5KIXA

Crystal structure of staphylococcal nuclease variant delta+phs i92e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kixA00
4WORA 3OMGA 5KIXA 1SNDA 2F3VA 2EXZA 2RKSA 3D6CA 3MXPA 4HTHA 5E1FA 2EYJA 3P75A 2LKVA 5EKKA 1JOOA 1KABA 5CV4A 2RDFA 5CV5A 4B9XA 1EY8A 2WACA 3OWFA 3SXHA 5IODA 2RBMA 1EZ6A 1SNCA 4ZUIA 3V2TA 2OF1A 3NP8A 4MIUA 4NP5A 1SYEA 2QDBA 1EYAA 1NSNS 2SOBA 4HMIA 5EKLA 3R3OA 5EGTA 2F0LA 4KHVA 2EYMA 4EVOA 3OSOA 1SNQA 1A2TA 3D8GA 2F0NA 5C5MA 3TP6A 3H6MA 3C1EA 1STGA 2KHSA 1STAA 3BDCA 5C4ZA 2F0MA 5IGCA 3NK9A 1A2UA 3T13A 5DAUA 2F0PA 2OXPA 4K5XA 3MEHA 3NHHA 4PMBA 3PMFA 1SYCA 4ME5A 4QB4A 4QMGA 4S3SA 1JOKA 4TRDA 4KD4A 5CV8A 3TP7A 1KDAA 4K2LA 4KJOA 1EY9A 1A3VA 1SNOA 5CR3A 4ZUJA 5I9PA 1STHA 2F0DA 5E3FA 5IOCA 1SNMA 1SYFA 3NXWA 3SK8A 3BDLA 4NKLA 4F8MA 5I6YA 5ISRA 2EYLA 5C4HA 3MHBA 4NDXA 3TP5A 2F0HA 5C6AA 3U9OA 3E5SA 3NUCA 3DHQA 5IGBA 5HGTA 5I6WA 1KDCA 1SNPA 5IGDA 2F0FA 4F7XA 2SNMA 1EYCA 3EJIA 2OEOA 3C1FA 2PZTA 4ODGA 3MVVA 2PYKA 3HZXA 5I9OA 2EYFA 4G57A 4K5VA 2F0TA 1SYBA 2O4XA 4K5WA 4I65A 4KV6A 4PNYA 3S9WA 5KRUA 1STYA 2PW5A 3HEJA 5CV7A 5IIFA 4PMCA 4KY6A 2F3WA 4RKLA 1RKNA 3TMEA 5J22A 5J39A 5IGFA 1STNA 2HQEA 4ID6A 1JORA 1EY7A 2EYHA 3VA5A 1EY6A 3SK6A 2F0JA 3D4WA 1F2YA 4ZQ3A 5KEEA 2PZUA 5CV6A 3DMUA 3SR1A 3T16A 4K2KA 3MZ5A 3ERQA 5CGKA 4DF7A 3EROA 2F0OA 3NQTA 5CV9A 1ENCA 2ENBA 2NUCA 4IZ8A 1A3TA 2PQEA 1TQOA 3ITPA 1TT2A 4J6HA 4H7BA 4IALA 4KY5A 4EQNA 2F0KA 1U9RA 1SYDA 2F0EA 2F0GA 5CC4A 2F0SA 2F0WA 5JAVA 3RUZA 5K5PA 2EY2A 3D4DA 2F0UA 4R8NA 4EQOA 5C5LA 3LX0A 4N9TA 1F2ZA 1STBA 3P1HA 4KTAA 3SK4A 5JOBA 4E6IA 5KYIA 3QOLA 1EZ8A 1EQVA 4KY7A 1EYDA 4QF4A 4YIJA 5NUCA 4LAAA 4OL7A 5J1ZA 2F0VA 2PW7A 3QOJA 1F2MA 2PZWA 3EVQA 2EY6A 4DFAA 4DU9A 5C3WA 1KDBA 2F0IA 4B9WA 2M00A 2F0QA 3OMCA 4IUNA 5HURA 1II3A 5KYLA 1TR5A 5IGGA 4RKBA 5F2DA 3QB3A 3SHLA 3SK5A 4KD3A 4DGZA 5M9OA 2EY5A 4HMJA 4J1MA 5KGUA 1EY0A 2SNSA 5IGEA 1ENAA 1SYGA 2EY1A 1AEXA 1IHZA 4K6DA 1A3UA 1EY5A 1KAAA 4N9PA 1JOQA 2EYPA 4K14A 3TP8A 1EY4A 2KQ3A 4K8IA 4WRDA 4NMZA 4EQPA 5C3XA 4K8JA 1NUCA 4KJNA 5DEHA 2EYOA
chains in the Genus database with same CATH superfamily
3MXGA 2CW0D 4A3CG 2IWHA 2A73B 2R7FA 5E1FA 4HTHA 4Z9CB 1LABA 5LMNL 1ASZA 1FGUA 2XGTA 3OWFA 1ASYA 5I2YA 4MNOA 4C56C 3NP8A 4PV1C 1L1OB 1AZQA 4GN5A 1ZEQX 1EOTA 4JI1Q 2L55A 2EYMA 3DM1A 2F0NA 2QA4A 1WD0A 5C4ZA 1WCMG 2K1BA 1VQ5A 4CJ2C 1JB3A 5DAUA 1ML0D 5LHY1 2N88A 1NR2A 4ME5A 4MHEA 4DPGA 1NR4A 2EJGC 3M4OB 4IUUA 5C4JB 2A74C 3CPFA 3I7FA 4MTKA 3QG1A 5IYCG 2ZTDA 5JEAH 2AHOB 4FO2A 5E7NA 5FLXc 1H9SB 1TVXA 3M3YB 4KHZA 3NELA 5AJ3L 1OTCA 2GA4B 2WIIB 4KK7A 2E2DC 3HRZC 4LF5Q 2B2WA 5C3EG 5KRUA 4C3IG 1F9QA 2WAQE 4KY6A 3K7AH 4GOPC 1C4QA 3CCRA 4ZKCB 3FMCA 1NCVA 1YBYA 1MHWC 1MSHA 4NXNL 4IURA 3A7AB 4YCVA 1F2YA 2E76C 2F3IA 4PMWA 1N36L 3IKJA 3RZOB 4JI0L 1DOMA 3Q0AA 2O5JC 1A3TA 1TT2A 2YTVA 1D5ZC 3K0XA 2C5CA 3HKZE 2CFMA 2NB0A 3K7UC 4N9TA 1K0RA 1GHKA 2Q2TA 4A3MH 4L5RC 3I4LA 1KRSA 3KF6A 1OXVA 2PW7A 1B9NA 1DOKA 1F2MA 2EY6A 4G7HC 1M8AA 1PYSB 2E74C 1O7LA 3ERSX 4KLKA 1EUJA 2P5ZX 1PA6A 2G9HD 1M90C 3CMAA 1SE3A 1SSOA 2EVBA 4DV7L 4DR6Q 4MZ9A 1I4PA 2C9OA 1NY4A 1CKNB 4A3JG 4FYDA 5M3MH 5JVG3 3MXPA 3K58A 3P75A 1I4RA 5EKKA 1JOOA 1Q7YC 2UUAQ 2EE1A 1QUQA 1FR3A 1PFMA 3E6ZX 1NMFA 4I7ZC 2F4VQ 1L0XB 4AYBB 1E0BA 3G48A 3KLSA 4EVOA 4B3SL 2NN6I 2AKWB 3MFGA 2K7VA 4X3UA 4JYAL 3HOUG 2JE6I 3K7AB 1S40A 4APVA 2XRQD 4KJOA 1I94Q 4R4OA 4X3TA 4OIJA 2K75A 1H9RA 2HCCA 2Q2HA 1T9HA 4DNIA 1VQFA 1D7QA 2F0FA 5EPLA 4DAYB 4IN3A 1A0IA 5I9OA 4JI5L 5T1GA 4BXXH 3S9WA 4A3MB 3TRZA 1B7YB 2FINB 2VS1A 1N34L 2BDOA 2QCPX 5IGFA 4JI2L 1STNA 2XVSA 1WI5A 2PO4A 1WVLA 3H0GH 2FJ2A 1DZ1A 2XNAC 3BVMA 2ENBA 2NUCA 4POFA 4C3JH 1Y14B 4GNXC 1XMOQ 4J6HA 2I0QA 1U9RA 4LUOA 1SYDA 5H1SE 4ULLA 2CQOA 4RWSC 1V8QA 5M3MB 4EQOA 4ZKBB 4AIMA 2VZAA 3KDFB 3ZYYX 2EPBA 4DAMA 4DK6C 1EQVA 3GDEA 3CC7A 4XQQA 3Q24A 1K8OA 2I5LX 3QOJA 5IWAQ 3RR5A 3TZDA 2QEXA 2E2HH 3A0JA 2IX3A 3BZDB 4RKBA 3S1NH 2B39A 1TKWB 2Z6KA 4N9PA 3EQLC 5JJIA 5IP7H 1DYQA 3H3VC 1EL0A 2EIFA 4IPCA 2MNAA 5CORA 1GD7A 4LJZC 5FLMG 2VY3A 1MI2A 3W1BA 2HHHQ 3D3RA 3QO2A 1KABA 1XX8A 4LNQA 2E5LQ 2JK8A 1SNCA 5C0XH 1NTGA 4DKAC 2ICIA 4LF9Q 3R3OA 3MXNA 4C2MH 2KEDA 4QQBX 3K57A 1HZBA 1D6EC 1CA6A 2A69D 1DD2A 1PRTC 3C1EA 4OWXB 1STEA 2KHSA 4C3HH 1PDQA 3O13A 4HIMA 4A3DG 3PUZA 2CKZB 1LTAD 1AE3A 4PMBA 3HG9A 3H0GB 5CV8A 2KCNA 3TP7A 1ZYRC 1G291 3X3NA 2JA6G 2XIWA 3NBHA 1VQPA 1EQQA 3GTPH 1VCIA 5C4HA 3UDXA 4IUQA 4C3JB 3BG3A 3IL8A 2R92H 3A8JE 4JG2A 4LF6Q 4ALPA 3H91A 2PYKA 1J5EL 1DONA 1ZYRD 1KL9A 2DUDA 4PNYA 2RDHA 4CHTB 1YEZA 3KBXA 3T1HQ 2Y0SG 2HIXA 5G3LF 1UEAB 1TIID 3BZKA 2HQEA 1JORA 1PTOC 3PUYA 2EYHA 1EQTA 4JI6Q 4OO1H 4HCSA 3DEOA 4OEMB 2E2HB 2PZUA 1TS4A 1BF4A 3OYYA 2IX1A 3S1NB 5CGKA 1Y8NB 1BBUA 2IW3A 1TQOA 4LUZA 2F0KA 4BBSG 5LL6S 5CC4A 5JAVA 1PTOD 4G4KA 3KOJA 3H3VI 2UUAL 5LMNW 1NAPA 3P1HA 4OWWB 3T56B 3OTOL 3MFYA 4PZ7A 2JA7H 2K05A 5M3FH 2F4VL 4PZ8A 1KAWA 3F1ZA 5JPNC 5IT9c 4DU9A 1KDBA 1ICWA 1YZ6A 4IJLA 4B3TL 2MPMA 3E9HA 3NTHA 4C2MB 4JI7Q 5JJLA 5A2QE 3E0JA 4HJ8A 2Z4HA 4C3HB 1QNUA 2M9VA 4DK1A 1S4ZA 3CU7A 3BZCA 1QVCA 2VUMH 2QF7A 4BY7H 2G5DA 5DEHA 5IYDG 4DUZL 4L5QA 5ELFA 3EBEA 3J7ZC 3GTPB 3GO5A 1E2VA 4EGVA 3I72A 4DN4M 3BDOA 3NE5B 3NENA 2HDLA 2R92B 4CKCA 1D8LA 2L5TA 4KN4C 2JSOA 2B2WC 3BVZA 5EKLA 1Y1WG 1QZHA 3BVGA 5EGTA 4GKKL 3JAME 2K33A 4OXPA 1IBKL 3NWTA 2RDGA 4QIWB 4DV2Q 1G91A 2RSOA 1ICFB 4HIKA 5COYA 3V05A 1GUWA 5ELNA 4QMGA 4S3SA 4TKOB 5J22A 4IO9A 1WTQA 4OIKA 1TWHH 2L0CA 5I9PA 3AEVA 3OIPA 3I91A 4RGNA 1V1PB 1ESRA 4L5SA 3J80L 2RF4A 3I55A 4K6LA 2EDGA 4L5TA 1BUVT 1LM0A 3D6WA 4ODGA 3CCEA 5IP9H 4HSPA 4DR1Q 3QWNA 5IWAL 2JA7B 1JMCA 5M3FB 1SMXA 4R9WA 4X65L 3TMEA 1SROA 5TSSA 1XXGA 1YHBA 1HA6A 3CKIB 1YHQA 3DLLA 4N8FA 4WFN3 1VQBA 4IZ8A 2HCIA 5GQOA 2VUMB 1JJGA 4BY7B 1XYIA 2E8GA 2HHHL 4JI4L 4R4IA 5C44H 4IUPA 1CM9A 4X3KA 1LYLA 1E1OA 4KKSA 4YY3L 4OL7A 2B2YC 4AYBE 1I4QA 1JB7A 1AP0A 1EEFD 4X66Q 2K5VA 4DFAA 1E2ZA 4DR2L 5IGGA 3SK5A 4KD3A 5KGUA 3HFZB 2UXDL 2O2LD 1WFQA 1HJPA 3HOVG 3RLNA 4BBRH 3TP8A 1EY4A 4AQYQ 1AE2A 3UDGA 1NUCA 1TWHB 3TS0A 1VQLA 4R1JA 4ZRZA 2A8VA 1BQQT 1C0AA 3SDZA 4A4IA 4JCVE 1EY8A 1AFPA 1EZ6A 3V2TA 1CZGA 1F9RA 3UDIA 4MIUA 5M5XH 3HOXH 3PO2H 1XMQQ 4XYOA 4FXDA 3AQQA 1TS2A 3D8GA 1RJTA 1OXSC 1EQRA 3EN2A 3T13A 4LF4L 1JCKB 5GAEC 1G6ZA 2JEBI 3N6RA 1TY0A 2R93H 2NVYH 2KHIA 5E3FA 2AMCB 2PQAB 2I07B 4GLAC 3CQZH 3DHQA 1RTNA 3NTKA 4IFDI 5IT9E 1PH1A 1PH5A 4KKUA 1EYCA 4LF7Q 1XNRQ 1YNJC 2GN5A 4O42A 5C44B 2EYFA 4PQXA 4WJ4A 1B3QA 1F9PA 4JBWA 1CZWA 1NNXA 4NB3A 4I65A 4LWCA 1X6OA 2M2LA 3GQBA 3NWSA 4RKLA 1K3BC 1FJGQ 1R9TH 2PNRC 2J4XA 3T16A 2Z6KC 3HOYG 1YNJD 2RHSB 1X54A 4A3CH 2K04A 1X3GA 4CBVA 4ME3A 1BDOA 2LMCB 4BBRG 3I73A 2L1BA 1S5FD 4BBRB 4ZLTF 2IJ0A 4RAUC 2F0SA 4A3GG 1FYCA 1S5DD 3A8KE 2NWGA 4GKJQ 5A35A 3CC2A 5JJKA 4PZ6A 4HIOA 1XPOA 5GROA 4KTAA 2Z8LA 3HKSA 1BCPB 4DV5L 3CW2C 1VF5C 1PH7A 4LAAA 1WCMH 2F0VA 5M5XB 3M7GA 3HOXB 2F0QA 1SFOH 5KYLA 1KIXA 3PO2B 4QUFA 1X3PA 1ENAA 4HEDA 1BXTA 1JE5A 5IYCH 1Q8IA 2YTXA 4K14A 1I4GA 2WB1G 1TU2B 2R93B 2NVYB 1N8RC 1CSPA 3RN5A 1E3PA 2O5IC 1NMGA 1RDPD 3W1GA 2JXMB 1HNXQ 1OXTA 1Q3LA 4MTNA 5C3EH 4BWGB 3CQZB 1BCPF 4GLXA 4C3IH 2OF1A 1TXYA 3EFXD 4GLVB 4IFDJ 5EKIA 1OXXK 3NTIA 1IYVA 4QCLA 3MC0B 2R6GA 1IBLL 3J81L 4DV3L 4RH6A 4FNFA 3PF5A 3TQYA 2OXPA 4DXFA 4DV4L 1X56A 4QB4A 1R9TB 4QGUA 4K2LA 4UHVA 3X3MA 5ELEA 4P2CB 2VQEQ 2R7ZG 1F77A 1VQEA 5T1IA 2VNUD 2F0HA 2VXWA 3E5SA 1FNWA 2ZJQA 4M1UB 5IGDA 3KLRA 2SNMA 4FF2A 1R4PB 1KLGD 3OIQA 3HZXA 1KNAA 5LMUQ 1LTLA 3HEJA 2MUYA 4A3FG 1WCMB 1RKNA 1JJCB 5BN3A 3K5NA 5ELCA 1TS3A 3VA7A 4V190 1SFOB 3S16H 4ZQ3A 1IL8A 1LT6D 4DA2A 3S1MH 4K2KA 4A3JH 1SMYC 1A62A 1C7YA 1QVGA 2JA8G 1QG7A 3ITPA 5GAHC 3F2DA 1LT5D 1JR0D 1EIHA 3VR2A 2Z9HA 1OXUA 1KNEA 3D4DA 1STBA 4E6IA 4X64L 5C3EB 1SMYD 4KY7A 2WV6D 1U4MA 3UE1A 3J80i 3T4AC 