5KGUA

Crystal structure of staphylococcal nuclease variant delta+phs n118d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGDNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS N118D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kguA00
5KEEA 5NUCA 4PMBA 5C5LA 3SK6A 1KABA 3C1EA 3D4WA 1EY6A 3R3OA 1EY4A 5J1ZA 3TP5A 5C4ZA 4IALA 5E1FA 5M9OA 5KYLA 2F0GA 1EYAA 3HZXA 5IGFA 3QOJA 1II3A 2EXZA 2F0JA 1SYCA 2F0DA 3NQTA 3MHBA 4K5XA 1STBA 2O4XA 4PNYA 5CC4A 2EYMA 5CV5A 2PW7A 3MVVA 3PMFA 1IHZA 1SYGA 3TP6A 5KYIA 4WRDA 2EYPA 1ENAA 1SNOA 4MIUA 4IUNA 1A3TA 5I9PA 1EYDA 3NP8A 3ERQA 1A3VA 2EYFA 1STNA 4J6HA 4IZ8A 2RKSA 4NKLA 4K2LA 5IODA 1EY7A 2M00A 5IGBA 3P1HA 5IGCA 2EYJA 3SR1A 4RKBA 5CR3A 3RUZA 2PZWA 4EQOA 4QMGA 1AEXA 4E6IA 2OXPA 1EY5A 5KGUA 1JORA 2F3WA 3MXPA 1EY0A 2F0SA 3LX0A 4H7BA 2F0LA 2OF1A 5CV8A 5EGTA 4PMCA 4K8IA 4K5VA 4KTAA 4KD4A 4K6DA 5J39A 2EY5A 3E5SA 3NUCA 4LAAA 1TT2A 3QB3A 3BDCA 1A2UA 4K2KA 5IGGA 5E3FA 1F2ZA 1TR5A 1NUCA 3SK8A 2F0KA 2NUCA 5IOCA 5JAVA 2F0TA 2WACA 5KIXA 1A2TA 3T13A 3U9OA 5C3WA 4ZQ3A 4K14A 4QF4A 4RKLA 4S3SA 3EROA 2KHSA 1STAA 2EY6A 3EVQA 5EKKA 5C4HA 2RBMA 1A3UA 2F0QA 4KJNA 5C6AA 1KDBA 3C1FA 5F2DA 4N9TA 3H6MA 3D8GA 4DGZA 4EQPA 2EY1A 5KRUA 3SK5A 1JOKA 5EKLA 4DF7A 2ENBA 3TP7A 1U9RA 4NDXA 4ZUIA 3NXWA 1F2MA 4OL7A 3T16A 1JOQA 1SYDA 5C3XA 5ISRA 4K5WA 4ODGA 4N9PA 2SNMA 5C5MA 2PZTA 3OMGA 5J22A 4B9XA 4K8JA 1EZ6A 1SNMA 4KV6A 5IIFA 1STYA 3ITPA 1SYFA 3QOLA 4TRDA 5CV7A 5JOBA 4HTHA 2F3VA 1JOOA 2F0VA 3TP8A 2RDFA 3OSOA 3SHLA 4DFAA 5IGDA 4NMZA 2F0MA 1EY9A 5DEHA 1F2YA 4QB4A 3SXHA 3NHHA 5I9OA 3EJIA 2F0PA 3HEJA 3DMUA 1ENCA 1EYCA 4KY5A 4ME5A 3D6CA 2SOBA 5K5PA 1SYEA 2EYOA 4KJOA 2EY2A 2F0HA 3P75A 4KY7A 4NP5A 1NSNS 5DAUA 4KY6A 4I65A 4EQNA 2F0UA 3D4DA 4WORA 1KAAA 3S9WA 1RKNA 4F7XA 4KD3A 3MEHA 3OWFA 1SYBA 4HMIA 1EY8A 2EYHA 4DU9A 1EQVA 4KHVA 2OEOA 1SNCA 2PQEA 4J1MA 3TMEA 3V2TA 2SNSA 5CGKA 2F0IA 2F0OA 5IGEA 4YIJA 2F0EA 5CV4A 1EZ8A 2HQEA 3OMCA 5CV9A 3VA5A 4B9WA 2EYLA 1KDAA 3MZ5A 3SK4A 2PYKA 2F0NA 1KDCA 2QDBA 4ID6A 2LKVA 1TQOA 1STGA 2KQ3A 5I6WA 5HGTA 1SNQA 2F0WA 3DHQA 4HMJA 4F8MA 1SNPA 2F0FA 5CV6A 4R8NA 1STHA 4ZUJA 5HURA 4EVOA 2PW5A 5I6YA 3BDLA 1SNDA 3NK9A 4G57A 2PZUA
chains in the Genus database with same CATH superfamily
1VQLA 3PIO3 1I94L 2H4OA 3CC7A 2A73B 4C3HB 1YNNC 1SEBD 2F0GA 3KDFB 2JA7G 2LS01 3EBEA 3NQIA 3NQTA 5C0XI 1XNRQ 4HCEA 2PQAB 1HHVA 3OHXC 4V0BA 2K04A 1PH6A 1IHZA 2EYPA 1ENAA 1MJCA 3DXJC 3NP8A 4RH6A 2EYFA 4CDEC 3PO3H 3J80c 1VQ8A 3KOJA 2B63G 3PQIA 4GN5A 4BWGB 2M9VA 2QW7A 4LFCQ 2MO0A 2R93H 2WV6D 4NW2A 2HHHQ 2TMPA 4IJHA 1PH2A 1V43A 5IYCG 3S16B 3KF6A 1KXLA 1QUQB 1IW7D 3J81i 4GS3A 3NENA 1K0RA 3KUPA 4FXGC 2R7ZB 4WFN3 2NVTB 2RCNA 1FVIA 2ZT9C 1ILQA 4FXKC 5C4HA 1D1KA 3BYTB 4BY1H 1N32Q 1JWUD 1SMYD 3BS1A 1D2BA 5H1SE 2UUBQ 3PF4A 3BVGA 2NZHA 2IY5B 2ZJPA 1OXXK 1SNMA 1WYDA 1VQMA 3S1MB 4K0KQ 1X65A 1IYVA 3KDFA 2D2CC 2I5HA 4LFAQ 1KNEA 2PQAA 3I4OA 2UXCQ 2K03A 2LXKA 1FD7D 4CJ2C 1WTQA 1U4RA 4QY7A 1G6ZA 4JI6L 3GTKB 1E1TA 1O7IA 2KBNA 3E6ZX 1E2WA 4FDBA 1HNXQ 1IL2A 4GKJQ 4P74A 4ILWA 4A3MB 1PH8A 1R9TH 4LMQD 2PI2A 1KRSA 4IO9A 1W6JA 1KHIA 1VS0A 1KNAA 1TY2A 3CKIB 1QUQA 4R4IA 3K58A 2E2JH 4ZYSA 4DR4L 1K8MA 4UPAA 3CCJA 2IX1A 5I6YA 2AHOB 4LJZC 1EIFA 2JA6G 3I70A 5E1FA 3F2UA 1S5ED 1LUZA 4B3TL 2IPKD 5M5WB 1RD9D 2XNAC 1H9SB 4FVMA 1EU4A 2GVAA 3PMFA 1PZKD 3MVVA 4DR2Q 3VR2A 5ELFA 2I0QA 4LF7L 5K36G 3RZOH 1IBKQ 3FP9A 2RKSA 2F3IA 4MNOA 4RA8A 4UP9A 1AFPA 1B9MA 3G6JB 3UI2A 4E6IA 2BDOA 3MXPA 4U673 3J80L 1FYCA 2B2TC 4PMCA 4IPDA 3W1GA 4XQQA 3AQQA 2GA4B 4F88A 1FJGQ 1VQ6A 3GTJH 3PF5A 1JB3A 1AZPA 4ME3A 2KEDA 3Q8DA 1XPRA 1QZGA 3G7LA 3BVZA 2KENA 4HIOA 5IY0A 1KDBA 2ID0A 1BCPC 4JI1Q 5JEAG 3SK5A 3DEPA 3M7GA 1SROA 3JAML 3T16A 1MSHA 1BQQT 4ODGA 1ICFB 1EZ6A 1STYA 2K5DA 1H9RA 1TWHB 4UP8A 1RHPA 4DK6C 5C4XG 4OIKA 1LTTD 3I3CA 2IX0A 4A3DH 4ME5A 1M1KC 5G3LF 3J81j 5JVG3 1JB7A 1RKNA 4QGUA 3OW2A 2UXBQ 4HMIA 3X3NA 1PXUA 1EY8A 1A15A 3H0GB 5G3LD 1EU3A 1WTWA 2PQEA 4PZ7A 3A8IE 1VCIA 3U50C 3VYUA 2NB0A 2F0OA 5CV4A 2HQEA 1PFMA 1I4GA 4KHPL 2EYLA 3TEHB 2F4VQ 4DKAC 2VQFL 2F0WA 1LABA 1HQMC 4C3IB 1GJXA 5C3EG 2J0TD 2E74C 3CPWA 4DV4L 2YTXA 4YCWA 3GTPB 1XMOQ 2R92H 4G7OC 4A3BH 4Y7NB 2Q8IB 4JI2Q 4XQJA 2DY8A 4XYQA 1A62A 5IE8A 2RSNA 2O4XA 4GLAC 5JEAJ 2ICIA 2WB1G 1SR3A 3MWYW 2DJFC 4NXML 4DAPA 5FLXE 2JA7B 1Y1WG 1MSGA 5FLMG 5FO8B 1NMGA 3ND9A 1X32A 1J8IA 4L5QA 2A68C 3HOUG 5J3BA 3MTSA 4L5RC 4RKBA 2FFKB 1DM0B 4A3EG 5M3MG 3VYSA 1BBXC 3K8AA 3LX0A 2F03A 2F0LA 1YHAA 3K5NA 3F2CA 2B63B 2R3ZA 4LAAA 5BN5A 2XIWA 2L55A 4JC0A 1NUCA 5IOCA 2IHFA 5EPJA 1GUWA 1WVLA 2KHSA 2RSOA 2OQKA 4A3KG 3PO3B 1Q7YC 3BYYB 5IP9H 2K75A 2LXJA 1PYSB 5FLXc 4DGZA 4CBVA 1AE2A 1X6OA 2NVXH 3A0JA 1GOZA 2HIVA 5LMNW 1O7YA 2XSCA 5FKAC 5D3DA 4ZUIA 2R93B 5KNCA 4JV5Q 2M2LA 1V1OA 4WJ4A 1IL8A 3I55A 3IAYA 2KOLA 4RGOS 2K5HA 2K32A 1SLJA 4HTHA 1HUNA 2R6GA 3K59A 1R4QB 3OYYA 3OSOA 1N36L 4EQ5A 5BN3A 2OTLA 4DFAA 5C44B 4DV0L 4OO1G 2NVYH 4YWLA 4RCOA 2AKWB 4OELB 1EYCA 4KY5A 4JYAQ 4A93G 1HA5A 4BS9A 1DYQA 1C0AA 3KK7A 3E9HA 3TS2A 1E2ZA 1E1OA 2EYHA 3PGZA 1V1QA 5FK9C 1I4RA 2OEOA 1VQ4A 3V2TA 4C1NI 1LTGD 3AFQA 2IJ0A 5TSSA 2PYKA 1CZGA 3A5UA 1IBML 1BVSA 2A6HD 3TDQA 5I6WA 1SNQA 4LUVA 3DHQA 1PYWD 3CHBD 4B3SL 4HCSA 5JVH3 4ZK9B 4KLKA 3L2PA 4G57A 2UU9Q 3MXNA 5EQ0A 4C3HH 4A3LH 1H9KA 4JOIC 4A3GG 1GD7A 2N3SA 2EXZA 1WD0A 4K5XA 1STBA 3A56A 5ELNA 3K57A 4HJAA 5CV5A 2E2IB 2PW7A 5EJWA 1WFQA 4L8JA 1WTRA 1EQRA 2Q2IA 3I8ZA 1E22A 4QIWB 3GTMB 4C3JH 3V05A 4CKBA 1IYJB 2B29A 4ZKBB 4DN4M 4GKKL 1JR0D 1KLGD 1JQYD 1KAWA 1XJVA 4QMGA 3HOWG 1EY0A 1FGBD 2LFNA 3E3XA 3U9SA 1J5EQ 1TS2A 4N8X1 3S16H 3TZUA 1LT6D 4IUQA 3D31A 2FXQA 2F0KA 2NUCA 5IWAL 1D7QA 3U9OA 4S3SA 2PO4A 1D5XC 3I91A 1STAA 2R7ZH 1A3UA 4B3MQ 1HZAA 1QVGA 4DR6Q 2EDGA 3D8GA 2B2UA 2EY1A 3C46A 3I7FA 5IYDH 1U9RA 1EIGA 3DEOA 4NDXA 3T4AC 5CMDA 5LL6X 5ISRA 4AH6A 4FNFA 1EEID 2N55A 5FLXL 1HNWL 1BF4A 3FEWX 4ULLA 4R4QA 3GTJB 1LTLA 1H95A 2VW9A 4A3IB 3GV6A 1K28A 3KLSX 1MHWC 3SHLA 1RCVD 4DNTB 1XNQL 5IP7G 4IPCA 3TQYA 3A7LA 3RLNA 4DR5Q 1SYEA 1QVFA 1NSNS 2IHEA 3AB9A 3D4DA 4WORA 1WTHA 1D8LA 1F77A 3NBHB 5AJ3L 1HR0L 4A3MH 1YEZA 2XRSD 1Q1BA 4DR7L 2QCPX 1Z9FA 1K73C 1GXDC 1KTKA 2BE5C 2OQ0A 1HTPA 4GNXB 2KEEA 1SSOA 4XYOA 4F8MA 3SGIA 1QCBD 1SE4A 2XN9C 2HCCA 1QVCA 3NBIA 1LO5D 3CCUA 3PO2B 3FPPA 2L15A 4CDCC 4IFDH 1EWCA 4V190 5M5XB 1KRTA 1CA5A 1QILA 4LF9Q 3CP0A 4UAIA 1N8RC 1EIHA 4LFBL 2E5LL 2DUDA 4X64L 4X65L 4JW0A 2D62A 1B3QA 2HQLA 2TSSA 2Y0SE 3OTOL 1STNA 2BA1A 4IZ8A 2EE1A 2WB1B 3T1HL 5IGCA 5EBDA 1L2FA 4BXXG 1EY5A 2R92B 2OF1A 4QQBX 1PRTF 3HOYB 1I50B 1Q8KA 1T9HA 5IYBH 1A2UA 1JE5A 1I4PA 2CVRA 4MTNA 2VUMB 4MZ9A 1PRTD 3K80C 4LUZA 3L9AX 1S5BD 2WAQE 3EVQA 4J15A 3I4NH 1IBLL 1IKMA 4KJNA 1PH7A 4GNXA 1QB5D 1JOKA 1SN8A 2ZM6Q 4G7ZC 2A69D 4IOCA 1KL9A 5LMNQ 2UUCQ 4K5WA 2RHSB 4KK7A 3Q23A 4K8JA 3CMEA 1PV4A 1OO9B 2K14A 2JA8G 1A0IA 2GVBA 3SDZA 2N49A 3DWAA 1X3EA 4OWXB 1VQAA 4BBRG 4A3JG 3GTGH 1NY4A 1TWHH 1PHJA 4POGA 4NMZA 1K9MC 3RLOA 1UAPA 3EJIA 4JI5Q 1ENCA 3EA6A 3FRPB 1JE4A 3OWEB 2R61A 3PSIA 1PFSA 4I65A 4EQNA 5A2QL 3Q22A 1HRJA 1KAAA 1X9NA 1EOVA 2K7VA 2ZTCA 1RL2A 4JBWA 3UDFA 3KJOA 3K6OA 1EEFD 3CRKC 2F0IA 5IGEA 4A3CG 1DCZA 2YV5A 3MXGA 4YCVA 1VMCA 3K5MA 1UEBA 1XPOA 2F0FA 4G7HC 3RMHA 5CV6A 2NVYB 3K81C 4C3IH 3OW7A 2RF4A 5HURA 2Y0SG 4EVOA 1G291 1TWFB 1RTNA 2PZUA 3U4VA 1L1OB 3K7UC 3BJUA 1H9JA 4LF4L 1EY6A 2Z4IA 1EY4A 5J1ZA 3MXUA 4JI8Q 3I56A 3KF6B 4JI7L 4Y7NH 2L4NA 4JPBW 1EWIA 1HTLD 3KYHC 1FNVA 3S17B 1L0WA 1II3A 3MHBA 3CCRA 1X3PA 2DNEA 1HFGA 3BZCA 3HG9A 4C56C 1VQBA 1N9WA 1SMYC 2JA7H 4NXNL 3FKIB 3HOVG 2EZVA 1EY7A 1V8QA 2WAQG 5AFWA 1P8LA 2B2WA 2EYJA 1EIYB 1VQGA 3VA7A 1JJCB 1MI2A 4APVA 3AMUA 3A8KE 3PUYA 5CV8A 2NWGA 3TZDA 2K5VA 4HJ7A 2XGTA 2B63H 2UUAQ 3KFUA 1HA6A 2JA5G 3HOWB 3JAME 5IT9L 3CU7A 3GTLB 2WACA 2JQOA 4ZQ3A 2G9HD 4LF8Q 3I73A 1QNUA 3I90A 4C3JB 2Q2TA 2EY6A 1S5DD 2B3GA 5IYCH 4CDFC 3G6EA 4AYBG 1M90C 2ZXRA 4BBSG 3UDGA 2L9HA 3H6MA 5D3IB 4HR7B 1S72A 2PNHA 1VQKA 1VQDA 4XIGS 1ZYRD 1I6HH 1L1OA 3QR8A 1ZKOA 1FNUA 1O7ZA 3NWTA 2RDFA 4X3TA 1YNJC 1CUKA 4QB4A 3JAMc 5C44H 5D65A 4LF5Q 1RODA 2SEBD 3HEJA 1B44D 2CH4W 4DAYB 4IOAA 2C35B 5LMUQ 4QIWE 2G9DA 4DV5L 2ATWA 1GUOA 3AU7A 1QNKA 3NTIA 4ZRZA 2ZTEA 4DR3L 4IQZA 4DA2A 2EPBA 1F9PA 3VA5A 1E2VA 1KDAA 4DV1L 2KCNA 1STGA 3CCLA 2F1MA 3J7AF 2CWPA 2Q8TA 2JSOA 2N8NA 2NN6G 1N34L 4GNXC 2RDGA 4QUFA 1E24A 1W3SA 1VF7A 1SNDA 1PZJD 1OXUA 4H44C 3RZDB 4OWWB 4JBJA 2JP1A 2PMZE 4IALA 3QO2A 4GOPB 3RN5A 2I46A 1BKBA 2IX3A 1XMQQ 3J7A5 3LWUA 3F2BA 4DV2L 2JA6H 3WDNA 2E2IH 4LNQA 4BY1G 