  1EYA A;  3LX0 A;  3K5L A;  4QIW B;  3TDQ A;  1MI2 A;  1D6E C;  5CV6 A;  4FF2 A;  2B2Y C;  5KEE A;  3JAM L;  1PRT C;  4WOR A;  3RZD B;  2WKD A;  5C5M A;  1ET6 A;  4KJO A;  2EYO A;  5HGT A;  1O80 A;  1HHV A;  3P20 A;  4KY5 A;  5M9O A;  1F9R A;  1Y1V B;  4ZKB B;  4QUC A;  2JXM B;  4U67 3;  3CU7 A;  4E6I A;  1OXX K;  5C4J B;  5ELE A;  1PXU A;  1SYB A;  1PTO D;  5EQ0 A;  4WRD A;  4DK0 A;  3D4W A;  1HTL D;  1PYW D;  5E4X A;  1EY9 A;  1LAC A;  1RJT A;  4O42 A;  1GHK A;  1FD7 D;  4A3D B;  4DAV A;  3T16 A;  4BY1 B;  5FO8 B;  1V1P A;  1ZYR D;  4RA8 A;  3IFT A;  2PCF B;  1TT2 A;  1V8Q A;  2XVS A;  3BG3 A;  4MHE A;  2E2H B;  3K5N A;  1VMC A;  3ERQ A;  2WAQ B;  1ESR A;  2PZT A;  1D2B A;  3EA6 A;  3PO3 B;  2HDM A;  3I73 A;  2KEC A;  2F0W A;  1SE2 A;  3HEJ A;  1C48 A;  1RTN A;  4FXG C;  1TS2 A;  1SXT A;  3FVQ A;  1XYI A;  4KKT A;  5IGG A;  5ELF A;  1TQO A;  4DFA A;  5C0X G;  1SNQ A;  4RHS A;  2DN8 A;  3TP7 A;  4NMZ A;  1K83 B;  5A2Q E;  3S1R B;  2CVR A;  3KUP A;  1AN8 A;  1PRT D;  1DOL A;  2CW0 D;  2B2W C;  2A68 D;  4A93 B;  2KEE A;  2AWN A;  3PUW A;  5DM7 3;  3QWN A;  3M85 A;  3NHH A;  3X3M A;  1HA5 A;  2R92 B;  2H1E A;  3J80 L;  3DUZ A;  5E4W C;  3H0G B;  5I9P A;  1WD0 A;  2PZU A;  4OHJ A;  3M7G A;  2MHV A;  3FPP A;  2K33 A;  3D8G A;  3NP8 A;  4A3F B;  4QF4 A;  5M5Y B;  3L3O C;  2NN6 G;  5EBC A;  1NSN S;  2Z1C A;  3MC0 B;  1QNK A;  2PPB C;  1GUS A;  4EGV A;  4G7Z C;  5IGB A;  1Z7T A;  2JP1 A;  1RHP A;  3SK4 A;  1EU4 A;  3RLF A;  1HRJ A;  4IFD J;  1TY0 A;  2L1B A;  5C6A A;  2KED A;  2SOB A;  2O2L D;  1H9S B;  3MXU A;  2A6H C;  4XQQ A;  4X3T A;  4C1N I;  1JIC A;  2F0M A;  1YNJ D;  4KKU A;  2R7Z B;  1D1K A;  2RSN A;  2EY1 A;  4FO2 A;  3BVG A;  4AYB B;  4HTH A;  2VNU D;  1BDO A;  1FNW A;  3PMF A;  4DAY A;  3TP6 A;  2M00 A;  3I4M B;  4TRD A;  3C3L A;  5C0X J;  1RF2 D;  5EJW A;  1C4Q A;  4RGO S;  1PTO B;  2QCP X;  1DJR D;  2XSC A;  1XWE A;  1TWF B;  1I6H B;  2O5J C;  4L63 B;  3I3C A;  2F0H A;  1BCP D;  3VA5 A;  3LWU A;  1CQF A;  1EY4 A;  1ILQ A;  3KBG A;  3TSS A;  1S5C D;  4C3H B;  5CV7 A;  4BBS B;  3M4O B;  2TMP A;  2O4X A;  2L12 A;  2B8G A;  4DK1 A;  2O5I C;  2AUK A;  5D3I B;  2F3W A;  1PFM A;  2F0D A;  3DXJ C;  2JEA I;  5ISR A;  3R3O A;  2QKI C;  2RDF A;  1ONL A;  1JC7 A;  4A3I B;  1AP0 A;  3EVQ A;  3VA7 A;  2VB2 X;  2EXZ A;  2XN9 C;  2H4O A;  3LNN A;  3GTM B;  4EQO A;  3EQL C;  1F9S A;  3K7A B;  1CHQ D;  2EYH A;  5JPN C;  1S5E D;  3FPU B;  2FJ2 A;  4J6H A;  3I70 A;  1GUW A;  1UEA B;  1MD2 D;  1DYQ A;  5CV8 A;  2ZT9 C;  3WDN A;  1KTK A;  1VF5 C;  4QB4 A;  4C3H G;  3S9W A;  1Q12 A;  4BA2 I;  