5KEEA

Crystal structure of staphylococcal nuclease variant delta+phs l25k/i92f at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKKMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYFYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25K/I92F at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5keeA00
1EY0A 3OMCA 3LX0A 4KY7A 3TMEA 2OF1A 5JAVA 5DEHA 4K14A 5EKLA 1EZ8A 4RKBA 4ID6A 2EY1A 4NMZA 2PZWA 4KJNA 1KAAA 2F0VA 2F0FA 2RDFA 3D8GA 1TR5A 4K2KA 5CV4A 1ENAA 5EGTA 3TP7A 1EY4A 2F3WA 1EQVA 1SYEA 4KV6A 4KY5A 3SHLA 1SYBA 3VA5A 1AEXA 1SNQA 4H7BA 1STAA 4QF4A 4R8NA 3OSOA 5I6WA 3MVVA 5KGUA 4DU9A 2F3VA 4IZ8A 4EQPA 5KYLA 1IHZA 2EY2A 4NKLA 4KD4A 2O4XA 2F0SA 4QB4A 4ZUJA 1EYAA 2EYPA 4YIJA 2F0UA 3BDLA 1F2ZA 1EZ6A 1SYGA 4EQNA 4WORA 4PMBA 1STNA 1EY6A 3ERQA 4QMGA 2EYMA 4ODGA 2EXZA 3ITPA 3TP8A 2F0GA 4ZUIA 5CV7A 5C3XA 4G57A 1STYA 3SK5A 5I9OA 1SNOA 1SNCA 5M9OA 1A2UA 3DMUA 5K5PA 5C5MA 3D6CA 2NUCA 2QDBA 1EY8A 1STGA 1STBA 4NDXA 2EYJA 5DAUA 3EVQA 3OWFA 4KHVA 5HGTA 3HEJA 1EYDA 5J22A 1U9RA 4IUNA 5IGBA 2F0IA 4KD3A 5CV6A 3RUZA 2KHSA 4EVOA 1EY9A 1A3TA 4NP5A 2OXPA 2EYHA 4HMJA 2PW5A 5JOBA 3HZXA 4DFAA 2LKVA 2F0HA 5IGGA 5HURA 2F0MA 1F2MA 1SYDA 2SNMA 3EJIA 1RKNA 4HTHA 5J1ZA 5CGKA 2EYFA 3NUCA 4WRDA 5I9PA 2F0EA 3DHQA 5J39A 3D4DA 3QB3A 4TRDA 3NP8A 5EKKA 4HMIA 1A2TA 4N9TA 5IGDA 5CV8A 5NUCA 3EROA 5IGEA 2F0WA 3TP5A 5CV9A 2F0DA 2RBMA 4K5VA 2PZTA 5E3FA 3NXWA 4MIUA 3SK6A 3P75A 3SR1A 1EY7A 4B9WA 5KEEA 1JOQA 5IGFA 4K2LA 4ZQ3A 2F0JA 4F8MA 5CR3A 3C1EA 3H6MA 4K5WA 4LAAA 4OL7A 5C5LA 1EYCA 1TQOA 4KY6A 5IIFA 2EYOA 4K5XA 2SOBA 5ISRA 4F7XA 5KIXA 4DGZA 3QOJA 3NHHA 5CC4A 1ENCA 3PMFA 3NK9A 3S9WA 3SXHA 4PNYA 4K8IA 2PYKA 4J6HA 1KABA 4RKLA 1A3VA 1TT2A 2HQEA 5E1FA 2KQ3A 2F0LA 3E5SA 3T13A 3TP6A 3MEHA 4I65A 1SYFA 2OEOA 4IALA 4E6IA 5C3WA 2EYLA 3C1FA 1NSNS 3BDCA 1KDBA 2PQEA 2F0PA 5CV5A 4DF7A 5C4HA 5IGCA 4KJOA 2F0OA 1A3UA 1SNMA 4K8JA 3T16A 4EQOA 5I6YA 1F2YA 5IOCA 2F0KA 3D4WA 3NQTA 4S3SA 3U9OA 1SNDA 4B9XA 2WACA 5C4ZA 5IODA 2SNSA 3SK8A 5KRUA 5F2DA 2F0QA 1JORA 1JOOA 3QOLA 1EY5A 2F0TA 1KDCA 1STHA 2RKSA 2ENBA 2EY6A 3R3OA 4J1MA 3MXPA 3P1HA 1KDAA 2PW7A 1SYCA 4N9PA 4K6DA 1NUCA 1SNPA 3SK4A 3V2TA 3OMGA 2PZUA 4KTAA 2EY5A 4ME5A 2M00A 3MZ5A 1II3A 2F0NA 5C6AA 4PMCA 3MHBA 1JOKA 5KYIA
chains in the Genus database with same CATH superfamily
4BXXG 3LX0A 4JV5Q 3CCRA 1JJGA 2NN6G 2EY1A 2PQAA 1Q1EA 3G6EA 1J6QA 2F3WA 3STBD 2NVQH 1CHPD 3A8JE 3HRZC 5IYDH 4H7BA 2MGSA 1STAA 2JN4A 2C35B 2WAQG 3OSOA 1IBLL 1JE4A 2BH2A 2EY2A 2R7DA 5M3FB 3FKIH 2NZ1D 2EIFA 2FJ2A 4IO9A 1NE3A 4XTCS 4QMGA 3HOXH 2FINB 4L5SA 5C3XA 1B2TA 1A2UA 2N49A 4GKKL 3D6CA 1MBYA 2NUCA 1PV4A 1WYDA 3Q0AA 2R92G 2QILA 1EYDA 3S16B 3FDTA 3MXUA 1KNAA 1RTOA 4O42A 2NVXH 4JI0L 4BBRG 1FR3A 1VQAA 3EJIA 1F2MA 1LT3D 2O2LD 1CKOA 2EYFA 4WFN3 3QO2A 5C3EG 2AWOA 1ILQA 5IE8A 1EU3A 4NXNQ 1E2ZA 5A2QE 2ZJPA 1N8RC 3VR4A 3W5OA 4C2MH 2XSCA 3SK6A 1B44D 1X9NA 1AN8A 2AKWB 1PH9A 1TS2A 4R4TA 4CKCA 5EQ0A 1Q1BA 3KJPA 4F8MA 4TSSA 3SVMA 4YY3Q 4HIKA 4IFDH 3A5UA 4K5XA 1V1PB 3HP3A 3QOJA 1JC7A 1TWCH 2CQAA 1KXLA 3QG1A 3A56A 3SXHA 2F4IA 2JA5B 4DK0A 3I3CA 1A15A 2SEBD 2KQ3A 4KKSA 1J5EL 2I5LX 3KLSX 5JEAH 3J80E 5ELCA 2JQOA 1T5EA 2F0OA 1WCMG 2WV6D 3VR3A 3Q22A 1HQRD 1F2LA 3UE0A 2F4VQ 1LYLA 1BCPB 2OQ0A 4K0KQ 3ND9A 3E9IA 5C0XJ 1Y8OB 2Y0SG 3PF5A 4DUYL 4TQUS 1PZKD 4YWMA 4JOIA 2YU9B 4RA8A 5EBCA 2E8GA 4BS9A 2DY8A 4BA2I 5K36H 4M8AA 4BY7B 4KTAA 1BBWA 3WWVA 1HA5A 1II3A 2XN9C 2KEDA 1CA6A 4MZ9A 3A5ZB 5KYIA 3S1MB 1RL2A 4YCWA 4ZLTF 4RKBA 3K81C 4K2KA 3CPWA 1I6HH 2DJFC 4LF5L 3I4MB 3OIPA 2R7ZH 4UP9A 3UI2A 2QF7A 1B50A 4QIWB 4WJ3M 4IQZA 1WTRA 1F2ZA 4A3JG 3RZDB 3T1YQ 1YJNA 4X66L 1SDFA 3PV0A 1X6OA 2PNHA 1YBYA 1ENFA 2NZHA 1LV9A 3MWYW 3P7JA 1NR4A 3S15H 4H13C 3SEBA 1IL8A 5DAUA 3K5NA 4DR4Q 2F0IA 1SE4A 2L0CA 3KF8B 4C3HG 1A3TA 4FP5D 1CTMA 1JE5A 1I4XA 3EQLC 4RFBA 5CORA 2BDOA 1TY0A 2MO1A 5HURA 1EQQA 2IHFA 3W3AA 2KEEA 4LF9Q 1BDOA 4HEDA 3NUCA 5C44B 3NP8A 2UUBQ 1A2TA 3EROA 4A3FG 2UU9L 2MJ8A 5GROA 4FF3A 1O7YA 4DV7L 4IPHA 2DNEA 2CCZA 1PYWD 4K2LA 2UXDQ 3GV3A 1E24A 1RHPA 4H44C 4X65Q 2VUMH 4ZYSA 3T1HQ 2H5XA 1KD1C 3PMFA 3BZCA 1YNJD 5E4WC 3T13A 3K80C 3C1FA 1VDZA 2PQEA 1Y1WH 4A3KB 2RDHA 1E2VA 3J7AF 4QUCA 4KN4C 1XXGA 1PH3A 4S3SA 1SXTA 3MFGA 3SK8A 2DJGC 2F0QA 1WTQA 4Z9CB 1STHA 2MHVA 1LT4D 2A6EC 2CH4A 4P2CB 1LLRD 2A74C 4A3CG 1KDAA 2M9VA 2BA1A 2A73B 2ICEC 2Q2HA 3BZKA 4LFCL 3M4QA 4JI2L 5M3MB 4QIWE 4LJZC 1QVGA 3KFUA 5AJ3Q 1LABA 3J81E 4ZCKA 4JI3Q 2NN6I 5LMUL 1I6VC 2XNAC 3K7AH 2MFIA 1AW7A 3GV6A 4B3SL 2NVTH 2KUMA 4KJNA 3JC66 3KYHC 1AP0A 1EY4A 3I73A 3AEVA 1EQVA 3OIQA 3X3NA 2LSSA 1F77A 1PFSA 3ND8A 4JBJA 4DUZQ 3W2DA 2B2YC 1SBBB 1S5FD 1VMPA 4KKTA 4L8JA 2HHHQ 3RR5A 3S14H 2OT2A 3I91A 4DR5Q 3OHXC 1EL0A 3HOVB 2KOLA 3DWQA 2CW0C 4CJ1B 1S40A 1KHIA 4HCEA 2PO4A 4RMFA 4PZ8A 4LF7L 3I4NB 2QDBA 4J15A 3L7ZC 1SE2A 4X64L 1LTSD 1PH7A 4IUNA 1AE3A 4LUZA 2VY3A 3N52A 1HR0L 2OXPA 2EYHA 2LS01 4X3SA 1MJEA 3QR8A 1K28A 2Z4IA 3DM1A 1Q12A 4HMIA 3A8KE 4I7AA 2Z1CA 3ULPA 4GKJQ 4JI8L 1VQKA 3P75A 1QILA 3KDFB 4OX9L 5GAEC 2LMCB 3M4YA 1JR0D 5EBDA 1VF7A 2ZT9C 3H0GG 1TQOA 2MP1A 3CCQA 3BYYB 4GOPB 1IBLQ 4C3IH 1A3VA 2MQHA 5DM73 3BDOA 3T4AC 4NXML 1BBUA 4B3TL 1C48A 3AB9A 3DEPA 3M4OB 3GTGH 1RODA 1VQ6A 1DYQA 3CPFA 1IYUA 1PRTD 4CDCC 1BCPC 1EY5A 2F0TA 2ZXRA 3GTJH 3GTOH 3TZDA 3FVQA 2B2UC 1Z9FA 3PUVA 4JBKA 1U4LA 2O5IC 1RCVD 4ME5A 2VL6A 4BY1G 1BQQT 4JI0Q 1EU4A 1PFBA 3TRZA 4DNTB 4BBSG 3K8AA 1PZID 1DGSA 4DXGA 4K14A 5EKLA 4APVA 1UEAB 1OXUA 2JSOA 4XT1B 2F0VA 2F0FA 2AHOB 1ENAA 3BJUA 5E7NA 1TWGB 4ZK9B 2R6GA 5M3FH 4DAYA 3J80c 1SYBA 4A76A 3E0EA 4RGMA 3NBHA 1D8LA 3E3XA 5M5YB 1QWYA 4LUVA 4DU9A 1Y14B 2ICIA 4ZUJA 3U50C 3FPPA 5CBAE 5C4JB 1XPUA 1Y1VB 2SDFA 2JP1A 4X3TA 3S16H 1DONA 2RHQB 5CV7A 2A19A 4AH6A 1ZKOA 1NR2A 5IYDG 2X69A 4A3DB 1STGA 5BN5A 4C3JB 3HGBA 4GZYC 3NTIA 1DOKA 4DNIA 4IJLA 3FKIG 4EVOA 3HOXG 4DUYQ 4HMJA 4OIKA 5IP7G 3R2IA 4XYOA 4ILWA 2RSOA 4QL5A 4JYAQ 2K52A 2ZJQA 1XYIA 5M5XB 2A68D 2NVYB 1XJVA 4P74A 3VR5A 2E74C 4KLKA 3S1NB 2A6HC 3SR1A 3JAML 4A93B 1R4PB 5KEEA 1N32L 1VQHA 2JA5H 2H1EA 4HSVA 1HPCA 5FJ8H 1EYCA 5ISRA 1HUNA 4F7XA 3NTHA 3A54A 2UXCL 1A6XA 2B8FA 1MKHA 1HJPA 1WTHA 2MPMA 4L63B 1GHKA 3MEHA 1PRTB 4I65A 1VF5C 2OCEA 1B7YB 1K3RA 2J4XA 2YU9H 3L3OC 3ULJA 3AFPA 1A3UA 4L5QA 4IFDG 4QQBX 3D4WA 3CHBD 1G6PA 4X66Q 1XPRA 3H94A 2SNSA 4ZRZA 4BY7H 1PHJA 2KCMA 5FO9B 5JEAG 4PZ6A 3S1MH 5M5WB 3H3VI 3HOZG 1X3EA 1S72A 3HS0C 4YHHL 2EY5A 3WOEA 2K7VA 1VQGA 2AUJD 1WTWA 4PMCA 3TDQA 3TMEA 3URYA 3I4MH 1QCBD 4KI0A 1PH6A 5T1IA 2N55A 2UU9Q 5K36G 1Q3LA 4DNRB 1V1OA 1V8QA 4DV7Q 3RZDH 1I5FA 1VCIA 4V0BA 1AEXA 1FJGL 4OWTB 4MNOA 1SSOA 1LTGD 2WB1B 2FMCA 1N33L 3D31A 4GN5A 3KLWA 4NKLA 2D62A 2PNRC 1KC8C 5C4XG 1STNA 1RJTA 1EY6A 2J0TD 1TS4A 1B1ZA 2EXZA 1NY4A 4FXKC 1S5ED 3CCLA 1SJHD 4PG3A 2K5WA 1VQNA 2R7ZG 1PYBA 4OWWB 1DD2A 1KRTA 1W6JA 4KHVA 5C44H 4ZAIA 1B3QA 4KD3A 1YI2A 4X3UA 2UUAL 3Q8DA 3E9HA 3S17B 4ME3A 3PO2B 4HSPA 2BE5C 4LFCQ 1YHBA 4JI2Q 3KF6A 4N9TA 4YWLA 3TBIB 5IY0A 2GVAA 1SROA 2IPKD 1UWVA 2MUYA 5LMUQ 3H15A 3GTKB 1KLUD 2WINB 1XTCD 5JPMC 4K5WA 4LAAA 4OL7A 1I94L 4KY6A 1VQ8A 4A3KH 3S9WA 3NK9A 3HKZE 1AH9A 2N8NA 1G91A 2ZTDA 3EFXD 1I3QB 3QIAA 5KNCA 2HQEA 1XMOQ 1C8CA 4OO1G 1EIHA 4PMWA 4UP8A 5DLQE 5C0XH 2VUMG 1L1OA 1RIPA 2B29A 2A5HA 1S5CD 1N9WA 5M3MH 4FXDA 4LF7Q 1L1OB 4CKBA 2YTVA 4OGQC 4DR1L 2CKZB 4CDEC 1HQMC 1KAWA 4X64Q 3R93A 1Y1WG 1D2BA 2WB1E 3CW2C 3LNNA 4DXFA 4TKOB 4KMUC 3OMCA 2JEBI 3I90A 1VQCA 4JI1L 2R92B 1I50B 1XPOA 1HH2P 4HJ8A 2Z9HA 3G48A 4JI8Q 3IL8A 1GM5A 3PUXA 1CSQA 1D5XC 4BBRB 2XVSA 2E75C 4KHZA 4OX9Q 1LT5D 1QG7A 3HOVH 1NTGA 1S5BD 2F3VA 5KYLA 4R4CA 3I4NH 1KLGD 2E2IB 3S24A 4HIMA 2XWBB 2EYMA 1PH1A 1DXMA 4CKEA 3MC0B 3PIO3 2I5MX 2A8VA 3I70A 3CP0A 4NXMQ 1SNCA 2ID0A 2HCCA 1BR9A 4B3TQ 2EDGA 4GN4B 2B2YA 3RNUA 1OXXK 4HJAA 1BVSA 1HNXL 1HRJA 1IW7C 4RHSA 3R2TA 3QWNA 1AZQA 1I4PA 4LF6L 3M3YB 2Z6KC 4NP5A 4R4IA 4IN3A 3DLLA 1QUQB 1RKNA 1I4QA 1D5ZC 1TIID 2K03A 1IBMQ 4DN4M 1WD1A 4A3BB 3D4DA 3D6WA 4QY7A 5CV8A 1SFOB 3TP5A 3X3MA 2GN5A 2Y0SB 4XT3B 2Q2UA 4G4KA 1CA5A 1EY7A 4YCUA 2A69D 1RDPD 3T53B 2VW9A 5L37A 1MGSA 1TS3A 2OQKA 3M4OH 1GVPA 2E2HB 3MAQA 1VQJA 4U68A 4A3IB 4DV1Q 3K6OA 5BN4A 3E5SA 1Y69U 4JBMA 3GTQB 1JQYD 1OXTA 4JI4Q 4GLXA 1NSNS 1H9KA 1WJJA 2L4NA 4OIJA 3OTOL 2D0OA 1SNDA 1V1PA 3UE1A 2K5DA 5F2DA 4A3MB 1JOOA 1FGBD 3QOLA 2RHSB 1EIGA 1KDCA 4BWGB 3G4SA 2XTIA 3BG3A 1VQ7A 2B2TC 2ZXPA 3SK4A 1PTOB 1TWAB 4DR3L 1Q8KA 1IYVA 2IHEA 4PV1C 1TWGH 3IFTA 2F0NA 3IRBA 3AU7A 3CCJA 1JOKA 3HOYG 3OOCA 5M5YH 2B2UA 3CRKC 4LK1C 4DV3L 1VQ5A 1OXVA 2EE1A 