1BDOA 1SNOA 1X56A 2MFIA 3AYHB 4DUZL 3GTMH 4WJ3M 1LTBD 3FVQA 3RUZA 4OX9Q 1DGSA 5K36H 2CCZA 1X54A 5I4DA 3HKZE 4HIMA 2F0SA 4F87A 2UXDQ 2P5ZX 2QEJC 5COYA 5E4WC 1HNZQ 4DAYA 1YNJD 5J39A 2Z6KA 5BR8L 1EQQA 4JI0L 1Y8OB 4K2KA 1GUGA 1GO3E 2PPBC 4A3FG 1K83B 2MO1A 1I4HA 2V1CC 1TS3A 1Q12A 3K5OA 2R7DA 4O1NA 4O2DA 3J7ZC 3HOZG 4P73A 2F0QA 3ULPA 3PUZA 2CWAA 2ASBA 2Q2UA 3E0JA 4UDUC 1PA6A 2ES2A 5CBEE 1K3RA 4PV1C 3D4RA 2RDHA 4B9XA 2VL6A 4OONA 5JEAH 1VQPA 1Y69U 1BOSA 4GOPA 4QCLA 1S5FD 4O42A 3NELA 1TS4A 3MFGA 4A3IH 1CKNA 1XXGA 4YHHL 5I9OA 5ELOA 3T56B 3I4NB 2AUKA 3D6CA 2SOBA 3M7NA 4XDXA 4XXEA 2LMCB 1XX8A 5C4XH 2BOSA 1LT5D 3JC66 5C0XG 4JI4L 1MGSA 4X3UA 1SE8A 1XTCD 1EQVA 4ZCKA 3HKSA 1I94Q 1HZCA 2I5MX 2E2DC 2C5CA 1F2LA 3P7JA 3GTGB 3S2HB 1XTDA 5HGTA 2H5XA 1EYGA 4UHVA 3RN2A 1PRTB 3W3AA 1G8ZD 1EUJA 2OCEA 4LF6L 5KGUA 5C5LA 3TREA 4RGMA 1K0SA 3PO2H 2F52A 5KYLA 3ER0A 1L1OC 3HKZG 4KKTA 4EX5A 1YJWA 1TWAB 5M5XH 1SYCA 1VQOA 1VQ9A 2V4DA 4LK1C 1LT4D 3CRLC 1SYGA 4WRDA 2KUMA 1UUPA 1E3PA 4JI3L 2NBFA 1IXRA 3NPPA 1H9MA 4DUYL 4J8QA 2O5JC 2X6LA 5CR3A 4TSSA 1QWYA 5DNFA 5FLMH 3A5ZB 2N88A 4ZAIA 1BNZA 3HOXB 2K50A 1N33L 1JWMD 2H1EA 3HOUH 3HOYH 1I50H 1CT1D 2LSSA 2YTYA 5IGGA 5E3FA 1TR5A 5M3MH 3CCMA 2F0TA 2VUMH 1I4QA 5C0XJ 2DNCA 5M3FG 3A74A 3CW2C 4QL5A 1XWEA 4PZ8A 2D9UA 2A1AA 4B08A 3BG3A 2EQSA 3H09A 2A6HC 2Z4HA 4AQYL 4AYBB 4N9PA 2BH2A 4JI6Q 1SYFA 5BN4A 3J81c 2L0CA 4MHEA 1DXMA 4CKCA 3TP8A 3H91A 2L12A 4LUOA 1B3AA 5LHY1 5IGDA 2CFMA 2VNUD 3SXHA 3MXNB 4BA2I 2F0PA 1JJGA 1OXSC 5K5PA 3W2DA 4YY3L 4NB3A 4P2CB 3DWPA 3P75A 3R2TA 3LNNA 3S9WA 4DR4Q 1K8AC 3Q0AA 2CHBD 1I6HB 5DM63 2EJFC 2B2VA 4A93H 4KMUC 3NTHA 3M4PA 2KHJA 2QEXA 4B3TQ 4DNIA 1EL0A 1TY0A 1KLUD 3CCEA 1X3QA 4LF7Q 5GAGC 1TWFH 5KEEA 4DK0A 5EPKA 1WOCA 2E76C 1CKOA 2WFWA 4YWKA 3RR5A 3PUVA 1GUNA 3S17H 3UDXA 3CCSA 4GOPC 3PIPA 2JA9A 1G91A 4IUVA 4G4KA 4A3GH 5GAEC 1A3VA 2ICEC 3FKIH 2BCOA 5IODA 1U4LA 2CH4A 3I2ZA 1XYIA 1OXTA 2HIXA 2WIIB 3STBD 1V1PA 4IFDI 4LW1A 3TN2A 1E7ZA 4P71A 4KD4A 1RTOA 2ZJQA 1TT2A 5JPNC 3G71A 2VZAA 1YHQA 3A54A 1IZ6A 3HOWH 1JJ2A 2JA6B 4B3RL 3D0FA 3GTLH 1YZ6A 4TQUS 3RNUA 1SRUA 5I2XA 4LWCA 3ONAB 3M3YH 2NYZD 3NWSA 4DV7L 1P16A 4DR1L 4TKOB 1DD2A 3SE0A 3R2IA 2X69A 1D6EC 4R4TA 5C3XA 3KBXA 3HOZB 1AH9A 5ELDA 2B2YA 1UEAB 4XQNA 1U4PA 4DV3L 1HR0W 4TVAB 5A2QE 1Q90A 3QOLA 3IRBA 2QKIC 3FDTA 5JOBA 1JOOA 2F0VA 2RCFA 1B1ZA 2YTVA 4X62L 3KLSA 1U5KA 4C3HG 1NJIC 4A3LG 3DMUA 4KHPQ 3I4LA 2NZOA 3J81L 2QGQA 1C7YA 4KI0A 2VQFQ 2QA4A 1GUSA 1LTAD 1ICWA 2OWOA 1U4MA 5IP7H 2CQOA 1J9OA 4J1MA 4DV4Q 1ESRA 3LGJA 1VQFA 1A6XA 1LTID 2Z1CA 3EIVA 5KNBA 2G5DA 3CMAA 1LM0A 3CXCA 1CA6A 3F8TA 1LACA 1VQ5A 1SNPA 3J80i 2KECA 2KCTA 4Q5VA 1STHA 1F9QA 4HJ5A 4NXMQ 4EGVA 4HIDA 2L5TA 2KVMA 2A8VA 3RZDH 1ZXTA 5M9OA 5C4XB 1PRTC 4DV6L 3CC4A 4IURA 5DLQE 4RAUC 3BZKA 4X66L 3M4OB 1NR4A 2R7ZG 1A63A 3MAQA 2F0JA 1RIPA 4DK3C 5LL6S 1VMPA 3T1YL 4PNYA 1NNXA 1YVCA 3S1RB 3TP6A 1O78A 2VQEL 2A69C 3S1QH 2K5WA 4MIUA 1CQFA 3JAMi 4L5TA 2JEAI 1K8OA 1VQ7A 2JEBI 4O0AA 4HSPA 5IT9E 3H15A 1CZWA 2FINB 3ICEA 2A6ED 1EFID 1WTXA 1TVXA 2PZWA 1XNRL 1D1IA 1B2TA 4FF4A 2F3WA 2VXWA 4H7BA 4P75A 1NR2A 5C3EB 4K6DA 2ZJRA 3QB3A 4BXXH 3PIOA 5KIXA 2J7ZA 2AQ1B 1K83H 3T13A 5C3WA 2KHIA 4K14A 4A4IA 4DNRB 1PTOB 1EFWA 4LFCL 2YU9H 1Y1VG 1KQSA 2ZTDA 4M8AA 5EKKA 5CORA 5FO7B 2HHHL 4PG3A 1JWSD 3C1FA 3DLLA 5FJ8G 5M3FB 1N36Q 1Y1WB 4KHZA 3GO5A 4DV0Q 1PDQA 1SYDA 5IT9c 2A5HA 4BA1I 2AMCB 4I7AA 3E9IA 3K5LA 3HOUB 5EAYA 2L1BA 3DWQA 2J4XA 3ITPA 2IWHA 1Q1EA 4A3EB 4H13C 5M3MB 1VQHA 2DJGC 1E0BA 4BY7G 2MJ8A 4YWMA 4NPSA 1TWGB 1N32L 4R8IA 4U68A 3N6RA 2JA8H 5E4XA 2UUBL 4OWTB 1YHBA 5GQOA 4BBRH 1IBMQ 2F0HA 2F0UA 3EN2A 4K0KL 1PH9A 1WI5A 4A3KB 4B3SQ 1WCMG 1TIID 5GADC 2KCCA 4POFA 4LFAL 1PLFA 3TMEA 5FOBB 2UXCL 5CV9A 3S2HH 3ZYYX 1HNXL 4GKJL 4ZKCB 4ZUJA 5M5YH 4A3CH 2K6AA 3NK9A 2B39A 1B53A 1KABA 3D4WA 3DM3A 4HSVA 3S15B 3HP3A 4GKKQ 2VY3A 2A74C 3S2DH 1EYAA 1D5ZC 3QOJA 1TWAH 1AW7A 3FHWA 2F0DA 1PZID 3BU2A 4A93B 1XPUA 1A8VA 1CFMA 1SMXA 1MIUA 2E75C 3HS0C 4IPHA 4IUNA 1ET6A 1ZYRC 2FHTA 4FO2A 2JK8A 5IGBA 1STEA 2XWJB 2B2UC 1Z7TA 5IWAQ 3A8JE 1G6PA 1CI3M 4FP5D 3HOXH 3HOVH 4DR2L 1Z47A 1X3GA 1T5EA 1IBKL 5FO9B 2EY5A 1V9PA 2HD3A 1UE1A 4CKEA 1C48A 3BDCA 3CC2A 3SK8A 2ZXOA 5JJIA 4RGTA 4A3GB 1HNWQ 2PCFB 3S1NB 1FGUA 3H0GG 1FR3A 4X6AH 3CCQA 1MD2D 2A19A 2IL8A 3R93A 1FJGL 1JCKB 3D6WA 1F2MA 3I4MG 3HGBA 1XNQQ 1QJOA 4JCVE 1JMCA 4BBSH 2PNRC 2PZTA 3H3VC 1HUMA 4C3IG 1LYLA 5EKIA 3M4QA 3TS0A 4A75A 3WWVA 1HR0Q 5AJ3Q 2K01A 1YNXA 1KD1C 1PMRA 4JI1L 1Q86C 4RGNA 4FF3A 1ML0D 4DR7Q 1EY9A 1K8GA 3M3YB 4H0LC 1B9NA 3KJPA 4CJ0B 1Y14B 2K4KA 4HJ8A 3T53B 3VR5A 2HDMA 4RG1A 1KIXA 2D5DA 4KD3A 3OWFA 3RD4A 2K05A 4M1UB 2HCIA 2MGSA 2EVBA 2F0NA 4IJLA 4ID6A 2FMMA 2EJMA 4RHSA 1DONA 1BR9A 4KKUA 1QOHA 3NEMA 1B4OA 3K7AB 2UXBL 2AQ3B 1UWVA 4LFBQ 2XTIA 3BDLA 3GD7A 3NSWA 4X64Q 2E5LQ 4X65Q 4KHVA 1SXTA 5NUCA 4PMBA 3NTKA 3TP5A 1YIJA 3OTOQ 2CW0D 3GDEA 2NN6H 2F4VL 3T1HQ 4FYDA 4CDDC 3PO3G 1YBYA 2E2HB 4C1NK 4UY8C 1OTCA 3H94A 5CC4A 3M85A 1I6VC 2RHQB 1BBUA 5JJLA 1LTSD 1S5CD 3UE0A 5I9PA 1XMOL 1BUVT 2R93G 1L0YB 3VR4A 1PH5A 3ERQA 3QG1A 4J6HA 4K2LA 4JI2L 1PH4A 2KA7A 1FL0A 3GTQB 1QE6A 1NAPA 3MC0B 3TBIB 3PUWA 1HZBA 1VQJA 2K5QA 5C4JB 5T1IA 1IBLQ 2VB3X 3L7ZC 3T51B 5C44G 1RDPD 4IN3A 3VYTA 3E5SA 4QJFA 1CKNB 2MHVA 5JAVA 1MKHA 1DOLA 1CSQA 4PMWA 1ESFA 1A2TA 3S1QB 1ASZA 2CKZB 1CSPA 4MTKA 1I3QH 2Q8RE 4DPGA 3CD6A 1YNND 2RBMA 3IKJA 1HFNA 2XWBB 1PTOC 1TWCH 4EQPA 4A3FH 1YI2A 4DF7A 3J7AV 5JJKA 3CQZH 1Y1VB 1LLRD 3H3VH 1W2BA 4CGYB 3HOZH 3W1BA 3PCOB 2OT2A 2BDNA 5IIFA 5EPLA 1AZQA 1B7YB 2VS1A 5CYUA 1B8AA 1M4VA 1UE5A 1JC7A 1PFBA 3OPOA 1Q3LA 5CV7A 2LY7A 3UDIA 2YU9B 1CHQD 1F2YA 4JV5L 3BDOA 3CAMA 1VQNA 5GROA 1VQIA 2F4IA 3GV3A 4OHJA 4BY7B 1B50A 3EQLC 3MEHA 1GM5A 1Q46A 2BA0A 3RLFA 2NVQH 2NTTA 3PUXA 5L37A 4HJ9A 4LF4Q 2AQ2B 4X3KA 1Z6HA 1WJJA 4JI7Q 5C0XH 3M4YA 3MZ5A 1ILPA 1WCMB 4JYAL 2KQ3A 4C2MB 2MQHA 2JA8B 2MPMA 2B2WC 1CM9A 4F7XA 1SFOH 1DOKA 4A3JB 1ET9A 2AUJD 4BBRB 4L6TB 4OO1I 1Y8PB 2HUGA 1Q82C 4NXNQ 3LWEA 2HT1A 1PTOF 3GTOB 5HGQA 1IYUA 3M4OH 2WB1E 5IGFA 4R1JA 2JN4A 1PTOD 3C2PA 3S1RH 1PH3A 2UU9L 1EYDA 2ALYB 4DK1A 1WD1A 5M5YB 2M00A 4PQXA 3ZJYC 3G48A 3SR1A 1ENFA 1CKMA 1VQEA 1SJHD 1WTOA 4A3IG 2XRQD 4K8IA 4DAMA 4JOIA 2NTSA 4KTAA 3S2DB 2Y0SB 5C3EH 3UE1A 4YCUA 1GUTA 2EXDA 1O80A 1G2SA 1CTMA 3EFXD 4I7ZC 5ELBA 1H9SA 3V96A 3U4ZA 1PTOH 1PVOA 3CPFA 5C6AA 4GN3B 3A7AB 1J5EL 5M3FH 2XVSA 1Y1WH 3DUZA 3HOVB 5HY6A 3VYRA 3J81E 2WAQB 3OMGA 4KV6A 3KLRA 1I4XA 2FJ2A 4A3DG 4B3ML 2K1BA 1R4PB 3I4MB 4DV5Q 4A3EH 2F3VA 3IFDA 4DR6L 4GZYC 3N52A 4DR3Q 3PO2G 4RCNA 5DEHA 1TWGH 5I2YA 4UP7A 2EOTA 3QIAA 3HFZB 2JA5B 4PZ6A 4DV1Q 2Z6BA 4RWSC 2EY2A 4NP5A 2O2LD 2CQAA 3BZDB 1AP0A 1BCPF 1NTGA 3VR6A 1N34Q 3FMCA 2KCMA 4A3KH 3SVMA 4BBSB 1HZ9A 5CGKA 1BCPD 4YIJA 2F0EA 2B8GA 2R7FA 4B9WA 4DR5L 2QILA 3STBC 2R92G 4A3BG 1F9SA 4HN7A 4R8NA 1YJ9A 4IPGA 4DV2Q 1V1PB 3HOYG 2ZXPA 4CHTB 4Q0FA 4DUZQ 2VUMG 3U58A 3WOFA 1HPCA 3S15H 4OO1H 1WTVA 2EJGC 1DOMA 1GVPA 3A55A 3HZXA 2Z6KC 4R4CA 4HEDA 4XT1B 2C9OA 5KYIA 1U0LA 3IFTA 1JT8A 3J7YW 1F9RA 5BR8Q 4JI0Q 2Z0SA 3S14H 3ERSX 3ULJA 1LTRD 2SDFA 1SBBB 4LF9L 1JORA 1PYBA 1SDFA 2B8FA 5EGTA 4AIMA 1FNWA 4K5VA 1PFNA 3NUCA 5DM73 5IP9G 4KKSA 2PI2E 1CHPD 4JVZA 5GAHC 1Q81C 4ALPA 3AEVA 2WP8J 1AN8A 4RKLA 2K52A 3G4SA 1KC8C 4OIJA 3S1NH 5F2DA 3BVMA 5EKLA 5D14A 3TP7A 3OIQA 4BY1B 3NXWA 4YHHQ 3URYA 1EQTA 1PH1A 2A68D 1EWHA 4OXPA 4JI4Q 1YITA 5JJZA 1WTPA 1ONLA 2AWNA 4L63B 1I3QB 2ZM6L 1CK1A 5LMNL 2UUCL 1SE2A 4H02A 3W5OA 1TWCB 3B6YA 4A3FB 4KY7A 1LV9A 3QWNA 2MNAA 4KN4C 1K3BC 2WINB 3CQZB 1J6QA 1ZEQX 3KF8B 4HIKA 1BBWA 1R9TB 4DU9A 3FKIG 1SNCA 2IT1A 1UE6A 4LF6Q 1HH2P 2A6EC 2D0PA 2JE6I 4JI5L 3K0YA 3OMCA 1VQCA 2QDBA 5ELCA 4JBKA 2E2JB 4ZLTF 2GN5A 1QG7A 1Q8IA 3K7AH 1VDZA 2PW5A 4R9WA 2K28A 2EIFA 4HMJA 1VF5C 4JG2A 3SK6A 3C1EA 3R3OA 5C4ZA 2DN8A 4JI3Q 4X3SA 4DUYQ 4P72A 1NE3A 2NVQB 4C3JG 1G2TA 2RA4A 2K33A 4N8FA 3GP7A 2E2HH 5KNDA 1N33Q 3RZOB 1A3TA 5E7NA 2NVTH 2PMZB 2JJQA 4JI8L 1GHJA 2JXMB 3HRZC 3E0EA 3DM1A 3PV0A 2K5NA 3P1HA 2WKCA 4DXFA 1SFOB 1X55A 3MA2B 2OXPA 1NBWA 3ULLA 3GTQH 3D3RA 4Z9CB 1MBYA 5C4JH 1SAPA 3S1MH 3L0OA 1JICA 5JPMC 3F2DA 1F2ZA 3KF8A 2DY7A 4AQYQ 4K6LA 3S24A 2I5LX 5IYDG 3HKZB 1HQRD 4JK1C 1SE3A 1NCVA 4DAVA 3I72A 1QZHA 4N9TA 3SEBA 3GTKH 2ENBA 2UUAL 2MUYA 4OL7A 1UE7A 1Y1VH 4JBMA 2O5IC 1SJED 4YY3Q 5J22A 4LF8L 1BO0A 2B2VC 1ASYA 5FJ8H 4TRDA 3CF5A 4KN7C 2X6GA 2Q2HA 3WOEA 4FF1A 4OEMB 2Z8LA 1OXVA 3NHHA 4IUTA 3VDYA 4A3DB 2I07B 4A3MG 4OGQC 3M9BA 1HXYD 3PIP3 4KJOA 4BY7H 5DAUA 4KY6A 4L5SA 1SYBA 5M5WH 4FF2A 2SNSA 4RFBA 3MFYA 1DZ1A 4LF5L 2VB2X 1EZ8A 2BH8A 4IUUA 4XT3B 5A35A 1D5MC 1KDCA 1Y8NB 4GLXA 1WCMH 4HAEA 5LMUL 4C2MH 2KJXA 2NZ1D 4Y52H 2YYZA 4IFDG 1X3FA 3SK4A 2LKVA 4A3JH 4A3BB 1G51A 3AFPA 3GTOH 3R8BA 4RMFA 1YJNA 2OTJA 4GLVB 1S3OA 1B70B 1BXTA 3NBHA 1GHKA 2EYMA 4IUPA 3X3MA 1C4QA 1UNSA 3Q6SA 3K0XA 4NKLA 1DJRD 1NMFA 4B3RQ 1RF2D 3NE5B 1XMQL 2BE5D 4EQOA 1TKWB 1AEXA 5IYBG 2NN6I 1GKHA 1LT3D 1IKLA 2L11A 2IW3A 4DV7Q 4DR1Q 5T1GA 1AE3A 3VR3A 2B2YC 2DGYA 3MEFA 3I4NG 1S4ZA 1TU2B 1L0XB 4CJ1B 4AYBE 4OX9L 4QF4A 3CCVA 3EROA 1BCPB 4DV3Q 2UXDL 3S14B 1HNZL 4DXGA 2N78A 4ABNA 1HJPA 1W6KA 2NVXB 3GQBA 4X62Q 3L3OC 5KRUA 2WKDA 1JOQA 3O13A 2JYOA 1MJEA 1C9OA 3H0GH 2MP1A 2SNMA 5C5MA 2RQXA 4IFDJ 4RHRA 4WJWA 3I4MH 1HCZA 1TXYA 2CW0C 5CBAE 2Z9HA 3FPUB 3Q24A 4QUCA 2F0MA 4FXDA 1CQVA 2QDLA 3KLWA 1IW7C 2JA5H 5EBCA 2EYOA 4GN4B 3GTPH 3H3VI 2QF7A 4A76A 4MN3A 2AWOA 3ND8A 1O7LA 1TS5A 2B2TA 3OOCA 2HDLA 3C3LA 1RJTA 2RVLA 3QJYA 4DV6Q 3OIPA 3J80E 5ELEA 1M8AA 4X66Q 1TQOA 3IL8A 4R4OA 1I5FA 1S40A 3HOXG 2FMCA 2D0OA 1EOTA 1C8CA 3KBGA 4XTCS 3T1YQ 3F1ZA 3P20A 2E8GA 2VQEQ 1T5XD 3TSSA 3TRZA