3JAMi 4C3IB 3HOUH 1N33L 3R2IA 3EVQA 3VYUA 4DAPA 2F0IA 3C2PA 1HUMA 1YITA 4QIWE 1EEID 3L9AX 1O7YA 2EZVA 2KOLA 1EFID 1WD1A 3I8ZA 2HDMA 4YCWA 4LFCL 3G71A 4FDBA 5J39A 4WRDA 2SEBD 1CHPD 3EIVA 4WORA 1Q8KA 2NN6G 2K14A 1BNZA 2UXCL 3RNUA 1E1TA 1YI2A 3PUVA 5CYUA 4LF7L 3DWAA 4AH6A 4EX5A 3C46A 4DR4L 3GV3A 4JV5Q 1Q81C 4FF3A 4JI8Q 4HMIA 1HCZA 3FPUB 2WKDA 5GAGC 1W6JA 3A54A 1G51A 3A5ZB 3I3CA 2HD3A 2X69A 3KBGA 2BCOA 3S16B 3CPWA 2AQ1B 1K0SA 1IYJB 3U4ZA 3K59A 3S1MB 4A3JB 3PF4A 3BDLA 3CCVA 4XT3B 4OELB 3CRLC 4Y52H 2ZM6Q 1FL0A 4R4TA 2C35B 5LL6X 2MO0A 5KNCA 1VQ6A 1GUOA 4WJ3M 2B2YA 1Q86C 3DUZA 3ER0A 4K5WA 4R4QA 1QB5D 1RD9D 1VQMA 1A15A 2YV5A 5AFWA 3HOUB 3HOWG 2FXQA 1B4OA 4JOIA 4JVZA 2XWBB 1SE2A 3RN2A 4YWLA 1EU3A 1GUSA 2RSNA 4LK1C 1C48A 1I6VC 4MN3A 5FLMH 3J7A5 2F4IA 3F2CA 1Q90A 4G7OC 1B50A 4A3BG 3QJYA 3KUPA 4IPDA 4DR5Q 5BN5A 1V43A 4RCOA 5C5LA 2EOTA 3PO3G 3H09A 4K0KQ 1H9KA 3IFTA 2MJ8A 1EYDA 4LW1A 5FKAC 5DM63 4A3DH 3I4NG 1N32Q 4RFBA 3H3VH 3SHLA 3JAMc 1A63A 3J80c 2JA6H 1X3QA 4LFAL 1PH9A 2UU9Q 1AEXA 3NSWA 1EY5A 1GVPA 1TS5A 2Z1CA 2KQ3A 2KECA 3E9IA 5HY6A 2KBNA 4LMQD 3OHXC 2JA5G 4XQJA 1XNQQ 2EXZA 1QNKA 3Q8DA 1U0LA 3D31A 4CGYB 3T1YQ 1LACA 2LKVA 2RDFA 4JI1L 1HQMC 1CSQA 1SJED 2UUCQ 4YHHQ 1G6PA 5JPMC 4RG1A 4ZUIA 2AWOA 4JI3Q 5LMUL 1HR0Q 3K8AA 3NEMA 4RA8A 3STBC 2QILA 2B2TA 1JICA 2VW9A 5K36G 3UDFA 1JWUD 3PIPA 5D65A 3LNNA 4L63B 3NK9A 5IGCA 4GNXB 2IHFA 2RVLA 1CK1A 2UUBQ 2A69C 4BBSH 4L8JA 4KD4A 1EY9A 4NPSA 2BDNA 3STBD 1SNMA 1IL2A 5I6YA 3OW2A 1KHIA 4DNRB 1ET6A 5BR8Q 4LF5L 4Q0FA 1HZAA 1PTOH 1X32A 3NPPA 1H9MA 2XSCA 1VQGA 2Q2IA 4HIDA 1RHPA 1STYA 1UNSA 2NZOA 5CV7A 5EQ0A 4PMCA 1MBYA 5G3LD 4A3DB 1I50H 3KLSX 1DM0B 3PUXA 5CV6A 2WINB 2R61A 4Y7NH 5IYDH 2A1AA 2XTIA 3E3XA 3MZ5A 5FLXL 3ULPA 2JA6B 3FVQA 1QZGA 1CTMA 1VDZA 2A68D 1JQYD 1X65A 1FVIA 1CA5A 2PQEA 1CHQD 1LLRD 2RQXA 2QDLA 3GTMH 5JEAJ 1HNZQ 3RUZA 3J7YW 3OW7A 4B3RQ 2B29A 3PSIA 1DOLA 2F0UA 2SDFA 4CJ0B 3KLWA 1Y1WH 1QILA 1SRUA 5CMDA 3ND9A 3TSSA 3QOLA 3K5MA 1PRTB 1E2WA 1KRTA 2Y0SB 1DGSA 1MJCA 4JBMA 1FGBD 4B3MQ 3GTGH 4J8QA 5I2XA 1QVFA 1P8LA 2ICEC 2L4NA 4DR6L 4LF8Q 2KHJA 1L1OA 5CBAE 1EY0A 1SEBD 5IYBG 1HUNA 2EY1A 3S15H 2EYPA 1UEBA 4OGQC 4XT1B 4HSVA 4BBSB 3VR4A 1RIPA 3QR8A 2RKSA 1JE4A 2K5DA 2EYJA 2WFWA 2VB2X 3F8TA 1PRTF 4OONA 5FO7B 1Q82C 2Z6BA 1PTOB 1NSNS 3KFUA 1H9SA 2KCCA 2PI2E 3K81C 4X62Q 3KYHC 1PHJA 1SXTA 1STGA 3GP7A 1PH2A 1I94L 1A2UA 1QWYA 1I50B 1HNWQ 1S72A 3DM3A 4Y7NB 4BA1I 1VF7A 3Q22A 2F0DA 5ISRA 1Y1VG 2Q8TA 3Q23A 5C6AA 4UDUC 1XPRA 1TWCH 3GTMB 1C9OA 2PZTA 3D0FA 2QKIC 4A3IH 1T5EA 2RCFA 4DUYQ 3J80E 1BVSA 1Y1WB 3VR5A 4A93G 2L11A 1VQ7A 1D5XC 3J7AF 1E24A 3DXJC 3FP9A 2HQLA 2R3ZA 1VQCA 4QL5A 2J0TD 5EAYA 4A3EG 4IJHA 1IZ6A 2L9HA 5ELDA 3GTGB 2HUGA 3HOVH 1GUNA 2WAQG 3WOFA 1DJRD 2F0JA 2K50A 1IW7D 3CCUA 1XMOL 1BBXC 2D0OA 2HT1A 5M5YH 1A6XA 1ENCA 3S15B 4RCNA 1XNQL 1LTSD 3IAYA 4EQNA 3TREA 5C0XI 5C4XG 3BJUA 3T1YL 5K5PA 4IOCA 3ZJYC 3IRBA 4CKBA 4YHHL 3LX0A 3FRPB 3SK4A 2A6HD 3HKZG 5CBEE 5KYIA 1CKNA 1CKMA 1WTPA 1PZKD 4IQZA 3KF8B 1TY2A 1PFBA 3OMCA 3RZDH 4IUVA 5M9OA 4Q5VA 1CQVA 1PVOA 1PYBA 4A3KG 1PH4A 4OWTB 1A3UA 2F52A 3I70A 3W2DA 1BO0A 4FVMA 2XN9C 1SAPA 4K8JA 5JOBA 3OMGA 3K5LA 2ZJPA 4EQ5A 3H15A 2E5LL 2VQFQ 4J15A 4DK3C 4LF9L 1HZCA 3PUWA 4OX9Q 4XIGS 4GN3B 1TWCB 5IODA 4A3IG 1QJOA 4BY1G 3OOCA 4A3IB 3BU2A 2DJGC 1K3RA 2ZXOA 4DAYA 4TQUS 5EJWA 5C5MA 4JOIC 3HOYH 1PZID 3H6MA 4RGMA 1D1IA 4IFDG 2PCFB 1SDFA 3K80C 1O80A 1O7ZA 4DR3Q 3I4MG 3N52A 3HOVB 4R4CA 2QGQA 3PMFA 4CJ1B 1D5MC 3S17H 4WJWA 4LF6L 1Y8OB 4A3GH 2AWNA 4KHPQ 1SYFA 3CCLA 1QUQB 3NXWA 3SK8A 1VQNA 1UE7A 1VQ4A 5M5YB 2X6LA 1PXUA 4I7AA 1HNZL 3L2PA 3A55A 3Q6SA 4F7XA 3T1HL 3PIO3 1YHAA 2CVRA 4IPHA 4YCUA 4K5VA 5C0XJ 3MEFA 4DAVA 3CC4A 4RGTA 2KEEA 4JI6L 2D0PA 4TSSA 2B63G 1X3EA 5AJ3Q 3KDFA 4B08A 2NZ1D 2LSSA 4KKTA 2B2VA 4H44C 4LF8L 5EBDA 2EJMA 3RZDB 3AFPA 3DMUA 1CQFA 1QE6A 2B8FA 1CI3M 3ERQA 1V9PA 3T53B 2PMZB 2I5MX 4NXNQ 1EU4A 1MD2D 1N36Q 4JPBW 4JI0Q 1LT4D 4GN4B 2KUMA 3PIP3 2B3GA 3FKIG 4HJAA 2K6AA 4A3LG 4X3SA 4H02A 4KN7C 4JI7L 4IOAA 4YIJA 2CQAA 5J1ZA 1B53A 2X6GA 3W3AA 2B2TC 4UPAA 1Y69U 1RL2A 1TWGH 4NW2A 2K03A 1G8ZD 2LXJA 3QB3A 3A5UA 1ILQA 1AZPA 3GTQH 5GADC 3HOYB 2D9UA 5EBCA 1BCPC 2R7ZH 1VQIA 1EIYB 1B2TA 1JOQA 1LTID 3ICEA 3P7JA 1UE1A 3A8IE 3SE0A 1NJIC 2CWAA 4CDFC 3S17B 4A75A 1W3SA 1SNDA 4A3GB 3D6CA 5FJ8G 4DV7Q 1I5FA 5IE8A 3M7NA 1BCPD 2WACA 4A3FH 5D3IB 1PFNA 3TDQA 3URYA 1W2BA 4NP5A 1K83H 4DV2L 3VYTA 2L12A 3P20A 1SJHD 4HAEA 1WOCA 2D5DA 3RMHA 3BDCA 4YWMA 3MA2B 3M4YA 2JA8H 4H13C 3J81E 1K9MC 1IXRA 1SYCA 2WB1B 1JOKA 2DNEA 4JYAQ 3I4OA 1ESFA 1Q1BA 1VQ8A 3LWEA 4F8MA 1A8VA 3ND8A 2CH4A 1K73C 3U9OA 4DR1L 1XTCD 3MXNB 3C1FA 5D14A 3I56A 1YNNC 3K0YA 4G57A 2Y0SE 2KJXA 2O4XA 4FF1A 4KV6A 2PW5A 1F9SA 2DNCA 4GZYC 1HTLD 4JI5Q 4RHRA 1PMRA 1L1OC 1TWGB 1L0WA 3GTLH 2DY8A 3TN2A 3NBHB 5E4XA 3OPOA 1UE5A 2OQKA 3U50C 4V0BA 2NN6H 3GTQB 3HOZG 1YNND 4JI2Q 5L37A 3EROA 1S5BD 1HZ9A 2ASBA 1UAPA 2R7ZB 2H4OA 2F0GA 2VB3X 2F0WA 2K5HA 1PH3A 3CCSA 4X66L 1S3OA 2KVMA 3PCOB 1IYUA 4X6AH 2NVXH 1JC7A 4ZCKA 5NUCA 2DGYA 4A3FB 2DJFC 1I3QH 1PH6A 1K83B 1WTHA 1MIUA 1KTKA 1LV9A 3D4RA 3S1QH 4B9WA 1R4QB 2IL8A 1KC8C 2ZTCA 4AQYL 2EY5A 4DR3L 2OWOA 1HQRD 5M5WH 4GS3A 5IGEA 4IUTA 1J8IA 3JC66 2JA8B 4KHPL 2B8GA 1UE6A 4NMZA 1VMCA 4L6TB 3M9BA 1LO5D 3W5OA 5CV5A 3NQIA 3S14H 3VYSA 1XMQL 4ZYSA 1V1PA 2OCEA 1WTVA 3HOWH 1VQDA 1F2LA 1VS0A 4KHVA 5FO9B 2F0MA 1HTPA 2KENA 2F0PA 4PG3A 2CHBD 4DV0Q 1EYGA 3GTLB 4A3BH 1T5XD 2NYZD 1Z47A 4ZUJA 3AMUA 1PLFA 2LS01 1U5KA 3KF8A 3M4QA 1XNRL 2JN4A 3PO3H 2K5NA 3K6OA 3CCQA 5FO8B 4GOPB 1KDCA 1NE3A 3ULJA 2TMPA 3EJIA 2NTTA 1HR0W 4QUCA 1FJGL 3I4NH 4ILWA 3TS2A 4C1NI 3OWEB 2NVXB 1JT8A 1ENFA 2DY7A 1B9MA 1WTRA 1GM5A 1LUZA 1K8MA 2F3WA 3RD4A 4HCEA 1I3QB 2GVBA 3QIAA 1J5EQ 4DR7Q 3S1QB 3I2ZA 3MAQA 2A5HA 2JA5H 2NVQH 5M5WB 5CV9A 3G6JB 4GKJL 3FDTA 1Q12A 2B2UA 1N9WA 1UWVA 1B44D 3MTSA 2F0EA 1VQKA 3L7ZC 2YYZA 1RCVD 1CUKA 4TVAB 5FK9C 4O0AA 1Y8PB 5K36H 1W6KA 3S14B 5JEAG 1XTDA 1UUPA 3U9SA 4F88A 1KD1C 2D62A 2I5HA 3HOWB 2EQSA 1K28A 4AYBG 1I4HA 3OTOQ 1I6HH 2YU9H 1TWFH 4DGZA 1X55A 2PPBC 4QY7A 2E2IH 3KJPA 2SNSA 1E7ZA 2ZTEA 3LGJA 2LFNA 4B3TQ 5D3DA 2N8NA 1HNXL 4K8IA 5EPKA 4EQPA 4DK0A 4FF4A 1K8GA 4A3BB 5KIXA 3H94A 1B3AA 2KCMA 1CKOA 3PO3B 1LTBD 1LTGD 3CRKC 4DUZQ 4N8X1 2RBMA 1XJVA 2PQAA 1HFNA 3PIOA 2F0LA 3I4NB 3R93A 2K52A 2ZJRA 3RLOA 4A3MG 2B2VC 2V1CC 2K5WA 4O2DA 5IY0A 1STAA 1Q1EA 3NBIA 4GKKQ 2VQEL 4K5XA 3FPPA 1MSGA 3S24A 1Q46A 1IBKQ 2XRSD 2PMZE 3CHBD 4RMFA 4XDXA 4XQNA 1WTOA 5CR3A 1H95A 2JA5B 3SEBA 5HGQA 4DV6Q 4LUVA 2ATWA 2NVQB 3TP5A 3T51B 3WWVA 5HGTA 3R2TA 1JJ2A 2F1MA 2OEOA 1EIGA 5M3MG 2FMMA 3J7AV 2IT1A 1VQ9A 3CCJA 3G4SA 5KNDA 2RHQB 2ZXRA 2LY7A 5IYBH 1KLUD 3AFQA 5E4WC 1BOSA 4JBJA 2HIVA 3CP0A 1I6HB 2YU9B 1TWFB 1PFSA 3G6EA 4X65Q 2E2IB 4P75A 2F0OA 4A76A 1HA5A 1G2SA 1GUGA 1U4PA 1HH2P 2BH2A 2IPKD 2CWPA 4KY5A 2GVAA 5FLXE 1YJWA 1TWAH 1FD7D 1CT1D 3HGBA 2A68C 4R8NA 4ZAIA 2NVTH 5JVH3 3WDNA 2WP8J 2QEJC 3RLFA 1AN8A 1HXYD 4U673 4JI4Q 1D2BA 3TBIB 4LFBQ 1L0YB 5C3WA 2FHTA 3LWUA 2M00A 1TR5A 4BXXG 2H1EA 5ELBA 3J81i 1DCZA 4YY3Q 3VDYA 4DV0L 2BE5C 1G2TA 2G9DA 4JK1C 1Y1VH 2WB1E 1LTTD 4K6DA 4DR2Q 5BN4A 4M8AA 3H0GG 2PZWA 2JA9A 4G7ZC 2UXDQ 3S2HH 4JV5L 4JI8L 2A6EC 1J9OA 1KQSA 3C3LA 4A93H 2VL6A 1AH9A 1VQHA 4C3JG 3IFDA 1X9NA 2BE5D 2Q2UA 1PRTD 4XXEA 3U4VA 4A3EH 4DXGA 4H0LC 1EYAA 2SOBA 2EXDA 4HJ9A 4O1NA 4HJ5A 1NBWA 1A2TA 1IBMQ 2A6ED 2Q8RE 4DR7L 1IKLA 1BBWA 1EFWA 2BA1A 1Z9FA 2PI2A 2ZM6L 1SN8A 2MO1A 1ET9A 5C4XH 5IGBA 5FOBB 1SNOA 1STHA 2OQ0A 4NXMQ 5IOCA 3J81j 3S1RH 4XTCS 4NKLA 3I90A 2J7ZA 4LF4Q 2EYLA 3MHBA 1DXMA 3GTKH 2UXBQ 3NUCA 5IP7G 4HJ7A 1MGSA 2NZHA 1TWAB 1U4RA 3VR3A 1PV4A 3TEHB 4HR7B 2F0TA 1JWMD 2NVTB 2WKCA 1O78A 2YTYA 2ZT9C 1EWIA 4DV1Q 5C0XG 3AU7A 4A3KH 1IKMA 1ZKOA 1YIJA 2KA7A 3CXCA 4P73A 2N55A 2CH4W 1EOVA 4UP7A 4P74A 3BYYB 