1PRT B;  1STE A;  2F0J A;  2F0V A;  2EVB A;  1ILP A;  4DN4 M;  2F0P A;  1SDF A;  1FYC A;  4K6L A;  4DNT B;  1Q90 A;  1IHZ A;  5FKA C;  3N52 A;  3VR5 A;  1SEB D;  1Y8N B;  4KV6 A;  5JOB A;  2CHB D;  1AFP A;  3U9O A;  1A2U A;  1TWH B;  2L0C A;  1HUM A;  3URY A;  5G3L F;  4X3U A;  3GD7 A;  3H09 A;  3R2I A;  1D5X C;  4GZY C;  2K28 A;  5BN3 A;  1SSO A;  3A8K E;  1OO9 B;  3GO5 A;  3I72 A;  3MZ5 A;  1O7L A;  3CRL C;  3QJY A;  1BNZ A;  4HMI A;  1J9O A;  5C4H A;  4KHZ A;  2BA0 A;  3NWT A;  5C4X B;  5T1I A;  4K8I A;  3GP7 A;  3FMC A;  5EPK A;  3SK6 A;  3WOE A;  1I4X A;  2KQ3 A;  1EY6 A;  3T4A C;  1LTB D;  5K5P A;  5FLX E;  3EFX D;  3T53 B;  3I4N B;  1A2T A;  3BS1 A;  1H9M A;  2E74 C;  4KTA A;  5C5L A;  1QJO A;  5CV9 A;  3PV0 A;  3EJI A;  1JR0 D;  1F2Y A;  4QCL A;  2NB0 A;  1STB A;  3NBI A;  1JWM D;  4RCO A;  4LMQ D;  1SNP A;  4HR7 B;  1SAP A;  1B2T A;  2AUJ D;  3KF8 A;  2DY8 A;  4FP5 D;  4ILW A;  3K6O A;  5I6Y A;  2B2V C;  3W3A A;  1BCP B;  3BVZ A;  2JSO A;  2WIN B;  2LFN A;  2QIL A;  2NYZ D;  4H0L C;  1WTQ A;  1EIG A;  3TP5 A;  2Z8L A;  1TVX A;  1PFB A;  5DEH A;  1B9N A;  1LTR D;  1S5D D;  2MP1 A;  5IT9 E;  3SK5 A;  3FRP B;  2EYP A;  5KNC A;  1QB5 D;  5BN4 A;  2KJX A;  3S2D B;  1GXD C;  4FYD A;  5COY A;  4IUP A;  2F0U A;  3A56 A;  2D62 A;  1A3V A;  3Q22 A;  2FHT A;  2EY6 A;  3PUZ A;  2D5D A;  5KIX A;  2KUM A;  4HMJ A;  4ZKC B;  2E2I B;  2K01 A;  5JEA H;  3NQT A;  5IGE A;  3OOC A;  3C1E A;  5D65 A;  1JWU D;  3NK9 A;  4K2L A;  4N9P A;  2R6G A;  4ME5 A;  1TU2 B;  1JE4 A;  1STN A;  4J8Q A;  3ONA B;  4QUF A;  4G7O C;  3NE5 B;  4KK7 A;  4UDU C;  1OXV A;  2Z4I A;  1GUN A;  3KLR A;  1Q8I A;  1ENF A;  1LT3 D;  2BE5 C;  2PZW A;  4YIJ A;  1EY8 A;  3QIA A;  4RCN A;  5EGT A;  3SEB A;  5AFW A;  1EY5 A;  3CHB D;  3A8J E;  1BXT A;  2LKV A;  1SYF A;  3SXH A;  3R2T A;  1G8Z D;  2PYK A;  2KHS A;  1PZK D;  3RMH A;  2JYO A;  4F7X A;  2HCC A;  1QE6 A;  4B08 A;  5KND A;  3I4L A;  2OEO A;  1PTO F;  3DWA A;  1H9S A;  3CRK C;  1LTI D;  3E5S A;  4HCE A;  3OIP A;  3DMU A;  1TS4 A;  1IYV A;  2E76 C;  2L5T A;  4P2C B;  2A69 C;  3OWE B;  2IL8 A;  3VYR A;  1WTR A;  4XQN A;  4F88 A;  1JOK A;  2XIW A;  1BF4 A;  1RKN A;  1HPC A;  3BDC A;  3T51 B;  3GTL B;  3QOL A;  3GTJ B;  2X6G A;  1F9Q A;  3G7L A;  5FO7 B;  1E2V A;  2EOT A;  4KMU C;  1MBY A;  4IUN A;  3J81 E;  4XYQ A;  2EYM A;  5K36 G;  3C1F A;  1Q1B A;  2PNR C;  3S2H B;  5EKK A;  4H7B A;  1B50 A;  3DHQ A;  5FK9 C;  2HQE A;  4ID6 A;  4NKL A;  2SDF A;  3CQZ B;  4U68 A;  2V4D A;  5NUC A;  4PNY A;  5DAU A;  3X3N A;  1LTS D;  2QEJ C;  1GJX A;  1DXM A;  1BUV T;  1ZXT A;  4G4K