chains in the Genus database with same CATH topology
3PIO3 2H4OA 2A73B 4C3HB 1YNNC 1SEBD 2F0GA 2LS01 3NQIA 3NQTA 5C0XI 4HCEA 1HHVA 3OHXC 4V0BA 2K04A 1IHZA 2EYPA 1ENAA 3DXJC 3NP8A 4RH6A 2EYFA 4BWGB 2M9VA 2WV6D 4NW2A 2TMPA 1V43A 3S16B 1IW7D 3KUPA 4FXGC 2R7ZB 4WFN3 2NVTB 2ZT9C 1ILQA 4FXKC 5C4HA 1D1KA 3BYTB 1JWUD 1SMYD 3BS1A 1D2BA 3BVGA 1OXXK 1SNMA 3S1MB 1IYVA 2D2CC 1KNEA 2K03A 1FD7D 4CJ2C 1WTQA 1U4RA 1G6ZA 3GTKB 3E6ZX 1E2WA 4ILWA 4A3MB 4LMQD 1W6JA 1KNAA 1TY2A 3CKIB 3K58A 4ZYSA 1K8MA 2IX1A 5I6YA 4LJZC 3I70A 5E1FA 3F2UA 1S5ED 2IPKD 5M5WB 1RD9D 2XNAC 1H9SB 4FVMA 1EU4A 3PMFA 1PZKD 3MVVA 3VR2A 5ELFA 5K36G 2RKSA 4RA8A 1AFPA 1B9MA 3G6JB 3UI2A 4E6IA 2BDOA 3MXPA 4U673 3J80L 1FYCA 2B2TC 4PMCA 4XQQA 2GA4B 4F88A 1JB3A 1AZPA 2KEDA 3G7LA 3BVZA 1KDBA 2ID0A 1BCPC 5JEAG 3SK5A 3DEPA 3M7GA 3JAML 3T16A 1MSHA 1BQQT 4ODGA 1EZ6A 1STYA 2K5DA 1H9RA 1TWHB 1RHPA 4OIKA 1LTTD 3I3CA 2IX0A 4ME5A 5G3LF 5JVG3 1RKNA 4HMIA 3X3NA 1PXUA 1EY8A 1A15A 3H0GB 5G3LD 1EU3A 1WTWA 2PQEA 3A8IE 1VCIA 3VYUA 2NB0A 2F0OA 5CV4A 2HQEA 1PFMA 1I4GA 2EYLA 2F0WA 1LABA 1HQMC 4C3IB 1GJXA 2J0TD 2E74C 3GTPB 4G7OC 4Y7NB 2Q8IB 4XQJA 2DY8A 4XYQA 2RSNA 2O4XA 5JEAJ 2ICIA 3MWYW 4DAPA 5FLXE 2JA7B 1MSGA 5FO8B 3ND9A 1X32A 1J8IA 2A68C 3MTSA 4RKBA 2FFKB 1DM0B 3VYSA 1BBXC 3LX0A 2F03A 2F0LA 3K5NA 2B63B 2R3ZA 4LAAA 5BN5A 2XIWA 2L55A 1NUCA 5IOCA 5EPJA 1GUWA 1WVLA 2KHSA 2RSOA 3PO3B 3BYYB 4DGZA 4CBVA 1GOZA 1O7YA 2XSCA 5FKAC 5D3DA 4ZUIA 2R93B 5KNCA 2M2LA 1V1OA 1IL8A 3IAYA 2KOLA 4RGOS 2K32A 4HTHA 1HUNA 2R6GA 3K59A 1R4QB 3OSOA 5BN3A 4DFAA 5C44B 4OO1G 4RCOA 1EYCA 4KY5A 1HA5A 4BS9A 1DYQA 3KK7A 1E2ZA 2EYHA 5FK9C 1I4RA 2OEOA 3V2TA 4C1NI 1LTGD 2IJ0A 5TSSA 2PYKA 1CZGA 2A6HD 3TDQA 5I6WA 1SNQA 3DHQA 1PYWD 3CHBD 4HCSA 5JVH3 4ZK9B 4G57A 3MXNA 5EQ0A 1H9KA 2EXZA 1WD0A 4K5XA 1STBA 3A56A 3K57A 5CV5A 2E2IB 2PW7A 5EJWA 4L8JA 1WTRA 3I8ZA 4QIWB 3GTMB 3V05A 4CKBA 4ZKBB 4DN4M 1JR0D 1KLGD 1JQYD 4QMGA 1EY0A 1FGBD 2LFNA 3U9SA 1TS2A 3TZUA 1LT6D 4IUQA 3D31A 2F0KA 2NUCA 3U9OA 4S3SA 2PO4A 1D5XC 3I91A 1STAA 1A3UA 2EDGA 3D8GA 2B2UA 2EY1A 3C46A 1U9RA 1EIGA 3DEOA 4NDXA 3T4AC 5CMDA 5LL6X 5ISRA 4FNFA 1EEID 2N55A 5FLXL 1BF4A 3FEWX 4ULLA 3GTJB 4A3IB 3GV6A 3KLSX 3SHLA 1RCVD 4DNTB 3A7LA 1SYEA 1NSNS 3AB9A 3D4DA 4WORA 1F77A 2XRSD 1Q1BA 2QCPX 1GXDC 1KTKA 2BE5C 1HTPA 2KEEA 1SSOA 4XYOA 4F8MA 1QCBD 1SE4A 2XN9C 2HCCA 3NBIA 1LO5D 3PO2B 3FPPA 4IFDH 1EWCA 4V190 5M5XB 1CA5A 1QILA 4UAIA 1EIHA 2D62A 2TSSA 1STNA 2BA1A 4IZ8A 2EE1A 2WB1B 5IGCA 5EBDA 1EY5A 2R92B 2OF1A 1PRTF 3HOYB 1I50B 1A2UA 1I4PA 2CVRA 2VUMB 1PRTD 3L9AX 1S5BD 3EVQA 1IKMA 4KJNA 1QB5D 1JOKA 4G7ZC 2A69D 4K5WA 4KK7A 3Q23A 4K8JA 1OO9B 3SDZA 3DWAA 4NMZA 1UAPA 3EJIA 1ENCA 3EA6A 3FRPB 1JE4A 3OWEB 2R61A 4I65A 4EQNA 5A2QL 3Q22A 1HRJA 1KAAA 2K7VA 4JBWA 3K6OA 1EEFD 3CRKC 2F0IA 5IGEA 1DCZA 3MXGA 1VMCA 3K5MA 2F0FA 4G7HC 3RMHA 5CV6A 2NVYB 3OW7A 5HURA 4EVOA 1G291 1TWFB 1RTNA 2PZUA 1H9JA 1EY6A 2Z4IA 1EY4A 5J1ZA 3MXUA 2L4NA 1HTLD 1FNVA 3S17B 1II3A 3MHBA 1X3PA 2DNEA 1HFGA 3HG9A 4C56C 1SMYC 3FKIB 2EZVA 1EY7A 1V8QA 5AFWA 2B2WA 2EYJA 3VA7A 1MI2A 3AMUA 3A8KE 3PUYA 5CV8A 2NWGA 3TZDA 1HA6A 3HOWB 3JAME 5IT9L 3CU7A 3GTLB 2WACA 4ZQ3A 2G9HD 3I73A 1QNUA 3I90A 4C3JB 2EY6A 1S5DD 2ZXRA 2L9HA 3H6MA 5D3IB 4HR7B 4XIGS 1ZYRD 1ZKOA 1FNUA 1O7ZA 3NWTA 2RDFA 4X3TA 1YNJC 4QB4A 5D65A 1RODA 2SEBD 3HEJA 1B44D 2G9DA 1GUOA 3AU7A 1QNKA 3NTIA 4ZRZA 4IQZA 4DA2A 2EPBA 1F9PA 3VA5A 1E2VA 1KDAA 2KCNA 1STGA 2F1MA 3J7AF 2Q8TA 2JSOA 2NN6G 2RDGA 4QUFA 1VF7A 1SNDA 1PZJD 1OXUA 4H44C 3RZDB 2JP1A 4IALA 3QO2A 2I46A 2IX3A 3LWUA 3WDNA 1BDOA 1SNOA 1LTBD 3FVQA 3RUZA 5K36H 5I4DA 2F0SA 4F87A 2QEJC 5COYA 5E4WC 4DAYA 1YNJD 5J39A 1Y8OB 4K2KA 1GUGA 2PPBC 1K83B 1I4HA 1TS3A 1Q12A 3K5OA 4O1NA 2F0QA 3PUZA 3E0JA 4UDUC 5CBEE 4PV1C 3D4RA 2RDHA 4B9XA 5JEAH 1Y69U 1BOSA 4QCLA 1S5FD 4O42A 1TS4A 3MFGA 1XXGA 5I9OA 3T56B 3I4NB 2AUKA 3D6CA 2SOBA 3M7NA 4XDXA 4XXEA 2LMCB 1XX8A 2BOSA 1LT5D 5C0XG 1MGSA 4X3UA 1XTCD 1EQVA 2E2DC 2C5CA 1F2LA 3P7JA 3GTGB 3S2HB 5HGTA 1PRTB 3W3AA 1G8ZD 5KGUA 5C5LA 4RGMA 5KYLA 4KKTA 1TWAB 1SYCA 2V4DA 4LK1C 1LT4D 3CRLC 1SYGA 4WRDA 2KUMA 1UUPA 2NBFA 3NPPA 1H9MA 4J8QA 2O5JC 2X6LA 5CR3A 4TSSA 1QWYA 5DNFA 3HOXB 2N88A 4ZAIA 1BNZA 1JWMD 2H1EA 1CT1D 5IGGA 5E3FA 1TR5A 2F0TA 1I4QA 5C0XJ 2DNCA 1XWEA 2D9UA 4B08A 3BG3A 3H09A 2A6HC 2Z4HA 4AYBB 4N9PA 1SYFA 5BN4A 2L0CA 4MHEA 1DXMA 4CKCA 3TP8A 3H91A 2L12A 1B3AA 5LHY1 5IGDA 2VNUD 3SXHA 4BA2I 2F0PA 1OXSC 5K5PA 3W2DA 4P2CB 3DWPA 3P75A 3R2TA 3LNNA 3S9WA 3Q0AA 2CHBD 1I6HB 5DM63 2EJFC 2B2VA 4KMUC 3NTHA 1EL0A 1TY0A 1KLUD 1X3QA 5KEEA 4DK0A 5EPKA 2E76C 3PUVA 1GUNA 1G91A 4IUVA 4G4KA 1A3VA 2ICEC 2BCOA 5IODA 1U4LA 1XYIA 1OXTA 2WIIB 1V1PA 4IFDI 3TN2A 4KD4A 1RTOA 1TT2A 5JPNC 3A54A 2JA6B 4TQUS 5I2XA 3ONAB 2NYZD 3NWSA 4TKOB 1DD2A 3SE0A 3R2IA 2X69A 1D6EC 3HOZB 5C3XA 3KBXA 5ELDA 2B2YA 1UEAB 4XQNA 1U4PA 5A2QE 1Q90A 3QOLA 5JOBA 2QKIC 3FDTA 1JOOA 2F0VA 1B1ZA 3KLSA 4C3HG 3DMUA 3I4LA 3J81L 4KI0A 1GUSA 1LTAD 1ICWA 1U4MA 1J9OA 4J1MA 1ESRA 1A6XA 1LTID 2Z1CA 5KNBA 1CA6A 1LACA 1SNPA 2KECA 4Q5VA 1STHA 1F9QA 4EGVA 2L5TA 2KVMA 1ZXTA 5M9OA 5C4XB 1PRTC 4IURA 4RAUC 3M4OB 1NR4A 3MAQA 2F0JA 5LL6S 1VMPA 4PNYA 3S1RB 3TP6A 1O78A 2A69C 2K5WA 4MIUA 1CQFA 2JEAI 1K8OA 2JEBI 4HSPA 5IT9E 1CZWA 2FINB 2A6ED 1EFID 1WTXA 1TVXA 2PZWA 1D1IA 1B2TA 4FF4A 2F3WA 2VXWA 4H7BA 1NR2A 5C3EB 4K6DA 3QB3A 5KIXA 2J7ZA 2AQ1B 3T13A 5C3WA 4K14A 4DNRB 1PTOB 4M8AA 5EKKA 5CORA 5FO7B 1JWSD 3C1FA 5M3FB 1Y1WB 4KHZA 3GO5A 1PDQA 1SYDA 2A5HA 4BA1I 3K5LA 3HOUB 2L1BA 3DWQA 2J4XA 3ITPA 2IWHA 1Q1EA 4A3EB 4H13C 5M3MB 1E0BA 2MJ8A 1TWGB 4R8IA 4U68A 3N6RA 5E4XA 2F0HA 2F0UA 4A3KB 1TIID 2KCCA 1PLFA 3TMEA 5FOBB 5CV9A 3ZYYX 4ZKCB 4ZUJA 2K6AA 3NK9A 2B39A 1B53A 1KABA 3D4WA 4HSVA 3S15B 3HP3A 2A74C 1EYAA 1D5ZC 3QOJA 1AW7A 2F0DA 1PZID 4A93B 1CFMA 2E75C 3HS0C 4IUNA 1ET6A 1ZYRC 2FHTA 4FO2A 5IGBA 1STEA 2XWJB 2B2UC 1Z7TA 3A8JE 1CI3M 4FP5D 1Z47A 1T5EA 5FO9B 2EY5A 4CKEA 1C48A 3BDCA 3SK8A 2ZXOA 4RGTA 4A3GB 2PCFB 3S1NB 1FR3A 1MD2D 2IL8A 3R93A 1JCKB 3D6WA 1F2MA 3HGBA 1QJOA 2PNRC 2PZTA 3H3VC 1HUMA 4C3IG 5EKIA 2K01A 1PMRA 4RGNA 4FF3A 1ML0D 1EY9A 3M3YB 4H0LC 1B9NA 4CJ0B 3T53B 3VR5A 2HDMA 2D5DA 4KD3A 3OWFA 3RD4A 2K05A 4M1UB 2HCIA 2MGSA 2EVBA 2F0NA 4ID6A 2FMMA 2EJMA 4RHSA 1DONA 1BR9A 4KKUA 1QOHA 1B4OA 3K7AB 2AQ3B 3NSWA 3BDLA 3GD7A 4KHVA 1SXTA 5NUCA 4PMBA 3NTKA 3TP5A 2CW0D 2NN6H 4FYDA 2E2HB 4C1NK 3H94A 5CC4A 3M85A 1I6VC 1LTSD 1S5CD 5I9PA 1BUVT 1L0YB 3VR4A 3ERQA 3QG1A 4J6HA 4K2LA 2KA7A 3GTQB 1QE6A 1NAPA 3TBIB 3MC0B 3PUWA 2K5QA 5C4JB 5T1IA 2VB3X 3L7ZC 3T51B 1RDPD 4IN3A 3VYTA 3E5SA 2MHVA 5JAVA 1DOLA 4PMWA 1ESFA 1A2TA 3S1QB 2Q8RE 1YNND 2RBMA 3IKJA 1HFNA 2XWBB 1PTOC 4EQPA 4DF7A 3J7AV 1Y1VB 1LLRD 4CGYB 2OT2A 2BDNA 5IIFA 5EPLA 1AZQA 5CYUA 1M4VA 1JC7A 1PFBA 3OPOA 1Q3LA 5CV7A 2LY7A 2YU9B 1CHQD 1F2YA 3BDOA 2F4IA 3GV3A 4OHJA 4BY7B 1B50A 3EQLC 3MEHA 2BA0A 3RLFA 2NTTA 3PUXA 2AQ2B 4X3KA 1Z6HA 5C0XH 3M4YA 3MZ5A 1ILPA 1WCMB 2KQ3A 4C2MB 2JA8B 2MPMA 2B2WC 1CM9A 4F7XA 1DOKA 4A3JB 4BBRB 2AUJD 1ET9A 4L6TB 4OO1I 1Y8PB 2HUGA 3LWEA 1PTOF 3GTOB 1IYUA 5IGFA 1PTOD 3C2PA 1EYDA 4DK1A 1WD1A 5M5YB 2M00A 4PQXA 3SR1A 1ENFA 1SJHD 1WTOA 2XRQD 4K8IA 3S2DB 2NTSA 4KTAA 2Y0SB 1GUTA 1O80A 1G2SA 1CTMA 3EFXD 4I7ZC 5ELBA 1H9SA 3V96A 1PTOH 5C6AA 3A7AB 2XVSA 3DUZA 3HOVB 3VYRA 3J81E 2WAQB 3OMGA 4KV6A 3KLRA 1I4XA 2FJ2A 2K1BA 1R4PB 3I4MB 2F3VA 3IFDA 4GZYC 3N52A 4RCNA 5DEHA 5I2YA 2EOTA 3QIAA 2JA5B 4RWSC 2EY2A 