4C3HG 4DF7A 2K4KA 4KI0A 3NQTA 4DR5L 1Y1VB 2KCTA 3V96A 3A7LA 2JEAI 1IW7C 4K0KL 4OHJA 1GOZA 4UAIA 1PTOF 2E2JH 4BY1H 3S2HB 2D2CC 2EY2A 4U68A 4A93B 3GTOH 2L15A 1EZ8A 5KNBA 4RHSA 4BS9A 2R92G 1N32L 4IFDH 3L0OA 2N78A 5A2QL 4A3EB 1VMPA 4UP9A 2UU9L 3I4MH 1SLJA 2V4DA 3GTJH 2WAQB 2A6HC 4IUNA 4GOPA 3KK7A 4DV5Q 1RF2D 2RCNA 3SGIA 1SYGA 1IHZA 2IX0A 4HN7A 4DNTB 4DV6L 4OO1G 3J81c 1J6QA 1I4XA 5C4XB 3F2UA 2UUCL 1GXDC 3CCMA 1PYWD 1QOHA 3S1RB 4JI3L 1HR0L 1SE8A 4C1NK 2A19A 1VQAA 3HKZB 5CV4A 2OTJA 2DN8A 4FP5D 3GTKB 1B1ZA 3SXHA 2B63H 1S5CD 3JAML 3HS0C 1SYEA 2QDBA 1H9JA 4JW0A 3M85A 2JYOA 1FNVA 1YVCA 3TP6A 2JA7G 2UUBL 5M3FG 3AB9A 4IPGA 1HRJA 3CMEA 3UI2A 4A3KB 1YJNA 1L2FA 4CDDC 3DWQA 5JJZA 1X3FA 3MEHA 3VYRA 1IBLQ 3NHHA 2MFIA 4DV3Q 3S2DH 5BR8L 1KDAA 1GUTA 2E75C 3BYTB 5ELOA 3KF6B 1WYDA 1ILPA 3FKIH 2B2UC 3CAMA 2XWJB 4A3LH 4DV4Q 3E0EA 1SR3A 2VUMG 3WOEA 1SNPA 4BY7G 1LTRD 5LMNQ 4OO1I 1U4LA 2BA0A 2ZXPA 4BY1B 2FMCA 2E2JB 3MVVA 1P16A 2H5XA 5DNFA 1CFMA 5I4DA 3GTOB 5EPJA 3TZUA 4ABNA 4LFBL 1D1KA 5IIFA 3I4MB 2NBFA 3VA5A 3GTJB 1EY6A 3BS1A 3SK6A 3CD6A 1HHVA 2AUJD 3SR1A 3DWPA 2PNHA 3PQIA 2TSSA 4FXGC 5FJ8H 1B70B 4B3RL 2BH8A 2Q8IB 2EJFC 1GHJA 2NTSA 1E22A 2ID0A 2I46A 3CF5A 4B3ML 2Z0SA 2AQ3B 3MWYW 1F2ZA 4F87A 1YNXA 3FHWA 2MP1A 3SVMA 1MJEA 1S5ED 2B63B 2JQOA 1C8CA 2AUKA 1Z6HA 1IBML 1XPUA 5IP9G 4BA2I 2MGSA 5HURA 4X64Q 5F2DA 3R8BA 4HMJA 4J1MA 1N33Q 2CCZA 2MHVA 5DM73 3B6YA 2N3SA 4NXML 2FFKB 2EYOA 1BR9A 3S2DB 3A74A 4GNXA 2Z4IA 2UXBL 2QW7A 1B8AA 1GO3E 1SBBB 2F3VA 1WJJA 3FKIB 4LFCQ 3UE0A 1XWEA 4B9XA 4KMUC 4X62L 5J3BA 2UXCQ 2OT2A 3U58A 1O7IA 3M4PA 4P71A 1WTXA 1GKHA 5C44G 1FNUA 4DV1L 1KXLA 1AW7A 1V1QA 3ONAB 3OSOA 4DR4Q 1HNWL 1SNQA 1VQOA 3G7LA 3HOZH 4FXKC 1EWHA 4UY8C 2K01A 1JWSD 3EA6A 4UP8A 1EIFA 4TRDA 2K32A 2MQHA 1A3VA 3AYHB 3ULLA 5IT9L 4POGA 4JBKA 3GD7A 2F03A 4NDXA 4DUYL 5I6WA 3KJOA 2ALYB 2LXKA 2K28A 1ZXTA 2R7DA 4YWKA 1BKBA 1SYBA 3K5OA 1M1KC 1RODA 3PV0A 3FEWX 4RGOS 3L3OC 4B3SQ 1ONLA 1RTOA 2JJQA 3HOXG 4CDCC 1M4VA 4ID6A 2OTLA 1EY7A 4JC0A 3D4WA 1WTWA 2AQ2B 5KEEA 3PO2G 2N49A 3M4OH 5C4JH 1HPCA 2K5QA 1YJ9A 1K8AC 2ES2A 2BOSA 4H7BA 4IALA 5DLQE 4R8IA 3GV6A 3M3YH 1OO9B 2R93G 2JP1A 4QJFA 2RA4A 1V1OA 1PZJD 4XYQA 4ZK9B 1PH8A 4CKEA 2IY5B 1Z7TA 4CDEC 3PGZA 4QF4A 2IHEA 1GJXA 1LT3D 2CW0C 1MKHA 1N34Q 1II3A 1HFGA 3VR6A 4P72A 3RZOH 1SE4A 3MXUA 3HOZB 1QCBD 1EWCA 3A56A 3HP3A 3DEPA 1KAAA 2VQFL 1VQJA 5C3XA 3F2BA 4KJNA 4OX9L 4LFAQ
chains in the Genus database with same CATH topology
3MXGA 2CW0D 2IWHA 2A73B 5E1FA 4HTHA 4Z9CB 1LABA 3OWFA 5I2YA 4C56C 3NP8A 4PV1C 1AZQA 1ZEQX 1EOTA 2L55A 2EYMA 3DM1A 2F0NA 1WD0A 5C4ZA 2K1BA 4CJ2C 1JB3A 5DAUA 1ML0D 5LHY1 2N88A 1NR2A 4ME5A 4MHEA 1NR4A 2EJGC 3M4OB 4IUUA 5C4JB 2A74C 3QG1A 5JEAH 4FO2A 1H9SB 1TVXA 3M3YB 4KHZA 2GA4B 2WIIB 4KK7A 2E2DC 3HRZC 2B2WA 5KRUA 4C3IG 1F9QA 4KY6A 1C4QA 4ZKCB 3FMCA 1NCVA 1MSHA 4IURA 3A7AB 1F2YA 2E76C 4PMWA 3IKJA 3RZOB 1DOMA 3Q0AA 2O5JC 1A3TA 1TT2A 1D5ZC 2C5CA 2NB0A 4N9TA 1GHKA 3I4LA 1OXVA 2PW7A 1B9NA 1DOKA 1F2MA 2EY6A 4G7HC 1M8AA 2E74C 1O7LA 2G9HD 1SE3A 1SSOA 2EVBA 1I4PA 2C9OA 4FYDA 5JVG3 3MXPA 3K58A 3P75A 1I4RA 5EKKA 1JOOA 2EE1A 1FR3A 1PFMA 3E6ZX 4I7ZC 1L0XB 4AYBB 1E0BA 4EVOA 3KLSA 2NN6I 3MFGA 2K7VA 4X3UA 2JE6I 3K7AB 2XRQD 4KJOA 4X3TA 4OIJA 1H9RA 2HCCA 2F0FA 5EPLA 4IN3A 5I9OA 5T1GA 3S9WA 4A3MB 2FINB 2BDOA 2QCPX 5IGFA 1STNA 2XVSA 1WVLA 2PO4A 2FJ2A 1DZ1A 2XNAC 3BVMA 2ENBA 2NUCA 4J6HA 1U9RA 1SYDA 4ULLA 4RWSC 1V8QA 5M3MB 4EQOA 4ZKBB 3ZYYX 2EPBA 1EQVA 4XQQA 3Q24A 1K8OA 3QOJA 3TZDA 2IX3A 3BZDB 4RKBA 2B39A 1TKWB 4N9PA 3EQLC 1DYQA 3H3VC 1EL0A 5CORA 4LJZC 1MI2A 3D3RA 3QO2A 1KABA 1XX8A 1SNCA 5C0XH 2ICIA 3R3OA 3MXNA 2KEDA 3K57A 1CA6A 1D6EC 1DD2A 2A69D 1PRTC 3C1EA 1STEA 2KHSA 1PDQA 3O13A 3PUZA 1LTAD 4PMBA 3HG9A 3H0GB 5CV8A 2KCNA 3TP7A 1ZYRC 1G291 3X3NA 2XIWA 3NBHA 1VCIA 5C4HA 4IUQA 4C3JB 3BG3A 3IL8A 3A8JE 3H91A 2PYKA 1DONA 1ZYRD 4PNYA 2RDHA 4CHTB 3KBXA 5G3LF 1UEAB 1TIID 2HQEA 1JORA 1PTOC 3PUYA 2EYHA 1EQTA 4OO1H 4HCSA 3DEOA 2E2HB 2PZUA 1TS4A 1BF4A 2IX1A 3S1NB 5CGKA 1Y8NB 2IW3A 1TQOA 2F0KA 5LL6S 5CC4A 5JAVA 1PTOD 4G4KA 1NAPA 3P1HA 3T56B 3MFYA 2K05A 5JPNC 4DU9A 1KDBA 1ICWA 2MPMA 3NTHA 4C2MB 5A2QE 3E0JA 2Z4HA 4C3HB 1QNUA 2M9VA 4DK1A 1S4ZA 3CU7A 2QF7A 5DEHA 5ELFA 3GTPB 4EGVA 1E2VA 3GO5A 3I72A 4DN4M 3BDOA 3NE5B 2HDLA 2R92B 4CKCA 2L5TA 4KN4C 2JSOA 2B2WC 3BVZA 5EKLA 3BVGA 5EGTA 3JAME 2K33A 3NWTA 2RDGA 4QIWB 1G91A 2RSOA 5COYA 3V05A 1GUWA 4QMGA 4S3SA 4TKOB 5J22A 1WTQA 4OIKA 2L0CA 5I9PA 3OIPA 3I91A 4RGNA 1V1PB 1ESRA 3J80L 4K6LA 2EDGA 1BUVT 3D6WA 4ODGA 4HSPA 3QWNA 2JA7B 5M3FB 4R9WA 3TMEA 5TSSA 1XXGA 1HA6A 3CKIB 4WFN3 4IZ8A 2HCIA 2VUMB 4BY7B 1XYIA 4IUPA 1CM9A 4X3KA 4KKSA 1AP0A 4OL7A 2B2YC 1I4QA 1EEFD 4DFAA 1E2ZA 5IGGA 3SK5A 4KD3A 5KGUA 2O2LD 3TP8A 1EY4A 1NUCA 1TWHB 4ZRZA 1BQQT 3SDZA 1EY8A 1AFPA 1EZ6A 3V2TA 1CZGA 1F9RA 4MIUA 4XYOA 4FXDA 1TS2A 3D8GA 1RJTA 1OXSC 3T13A 1JCKB 1G6ZA 2JEBI 3N6RA 1TY0A 5E3FA 2I07B 3DHQA 1RTNA 3NTKA 4IFDI 5IT9E 4KKUA 1EYCA 1YNJC 4O42A 5C44B 2EYFA 4PQXA 1F9PA 4JBWA 1CZWA 4I65A 2M2LA 3GQBA 3NWSA 4RKLA 2PNRC 2J4XA 3T16A 1YNJD 2K04A 4CBVA 1BDOA 2LMCB 3I73A 2L1BA 1S5FD 4BBRB 4ZLTF 2IJ0A 4RAUC 2F0SA 1FYCA 1S5DD 3A8KE 2NWGA 5A35A 4KTAA 2Z8LA 1BCPB 1VF5C 4LAAA 2F0VA 5M5XB 3M7GA 3HOXB 2F0QA 5KYLA 3PO2B 4QUFA 1X3PA 1ENAA 4HEDA 1BXTA 1Q8IA 4K14A 1I4GA 1TU2B 2R93B 2NVYB 2O5IC 1RDPD 2JXMB 1OXTA 1Q3LA 4BWGB 3CQZB 1BCPF 2OF1A 3EFXD 4IFDJ 5EKIA 1OXXK 3NTIA 1IYVA 4QCLA 3MC0B 2R6GA 3J81L 4RH6A 4FNFA 2OXPA 4DXFA 4QB4A 1R9TB 4K2LA 3X3MA 5ELEA 4P2CB 1F77A 5T1IA 2VNUD 2F0HA 2VXWA 3E5SA 1FNWA 4M1UB 5IGDA 3KLRA 2SNMA 4FF2A 1R4PB 1KLGD 3OIQA 3HZXA 1KNAA 3HEJA 2MUYA 1WCMB 1RKNA 5BN3A 3K5NA 5ELCA 1TS3A 3VA7A 4V190 1SFOB 4ZQ3A 1IL8A 1LT6D 4DA2A 4K2KA 1SMYC 1QG7A 3ITPA 1LT5D 1JR0D 1EIHA 3VR2A 1OXUA 1KNEA 3D4DA 1STBA 4E6IA 5C3EB 1SMYD 4KY7A 2WV6D 1U4MA 3T4AC 4C3IB 3R2IA 3EVQA 3VYUA 4DAPA 2F0IA 3C2PA 1HUMA 1EEID 3L9AX 1O7YA 2EZVA 2KOLA 1EFID 1WD1A 3I8ZA 2HDMA 5J39A 4WRDA 2SEBD 1CHPD 4WORA 2NN6G 1BNZA 3PUVA 5CYUA 3DWAA 3C46A 3GV3A 4FF3A 4HMIA 1HCZA 3FPUB 2WKDA 1W6JA 3A54A 3I3CA 2X69A 3KBGA 2BCOA 3S16B 2AQ1B 3K59A 3S1MB 4A3JB 3BDLA 4XT3B 3CRLC 5LL6X 5KNCA 1GUOA 2B2YA 3DUZA 4K5WA 1QB5D 1RD9D 1A15A 5AFWA 3HOUB 1B4OA 2XWBB 1SE2A 1EU3A 1GUSA 2RSNA 4LK1C 1C48A 1I6VC 4MN3A 2F4IA 1Q90A 4G7OC 1B50A 3QJYA 3KUPA 5BN5A 1V43A 4RCOA 5C5LA 2EOTA 3H09A 1H9KA 3IFTA 2MJ8A 1EYDA 5FKAC 5DM63 4RFBA 3SHLA 1X3QA 1AEXA 3NSWA 1EY5A 1TS5A 2Z1CA 2KQ3A 2KECA 4LMQD 3OHXC 4XQJA 2EXZA 1QNKA 3D31A 4CGYB 1LACA 2LKVA 2RDFA 1HQMC 1SJED 5JPMC 4ZUIA 2AWOA 4RA8A 2QILA 2B2TA 1JICA 5K36G 1JWUD 5D65A 3LNNA 4L63B 3NK9A 5IGCA 2RVLA 1CK1A 2A69C 4L8JA 4KD4A 1EY9A 2BDNA 1SNMA 5I6YA 4DNRB 1ET6A 4Q0FA 1PTOH 1X32A 3NPPA 1H9MA 2XSCA 1RHPA 1STYA 1UNSA 5CV7A 5EQ0A 4PMCA 1MBYA 5G3LD 4A3DB 3KLSX 1DM0B 3PUXA 5CV6A 2WINB 2R61A 3MZ5A 5FLXL 2JA6B 3FVQA 1CTMA 1VDZA 2A68D 1JQYD 1CA5A 2PQEA 1CHQD 1LLRD 2RQXA 5JEAJ 3RUZA 3J7YW 3OW7A 1DOLA 4CJ0B 2F0UA 2SDFA 1QILA 5CMDA 3ND9A 3TSSA 3QOLA 3K5MA 1PRTB 1E2WA 2Y0SB 1FGBD 4J8QA 5I2XA 2ICEC 2L4NA 5CBAE 1EY0A 1SEBD 1HUNA 2EY1A 2EYPA 4OGQC 4XT1B 4HSVA 4BBSB 3VR4A 2RKSA 1JE4A 2K5DA 2EYJA 2VB2X 1PRTF 5FO7B 1PTOB 1NSNS 1H9SA 2KCCA 1SXTA 1STGA 3GP7A 1A2UA 1QWYA 1I50B 4Y7NB 4BA1I 1VF7A 3Q22A 2F0DA 5ISRA 2Q8TA 3Q23A 5C6AA 4UDUC 3GTMB 2PZTA 2QKIC 1T5EA 3J80E 1Y1WB 3VR5A 2L11A 1D5XC 3J7AF 3DXJC 2R3ZA 2J0TD 2L9HA 5ELDA 3GTGB 2HUGA 1GUNA 3WOFA 1DJRD 2F0JA 1IW7D 1BBXC 1A6XA 1ENCA 3S15B 4RCNA 1LTSD 3IAYA 4EQNA 5C0XI 5K5PA 4CKBA 3LX0A 3FRPB 3SK4A 2A6HD 5CBEE 5KYIA 1WTPA 1PZKD 4IQZA 1TY2A 1PFBA 3OMCA 4IUVA 5M9OA 4Q5VA 1CQVA 1A3UA 3I70A 3W2DA 1BO0A 4FVMA 2XN9C 1SAPA 4K8JA 5JOBA 3OMGA 3K5LA 3PUWA 4XIGS 1TWCB 5IODA 1QJOA 3OOCA 4A3IB 2ZXOA 4DAYA 4TQUS 5EJWA 5C5MA 1PZID 3H6MA 4RGMA 1D1IA 4IFDG 2PCFB 1SDFA 1O80A 1O7ZA 3N52A 