2NB0A 3AYHB 5C4JH 3VA5A 2KECA 1Y1VH 2Q2IA 2AMCB 1N32Q 1PLFA 3MTSA 5IWAL 4AQYQ 4R8NA 3PIP3 4MN3A 3I4OA 1G51A 4A3DH 4A3EB 4KD4A 4KHPQ 2E5LL 1GUWA 2UXCQ 2EYPA 3MXNB 3MA2B 4C3JH 2B63B 1Q7YC 2JE6I 2UXBL 4ZUIA 5M3FG 4Q0FA 3FHWA 1OTCA 3AMUA 2OTLA 4XQQA 3LWEA 1V1QA 4WJ4A 2NBFA 1TWHB 2VNUD 3KOJA 4WJWA 2NVYH 4DV6L 5JOBA 1QNKA 1PXUA 4OONA 3RN2A 5CGKA 1XNQL 3S1NH 4YCVA 1CKMA 2KENA 4A93H 1W6KA 4AYBB 1SR3A 2JA9A 3F1ZA 3AQQA 3NE5B 4YHHQ 2QEXA 1H95A 2RDGA 5EKIA 4MIUA 1NMFA 2CH4W 1MD2D 2Q2TA 3KF8A 3GTLB 2L12A 5GAGC 4O0AA 2K32A 3PIOA 1LTRD 3M7GA 4MHEA 2K50A 1BBXC 1FJGQ 3VA7A 4OO1I 1VQLA 2O5JC 3A55A 1N33Q 3PO3B 2JA5G 1AZPA 5IGCA 3A0JA 4UDUC 5CYUA 4K8JA 5FJ8G 3ER0A 4QCLA 5IOCA 2E2JB 5M5WH 4A75A 5KRUA 4PQXA 1Q90A 1JORA 4DAPA 1WVLA 1XWEA 1X65A 1L1OC 1EIYB 1BUVT 2C5CA 1KRSA 1CI3M 1VQDA 2UUAQ 3AFQA 3Q23A 1NNXA 2G5DA 4V190 1YHQA 4R4QA 4DKAC 4ZKBB 4BY7G 1UAPA 1MIUA 5DEHA 2JA7B 1V9PA 1D6EC 3CC2A 5EGTA 1WTOA 1VQFA 1SYEA 3SHLA 2EJFC 3K59A 2EOTA 3W1BA 4IOCA 4LFAQ 1I94Q 1JJCB 2D5DA 1SMYC 3I4MG 2F0SA 4FXGC 1ET9A 1Q8IA 4EQNA 3GO5A 4RCNA 4WORA 5GAHC 3J81j 3B6YA 3ERQA 4AYBE 1Z7TA 4HN7A 1X3GA 3OW2A 1VS0A 4NPSA 4DV0L 5H1SE 1SNOA 5M9OA 2ATWA 3CD6A 2XGTA 3DMUA 4EGVA 3S17H 3D4RA 3H0GB 3PO2H 4NDXA 1JB3A 1X32A 5LL6X 1QZGA 5EPLA 3TN2A 1KTKA 5LL6S 1GUGA 4DR1Q 1VMCA 4C56C 4IFDJ 3A74A 1HHVA 3HKSA 1LACA 2QCPX 2TSSA 3GTKH 1PA6A 2KCTA 1DJRD 2NTSA 4DV4L 5EKKA 5LMNW 5LMNL 3HG9A 3PIPA 4R1JA 5JEAJ 3UDXA 4RCOA 1P8LA 4JI1Q 1ESFA 3CMEA 4BXXH 3I72A 1FL0A 1I3QH 2E2DC 3I7FA 4RWSC 5FK9C 3NBIA 1K8OA 4HIDA 4HJ7A 4R8IA 1ENCA 2CWAA 1HR0W 3M7NA 2K5HA 4OXPA 4L6TB 3OPOA 3TZUA 3T51B 2EYLA 4TVAB 4JI5L 3KDFA 4A3GB 3V05A 4UP7A 4KJOA 3LWUA 1H9SB 1C4QA 2VB3X 1Q86C 2X6GA 4B9XA 3C46A 3H91A 2D0PA 3BVZA 1PH4A 4GOPA 4JK1C 4RGNA 3ONAB 4XQNA 1CK1A 1IL2A 1G291 1HNXQ 2R92H 4QUFA 1I50H 1GHJA 4RG1A 2PZUA 4JPBW 4LF6Q 1GXDC 1PTOC 4LF8L 4F88A 1NCVA 3BZDB 4R9WA 4BBRH 3VYTA 3UDFA 3UDGA 3A7LA 2FMMA 2OF1A 3EA6A 1TKWB 3DM3A 1EOTA 3FEWX 1AFPA 3D8GA 1FGUA 2I07B 1KNEA 1YVCA 2RDFA 4JI6L 1QNUA 2E2IH 1FNUA 1BXTA 3NENA 1D7QA 4GKKQ 1UE1A 3K5MA 2K4KA 4EQPA 1K73C 1YNXA 2I5HA 2IL8A 5BR8L 2IW3A 4YIJA 1BNZA 1X3QA 1BOSA 4B08A 1CKNB 3OW7A 4O1NA 3NWSA 3M3YH 3STBC 3VR6A 1RF2D 2KBNA 4G7OC 2BH8A 1STBA 3OTOQ 4MTKA 3I4NG 2PPBC 2H4OA 4A3BH 4OWXB 3CU7A 3CAMA 5CV6A 2NWGA 1EY9A 1SFOH 3F2DA 2PW5A 1GUOA 3WDNA 5ELEA 4WRDA 3JAMi 2F0EA 3VR2A 2B2WA 2N88A 4DR3Q 5NUCA 2RCFA 2DUDA 5CV9A 2F0DA 1J5EQ 4K5VA 3HOWB 1PH8A 5E3FA 4X62L 2E2HH 3PF4A 3HOUB 5ELFA 2Z6KA 2B39A 1F9QA 1W3SA 2HUGA 1JOQA 1FYCA 2WFWA 4A3IH 1X56A 2JA8B 2F0JA 1STEA 4DA2A 2JA6B 4DV3Q 3HOZB 3GTQH 3A8IE 4DPGA 1JT8A 1BO0A 5IIFA 1VQEA 5I4DA 1SLJA 1HFGA 5IWAQ 3RMHA 3J7YW 3TP6A 4A3MH 1SYFA 3J7AV 2E5LQ 4A3LH 3W1GA 4DF7A 2F1MA 1F2YA 1QE6A 2UXBQ 2FFKB 1HZCA 5D65A 1PTOH 5ELDA 1TWAH 5IYBH 2R93B 3SGIA 1NBWA 1ZXTA 3I4LA 3NELA 1PFNA 5T1GA 2VZAA 2P5ZX 5FLXc 5C4XB 3K0XA 2L11A 4CJ2C 4LF5Q 1ICWA 4DV6Q 4R4OA 3MZ5A 1XNQQ 5C6AA 3KK7A 5JJZA 1GO3E 4KY7A 4P73A 5JAVA 3ZYYX 3S1RB 2B2TA 5HY6A 4M1UB 3TP7A 4A3EH 1SN8A 2IX0A 1EFWA 5IT9c 2B63H 2YTYA 3C2PA 4FNFA 2B2VC 4JG2A 2HD3A 3TSSA 2UUCL 1WTXA 1EYGA 3BDLA 1TWHH 3KLSA 5EJWA 3TS2A 1A63A 4DK6C 1Y1VG 2CWPA 1L2FA 2EVBA 4JI7L 3TREA 5FLMH 3FP9A 5IGBA 1K3BC 2JYOA 4C3JG 4GS3A 4KN7C 4IUVA 1CFMA 4I7ZC 1E2WA 1PYSB 2VQEL 3FPUB 2F03A 1H9MA 3GTLH 5J39A 1B3AA 4GNXB 4K6LA 1E1TA 5IYCH 1SE3A 2VS1A 3K57A 1M90C 3H3VH 5CBEE 2N78A 2YTXA 3GDEA 2GVBA 5D14A 1LTLA 5A2QL 3PO3H 4A93G 5C5LA 4DK1A 1SAPA 3PUZA 3Q6SA 4LFBL 3NHHA 1NMGA 2A6ED 3M4PA 2E2JH 4K8IA 2ZTCA 5JPNC 2QGQA 5I9OA 1LT6D 5A35A 1ZEQX 5JVH3 3IAYA 1YITA 2IX1A 1L0XB 5DM63 2F0KA 3RLOA 3WOFA 4AIMA 4DV0Q 5IODA 1VQBA 2KJXA 3J80L 4IUPA 2HT1A 1B53A 4B3SQ 1YNJC 1UE6A 2PW7A 4YWKA 3KBXA 1DOLA 5G3LF 2JA7H 1L0WA 1CHQD 3HKZG 4POGA 1X3FA 5ELOA 4GOPC 2RF4A 3GTMB 2M00A 1HNZL 1EY0A 2ZXOA 4DV4Q 3NPPA 3DWPA 1M1KC 4FDBA 5LMNQ 1EIFA 3ICEA 2CW0D 1XTDA 2WAQB 2Q8TA 4KY5A 1QVCA 3CC7A 2D2CC 3CQZB 5COYA 2B3GA 1O78A 3H0GH 1EYAA 1EZ6A 1SYGA 1BCPF 3GTPB 1N34L 1HR0Q 2WB1G 1T5XD 2NYZD 1CSPA 3P20A 1MSGA 3U9SA 3L9AX 1VQPA 2MNAA 1Y8PB 4JI5Q 4UHVA 1QB5D 1EY8A 3Q24A 5G3LD 2I0QA 2AWNA 5J22A 2E76C 4FYDA 3T56B 2XRSD 1WTVA 5C3EB 5IGGA 1SYDA 2G9DA 2M2LA 4DK3C 3DWAA 1IYJB 1VQ9A 2Z4HA 4JBWA 4LF8Q 4OHJA 1JWSD 1C0AA 2RBMA 1O7LA 2L1BA 1HTPA 4HAEA 2IX3A 2BA0A 5IP9H 1GJXA 3RLFA 2OWOA 4EQ5A 2B2WC 3RN5A 3H6MA 2BOSA 1QUQA 1GKHA 4JI6Q 1BCPD 2EYOA 4CBVA 4A3GH 4DGZA 5CC4A 4HJ9A 4ALPA 1IBKL 1A62A 1H9JA 1KABA 4RKLA 1F9SA 1E0BA 1FD7D 2F0LA 3HOYB 1WCMB 3PSIA 2CVRA 1GUNA 5BR8Q 1KDBA 3J7ZC 3LGJA 3T16A 1RTNA 2YV5A 3U9OA 1HFNA 3HFZB 1YIJA 2WAQE 2PQAB 2RKSA 1SMXA 5E4XA 4HIOA 1IKMA 1UE7A 3IKJA 4DR2L 1GD7A 1M4VA 2Z6BA 2FXQA 1JWMD 2DN8A 3N6RA 3CC4A 5IP7H 5BN3A 4IPCA 3CXCA 1UE5A 4IFDI 1PRTC 2ZTEA 1L0YB 2EJMA 1O80A 4ID6A 1H9RA 3F2BA 3EBEA 2KCCA 1CQFA 5CV4A 3J81L 4X62Q 4CDDC 4IUQA 1C7YA 1CT1D 4C3IG 4FF4A 4EX5A 4DV2L 1HNWL 4A3JB 1A0IA 4IZ8A 2RVLA 3GQBA 3VDYA 1DCZA 4CJ0B 3RZOB 2K1BA 1HCZA 1HZBA 1LO5D 1LTAD 3ITPA 1R9TB 1ZYRD 1STYA 4KKUA 2HQLA 2R7FA 5K5PA 1XMQL 3ULLA 1E22A 2EYJA 2A6HD 4C3HB 1O7IA 1TWFB 2LFNA 3MXNA 2VQFL 3HOWH 1YNND 2N3SA 3V96A 3HOUH 4IJHA 3TEHB 4A3FB 2AQ1B 4JC0A 2JA8H 3E0JA 3MEFA 4U673 2JA6H 3HOZH 2ASBA 2RA4A 1KIXA 4GNXC 4RAUC 4JVZA 1PZJD 3PGZA 4A3BG 5FO8B 2XIWA 4DR7L 3CMAA 1LTBD 4XIGS 2Y0SE 5IGFA 3MFYA 5AFWA 3PQIA 3C1EA 1B8AA 1D1IA 4H0LC 5CMDA 4Q5VA 4UY8C 4B3RL 3KLRA 1ASZA 3L0OA 4JYAL 4QGUA 1BF4A 4DR6L 5M5XH 1IXRA 4XXEA 4QJFA 2A68C 2R93H 4IALA 4A3IG 2UUCQ 4Y7NB 1SNMA 5C4XH 5FLXE 1B70B 3F8TA 1QVFA 1R4QB 2K5NA 2EZVA 1S4ZA 4JI7Q 4PZ7A 3U4VA 1J8IA 2K04A 1PDQA 2PI2A 2ENBA 1U4PA 2EY6A 4A3MG 1I4RA 5FO7B 4A3LG 3S1RH 1ILPA 3V2TA 3FRPB 1G8ZD 1HTLD 3G7LA 4RGOS 2AQ3B 1S5DD 5ELBA 4XQJA 5IYBG 2MO0A 3UDIA 2VQEQ 5IT9E 1G6ZA 4NMZA 5JVG3 4DV5L 1ET6A 2WKDA 4KV6A 5DNFA 1JJ2A 4LUOA 3M9BA 1MJCA 3VYSA 4MTNA 3L2PA 2ES2A 4LFBQ 3G71A 2O4XA 1OO9B 2F0UA 2K14A 1XX8A 5GADC 2JXMB 3CCVA 4A3EG 4ODGA 2F0GA 2JK8A 2BE5D 1G2TA 4P71A 1I4GA 3SK5A 2B63G 1OXSC 3CCEA 3PUWA 3PCOB 4OO1H 4LF4L 4UAIA 2B2VA 5HGTA 1FVIA 3IFDA 3HEJA 1SJED 2EPBA 1XNRL 1Z6HA 2PMZB 2AQ2B 3TQYA 2KA7A 1K0RA 1CUKA 2LKVA 4BA1I 2VB2X 2SNMA 5FLMG 3DHQA 3EIVA 4L5TA 4P72A 1Q81C 1FNVA 2IJ0A 2F0WA 4AYBG 2RQXA 2PZTA 1HNZQ 1MSHA 2VXWA 4IURA 1WD0A 1K83B 5CR3A 3SDZA 1PFMA 5KIXA 4H02A 5IYCG 1U4MA 3S1QB 3S2HB 1N36L 5E1FA 2K05A 4IUUA 2L5TA 4C1NK 4LMQD 2PI2E 2IT1A 1N34Q 5C44G 4EQOA 3PO3G 3KUPA 2WACA 1K0SA 4HR7B 3JAMc 3GTMH 2ZM6L 4ABNA 5D3IB 3GP7A 3R3OA 4J1MA 3J7A5 2NN6H 3MXPA 3P1HA 3MXGA 2R3ZA 1XMOL 3F2UA 2C9OA 2EXDA 4BY1B 2QDLA 3EN2A 4K6DA 3S2DB 3D3RA 4L5RC 4BBSB 1YZ6A 4B3ML 1H9SA 4FF2A 1QZHA 3DEOA 3MHBA 2KHSA 4OEMB 3CQZH 2QEJC 2Q8IB 1TR5A 5I2YA 4A3KG 1YJWA 2NTTA 2JA7G 3GTPH 3OWEB 5KNDA 1PRTF 3OYYA 2WKCA 4HCSA 2PMZE 5J3BA 1IW7D 2CQOA 1WTPA 1T9HA 3NWTA 5C0XG 2QA4A 3K0YA 2NVQB 3NSWA 1IBKQ 2JJQA 3O13A 2DY7A 5M3MG 3TP8A 1ML0D 2WP8J 3K5OA 1ONLA 1TU2B 1EFID 4F87A 4FO2A 5C3EH 2HIVA 3FKIB 1EEID 4ULLA 3HOXB 1LTID 1M8AA 1MI2A 2V4DA 4JW0A 3DUZA 1HXYD 4GLVB 1TVXA 1NJIC 4HTHA 5J1ZA 1IBML 1CKNA 4LNQA 4JV5L 4J8QA 4DR2Q 4TRDA 3SE0A 2Z8LA 1QOHA 1CZWA 5IGEA 1DM0B 4NB3A 2NVXB 2Z0SA 1EQRA 2KCNA 3VYRA 2D9UA 2J7ZA 4ZKCB 1LTTD 2LXJA 3HOVG 1UUPA 1U5KA 3ZJYC 1EOVA 3HOYH 4JCVE 1FNWA 1VQIA 1WCMH 2EQSA 2X6LA 2SOBA 4C2MB 1W2BA 4CHTB 1B9MA 3I2ZA 4J6HA 4DV2Q 4OELB 1HNWQ 1PVOA 4JOIC 5IP9G 2QW7A 1VQMA 3NTKA 5CV5A 3BDCA 2TMPA 2F0PA 2Q8RE 2RCNA 1TWCB 2HDMA 1YEZA 1F9PA 1CQVA 2L9HA 4A3GG 2A69C 2EJGC 3E6ZX 1XMQQ 1G2SA 1K8GA 4DV1L 1SYCA 4X6AH 4DAYB 3H3VC 4JI4L 1BKBA 3NBHB 4NXNL 2VQFQ 1VQ4A 1CZGA 2FHTA 3PUYA 1JB7A 1QJOA 1GUSA 1U0LA 2RSNA 3D0FA 5TSSA 2L15A 2XRQD 3K7UC 5LHY1 1EZ8A 4XYQA 1Q46A 4A3JH 3CCMA 1KAAA 4YY3L 3F2CA 3A7AB 3RZOH 4DR7Q 1AE2A 2HCIA 2HIXA 1SNQA 1E7ZA 3MVVA 1R9TH 4B3RQ 3RD4A 2F3IA 1IHZA 1I6HB 2WIIB 1ZYRC 4DR6Q 1HA6A 1A8VA 2A1AA 4C3HH 2F4VL 2R7ZB 4K0KL 1YJ9A 4G57A 1TWFH 2I46A 1X54A 5C5MA 5JJIA 4AQYL 1LM0A 3VYUA 1RD9D 4HJ5A 3EVQA 4A3FH 3BVGA 1EWIA 1PH5A 1YNNC 1DZ1A 4KHPL 3RUZA 1SE8A 1E1OA 2LXKA 1S3OA 4DFAA 3S15B 2F0MA 2K01A 5I9PA 1KL9A 3CCSA 1HZ9A 5IGDA 1TY2A 1HZAA 1B9NA 3M85A 3BYTB 5GQOA 1JCKB 3NXWA 1EEFD 1YHAA 2DGYA 4FF1A 1I4HA 1K8MA 1PMRA 4B9WA 5HGQA 2ALYB 2F52A 4ZQ3A 3HOWG 4G7ZC 4DV5Q 4A3DG 3HOUG 3I8ZA 3HKZB 3CF5A 2JA8G 4Y7NH 2JA6G 3ERSX 4NW2A 2QKIC 2R61A 1D5MC 4GNXA 2OTJA 3QJYA 3T1YL 1DOMA 2PYKA 4P75A 3U4ZA 2IY5B 3TS0A 2VUMB 1D1KA 1LUZA 5EAYA 4DAMA 4E6IA 3J80i 5C3WA 4A3CH 1K9MC 2JEAI 1PH2A 3BU2A 5I6YA 4GLAC 3NQTA 4DR4L 4IPDA 5C4ZA 4LF4Q 2YYZA 2KHIA 1CM9A 3U58A 2KHJA 1Y1WB 2DNCA 3KJOA 2R93G 3K5LA 4LF9L 1UEBA 1XNRQ 5FKAC 2BDNA 4N9PA 1IKLA 1EWCA 4O2DA 3K58A 2UUBL 1SEBD 2HDLA 1ESRA 2G9HD 1EWHA 1SMYD 1TXYA 1JICA 3R8BA 5JJLA 3GD7A 2UXDL 1WOCA 4CDFC 2B8GA 2PZWA 4X65L 1O7ZA 3T1HL 2BCOA 3J81c 1U4RA 1C9OA 1Q82C 1NAPA 1Y8NB 4QF4A 5KGUA 5I6WA 4RGTA 3K7AB 4X3KA 1B4OA 2NVTB 5C0XI 1UNSA 2CHBD 3FMCA 5KNBA 3KBGA 4QB4A 1J9OA 5D3DA 1F9RA 3CRLC 4PMBA 1N36Q 2IWHA 4C1NI 4POFA 1E3PA 1WFQA 3C3LA 1P16A 1V43A 1JMCA 4RHRA 3KF6B 1EQTA 3S14B 5FOBB 3OWFA 1PTOF 1X3PA 5EPKA 4LFAL 1K8AC 1MHWC 1U9RA 2K33A 3H09A 1IZ6A 2KVMA 2ZM6Q 3DXJC 5ELNA 3HZXA 2ZJRA 5JJKA 2F0HA 2AUKA 5AJ3L 1VQOA 4JI3L 1KQSA 2CFMA 4N8X1 3QB3A 3I55A 1K83H 4LWCA 1HUMA 4B3MQ 2PCFB 3CCUA 3S1QH 2V1CC 3S2HH 2L55A 1ICFB 3BVMA 4XDXA 2K5VA 2NZOA 4KK7A 4DUZL 5FLXL 4UPAA 4N8FA 1GUTA 1GOZA 2HHHL 5I2XA 4PNYA 4RH6A 4DR5L 2GA4B 3NEMA 1TT2A 4CGYB 3JAME 2OEOA 2K5QA 1TS5A 1ASYA 5C4HA 3BS1A 3PO2G 1PTOD 4IUTA 4BY1H 1X55A 4G7HC 4C3IB 3S2DH 1WI5A 4A4IA 2K75A 4IOAA 4FVMA 4Y52H 5IT9L 4BBSH 3CKIB 3NQIA 2K28A 3GTGB 2K6AA 4GN3B 4IPGA 4DAVA 1JWUD 3G6JB 1NUCA 4LW1A 1SNPA 3OMGA 1SRUA 2LY7A 1Z47A 3RLNA 4GKJL 3I56A 3GTJB 5EPJA 3J81i 1EUJA 3GTOB 2XWJB