4NP5A 2O2LD 2CQAA 3BZDB 1AP0A 1BCPF 3VR6A 3FMCA 3SVMA 4BBSB 5CGKA 1BCPD 4YIJA 2F0EA 2B8GA 4B9WA 2QILA 1F9SA 4HN7A 4R8NA 1V1PB 2ZXPA 4CHTB 4Q0FA 3WOFA 1HPCA 4OO1H 1WTVA 2EJGC 1DOMA 3A55A 3HZXA 4HEDA 4XT1B 2C9OA 5KYIA 3IFTA 3J7YW 1F9RA 1LTRD 2SDFA 1SBBB 1JORA 1SDFA 2B8FA 5EGTA 1FNWA 4K5VA 1PFNA 3NUCA 5DM73 4KKSA 1CHPD 2WP8J 1AN8A 4RKLA 4OIJA 5F2DA 3BVMA 5EKLA 5D14A 3TP7A 3OIQA 4BY1B 3NXWA 3URYA 1EQTA 2A68D 1EWHA 5JJZA 1WTPA 1ONLA 2AWNA 4L63B 1I3QB 1CK1A 1SE2A 1TWCB 4A3FB 4KY7A 1LV9A 3QWNA 4KN4C 2WINB 3CQZB 1ZEQX 1R9TB 4DU9A 1SNCA 2IT1A 2A6EC 2JE6I 3K0YA 3OMCA 2QDBA 5ELCA 2E2JB 4ZLTF 1QG7A 1Q8IA 1VDZA 2PW5A 4R9WA 2K28A 4HMJA 1VF5C 3SK6A 3C1EA 3R3OA 5C4ZA 2DN8A 4X3SA 2NVQB 4C3JG 1G2TA 2RA4A 2K33A 3GP7A 5KNDA 3RZOB 1A3TA 2PMZB 1GHJA 2JXMB 3HRZC 3DM1A 3PV0A 3P1HA 2WKCA 4DXFA 1SFOB 3MA2B 2OXPA 3D3RA 4Z9CB 1MBYA 1SAPA 1JICA 5JPMC 1F2ZA 3KF8A 2DY7A 4K6LA 3HKZB 1HQRD 4JK1C 1SE3A 1NCVA 4DAVA 3I72A 4N9TA 3SEBA 2ENBA 2MUYA 4OL7A 2O5IC 1SJED 5J22A 1BO0A 2B2VC 4TRDA 4KN7C 2X6GA 3WOEA 4FF1A 2Z8LA 1OXVA 3NHHA 4IUTA 4A3DB 2I07B 4OGQC 1HXYD 3PIP3 4KJOA 5DAUA 4KY6A 1SYBA 4FF2A 2SNSA 4RFBA 3MFYA 1DZ1A 2VB2X 1EZ8A 4XT3B 4IUUA 5A35A 1D5MC 1KDCA 1Y8NB 4HAEA 2KJXA 2NZ1D 2YYZA 4IFDG 3SK4A 2LKVA 4A3BB 3R8BA 1BXTA 3NBHA 1GHKA 2EYMA 4IUPA 3X3MA 1C4QA 1UNSA 3Q6SA 4NKLA 1DJRD 1RF2D 3NE5B 2BE5D 4EQOA 1TKWB 1AEXA 2NN6I 1LT3D 1IKLA 2L11A 2IW3A 5T1GA 3VR3A 2B2YC 1S4ZA 1TU2B 1L0XB 4CJ1B 4QF4A 3EROA 1BCPB 3S14B 4DXGA 4ABNA 1W6KA 2NVXB 3GQBA 3L3OC 5KRUA 2WKDA 1JOQA 3O13A 2JYOA 2MP1A 2SNMA 5C5MA 2RQXA 4IFDJ 4RHRA 4WJWA 1HCZA 2CW0C 5CBAE 3Q24A 3FPUB 4QUCA 2F0MA 4FXDA 1CQVA 1IW7C 5EBCA 2EYOA 2QF7A 4MN3A 2AWOA 3ND8A 1O7LA 1TS5A 2B2TA 3OOCA 2HDLA 3C3LA 1RJTA 2RVLA 3QJYA 3OIPA 3J80E 5ELEA 1M8AA 1TQOA 3IL8A 2FMCA 1EOTA 1C8CA 3KBGA 4XTCS 3P20A 1T5XD 3TSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KEE A;  5NUC A;  4PMB A;  5C5L A;  3SK6 A;  1KAB A;  3C1E A;  3D4W A;  1EY6 A;  3R3O A;  1EY4 A;  5J1Z A;  3TP5 A;  5C4Z A;  4IAL A;  5E1F A;  5M9O A;  5KYL A;  2F0G A;  1EYA A;  3HZX A;  5IGF A;  3QOJ A;  1II3 A;  2EXZ A;  2F0J A;  1SYC A;  2F0D A;  3NQT A;  3MHB A;  4K5X A;  1STB A;  2O4X A;  4PNY A;  5CC4 A;  2EYM A;  5CV5 A;  2PW7 A;  3MVV A;  3PMF A;  1IHZ A;  1SYG A;  3TP6 A;  5KYI A;  4WRD A;  2EYP A;  1ENA A;  1SNO A;  4MIU A;  4IUN A;  1A3T A;  5I9P A;  1EYD A;  3NP8 A;  3ERQ A;  1A3V A;  2EYF A;  1STN A;  4J6H A;  4IZ8 A;  2RKS A;  4NKL A;  4K2L A;  5IOD A;  1EY7 A;  2M00 A;  5IGB A;  3P1H A;  5IGC A;  2EYJ A;  3SR1 A;  4RKB A;  5CR3 A;  3RUZ A;  2PZW A;  4EQO A;  4QMG A;  1AEX A;  4E6I A;  2OXP A;  1EY5 A;  5KGU A;  1JOR A;  2F3W A;  3MXP A;  1EY0 A;  2F0S A;  3LX0 A;  4H7B A;  2F0L A;  2OF1 A;  5CV8 A;  5EGT A;  4PMC A;  4K8I A;  4K5V A;  4KTA A;  4KD4 A;  4K6D A;  5J39 A;  2EY5 A;  3E5S A;  3NUC A;  4LAA A;  1TT2 A;  3QB3 A;  3BDC A;  1A2U A;  4K2K A;  5IGG A;  5E3F A;  1F2Z A;  1TR5 A;  1NUC A;  3SK8 A;  2F0K A;  2NUC A;  5IOC A;  5JAV A;  2F0T A;  2WAC A;  5KIX A;  1A2T A;  3T13 A;  3U9O A;  5C3W A;  4ZQ3 A;  4K14 A;  4QF4 A;  4RKL A;  4S3S A;  3ERO A;  2KHS A;  1STA A;  2EY6 A;  3EVQ A;  5EKK A;  5C4H A;  2RBM A;  1A3U A;  2F0Q A;  4KJN A;  5C6A A;  1KDB A;  3C1F A;  5F2D A;  4N9T A;  3H6M A;  3D8G A;  4DGZ A;  4EQP A;  2EY1 A;  5KRU A;  3SK5 A;  1JOK A;  5EKL A;  4DF7 A;  2ENB A;  3TP7 A;  1U9R A;  4NDX A;  4ZUI A;  3NXW A;  1F2M A;  4OL7 A;  3T16 A;  1JOQ A;  1SYD A;  5C3X A;  5ISR A;  4K5W A;  4ODG A;  4N9P A;  2SNM A;  5C5M A;  2PZT A;  3OMG A;  5J22 A;  4B9X A;  4K8J A;  1EZ6 A;  1SNM A;  4KV6 A;  5IIF A;  1STY A;  3ITP A;  1SYF A;  3QOL A;  4TRD A;  5CV7 A;  5JOB A;  4HTH A;  2F3V A;  1JOO A;  2F0V A;  3TP8 A;  2RDF A;  3OSO A;  3SHL A;  4DFA A;  5IGD A;  4NMZ A;  2F0M A;  1EY9 A;  5DEH A;  1F2Y A;  4QB4 A;  3SXH A;  3NHH A;  5I9O A;  3EJI A;  2F0P A;  3HEJ A;  3DMU A;  1ENC A;  1EYC A;  4KY5 A;  4ME5 A;  3D6C A;  2SOB A;  5K5P A;  1SYE A;  2EYO A;  4KJO A;  2EY2 A;  2F0H A;  3P75 A;  4KY7 A;  4NP5 A;  1NSN S;  5DAU A;  4KY6 A;  4I65 A;  4EQN A;  2F0U A;  3D4D A;  4WOR A;  1KAA A;  3S9W A;  1RKN A;  4F7X A;  4KD3 A;  3MEH A;  3OWF A;  1SYB A;  4HMI A;  1EY8 A;  2EYH A;  4DU9 A;  1EQV A;  4KHV A;  2OEO A;  1SNC A;  2PQE A;  4J1M A;  3TME A;  3V2T A;  2SNS A;  5CGK A;  2F0I A;  2F0O A;  5IGE A;  4YIJ A;  2F0E A;  5CV4 A;  1EZ8 A;  2HQE A;  3OMC A;  5CV9 A;  3VA5 A;  4B9W A;  2EYL A;  1KDA A;  3MZ5 A;  3SK4 A;  2PYK A;  2F0N A;  1KDC A;  2QDB A;  4ID6 A;  2LKV A;  1TQO A;  1STG A;  2KQ3 A;  5I6W A;  5HGT A;  1SNQ A;  2F0W A;  3DHQ A;  4HMJ A;  4F8M A;  1SNP A;  2F0F A;  5CV6 A;  4R8N A;  1STH A;  4ZUJ A;  5HUR A;  4EVO A;  2PW5 A;  5I6Y A;  3BDL A;  1SND A;  3NK9 A;  4G57 A;  2PZU A; 
#chains in the Genus database with same CATH topology
 1VQL A;  3PIO 3;  1I94 L;  2H4O A;  3CC7 A;  2A73 B;  4C3H B;  1YNN C;  1SEB D;  2F0G A;  3KDF B;  2JA7 G;  2LS0 1;  3EBE A;  3NQI A;  3NQT A;  5C0X I;  1XNR Q;  4HCE A;  2PQA B;  1HHV A;  3OHX C;  4V0B A;  2K04 A;  1PH6 A;  1IHZ A;  2EYP A;  1ENA A;  1MJC A;  3DXJ C;  3NP8 A;  4RH6 A;  2EYF A;  4CDE C;  3PO3 H;  3J80 c;  1VQ8 A;  3KOJ A;  2B63 G;  3PQI A;  4GN5 A;  4BWG B;  2M9V A;  2QW7 A;  4LFC Q;  2MO0 A;  2R93 H;  2WV6 D;  4NW2 A;  2HHH Q;  2TMP A;  4IJH A;  1PH2 A;  1V43 A;  5IYC G;  3S16 B;  3KF6 A;  1KXL A;  1QUQ B;  1IW7 D;  3J81 i;  4GS3 A;  3NEN A;  1K0R A;  3KUP A;  4FXG C;  2R7Z B;  4WFN 3;  2NVT B;  2RCN A;  1FVI A;  2ZT9 C;  1ILQ A;  4FXK C;  5C4H A;  1D1K A;  3BYT B;  4BY1 H;  1N32 Q;  1JWU D;  1SMY D;  3BS1 A;  1D2B A;  5H1S E;  2UUB Q;  3PF4 A;  3BVG A;  2NZH A;  2IY5 B;  2ZJP A;  1OXX K;  1SNM A;  1WYD A;  1VQM A;  3S1M B;  4K0K Q;  1X65 A;  1IYV A;  3KDF A;  2D2C C;  2I5H A;  4LFA Q;  1KNE A;  2PQA A;  3I4O A;  2UXC Q;  2K03 A;  2LXK A;  1FD7 D;  4CJ2 C;  1WTQ A;  1U4R A;  4QY7 A;  1G6Z A;  4JI6 L;  3GTK B;  1E1T A;  1O7I A;  2KBN A;  3E6Z X;  1E2W A;  4FDB A;  1HNX Q;  1IL2 A;  4GKJ Q;  4P74 A;  4ILW A;  4A3M B;  1PH8 A;  1R9T H;  4LMQ D;  2PI2 A;  1KRS A;  4IO9 A;  1W6J A;  1KHI A;  1VS0 A;  1KNA A;  1TY2 A;  3CKI B;  1QUQ A;  4R4I A;  3K58 A;  2E2J H;  4ZYS A;  4DR4 L;  1K8M A;  4UPA A;  3CCJ A;  2IX1 A;  5I6Y A;  2AHO B;  4LJZ C;  1EIF A;  2JA6 G;  3I70 A;  5E1F A;  3F2U A;  1S5E D;  1LUZ A;  4B3T L;  2IPK D;  5M5W B;  1RD9 D;  2XNA C;  1H9S B;  4FVM A;  1EU4 A;  2GVA A;  3PMF A;  1PZK D;  3MVV A;  4DR2 Q;  3VR2 A;  5ELF A;  2I0Q A;  4LF7 L;  5K36 G;  3RZO H;  1IBK Q;  3FP9 A;  2RKS A;  2F3I A;  4MNO A;  4RA8 A;  4UP9 A;  1AFP A;  1B9M A;  3G6J B;  3UI2 A;  4E6I A;  2BDO A;  3MXP A;  4U67 3;  3J80 L;  1FYC A;  2B2T C;  4PMC A;  4IPD A;  3W1G A;  4XQQ A;  3AQQ A;  2GA4 B;  4F88 A;  1FJG Q;  1VQ6 A;  3GTJ H;  3PF5 A;  1JB3 A;  1AZP A;  4ME3 A;  2KED A;  3Q8D A;  1XPR A;  1QZG A;  3G7L A;  3BVZ A;  2KEN A;  4HIO A;  5IY0 A;  1KDB A;  2ID0 A;  1BCP C;  4JI1 Q;  5JEA G;  3SK5 A;  3DEP A;  3M7G A;  1SRO A;  3JAM L;  3T16 A;  1MSH A;  1BQQ T;  4ODG A;  1ICF B;  1EZ6 A;  1STY A;  2K5D A;  1H9R A;  1TWH B;  4UP8 A;  1RHP A;  4DK6 C;  5C4X G;  4OIK A;  1LTT D;  3I3C A;  2IX0 A;  4A3D H;  4ME5 A;  1M1K C;  5G3L F;  3J81 j;  5JVG 3;  1JB7 A;  1RKN A;  4QGU A;  3OW2 A;  2UXB Q;  4HMI A;  3X3N A;  1PXU A;  1EY8 A;  1A15 A;  3H0G B;  5G3L D;  1EU3 A;  1WTW A;  2PQE A;  4PZ7 A;  3A8I E;  1VCI A;  3U50 C;  3VYU A;  2NB0 A;  2F0O A;  5CV4 A;  2HQE A;  1PFM A;  1I4G A;  4KHP L;  2EYL A;  3TEH B;  2F4V Q;  4DKA C;  2VQF L;  2F0W A;  1LAB A;  1HQM C;  4C3I B;  1GJX A;  5C3E G;  2J0T D;  2E74 C;  3CPW A;  4DV4 L;  2YTX A;  4YCW A;  3GTP B;  1XMO Q;  2R92 H;  4G7O C;  4A3B H;  4Y7N B;  2Q8I B;  4JI2 Q;  4XQJ A;  2DY8 A;  4XYQ A;  1A62 A;  5IE8 A;  2RSN A;  2O4X A;  4GLA C;  5JEA J;  2ICI A;  2WB1 G;  1SR3 A;  3MWY W;  2DJF C;  4NXM L;  4DAP A;  5FLX E;  2JA7 B;  1Y1W G;  1MSG A;  5FLM G;  5FO8 B;  1NMG A;  3ND9 A;  1X32 A;  1J8I A;  4L5Q A;  2A68 C;  3HOU G;  5J3B A;  3MTS A;  4L5R C;  4RKB A;  2FFK B;  1DM0 B;  4A3E G;  5M3M G;  3VYS A;  1BBX C;  3K8A A;  3LX0 A;  2F03 A;  2F0L A;  1YHA A;  3K5N A;  3F2C A;  2B63 B;  2R3Z A;  4LAA A;  5BN5 A;  2XIW A;  2L55 A;  4JC0 A;  1NUC A;  5IOC A;  2IHF A;  5EPJ A;  1GUW A;  1WVL A;  2KHS A;  2RSO A;  2OQK A;  4A3K G;  3PO3 B;  1Q7Y C;  3BYY B;  5IP9 H;  2K75 A;  2LXJ A;  1PYS B;  5FLX c;  4DGZ A;  4CBV A;  1AE2 A;  1X6O A;  2NVX H;  3A0J A;  