3HOVB 3PMFA 4CJ1B 1D5MC 4WJWA 1Y8OB 2AWNA 1SYFA 3NXWA 3SK8A 5M5YB 2X6LA 1PXUA 3A55A 3Q6SA 4F7XA 3PIO3 2CVRA 5C0XJ 4K5VA 4DAVA 4RGTA 2KEEA 4TSSA 4B08A 2NZ1D 4KKTA 2B2VA 4H44C 5EBDA 2EJMA 3RZDB 3DMUA 1CQFA 1QE6A 2B8FA 1CI3M 3ERQA 3T53B 2PMZB 1EU4A 1MD2D 1LT4D 2KUMA 3PIP3 2K6AA 4X3SA 4KN7C 4YIJA 2CQAA 5J1ZA 1B53A 2X6GA 3W3AA 2B2TC 1Y69U 4NW2A 2K03A 1G8ZD 3QB3A 1ILQA 1AZPA 3HOYB 2D9UA 5EBCA 1BCPC 1B2TA 1JOQA 1LTID 3P7JA 3A8IE 3SE0A 3S17B 1SNDA 4A3GB 3D6CA 3M7NA 1BCPD 2WACA 5D3IB 1PFNA 3TDQA 3URYA 4NP5A 3VYTA 2L12A 3P20A 1SJHD 4HAEA 2D5DA 3RMHA 3BDCA 3MA2B 3M4YA 4H13C 3J81E 1SYCA 2WB1B 1JOKA 2DNEA 1ESFA 1Q1BA 3LWEA 4F8MA 3ND8A 3U9OA 1XTCD 3C1FA 5D14A 1YNNC 3K0YA 4G57A 2KJXA 2O4XA 4FF1A 4KV6A 2PW5A 1F9SA 2DNCA 4GZYC 1HTLD 4RHRA 1PMRA 1TWGB 2DY8A 3TN2A 5E4XA 3OPOA 4V0BA 2NN6H 3GTQB 1YNND 3EROA 1S5BD 1UAPA 2R7ZB 2H4OA 2F0GA 2VB3X 2F0WA 2KVMA 1IYUA 1JC7A 5NUCA 4A3FB 1K83B 1KTKA 1LV9A 3D4RA 4B9WA 1R4QB 2IL8A 2EY5A 1HQRD 5IGEA 4IUTA 1J8IA 2JA8B 2B8GA 4NMZA 1VMCA 4L6TB 1LO5D 5CV5A 3NQIA 3VYSA 4ZYSA 1V1PA 1WTVA 1F2LA 4KHVA 5FO9B 2F0MA 1HTPA 2F0PA 2CHBD 3GTLB 1T5XD 2NYZD 1Z47A 4ZUJA 3AMUA 1PLFA 2LS01 3KF8A 3K6OA 5FO8B 1KDCA 2TMPA 3EJIA 2NTTA 4QUCA 4ILWA 2NVXB 4C1NI 3OWEB 1ENFA 2DY7A 1B9MA 1WTRA 3RD4A 1K8MA 2F3WA 4HCEA 1I3QB 3QIAA 3S1QB 3MAQA 2A5HA 5M5WB 5CV9A 3G6JB 3FDTA 1Q12A 2B2UA 1B44D 3MTSA 2F0EA 3L7ZC 2YYZA 1RCVD 5FK9C 1Y8PB 5K36H 1W6KA 3S14B 5JEAG 1UUPA 3U9SA 4F88A 2D62A 3HOWB 1I4HA 4DGZA 2PPBC 2SNSA 2LFNA 5D3DA 4K8IA 5EPKA 4EQPA 4DK0A 4FF4A 4A3BB 5KIXA 3H94A 1B3AA 3PO3B 1LTBD 1LTGD 3CRKC 2RBMA 1HFNA 2F0LA 3I4NB 3R93A 2B2VC 2K5WA 1STAA 1Q1EA 3NBIA 4K5XA 3FPPA 1MSGA 2XRSD 3CHBD 4XDXA 4XQNA 1WTOA 5CR3A 2JA5B 3SEBA 2NVQB 3TP5A 3T51B 5HGTA 3R2TA 2F1MA 2OEOA 1EIGA 2FMMA 3J7AV 2IT1A 5KNDA 2ZXRA 2LY7A 1KLUD 5E4WC 1BOSA 1I6HB 2YU9B 1TWFB 2E2IB 2F0OA 1HA5A 1G2SA 1GUGA 1U4PA 2IPKD 4KY5A 5FLXE 1FD7D 1CT1D 3HGBA 2A68C 4R8NA 4ZAIA 5JVH3 3WDNA 2WP8J 2QEJC 3RLFA 1AN8A 1HXYD 4U673 1D2BA 3TBIB 1L0YB 5C3WA 2FHTA 3LWUA 2M00A 1TR5A 2H1EA 5ELBA 1DCZA 2BE5C 1G2TA 2G9DA 4JK1C 1LTTD 4K6DA 5BN4A 4M8AA 2PZWA 4G7ZC 2A6EC 1J9OA 3C3LA 4C3JG 3IFDA 2BE5D 1PRTD 4XXEA 4DXGA 4H0LC 1EYAA 2SOBA 4O1NA 1A2TA 2A6ED 2Q8RE 1IKLA 2BA1A 1ET9A 5IGBA 5FOBB 1SNOA 1STHA 5IOCA 4XTCS 4NKLA 3I90A 2J7ZA 2EYLA 3MHBA 1DXMA 3NUCA 1MGSA 1TWAB 1U4RA 3VR3A 4HR7B 2F0TA 1JWMD 2NVTB 2WKCA 1O78A 2ZT9C 5C0XG 3AU7A 1IKMA 1ZKOA 2KA7A 2N55A 3BYYB 4C3HG 4DF7A 4KI0A 3NQTA 1Y1VB 3V96A 3A7LA 2JEAI 1IW7C 4OHJA 1GOZA 4UAIA 1PTOF 3S2HB 2D2CC 2EY2A 4U68A 4A93B 1EZ8A 5KNBA 4RHSA 4BS9A 4IFDH 5A2QL 4A3EB 1VMPA 2V4DA 2WAQB 2A6HC 4IUNA 3KK7A 1RF2D 1SYGA 1IHZA 2IX0A 4HN7A 4DNTB 4OO1G 1I4XA 5C4XB 3F2UA 1GXDC 1PYWD 1QOHA 3S1RB 4C1NK 3HKZB 5CV4A 2DN8A 4FP5D 3GTKB 1B1ZA 3SXHA 1S5CD 3JAML 3HS0C 1SYEA 2QDBA 1H9JA 3M85A 2JYOA 1FNVA 3TP6A 3AB9A 1HRJA 3UI2A 4A3KB 5JJZA 3DWQA 3VYRA 3MEHA 3NHHA 1KDAA 1GUTA 2E75C 3BYTB 1ILPA 2B2UC 2XWJB 3WOEA 1SNPA 1LTRD 4OO1I 1U4LA 2BA0A 2ZXPA 4BY1B 2FMCA 2E2JB 3MVVA 5DNFA 1CFMA 5I4DA 3GTOB 5EPJA 3TZUA 4ABNA 1D1KA 5IIFA 3I4MB 2NBFA 3VA5A 3GTJB 1EY6A 3BS1A 3SK6A 1HHVA 2AUJD 3SR1A 3DWPA 2TSSA 4FXGC 2Q8IB 2EJFC 1GHJA 2NTSA 2ID0A 2I46A 2AQ3B 3MWYW 1F2ZA 4F87A 2MP1A 3SVMA 1S5ED 2B63B 1C8CA 2AUKA 1Z6HA 4BA2I 2MGSA 5HURA 5F2DA 3R8BA 4HMJA 4J1MA 2MHVA 5DM73 2FFKB 2EYOA 1BR9A 3S2DB 2Z4IA 1SBBB 2F3VA 3FKIB 1XWEA 4B9XA 4KMUC 2OT2A 1WTXA 1FNUA 1AW7A 3OSOA 3ONAB 1SNQA 3G7LA 4FXKC 1EWHA 2K01A 1JWSD 3EA6A 4TRDA 2K32A 1A3VA 5IT9L 3GD7A 2F03A 4NDXA 5I6WA 2K28A 1ZXTA 1SYBA 3K5OA 1RODA 3PV0A 3FEWX 4RGOS 3L3OC 1ONLA 1RTOA 1M4VA 4ID6A 1EY7A 3D4WA 1WTWA 2AQ2B 5KEEA 1HPCA 2K5QA 2BOSA 4H7BA 4IALA 4R8IA 3GV6A 1OO9B 2JP1A 2RA4A 1V1OA 1PZJD 4XYQA 4ZK9B 4CKEA 1Z7TA 4QF4A 1GJXA 1LT3D 2CW0C 1II3A 1HFGA 3VR6A 1SE4A 3MXUA 3HOZB 1QCBD 1EWCA 3A56A 3HP3A 3DEPA 1KAAA 5C3XA 4KJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WOR A;  3OMG A;  5KIX A;  1SND A;  2F3V A;  2EXZ A;  2RKS A;  3D6C A;  3MXP A;  4HTH A;  5E1F A;  2EYJ A;  3P75 A;  2LKV A;  5EKK A;  1JOO A;  1KAB A;  5CV4 A;  2RDF A;  5CV5 A;  4B9X A;  1EY8 A;  2WAC A;  3OWF A;  3SXH A;  5IOD A;  2RBM A;  1EZ6 A;  1SNC A;  4ZUI A;  3V2T A;  2OF1 A;  3NP8 A;  4MIU A;  4NP5 A;  1SYE A;  2QDB A;  1EYA A;  1NSN S;  2SOB A;  4HMI A;  5EKL A;  3R3O A;  5EGT A;  2F0L A;  4KHV A;  2EYM A;  4EVO A;  3OSO A;  1SNQ A;  1A2T A;  3D8G A;  2F0N A;  5C5M A;  3TP6 A;  3H6M A;  3C1E A;  1STG A;  2KHS A;  1STA A;  3BDC A;  5C4Z A;  2F0M A;  5IGC A;  3NK9 A;  1A2U A;  3T13 A;  5DAU A;  2F0P A;  2OXP A;  4K5X A;  3MEH A;  3NHH A;  4PMB A;  3PMF A;  1SYC A;  4ME5 A;  4QB4 A;  4QMG A;  4S3S A;  1JOK A;  4TRD A;  4KD4 A;  5CV8 A;  3TP7 A;  1KDA A;  4K2L A;  4KJO A;  1EY9 A;  1A3V A;  1SNO A;  5CR3 A;  4ZUJ A;  5I9P A;  1STH A;  2F0D A;  5E3F A;  5IOC A;  1SNM A;  1SYF A;  3NXW A;  3SK8 A;  3BDL A;  4NKL A;  4F8M A;  5I6Y A;  5ISR A;  2EYL A;  5C4H A;  3MHB A;  4NDX A;  3TP5 A;  2F0H A;  5C6A A;  3U9O A;  3E5S A;  3NUC A;  3DHQ A;  5IGB A;  5HGT A;  5I6W A;  1KDC A;  1SNP A;  5IGD A;  2F0F A;  4F7X A;  2SNM A;  1EYC A;  3EJI A;  2OEO A;  3C1F A;  2PZT A;  4ODG A;  3MVV A;  2PYK A;  3HZX A;  5I9O A;  2EYF A;  4G57 A;  4K5V A;  2F0T A;  1SYB A;  2O4X A;  4K5W A;  4I65 A;  4KV6 A;  4PNY A;  3S9W A;  5KRU A;  1STY A;  2PW5 A;  3HEJ A;  5CV7 A;  5IIF A;  4PMC A;  4KY6 A;  2F3W A;  4RKL A;  1RKN A;  3TME A;  5J22 A;  5J39 A;  5IGF A;  1STN A;  2HQE A;  4ID6 A;  1JOR A;  1EY7 A;  2EYH A;  3VA5 A;  1EY6 A;  3SK6 A;  2F0J A;  3D4W A;  1F2Y A;  4ZQ3 A;  5KEE A;  2PZU A;  5CV6 A;  3DMU A;  3SR1 A;  3T16 A;  4K2K A;  3MZ5 A;  3ERQ A;  5CGK A;  4DF7 A;  3ERO A;  2F0O A;  3NQT A;  5CV9 A;  1ENC A;  2ENB A;  2NUC A;  4IZ8 A;  1A3T A;  2PQE A;  1TQO A;  3ITP A;  1TT2 A;  4J6H A;  4H7B A;  4IAL A;  4KY5 A;  4EQN A;  2F0K A;  1U9R A;  1SYD A;  2F0E A;  2F0G A;  5CC4 A;  2F0S A;  2F0W A;  5JAV A;  3RUZ A;  5K5P A;  2EY2 A;  3D4D A;  2F0U A;  4R8N A;  4EQO A;  5C5L A;  3LX0 A;  4N9T A;  1F2Z A;  1STB A;  3P1H A;  4KTA A;  3SK4 A;  5JOB A;  4E6I A;  5KYI A;  3QOL A;  1EZ8 A;  1EQV A;  4KY7 A;  1EYD A;  4QF4 A;  4YIJ A;  5NUC A;  4LAA A;  4OL7 A;  5J1Z A;  2F0V A;  2PW7 A;  3QOJ A;  1F2M A;  2PZW A;  3EVQ A;  2EY6 A;  4DFA A;  4DU9 A;  5C3W A;  1KDB A;  2F0I A;  4B9W A;  2M00 A;  2F0Q A;  3OMC A;  4IUN A;  5HUR A;  1II3 A;  5KYL A;  1TR5 A;  5IGG A;  4RKB A;  5F2D A;  3QB3 A;  3SHL A;  3SK5 A;  4KD3 A;  4DGZ A;  5M9O A;  2EY5 A;  4HMJ A;  4J1M A;  5KGU A;  1EY0 A;  2SNS A;  5IGE A;  1ENA A;  1SYG A;  2EY1 A;  1AEX A;  1IHZ A;  4K6D A;  1A3U A;  1EY5 A;  1KAA A;  4N9P A;  1JOQ A;  2EYP A;  4K14 A;  3TP8 A;  1EY4 A;  2KQ3 A;  4K8I A;  4WRD A;  4NMZ A;  4EQP A;  5C3X A;  4K8J A;  1NUC A;  4KJN A;  5DEH A;  2EYO A; 
#chains in the Genus database with same CATH topology