chains in the Genus database with same CATH topology
3LX0A 2NN6G 2EY1A 1Q1EA 2F3WA 1CHPD 3A8JE 3HRZC 4H7BA 2MGSA 1STAA 3OSOA 1JE4A 2EY2A 5M3FB 2NZ1D 2FJ2A 4XTCS 4QMGA 2FINB 5C3XA 1B2TA 1A2UA 3D6CA 1MBYA 2NUCA 3Q0AA 2QILA 1EYDA 3S16B 3FDTA 3MXUA 1KNAA 1RTOA 4O42A 1FR3A 3EJIA 1F2MA 1LT3D 2O2LD 2EYFA 4WFN3 3QO2A 2AWOA 1ILQA 1EU3A 1E2ZA 5A2QE 3VR4A 2XSCA 3SK6A 1B44D 1AN8A 1TS2A 4CKCA 5EQ0A 1Q1BA 4F8MA 4TSSA 3SVMA 4IFDH 4K5XA 1V1PB 3HP3A 3QOJA 1JC7A 2CQAA 3QG1A 3A56A 3SXHA 2F4IA 2JA5B 4DK0A 3I3CA 1A15A 2SEBD 2KQ3A 4KKSA 3KLSX 5JEAH 3J80E 5ELCA 1T5EA 2F0OA 2WV6D 3VR3A 3Q22A 1HQRD 1F2LA 1BCPB 3ND9A 5C0XJ 1Y8OB 4TQUS 1PZKD 2YU9B 4RA8A 5EBCA 4BA2I 4BS9A 2DY8A 5K36H 4M8AA 4BY7B 4KTAA 1HA5A 1II3A 2XN9C 2KEDA 1CA6A 5KYIA 3S1MB 4ZLTF 4RKBA 4K2KA 3I4MB 3OIPA 3UI2A 2QF7A 1B50A 4QIWB 4IQZA 1WTRA 1F2ZA 3RZDB 1SDFA 3PV0A 1ENFA 1LV9A 3MWYW 3P7JA 1NR4A 4H13C 3SEBA 1IL8A 5DAUA 3K5NA 2F0IA 1SE4A 2L0CA 4C3HG 1A3TA 1CTMA 4FP5D 1I4XA 3EQLC 4RFBA 5CORA 2BDOA 1TY0A 5HURA 3W3AA 2KEEA 1BDOA 4HEDA 3NUCA 5C44B 3NP8A 1A2TA 3EROA 2MJ8A 4FF3A 1O7YA 2DNEA 1PYWD 4K2LA 3GV3A 1RHPA 4H44C 4ZYSA 3PMFA 1YNJD 5E4WC 3T13A 3C1FA 1VDZA 2PQEA 4A3KB 2RDHA 1E2VA 3J7AF 4QUCA 4KN4C 1XXGA 4S3SA 1SXTA 3MFGA 3SK8A 2F0QA 1WTQA 4Z9CB 1STHA 2MHVA 1LT4D 2A6EC 4P2CB 1LLRD 2A74C 1KDAA 2M9VA 2BA1A 2A73B 2ICEC 5M3MB 4LJZC 1LABA 3J81E 2NN6I 1I6VC 2XNAC 1AW7A 3GV6A 2KUMA 4KJNA 1AP0A 1EY4A 3I73A 1EQVA 3OIQA 3X3NA 1F77A 3ND8A 3W2DA 2B2YC 1SBBB 1S5FD 1VMPA 4KKTA 4L8JA 2OT2A 3I91A 3OHXC 1EL0A 3HOVB 2KOLA 3DWQA 2CW0C 4CJ1B 4HCEA 2PO4A 3I4NB 2QDBA 3L7ZC 1SE2A 1LTSD 4IUNA 3N52A 2OXPA 2EYHA 2LS01 4X3SA 2Z4IA 3DM1A 1Q12A 4HMIA 3A8KE 2Z1CA 3P75A 1QILA 2LMCB 3M4YA 1JR0D 5EBDA 1VF7A 2ZT9C 1TQOA 2MP1A 3BYYB 1A3VA 5DM73 3BDOA 3T4AC 1C48A 3AB9A 3DEPA 3M4OB 1RODA 1DYQA 1IYUA 1PRTD 1BCPC 1EY5A 2F0TA 2ZXRA 3TZDA 3FVQA 2B2UC 3PUVA 1U4LA 2O5IC 1RCVD 4ME5A 1BQQT 1EU4A 1PFBA 4DNTB 1PZID 4DXGA 4K14A 5EKLA 1UEAB 1OXUA 2JSOA 4XT1B 2F0VA 2F0FA 1ENAA 1TWGB 4ZK9B 2R6GA 4DAYA 1SYBA 4RGMA 3NBHA 5M5YB 1QWYA 4DU9A 2ICIA 4ZUJA 3FPPA 5CBAE 5C4JB 4X3TA 1Y1VB 2SDFA 2JP1A 1DONA 5CV7A 1ZKOA 1NR2A 2X69A 4A3DB 1STGA 5BN5A 4C3JB 3HGBA 4GZYC 3NTIA 1DOKA 4EVOA 4HMJA 4OIKA 3R2IA 4XYOA 4ILWA 2RSOA 1XYIA 5M5XB 2A68D 2NVYB 3VR5A 2E74C 3S1NB 2A6HC 3SR1A 3JAML 4A93B 1R4PB 5KEEA 2H1EA 4HSVA 1HPCA 1EYCA 5ISRA 1HUNA 4F7XA 3NTHA 3A54A 1A6XA 2B8FA 2MPMA 4L63B 1GHKA 3MEHA 1PRTB 4I65A 1VF5C 2J4XA 3L3OC 1A3UA 4IFDG 3D4WA 3CHBD 3H94A 2SNSA 4ZRZA 5FO9B 5JEAG 5M5WB 3HS0C 2EY5A 3WOEA 2K7VA 2AUJD 1WTWA 4PMCA 3TDQA 3TMEA 3URYA 1QCBD 4KI0A 5T1IA 2N55A 5K36G 1Q3LA 4DNRB 1V1OA 1V8QA 1VCIA 4V0BA 1AEXA 1SSOA 1LTGD 2WB1B 2FMCA 3D31A 4NKLA 2D62A 2PNRC 1STNA 1RJTA 1EY6A 2J0TD 1TS4A 1B1ZA 2EXZA 4FXKC 1S5ED 1SJHD 2K5WA 1DD2A 1W6JA 4KHVA 4ZAIA 4KD3A 4X3UA 3S17B 3PO2B 4HSPA 2BE5C 4N9TA 3TBIB 2IPKD 2MUYA 3GTKB 1KLUD 2WINB 1XTCD 5JPMC 4K5WA 4LAAA 4OL7A 4KY6A 3S9WA 3NK9A 1G91A 3EFXD 5KNCA 1I3QB 3QIAA 2HQEA 1C8CA 4OO1G 1EIHA 4PMWA 5C0XH 2A5HA 1S5CD 4FXDA 4CKBA 4OGQC 1HQMC 3R93A 1D2BA 3LNNA 4DXFA 4TKOB 4KMUC 3OMCA 2JEBI 3I90A 2R92B 1I50B 3IL8A 3PUXA 1D5XC 4BBRB 2XVSA 2E75C 4KHZA 1LT5D 1QG7A 1S5BD 2F3VA 5KYLA 1KLGD 2E2IB 2XWBB 2EYMA 1DXMA 4CKEA 3MC0B 3PIO3 3I70A 1SNCA 2ID0A 2HCCA 1BR9A 2EDGA 2B2YA 1OXXK 1HRJA 1IW7C 4RHSA 3R2TA 3QWNA 1AZQA 1I4PA 3M3YB 4NP5A 4IN3A 1RKNA 1I4QA 1D5ZC 1TIID 2K03A 4DN4M 1WD1A 4A3BB 3D4DA 3D6WA 5CV8A 1SFOB 3TP5A 3X3MA 2Y0SB 4XT3B 4G4KA 1CA5A 1EY7A 2A69D 1RDPD 3T53B 1MGSA 1TS3A 2E2HB 3MAQA 4U68A 4A3IB 3K6OA 5BN4A 3E5SA 1Y69U 3GTQB 1JQYD 1OXTA 1NSNS 1H9KA 2L4NA 4OIJA 1SNDA 1V1PA 2K5DA 5F2DA 4A3MB 1JOOA 1FGBD 3QOLA 1EIGA 1KDCA 4BWGB 3BG3A 2B2TC 2ZXPA 3SK4A 1PTOB 1TWAB 1IYVA 4PV1C 3IFTA 2F0NA 3AU7A 1JOKA 3OOCA 2B2UA 3CRKC 4LK1C 1OXVA 2EE1A 2NB0A 3VA5A 2KECA 1PLFA 3MTSA 4R8NA 3PIP3 4MN3A 4A3EB 4KD4A 1GUWA 2EYPA 3MA2B 2B63B 2JE6I 4ZUIA 4Q0FA 3AMUA 4XQQA 3LWEA 2NBFA 1TWHB 2VNUD 4WJWA 5JOBA 1QNKA 1PXUA 5CGKA 1W6KA 4AYBB 3NE5B 2RDGA 5EKIA 4MIUA 1MD2D 3KF8A 3GTLB 2L12A 2K32A 1LTRD 3M7GA 4MHEA 1BBXC 3VA7A 4OO1I 2O5JC 3A55A 3PO3B 1AZPA 5IGCA 5CYUA 4UDUC 4K8JA 4QCLA 2E2JB 5IOCA 5KRUA 4PQXA 1Q90A 1JORA 4DAPA 1WVLA 1XWEA 1BUVT 2C5CA 1CI3M 3Q23A 4V190 4ZKBB 1UAPA 5DEHA 2JA7B 1D6EC 5EGTA 1WTOA 1SYEA 3SHLA 2EJFC 3K59A 2EOTA 2D5DA 1SMYC 2F0SA 4FXGC 1ET9A 1Q8IA 4EQNA 3GO5A 4RCNA 4WORA 3ERQA 1Z7TA 4HN7A 1SNOA 5M9OA 3DMUA 4EGVA 3D4RA 3H0GB 4NDXA 1JB3A 1X32A 5LL6X 5EPLA 3TN2A 1KTKA 5LL6S 1GUGA 1VMCA 4C56C 4IFDJ 1HHVA 1LACA 2QCPX 2TSSA 1DJRD 2NTSA 5EKKA 3HG9A 5JEAJ 4RCOA 1ESFA 3I72A 2E2DC 4RWSC 5FK9C 3NBIA 1K8OA 4R8IA 1ENCA 3M7NA 4L6TB 3OPOA 3TZUA 3T51B 2EYLA 4A3GB 3V05A 4KJOA 3LWUA 1H9SB 1C4QA 2VB3X 2X6GA 4B9XA 3C46A 3H91A 3BVZA 4JK1C 4RGNA 3ONAB 4XQNA 1CK1A 1G291 4QUFA 1GHJA 2PZUA 1GXDC 1PTOC 4F88A 1NCVA 3BZDB 4R9WA 3VYTA 3A7LA 2FMMA 2OF1A 3EA6A 1TKWB 1EOTA 3FEWX 1AFPA 3D8GA 2I07B 2RDFA 1KNEA 1QNUA 1FNUA 1BXTA 3K5MA 4EQPA 2IL8A 2IW3A 4YIJA 1BNZA 1X3QA 1BOSA 4B08A 3OW7A 4O1NA 3NWSA 3VR6A 1RF2D 4G7OC 1STBA 2PPBC 2H4OA 3CU7A 5CV6A 2NWGA 1EY9A 2PW5A 1GUOA 3WDNA 5ELEA 4WRDA 2F0EA 3VR2A 2B2WA 2N88A 5NUCA 5CV9A 2F0DA 4K5VA 3HOWB 5E3FA 3HOUB 5ELFA 2B39A 1F9QA 2HUGA 1JOQA 1FYCA 2JA8B 2F0JA 1STEA 4DA2A 2JA6B 3HOZB 3A8IE 1BO0A 5IIFA 5I4DA 1HFGA 3RMHA 3J7YW 3TP6A 1SYFA 3J7AV 4DF7A 2F1MA 1F2YA 1QE6A 2FFKB 5D65A 1PTOH 5ELDA 2R93B 1ZXTA 3I4LA 1PFNA 5T1GA 5C4XB 2L11A 4CJ2C 1ICWA 3MZ5A 5C6AA 3KK7A 5JJZA 4KY7A 5JAVA 3ZYYX 3S1RB 2B2TA 4M1UB 3TP7A 2IX0A 3C2PA 4FNFA 2B2VC 3TSSA 1WTXA 3BDLA 3KLSA 5EJWA 2EVBA 5IGBA 2JYOA 4C3JG 4KN7C 4IUVA 1CFMA 4I7ZC 1E2WA 3FPUB 2F03A 1H9MA 5J39A 1B3AA 4K6LA 1SE3A 3K57A 5CBEE 5D14A 5A2QL 5C5LA 4DK1A 1SAPA 3PUZA 3Q6SA 3NHHA 2A6ED 4K8IA 5JPNC 5I9OA 1LT6D 5A35A 1ZEQX 5JVH3 3IAYA 2IX1A 1L0XB 5DM63 2F0KA 3WOFA 5IODA 2KJXA 3J80L 4IUPA 1B53A 1YNJC 2PW7A 3KBXA 1DOLA 5G3LF 1CHQD 3GTMB 2M00A 1EY0A 2ZXOA 3NPPA 3DWPA 2CW0D 2WAQB 2Q8TA 4KY5A 2D2CC 3CQZB 5COYA 1O78A 1EYAA 1EZ6A 1SYGA 1BCPF 3GTPB 1T5XD 2NYZD 3P20A 1MSGA 3U9SA 3L9AX 1Y8PB 1QB5D 1EY8A 3Q24A 5G3LD 2AWNA 5J22A 2E76C 4FYDA 3T56B 2XRSD 1WTVA 5C3EB 5IGGA 1SYDA 2G9DA 2M2LA 3DWAA 2Z4HA 4JBWA 4OHJA 1JWSD 2RBMA 1O7LA 2L1BA 1HTPA 4HAEA 2IX3A 2BA0A 1GJXA 3RLFA 2B2WC 3H6MA 2BOSA 1BCPD 2EYOA 4CBVA 4DGZA 5CC4A 1H9JA 1KABA 4RKLA 1F9SA 1E0BA 1FD7D 2F0LA 3HOYB 1WCMB 2CVRA 1GUNA 1KDBA 3T16A 1RTNA 3U9OA 1HFNA 2RKSA 5E4XA 1IKMA 3IKJA 1M4VA 1JWMD 2DN8A 3N6RA 5BN3A 4IFDI 1PRTC 1L0YB 2EJMA 1O80A 4ID6A 1H9RA 2KCCA 1CQFA 5CV4A 3J81L 4IUQA 1CT1D 4C3IG 4FF4A 4A3JB 4IZ8A 2RVLA 3GQBA 4CJ0B 1DCZA 3RZOB 2K1BA 1HCZA 1LO5D 1LTAD 3ITPA 1R9TB 1ZYRD 1STYA 4KKUA 5K5PA 2EYJA 2A6HD 4C3HB 1TWFB 2LFNA 3MXNA 1YNND 3V96A 4A3FB 2AQ1B 3E0JA 4U673 2RA4A 4RAUC 1PZJD 5FO8B 2XIWA 1LTBD 4XIGS 5IGFA 3MFYA 5AFWA 3C1EA 4H0LC 1D1IA 5CMDA 4Q5VA 3KLRA 1BF4A 4XXEA 2A68C 4IALA 4Y7NB 1SNMA 5FLXE 1R4QB 2EZVA 1S4ZA 1J8IA 2K04A 1PDQA 2ENBA 1U4PA 2EY6A 1I4RA 5FO7B 1ILPA 3V2TA 3FRPB 1G8ZD 1HTLD 3G7LA 4RGOS 2AQ3B 1S5DD 5ELBA 4XQJA 5IT9E 1G6ZA 4NMZA 5JVG3 1ET6A 2WKDA 4KV6A 5DNFA 3VYSA 2O4XA 1OO9B 2F0UA 1XX8A 2JXMB 4ODGA 2F0GA 2BE5D 1G2TA 1I4GA 3SK5A 4OO1H 1OXSC 3PUWA 4UAIA 2B2VA 5HGTA 3IFDA 3HEJA 1SJED 2EPBA 1Z6HA 2PMZB 2AQ2B 2KA7A 2LKVA 4BA1I 2VB2X 2SNMA 3DHQA 1FNVA 2IJ0A 2F0WA 2RQXA 2PZTA 1MSHA 2VXWA 4IURA 1WD0A 1K83B 5CR3A 3SDZA 1PFMA 5KIXA 1U4MA 3S1QB 