1GOZ A;  2HIV A;  5LMN W;  1O7Y A;  2XSC A;  5FKA C;  5D3D A;  4ZUI A;  2R93 B;  5KNC A;  4JV5 Q;  2M2L A;  1V1O A;  4WJ4 A;  1IL8 A;  3I55 A;  3IAY A;  2KOL A;  4RGO S;  2K5H A;  2K32 A;  1SLJ A;  4HTH A;  1HUN A;  2R6G A;  3K59 A;  1R4Q B;  3OYY A;  3OSO A;  1N36 L;  4EQ5 A;  5BN3 A;  2OTL A;  4DFA A;  5C44 B;  4DV0 L;  4OO1 G;  2NVY H;  4YWL A;  4RCO A;  2AKW B;  4OEL B;  1EYC A;  4KY5 A;  4JYA Q;  4A93 G;  1HA5 A;  4BS9 A;  1DYQ A;  1C0A A;  3KK7 A;  3E9H A;  3TS2 A;  1E2Z A;  1E1O A;  2EYH A;  3PGZ A;  1V1Q A;  5FK9 C;  1I4R A;  2OEO A;  1VQ4 A;  3V2T A;  4C1N I;  1LTG D;  3AFQ A;  2IJ0 A;  5TSS A;  2PYK A;  1CZG A;  3A5U A;  1IBM L;  1BVS A;  2A6H D;  3TDQ A;  5I6W A;  1SNQ A;  4LUV A;  3DHQ A;  1PYW D;  3CHB D;  4B3S L;  4HCS A;  5JVH 3;  4ZK9 B;  4KLK A;  3L2P A;  4G57 A;  2UU9 Q;  3MXN A;  5EQ0 A;  4C3H H;  4A3L H;  1H9K A;  4JOI C;  4A3G G;  1GD7 A;  2N3S A;  2EXZ A;  1WD0 A;  4K5X A;  1STB A;  3A56 A;  5ELN A;  3K57 A;  4HJA A;  5CV5 A;  2E2I B;  2PW7 A;  5EJW A;  1WFQ A;  4L8J A;  1WTR A;  1EQR A;  2Q2I A;  3I8Z A;  1E22 A;  4QIW B;  3GTM B;  4C3J H;  3V05 A;  4CKB A;  1IYJ B;  2B29 A;  4ZKB B;  4DN4 M;  4GKK L;  1JR0 D;  1KLG D;  1JQY D;  1KAW A;  1XJV A;  4QMG A;  3HOW G;  1EY0 A;  1FGB D;  2LFN A;  3E3X A;  3U9S A;  1J5E Q;  1TS2 A;  4N8X 1;  3S16 H;  3TZU A;  1LT6 D;  4IUQ A;  3D31 A;  2FXQ A;  2F0K A;  2NUC A;  5IWA L;  1D7Q A;  3U9O A;  4S3S A;  2PO4 A;  1D5X C;  3I91 A;  1STA A;  2R7Z H;  1A3U A;  4B3M Q;  1HZA A;  1QVG A;  4DR6 Q;  2EDG A;  3D8G A;  2B2U A;  2EY1 A;  3C46 A;  3I7F A;  5IYD H;  1U9R A;  1EIG A;  3DEO A;  4NDX A;  3T4A C;  5CMD A;  5LL6 X;  5ISR A;  4AH6 A;  4FNF A;  1EEI D;  2N55 A;  5FLX L;  1HNW L;  1BF4 A;  3FEW X;  4ULL A;  4R4Q A;  3GTJ B;  1LTL A;  1H95 A;  2VW9 A;  4A3I B;  3GV6 A;  1K28 A;  3KLS X;  1MHW C;  3SHL A;  1RCV D;  4DNT B;  1XNQ L;  5IP7 G;  4IPC A;  3TQY A;  3A7L A;  3RLN A;  4DR5 Q;  1SYE A;  1QVF A;  1NSN S;  2IHE A;  3AB9 A;  3D4D A;  4WOR A;  1WTH A;  1D8L A;  1F77 A;  3NBH B;  5AJ3 L;  1HR0 L;  4A3M H;  1YEZ A;  2XRS D;  1Q1B A;  4DR7 L;  2QCP X;  1Z9F A;  1K73 C;  1GXD C;  1KTK A;  2BE5 C;  2OQ0 A;  1HTP A;  4GNX B;  2KEE A;  1SSO A;  4XYO A;  4F8M A;  3SGI A;  1QCB D;  1SE4 A;  2XN9 C;  2HCC A;  1QVC A;  3NBI A;  1LO5 D;  3CCU A;  3PO2 B;  3FPP A;  2L15 A;  4CDC C;  4IFD H;  1EWC A;  4V19 0;  5M5X B;  1KRT A;  1CA5 A;  1QIL A;  4LF9 Q;  3CP0 A;  4UAI A;  1N8R C;  1EIH A;  4LFB L;  2E5L L;  2DUD A;  4X64 L;  4X65 L;  4JW0 A;  2D62 A;  1B3Q A;  2HQL A;  2TSS A;  2Y0S E;  3OTO L;  1STN A;  2BA1 A;  4IZ8 A;  2EE1 A;  2WB1 B;  3T1H L;  5IGC A;  5EBD A;  1L2F A;  4BXX G;  1EY5 A;  2R92 B;  2OF1 A;  4QQB X;  1PRT F;  3HOY B;  1I50 B;  1Q8K A;  1T9H A;  5IYB H;  1A2U A;  1JE5 A;  1I4P A;  2CVR A;  4MTN A;  2VUM B;  4MZ9 A;  1PRT D;  3K80 C;  4LUZ A;  3L9A X;  1S5B D;  2WAQ E;  3EVQ A;  4J15 A;  3I4N H;  1IBL L;  1IKM A;  4KJN A;  1PH7 A;  4GNX A;  1QB5 D;  1JOK A;  1SN8 A;  2ZM6 Q;  4G7Z C;  2A69 D;  4IOC A;  1KL9 A;  5LMN Q;  2UUC Q;  4K5W A;  2RHS B;  4KK7 A;  3Q23 A;  4K8J A;  3CME A;  1PV4 A;  1OO9 B;  2K14 A;  2JA8 G;  1A0I A;  2GVB A;  3SDZ A;  2N49 A;  3DWA A;  1X3E A;  4OWX B;  1VQA A;  4BBR G;  4A3J G;  3GTG H;  1NY4 A;  1TWH H;  1PHJ A;  4POG A;  4NMZ A;  1K9M C;  3RLO A;  1UAP A;  3EJI A;  4JI5 Q;  1ENC A;  3EA6 A;  3FRP B;  1JE4 A;  3OWE B;  2R61 A;  3PSI A;  1PFS A;  4I65 A;  4EQN A;  5A2Q L;  3Q22 A;  1HRJ A;  1KAA A;  1X9N A;  1EOV A;  2K7V A;  2ZTC A;  1RL2 A;  4JBW A;  3UDF A;  3KJO A;  3K6O A;  1EEF D;  3CRK C;  2F0I A;  5IGE A;  4A3C G;  1DCZ A;  2YV5 A;  3MXG A;  4YCV A;  1VMC A;  3K5M A;  1UEB A;  1XPO A;  2F0F A;  4G7H C;  3RMH A;  5CV6 A;  2NVY B;  3K81 C;  4C3I H;  3OW7 A;  2RF4 A;  5HUR A;  2Y0S G;  4EVO A;  1G29 1;  1TWF B;  1RTN A;  2PZU A;  3U4V A;  1L1O B;  3K7U C;  3BJU A;  1H9J A;  4LF4 L;  1EY6 A;  2Z4I A;  1EY4 A;  5J1Z A;  3MXU A;  4JI8 Q;  3I56 A;  3KF6 B;  4JI7 L;  4Y7N H;  2L4N A;  4JPB W;  1EWI A;  1HTL D;  3KYH C;  1FNV A;  3S17 B;  1L0W A;  1II3 A;  3MHB A;  3CCR A;  1X3P A;  2DNE A;  1HFG A;  3BZC A;  3HG9 A;  4C56 C;  1VQB A;  1N9W A;  1SMY C;  2JA7 H;  4NXN L;  3FKI B;  3HOV G;  2EZV A;  1EY7 A;  1V8Q A;  2WAQ G;  5AFW A;  1P8L A;  2B2W A;  2EYJ A;  1EIY B;  1VQG A;  3VA7 A;  1JJC B;  1MI2 A;  4APV A;  3AMU A;  3A8K E;  3PUY A;  5CV8 A;  2NWG A;  3TZD A;  2K5V A;  4HJ7 A;  2XGT A;  2B63 H;  2UUA Q;  3KFU A;  1HA6 A;  2JA5 G;  3HOW B;  3JAM E;  5IT9 L;  3CU7 A;  3GTL B;  2WAC A;  2JQO A;  4ZQ3 A;  2G9H D;  4LF8 Q;  3I73 A;  1QNU A;  3I90 A;  4C3J B;  2Q2T A;  2EY6 A;  1S5D D;  2B3G A;  5IYC H;  4CDF C;  3G6E A;  4AYB G;  1M90 C;  2ZXR A;  4BBS G;  3UDG A;  2L9H A;  3H6M A;  5D3I B;  4HR7 B;  1S72 A;  2PNH A;  1VQK A;  1VQD A;  4XIG S;  1ZYR D;  1I6H H;  1L1O A;  3QR8 A;  1ZKO A;  1FNU A;  1O7Z A;  3NWT A;  2RDF A;  4X3T A;  1YNJ C;  1CUK A;  4QB4 A;  3JAM c;  5C44 H;  5D65 A;  4LF5 Q;  1ROD A;  2SEB D;  3HEJ A;  1B44 D;  2CH4 W;  4DAY B;  4IOA A;  2C35 B;  5LMU Q;  4QIW E;  2G9D A;  4DV5 L;  2ATW A;  1GUO A;  3AU7 A;  1QNK A;  3NTI A;  4ZRZ A;  2ZTE A;  4DR3 L;  4IQZ A;  4DA2 A;  2EPB A;  1F9P A;  3VA5 A;  1E2V A;  1KDA A;  4DV1 L;  2KCN A;  1STG A;  3CCL A;  2F1M A;  3J7A F;  2CWP A;  2Q8T A;  2JSO A;  2N8N A;  2NN6 G;  1N34 L;  4GNX C;  2RDG A;  4QUF A;  1E24 A;  1W3S A;  1VF7 A;  1SND A;  1PZJ D;  1OXU A;  4H44 C;  3RZD B;  4OWW B;  4JBJ A;  2JP1 A;  2PMZ E;  4IAL A;  3QO2 A;  4GOP B;  3RN5 A;  2I46 A;  1BKB A;  2IX3 A;  1XMQ Q;  3J7A 5;  3LWU A;  3F2B A;  4DV2 L;  2JA6 H;  3WDN A;  2E2I H;  4LNQ A;  4BY1 G;  1BDO A;  1SNO A;  1X56 A;  2MFI A;  3AYH B;  4DUZ L;  3GTM H;  4WJ3 M;  1LTB D;  3FVQ A;  3RUZ A;  4OX9 Q;  1DGS A;  5K36 H;  2CCZ A;  1X54 A;  5I4D A;  3HKZ E;  4HIM A;  2F0S A;  4F87 A;  2UXD Q;  2P5Z X;  2QEJ C;  5COY A;  5E4W C;  1HNZ Q;  4DAY A;  1YNJ D;  5J39 A;  2Z6K A;  5BR8 L;  1EQQ A;  4JI0 L;  1Y8O B;  4K2K A;  1GUG A;  1GO3 E;  2PPB C;  4A3F G;  1K83 B;  2MO1 A;  1I4H A;  2V1C C;  1TS3 A;  1Q12 A;  3K5O A;  2R7D A;  4O1N A;  4O2D A;  3J7Z C;  3HOZ G;  4P73 A;  2F0Q A;  3ULP A;  3PUZ A;  2CWA A;  2ASB A;  2Q2U A;  3E0J A;  4UDU C;  1PA6 A;  2ES2 A;  5CBE E;  1K3R A;  4PV1 C;  3D4R A;  2RDH A;  4B9X A;  2VL6 A;  4OON A;  5JEA H;  1VQP A;  1Y69 U;  1BOS A;  4GOP A;  4QCL A;  1S5F D;  4O42 A;  3NEL A;  1TS4 A;  3MFG A;  4A3I H;  1CKN A;  1XXG A;  4YHH L;  5I9O A;  5ELO A;  3T56 B;  3I4N B;  2AUK A;  3D6C A;  2SOB A;  3M7N A;  4XDX A;  4XXE A;  2LMC B;  1XX8 A;  5C4X H;  2BOS A;  1LT5 D;  3JC6 6;  5C0X G;  4JI4 L;  1MGS A;  4X3U A;  1SE8 A;  1XTC D;  1EQV A;  4ZCK A;  3HKS A;  1I94 Q;  1HZC A;  2I5M X;  2E2D C;  2C5C A;  1F2L A;  3P7J A;  3GTG B;  3S2H B;  1XTD A;  5HGT A;  2H5X A;  1EYG A;  4UHV A;  3RN2 A;  1PRT B;  3W3A A;  1G8Z D;  1EUJ A;  2OCE A;  4LF6 L;  5KGU A;  5C5L A;  3TRE A;  4RGM A;  1K0S A;  3PO2 H;  2F52 A;  5KYL A;  3ER0 A;  1L1O C;  3HKZ G;  4KKT A;  4EX5 A;  1YJW A;  1TWA B;  5M5X H;  1SYC A;  1VQO A;  1VQ9 A;  2V4D A;  4LK1 C;  1LT4 D;  3CRL C;  1SYG A;  4WRD A;  2KUM A;  1UUP A;  1E3P A;  4JI3 L;  2NBF A;  1IXR A;  3NPP A;  1H9M A;  4DUY L;  4J8Q A;  2O5J C;  2X6L A;  5CR3 A;  4TSS A;  1QWY A;  5DNF A;  5FLM H;  3A5Z B;  2N88 A;  4ZAI A;  1BNZ A;  3HOX B;  2K50 A;  1N33 L;  1JWM D;  2H1E A;  3HOU H;  3HOY H;  1I50 H;  1CT1 D;  2LSS A;  2YTY A;  5IGG A;  5E3F A;  1TR5 A;  5M3M H;  3CCM A;  2F0T A;  2VUM H;  1I4Q A;  5C0X J;  2DNC A;  5M3F G;  3A74 A;  3CW2 C;  4QL5 A;  1XWE A;  4PZ8 A;  2D9U A;  2A1A A;  4B08 A;  3BG3 A;  2EQS A;  3H09 A;  2A6H C;  2Z4H A;  4AQY L;  4AYB B;  4N9P A;  2BH2 A;  4JI6 Q;  1SYF A;  5BN4 A;  3J81 c;  2L0C A;  4MHE A;  1DXM A;  4CKC A;  3TP8 A;  3H91 A;  2L12 A;  4LUO A;  1B3A A;  5LHY 1;  5IGD A;  2CFM A;  2VNU D;  3SXH A;  3MXN B;  4BA2 I;  2F0P A;  1JJG A;  1OXS C;  5K5P A;  3W2D A;  4YY3 L;  4NB3 A;  4P2C B;  3DWP A;  3P75 A;  3R2T A;  3LNN A;  3S9W A;  4DR4 Q;  1K8A C;  3Q0A A;  2CHB D;  1I6H B;  5DM6 3;  2EJF C;  2B2V A;  4A93 H;  4KMU C;  3NTH A;  3M4P A;  2KHJ A;  2QEX A;  4B3T Q;  4DNI A;  1EL0 A;  1TY0 A;  1KLU D;  3CCE A;  1X3Q A;  4LF7 Q;  5GAG C;  1TWF H;  5KEE A;  4DK0 A;  5EPK A;  1WOC A;  2E76 C;  1CKO A;  2WFW A;  4YWK A;  3RR5 A;  3PUV A;  1GUN A;  3S17 H;  3UDX A;  3CCS A;  4GOP C;  3PIP A;  2JA9 A;  1G91 A;  4IUV A;  