 3MXG A;  2CW0 D;  4A3C G;  2IWH A;  2A73 B;  2R7F A;  5E1F A;  4HTH A;  4Z9C B;  1LAB A;  5LMN L;  1ASZ A;  1FGU A;  2XGT A;  3OWF A;  1ASY A;  5I2Y A;  4MNO A;  4C56 C;  3NP8 A;  4PV1 C;  1L1O B;  1AZQ A;  4GN5 A;  1ZEQ X;  1EOT A;  4JI1 Q;  2L55 A;  2EYM A;  3DM1 A;  2F0N A;  2QA4 A;  1WD0 A;  5C4Z A;  1WCM G;  2K1B A;  1VQ5 A;  4CJ2 C;  1JB3 A;  5DAU A;  1ML0 D;  5LHY 1;  2N88 A;  1NR2 A;  4ME5 A;  4MHE A;  4DPG A;  1NR4 A;  2EJG C;  3M4O B;  4IUU A;  5C4J B;  2A74 C;  3CPF A;  3I7F A;  4MTK A;  3QG1 A;  5IYC G;  2ZTD A;  5JEA H;  2AHO B;  4FO2 A;  5E7N A;  5FLX c;  1H9S B;  1TVX A;  3M3Y B;  4KHZ A;  3NEL A;  5AJ3 L;  1OTC A;  2GA4 B;  2WII B;  4KK7 A;  2E2D C;  3HRZ C;  4LF5 Q;  2B2W A;  5C3E G;  5KRU A;  4C3I G;  1F9Q A;  2WAQ E;  4KY6 A;  3K7A H;  4GOP C;  1C4Q A;  3CCR A;  4ZKC B;  3FMC A;  1NCV A;  1YBY A;  1MHW C;  1MSH A;  4NXN L;  4IUR A;  3A7A B;  4YCV A;  1F2Y A;  2E76 C;  2F3I A;  4PMW A;  1N36 L;  3IKJ A;  3RZO B;  4JI0 L;  1DOM A;  3Q0A A;  2O5J C;  1A3T A;  1TT2 A;  2YTV A;  1D5Z C;  3K0X A;  2C5C A;  3HKZ E;  2CFM A;  2NB0 A;  3K7U C;  4N9T A;  1K0R A;  1GHK A;  2Q2T A;  4A3M H;  4L5R C;  3I4L A;  1KRS A;  3KF6 A;  1OXV A;  2PW7 A;  1B9N A;  1DOK A;  1F2M A;  2EY6 A;  4G7H C;  1M8A A;  1PYS B;  2E74 C;  1O7L A;  3ERS X;  4KLK A;  1EUJ A;  2P5Z X;  1PA6 A;  2G9H D;  1M90 C;  3CMA A;  1SE3 A;  1SSO A;  2EVB A;  4DV7 L;  4DR6 Q;  4MZ9 A;  1I4P A;  2C9O A;  1NY4 A;  1CKN B;  4A3J G;  4FYD A;  5M3M H;  5JVG 3;  3MXP A;  3K58 A;  3P75 A;  1I4R A;  5EKK A;  1JOO A;  1Q7Y C;  2UUA Q;  2EE1 A;  1QUQ A;  1FR3 A;  1PFM A;  3E6Z X;  1NMF A;  4I7Z C;  2F4V Q;  1L0X B;  4AYB B;  1E0B A;  3G48 A;  3KLS A;  4EVO A;  4B3S L;  2NN6 I;  2AKW B;  3MFG A;  2K7V A;  4X3U A;  4JYA L;  3HOU G;  2JE6 I;  3K7A B;  1S40 A;  4APV A;  2XRQ D;  4KJO A;  1I94 Q;  4R4O A;  4X3T A;  4OIJ A;  2K75 A;  1H9R A;  2HCC A;  2Q2H A;  1T9H A;  4DNI A;  1VQF A;  1D7Q A;  2F0F A;  5EPL A;  4DAY B;  4IN3 A;  1A0I A;  5I9O A;  4JI5 L;  5T1G A;  4BXX H;  3S9W A;  4A3M B;  3TRZ A;  1B7Y B;  2FIN B;  2VS1 A;  1N34 L;  2BDO A;  2QCP X;  5IGF A;  4JI2 L;  1STN A;  2XVS A;  1WI5 A;  2PO4 A;  1WVL A;  3H0G H;  2FJ2 A;  1DZ1 A;  2XNA C;  3BVM A;  2ENB A;  2NUC A;  4POF A;  4C3J H;  1Y14 B;  4GNX C;  1XMO Q;  4J6H A;  2I0Q A;  1U9R A;  4LUO A;  1SYD A;  5H1S E;  4ULL A;  2CQO A;  4RWS C;  1V8Q A;  5M3M B;  4EQO A;  4ZKB B;  4AIM A;  2VZA A;  3KDF B;  3ZYY X;  2EPB A;  4DAM A;  4DK6 C;  1EQV A;  3GDE A;  3CC7 A;  4XQQ A;  3Q24 A;  1K8O A;  2I5L X;  3QOJ A;  5IWA Q;  3RR5 A;  3TZD A;  2QEX A;  2E2H H;  3A0J A;  2IX3 A;  3BZD B;  4RKB A;  3S1N H;  2B39 A;  1TKW B;  2Z6K A;  4N9P A;  3EQL C;  5JJI A;  5IP7 H;  1DYQ A;  3H3V C;  1EL0 A;  2EIF A;  4IPC A;  2MNA A;  5COR A;  1GD7 A;  4LJZ C;  5FLM G;  2VY3 A;  1MI2 A;  3W1B A;  2HHH Q;  3D3R A;  3QO2 A;  1KAB A;  1XX8 A;  4LNQ A;  2E5L Q;  2JK8 A;  1SNC A;  5C0X H;  1NTG A;  4DKA C;  2ICI A;  4LF9 Q;  3R3O A;  3MXN A;  4C2M H;  2KED A;  4QQB X;  3K57 A;  1HZB A;  1D6E C;  1CA6 A;  2A69 D;  1DD2 A;  1PRT C;  3C1E A;  4OWX B;  1STE A;  2KHS A;  4C3H H;  1PDQ A;  3O13 A;  4HIM A;  4A3D G;  3PUZ A;  2CKZ B;  1LTA D;  1AE3 A;  4PMB A;  3HG9 A;  3H0G B;  5CV8 A;  2KCN A;  3TP7 A;  1ZYR C;  1G29 1;  3X3N A;  2JA6 G;  2XIW A;  3NBH A;  1VQP A;  1EQQ A;  3GTP H;  1VCI A;  5C4H A;  3UDX A;  4IUQ A;  4C3J B;  3BG3 A;  3IL8 A;  2R92 H;  3A8J E;  4JG2 A;  4LF6 Q;  4ALP A;  3H91 A;  2PYK A;  1J5E L;  1DON A;  1ZYR D;  1KL9 A;  2DUD A;  4PNY A;  2RDH A;  4CHT B;  1YEZ A;  3KBX A;  3T1H Q;  2Y0S G;  2HIX A;  5G3L F;  1UEA B;  1TII D;  3BZK A;  2HQE A;  1JOR A;  1PTO C;  3PUY A;  2EYH A;  1EQT A;  4JI6 Q;  4OO1 H;  4HCS A;  3DEO A;  4OEM B;  2E2H B;  2PZU A;  1TS4 A;  1BF4 A;  3OYY A;  2IX1 A;  3S1N B;  5CGK A;  1Y8N B;  1BBU A;  2IW3 A;  1TQO A;  4LUZ A;  2F0K A;  4BBS G;  5LL6 S;  5CC4 A;  5JAV A;  1PTO D;  4G4K A;  3KOJ A;  3H3V I;  2UUA L;  5LMN W;  1NAP A;  3P1H A;  4OWW B;  3T56 B;  3OTO L;  3MFY A;  4PZ7 A;  2JA7 H;  2K05 A;  5M3F H;  2F4V L;  4PZ8 A;  1KAW A;  3F1Z A;  5JPN C;  5IT9 c;  4DU9 A;  1KDB A;  1ICW A;  1YZ6 A;  4IJL A;  4B3T L;  2MPM A;  3E9H A;  3NTH A;  4C2M B;  4JI7 Q;  5JJL A;  5A2Q E;  3E0J A;  4HJ8 A;  2Z4H A;  4C3H B;  1QNU A;  2M9V A;  4DK1 A;  1S4Z A;  3CU7 A;  3BZC A;  1QVC A;  2VUM H;  2QF7 A;  4BY7 H;  2G5D A;  5DEH A;  5IYD G;  4DUZ L;  4L5Q A;  5ELF A;  3EBE A;  3J7Z C;  3GTP B;  3GO5 A;  1E2V A;  4EGV A;  3I72 A;  4DN4 M;  3BDO A;  3NE5 B;  3NEN A;  2HDL A;  2R92 B;  4CKC A;  1D8L A;  2L5T A;  4KN4 C;  2JSO A;  2B2W C;  3BVZ A;  5EKL A;  1Y1W G;  1QZH A;  3BVG A;  5EGT A;  4GKK L;  3JAM E;  2K33 A;  4OXP A;  1IBK L;  3NWT A;  2RDG A;  4QIW B;  4DV2 Q;  1G91 A;  2RSO A;  1ICF B;  4HIK A;  5COY A;  3V05 A;  1GUW A;  5ELN A;  4QMG A;  4S3S A;  4TKO B;  5J22 A;  4IO9 A;  1WTQ A;  4OIK A;  1TWH H;  2L0C A;  5I9P A;  3AEV A;  3OIP A;  3I91 A;  4RGN A;  1V1P B;  1ESR A;  4L5S A;  3J80 L;  2RF4 A;  3I55 A;  4K6L A;  2EDG A;  4L5T A;  1BUV T;  1LM0 A;  3D6W A;  4ODG A;  3CCE A;  5IP9 H;  4HSP A;  4DR1 Q;  3QWN A;  5IWA L;  2JA7 B;  1JMC A;  5M3F B;  1SMX A;  4R9W A;  4X65 L;  3TME A;  1SRO A;  5TSS A;  1XXG A;  1YHB A;  1HA6 A;  3CKI B;  1YHQ A;  3DLL A;  4N8F A;  4WFN 3;  1VQB A;  4IZ8 A;  2HCI A;  5GQO A;  2VUM B;  1JJG A;  4BY7 B;  1XYI A;  2E8G A;  2HHH L;  4JI4 L;  4R4I A;  5C44 H;  4IUP A;  1CM9 A;  4X3K A;  1LYL A;  1E1O A;  4KKS A;  4YY3 L;  4OL7 A;  2B2Y C;  4AYB E;  1I4Q A;  1JB7 A;  1AP0 A;  1EEF D;  4X66 Q;  2K5V A;  4DFA A;  1E2Z A;  4DR2 L;  5IGG A;  3SK5 A;  4KD3 A;  5KGU A;  3HFZ B;  2UXD L;  2O2L D;  1WFQ A;  1HJP A;  3HOV G;  3RLN A;  4BBR H;  3TP8 A;  1EY4 A;  4AQY Q;  1AE2 A;  3UDG A;  1NUC A;  1TWH B;  3TS0 A;  1VQL A;  4R1J A;  4ZRZ A;  2A8V A;  1BQQ T;  1C0A A;  3SDZ A;  4A4I A;  4JCV E;  1EY8 A;  1AFP A;  1EZ6 A;  3V2T A;  1CZG A;  1F9R A;  3UDI A;  4MIU A;  5M5X H;  3HOX H;  3PO2 H;  1XMQ Q;  4XYO A;  4FXD A;  3AQQ A;  1TS2 A;  3D8G A;  1RJT A;  1OXS C;  1EQR A;  3EN2 A;  3T13 A;  4LF4 L;  1JCK B;  5GAE C;  1G6Z A;  2JEB I;  3N6R A;  1TY0 A;  2R93 H;  2NVY H;  2KHI A;  5E3F A;  2AMC B;  2PQA B;  2I07 B;  4GLA C;  3CQZ H;  3DHQ A;  1RTN A;  3NTK A;  4IFD I;  5IT9 E;  1PH1 A;  1PH5 A;  4KKU A;  1EYC A;  4LF7 Q;  1XNR Q;  1YNJ C;  2GN5 A;  4O42 A;  5C44 B;  2EYF A;  4PQX A;  4WJ4 A;  1B3Q A;  1F9P A;  4JBW A;  1CZW A;  1NNX A;  4NB3 A;  4I65 A;  4LWC A;  1X6O A;  2M2L A;  3GQB A;  3NWS A;  4RKL A;  1K3B C;  1FJG Q;  1R9T H;  2PNR C;  2J4X A;  3T16 A;  2Z6K C;  3HOY G;  1YNJ D;  2RHS B;  1X54 A;  4A3C H;  2K04 A;  1X3G A;  4CBV A;  4ME3 A;  1BDO A;  2LMC B;  4BBR G;  3I73 A;  2L1B A;  1S5F D;  4BBR B;  4ZLT F;  2IJ0 A;  4RAU C;  2F0S A;  4A3G G;  1FYC A;  1S5D D;  3A8K E;  2NWG A;  4GKJ Q;  5A35 A;  3CC2 A;  5JJK A;  4PZ6 A;  4HIO A;  1XPO A;  5GRO A;  4KTA A;  2Z8L A;  3HKS A;  1BCP B;  4DV5 L;  3CW2 C;  1VF5 C;  1PH7 A;  4LAA A;  1WCM H;  2F0V A;  5M5X B;  3M7G A;  3HOX B;  2F0Q A;  1SFO H;  5KYL A;  1KIX A;  3PO2 B;  4QUF A;  1X3P A;  1ENA A;  4HED A;  1BXT A;  1JE5 A;  5IYC H;  1Q8I A;  2YTX A;  4K14 A;  1I4G A;  2WB1 G;  1TU2 B;  2R93 B;  2NVY B;  1N8R C;  1CSP A;  3RN5 A;  1E3P A;  2O5I C;  1NMG A;  1RDP D;  3W1G A;  2JXM B;  1HNX Q;  1OXT A;  1Q3L A;  4MTN A;  5C3E H;  4BWG B;  3CQZ B;  1BCP F;  4GLX A;  4C3I H;  2OF1 A;  1TXY A;  3EFX D;  4GLV B;  4IFD J;  5EKI A;  1OXX K;  3NTI A;  1IYV A;  4QCL A;  3MC0 B;  2R6G A;  1IBL L;  3J81 L;  4DV3 L;  4RH6 A;  4FNF A;  3PF5 A;  3TQY A;  2OXP A;  4DXF A;  4DV4 L;  1X56 A;  4QB4 A;  1R9T B;  4QGU A;  4K2L A;  4UHV A;  3X3M A;  5ELE A;  4P2C B;  2VQE Q;  2R7Z G;  1F77 A;  1VQE A;  5T1I A;  2VNU D;  2F0H A;  2VXW A;  3E5S A;  1FNW A;  2ZJQ A;  4M1U B;  5IGD A;  3KLR A;  2SNM A;  4FF2 A;  1R4P B;  1KLG D;  3OIQ A;  3HZX A;  1KNA A;  5LMU Q;  1LTL A;  3HEJ A;  2MUY A;  4A3F G;  1WCM B;  1RKN A;  1JJC B;  5BN3 A;  3K5N A;  5ELC A;  1TS3 A;  3VA7 A;  4V19 0;  1SFO B;  3S16 H;  4ZQ3 A;  1IL8 A;  1LT6 D;  4DA2 A;  3S1M H;  4K2K A;  4A3J H;  1SMY C;  1A62 A;  1C7Y A;  1QVG A;  2JA8 G;  1QG7 A;  3ITP A;  5GAH C;  3F2D A;  1LT5 D;  1JR0 D;  1EIH A;  3VR2 A;  2Z9H A;  1OXU A;  1KNE A;  3D4D A;  1STB A;  4E6I A;  4X64 L;  5C3E B;  1SMY D;  4KY7 A;  2WV6 D;  1U4M A;  3UE1 A;  3J80 i;  3T4A C;  3JAM i;  4C3I B;  3HOU H;  1N33 L;  3R2I A;  3EVQ A;  3VYU A;  4DAP A;  2F0I A;  3C2P A;  1HUM A;  1YIT A;  4QIW E;  1EEI D;  3L9A X;  1O7Y A;  2EZV A;  2KOL A;  1EFI D;  1WD1 A;  3I8Z A;  2HDM A;  4YCW A;  4LFC