3S2HB 5E1FA 2K05A 4IUUA 2L5TA 4C1NK 4LMQD 2IT1A 4EQOA 3KUPA 2WACA 4HR7B 4ABNA 5D3IB 3GP7A 3R3OA 4J1MA 2NN6H 3MXPA 3P1HA 3MXGA 2R3ZA 3F2UA 2C9OA 4BY1B 3S2DB 4K6DA 3D3RA 4BBSB 1H9SA 4FF2A 3DEOA 3MHBA 2KHSA 2QEJC 2Q8IB 1TR5A 5I2YA 2NTTA 3OWEB 5KNDA 1PRTF 2WKCA 4HCSA 1IW7D 1WTPA 3NWTA 5C0XG 3K0YA 2NVQB 3NSWA 3O13A 2DY7A 3TP8A 1ML0D 2WP8J 3K5OA 1ONLA 1TU2B 1EFID 4F87A 4FO2A 3FKIB 1EEID 4ULLA 3HOXB 1LTID 1M8AA 1MI2A 2V4DA 3DUZA 1HXYD 1TVXA 4HTHA 5J1ZA 4J8QA 4TRDA 3SE0A 2Z8LA 1QOHA 1CZWA 5IGEA 1DM0B 2NVXB 2KCNA 3VYRA 2D9UA 2J7ZA 4ZKCB 1LTTD 1UUPA 1FNWA 2X6LA 2SOBA 4C2MB 4CHTB 1B9MA 4J6HA 3NTKA 5CV5A 3BDCA 2TMPA 2F0PA 2Q8RE 1TWCB 2HDMA 1F9PA 1CQVA 2L9HA 2A69C 2EJGC 3E6ZX 1G2SA 1SYCA 3H3VC 1CZGA 2FHTA 3PUYA 1QJOA 1GUSA 2RSNA 5TSSA 2XRQD 5LHY1 1EZ8A 4XYQA 1KAAA 3A7AB 2HCIA 1SNQA 3MVVA 3RD4A 1IHZA 1I6HB 2WIIB 1ZYRC 1HA6A 2R7ZB 4G57A 2I46A 5C5MA 3VYUA 1RD9D 3EVQA 3BVGA 1YNNC 1DZ1A 3RUZA 4DFAA 3S15B 2F0MA 2K01A 5I9PA 5IGDA 1TY2A 3M85A 1B9NA 3BYTB 1JCKB 3NXWA 1EEFD 4FF1A 1I4HA 1K8MA 1PMRA 4B9WA 4ZQ3A 4G7ZC 3I8ZA 3HKZB 4NW2A 2QKIC 2R61A 1D5MC 3QJYA 1DOMA 2PYKA 2VUMB 1D1KA 4E6IA 5C3WA 2JEAI 5I6YA 3NQTA 5C4ZA 2YYZA 1CM9A 1Y1WB 2DNCA 3K5LA 5FKAC 2BDNA 4N9PA 1IKLA 1EWCA 3K58A 1SEBD 2HDLA 1ESRA 2G9HD 1EWHA 1SMYD 1JICA 3R8BA 3GD7A 2B8GA 2PZWA 1O7ZA 2BCOA 1U4RA 1NAPA 1Y8NB 4QF4A 5KGUA 5I6WA 4RGTA 3K7AB 4X3KA 1B4OA 2NVTB 5C0XI 1UNSA 2CHBD 3FMCA 5KNBA 3KBGA 4QB4A 1J9OA 5D3DA 1F9RA 3CRLC 4PMBA 2IWHA 4C1NI 3C3LA 1V43A 4RHRA 1EQTA 3S14B 5FOBB 3OWFA 1PTOF 1X3PA 5EPKA 1U9RA 2K33A 3H09A 2KVMA 3DXJC 3HZXA 2F0HA 2AUKA 3QB3A 1HUMA 2PCFB 2L55A 3BVMA 4XDXA 4KK7A 5FLXL 1GUTA 1GOZA 5I2XA 4PNYA 4RH6A 2GA4B 1TT2A 4CGYB 3JAME 2OEOA 2K5QA 1TS5A 5C4HA 3BS1A 1PTOD 4IUTA 4G7HC 4C3IB 4FVMA 5IT9L 3CKIB 3NQIA 2K28A 3GTGB 2K6AA 4DAVA 1JWUD 3G6JB 1NUCA 1SNPA 3OMGA 2LY7A 1Z47A 3GTJB 5EPJA 3GTOB 2XWJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY0 A;  3OMC A;  3LX0 A;  4KY7 A;  3TME A;  2OF1 A;  5JAV A;  5DEH A;  4K14 A;  5EKL A;  1EZ8 A;  4RKB A;  4ID6 A;  2EY1 A;  4NMZ A;  2PZW A;  4KJN A;  1KAA A;  2F0V A;  2F0F A;  2RDF A;  3D8G A;  1TR5 A;  4K2K A;  5CV4 A;  1ENA A;  5EGT A;  3TP7 A;  1EY4 A;  2F3W A;  1EQV A;  1SYE A;  4KV6 A;  4KY5 A;  3SHL A;  1SYB A;  3VA5 A;  1AEX A;  1SNQ A;  4H7B A;  1STA A;  4QF4 A;  4R8N A;  3OSO A;  5I6W A;  3MVV A;  5KGU A;  4DU9 A;  2F3V A;  4IZ8 A;  4EQP A;  5KYL A;  1IHZ A;  2EY2 A;  4NKL A;  4KD4 A;  2O4X A;  2F0S A;  4QB4 A;  4ZUJ A;  1EYA A;  2EYP A;  4YIJ A;  2F0U A;  3BDL A;  1F2Z A;  1EZ6 A;  1SYG A;  4EQN A;  4WOR A;  4PMB A;  1STN A;  1EY6 A;  3ERQ A;  4QMG A;  2EYM A;  4ODG A;  2EXZ A;  3ITP A;  3TP8 A;  2F0G A;  4ZUI A;  5CV7 A;  5C3X A;  4G57 A;  1STY A;  3SK5 A;  5I9O A;  1SNO A;  1SNC A;  5M9O A;  1A2U A;  3DMU A;  5K5P A;  5C5M A;  3D6C A;  2NUC A;  2QDB A;  1EY8 A;  1STG A;  1STB A;  4NDX A;  2EYJ A;  5DAU A;  3EVQ A;  3OWF A;  4KHV A;  5HGT A;  3HEJ A;  1EYD A;  5J22 A;  1U9R A;  4IUN A;  5IGB A;  2F0I A;  4KD3 A;  5CV6 A;  3RUZ A;  2KHS A;  4EVO A;  1EY9 A;  1A3T A;  4NP5 A;  2OXP A;  2EYH A;  4HMJ A;  2PW5 A;  5JOB A;  3HZX A;  4DFA A;  2LKV A;  2F0H A;  5IGG A;  5HUR A;  2F0M A;  1F2M A;  1SYD A;  2SNM A;  3EJI A;  1RKN A;  4HTH A;  5J1Z A;  5CGK A;  2EYF A;  3NUC A;  4WRD A;  5I9P A;  2F0E A;  3DHQ A;  5J39 A;  3D4D A;  3QB3 A;  4TRD A;  3NP8 A;  5EKK A;  4HMI A;  1A2T A;  4N9T A;  5IGD A;  5CV8 A;  5NUC A;  3ERO A;  5IGE A;  2F0W A;  3TP5 A;  5CV9 A;  2F0D A;  2RBM A;  4K5V A;  2PZT A;  5E3F A;  3NXW A;  4MIU A;  3SK6 A;  3P75 A;  3SR1 A;  1EY7 A;  4B9W A;  5KEE A;  1JOQ A;  5IGF A;  4K2L A;  4ZQ3 A;  2F0J A;  4F8M A;  5CR3 A;  3C1E A;  3H6M A;  4K5W A;  4LAA A;  4OL7 A;  5C5L A;  1EYC A;  1TQO A;  4KY6 A;  5IIF A;  2EYO A;  4K5X A;  2SOB A;  5ISR A;  4F7X A;  5KIX A;  4DGZ A;  3QOJ A;  3NHH A;  5CC4 A;  1ENC A;  3PMF A;  3NK9 A;  3S9W A;  3SXH A;  4PNY A;  4K8I A;  2PYK A;  4J6H A;  1KAB A;  4RKL A;  1A3V A;  1TT2 A;  2HQE A;  5E1F A;  2KQ3 A;  2F0L A;  3E5S A;  3T13 A;  3TP6 A;  3MEH A;  4I65 A;  1SYF A;  2OEO A;  4IAL A;  4E6I A;  5C3W A;  2EYL A;  3C1F A;  1NSN S;  3BDC A;  1KDB A;  2PQE A;  2F0P A;  5CV5 A;  4DF7 A;  5C4H A;  5IGC A;  4KJO A;  2F0O A;  1A3U A;  1SNM A;  4K8J A;  3T16 A;  4EQO A;  5I6Y A;  1F2Y A;  5IOC A;  2F0K A;  3D4W A;  3NQT A;  4S3S A;  3U9O A;  1SND A;  4B9X A;  2WAC A;  5C4Z A;  5IOD A;  2SNS A;  3SK8 A;  5KRU A;  5F2D A;  2F0Q A;  1JOR A;  1JOO A;  3QOL A;  1EY5 A;  2F0T A;  1KDC A;  1STH A;  2RKS A;  2ENB A;  2EY6 A;  3R3O A;  4J1M A;  3MXP A;  3P1H A;  1KDA A;  2PW7 A;  1SYC A;  4N9P A;  4K6D A;  1NUC A;  1SNP A;  3SK4 A;  3V2T A;  3OMG A;  2PZU A;  4KTA A;  2EY5 A;  4ME5 A;  2M00 A;  3MZ5 A;  1II3 A;  2F0N A;  5C6A A;  4PMC A;  3MHB A;  1JOK A;  5KYI A; 
#chains in the Genus database with same CATH topology
 4BXX G;  3LX0 A;  4JV5 Q;  3CCR A;  1JJG A;  2NN6 G;  2EY1 A;  2PQA A;  1Q1E A;  3G6E A;  1J6Q A;  2F3W A;  3STB D;  2NVQ H;  1CHP D;  3A8J E;  3HRZ C;  5IYD H;  4H7B A;  2MGS A;  1STA A;  2JN4 A;  2C35 B;  2WAQ G;  3OSO A;  1IBL L;  1JE4 A;  2BH2 A;  2EY2 A;  2R7D A;  5M3F B;  3FKI H;  2NZ1 D;  2EIF A;  2FJ2 A;  4IO9 A;  1NE3 A;  4XTC S;  4QMG A;  3HOX H;  2FIN B;  4L5S A;  5C3X A;  1B2T A;  1A2U A;  2N49 A;  4GKK L;  3D6C A;  1MBY A;  2NUC A;  1PV4 A;  1WYD A;  3Q0A A;  2R92 G;  2QIL A;  1EYD A;  3S16 B;  3FDT A;  3MXU A;  1KNA A;  1RTO A;  4O42 A;  2NVX H;  4JI0 L;  4BBR G;  1FR3 A;  1VQA A;  3EJI A;  1F2M A;  1LT3 D;  2O2L D;  1CKO A;  2EYF A;  4WFN 3;  3QO2 A;  5C3E G;  2AWO A;  1ILQ A;  5IE8 A;  1EU3 A;  4NXN Q;  1E2Z A;  5A2Q E;  2ZJP A;  1N8R C;  3VR4 A;  3W5O A;  4C2M H;  2XSC A;  3SK6 A;  1B44 D;  1X9N A;  1AN8 A;  2AKW B;  1PH9 A;  1TS2 A;  4R4T A;  4CKC A;  5EQ0 A;  1Q1B A;  3KJP A;  4F8M A;  4TSS A;  3SVM A;  4YY3 Q;  4HIK A;  4IFD H;  3A5U A;  4K5X A;  1V1P B;  3HP3 A;  3QOJ A;  1JC7 A;  1TWC H;  2CQA A;  1KXL A;  3QG1 A;  3A56 A;  3SXH A;  2F4I A;  2JA5 B;  4DK0 A;  3I3C A;  1A15 A;  2SEB D;  2KQ3 A;  4KKS A;  1J5E L;  2I5L X;  3KLS X;  5JEA H;  3J80 E;  5ELC A;  2JQO A;  1T5E A;  2F0O A;  1WCM G;  2WV6 D;  3VR3 A;  3Q22 A;  1HQR D;  1F2L A;  3UE0 A;  2F4V Q;  1LYL A;  1BCP B;  2OQ0 A;  4K0K Q;  3ND9 A;  3E9I A;  5C0X J;  1Y8O B;  2Y0S G;  3PF5 A;  4DUY L;  4TQU S;  1PZK D;  4YWM A;  4JOI A;  2YU9 B;  4RA8 A;  5EBC A;  2E8G A;  4BS9 A;  2DY8 A;  4BA2 I;  5K36 H;  4M8A A;  4BY7 B;  4KTA A;  1BBW A;  3WWV A;  1HA5 A;  1II3 A;  2XN9 C;  2KED A;  1CA6 A;  4MZ9 A;  3A5Z B;  5KYI A;  3S1M B;  1RL2 A;  4YCW A;  4ZLT F;  4RKB A;  3K81 C;  4K2K A;  3CPW A;  1I6H H;  2DJF C;  4LF5 L;  3I4M B;  3OIP A;  2R7Z H;  4UP9 A;  3UI2 A;  2QF7 A;  1B50 A;  4QIW B;  4WJ3 M;  4IQZ A;  1WTR A;  1F2Z A;  4A3J G;  3RZD B;  3T1Y Q;  1YJN A;  4X66 L;  1SDF A;  3PV0 A;  1X6O A;  2PNH A;  1YBY A;  1ENF A;  2NZH A;  1LV9 A;  3MWY W;  3P7J A;  1NR4 A;  3S15 H;  4H13 C;  3SEB A;  1IL8 A;  5DAU A;  3K5N A;  4DR4 Q;  2F0I A;  1SE4 A;  2L0C A;  3KF8 B;  4C3H G;  1A3T A;  4FP5 D;  1CTM A;  1JE5 A;  1I4X A;  3EQL C;  4RFB A;  5COR A;  2BDO A;  1TY0 A;  2MO1 A;  5HUR A;  1EQQ A;  2IHF A;  3W3A A;  2KEE A;  4LF9 Q;  1BDO A;  4HED A;  3NUC A;  5C44 B;  3NP8 A;  2UUB Q;  1A2T A;  3ERO A;  4A3F G;  2UU9 L;  2MJ8 A;  5GRO A;  4FF3 A;  1O7Y A;  4DV7 L;  4IPH A;  2DNE A;  2CCZ A;  1PYW D;  4K2L A;  2UXD Q;  3GV3 A;  1E24 A;  1RHP A;  4H44 C;  4X65 Q;  2VUM H;  4ZYS A;  3T1H Q;  2H5X A;  1KD1 C;  3PMF A;  3BZC A;  1YNJ D;  5E4W C;  3T13 A;  3K80 C;  3C1F A;  1VDZ A;  2PQE A;  1Y1W H;  4A3K B;  2RDH A;  1E2V A;  3J7A F;  4QUC A;  4KN4 C;  1XXG A;  1PH3 A;  4S3S A;  1SXT A;  3MFG A;  3SK8 A;  2DJG C;  2F0Q A;  1WTQ A;  4Z9C B;  1STH A;  2MHV A;  1LT4 D;  2A6E C;  2CH4 A;  4P2C B;  1LLR D;  2A74 C;  4A3C G;  1KDA A;  2M9V A;  2BA1 A;  2A73 B;  2ICE C;  2Q2H A;  3BZK A;  4LFC L;  3M4Q A;  4JI2 L;  5M3M B;  4QIW E;  4LJZ C;  1QVG A;  3KFU A;  5AJ3 Q;  1LAB A;  3J81 E;  4ZCK A;  4JI3 Q;  2NN6 I;  5LMU L;  1I6V C;  2XNA C;  3K7A H;  2MFI A;  1AW7 A;  3GV6 A;  4B3S L;  2NVT H;  2KUM A;  4KJN A;  3JC6 6;  3KYH C;  1AP0 A;  1EY4 A;  3I73 A;  3AEV A;  1EQV A;  3OIQ A;  3X3N A;  2LSS A;  1F77 A;  1PFS A;  3ND8 A;  4JBJ A;  4DUZ Q;  3W2D A;  2B2Y C;  1SBB B;  1S5F D;  1VMP A;  4KKT A;  4L8J A;  2HHH Q;  3RR5 A;  3S14 H;  2OT2 A;  3I91 A;  4DR5 Q;  3OHX C;  1EL0 A;  3HOV B;  2KOL A;  3DWQ A;  