4G4K A;  4A3G H;  5GAE C;  1A3V A;  2ICE C;  3FKI H;  2BCO A;  5IOD A;  1U4L A;  2CH4 A;  3I2Z A;  1XYI A;  1OXT A;  2HIX A;  2WII B;  3STB D;  1V1P A;  4IFD I;  4LW1 A;  3TN2 A;  1E7Z A;  4P71 A;  4KD4 A;  1RTO A;  2ZJQ A;  1TT2 A;  5JPN C;  3G71 A;  2VZA A;  1YHQ A;  3A54 A;  1IZ6 A;  3HOW H;  1JJ2 A;  2JA6 B;  4B3R L;  3D0F A;  3GTL H;  1YZ6 A;  4TQU S;  3RNU A;  1SRU A;  5I2X A;  4LWC A;  3ONA B;  3M3Y H;  2NYZ D;  3NWS A;  4DV7 L;  1P16 A;  4DR1 L;  4TKO B;  1DD2 A;  3SE0 A;  3R2I A;  2X69 A;  1D6E C;  4R4T A;  5C3X A;  3KBX A;  3HOZ B;  1AH9 A;  5ELD A;  2B2Y A;  1UEA B;  4XQN A;  1U4P A;  4DV3 L;  1HR0 W;  4TVA B;  5A2Q E;  1Q90 A;  3QOL A;  3IRB A;  2QKI C;  3FDT A;  5JOB A;  1JOO A;  2F0V A;  2RCF A;  1B1Z A;  2YTV A;  4X62 L;  3KLS A;  1U5K A;  4C3H G;  1NJI C;  4A3L G;  3DMU A;  4KHP Q;  3I4L A;  2NZO A;  3J81 L;  2QGQ A;  1C7Y A;  4KI0 A;  2VQF Q;  2QA4 A;  1GUS A;  1LTA D;  1ICW A;  2OWO A;  1U4M A;  5IP7 H;  2CQO A;  1J9O A;  4J1M A;  4DV4 Q;  1ESR A;  3LGJ A;  1VQF A;  1A6X A;  1LTI D;  2Z1C A;  3EIV A;  5KNB A;  2G5D A;  3CMA A;  1LM0 A;  3CXC A;  1CA6 A;  3F8T A;  1LAC A;  1VQ5 A;  1SNP A;  3J80 i;  2KEC A;  2KCT A;  4Q5V A;  1STH A;  1F9Q A;  4HJ5 A;  4NXM Q;  4EGV A;  4HID A;  2L5T A;  2KVM A;  2A8V A;  3RZD H;  1ZXT A;  5M9O A;  5C4X B;  1PRT C;  4DV6 L;  3CC4 A;  4IUR A;  5DLQ E;  4RAU C;  3BZK A;  4X66 L;  3M4O B;  1NR4 A;  2R7Z G;  1A63 A;  3MAQ A;  2F0J A;  1RIP A;  4DK3 C;  5LL6 S;  1VMP A;  3T1Y L;  4PNY A;  1NNX A;  1YVC A;  3S1R B;  3TP6 A;  1O78 A;  2VQE L;  2A69 C;  3S1Q H;  2K5W A;  4MIU A;  1CQF A;  3JAM i;  4L5T A;  2JEA I;  1K8O A;  1VQ7 A;  2JEB I;  4O0A A;  4HSP A;  5IT9 E;  3H15 A;  1CZW A;  2FIN B;  3ICE A;  2A6E D;  1EFI D;  1WTX A;  1TVX A;  2PZW A;  1XNR L;  1D1I A;  1B2T A;  4FF4 A;  2F3W A;  2VXW A;  4H7B A;  4P75 A;  1NR2 A;  5C3E B;  4K6D A;  2ZJR A;  3QB3 A;  4BXX H;  3PIO A;  5KIX A;  2J7Z A;  2AQ1 B;  1K83 H;  3T13 A;  5C3W A;  2KHI A;  4K14 A;  4A4I A;  4DNR B;  1PTO B;  1EFW A;  4LFC L;  2YU9 H;  1Y1V G;  1KQS A;  2ZTD A;  4M8A A;  5EKK A;  5COR A;  5FO7 B;  2HHH L;  4PG3 A;  1JWS D;  3C1F A;  3DLL A;  5FJ8 G;  5M3F B;  1N36 Q;  1Y1W B;  4KHZ A;  3GO5 A;  4DV0 Q;  1PDQ A;  1SYD A;  5IT9 c;  2A5H A;  4BA1 I;  2AMC B;  4I7A A;  3E9I A;  3K5L A;  3HOU B;  5EAY A;  2L1B A;  3DWQ A;  2J4X A;  3ITP A;  2IWH A;  1Q1E A;  4A3E B;  4H13 C;  5M3M B;  1VQH A;  2DJG C;  1E0B A;  4BY7 G;  2MJ8 A;  4YWM A;  4NPS A;  1TWG B;  1N32 L;  4R8I A;  4U68 A;  3N6R A;  2JA8 H;  5E4X A;  2UUB L;  4OWT B;  1YHB A;  5GQO A;  4BBR H;  1IBM Q;  2F0H A;  2F0U A;  3EN2 A;  4K0K L;  1PH9 A;  1WI5 A;  4A3K B;  4B3S Q;  1WCM G;  1TII D;  5GAD C;  2KCC A;  4POF A;  4LFA L;  1PLF A;  3TME A;  5FOB B;  2UXC L;  5CV9 A;  3S2H H;  3ZYY X;  1HNX L;  4GKJ L;  4ZKC B;  4ZUJ A;  5M5Y H;  4A3C H;  2K6A A;  3NK9 A;  2B39 A;  1B53 A;  1KAB A;  3D4W A;  3DM3 A;  4HSV A;  3S15 B;  3HP3 A;  4GKK Q;  2VY3 A;  2A74 C;  3S2D H;  1EYA A;  1D5Z C;  3QOJ A;  1TWA H;  1AW7 A;  3FHW A;  2F0D A;  1PZI D;  3BU2 A;  4A93 B;  1XPU A;  1A8V A;  1CFM A;  1SMX A;  1MIU A;  2E75 C;  3HS0 C;  4IPH A;  4IUN A;  1ET6 A;  1ZYR C;  2FHT A;  4FO2 A;  2JK8 A;  5IGB A;  1STE A;  2XWJ B;  2B2U C;  1Z7T A;  5IWA Q;  3A8J E;  1G6P A;  1CI3 M;  4FP5 D;  3HOX H;  3HOV H;  4DR2 L;  1Z47 A;  1X3G A;  1T5E A;  1IBK L;  5FO9 B;  2EY5 A;  1V9P A;  2HD3 A;  1UE1 A;  4CKE A;  1C48 A;  3BDC A;  3CC2 A;  3SK8 A;  2ZXO A;  5JJI A;  4RGT A;  4A3G B;  1HNW Q;  2PCF B;  3S1N B;  1FGU A;  3H0G G;  1FR3 A;  4X6A H;  3CCQ A;  1MD2 D;  2A19 A;  2IL8 A;  3R93 A;  1FJG L;  1JCK B;  3D6W A;  1F2M A;  3I4M G;  3HGB A;  1XNQ Q;  1QJO A;  4JCV E;  1JMC A;  4BBS H;  2PNR C;  2PZT A;  3H3V C;  1HUM A;  4C3I G;  1LYL A;  5EKI A;  3M4Q A;  3TS0 A;  4A75 A;  3WWV A;  1HR0 Q;  5AJ3 Q;  2K01 A;  1YNX A;  1KD1 C;  1PMR A;  4JI1 L;  1Q86 C;  4RGN A;  4FF3 A;  1ML0 D;  4DR7 Q;  1EY9 A;  1K8G A;  3M3Y B;  4H0L C;  1B9N A;  3KJP A;  4CJ0 B;  1Y14 B;  2K4K A;  4HJ8 A;  3T53 B;  3VR5 A;  2HDM A;  4RG1 A;  1KIX A;  2D5D A;  4KD3 A;  3OWF A;  3RD4 A;  2K05 A;  4M1U B;  2HCI A;  2MGS A;  2EVB A;  2F0N A;  4IJL A;  4ID6 A;  2FMM A;  2EJM A;  4RHS A;  1DON A;  1BR9 A;  4KKU A;  1QOH A;  3NEM A;  1B4O A;  3K7A B;  2UXB L;  2AQ3 B;  1UWV A;  4LFB Q;  2XTI A;  3BDL A;  3GD7 A;  3NSW A;  4X64 Q;  2E5L Q;  4X65 Q;  4KHV A;  1SXT A;  5NUC A;  4PMB A;  3NTK A;  3TP5 A;  1YIJ A;  3OTO Q;  2CW0 D;  3GDE A;  2NN6 H;  2F4V L;  3T1H Q;  4FYD A;  4CDD C;  3PO3 G;  1YBY A;  2E2H B;  4C1N K;  4UY8 C;  1OTC A;  3H94 A;  5CC4 A;  3M85 A;  1I6V C;  2RHQ B;  1BBU A;  5JJL A;  1LTS D;  1S5C D;  3UE0 A;  5I9P A;  1XMO L;  1BUV T;  2R93 G;  1L0Y B;  3VR4 A;  1PH5 A;  3ERQ A;  3QG1 A;  4J6H A;  4K2L A;  4JI2 L;  1PH4 A;  2KA7 A;  1FL0 A;  3GTQ B;  1QE6 A;  1NAP A;  3MC0 B;  3TBI B;  3PUW A;  1HZB A;  1VQJ A;  2K5Q A;  5C4J B;  5T1I A;  1IBL Q;  2VB3 X;  3L7Z C;  3T51 B;  5C44 G;  1RDP D;  4IN3 A;  3VYT A;  3E5S A;  4QJF A;  1CKN B;  2MHV A;  5JAV A;  1MKH A;  1DOL A;  1CSQ A;  4PMW A;  1ESF A;  1A2T A;  3S1Q B;  1ASZ A;  2CKZ B;  1CSP A;  4MTK A;  1I3Q H;  2Q8R E;  4DPG A;  3CD6 A;  1YNN D;  2RBM A;  3IKJ A;  1HFN A;  2XWB B;  1PTO C;  1TWC H;  4EQP A;  4A3F H;  1YI2 A;  4DF7 A;  3J7A V;  5JJK A;  3CQZ H;  1Y1V B;  1LLR D;  3H3V H;  1W2B A;  4CGY B;  3HOZ H;  3W1B A;  3PCO B;  2OT2 A;  2BDN A;  5IIF A;  5EPL A;  1AZQ A;  1B7Y B;  2VS1 A;  5CYU A;  1B8A A;  1M4V A;  1UE5 A;  1JC7 A;  1PFB A;  3OPO A;  1Q3L A;  5CV7 A;  2LY7 A;  3UDI A;  2YU9 B;  1CHQ D;  1F2Y A;  4JV5 L;  3BDO A;  3CAM A;  1VQN A;  5GRO A;  1VQI A;  2F4I A;  3GV3 A;  4OHJ A;  4BY7 B;  1B50 A;  3EQL C;  3MEH A;  1GM5 A;  1Q46 A;  2BA0 A;  3RLF A;  2NVQ H;  2NTT A;  3PUX A;  5L37 A;  4HJ9 A;  4LF4 Q;  2AQ2 B;  4X3K A;  1Z6H A;  1WJJ A;  4JI7 Q;  5C0X H;  3M4Y A;  3MZ5 A;  1ILP A;  1WCM B;  4JYA L;  2KQ3 A;  4C2M B;  2MQH A;  2JA8 B;  2MPM A;  2B2W C;  1CM9 A;  4F7X A;  1SFO H;  1DOK A;  4A3J B;  1ET9 A;  2AUJ D;  4BBR B;  4L6T B;  4OO1 I;  1Y8P B;  2HUG A;  1Q82 C;  4NXN Q;  3LWE A;  2HT1 A;  1PTO F;  3GTO B;  5HGQ A;  1IYU A;  3M4O H;  2WB1 E;  5IGF A;  4R1J A;  2JN4 A;  1PTO D;  3C2P A;  3S1R H;  1PH3 A;  2UU9 L;  1EYD A;  2ALY B;  4DK1 A;  1WD1 A;  5M5Y B;  2M00 A;  4PQX A;  3ZJY C;  3G48 A;  3SR1 A;  1ENF A;  1CKM A;  1VQE A;  1SJH D;  1WTO A;  4A3I G;  2XRQ D;  4K8I A;  4DAM A;  4JOI A;  2NTS A;  4KTA A;  3S2D B;  2Y0S B;  5C3E H;  3UE1 A;  4YCU A;  1GUT A;  2EXD A;  1O80 A;  1G2S A;  1CTM A;  3EFX D;  4I7Z C;  5ELB A;  1H9S A;  3V96 A;  3U4Z A;  1PTO H;  1PVO A;  3CPF A;  5C6A A;  4GN3 B;  3A7A B;  1J5E L;  5M3F H;  2XVS A;  1Y1W H;  3DUZ A;  3HOV B;  5HY6 A;  3VYR A;  3J81 E;  2WAQ B;  3OMG A;  4KV6 A;  3KLR A;  1I4X A;  2FJ2 A;  4A3D G;  4B3M L;  2K1B A;  1R4P B;  3I4M B;  4DV5 Q;  4A3E H;  2F3V A;  3IFD A;  4DR6 L;  4GZY C;  3N52 A;  4DR3 Q;  3PO2 G;  4RCN A;  5DEH A;  1TWG H;  5I2Y A;  4UP7 A;  2EOT A;  3QIA A;  3HFZ B;  2JA5 B;  4PZ6 A;  4DV1 Q;  2Z6B A;  4RWS C;  2EY2 A;  4NP5 A;  2O2L D;  2CQA A;  3BZD B;  1AP0 A;  1BCP F;  1NTG A;  3VR6 A;  1N34 Q;  3FMC A;  2KCM A;  4A3K H;  3SVM A;  4BBS B;  1HZ9 A;  5CGK A;  1BCP D;  4YIJ A;  2F0E A;  2B8G A;  2R7F A;  4B9W A;  4DR5 L;  2QIL A;  3STB C;  2R92 G;  4A3B G;  1F9S A;  4HN7 A;  4R8N A;  1YJ9 A;  4IPG A;  4DV2 Q;  1V1P B;  3HOY G;  2ZXP A;  4CHT B;  4Q0F A;  4DUZ Q;  2VUM G;  3U58 A;  3WOF A;  1HPC A;  3S15 H;  4OO1 H;  1WTV A;  2EJG C;  1DOM A;  1GVP A;  3A55 A;  3HZX A;  2Z6K C;  4R4C A;  4HED A;  4XT1 B;  2C9O A;  5KYI A;  1U0L A;  3IFT A;  1JT8 A;  3J7Y W;  1F9R A;  5BR8 Q;  4JI0 Q;  2Z0S A;  3S14 H;  3ERS X;  3ULJ A;  1LTR D;  2SDF A;  1SBB B;  4LF9 L;  1JOR A;  1PYB A;  1SDF A;  2B8F A;  5EGT A;  4AIM A;  1FNW A;  4K5V A;  1PFN A;  3NUC A;  5DM7 3;  5IP9 G;  4KKS A;  2PI2 E;  1CHP D;  4JVZ A;  5GAH C;  1Q81 C;  4ALP A;  3AEV A;  2WP8 J;  1AN8 A;  4RKL A;  2K52 A;  3G4S A;  1KC8 C;  4OIJ A;  3S1N H;  5F2D A;  3BVM A;  5EKL A;  5D14 A;  3TP7 A;  3OIQ A;  4BY1 B;  3NXW A;  4YHH Q;  3URY A;  1EQT A;  1PH1 A;  2A68 D;  1EWH A;  4OXP A;  4JI4 Q;  1YIT A;  5JJZ A;  1WTP A;  1ONL A;  2AWN A;  4L63 B;  1I3Q B;  2ZM6 L;  1CK1 A;  5LMN L;  2UUC L;  1SE2 A;  4H02 A;  3W5O A;  1TWC B;  3B6Y A;  4A3F B;  4KY7 A;  1LV9 A;  3QWN A;  2MNA A;  4KN4 C;  1K3B C;  2WIN