L;  3G71 A;  4FDB A;  5J39 A;  4WRD A;  2SEB D;  1CHP D;  3EIV A;  4WOR A;  1Q8K A;  2NN6 G;  2K14 A;  1BNZ A;  2UXC L;  3RNU A;  1E1T A;  1YI2 A;  3PUV A;  5CYU A;  4LF7 L;  3DWA A;  4AH6 A;  4EX5 A;  3C46 A;  4DR4 L;  3GV3 A;  4JV5 Q;  1Q81 C;  4FF3 A;  4JI8 Q;  4HMI A;  1HCZ A;  3FPU B;  2WKD A;  5GAG C;  1W6J A;  3A54 A;  1G51 A;  3A5Z B;  3I3C A;  2HD3 A;  2X69 A;  3KBG A;  2BCO A;  3S16 B;  3CPW A;  2AQ1 B;  1K0S A;  1IYJ B;  3U4Z A;  3K59 A;  3S1M B;  4A3J B;  3PF4 A;  3BDL A;  3CCV A;  4XT3 B;  4OEL B;  3CRL C;  4Y52 H;  2ZM6 Q;  1FL0 A;  4R4T A;  2C35 B;  5LL6 X;  2MO0 A;  5KNC A;  1VQ6 A;  1GUO A;  4WJ3 M;  2B2Y A;  1Q86 C;  3DUZ A;  3ER0 A;  4K5W A;  4R4Q A;  1QB5 D;  1RD9 D;  1VQM A;  1A15 A;  2YV5 A;  5AFW A;  3HOU B;  3HOW G;  2FXQ A;  1B4O A;  4JOI A;  4JVZ A;  2XWB B;  1SE2 A;  3RN2 A;  4YWL A;  1EU3 A;  1GUS A;  2RSN A;  4LK1 C;  1C48 A;  1I6V C;  4MN3 A;  5FLM H;  3J7A 5;  2F4I A;  3F2C A;  1Q90 A;  4G7O C;  1B50 A;  4A3B G;  3QJY A;  3KUP A;  4IPD A;  4DR5 Q;  5BN5 A;  1V43 A;  4RCO A;  5C5L A;  2EOT A;  3PO3 G;  3H09 A;  4K0K Q;  1H9K A;  3IFT A;  2MJ8 A;  1EYD A;  4LW1 A;  5FKA C;  5DM6 3;  4A3D H;  3I4N G;  1N32 Q;  4RFB A;  3H3V H;  3SHL A;  3JAM c;  1A63 A;  3J80 c;  2JA6 H;  1X3Q A;  4LFA L;  1PH9 A;  2UU9 Q;  1AEX A;  3NSW A;  1EY5 A;  1GVP A;  1TS5 A;  2Z1C A;  2KQ3 A;  2KEC A;  3E9I A;  5HY6 A;  2KBN A;  4LMQ D;  3OHX C;  2JA5 G;  4XQJ A;  1XNQ Q;  2EXZ A;  1QNK A;  3Q8D A;  1U0L A;  3D31 A;  4CGY B;  3T1Y Q;  1LAC A;  2LKV A;  2RDF A;  4JI1 L;  1HQM C;  1CSQ A;  1SJE D;  2UUC Q;  4YHH Q;  1G6P A;  5JPM C;  4RG1 A;  4ZUI A;  2AWO A;  4JI3 Q;  5LMU L;  1HR0 Q;  3K8A A;  3NEM A;  4RA8 A;  3STB C;  2QIL A;  2B2T A;  1JIC A;  2VW9 A;  5K36 G;  3UDF A;  1JWU D;  3PIP A;  5D65 A;  3LNN A;  4L63 B;  3NK9 A;  5IGC A;  4GNX B;  2IHF A;  2RVL A;  1CK1 A;  2UUB Q;  2A69 C;  4BBS H;  4L8J A;  4KD4 A;  1EY9 A;  4NPS A;  2BDN A;  3STB D;  1SNM A;  1IL2 A;  5I6Y A;  3OW2 A;  1KHI A;  4DNR B;  1ET6 A;  5BR8 Q;  4LF5 L;  4Q0F A;  1HZA A;  1PTO H;  1X32 A;  3NPP A;  1H9M A;  2XSC A;  1VQG A;  2Q2I A;  4HID A;  1RHP A;  1STY A;  1UNS A;  2NZO A;  5CV7 A;  5EQ0 A;  4PMC A;  1MBY A;  5G3L D;  4A3D B;  1I50 H;  3KLS X;  1DM0 B;  3PUX A;  5CV6 A;  2WIN B;  2R61 A;  4Y7N H;  5IYD H;  2A1A A;  2XTI A;  3E3X A;  3MZ5 A;  5FLX L;  3ULP A;  2JA6 B;  3FVQ A;  1QZG A;  1CTM A;  1VDZ A;  2A68 D;  1JQY D;  1X65 A;  1FVI A;  1CA5 A;  2PQE A;  1CHQ D;  1LLR D;  2RQX A;  2QDL A;  3GTM H;  5JEA J;  1HNZ Q;  3RUZ A;  3J7Y W;  3OW7 A;  4B3R Q;  2B29 A;  3PSI A;  1DOL A;  2F0U A;  2SDF A;  4CJ0 B;  3KLW A;  1Y1W H;  1QIL A;  1SRU A;  5CMD A;  3ND9 A;  3TSS A;  3QOL A;  3K5M A;  1PRT B;  1E2W A;  1KRT A;  2Y0S B;  1DGS A;  1MJC A;  4JBM A;  1FGB D;  4B3M Q;  3GTG H;  4J8Q A;  5I2X A;  1QVF A;  1P8L A;  2ICE C;  2L4N A;  4DR6 L;  4LF8 Q;  2KHJ A;  1L1O A;  5CBA E;  1EY0 A;  1SEB D;  5IYB G;  1HUN A;  2EY1 A;  3S15 H;  2EYP A;  1UEB A;  4OGQ C;  4XT1 B;  4HSV A;  4BBS B;  3VR4 A;  1RIP A;  3QR8 A;  2RKS A;  1JE4 A;  2K5D A;  2EYJ A;  2WFW A;  2VB2 X;  3F8T A;  1PRT F;  4OON A;  5FO7 B;  1Q82 C;  2Z6B A;  1PTO B;  1NSN S;  3KFU A;  1H9S A;  2KCC A;  2PI2 E;  3K81 C;  4X62 Q;  3KYH C;  1PHJ A;  1SXT A;  1STG A;  3GP7 A;  1PH2 A;  1I94 L;  1A2U A;  1QWY A;  1I50 B;  1HNW Q;  1S72 A;  3DM3 A;  4Y7N B;  4BA1 I;  1VF7 A;  3Q22 A;  2F0D A;  5ISR A;  1Y1V G;  2Q8T A;  3Q23 A;  5C6A A;  4UDU C;  1XPR A;  1TWC H;  3GTM B;  1C9O A;  2PZT A;  3D0F A;  2QKI C;  4A3I H;  1T5E A;  2RCF A;  4DUY Q;  3J80 E;  1BVS A;  1Y1W B;  3VR5 A;  4A93 G;  2L11 A;  1VQ7 A;  1D5X C;  3J7A F;  1E24 A;  3DXJ C;  3FP9 A;  2HQL A;  2R3Z A;  1VQC A;  4QL5 A;  2J0T D;  5EAY A;  4A3E G;  4IJH A;  1IZ6 A;  2L9H A;  5ELD A;  3GTG B;  2HUG A;  3HOV H;  1GUN A;  2WAQ G;  3WOF A;  1DJR D;  2F0J A;  2K50 A;  1IW7 D;  3CCU A;  1XMO L;  1BBX C;  2D0O A;  2HT1 A;  5M5Y H;  1A6X A;  1ENC A;  3S15 B;  4RCN A;  1XNQ L;  1LTS D;  3IAY A;  4EQN A;  3TRE A;  5C0X I;  5C4X G;  3BJU A;  3T1Y L;  5K5P A;  4IOC A;  3ZJY C;  3IRB A;  4CKB A;  4YHH L;  3LX0 A;  3FRP B;  3SK4 A;  2A6H D;  3HKZ G;  5CBE E;  5KYI A;  1CKN A;  1CKM A;  1WTP A;  1PZK D;  4IQZ A;  3KF8 B;  1TY2 A;  1PFB A;  3OMC A;  3RZD H;  4IUV A;  5M9O A;  4Q5V A;  1CQV A;  1PVO A;  1PYB A;  4A3K G;  1PH4 A;  4OWT B;  1A3U A;  2F52 A;  3I70 A;  3W2D A;  1BO0 A;  4FVM A;  2XN9 C;  1SAP A;  4K8J A;  5JOB A;  3OMG A;  3K5L A;  2ZJP A;  4EQ5 A;  3H15 A;  2E5L L;  2VQF Q;  4J15 A;  4DK3 C;  4LF9 L;  1HZC A;  3PUW A;  4OX9 Q;  4XIG S;  4GN3 B;  1TWC B;  5IOD A;  4A3I G;  1QJO A;  4BY1 G;  3OOC A;  4A3I B;  3BU2 A;  2DJG C;  1K3R A;  2ZXO A;  4DAY A;  4TQU S;  5EJW A;  5C5M A;  4JOI C;  3HOY H;  1PZI D;  3H6M A;  4RGM A;  1D1I A;  4IFD G;  2PCF B;  1SDF A;  3K80 C;  1O80 A;  1O7Z A;  4DR3 Q;  3I4M G;  3N52 A;  3HOV B;  4R4C A;  2QGQ A;  3PMF A;  4CJ1 B;  1D5M C;  3S17 H;  4WJW A;  4LF6 L;  1Y8O B;  4A3G H;  2AWN A;  4KHP Q;  1SYF A;  3CCL A;  1QUQ B;  3NXW A;  3SK8 A;  1VQN A;  1UE7 A;  1VQ4 A;  5M5Y B;  2X6L A;  1PXU A;  4I7A A;  1HNZ L;  3L2P A;  3A55 A;  3Q6S A;  4F7X A;  3T1H L;  3PIO 3;  1YHA A;  2CVR A;  4IPH A;  4YCU A;  4K5V A;  5C0X J;  3MEF A;  4DAV A;  3CC4 A;  4RGT A;  2KEE A;  4JI6 L;  2D0P A;  4TSS A;  2B63 G;  1X3E A;  5AJ3 Q;  3KDF A;  4B08 A;  2NZ1 D;  2LSS A;  4KKT A;  2B2V A;  4H44 C;  4LF8 L;  5EBD A;  2EJM A;  3RZD B;  3AFP A;  3DMU A;  1CQF A;  1QE6 A;  2B8F A;  1CI3 M;  3ERQ A;  1V9P A;  3T53 B;  2PMZ B;  2I5M X;  4NXN Q;  1EU4 A;  1MD2 D;  1N36 Q;  4JPB W;  4JI0 Q;  1LT4 D;  4GN4 B;  2KUM A;  3PIP 3;  2B3G A;  3FKI G;  4HJA A;  2K6A A;  4A3L G;  4X3S A;  4H02 A;  4KN7 C;  4JI7 L;  4IOA A;  4YIJ A;  2CQA A;  5J1Z A;  1B53 A;  2X6G A;  3W3A A;  2B2T C;  4UPA A;  1Y69 U;  1RL2 A;  1TWG H;  4NW2 A;  2K03 A;  1G8Z D;  2LXJ A;  3QB3 A;  3A5U A;  1ILQ A;  1AZP A;  3GTQ H;  5GAD C;  3HOY B;  2D9U A;  5EBC A;  1BCP C;  2R7Z H;  1VQI A;  1EIY B;  1B2T A;  1JOQ A;  1LTI D;  3ICE A;  3P7J A;  1UE1 A;  3A8I E;  3SE0 A;  1NJI C;  2CWA A;  4CDF C;  3S17 B;  4A75 A;  1W3S A;  1SND A;  4A3G B;  3D6C A;  5FJ8 G;  4DV7 Q;  1I5F A;  5IE8 A;  3M7N A;  1BCP D;  2WAC A;  4A3F H;  5D3I B;  1PFN A;  3TDQ A;  3URY A;  1W2B A;  4NP5 A;  1K83 H;  4DV2 L;  3VYT A;  2L12 A;  3P20 A;  1SJH D;  4HAE A;  1WOC A;  2D5D A;  3RMH A;  3BDC A;  4YWM A;  3MA2 B;  3M4Y A;  2JA8 H;  4H13 C;  3J81 E;  1K9M C;  1IXR A;  1SYC A;  2WB1 B;  1JOK A;  2DNE A;  4JYA Q;  3I4O A;  1ESF A;  1Q1B A;  1VQ8 A;  3LWE A;  4F8M A;  1A8V A;  3ND8 A;  2CH4 A;  1K73 C;  3U9O A;  4DR1 L;  1XTC D;  3MXN B;  3C1F A;  5D14 A;  3I56 A;  1YNN C;  3K0Y A;  4G57 A;  2Y0S E;  2KJX A;  2O4X A;  4FF1 A;  4KV6 A;  2PW5 A;  1F9S A;  2DNC A;  4GZY C;  1HTL D;  4JI5 Q;  4RHR A;  1PMR A;  1L1O C;  1TWG B;  1L0W A;  3GTL H;  2DY8 A;  3TN2 A;  3NBH B;  5E4X A;  3OPO A;  1UE5 A;  2OQK A;  3U50 C;  4V0B A;  2NN6 H;  3GTQ B;  3HOZ G;  1YNN D;  4JI2 Q;  5L37 A;  3ERO A;  1S5B D;  1HZ9 A;  2ASB A;  1UAP A;  2R7Z B;  2H4O A;  2F0G A;  2VB3 X;  2F0W A;  2K5H A;  1PH3 A;  3CCS A;  4X66 L;  1S3O A;  2KVM A;  3PCO B;  1IYU A;  4X6A H;  2NVX H;  1JC7 A;  4ZCK A;  5NUC A;  2DGY A;  4A3F B;  2DJF C;  1I3Q H;  1PH6 A;  1K83 B;  1WTH A;  1MIU A;  1KTK A;  1LV9 A;  3D4R A;  3S1Q H;  4B9W A;  1R4Q B;  2IL8 A;  1KC8 C;  2ZTC A;  4AQY L;  2EY5 A;  4DR3 L;  2OWO A;  1HQR D;  5M5W H;  4GS3 A;  5IGE A;  4IUT A;  1J8I A;  3JC6 6;  2JA8 B;  4KHP L;  2B8G A;  1UE6 A;  4NMZ A;  1VMC A;  4L6T B;  3M9B A;  1LO5 D;  3W5O A;  5CV5 A;  3NQI A;  3S14 H;  3VYS A;  1XMQ L;  4ZYS A;  1V1P A;  2OCE A;  1WTV A;  3HOW H;  1VQD A;  1F2L