2CW0 C;  4CJ1 B;  1S40 A;  1KHI A;  4HCE A;  2PO4 A;  4RMF A;  4PZ8 A;  4LF7 L;  3I4N B;  2QDB A;  4J15 A;  3L7Z C;  1SE2 A;  4X64 L;  1LTS D;  1PH7 A;  4IUN A;  1AE3 A;  4LUZ A;  2VY3 A;  3N52 A;  1HR0 L;  2OXP A;  2EYH A;  2LS0 1;  4X3S A;  1MJE A;  3QR8 A;  1K28 A;  2Z4I A;  3DM1 A;  1Q12 A;  4HMI A;  3A8K E;  4I7A A;  2Z1C A;  3ULP A;  4GKJ Q;  4JI8 L;  1VQK A;  3P75 A;  1QIL A;  3KDF B;  4OX9 L;  5GAE C;  2LMC B;  3M4Y A;  1JR0 D;  5EBD A;  1VF7 A;  2ZT9 C;  3H0G G;  1TQO A;  2MP1 A;  3CCQ A;  3BYY B;  4GOP B;  1IBL Q;  4C3I H;  1A3V A;  2MQH A;  5DM7 3;  3BDO A;  3T4A C;  4NXM L;  1BBU A;  4B3T L;  1C48 A;  3AB9 A;  3DEP A;  3M4O B;  3GTG H;  1ROD A;  1VQ6 A;  1DYQ A;  3CPF A;  1IYU A;  1PRT D;  4CDC C;  1BCP C;  1EY5 A;  2F0T A;  2ZXR A;  3GTJ H;  3GTO H;  3TZD A;  3FVQ A;  2B2U C;  1Z9F A;  3PUV A;  4JBK A;  1U4L A;  2O5I C;  1RCV D;  4ME5 A;  2VL6 A;  4BY1 G;  1BQQ T;  4JI0 Q;  1EU4 A;  1PFB A;  3TRZ A;  4DNT B;  4BBS G;  3K8A A;  1PZI D;  1DGS A;  4DXG A;  4K14 A;  5EKL A;  4APV A;  1UEA B;  1OXU A;  2JSO A;  4XT1 B;  2F0V A;  2F0F A;  2AHO B;  1ENA A;  3BJU A;  5E7N A;  1TWG B;  4ZK9 B;  2R6G A;  5M3F H;  4DAY A;  3J80 c;  1SYB A;  4A76 A;  3E0E A;  4RGM A;  3NBH A;  1D8L A;  3E3X A;  5M5Y B;  1QWY A;  4LUV A;  4DU9 A;  1Y14 B;  2ICI A;  4ZUJ A;  3U50 C;  3FPP A;  5CBA E;  5C4J B;  1XPU A;  1Y1V B;  2SDF A;  2JP1 A;  4X3T A;  3S16 H;  1DON A;  2RHQ B;  5CV7 A;  2A19 A;  4AH6 A;  1ZKO A;  1NR2 A;  5IYD G;  2X69 A;  4A3D B;  1STG A;  5BN5 A;  4C3J B;  3HGB A;  4GZY C;  3NTI A;  1DOK A;  4DNI A;  4IJL A;  3FKI G;  4EVO A;  3HOX G;  4DUY Q;  4HMJ A;  4OIK A;  5IP7 G;  3R2I A;  4XYO A;  4ILW A;  2RSO A;  4QL5 A;  4JYA Q;  2K52 A;  2ZJQ A;  1XYI A;  5M5X B;  2A68 D;  2NVY B;  1XJV A;  4P74 A;  3VR5 A;  2E74 C;  4KLK A;  3S1N B;  2A6H C;  3SR1 A;  3JAM L;  4A93 B;  1R4P B;  5KEE A;  1N32 L;  1VQH A;  2JA5 H;  2H1E A;  4HSV A;  1HPC A;  5FJ8 H;  1EYC A;  5ISR A;  1HUN A;  4F7X A;  3NTH A;  3A54 A;  2UXC L;  1A6X A;  2B8F A;  1MKH A;  1HJP A;  1WTH A;  2MPM A;  4L63 B;  1GHK A;  3MEH A;  1PRT B;  4I65 A;  1VF5 C;  2OCE A;  1B7Y B;  1K3R A;  2J4X A;  2YU9 H;  3L3O C;  3ULJ A;  3AFP A;  1A3U A;  4L5Q A;  4IFD G;  4QQB X;  3D4W A;  3CHB D;  1G6P A;  4X66 Q;  1XPR A;  3H94 A;  2SNS A;  4ZRZ A;  4BY7 H;  1PHJ A;  2KCM A;  5FO9 B;  5JEA G;  4PZ6 A;  3S1M H;  5M5W B;  3H3V I;  3HOZ G;  1X3E A;  1S72 A;  3HS0 C;  4YHH L;  2EY5 A;  3WOE A;  2K7V A;  1VQG A;  2AUJ D;  1WTW A;  4PMC A;  3TDQ A;  3TME A;  3URY A;  3I4M H;  1QCB D;  4KI0 A;  1PH6 A;  5T1I A;  2N55 A;  2UU9 Q;  5K36 G;  1Q3L A;  4DNR B;  1V1O A;  1V8Q A;  4DV7 Q;  3RZD H;  1I5F A;  1VCI A;  4V0B A;  1AEX A;  1FJG L;  4OWT B;  4MNO A;  1SSO A;  1LTG D;  2WB1 B;  2FMC A;  1N33 L;  3D31 A;  4GN5 A;  3KLW A;  4NKL A;  2D62 A;  2PNR C;  1KC8 C;  5C4X G;  1STN A;  1RJT A;  1EY6 A;  2J0T D;  1TS4 A;  1B1Z A;  2EXZ A;  1NY4 A;  4FXK C;  1S5E D;  3CCL A;  1SJH D;  4PG3 A;  2K5W A;  1VQN A;  2R7Z G;  1PYB A;  4OWW B;  1DD2 A;  1KRT A;  1W6J A;  4KHV A;  5C44 H;  4ZAI A;  1B3Q A;  4KD3 A;  1YI2 A;  4X3U A;  2UUA L;  3Q8D A;  3E9H A;  3S17 B;  4ME3 A;  3PO2 B;  4HSP A;  2BE5 C;  4LFC Q;  1YHB A;  4JI2 Q;  3KF6 A;  4N9T A;  4YWL A;  3TBI B;  5IY0 A;  2GVA A;  1SRO A;  2IPK D;  1UWV A;  2MUY A;  5LMU Q;  3H15 A;  3GTK B;  1KLU D;  2WIN B;  1XTC D;  5JPM C;  4K5W A;  4LAA A;  4OL7 A;  1I94 L;  4KY6 A;  1VQ8 A;  4A3K H;  3S9W A;  3NK9 A;  3HKZ E;  1AH9 A;  2N8N A;  1G91 A;  2ZTD A;  3EFX D;  1I3Q B;  3QIA A;  5KNC A;  2HQE A;  1XMO Q;  1C8C A;  4OO1 G;  1EIH A;  4PMW A;  4UP8 A;  5DLQ E;  5C0X H;  2VUM G;  1L1O A;  1RIP A;  2B29 A;  2A5H A;  1S5C D;  1N9W A;  5M3M H;  4FXD A;  4LF7 Q;  1L1O B;  4CKB A;  2YTV A;  4OGQ C;  4DR1 L;  2CKZ B;  4CDE C;  1HQM C;  1KAW A;  4X64 Q;  3R93 A;  1Y1W G;  1D2B A;  2WB1 E;  3CW2 C;  3LNN A;  4DXF A;  4TKO B;  4KMU C;  3OMC A;  2JEB I;  3I90 A;  1VQC A;  4JI1 L;  2R92 B;  1I50 B;  1XPO A;  1HH2 P;  4HJ8 A;  2Z9H A;  3G48 A;  4JI8 Q;  3IL8 A;  1GM5 A;  3PUX A;  1CSQ A;  1D5X C;  4BBR B;  2XVS A;  2E75 C;  4KHZ A;  4OX9 Q;  1LT5 D;  1QG7 A;  3HOV H;  1NTG A;  1S5B D;  2F3V A;  5KYL A;  4R4C A;  3I4N H;  1KLG D;  2E2I B;  3S24 A;  4HIM A;  2XWB B;  2EYM A;  1PH1 A;  1DXM A;  4CKE A;  3MC0 B;  3PIO 3;  2I5M X;  2A8V A;  3I70 A;  3CP0 A;  4NXM Q;  1SNC A;  2ID0 A;  2HCC A;  1BR9 A;  4B3T Q;  2EDG A;  4GN4 B;  2B2Y A;  3RNU A;  1OXX K;  4HJA A;  1BVS A;  1HNX L;  1HRJ A;  1IW7 C;  4RHS A;  3R2T A;  3QWN A;  1AZQ A;  1I4P A;  4LF6 L;  3M3Y B;  2Z6K C;  4NP5 A;  4R4I A;  4IN3 A;  3DLL A;  1QUQ B;  1RKN A;  1I4Q A;  1D5Z C;  1TII D;  2K03 A;  1IBM Q;  4DN4 M;  1WD1 A;  4A3B B;  3D4D A;  3D6W A;  4QY7 A;  5CV8 A;  1SFO B;  3TP5 A;  3X3M A;  2GN5 A;  2Y0S B;  4XT3 B;  2Q2U A;  4G4K A;  1CA5 A;  1EY7 A;  4YCU A;  2A69 D;  1RDP D;  3T53 B;  2VW9 A;  5L37 A;  1MGS A;  1TS3 A;  2OQK A;  3M4O H;  1GVP A;  2E2H B;  3MAQ A;  1VQJ A;  4U68 A;  4A3I B;  4DV1 Q;  3K6O A;  5BN4 A;  3E5S A;  1Y69 U;  4JBM A;  3GTQ B;  1JQY D;  1OXT A;  4JI4 Q;  4GLX A;  1NSN S;  1H9K A;  1WJJ A;  2L4N A;  4OIJ A;  3OTO L;  2D0O A;  1SND A;  1V1P A;  3UE1 A;  2K5D A;  5F2D A;  4A3M B;  1JOO A;  1FGB D;  3QOL A;  2RHS B;  1EIG A;  1KDC A;  4BWG B;  3G4S A;  2XTI A;  3BG3 A;  1VQ7 A;  2B2T C;  2ZXP A;  3SK4 A;  1PTO B;  1TWA B;  4DR3 L;  1Q8K A;  1IYV A;  2IHE A;  4PV1 C;  1TWG H;  3IFT A;  2F0N A;  3IRB A;  3AU7 A;  3CCJ A;  1JOK A;  3HOY G;  3OOC A;  5M5Y H;  2B2U A;  3CRK C;  4LK1 C;  4DV3 L;  1VQ5 A;  1OXV A;  2EE1 A;  2NB0 A;  3AYH B;  5C4J H;  3VA5 A;  2KEC A;  1Y1V H;  2Q2I A;  2AMC B;  1N32 Q;  1PLF A;  3MTS A;  5IWA L;  4AQY Q;  4R8N A;  3PIP 3;  4MN3 A;  3I4O A;  1G51 A;  4A3D H;  4A3E B;  4KD4 A;  4KHP Q;  2E5L L;  1GUW A;  2UXC Q;  2EYP A;  3MXN B;  3MA2 B;  4C3J H;  2B63 B;  1Q7Y C;  2JE6 I;  2UXB L;  4ZUI A;  5M3F G;  4Q0F A;  3FHW A;  1OTC A;  3AMU A;  2OTL A;  4XQQ A;  3LWE A;  1V1Q A;  4WJ4 A;  2NBF A;  1TWH B;  2VNU D;  3KOJ A;  4WJW A;  2NVY H;  4DV6 L;  5JOB A;  1QNK A;  1PXU A;  4OON A;  3RN2 A;  5CGK A;  1XNQ L;  3S1N H;  4YCV A;  1CKM A;  2KEN A;  4A93 H;  1W6K A;  4AYB B;  1SR3 A;  2JA9 A;  3F1Z A;  3AQQ A;  3NE5 B;  4YHH Q;  2QEX A;  1H95 A;  2RDG A;  5EKI A;  4MIU A;  1NMF A;  2CH4 W;  1MD2 D;  2Q2T A;  3KF8 A;  3GTL B;  2L12 A;  5GAG C;  4O0A A;  2K32 A;  3PIO A;  1LTR D;  3M7G A;  4MHE A;  2K50 A;  1BBX C;  1FJG Q;  3VA7 A;  4OO1 I;  1VQL A;  2O5J C;  3A55 A;  1N33 Q;  3PO3 B;  2JA5 G;  1AZP A;  5IGC A;  3A0J A;  4UDU C;  5CYU A;  4K8J A;  5FJ8 G;  3ER0 A;  4QCL A;  5IOC A;  2E2J B;  5M5W H;  4A75 A;  5KRU A;  4PQX A;  1Q90 A;  1JOR A;  4DAP A;  1WVL A;  1XWE A;  1X65 A;  1L1O C;  1EIY B;  1BUV T;  2C5C A;  1KRS A;  1CI3 M;  1VQD A;  2UUA Q;  3AFQ A;  3Q23 A;  1NNX A;  2G5D A;  4V19 0;  1YHQ A;  4R4Q A;  4DKA C;  4ZKB B;  4BY7 G;  1UAP A;  1MIU A;  5DEH A;  2JA7 B;  1V9P A;  1D6E C;  3CC2 A;  5EGT A;  1WTO A;  1VQF A;  1SYE A;  3SHL A;  2EJF C;  3K59 A;  2EOT A;  3W1B A;  4IOC A;  4LFA Q;  1I94 Q;  1JJC B;  2D5D A;  1SMY C;  3I4M G;  2F0S A;  4FXG C;  1ET9 A;  1Q8I A;  4EQN A;  3GO5 A;  4RCN A;  4WOR A;  5GAH C;  3J81 j;  3B6Y A;  3ERQ A;  4AYB E;  1Z7T A;  4HN7 A;  1X3G A;  3OW2 A;  1VS0 A;  4NPS A;  4DV0 L;  5H1S E;  1SNO A;  5M9O A;  2ATW A;  3CD6 A;  2XGT A;  3DMU A;  4EGV A;  3S17 H;  3D4R A;  3H0G B;  3PO2 H;  4NDX A;  1JB3 A;  1X32 A;  5LL6 X;  1QZG A;  5EPL A;  3TN2 A;  1KTK A;  5LL6 S;  1GUG A;  4DR1 Q;  1VMC A;  4C56 C;  4IFD J;  3A74 A;  1HHV A;  3HKS A;  1LAC A;  2QCP X;  2TSS A;  3GTK H;  1PA6 A;  2KCT A;  1DJR D;  2NTS A;  4DV4 L;  5EKK A;  5LMN W;  5LMN L;  3HG9 A;  3PIP A;  4R1J A;  5JEA J;  3UDX A;  4RCO A;  1P8L A;  4JI1 Q;  1ESF A;  3CME A;  4BXX H;  3I72 A;  1FL0 A;  1I3Q H;  2E2D C;  3I7F A;  4RWS C;  5FK9 C;  3NBI A;  1K8O A;  4HID A;  4HJ7 A;  4R8I A;  1ENC A;  2CWA A;  1HR0 W;  3M7N A;  2K5H A;  4OXP A;  4L6T B;  3OPO A;  3TZU A;  3T51 B;  2EYL A;  4TVA B;  4JI5 L;  3KDF A;  4A3G B;  3V05 A;  4UP7 A;  4KJO A;  3LWU A;  1H9S B;  1C4Q A;  2VB3 X;  1Q86 C;  2X6G A;  4B9X A;  3C46 A;  3H91 A;  2D0P A;  3BVZ A;  1PH4 A;  4GOP A;  4JK1 C;  4RGN A;  3ONA B;  4XQN A;  1CK1 A;  1IL2 A;  1G29 1;  1HNX Q;  2R92 H;  4QUF A;  1I50 H;  1GHJ A;  4RG1 A;  2PZU A;  4JPB W;  4LF6 Q;  1GXD C;  1PTO C;  4LF8 L;  4F88 A;  1NCV A;  3BZD B;  