B;  3CQZ B;  1J6Q A;  1ZEQ X;  3KF8 B;  4HIK A;  1BBW A;  1R9T B;  4DU9 A;  3FKI G;  1SNC A;  2IT1 A;  1UE6 A;  4LF6 Q;  1HH2 P;  2A6E C;  2D0P A;  2JE6 I;  4JI5 L;  3K0Y A;  3OMC A;  1VQC A;  2QDB A;  5ELC A;  4JBK A;  2E2J B;  4ZLT F;  2GN5 A;  1QG7 A;  1Q8I A;  3K7A H;  1VDZ A;  2PW5 A;  4R9W A;  2K28 A;  2EIF A;  4HMJ A;  1VF5 C;  4JG2 A;  3SK6 A;  3C1E A;  3R3O A;  5C4Z A;  2DN8 A;  4JI3 Q;  4X3S A;  4DUY Q;  4P72 A;  1NE3 A;  2NVQ B;  4C3J G;  1G2T A;  2RA4 A;  2K33 A;  4N8F A;  3GP7 A;  2E2H H;  5KND A;  1N33 Q;  3RZO B;  1A3T A;  5E7N A;  2NVT H;  2PMZ B;  2JJQ A;  4JI8 L;  1GHJ A;  2JXM B;  3HRZ C;  3E0E A;  3DM1 A;  3PV0 A;  2K5N A;  3P1H A;  2WKC A;  4DXF A;  1SFO B;  1X55 A;  3MA2 B;  2OXP A;  1NBW A;  3ULL A;  3GTQ H;  3D3R A;  4Z9C B;  1MBY A;  5C4J H;  1SAP A;  3S1M H;  3L0O A;  1JIC A;  5JPM C;  3F2D A;  1F2Z A;  3KF8 A;  2DY7 A;  4AQY Q;  4K6L A;  3S24 A;  2I5L X;  5IYD G;  3HKZ B;  1HQR D;  4JK1 C;  1SE3 A;  1NCV A;  4DAV A;  3I72 A;  1QZH A;  4N9T A;  3SEB A;  3GTK H;  2ENB A;  2UUA L;  2MUY A;  4OL7 A;  1UE7 A;  1Y1V H;  4JBM A;  2O5I C;  1SJE D;  4YY3 Q;  5J22 A;  4LF8 L;  1BO0 A;  2B2V C;  1ASY A;  5FJ8 H;  4TRD A;  3CF5 A;  4KN7 C;  2X6G A;  2Q2H A;  3WOE A;  4FF1 A;  4OEM B;  2Z8L A;  1OXV A;  3NHH A;  4IUT A;  3VDY A;  4A3D B;  2I07 B;  4A3M G;  4OGQ C;  3M9B A;  1HXY D;  3PIP 3;  4KJO A;  4BY7 H;  5DAU A;  4KY6 A;  4L5S A;  1SYB A;  5M5W H;  4FF2 A;  2SNS A;  4RFB A;  3MFY A;  1DZ1 A;  4LF5 L;  2VB2 X;  1EZ8 A;  2BH8 A;  4IUU A;  4XT3 B;  5A35 A;  1D5M C;  1KDC A;  1Y8N B;  4GLX A;  1WCM H;  4HAE A;  5LMU L;  4C2M H;  2KJX A;  2NZ1 D;  4Y52 H;  2YYZ A;  4IFD G;  1X3F A;  3SK4 A;  2LKV A;  4A3J H;  4A3B B;  1G51 A;  3AFP A;  3GTO H;  3R8B A;  4RMF A;  1YJN A;  2OTJ A;  4GLV B;  1S3O A;  1B70 B;  1BXT A;  3NBH A;  1GHK A;  2EYM A;  4IUP A;  3X3M A;  1C4Q A;  1UNS A;  3Q6S A;  3K0X A;  4NKL A;  1DJR D;  1NMF A;  4B3R Q;  1RF2 D;  3NE5 B;  1XMQ L;  2BE5 D;  4EQO A;  1TKW B;  1AEX A;  5IYB G;  2NN6 I;  1GKH A;  1LT3 D;  1IKL A;  2L11 A;  2IW3 A;  4DV7 Q;  4DR1 Q;  5T1G A;  1AE3 A;  3VR3 A;  2B2Y C;  2DGY A;  3MEF A;  3I4N G;  1S4Z A;  1TU2 B;  1L0X B;  4CJ1 B;  4AYB E;  4OX9 L;  4QF4 A;  3CCV A;  3ERO A;  1BCP B;  4DV3 Q;  2UXD L;  3S14 B;  1HNZ L;  4DXG A;  2N78 A;  4ABN A;  1HJP A;  1W6K A;  2NVX B;  3GQB A;  4X62 Q;  3L3O C;  5KRU A;  2WKD A;  1JOQ A;  3O13 A;  2JYO A;  1MJE A;  1C9O A;  3H0G H;  2MP1 A;  2SNM A;  5C5M A;  2RQX A;  4IFD J;  4RHR A;  4WJW A;  3I4M H;  1HCZ A;  1TXY A;  2CW0 C;  5CBA E;  2Z9H A;  3FPU B;  3Q24 A;  4QUC A;  2F0M A;  4FXD A;  1CQV A;  2QDL A;  3KLW A;  1IW7 C;  2JA5 H;  5EBC A;  2EYO A;  4GN4 B;  3GTP H;  3H3V I;  2QF7 A;  4A76 A;  4MN3 A;  2AWO A;  3ND8 A;  1O7L A;  1TS5 A;  2B2T A;  3OOC A;  2HDL A;  3C3L A;  1RJT A;  2RVL A;  3QJY A;  4DV6 Q;  3OIP A;  3J80 E;  5ELE A;  1M8A A;  4X66 Q;  1TQO A;  3IL8 A;  4R4O A;  1I5F A;  1S40 A;  3HOX G;  2FMC A;  2D0O A;  1EOT A;  1C8C A;  3KBG A;  4XTC S;  3T1Y Q;  3F1Z A;  3P20 A;  2E8G A;  2VQE Q;  1T5X D;  3TSS A;  3TRZ A; 
#chains in the Genus database with same CATH homology
 3PIO 3;  2H4O A;  2A73 B;  4C3H B;  1YNN C;  1SEB D;  2F0G A;  2LS0 1;  3NQI A;  3NQT A;  5C0X I;  4HCE A;  1HHV A;  3OHX C;  4V0B A;  2K04 A;  1IHZ A;  2EYP A;  1ENA A;  3DXJ C;  3NP8 A;  4RH6 A;  2EYF A;  4BWG B;  2M9V A;  2WV6 D;  4NW2 A;  2TMP A;  1V43 A;  3S16 B;  1IW7 D;  3KUP A;  4FXG C;  2R7Z B;  4WFN 3;  2NVT B;  2ZT9 C;  1ILQ A;  4FXK C;  5C4H A;  1D1K A;  3BYT B;  1JWU D;  1SMY D;  3BS1 A;  1D2B A;  3BVG A;  1OXX K;  1SNM A;  3S1M B;  1IYV A;  2D2C C;  1KNE A;  2K03 A;  1FD7 D;  4CJ2 C;  1WTQ A;  1U4R A;  1G6Z A;  3GTK B;  3E6Z X;  1E2W A;  4ILW A;  4A3M B;  4LMQ D;  1W6J A;  1KNA A;  1TY2 A;  3CKI B;  3K58 A;  4ZYS A;  1K8M A;  2IX1 A;  5I6Y A;  4LJZ C;  3I70 A;  5E1F A;  3F2U A;  1S5E D;  2IPK D;  5M5W B;  1RD9 D;  2XNA C;  1H9S B;  4FVM A;  1EU4 A;  3PMF A;  1PZK D;  3MVV A;  3VR2 A;  5ELF A;  5K36 G;  2RKS A;  4RA8 A;  1AFP A;  1B9M A;  3G6J B;  3UI2 A;  4E6I A;  2BDO A;  3MXP A;  4U67 3;  3J80 L;  1FYC A;  2B2T C;  4PMC A;  4XQQ A;  2GA4 B;  4F88 A;  1JB3 A;  1AZP A;  2KED A;  3G7L A;  3BVZ A;  1KDB A;  2ID0 A;  1BCP C;  5JEA G;  3SK5 A;  3DEP A;  3M7G A;  3JAM L;  3T16 A;  1MSH A;  1BQQ T;  4ODG A;  1EZ6 A;  1STY A;  2K5D A;  1H9R A;  1TWH B;  1RHP A;  4OIK A;  1LTT D;  3I3C A;  2IX0 A;  4ME5 A;  5G3L F;  5JVG 3;  1RKN A;  4HMI A;  3X3N A;  1PXU A;  1EY8 A;  1A15 A;  3H0G B;  5G3L D;  1EU3 A;  1WTW A;  2PQE A;  3A8I E;  1VCI A;  3VYU A;  2NB0 A;  2F0O A;  5CV4 A;  2HQE A;  1PFM A;  1I4G A;  2EYL A;  2F0W A;  1LAB A;  1HQM C;  4C3I B;  1GJX A;  2J0T D;  2E74 C;  3GTP B;  4G7O C;  4Y7N B;  2Q8I B;  4XQJ A;  2DY8 A;  4XYQ A;  2RSN A;  2O4X A;  5JEA J;  2ICI A;  3MWY W;  4DAP A;  5FLX E;  2JA7 B;  1MSG A;  5FO8 B;  3ND9 A;  1X32 A;  1J8I A;  2A68 C;  3MTS A;  4RKB A;  2FFK B;  1DM0 B;  3VYS A;  1BBX C;  3LX0 A;  2F03 A;  2F0L A;  3K5N A;  2B63 B;  2R3Z A;  4LAA A;  5BN5 A;  2XIW A;  2L55 A;  1NUC A;  5IOC A;  5EPJ A;  1GUW A;  1WVL A;  2KHS A;  2RSO A;  3PO3 B;  3BYY B;  4DGZ A;  4CBV A;  1GOZ A;  1O7Y A;  2XSC A;  5FKA C;  5D3D A;  4ZUI A;  2R93 B;  5KNC A;  2M2L A;  1V1O A;  1IL8 A;  3IAY A;  2KOL A;  4RGO S;  2K32 A;  4HTH A;  1HUN A;  2R6G A;  3K59 A;  1R4Q B;  3OSO A;  5BN3 A;  4DFA A;  5C44 B;  4OO1 G;  4RCO A;  1EYC A;  4KY5 A;  1HA5 A;  4BS9 A;  1DYQ A;  3KK7 A;  1E2Z A;  2EYH A;  5FK9 C;  1I4R A;  2OEO A;  3V2T A;  4C1N I;  1LTG D;  2IJ0 A;  5TSS A;  2PYK A;  1CZG A;  2A6H D;  3TDQ A;  5I6W A;  1SNQ A;  3DHQ A;  1PYW D;  3CHB D;  4HCS A;  5JVH 3;  4ZK9 B;  4G57 A;  3MXN A;  5EQ0 A;  1H9K A;  2EXZ A;  1WD0 A;  4K5X A;  1STB A;  3A56 A;  3K57 A;  5CV5 A;  2E2I B;  2PW7 A;  5EJW A;  4L8J A;  1WTR A;  3I8Z A;  4QIW B;  3GTM B;  3V05 A;  4CKB A;  4ZKB B;  4DN4 M;  1JR0 D;  1KLG D;  1JQY D;  4QMG A;  1EY0 A;  1FGB D;  2LFN A;  3U9S A;  1TS2 A;  3TZU A;  1LT6 D;  4IUQ A;  3D31 A;  2F0K A;  2NUC A;  3U9O A;  4S3S A;  2PO4 A;  1D5X C;  3I91 A;  1STA A;  1A3U A;  2EDG A;  3D8G A;  2B2U A;  2EY1 A;  3C46 A;  1U9R A;  1EIG A;  3DEO A;  4NDX A;  3T4A C;  5CMD A;  5LL6 X;  5ISR A;  4FNF A;  1EEI D;  2N55 A;  5FLX L;  1BF4 A;  3FEW X;  4ULL A;  3GTJ B;  4A3I B;  3GV6 A;  3KLS X;  3SHL A;  1RCV D;  4DNT B;  3A7L A;  1SYE A;  1NSN S;  3AB9 A;  3D4D A;  4WOR A;  1F77 A;  2XRS D;  1Q1B A;  2QCP X;  1GXD C;  1KTK A;  2BE5 C;  1HTP A;  2KEE A;  1SSO A;  4XYO A;  4F8M A;  1QCB D;  1SE4 A;  2XN9 C;  2HCC A;  3NBI A;  1LO5 D;  3PO2 B;  3FPP A;  4IFD H;  1EWC A;  4V19 0;  5M5X B;  1CA5 A;  1QIL A;  4UAI A;  1EIH A;  2D62 A;  2TSS A;  1STN A;  2BA1 A;  4IZ8 A;  2EE1 A;  2WB1 B;  5IGC A;  5EBD A;  1EY5 A;  2R92 B;  2OF1 A;  1PRT F;  3HOY B;  1I50 B;  1A2U A;  1I4P A;  2CVR A;  2VUM B;  1PRT D;  3L9A X;  1S5B D;  3EVQ A;  1IKM A;  4KJN A;  1QB5 D;  1JOK A;  4G7Z C;  2A69 D;  4K5W A;  4KK7 A;  3Q23 A;  4K8J A;  1OO9 B;  3SDZ A;  3DWA A;  4NMZ A;  1UAP A;  3EJI A;  1ENC A;  3EA6 A;  3FRP B;  1JE4 A;  3OWE B;  2R61 A;  4I65 A;  4EQN A;  5A2Q L;  3Q22 A;  1HRJ A;  1KAA A;  2K7V A;  4JBW A;  3K6O A;  1EEF D;  3CRK C;  2F0I A;  5IGE A;  1DCZ A;  3MXG A;  1VMC A;  3K5M A;  2F0F A;  4G7H C;  3RMH A;  5CV6 A;  2NVY B;  3OW7 A;  5HUR A;  4EVO A;  1G29 1;  1TWF B;  1RTN A;  2PZU A;  1H9J A;  1EY6 A;  2Z4I A;  1EY4 A;  5J1Z A;  3MXU A;  2L4N A;  1HTL D;  1FNV A;  3S17 B;  1II3 A;  3MHB A;  1X3P A;  2DNE A;  1HFG A;  3HG9 A;  4C56 C;  1SMY C;  3FKI B;  2EZV A;  1EY7 A;  1V8Q A;  5AFW A;  2B2W A;  2EYJ A;  3VA7 A;  1MI2 A;  3AMU A;  3A8K E;  3PUY A;  5CV8 A;  2NWG A;  3TZD A;  1HA6 A;  3HOW B;  3JAM E;  5IT9 L;  3CU7 A;  3GTL B;  2WAC A;  4ZQ3 A;  2G9H D;  3I73 A;  1QNU A;  3I90 A;  4C3J B;  2EY6 A;  1S5D D;  2ZXR A;  2L9H A;  3H6M A;  5D3I B;  4HR7 B;  4XIG S;  1ZYR D;  1ZKO A;  1FNU A;  1O7Z A;  3NWT A;  2RDF A;  4X3T A;  1YNJ C;  4QB4 A;  5D65 A;  1ROD A;  2SEB D;  3HEJ A;  1B44 D;  2G9D A;  1GUO A;  3AU7 A;  1QNK A;  3NTI A;  4ZRZ A;  4IQZ A;  4DA2 A;  2EPB A;  1F9P A;  3VA5 A;  1E2V A;  1KDA A;  2KCN A;  1STG A;  2F1M A;  3J7A F;  2Q8T A;  2JSO A;  2NN6 G;  2RDG A;  4QUF A;  1VF7 A;  1SND A;  1PZJ D;  1OXU A;  4H44 C;  3RZD B;  2JP1 A;  4IAL A;  3QO2 A;  2I46 A;  2IX3 A;  3LWU A;  3WDN A;  1BDO A;  1SNO A;  1LTB D;  3FVQ A;  3RUZ A;  5K36 