A;  3O13 A;  3S1Q B;  4IFD G;  2ICE C;  2JA6 B;  1PRT F;  1CK1 A;  3Q0A A;  1KDB A;  1EZ6 A;  1O7Y A;  2BE5 D;  4A3G B;  2HDL A;  3D3R A;  4EVO A;  4DA2 A;  1BR9 A;  2NVQ B;  3U9S A;  1G2T A;  3NSW A;  3BYT B;  1VDZ A;  1STY A;  2LY7 A;  1PDQ A;  2RDG A;  1EIH A;  2KCC A;  2XRS D;  1H9J A;  4DGZ A;  4XTC S;  2NBF A;  3NTI A;  3AU7 A;  3D6W A;  4FXK C;  1F77 A;  3GTK B;  1ENC A;  3PUX A;  1WD1 A;  4V0B A;  2L9H A;  2B2T A;  1BQQ T;  1ESF A;  2WV6 D;  4H44 C;  2F0S A;  2BDO A;  3OHX C;  1QIL A;  4K2K A;  4HSP A;  4RKL A;  1NR2 A;  4OO1 H;  1LLR D;  1GUT A;  4ABN A;  4CJ1 B;  3MXG A;  2WAC A;  1B9M A;  1YNN C;  2MUY A;  1HUN A;  4HSV A;  1LT5 D;  1SNO A;  2KA7 A;  1SYE A;  5LL6 S;  3TME A;  4ZUI A;  3I90 A;  2L55 A;  3A54 A;  4C1N K;  4CKE A;  4C3I G;  2ENB A;  3MAQ A;  2FMM A;  2KVM A;  5ELD A;  4I7Z C;  3MXN A;  1AEX A;  1STA A;  4IUU A;  3HGB A;  4KKS A;  1MSG A;  2B2U A;  4QMG A;  2NTT A;  3S1N B;  1CTM A;  2L4N A;  4ZLT F;  1L0Y B;  4FF1 A;  5JEA G;  1AZQ A;  1BCP F;  3GTO B;  2ZXP A;  1V43 A;  3DWQ A;  4Y7N B;  1F2L A;  3V05 A;  4DAP A;  4S3S A;  2Q8I B;  4B9X A;  4KD4 A;  2C5C A;  3ND9 A;  4NP5 A;  1ROD A;  1SJE D;  1LT6 D;  4L8J A;  2SNM A;  2J7Z A;  4RGT A;  4CBV A;  1AW7 A;  3OW7 A;  1EL0 A;  2RVL A;  5CMD A;  1F2Z A;  1EU3 A;  3HOV B;  5I9O A;  1GHJ A;  3MFY A;  3QB3 A;  1EWH A;  4XIG S;  2DNE A;  5I2X A;  5IIF A;  2F0T A;  3A55 A;  1KAB A;  5M3M B;  5LL6 X;  1U9R A;  1RTO A;  1GUO A;  5EPJ A;  4PV1 C;  2PW5 A;  2EYJ A;  5C3E B;  4XT3 B;  4R8I A;  2IX0 A;  2MGS A;  4RGN A;  3H94 A;  4BWG B;  1F2M A;  3E0J A;  1PZJ D;  4LJZ C;  1YNN D;  1C8C A;  5FO9 B;  1D5M C;  2RQX A;  3I8Z A;  3ITP A;  2OF1 A;  1V1P B;  4R9W A;  4RWS C;  2RSO A;  4XXE A;  4PMW A;  4DXG A;  1R4Q B;  3NUC A;  2D2C C;  2KCN A;  2FMC A;  1G91 A;  1Y69 U;  5FOB B;  3DM1 A;  2MPM A;  5JEA J;  1Y8P B;  2F0E A;  4K6D A;  1LV9 A;  3MA2 B;  3LWE A;  3HG9 A;  3KLS A;  1EEI D;  4XYO A;  1SE4 A;  4PQX A;  1JOO A;  2NVX B;  2A6H D;  4R8N A;  4XQJ A;  5C0X I;  1RDP D;  5LHY 1;  2NVT B;  1FR3 A;  2EJG C;  1IW7 C;  2RKS A;  1QWY A;  1W6K A;  1H9K A;  1G6Z A;  4G7H C;  5ELB A;  5JPM C;  1XX8 A;  3HS0 C;  1DOK A;  1LTG D;  2EDG A;  4EQP A;  4K8J A;  1IL8 A;  1HQM C;  3HOZ B;  4CKB A;  3GQB A;  3MWY W;  1EY7 A;  1CA5 A;  4KN4 C;  3NXW A;  2A6E C;  4NDX A;  5M5X B;  2DNC A;  4FF3 A;  2K5W A;  3Q24 A;  3VYU A;  4A3K B;  1XXG A;  3NBH A;  3Q23 A;  2Q8R E;  1QOH A;  3KBX A;  5M5W B;  3W2D A;  4IUR A;  2K7V A;  1BOS A;  3BYY B;  1STH A;  1WTP A;  4ZAI A;  2ID0 A;  5J22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...