4R9W A;  4BBR H;  3VYT A;  3UDF A;  3UDG A;  3A7L A;  2FMM A;  2OF1 A;  3EA6 A;  1TKW B;  3DM3 A;  1EOT A;  3FEW X;  1AFP A;  3D8G A;  1FGU A;  2I07 B;  1KNE A;  1YVC A;  2RDF A;  4JI6 L;  1QNU A;  2E2I H;  1FNU A;  1BXT A;  3NEN A;  1D7Q A;  4GKK Q;  1UE1 A;  3K5M A;  2K4K A;  4EQP A;  1K73 C;  1YNX A;  2I5H A;  2IL8 A;  5BR8 L;  2IW3 A;  4YIJ A;  1BNZ A;  1X3Q A;  1BOS A;  4B08 A;  1CKN B;  3OW7 A;  4O1N A;  3NWS A;  3M3Y H;  3STB C;  3VR6 A;  1RF2 D;  2KBN A;  4G7O C;  2BH8 A;  1STB A;  3OTO Q;  4MTK A;  3I4N G;  2PPB C;  2H4O A;  4A3B H;  4OWX B;  3CU7 A;  3CAM A;  5CV6 A;  2NWG A;  1EY9 A;  1SFO H;  3F2D A;  2PW5 A;  1GUO A;  3WDN A;  5ELE A;  4WRD A;  3JAM i;  2F0E A;  3VR2 A;  2B2W A;  2N88 A;  4DR3 Q;  5NUC A;  2RCF A;  2DUD A;  5CV9 A;  2F0D A;  1J5E Q;  4K5V A;  3HOW B;  1PH8 A;  5E3F A;  4X62 L;  2E2H H;  3PF4 A;  3HOU B;  5ELF A;  2Z6K A;  2B39 A;  1F9Q A;  1W3S A;  2HUG A;  1JOQ A;  1FYC A;  2WFW A;  4A3I H;  1X56 A;  2JA8 B;  2F0J A;  1STE A;  4DA2 A;  2JA6 B;  4DV3 Q;  3HOZ B;  3GTQ H;  3A8I E;  4DPG A;  1JT8 A;  1BO0 A;  5IIF A;  1VQE A;  5I4D A;  1SLJ A;  1HFG A;  5IWA Q;  3RMH A;  3J7Y W;  3TP6 A;  4A3M H;  1SYF A;  3J7A V;  2E5L Q;  4A3L H;  3W1G A;  4DF7 A;  2F1M A;  1F2Y A;  1QE6 A;  2UXB Q;  2FFK B;  1HZC A;  5D65 A;  1PTO H;  5ELD A;  1TWA H;  5IYB H;  2R93 B;  3SGI A;  1NBW A;  1ZXT A;  3I4L A;  3NEL A;  1PFN A;  5T1G A;  2VZA A;  2P5Z X;  5FLX c;  5C4X B;  3K0X A;  2L11 A;  4CJ2 C;  4LF5 Q;  1ICW A;  4DV6 Q;  4R4O A;  3MZ5 A;  1XNQ Q;  5C6A A;  3KK7 A;  5JJZ A;  1GO3 E;  4KY7 A;  4P73 A;  5JAV A;  3ZYY X;  3S1R B;  2B2T A;  5HY6 A;  4M1U B;  3TP7 A;  4A3E H;  1SN8 A;  2IX0 A;  1EFW A;  5IT9 c;  2B63 H;  2YTY A;  3C2P A;  4FNF A;  2B2V C;  4JG2 A;  2HD3 A;  3TSS A;  2UUC L;  1WTX A;  1EYG A;  3BDL A;  1TWH H;  3KLS A;  5EJW A;  3TS2 A;  1A63 A;  4DK6 C;  1Y1V G;  2CWP A;  1L2F A;  2EVB A;  4JI7 L;  3TRE A;  5FLM H;  3FP9 A;  5IGB A;  1K3B C;  2JYO A;  4C3J G;  4GS3 A;  4KN7 C;  4IUV A;  1CFM A;  4I7Z C;  1E2W A;  1PYS B;  2VQE L;  3FPU B;  2F03 A;  1H9M A;  3GTL H;  5J39 A;  1B3A A;  4GNX B;  4K6L A;  1E1T A;  5IYC H;  1SE3 A;  2VS1 A;  3K57 A;  1M90 C;  3H3V H;  5CBE E;  2N78 A;  2YTX A;  3GDE A;  2GVB A;  5D14 A;  1LTL A;  5A2Q L;  3PO3 H;  4A93 G;  5C5L A;  4DK1 A;  1SAP A;  3PUZ A;  3Q6S A;  4LFB L;  3NHH A;  1NMG A;  2A6E D;  3M4P A;  2E2J H;  4K8I A;  2ZTC A;  5JPN C;  2QGQ A;  5I9O A;  1LT6 D;  5A35 A;  1ZEQ X;  5JVH 3;  3IAY A;  1YIT A;  2IX1 A;  1L0X B;  5DM6 3;  2F0K A;  3RLO A;  3WOF A;  4AIM A;  4DV0 Q;  5IOD A;  1VQB A;  2KJX A;  3J80 L;  4IUP A;  2HT1 A;  1B53 A;  4B3S Q;  1YNJ C;  1UE6 A;  2PW7 A;  4YWK A;  3KBX A;  1DOL A;  5G3L F;  2JA7 H;  1L0W A;  1CHQ D;  3HKZ G;  4POG A;  1X3F A;  5ELO A;  4GOP C;  2RF4 A;  3GTM B;  2M00 A;  1HNZ L;  1EY0 A;  2ZXO A;  4DV4 Q;  3NPP A;  3DWP A;  1M1K C;  4FDB A;  5LMN Q;  1EIF A;  3ICE A;  2CW0 D;  1XTD A;  2WAQ B;  2Q8T A;  4KY5 A;  1QVC A;  3CC7 A;  2D2C C;  3CQZ B;  5COY A;  2B3G A;  1O78 A;  3H0G H;  1EYA A;  1EZ6 A;  1SYG A;  1BCP F;  3GTP B;  1N34 L;  1HR0 Q;  2WB1 G;  1T5X D;  2NYZ D;  1CSP A;  3P20 A;  1MSG A;  3U9S A;  3L9A X;  1VQP A;  2MNA A;  1Y8P B;  4JI5 Q;  4UHV A;  1QB5 D;  1EY8 A;  3Q24 A;  5G3L D;  2I0Q A;  2AWN A;  5J22 A;  2E76 C;  4FYD A;  3T56 B;  2XRS D;  1WTV A;  5C3E B;  5IGG A;  1SYD A;  2G9D A;  2M2L A;  4DK3 C;  3DWA A;  1IYJ B;  1VQ9 A;  2Z4H A;  4JBW A;  4LF8 Q;  4OHJ A;  1JWS D;  1C0A A;  2RBM A;  1O7L A;  2L1B A;  1HTP A;  4HAE A;  2IX3 A;  2BA0 A;  5IP9 H;  1GJX A;  3RLF A;  2OWO A;  4EQ5 A;  2B2W C;  3RN5 A;  3H6M A;  2BOS A;  1QUQ A;  1GKH A;  4JI6 Q;  1BCP D;  2EYO A;  4CBV A;  4A3G H;  4DGZ A;  5CC4 A;  4HJ9 A;  4ALP A;  1IBK L;  1A62 A;  1H9J A;  1KAB A;  4RKL A;  1F9S A;  1E0B A;  1FD7 D;  2F0L A;  3HOY B;  1WCM B;  3PSI A;  2CVR A;  1GUN A;  5BR8 Q;  1KDB A;  3J7Z C;  3LGJ A;  3T16 A;  1RTN A;  2YV5 A;  3U9O A;  1HFN A;  3HFZ B;  1YIJ A;  2WAQ E;  2PQA B;  2RKS A;  1SMX A;  5E4X A;  4HIO A;  1IKM A;  1UE7 A;  3IKJ A;  4DR2 L;  1GD7 A;  1M4V A;  2Z6B A;  2FXQ A;  1JWM D;  2DN8 A;  3N6R A;  3CC4 A;  5IP7 H;  5BN3 A;  4IPC A;  3CXC A;  1UE5 A;  4IFD I;  1PRT C;  2ZTE A;  1L0Y B;  2EJM A;  1O80 A;  4ID6 A;  1H9R A;  3F2B A;  3EBE A;  2KCC A;  1CQF A;  5CV4 A;  3J81 L;  4X62 Q;  4CDD C;  4IUQ A;  1C7Y A;  1CT1 D;  4C3I G;  4FF4 A;  4EX5 A;  4DV2 L;  1HNW L;  4A3J B;  1A0I A;  4IZ8 A;  2RVL A;  3GQB A;  3VDY A;  1DCZ A;  4CJ0 B;  3RZO B;  2K1B A;  1HCZ A;  1HZB A;  1LO5 D;  1LTA D;  3ITP A;  1R9T B;  1ZYR D;  1STY A;  4KKU A;  2HQL A;  2R7F A;  5K5P A;  1XMQ L;  3ULL A;  1E22 A;  2EYJ A;  2A6H D;  4C3H B;  1O7I A;  1TWF B;  2LFN A;  3MXN A;  2VQF L;  3HOW H;  1YNN D;  2N3S A;  3V96 A;  3HOU H;  4IJH A;  3TEH B;  4A3F B;  2AQ1 B;  4JC0 A;  2JA8 H;  3E0J A;  3MEF A;  4U67 3;  2JA6 H;  3HOZ H;  2ASB A;  2RA4 A;  1KIX A;  4GNX C;  4RAU C;  4JVZ A;  1PZJ D;  3PGZ A;  4A3B G;  5FO8 B;  2XIW A;  4DR7 L;  3CMA A;  1LTB D;  4XIG S;  2Y0S E;  5IGF A;  3MFY A;  5AFW A;  3PQI A;  3C1E A;  1B8A A;  1D1I A;  4H0L C;  5CMD A;  4Q5V A;  4UY8 C;  4B3R L;  3KLR A;  1ASZ A;  3L0O A;  4JYA L;  4QGU A;  1BF4 A;  4DR6 L;  5M5X H;  1IXR A;  4XXE A;  4QJF A;  2A68 C;  2R93 H;  4IAL A;  4A3I G;  2UUC Q;  4Y7N B;  1SNM A;  5C4X H;  5FLX E;  1B70 B;  3F8T A;  1QVF A;  1R4Q B;  2K5N A;  2EZV A;  1S4Z A;  4JI7 Q;  4PZ7 A;  3U4V A;  1J8I A;  2K04 A;  1PDQ A;  2PI2 A;  2ENB A;  1U4P A;  2EY6 A;  4A3M G;  1I4R A;  5FO7 B;  4A3L G;  3S1R H;  1ILP A;  3V2T A;  3FRP B;  1G8Z D;  1HTL D;  3G7L A;  4RGO S;  2AQ3 B;  1S5D D;  5ELB A;  4XQJ A;  5IYB G;  2MO0 A;  3UDI A;  2VQE Q;  5IT9 E;  1G6Z A;  4NMZ A;  5JVG 3;  4DV5 L;  1ET6 A;  2WKD A;  4KV6 A;  5DNF A;  1JJ2 A;  4LUO A;  3M9B A;  1MJC A;  3VYS A;  4MTN A;  3L2P A;  2ES2 A;  4LFB Q;  3G71 A;  2O4X A;  1OO9 B;  2F0U A;  2K14 A;  1XX8 A;  5GAD C;  2JXM B;  3CCV A;  4A3E G;  4ODG A;  2F0G A;  2JK8 A;  2BE5 D;  1G2T A;  4P71 A;  1I4G A;  3SK5 A;  2B63 G;  1OXS C;  3CCE A;  3PUW A;  3PCO B;  4OO1 H;  4LF4 L;  4UAI A;  2B2V A;  5HGT A;  1FVI A;  3IFD A;  3HEJ A;  1SJE D;  2EPB A;  1XNR L;  1Z6H A;  2PMZ B;  2AQ2 B;  3TQY A;  2KA7 A;  1K0R A;  1CUK A;  2LKV A;  4BA1 I;  2VB2 X;  2SNM A;  5FLM G;  3DHQ A;  3EIV A;  4L5T A;  4P72 A;  1Q81 C;  1FNV A;  2IJ0 A;  2F0W A;  4AYB G;  2RQX A;  2PZT A;  1HNZ Q;  1MSH A;  2VXW A;  4IUR A;  1WD0 A;  1K83 B;  5CR3 A;  3SDZ A;  1PFM A;  5KIX A;  4H02 A;  5IYC G;  1U4M A;  3S1Q B;  3S2H B;  1N36 L;  5E1F A;  2K05 A;  4IUU A;  2L5T A;  4C1N K;  4LMQ D;  2PI2 E;  2IT1 A;  1N34 Q;  5C44 G;  4EQO A;  3PO3 G;  3KUP A;  2WAC A;  1K0S A;  4HR7 B;  3JAM c;  3GTM H;  2ZM6 L;  4ABN A;  5D3I B;  3GP7 A;  3R3O A;  4J1M A;  3J7A 5;  2NN6 H;  3MXP A;  3P1H A;  3MXG A;  2R3Z A;  1XMO L;  3F2U A;  2C9O A;  2EXD A;  4BY1 B;  2QDL A;  3EN2 A;  4K6D A;  3S2D B;  3D3R A;  4L5R C;  4BBS B;  1YZ6 A;  4B3M L;  1H9S A;  4FF2 A;  1QZH A;  3DEO A;  3MHB A;  2KHS A;  4OEM B;  3CQZ H;  2QEJ C;  2Q8I B;  1TR5 A;  5I2Y A;  4A3K G;  1YJW A;  2NTT A;  2JA7 G;  3GTP H;  3OWE B;  5KND A;  1PRT F;  3OYY A;  2WKC A;  4HCS A;  2PMZ E;  5J3B A;  1IW7 D;  2CQO A;  1WTP A;  1T9H A;  3NWT A;  5C0X G;  2QA4 A;  3K0Y A;  2NVQ B;  3NSW A;  1IBK Q;  2JJQ A;  3O13 A;  2DY7 A;  5M3M G;  3TP8 A;  1ML0 D;  2WP8 J;  3K5O A;  1ONL A;  1TU2 B;  1EFI D;  4F87 A;  4FO2 A;  5C3E H;  2HIV A;  3FKI B;  1EEI D;  4ULL A;  3HOX B;  1LTI D;  1M8A A;  1MI2 A;  2V4D A;  4JW0 A;  3DUZ A;  1HXY D;  4GLV B;  1TVX A;  1NJI C;  4HTH A;  5J1Z A;  1IBM L;  1CKN A;  4LNQ A;  4JV5 L;  4J8Q A;  4DR2 Q;  4TRD A;  3SE0 A;  2Z8L A;  1QOH A;  1CZW A;  5IGE A;  1DM0 B;  4NB3 A;  2NVX B;  2Z0S A;  1EQR A;  2KCN A;  3VYR A;  2D9U A;  2J7Z A;  4ZKC B;  1LTT D;  2LXJ A;  3HOV G;  1UUP A;  1U5K A;  3ZJY C;  1EOV A;  3HOY H;  4JCV E;  1FNW A;  1VQI A;  1WCM H;  2EQS A;  2X6L A;  2SOB A;  4C2M B;  1W2B A;  4CHT B;  1B9M A;  3I2Z A;  4J6H A;  4DV2 Q;  4OEL B;  1HNW Q;  1PVO A;  4JOI C;  5IP9 G;  2QW7 A;  1VQM A;  3NTK A;  5CV5 A;  3BDC A;  2TMP A;  2F0P A;  2Q8R E;  2RCN A;  1TWC B;  2HDM A;  1YEZ A;  1F9P A;  1CQV A;  2L9H A;  4A3G G;  2A69 C;  2EJG C;  3E6Z X;  1XMQ Q;  1G2S A;  1K8G A;  4DV1 L;  1SYC A;  4X6A H;  4DAY B;  3H3V C;  4JI4 L;  1BKB A;  3NBH B;  4NXN L;  2VQF Q;  1VQ4 A;  1CZG A;  2FHT A;  3PUY A;  1JB7 A;  1QJO A;  