A;  1VS0 A;  4KHV A;  5FO9 B;  2F0M A;  1HTP A;  2KEN A;  2F0P A;  4PG3 A;  2CHB D;  4DV0 Q;  1EYG A;  3GTL B;  4A3B H;  1T5X D;  2NYZ D;  1Z47 A;  4ZUJ A;  3AMU A;  1PLF A;  2LS0 1;  1U5K A;  3KF8 A;  3M4Q A;  1XNR L;  2JN4 A;  3PO3 H;  2K5N A;  3K6O A;  3CCQ A;  5FO8 B;  4GOP B;  1KDC A;  1NE3 A;  3ULJ A;  2TMP A;  3EJI A;  2NTT A;  1HR0 W;  4QUC A;  1FJG L;  3I4N H;  4ILW A;  3TS2 A;  4C1N I;  3OWE B;  2NVX B;  1JT8 A;  1ENF A;  2DY7 A;  1B9M A;  1WTR A;  1GM5 A;  1LUZ A;  1K8M A;  2F3W A;  3RD4 A;  4HCE A;  1I3Q B;  2GVB A;  3QIA A;  1J5E Q;  4DR7 Q;  3S1Q B;  3I2Z A;  3MAQ A;  2A5H A;  2JA5 H;  2NVQ H;  5M5W B;  5CV9 A;  3G6J B;  4GKJ L;  3FDT A;  1Q12 A;  2B2U A;  1N9W A;  1UWV A;  1B44 D;  3MTS A;  2F0E A;  1VQK A;  3L7Z C;  2YYZ A;  1RCV D;  1CUK A;  4TVA B;  5FK9 C;  4O0A A;  1Y8P B;  5K36 H;  1W6K A;  3S14 B;  5JEA G;  1XTD A;  1UUP A;  3U9S A;  4F88 A;  1KD1 C;  2D62 A;  2I5H A;  3HOW B;  2EQS A;  1K28 A;  4AYB G;  1I4H A;  3OTO Q;  1I6H H;  2YU9 H;  1TWF H;  4DGZ A;  1X55 A;  2PPB C;  4QY7 A;  2E2I H;  3KJP A;  2SNS A;  1E7Z A;  2ZTE A;  3LGJ A;  2LFN A;  4B3T Q;  5D3D A;  2N8N A;  1HNX L;  4K8I A;  5EPK A;  4EQP A;  4DK0 A;  4FF4 A;  1K8G A;  4A3B B;  5KIX A;  3H94 A;  1B3A A;  2KCM A;  1CKO A;  3PO3 B;  1LTB D;  1LTG D;  3CRK C;  4DUZ Q;  4N8X 1;  2RBM A;  1XJV A;  2PQA A;  1HFN A;  3PIO A;  2F0L A;  3I4N B;  3R93 A;  2K52 A;  2ZJR A;  3RLO A;  4A3M G;  2B2V C;  2V1C C;  2K5W A;  4O2D A;  5IY0 A;  1STA A;  1Q1E A;  3NBI A;  4GKK Q;  2VQE L;  4K5X A;  3FPP A;  1MSG A;  3S24 A;  1Q46 A;  1IBK Q;  2XRS D;  2PMZ E;  3CHB D;  4RMF A;  4XDX A;  4XQN A;  1WTO A;  5CR3 A;  1H95 A;  2JA5 B;  3SEB A;  5HGQ A;  4DV6 Q;  4LUV A;  2ATW A;  2NVQ B;  3TP5 A;  3T51 B;  3WWV A;  5HGT A;  3R2T A;  1JJ2 A;  2F1M A;  2OEO A;  1EIG A;  5M3M G;  2FMM A;  3J7A V;  2IT1 A;  1VQ9 A;  3CCJ A;  3G4S A;  5KND A;  2RHQ B;  2ZXR A;  2LY7 A;  5IYB H;  1KLU D;  3AFQ A;  5E4W C;  1BOS A;  4JBJ A;  2HIV A;  3CP0 A;  1I6H B;  2YU9 B;  1TWF B;  1PFS A;  3G6E A;  4X65 Q;  2E2I B;  4P75 A;  2F0O A;  4A76 A;  1HA5 A;  1G2S A;  1GUG A;  1U4P A;  1HH2 P;  2BH2 A;  2IPK D;  2CWP A;  4KY5 A;  2GVA A;  5FLX E;  1YJW A;  1TWA H;  1FD7 D;  1CT1 D;  3HGB A;  2A68 C;  4R8N A;  4ZAI A;  2NVT H;  5JVH 3;  3WDN A;  2WP8 J;  2QEJ C;  3RLF A;  1AN8 A;  1HXY D;  4U67 3;  4JI4 Q;  1D2B A;  3TBI B;  4LFB Q;  1L0Y B;  5C3W A;  2FHT A;  3LWU A;  2M00 A;  1TR5 A;  4BXX G;  2H1E A;  5ELB A;  3J81 i;  1DCZ A;  4YY3 Q;  3VDY A;  4DV0 L;  2BE5 C;  1G2T A;  2G9D A;  4JK1 C;  1Y1V H;  2WB1 E;  1LTT D;  4K6D A;  4DR2 Q;  5BN4 A;  4M8A A;  3H0G G;  2PZW A;  2JA9 A;  4G7Z C;  2UXD Q;  3S2H H;  4JV5 L;  4JI8 L;  2A6E C;  1J9O A;  1KQS A;  3C3L A;  4A93 H;  2VL6 A;  1AH9 A;  1VQH A;  4C3J G;  3IFD A;  1X9N A;  2BE5 D;  2Q2U A;  1PRT D;  4XXE A;  3U4V A;  4A3E H;  4DXG A;  4H0L C;  1EYA A;  2SOB A;  2EXD A;  4HJ9 A;  4O1N A;  4HJ5 A;  1NBW A;  1A2T A;  1IBM Q;  2A6E D;  2Q8R E;  4DR7 L;  1IKL A;  1BBW A;  1EFW A;  2BA1 A;  1Z9F A;  2PI2 A;  2ZM6 L;  1SN8 A;  2MO1 A;  1ET9 A;  5C4X H;  5IGB A;  5FOB B;  1SNO A;  1STH A;  2OQ0 A;  4NXM Q;  5IOC A;  3J81 j;  3S1R H;  4XTC S;  4NKL A;  3I90 A;  2J7Z A;  4LF4 Q;  2EYL A;  3MHB A;  1DXM A;  3GTK H;  2UXB Q;  3NUC A;  5IP7 G;  4HJ7 A;  1MGS A;  2NZH A;  1TWA B;  1U4R A;  3VR3 A;  1PV4 A;  3TEH B;  4HR7 B;  2F0T A;  1JWM D;  2NVT B;  2WKC A;  1O78 A;  2YTY A;  2ZT9 C;  1EWI A;  4DV1 Q;  5C0X G;  3AU7 A;  4A3K H;  1IKM A;  1ZKO A;  1YIJ A;  2KA7 A;  3CXC A;  4P73 A;  2N55 A;  2CH4 W;  1EOV A;  4UP7 A;  4P74 A;  3BYY B;  4C3H G;  4DF7 A;  2K4K A;  4KI0 A;  3NQT A;  4DR5 L;  1Y1V B;  2KCT A;  3V96 A;  3A7L A;  2JEA I;  1IW7 C;  4K0K L;  4OHJ A;  1GOZ A;  4UAI A;  1PTO F;  2E2J H;  4BY1 H;  3S2H B;  2D2C C;  2EY2 A;  4U68 A;  4A93 B;  3GTO H;  2L15 A;  1EZ8 A;  5KNB A;  4RHS A;  4BS9 A;  2R92 G;  1N32 L;  4IFD H;  3L0O A;  2N78 A;  5A2Q L;  4A3E B;  1VMP A;  4UP9 A;  2UU9 L;  3I4M H;  1SLJ A;  2V4D A;  3GTJ H;  2WAQ B;  2A6H C;  4IUN A;  4GOP A;  3KK7 A;  4DV5 Q;  1RF2 D;  2RCN A;  3SGI A;  1SYG A;  1IHZ A;  2IX0 A;  4HN7 A;  4DNT B;  4DV6 L;  4OO1 G;  3J81 c;  1J6Q A;  1I4X A;  5C4X B;  3F2U A;  2UUC L;  1GXD C;  3CCM A;  1PYW D;  1QOH A;  3S1R B;  4JI3 L;  1HR0 L;  1SE8 A;  4C1N K;  2A19 A;  1VQA A;  3HKZ B;  5CV4 A;  2OTJ A;  2DN8 A;  4FP5 D;  3GTK B;  1B1Z A;  3SXH A;  2B63 H;  1S5C D;  3JAM L;  3HS0 C;  1SYE A;  2QDB A;  1H9J A;  4JW0 A;  3M85 A;  2JYO A;  1FNV A;  1YVC A;  3TP6 A;  2JA7 G;  2UUB L;  5M3F G;  3AB9 A;  4IPG A;  1HRJ A;  3CME A;  3UI2 A;  4A3K B;  1YJN A;  1L2F A;  4CDD C;  3DWQ A;  5JJZ A;  1X3F A;  3MEH A;  3VYR A;  1IBL Q;  3NHH A;  2MFI A;  4DV3 Q;  3S2D H;  5BR8 L;  1KDA A;  1GUT A;  2E75 C;  3BYT B;  5ELO A;  3KF6 B;  1WYD A;  1ILP A;  3FKI H;  2B2U C;  3CAM A;  2XWJ B;  4A3L H;  4DV4 Q;  3E0E A;  1SR3 A;  2VUM G;  3WOE A;  1SNP A;  4BY7 G;  1LTR D;  5LMN Q;  4OO1 I;  1U4L A;  2BA0 A;  2ZXP A;  4BY1 B;  2FMC A;  2E2J B;  3MVV A;  1P16 A;  2H5X A;  5DNF A;  1CFM A;  5I4D A;  3GTO B;  5EPJ A;  3TZU A;  4ABN A;  4LFB L;  1D1K A;  5IIF A;  3I4M B;  2NBF A;  3VA5 A;  3GTJ B;  1EY6 A;  3BS1 A;  3SK6 A;  3CD6 A;  1HHV A;  2AUJ D;  3SR1 A;  3DWP A;  2PNH A;  3PQI A;  2TSS A;  4FXG C;  5FJ8 H;  1B70 B;  4B3R L;  2BH8 A;  2Q8I B;  2EJF C;  1GHJ A;  2NTS A;  1E22 A;  2ID0 A;  2I46 A;  3CF5 A;  4B3M L;  2Z0S A;  2AQ3 B;  3MWY W;  1F2Z A;  4F87 A;  1YNX A;  3FHW A;  2MP1 A;  3SVM A;  1MJE A;  1S5E D;  2B63 B;  2JQO A;  1C8C A;  2AUK A;  1Z6H A;  1IBM L;  1XPU A;  5IP9 G;  4BA2 I;  2MGS A;  5HUR A;  4X64 Q;  5F2D A;  3R8B A;  4HMJ A;  4J1M A;  1N33 Q;  2CCZ A;  2MHV A;  5DM7 3;  3B6Y A;  2N3S A;  4NXM L;  2FFK B;  2EYO A;  1BR9 A;  3S2D B;  3A74 A;  4GNX A;  2Z4I A;  2UXB L;  2QW7 A;  1B8A A;  1GO3 E;  1SBB B;  2F3V A;  1WJJ A;  3FKI B;  4LFC Q;  3UE0 A;  1XWE A;  4B9X A;  4KMU C;  4X62 L;  5J3B A;  2UXC Q;  2OT2 A;  3U58 A;  1O7I A;  3M4P A;  4P71 A;  1WTX A;  1GKH A;  5C44 G;  1FNU A;  4DV1 L;  1KXL A;  1AW7 A;  1V1Q A;  3ONA B;  3OSO A;  4DR4 Q;  1HNW L;  1SNQ A;  1VQO A;  3G7L A;  3HOZ H;  4FXK C;  1EWH A;  4UY8 C;  2K01 A;  1JWS D;  3EA6 A;  4UP8 A;  1EIF A;  4TRD A;  2K32 A;  2MQH A;  1A3V A;  3AYH B;  3ULL A;  5IT9 L;  4POG A;  4JBK A;  3GD7 A;  2F03 A;  4NDX A;  4DUY L;  5I6W A;  3KJO A;  2ALY B;  2LXK A;  2K28 A;  1ZXT A;  2R7D A;  4YWK A;  1BKB A;  1SYB A;  3K5O A;  1M1K C;  1ROD A;  3PV0 A;  3FEW X;  4RGO S;  3L3O C;  4B3S Q;  1ONL A;  1RTO A;  2JJQ A;  3HOX G;  4CDC C;  1M4V A;  4ID6 A;  2OTL A;  1EY7 A;  4JC0 A;  3D4W A;  1WTW A;  2AQ2 B;  5KEE A;  3PO2 G;  2N49 A;  3M4O H;  5C4J H;  1HPC A;  2K5Q A;  1YJ9 A;  1K8A C;  2ES2 A;  2BOS A;  4H7B A;  4IAL A;  5DLQ E;  4R8I A;  3GV6 A;  3M3Y H;  1OO9 B;  2R93 G;  2JP1 A;  4QJF A;  2RA4 A;  1V1O A;  1PZJ D;  4XYQ A;  4ZK9 B;  1PH8 A;  4CKE A;  2IY5 B;  1Z7T A;  4CDE C;  3PGZ A;  4QF4 A;  2IHE A;  1GJX A;  1LT3 D;  2CW0 C;  1MKH A;  1N34 Q;  1II3 A;  1HFG A;  3VR6 A;  4P72 A;  3RZO H;  1SE4 A;  3MXU A;  3HOZ B;  1QCB D;  1EWC A;  3A56 A;  3HP3 A;  3DEP A;  1KAA A;  2VQF L;  1VQJ A;  5C3X A;  3F2B A;  4KJN A;  4OX9 L;  4LFA Q; 
#chains in the Genus database with same CATH homology