H;  5I4D A;  2F0S A;  4F87 A;  2QEJ C;  5COY A;  5E4W C;  4DAY A;  1YNJ D;  5J39 A;  1Y8O B;  4K2K A;  1GUG A;  2PPB C;  1K83 B;  1I4H A;  1TS3 A;  1Q12 A;  3K5O A;  4O1N A;  2F0Q A;  3PUZ A;  3E0J A;  4UDU C;  5CBE E;  4PV1 C;  3D4R A;  2RDH A;  4B9X A;  5JEA H;  1Y69 U;  1BOS A;  4QCL A;  1S5F D;  4O42 A;  1TS4 A;  3MFG A;  1XXG A;  5I9O A;  3T56 B;  3I4N B;  2AUK A;  3D6C A;  2SOB A;  3M7N A;  4XDX A;  4XXE A;  2LMC B;  1XX8 A;  2BOS A;  1LT5 D;  5C0X G;  1MGS A;  4X3U A;  1XTC D;  1EQV A;  2E2D C;  2C5C A;  1F2L A;  3P7J A;  3GTG B;  3S2H B;  5HGT A;  1PRT B;  3W3A A;  1G8Z D;  5KGU A;  5C5L A;  4RGM A;  5KYL A;  4KKT A;  1TWA B;  1SYC A;  2V4D A;  4LK1 C;  1LT4 D;  3CRL C;  1SYG A;  4WRD A;  2KUM A;  1UUP A;  2NBF A;  3NPP A;  1H9M A;  4J8Q A;  2O5J C;  2X6L A;  5CR3 A;  4TSS A;  1QWY A;  5DNF A;  3HOX B;  2N88 A;  4ZAI A;  1BNZ A;  1JWM D;  2H1E A;  1CT1 D;  5IGG A;  5E3F A;  1TR5 A;  2F0T A;  1I4Q A;  5C0X J;  2DNC A;  1XWE A;  2D9U A;  4B08 A;  3BG3 A;  3H09 A;  2A6H C;  2Z4H A;  4AYB B;  4N9P A;  1SYF A;  5BN4 A;  2L0C A;  4MHE A;  1DXM A;  4CKC A;  3TP8 A;  3H91 A;  2L12 A;  1B3A A;  5LHY 1;  5IGD A;  2VNU D;  3SXH A;  4BA2 I;  2F0P A;  1OXS C;  5K5P A;  3W2D A;  4P2C B;  3DWP A;  3P75 A;  3R2T A;  3LNN A;  3S9W A;  3Q0A A;  2CHB D;  1I6H B;  5DM6 3;  2EJF C;  2B2V A;  4KMU C;  3NTH A;  1EL0 A;  1TY0 A;  1KLU D;  1X3Q A;  5KEE A;  4DK0 A;  5EPK A;  2E76 C;  3PUV A;  1GUN A;  1G91 A;  4IUV A;  4G4K A;  1A3V A;  2ICE C;  2BCO A;  5IOD A;  1U4L A;  1XYI A;  1OXT A;  2WII B;  1V1P A;  4IFD I;  3TN2 A;  4KD4 A;  1RTO A;  1TT2 A;  5JPN C;  3A54 A;  2JA6 B;  4TQU S;  5I2X A;  3ONA B;  2NYZ D;  3NWS A;  4TKO B;  1DD2 A;  3SE0 A;  3R2I A;  2X69 A;  1D6E C;  3HOZ B;  5C3X A;  3KBX A;  5ELD A;  2B2Y A;  1UEA B;  4XQN A;  1U4P A;  5A2Q E;  1Q90 A;  3QOL A;  5JOB A;  2QKI C;  3FDT A;  1JOO A;  2F0V A;  1B1Z A;  3KLS A;  4C3H G;  3DMU A;  3I4L A;  3J81 L;  4KI0 A;  1GUS A;  1LTA D;  1ICW A;  1U4M A;  1J9O A;  4J1M A;  1ESR A;  1A6X A;  1LTI D;  2Z1C A;  5KNB A;  1CA6 A;  1LAC A;  1SNP A;  2KEC A;  4Q5V A;  1STH A;  1F9Q A;  4EGV A;  2L5T A;  2KVM A;  1ZXT A;  5M9O A;  5C4X B;  1PRT C;  4IUR A;  4RAU C;  3M4O B;  1NR4 A;  3MAQ A;  2F0J A;  5LL6 S;  1VMP A;  4PNY A;  3S1R B;  3TP6 A;  1O78 A;  2A69 C;  2K5W A;  4MIU A;  1CQF A;  2JEA I;  1K8O A;  2JEB I;  4HSP A;  5IT9 E;  1CZW A;  2FIN B;  2A6E D;  1EFI D;  1WTX A;  1TVX A;  2PZW A;  1D1I A;  1B2T A;  4FF4 A;  2F3W A;  2VXW A;  4H7B A;  1NR2 A;  5C3E B;  4K6D A;  3QB3 A;  5KIX A;  2J7Z A;  2AQ1 B;  3T13 A;  5C3W A;  4K14 A;  4DNR B;  1PTO B;  4M8A A;  5EKK A;  5COR A;  5FO7 B;  1JWS D;  3C1F A;  5M3F B;  1Y1W B;  4KHZ A;  3GO5 A;  1PDQ A;  1SYD A;  2A5H A;  4BA1 I;  3K5L A;  3HOU B;  2L1B A;  3DWQ A;  2J4X A;  3ITP A;  2IWH A;  1Q1E A;  4A3E B;  4H13 C;  5M3M B;  1E0B A;  2MJ8 A;  1TWG B;  4R8I A;  4U68 A;  3N6R A;  5E4X A;  2F0H A;  2F0U A;  4A3K B;  1TII D;  2KCC A;  1PLF A;  3TME A;  5FOB B;  5CV9 A;  3ZYY X;  4ZKC B;  4ZUJ A;  2K6A A;  3NK9 A;  2B39 A;  1B53 A;  1KAB A;  3D4W A;  4HSV A;  3S15 B;  3HP3 A;  2A74 C;  1EYA A;  1D5Z C;  3QOJ A;  1AW7 A;  2F0D A;  1PZI D;  4A93 B;  1CFM A;  2E75 C;  3HS0 C;  4IUN A;  1ET6 A;  1ZYR C;  2FHT A;  4FO2 A;  5IGB A;  1STE A;  2XWJ B;  2B2U C;  1Z7T A;  3A8J E;  1CI3 M;  4FP5 D;  1Z47 A;  1T5E A;  5FO9 B;  2EY5 A;  4CKE A;  1C48 A;  3BDC A;  3SK8 A;  2ZXO A;  4RGT A;  4A3G B;  2PCF B;  3S1N B;  1FR3 A;  1MD2 D;  2IL8 A;  3R93 A;  1JCK B;  3D6W A;  1F2M A;  3HGB A;  1QJO A;  2PNR C;  2PZT A;  3H3V C;  1HUM A;  4C3I G;  5EKI A;  2K01 A;  1PMR A;  4RGN A;  4FF3 A;  1ML0 D;  1EY9 A;  3M3Y B;  4H0L C;  1B9N A;  4CJ0 B;  3T53 B;  3VR5 A;  2HDM A;  2D5D A;  4KD3 A;  3OWF A;  3RD4 A;  2K05 A;  4M1U B;  2HCI A;  2MGS A;  2EVB A;  2F0N A;  4ID6 A;  2FMM A;  2EJM A;  4RHS A;  1DON A;  1BR9 A;  4KKU A;  1QOH A;  1B4O A;  3K7A B;  2AQ3 B;  3NSW A;  3BDL A;  3GD7 A;  4KHV A;  1SXT A;  5NUC A;  4PMB A;  3NTK A;  3TP5 A;  2CW0 D;  2NN6 H;  4FYD A;  2E2H B;  4C1N K;  3H94 A;  5CC4 A;  3M85 A;  1I6V C;  1LTS D;  1S5C D;  5I9P A;  1BUV T;  1L0Y B;  3VR4 A;  3ERQ A;  3QG1 A;  4J6H A;  4K2L A;  2KA7 A;  3GTQ B;  1QE6 A;  1NAP A;  3TBI B;  3MC0 B;  3PUW A;  2K5Q A;  5C4J B;  5T1I A;  2VB3 X;  3L7Z C;  3T51 B;  1RDP D;  4IN3 A;  3VYT A;  3E5S A;  2MHV A;  5JAV A;  1DOL A;  4PMW A;  1ESF A;  1A2T A;  3S1Q B;  2Q8R E;  1YNN D;  2RBM A;  3IKJ A;  1HFN A;  2XWB B;  1PTO C;  4EQP A;  4DF7 A;  3J7A V;  1Y1V B;  1LLR D;  4CGY B;  2OT2 A;  2BDN A;  5IIF A;  5EPL A;  1AZQ A;  5CYU A;  1M4V A;  1JC7 A;  1PFB A;  3OPO A;  1Q3L A;  5CV7 A;  2LY7 A;  2YU9 B;  1CHQ D;  1F2Y A;  3BDO A;  2F4I A;  3GV3 A;  4OHJ A;  4BY7 B;  1B50 A;  3EQL C;  3MEH A;  2BA0 A;  3RLF A;  2NTT A;  3PUX A;  2AQ2 B;  4X3K A;  1Z6H A;  5C0X H;  3M4Y A;  3MZ5 A;  1ILP A;  1WCM B;  2KQ3 A;  4C2M B;  2JA8 B;  2MPM A;  2B2W C;  1CM9 A;  4F7X A;  1DOK A;  4A3J B;  4BBR B;  2AUJ D;  1ET9 A;  4L6T B;  4OO1 I;  1Y8P B;  2HUG A;  3LWE A;  1PTO F;  3GTO B;  1IYU A;  5IGF A;  1PTO D;  3C2P A;  1EYD A;  4DK1 A;  1WD1 A;  5M5Y B;  2M00 A;  4PQX A;  3SR1 A;  1ENF A;  1SJH D;  1WTO A;  2XRQ D;  4K8I A;  3S2D B;  2NTS A;  4KTA A;  2Y0S B;  1GUT A;  1O80 A;  1G2S A;  1CTM A;  3EFX D;  4I7Z C;  5ELB A;  1H9S A;  3V96 A;  1PTO H;  5C6A A;  3A7A B;  2XVS A;  3DUZ A;  3HOV B;  3VYR A;  3J81 E;  2WAQ B;  3OMG A;  4KV6 A;  3KLR A;  1I4X A;  2FJ2 A;  2K1B A;  1R4P B;  3I4M B;  2F3V A;  3IFD A;  4GZY C;  3N52 A;  4RCN A;  5DEH A;  5I2Y A;  2EOT A;  3QIA A;  2JA5 B;  4RWS C;  2EY2 A;  4NP5 A;  2O2L D;  2CQA A;  3BZD B;  1AP0 A;  1BCP F;  3VR6 A;  3FMC A;  3SVM A;  4BBS B;  5CGK A;  1BCP D;  4YIJ A;  2F0E A;  2B8G A;  4B9W A;  2QIL A;  1F9S A;  4HN7 A;  4R8N A;  1V1P B;  2ZXP A;  4CHT B;  4Q0F A;  3WOF A;  1HPC A;  4OO1 H;  1WTV A;  2EJG C;  1DOM A;  3A55 A;  3HZX A;  4HED A;  4XT1 B;  2C9O A;  5KYI A;  3IFT A;  3J7Y W;  1F9R A;  1LTR D;  2SDF A;  1SBB B;  1JOR A;  1SDF A;  2B8F A;  5EGT A;  1FNW A;  4K5V A;  1PFN A;  3NUC A;  5DM7 3;  4KKS A;  1CHP D;  2WP8 J;  1AN8 A;  4RKL A;  4OIJ A;  5F2D A;  3BVM A;  5EKL A;  5D14 A;  3TP7 A;  3OIQ A;  4BY1 B;  3NXW A;  3URY A;  1EQT A;  2A68 D;  1EWH A;  5JJZ A;  1WTP A;  1ONL A;  2AWN A;  4L63 B;  1I3Q B;  1CK1 A;  1SE2 A;  1TWC B;  4A3F B;  4KY7 A;  1LV9 A;  3QWN A;  4KN4 C;  2WIN B;  3CQZ B;  1ZEQ X;  1R9T B;  4DU9 A;  1SNC A;  2IT1 A;  2A6E C;  2JE6 I;  3K0Y A;  3OMC A;  2QDB A;  5ELC A;  2E2J B;  4ZLT F;  1QG7 A;  1Q8I A;  1VDZ A;  2PW5 A;  4R9W A;  2K28 A;  4HMJ A;  1VF5 C;  3SK6 A;  3C1E A;  3R3O A;  5C4Z A;  2DN8 A;  4X3S A;  2NVQ B;  4C3J G;  1G2T A;  2RA4 A;  2K33 A;  3GP7 A;  5KND A;  3RZO B;  1A3T A;  2PMZ B;  1GHJ A;  2JXM B;  3HRZ C;  3DM1 A;  3PV0 A;  3P1H A;  2WKC A;  4DXF A;  1SFO B;  3MA2 B;  2OXP A;  3D3R A;  4Z9C B;  1MBY A;  1SAP A;  1JIC A;  5JPM C;  1F2Z A;  3KF8 A;  2DY7 A;  4K6L A;  3HKZ B;  1HQR D;  4JK1 C;  1SE3 A;  1NCV A;  4DAV A;  3I72 A;  4N9T A;  3SEB A;  2ENB A;  2MUY A;  4OL7 A;  2O5I C;  1SJE D;  5J22 A;  1BO0 A;  2B2V C;  4TRD A;  4KN7 C;  2X6G A;  3WOE A;  4FF1 A;  2Z8L A;  1OXV A;  3NHH A;  4IUT A;  4A3D B;  2I07 B;  4OGQ C;  1HXY D;  3PIP 3;  4KJO A;  5DAU A;  4KY6 A;  1SYB A;  4FF2 A;  2SNS A;  4RFB A;  3MFY A;  1DZ1 A;  2VB2 X;  1EZ8 A;  4XT3 B;  4IUU A;  5A35 A;  1D5M C;  1KDC A;  1Y8N B;  4HAE A;  2KJX A;  2NZ1 D;  2YYZ A;  4IFD G;  3SK4 A;  2LKV A;  4A3B B;  3R8B A;  1BXT A;  3NBH A;  1GHK A;  2EYM A;  4IUP A;  3X3M A;  1C4Q A;  1UNS A;  3Q6S A;  4NKL A;  1DJR D;  1RF2 D;  3NE5 B;  2BE5 D;  4EQO A;  1TKW B;  1AEX A;  2NN6 I;  1LT3 D;  1IKL A;  2L11 A;  2IW3 A;  5T1G A;  3VR3 A;  2B2Y C;  1S4Z A;  1TU2 B;  1L0X B;  4CJ1 B;  4QF4 A;  3ERO A;  1BCP B;  3S14 B;  4DXG A;  4ABN A;  1W6K A;  2NVX B;  3GQB A;  3L3O C;  5KRU A;  2WKD A;  1JOQ A;  3O13 A;  2JYO A;  2MP1 A;  2SNM A;  5C5M A;  2RQX A;  4IFD J;  4RHR A;  4WJW A;  1HCZ A;  2CW0 C;  5CBA E;  3Q24 A;  3FPU B;  4QUC A;  2F0M A;  4FXD A;  1CQV A;  1IW7 C;  5EBC A;  2EYO A;  2QF7 A;  4MN3 A;  2AWO A;  3ND8 A;  1O7L A;  1TS5 A;  2B2T A;  3OOC A;  2HDL A;  3C3L A;  1RJT A;  2RVL A;  3QJY A;  3OIP A;  3J80 E;  5ELE A;  1M8A A;  1TQO A;  3IL8 A;  2FMC A;  1EOT A;  1C8C A;  3KBG A;  4XTC S;  3P20 A;  1T5X D;  3TSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...