1GUS A;  1U0L A;  2RSN A;  3D0F A;  5TSS A;  2L15 A;  2XRQ D;  3K7U C;  5LHY 1;  1EZ8 A;  4XYQ A;  1Q46 A;  4A3J H;  3CCM A;  1KAA A;  4YY3 L;  3F2C A;  3A7A B;  3RZO H;  4DR7 Q;  1AE2 A;  2HCI A;  2HIX A;  1SNQ A;  1E7Z A;  3MVV A;  1R9T H;  4B3R Q;  3RD4 A;  2F3I A;  1IHZ A;  1I6H B;  2WII B;  1ZYR C;  4DR6 Q;  1HA6 A;  1A8V A;  2A1A A;  4C3H H;  2F4V L;  2R7Z B;  4K0K L;  1YJ9 A;  4G57 A;  1TWF H;  2I46 A;  1X54 A;  5C5M A;  5JJI A;  4AQY L;  1LM0 A;  3VYU A;  1RD9 D;  4HJ5 A;  3EVQ A;  4A3F H;  3BVG A;  1EWI A;  1PH5 A;  1YNN C;  1DZ1 A;  4KHP L;  3RUZ A;  1SE8 A;  1E1O A;  2LXK A;  1S3O A;  4DFA A;  3S15 B;  2F0M A;  2K01 A;  5I9P A;  1KL9 A;  3CCS A;  1HZ9 A;  5IGD A;  1TY2 A;  1HZA A;  1B9N A;  3M85 A;  3BYT B;  5GQO A;  1JCK B;  3NXW A;  1EEF D;  1YHA A;  2DGY A;  4FF1 A;  1I4H A;  1K8M A;  1PMR A;  4B9W A;  5HGQ A;  2ALY B;  2F52 A;  4ZQ3 A;  3HOW G;  4G7Z C;  4DV5 Q;  4A3D G;  3HOU G;  3I8Z A;  3HKZ B;  3CF5 A;  2JA8 G;  4Y7N H;  2JA6 G;  3ERS X;  4NW2 A;  2QKI C;  2R61 A;  1D5M C;  4GNX A;  2OTJ A;  3QJY A;  3T1Y L;  1DOM A;  2PYK A;  4P75 A;  3U4Z A;  2IY5 B;  3TS0 A;  2VUM B;  1D1K A;  1LUZ A;  5EAY A;  4DAM A;  4E6I A;  3J80 i;  5C3W A;  4A3C H;  1K9M C;  2JEA I;  1PH2 A;  3BU2 A;  5I6Y A;  4GLA C;  3NQT A;  4DR4 L;  4IPD A;  5C4Z A;  4LF4 Q;  2YYZ A;  2KHI A;  1CM9 A;  3U58 A;  2KHJ A;  1Y1W B;  2DNC A;  3KJO A;  2R93 G;  3K5L A;  4LF9 L;  1UEB A;  1XNR Q;  5FKA C;  2BDN A;  4N9P A;  1IKL A;  1EWC A;  4O2D A;  3K58 A;  2UUB L;  1SEB D;  2HDL A;  1ESR A;  2G9H D;  1EWH A;  1SMY D;  1TXY A;  1JIC A;  3R8B A;  5JJL A;  3GD7 A;  2UXD L;  1WOC A;  4CDF C;  2B8G A;  2PZW A;  4X65 L;  1O7Z A;  3T1H L;  2BCO A;  3J81 c;  1U4R A;  1C9O A;  1Q82 C;  1NAP A;  1Y8N B;  4QF4 A;  5KGU A;  5I6W A;  4RGT A;  3K7A B;  4X3K A;  1B4O A;  2NVT B;  5C0X I;  1UNS A;  2CHB D;  3FMC A;  5KNB A;  3KBG A;  4QB4 A;  1J9O A;  5D3D A;  1F9R A;  3CRL C;  4PMB A;  1N36 Q;  2IWH A;  4C1N I;  4POF A;  1E3P A;  1WFQ A;  3C3L A;  1P16 A;  1V43 A;  1JMC A;  4RHR A;  3KF6 B;  1EQT A;  3S14 B;  5FOB B;  3OWF A;  1PTO F;  1X3P A;  5EPK A;  4LFA L;  1K8A C;  1MHW C;  1U9R A;  2K33 A;  3H09 A;  1IZ6 A;  2KVM A;  2ZM6 Q;  3DXJ C;  5ELN A;  3HZX A;  2ZJR A;  5JJK A;  2F0H A;  2AUK A;  5AJ3 L;  1VQO A;  4JI3 L;  1KQS A;  2CFM A;  4N8X 1;  3QB3 A;  3I55 A;  1K83 H;  4LWC A;  1HUM A;  4B3M Q;  2PCF B;  3CCU A;  3S1Q H;  2V1C C;  3S2H H;  2L55 A;  1ICF B;  3BVM A;  4XDX A;  2K5V A;  2NZO A;  4KK7 A;  4DUZ L;  5FLX L;  4UPA A;  4N8F A;  1GUT A;  1GOZ A;  2HHH L;  5I2X A;  4PNY A;  4RH6 A;  4DR5 L;  2GA4 B;  3NEM A;  1TT2 A;  4CGY B;  3JAM E;  2OEO A;  2K5Q A;  1TS5 A;  1ASY A;  5C4H A;  3BS1 A;  3PO2 G;  1PTO D;  4IUT A;  4BY1 H;  1X55 A;  4G7H C;  4C3I B;  3S2D H;  1WI5 A;  4A4I A;  2K75 A;  4IOA A;  4FVM A;  4Y52 H;  5IT9 L;  4BBS H;  3CKI B;  3NQI A;  2K28 A;  3GTG B;  2K6A A;  4GN3 B;  4IPG A;  4DAV A;  1JWU D;  3G6J B;  1NUC A;  4LW1 A;  1SNP A;  3OMG A;  1SRU A;  2LY7 A;  1Z47 A;  3RLN A;  4GKJ L;  3I56 A;  3GTJ B;  5EPJ A;  3J81 i;  1EUJ A;  3GTO B;  2XWJ B; 
#chains in the Genus database with same CATH homology
 3LX0 A;  2NN6 G;  2EY1 A;  1Q1E A;  2F3W A;  1CHP D;  3A8J E;  3HRZ C;  4H7B A;  2MGS A;  1STA A;  3OSO A;  1JE4 A;  2EY2 A;  5M3F B;  2NZ1 D;  2FJ2 A;  4XTC S;  4QMG A;  2FIN B;  5C3X A;  1B2T A;  1A2U A;  3D6C A;  1MBY A;  2NUC A;  3Q0A A;  2QIL A;  1EYD A;  3S16 B;  3FDT A;  3MXU A;  1KNA A;  1RTO A;  4O42 A;  1FR3 A;  3EJI A;  1F2M A;  1LT3 D;  2O2L D;  2EYF A;  4WFN 3;  3QO2 A;  2AWO A;  1ILQ A;  1EU3 A;  1E2Z A;  5A2Q E;  3VR4 A;  2XSC A;  3SK6 A;  1B44 D;  1AN8 A;  1TS2 A;  4CKC A;  5EQ0 A;  1Q1B A;  4F8M A;  4TSS A;  3SVM A;  4IFD H;  4K5X A;  1V1P B;  3HP3 A;  3QOJ A;  1JC7 A;  2CQA A;  3QG1 A;  3A56 A;  3SXH A;  2F4I A;  2JA5 B;  4DK0 A;  3I3C A;  1A15 A;  2SEB D;  2KQ3 A;  4KKS A;  3KLS X;  5JEA H;  3J80 E;  5ELC A;  1T5E A;  2F0O A;  2WV6 D;  3VR3 A;  3Q22 A;  1HQR D;  1F2L A;  1BCP B;  3ND9 A;  5C0X J;  1Y8O B;  4TQU S;  1PZK D;  2YU9 B;  4RA8 A;  5EBC A;  4BA2 I;  4BS9 A;  2DY8 A;  5K36 H;  4M8A A;  4BY7 B;  4KTA A;  1HA5 A;  1II3 A;  2XN9 C;  2KED A;  1CA6 A;  5KYI A;  3S1M B;  4ZLT F;  4RKB A;  4K2K A;  3I4M B;  3OIP A;  3UI2 A;  2QF7 A;  1B50 A;  4QIW B;  4IQZ A;  1WTR A;  1F2Z A;  3RZD B;  1SDF A;  3PV0 A;  1ENF A;  1LV9 A;  3MWY W;  3P7J A;  1NR4 A;  4H13 C;  3SEB A;  1IL8 A;  5DAU A;  3K5N A;  2F0I A;  1SE4 A;  2L0C A;  4C3H G;  1A3T A;  1CTM A;  4FP5 D;  1I4X A;  3EQL C;  4RFB A;  5COR A;  2BDO A;  1TY0 A;  5HUR A;  3W3A A;  2KEE A;  1BDO A;  4HED A;  3NUC A;  5C44 B;  3NP8 A;  1A2T A;  3ERO A;  2MJ8 A;  4FF3 A;  1O7Y A;  2DNE A;  1PYW D;  4K2L A;  3GV3 A;  1RHP A;  4H44 C;  4ZYS A;  3PMF A;  1YNJ D;  5E4W C;  3T13 A;  3C1F A;  1VDZ A;  2PQE A;  4A3K B;  2RDH A;  1E2V A;  3J7A F;  4QUC A;  4KN4 C;  1XXG A;  4S3S A;  1SXT A;  3MFG A;  3SK8 A;  2F0Q A;  1WTQ A;  4Z9C B;  1STH A;  2MHV A;  1LT4 D;  2A6E C;  4P2C B;  1LLR D;  2A74 C;  1KDA A;  2M9V A;  2BA1 A;  2A73 B;  2ICE C;  5M3M B;  4LJZ C;  1LAB A;  3J81 E;  2NN6 I;  1I6V C;  2XNA C;  1AW7 A;  3GV6 A;  2KUM A;  4KJN A;  1AP0 A;  1EY4 A;  3I73 A;  1EQV A;  3OIQ A;  3X3N A;  1F77 A;  3ND8 A;  3W2D A;  2B2Y C;  1SBB B;  1S5F D;  1VMP A;  4KKT A;  4L8J A;  2OT2 A;  3I91 A;  3OHX C;  1EL0 A;  3HOV B;  2KOL A;  3DWQ A;  2CW0 C;  4CJ1 B;  4HCE A;  2PO4 A;  3I4N B;  2QDB A;  3L7Z C;  1SE2 A;  1LTS D;  4IUN A;  3N52 A;  2OXP A;  2EYH A;  2LS0 1;  4X3S A;  2Z4I A;  3DM1 A;  1Q12 A;  4HMI A;  3A8K E;  2Z1C A;  3P75 A;  1QIL A;  2LMC B;  3M4Y A;  1JR0 D;  5EBD A;  1VF7 A;  2ZT9 C;  1TQO A;  2MP1 A;  3BYY B;  1A3V A;  5DM7 3;  3BDO A;  3T4A C;  1C48 A;  3AB9 A;  3DEP A;  3M4O B;  1ROD A;  1DYQ A;  1IYU A;  1PRT D;  1BCP C;  1EY5 A;  2F0T A;  2ZXR A;  3TZD A;  3FVQ A;  2B2U C;  3PUV A;  1U4L A;  2O5I C;  1RCV D;  4ME5 A;  1BQQ T;  1EU4 A;  1PFB A;  4DNT B;  1PZI D;  4DXG A;  4K14 A;  5EKL A;  1UEA B;  1OXU A;  2JSO A;  4XT1 B;  2F0V A;  2F0F A;  1ENA A;  1TWG B;  4ZK9 B;  2R6G A;  4DAY A;  1SYB A;  4RGM A;  3NBH A;  5M5Y B;  1QWY A;  4DU9 A;  2ICI A;  4ZUJ A;  3FPP A;  5CBA E;  5C4J B;  4X3T A;  1Y1V B;  2SDF A;  2JP1 A;  1DON A;  5CV7 A;  1ZKO A;  1NR2 A;  2X69 A;  4A3D B;  1STG A;  5BN5 A;  4C3J B;  3HGB A;  4GZY C;  3NTI A;  1DOK A;  4EVO A;  4HMJ A;  4OIK A;  3R2I A;  4XYO A;  4ILW A;  2RSO A;  1XYI A;  5M5X B;  2A68 D;  2NVY B;  3VR5 A;  2E74 C;  3S1N B;  2A6H C;  3SR1 A;  3JAM L;  4A93 B;  1R4P B;  5KEE A;  2H1E A;  4HSV A;  1HPC A;  1EYC A;  5ISR A;  1HUN A;  4F7X A;  3NTH A;  3A54 A;  1A6X A;  2B8F A;  2MPM A;  4L63 B;  1GHK A;  3MEH A;  1PRT B;  4I65 A;  1VF5 C;  2J4X A;  3L3O C;  1A3U A;  4IFD G;  3D4W A;  3CHB D;  3H94 A;  2SNS A;  4ZRZ A;  5FO9 B;  5JEA G;  5M5W B;  3HS0 C;  2EY5 A;  3WOE A;  2K7V A;  2AUJ D;  1WTW A;  4PMC A;  3TDQ A;  3TME A;  3URY A;  1QCB D;  4KI0 A;  5T1I A;  2N55 A;  5K36 G;  1Q3L A;  4DNR B;  1V1O A;  1V8Q A;  1VCI A;  4V0B A;  1AEX A;  1SSO A;  1LTG D;  2WB1 B;  2FMC A;  3D31 A;  4NKL A;  2D62 A;  2PNR C;  1STN A;  1RJT A;  1EY6 A;  2J0T D;  1TS4 A;  1B1Z A;  2EXZ A;  4FXK C;  1S5E D;  1SJH D;  2K5W A;  1DD2 A;  1W6J A;  4KHV A;  4ZAI A;  4KD3 A;  4X3U A;  3S17 B;  3PO2 B;  4HSP A;  2BE5 C;  4N9T A;  3TBI B;  2IPK D;  2MUY A;  3GTK B;  1KLU D;  2WIN B;  1XTC D;  5JPM C;  4K5W A;  4LAA A;  4OL7 A;  4KY6 A;  3S9W A;  3NK9 A;  1G91 A;  3EFX D;  5KNC A;  1I3Q B;  3QIA A;  2HQE A;  1C8C A;  4OO1 G;  1EIH A;  4PMW A;  5C0X H;  2A5H A;  1S5C D;  4FXD A;  4CKB A;  4OGQ C;  1HQM C;  3R93 A;  1D2B A;  3LNN A;  4DXF A;  4TKO B;  4KMU C;  3OMC A;  2JEB I;  3I90 A;  2R92 B;  1I50 B;  3IL8 A;  3PUX A;  1D5X C;  4BBR B;  2XVS A;  2E75 C;  4KHZ A;  1LT5 D;  1QG7 A;  1S5B D;  2F3V A;  5KYL A;  1KLG D;  2E2I B;  2XWB B;  2EYM A;  1DXM A;  4CKE A;  3MC0 B;  3PIO 3;  3I70 A;  1SNC A;  2ID0 A;  2HCC A;  1BR9 A;  2EDG A;  2B2Y A;  1OXX K;  1HRJ A;  1IW7 C;  4RHS A;  3R2T A;  3QWN A;  1AZQ A;  1I4P A;  3M3Y B;  4NP5 A;  4IN3 A;  1RKN A;  1I4Q A;  1D5Z C;  1TII D;  2K03 A;  4DN4 M;  1WD1 A;  4A3B B;  3D4D A;  3D6W A;  5CV8 A;  1SFO B;  3TP5 A;  3X3M A;  2Y0S B;  4XT3 B;  4G4K A;  1CA5 A;  1EY7 A;  2A69 D;  1RDP D;  3T53 B;  1MGS A;  1TS3 A;  2E2H B;  3MAQ A;  4U68 A;  4A3I B;  3K6O A;  5BN4 A;  3E5S A;  1Y69 U;  3GTQ B;  1JQY D;  1OXT A;  1NSN S;  1H9K A;  2L4N A;  4OIJ A;  1SND A;  1V1P A;  2K5D A;  5F2D A;  4A3M B;  1JOO A;  1FGB D;  3QOL A;  1EIG A;  1KDC A;  4BWG B;  3BG3 A;  2B2T C;  2ZXP A;  3SK4 A;  1PTO B;  1TWA B;  1IYV A;  4PV1 C;  3IFT A;  2F0N A;  3AU7 A;  1JOK A;  3OOC A;  2B2U A;  3CRK C;  4LK1 C;  1OXV A;  2EE1 A;  2NB0 A;  3VA5 A;  2KEC A;  1PLF A;  3MTS A;  4R8N A;  3PIP 3;  4MN3 A;  4A3E B;  4KD4 A;  1GUW A;  2EYP A;  3MA2 B;  2B63 B;  2JE6 I;  4ZUI A;  4Q0F A;  3AMU A;  4XQQ A;  3LWE A;  2NBF A;  1TWH B;  2VNU D;  4WJW A;  5JOB A;  1QNK A;  1PXU A;  5CGK A;  1W6K A;  4AYB B;  3NE5 B;  2RDG A;  5EKI A;  4MIU A;  1MD2 D;  3KF8 A;  3GTL B;  2L12 A;  2K32 A;  1LTR D;  3M7G A;  4MHE A;  1BBX C;  3VA7 A;  4OO1 I;  2O5J C;  3A55 A;  3PO3 B;  1AZP A;  5IGC A;  5CYU A;  4UDU C;  4K8J A;  4QCL A;  2E2J B;  5IOC A;  5KRU A;  4PQX A;  1Q90 A;  1JOR A;  4DAP A;  1WVL A;  1XWE A;  1BUV T;  2C5C A;  1CI3 M;  3Q23 A;  4V19 0;  4ZKB B;  1UAP A;  5DEH A;  2JA7 B;  1D6E C;  5EGT A;  1WTO A;  1SYE A;  3SHL A;  2EJF C;  3K59 A;  2EOT A;  2D5D A;  1SMY C;  2F0S A;  4FXG C;  1ET9 A;  1Q8I A;  4EQN A;  3GO5 A;  4RCN A;  4WOR A;  3ERQ A;  1Z7T A;  4HN7 A;  1SNO A;  5M9O A;  3DMU A;  4EGV A;  3D4R A;  3H0G B;  4NDX A;  1JB3 A;  1X32 A;  5LL6 X;  5EPL A;  3TN2 A;  1KTK A;  5LL6 S;  1GUG A;  1VMC A;  4C56 C;  4IFD J;  1HHV A;  1LAC A;  2QCP X;  2TSS A;  1DJR D;  2NTS A;  5EKK A;  3HG9 A;  5JEA J;  4RCO A;  1ESF A;  3I72 A;  2E2D C;  4RWS C;  5FK9 C;  3NBI A;  1K8O A;  4R8I A;  1ENC A;  3M7N A;  4L6T B;  3OPO A;  3TZU A;  3T51 B;  2EYL A;  4A3G B;  3V05 A;  4KJO A;  3LWU A;  1H9S B;  1C4Q A;  2VB3 X;  2X6G A;  4B9X A;  3C46 A;  3H91 A;  3BVZ A;  4JK1 C;  4RGN A;  3ONA B;  4XQN A;  1CK1 A;  1G29 1;  4QUF A;  1GHJ A;  2PZU A;  1GXD C;  1PTO C;  4F88 A;  1NCV A;  3BZD B;  4R9W A;  3VYT A;  3A7L A;  2FMM A;  2OF1 A;  3EA6 A;  1TKW B;  1EOT A;  3FEW X;  1AFP A;  3D8G A;  2I07 B;  2RDF A;  1KNE A;  1QNU A;  1FNU A;  1BXT A;  3K5M A;  4EQP A;  2IL8 A;  2IW3 A;  4YIJ A;  1BNZ A;  1X3Q A;  1BOS A;  4B08 A;  3OW7 A;  4O1N A;  3NWS A;  3VR6 A;  1RF2 D;  4G7O C;  1STB A;  2PPB C;  2H4O A;  3CU7 A;  5CV6 A;  2NWG A;  1EY9 A;  2PW5 A;  1GUO A;  3WDN A;  5ELE A;  4WRD A;  2F0E A;  3VR2 A;  2B2W A;  2N88 A;  5NUC A;  5CV9 A;  2F0D A;  4K5V A;  3HOW B;  5E3F A;  3HOU B;  5ELF A;  2B39 A;  1F9Q A;  2HUG A;  1JOQ A;  1FYC A;  2JA8 B;  2F0J A;  1STE A;  4DA2 A;  2JA6 B;  3HOZ B;  3A8I E;  1BO0 A;  5IIF A;  5I4D A;  1HFG A;  3RMH A;  3J7Y W;  3TP6 A;  1SYF A;  3J7A V;  4DF7 A;  2F1M A;  1F2Y A;  1QE6 A;  2FFK B;  5D65 A;  1PTO H;  5ELD A;  2R93 B;  1ZXT A;  3I4L A;  1PFN A;  5T1G A;  5C4X B;  2L11 A;  4CJ2 C;  1ICW A;  3MZ5 A;  5C6A A;  3KK7 A;  5JJZ A;  4KY7 A;  5JAV A;  3ZYY X;  3S1R B;  2B2T A;  4M1U B;  3TP7 A;  2IX0 A;  3C2P A;  4FNF A;  2B2V C;  3TSS A;  1WTX A;  3BDL A;  3KLS A;  5EJW A;  2EVB A;  5IGB A;  2JYO A;  4C3J G;  4KN7 C;  4IUV A;  1CFM A;  4I7Z C;  1E2W A;  3FPU B;  2F03 A;  1H9M A;  5J39 A;  1B3A A;  4K6L A;  1SE3 A;  3K57 A;  5CBE E;  5D14 A;  5A2Q L;  5C5L A;  4DK1 A;  1SAP A;  3PUZ A;  3Q6S A;  3NHH A;  2A6E D;  4K8I A;  5JPN C;  5I9O A;  1LT6 D;  5A35 A;  1ZEQ X;  5JVH 3;  3IAY A;  2IX1 A;  1L0X B;  5DM6 3;  2F0K A;  3WOF A;  5IOD A;  2KJX A;  3J80 L;  4IUP A;  1B53 A;  1YNJ C;  2PW7 A;  3KBX A;  1DOL A;  5G3L F;  1CHQ D;  3GTM B;  2M00 A;  1EY0 A;  2ZXO A;  3NPP A;  3DWP A;  2CW0 D;  2WAQ B;  2Q8T A;  4KY5 A;  2D2C C;  3CQZ B;  5COY A;  1O78 A;  1EYA A;  1EZ6 A;  1SYG A;  1BCP F;  3GTP B;  1T5X D;  2NYZ D;  3P20 A;  1MSG A;  3U9S A;  3L9A X;  1Y8P B;  1QB5 D;  1EY8 A;  3Q24 A;  5G3L D;  2AWN A;  5J22 A;  2E76 C;  4FYD A;  3T56 B;  2XRS D;  1WTV A;  5C3E B;  5IGG A;  1SYD A;  2G9D A;  2M2L A;  3DWA A;  2Z4H A;  4JBW A;  4OHJ A;  1JWS D;  2RBM A;  1O7L A;  2L1B A;  1HTP A;  4HAE A;  2IX3 A;  2BA0 A;  1GJX A;  3RLF A;  2B2W C;  3H6M A;  2BOS A;  1BCP D;  2EYO A;  4CBV A;  4DGZ A;  5CC4 A;  1H9J A;  1KAB A;  4RKL A;  1F9S A;  1E0B A;  1FD7 D;  2F0L A;  3HOY B;  1WCM B;  2CVR A;  1GUN A;  1KDB A;  3T16 A;  1RTN A;  3U9O A;  1HFN A;  2RKS A;  5E4X A;  1IKM A;  3IKJ A;  1M4V A;  1JWM D;  2DN8 A;  3N6R A;  5BN3 A;  4IFD I;  1PRT C;  1L0Y B;  2EJM A;  1O80 A;  4ID6 A;  1H9R A;  2KCC A;  1CQF A;  5CV4 A;  3J81 L;  4IUQ A;  1CT1 D;  4C3I G;  4FF4 A;  4A3J B;  4IZ8 A;  2RVL A;  3GQB A;  4CJ0 B;  1DCZ A;  3RZO B;  2K1B A;  1HCZ A;  1LO5 D;  1LTA D;  3ITP A;  1R9T B;  1ZYR D;  1STY A;  4KKU A;  5K5P A;  2EYJ A;  2A6H D;  4C3H B;  1TWF B;  2LFN A;  3MXN A;  1YNN D;  3V96 A;  4A3F B;  2AQ1 B;  3E0J A;  4U67 3;  2RA4 A;  4RAU C;  1PZJ D;  5FO8 B;  2XIW A;  1LTB D;  4XIG S;  5IGF A;  3MFY A;  5AFW A;  3C1E A;  4H0L C;  1D1I A;  5CMD A;  4Q5V A;  3KLR A;  1BF4 A;  4XXE A;  2A68 C;  4IAL A;  4Y7N B;  1SNM A;  5FLX E;  1R4Q B;  2EZV A;  1S4Z A;  1J8I A;  2K04 A;  1PDQ A;  2ENB A;  1U4P A;  2EY6 A;  1I4R A;  5FO7 B;  1ILP A;  3V2T A;  3FRP B;  1G8Z D;  1HTL D;  3G7L A;  4RGO S;  2AQ3 B;  1S5D D;  5ELB A;  4XQJ A;  5IT9 E;  1G6Z A;  4NMZ A;  5JVG 3;  1ET6 A;  2WKD A;  4KV6 A;  5DNF A;  3VYS A;  2O4X A;  1OO9 B;  2F0U A;  1XX8 A;  2JXM B;  4ODG A;  2F0G A;  2BE5 D;  1G2T A;  1I4G A;  3SK5 A;  4OO1 H;  1OXS C;  3PUW A;  4UAI A;  2B2V A;  5HGT A;  3IFD A;  3HEJ A;  1SJE D;  2EPB A;  1Z6H A;  2PMZ B;  2AQ2 B;  2KA7 A;  2LKV A;  4BA1 I;  2VB2 X;  2SNM A;  3DHQ A;  1FNV A;  2IJ0 A;  2F0W A;  2RQX A;  2PZT A;  1MSH A;  2VXW A;  4IUR A;  1WD0 A;  1K83 B;  5CR3 A;  3SDZ A;  1PFM A;  5KIX A;  1U4M A;  3S1Q B;  3S2H B;  5E1F A;  2K05 A;  4IUU A;  2L5T A;  4C1N K;  4LMQ D;  2IT1 A;  4EQO A;  3KUP A;  2WAC A;  4HR7 B;  4ABN A;  5D3I B;  3GP7 A;  3R3O A;  4J1M A;  2NN6 H;  3MXP A;  3P1H A;  3MXG A;  2R3Z A;  3F2U A;  2C9O A;  4BY1 B;  3S2D B;  4K6D A;  3D3R A;  4BBS B;  1H9S A;  4FF2 A;  3DEO A;  3MHB A;  2KHS A;  2QEJ C;  2Q8I B;  1TR5 A;  5I2Y A;  2NTT A;  3OWE B;  5KND A;  1PRT F;  2WKC A;  4HCS A;  1IW7 D;  1WTP A;  3NWT A;  5C0X G;  3K0Y A;  2NVQ B;  3NSW A;  3O13 A;  2DY7 A;  3TP8 A;  1ML0 D;  2WP8 J;  3K5O A;  1ONL A;  1TU2 B;  1EFI D;  4F87 A;  4FO2 A;  3FKI B;  1EEI D;  4ULL A;  3HOX B;  1LTI D;  1M8A A;  1MI2 A;  2V4D A;  3DUZ A;  1HXY D;  1TVX A;  4HTH A;  5J1Z A;  4J8Q A;  4TRD A;  3SE0 A;  2Z8L A;  1QOH A;  1CZW A;  5IGE A;  1DM0 B;  2NVX B;  2KCN A;  3VYR A;  2D9U A;  2J7Z A;  4ZKC B;  1LTT D;  1UUP A;  1FNW A;  2X6L A;  2SOB A;  4C2M B;  4CHT B;  1B9M A;  4J6H A;  3NTK A;  5CV5 A;  3BDC A;  2TMP A;  2F0P A;  2Q8R E;  1TWC B;  2HDM A;  1F9P A;  1CQV A;  2L9H A;  2A69 C;  2EJG C;  3E6Z X;  1G2S A;  1SYC A;  3H3V C;  1CZG A;  2FHT A;  3PUY A;  1QJO A;  1GUS A;  2RSN A;  5TSS A;  2XRQ D;  5LHY 1;  1EZ8 A;  4XYQ A;  1KAA A;  3A7A B;  2HCI A;  1SNQ A;  3MVV A;  3RD4 A;  1IHZ A;  1I6H B;  2WII B;  1ZYR C;  1HA6 A;  2R7Z B;  4G57 A;  2I46 A;  5C5M A;  3VYU A;  1RD9 D;  3EVQ A;  3BVG A;  1YNN C;  1DZ1 A;  3RUZ A;  4DFA A;  3S15 B;  2F0M A;  2K01 A;  5I9P A;  5IGD A;  1TY2 A;  3M85 A;  1B9N A;  3BYT B;  1JCK B;  3NXW A;  1EEF D;  4FF1 A;  1I4H A;  1K8M A;  1PMR A;  4B9W A;  4ZQ3 A;  4G7Z C;  3I8Z A;  3HKZ B;  4NW2 A;  2QKI C;  2R61 A;  1D5M C;  3QJY A;  1DOM A;  2PYK A;  2VUM B;  1D1K A;  4E6I A;  5C3W A;  2JEA I;  5I6Y A;  3NQT A;  5C4Z A;  2YYZ A;  1CM9 A;  1Y1W B;  2DNC A;  3K5L A;  5FKA C;  2BDN A;  4N9P A;  1IKL A;  1EWC A;  3K58 A;  1SEB D;  2HDL A;  1ESR A;  2G9H D;  1EWH A;  1SMY D;  1JIC A;  3R8B A;  3GD7 A;  2B8G A;  2PZW A;  1O7Z A;  2BCO A;  1U4R A;  1NAP A;  1Y8N B;  4QF4 A;  5KGU A;  5I6W A;  4RGT A;  3K7A B;  4X3K A;  1B4O A;  2NVT B;  5C0X I;  1UNS A;  2CHB D;  3FMC A;  5KNB A;  3KBG A;  4QB4 A;  1J9O A;  5D3D A;  1F9R A;  3CRL C;  4PMB A;  2IWH A;  4C1N I;  3C3L A;  1V43 A;  4RHR A;  1EQT A;  3S14 B;  5FOB B;  3OWF A;  1PTO F;  1X3P A;  5EPK A;  1U9R A;  2K33 A;  3H09 A;  2KVM A;  3DXJ C;  3HZX A;  2F0H A;  2AUK A;  3QB3 A;  1HUM A;  2PCF B;  2L55 A;  3BVM A;  4XDX A;  4KK7 A;  5FLX L;  1GUT A;  1GOZ A;  5I2X A;  4PNY A;  4RH6 A;  2GA4 B;  1TT2 A;  4CGY B;  3JAM E;  2OEO A;  2K5Q A;  1TS5 A;  5C4H A;  3BS1 A;  1PTO D;  4IUT A;  4G7H C;  4C3I B;  4FVM A;  5IT9 L;  3CKI B;  3NQI A;  2K28 A;  3GTG B;  2K6A A;  4DAV A;  1JWU D;  3G6J B;  1NUC A;  1SNP A;  3OMG A;  2LY7 A;  1Z47 A;  3GTJ B;  5EPJ A;  3GTO B;  2XWJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...