 3MXG A;  2CW0 D;  2IWH A;  2A73 B;  5E1F A;  4HTH A;  4Z9C B;  1LAB A;  3OWF A;  5I2Y A;  4C56 C;  3NP8 A;  4PV1 C;  1AZQ A;  1ZEQ X;  1EOT A;  2L55 A;  2EYM A;  3DM1 A;  2F0N A;  1WD0 A;  5C4Z A;  2K1B A;  4CJ2 C;  1JB3 A;  5DAU A;  1ML0 D;  5LHY 1;  2N88 A;  1NR2 A;  4ME5 A;  4MHE A;  1NR4 A;  2EJG C;  3M4O B;  4IUU A;  5C4J B;  2A74 C;  3QG1 A;  5JEA H;  4FO2 A;  1H9S B;  1TVX A;  3M3Y B;  4KHZ A;  2GA4 B;  2WII B;  4KK7 A;  2E2D C;  3HRZ C;  2B2W A;  5KRU A;  4C3I G;  1F9Q A;  4KY6 A;  1C4Q A;  4ZKC B;  3FMC A;  1NCV A;  1MSH A;  4IUR A;  3A7A B;  1F2Y A;  2E76 C;  4PMW A;  3IKJ A;  3RZO B;  1DOM A;  3Q0A A;  2O5J C;  1A3T A;  1TT2 A;  1D5Z C;  2C5C A;  2NB0 A;  4N9T A;  1GHK A;  3I4L A;  1OXV A;  2PW7 A;  1B9N A;  1DOK A;  1F2M A;  2EY6 A;  4G7H C;  1M8A A;  2E74 C;  1O7L A;  2G9H D;  1SE3 A;  1SSO A;  2EVB A;  1I4P A;  2C9O A;  4FYD A;  5JVG 3;  3MXP A;  3K58 A;  3P75 A;  1I4R A;  5EKK A;  1JOO A;  2EE1 A;  1FR3 A;  1PFM A;  3E6Z X;  4I7Z C;  1L0X B;  4AYB B;  1E0B A;  4EVO A;  3KLS A;  2NN6 I;  3MFG A;  2K7V A;  4X3U A;  2JE6 I;  3K7A B;  2XRQ D;  4KJO A;  4X3T A;  4OIJ A;  1H9R A;  2HCC A;  2F0F A;  5EPL A;  4IN3 A;  5I9O A;  5T1G A;  3S9W A;  4A3M B;  2FIN B;  2BDO A;  2QCP X;  5IGF A;  1STN A;  2XVS A;  1WVL A;  2PO4 A;  2FJ2 A;  1DZ1 A;  2XNA C;  3BVM A;  2ENB A;  2NUC A;  4J6H A;  1U9R A;  1SYD A;  4ULL A;  4RWS C;  1V8Q A;  5M3M B;  4EQO A;  4ZKB B;  3ZYY X;  2EPB A;  1EQV A;  4XQQ A;  3Q24 A;  1K8O A;  3QOJ A;  3TZD A;  2IX3 A;  3BZD B;  4RKB A;  2B39 A;  1TKW B;  4N9P A;  3EQL C;  1DYQ A;  3H3V C;  1EL0 A;  5COR A;  4LJZ C;  1MI2 A;  3D3R A;  3QO2 A;  1KAB A;  1XX8 A;  1SNC A;  5C0X H;  2ICI A;  3R3O A;  3MXN A;  2KED A;  3K57 A;  1CA6 A;  1D6E C;  1DD2 A;  2A69 D;  1PRT C;  3C1E A;  1STE A;  2KHS A;  1PDQ A;  3O13 A;  3PUZ A;  1LTA D;  4PMB A;  3HG9 A;  3H0G B;  5CV8 A;  2KCN A;  3TP7 A;  1ZYR C;  1G29 1;  3X3N A;  2XIW A;  3NBH A;  1VCI A;  5C4H A;  4IUQ A;  4C3J B;  3BG3 A;  3IL8 A;  3A8J E;  3H91 A;  2PYK A;  1DON A;  1ZYR D;  4PNY A;  2RDH A;  4CHT B;  3KBX A;  5G3L F;  1UEA B;  1TII D;  2HQE A;  1JOR A;  1PTO C;  3PUY A;  2EYH A;  1EQT A;  4OO1 H;  4HCS A;  3DEO A;  2E2H B;  2PZU A;  1TS4 A;  1BF4 A;  2IX1 A;  3S1N B;  5CGK A;  1Y8N B;  2IW3 A;  1TQO A;  2F0K A;  5LL6 S;  5CC4 A;  5JAV A;  1PTO D;  4G4K A;  1NAP A;  3P1H A;  3T56 B;  3MFY A;  2K05 A;  5JPN C;  4DU9 A;  1KDB A;  1ICW A;  2MPM A;  3NTH A;  4C2M B;  5A2Q E;  3E0J A;  2Z4H A;  4C3H B;  1QNU A;  2M9V A;  4DK1 A;  1S4Z A;  3CU7 A;  2QF7 A;  5DEH A;  5ELF A;  3GTP B;  4EGV A;  1E2V A;  3GO5 A;  3I72 A;  4DN4 M;  3BDO A;  3NE5 B;  2HDL A;  2R92 B;  4CKC A;  2L5T A;  4KN4 C;  2JSO A;  2B2W C;  3BVZ A;  5EKL A;  3BVG A;  5EGT A;  3JAM E;  2K33 A;  3NWT A;  2RDG A;  4QIW B;  1G91 A;  2RSO A;  5COY A;  3V05 A;  1GUW A;  4QMG A;  4S3S A;  4TKO B;  5J22 A;  1WTQ A;  4OIK A;  2L0C A;  5I9P A;  3OIP A;  3I91 A;  4RGN A;  1V1P B;  1ESR A;  3J80 L;  4K6L A;  2EDG A;  1BUV T;  3D6W A;  4ODG A;  4HSP A;  3QWN A;  2JA7 B;  5M3F B;  4R9W A;  3TME A;  5TSS A;  1XXG A;  1HA6 A;  3CKI B;  4WFN 3;  4IZ8 A;  2HCI A;  2VUM B;  4BY7 B;  1XYI A;  4IUP A;  1CM9 A;  4X3K A;  4KKS A;  1AP0 A;  4OL7 A;  2B2Y C;  1I4Q A;  1EEF D;  4DFA A;  1E2Z A;  5IGG A;  3SK5 A;  4KD3 A;  5KGU A;  2O2L D;  3TP8 A;  1EY4 A;  1NUC A;  1TWH B;  4ZRZ A;  1BQQ T;  3SDZ A;  1EY8 A;  1AFP A;  1EZ6 A;  3V2T A;  1CZG A;  1F9R A;  4MIU A;  4XYO A;  4FXD A;  1TS2 A;  3D8G A;  1RJT A;  1OXS C;  3T13 A;  1JCK B;  1G6Z A;  2JEB I;  3N6R A;  1TY0 A;  5E3F A;  2I07 B;  3DHQ A;  1RTN A;  3NTK A;  4IFD I;  5IT9 E;  4KKU A;  1EYC A;  1YNJ C;  4O42 A;  5C44 B;  2EYF A;  4PQX A;  1F9P A;  4JBW A;  1CZW A;  4I65 A;  2M2L A;  3GQB A;  3NWS A;  4RKL A;  2PNR C;  2J4X A;  3T16 A;  1YNJ D;  2K04 A;  4CBV A;  1BDO A;  2LMC B;  3I73 A;  2L1B A;  1S5F D;  4BBR B;  4ZLT F;  2IJ0 A;  4RAU C;  2F0S A;  1FYC A;  1S5D D;  3A8K E;  2NWG A;  5A35 A;  4KTA A;  2Z8L A;  1BCP B;  1VF5 C;  4LAA A;  2F0V A;  5M5X B;  3M7G A;  3HOX B;  2F0Q A;  5KYL A;  3PO2 B;  4QUF A;  1X3P A;  1ENA A;  4HED A;  1BXT A;  1Q8I A;  4K14 A;  1I4G A;  1TU2 B;  2R93 B;  2NVY B;  2O5I C;  1RDP D;  2JXM B;  1OXT A;  1Q3L A;  4BWG B;  3CQZ B;  1BCP F;  2OF1 A;  3EFX D;  4IFD J;  5EKI A;  1OXX K;  3NTI A;  1IYV A;  4QCL A;  3MC0 B;  2R6G A;  3J81 L;  4RH6 A;  4FNF A;  2OXP A;  4DXF A;  4QB4 A;  1R9T B;  4K2L A;  3X3M A;  5ELE A;  4P2C B;  1F77 A;  5T1I A;  2VNU D;  2F0H A;  2VXW A;  3E5S A;  1FNW A;  4M1U B;  5IGD A;  3KLR A;  2SNM A;  4FF2 A;  1R4P B;  1KLG D;  3OIQ A;  3HZX A;  1KNA A;  3HEJ A;  2MUY A;  1WCM B;  1RKN A;  5BN3 A;  3K5N A;  5ELC A;  1TS3 A;  3VA7 A;  4V19 0;  1SFO B;  4ZQ3 A;  1IL8 A;  1LT6 D;  4DA2 A;  4K2K A;  1SMY C;  1QG7 A;  3ITP A;  1LT5 D;  1JR0 D;  1EIH A;  3VR2 A;  1OXU A;  1KNE A;  3D4D A;  1STB A;  4E6I A;  5C3E B;  1SMY D;  4KY7 A;  2WV6 D;  1U4M A;  3T4A C;  4C3I B;  3R2I A;  3EVQ A;  3VYU A;  4DAP A;  2F0I A;  3C2P A;  1HUM A;  1EEI D;  3L9A X;  1O7Y A;  2EZV A;  2KOL A;  1EFI D;  1WD1 A;  3I8Z A;  2HDM A;  5J39 A;  4WRD A;  2SEB D;  1CHP D;  4WOR A;  2NN6 G;  1BNZ A;  3PUV A;  5CYU A;  3DWA A;  3C46 A;  3GV3 A;  4FF3 A;  4HMI A;  1HCZ A;  3FPU B;  2WKD A;  1W6J A;  3A54 A;  3I3C A;  2X69 A;  3KBG A;  2BCO A;  3S16 B;  2AQ1 B;  3K59 A;  3S1M B;  4A3J B;  3BDL A;  4XT3 B;  3CRL C;  5LL6 X;  5KNC A;  1GUO A;  2B2Y A;  3DUZ A;  4K5W A;  1QB5 D;  1RD9 D;  1A15 A;  5AFW A;  3HOU B;  1B4O A;  2XWB B;  1SE2 A;  1EU3 A;  1GUS A;  2RSN A;  4LK1 C;  1C48 A;  1I6V C;  4MN3 A;  2F4I A;  1Q90 A;  4G7O C;  1B50 A;  3QJY A;  3KUP A;  5BN5 A;  1V43 A;  4RCO A;  5C5L A;  2EOT A;  3H09 A;  1H9K A;  3IFT A;  2MJ8 A;  1EYD A;  5FKA C;  5DM6 3;  4RFB A;  3SHL A;  1X3Q A;  1AEX A;  3NSW A;  1EY5 A;  1TS5 A;  2Z1C A;  2KQ3 A;  2KEC A;  4LMQ D;  3OHX C;  4XQJ A;  2EXZ A;  1QNK A;  3D31 A;  4CGY B;  1LAC A;  2LKV A;  2RDF A;  1HQM C;  1SJE D;  5JPM C;  4ZUI A;  2AWO A;  4RA8 A;  2QIL A;  2B2T A;  1JIC A;  5K36 G;  1JWU D;  5D65 A;  3LNN A;  4L63 B;  3NK9 A;  5IGC A;  2RVL A;  1CK1 A;  2A69 C;  4L8J A;  4KD4 A;  1EY9 A;  2BDN A;  1SNM A;  5I6Y A;  4DNR B;  1ET6 A;  4Q0F A;  1PTO H;  1X32 A;  3NPP A;  1H9M A;  2XSC A;  1RHP A;  1STY A;  1UNS A;  5CV7 A;  5EQ0 A;  4PMC A;  1MBY A;  5G3L D;  4A3D B;  3KLS X;  1DM0 B;  3PUX A;  5CV6 A;  2WIN B;  2R61 A;  3MZ5 A;  5FLX L;  2JA6 B;  3FVQ A;  1CTM A;  1VDZ A;  2A68 D;  1JQY D;  1CA5 A;  2PQE A;  1CHQ D;  1LLR D;  2RQX A;  5JEA J;  3RUZ A;  3J7Y W;  3OW7 A;  1DOL A;  4CJ0 B;  2F0U A;  2SDF A;  1QIL A;  5CMD A;  3ND9 A;  3TSS A;  3QOL A;  3K5M A;  1PRT B;  1E2W A;  2Y0S B;  1FGB D;  4J8Q A;  5I2X A;  2ICE C;  2L4N A;  5CBA E;  1EY0 A;  1SEB D;  1HUN A;  2EY1 A;  2EYP A;  4OGQ C;  4XT1 B;  4HSV A;  4BBS B;  3VR4 A;  2RKS A;  1JE4 A;  2K5D A;  2EYJ A;  2VB2 X;  1PRT F;  5FO7 B;  1PTO B;  1NSN S;  1H9S A;  2KCC A;  1SXT A;  1STG A;  3GP7 A;  1A2U A;  1QWY A;  1I50 B;  4Y7N B;  4BA1 I;  1VF7 A;  3Q22 A;  2F0D A;  5ISR A;  2Q8T A;  3Q23 A;  5C6A A;  4UDU C;  3GTM B;  2PZT A;  2QKI C;  1T5E A;  3J80 E;  1Y1W B;  3VR5 A;  2L11 A;  1D5X C;  3J7A F;  3DXJ C;  2R3Z A;  2J0T D;  2L9H A;  5ELD A;  3GTG B;  2HUG A;  1GUN A;  3WOF A;  1DJR D;  2F0J A;  1IW7 D;  1BBX C;  1A6X A;  1ENC A;  3S15 B;  4RCN A;  1LTS D;  3IAY A;  4EQN A;  5C0X I;  5K5P A;  4CKB A;  3LX0 A;  3FRP B;  3SK4 A;  2A6H D;  5CBE E;  5KYI A;  1WTP A;  1PZK D;  4IQZ A;  1TY2 A;  1PFB A;  3OMC A;  4IUV A;  5M9O A;  4Q5V A;  1CQV A;  1A3U A;  3I70 A;  3W2D A;  1BO0 A;  4FVM A;  2XN9 C;  1SAP A;  4K8J A;  5JOB A;  3OMG A;  3K5L A;  3PUW A;  4XIG S;  1TWC B;  5IOD A;  1QJO A;  3OOC A;  4A3I B;  2ZXO A;  4DAY A;  4TQU S;  5EJW A;  5C5M A;  1PZI D;  3H6M A;  4RGM A;  1D1I A;  4IFD G;  2PCF B;  1SDF A;  1O80 A;  1O7Z A;  3N52 A;  3HOV B;  3PMF A;  4CJ1 B;  1D5M C;  4WJW A;  1Y8O B;  2AWN A;  1SYF A;  3NXW A;  3SK8 A;  5M5Y B;  2X6L A;  1PXU A;  3A55 A;  3Q6S A;  4F7X A;  3PIO 3;  2CVR A;  5C0X J;  4K5V A;  4DAV A;  4RGT A;  2KEE A;  4TSS A;  4B08 A;  2NZ1 D;  4KKT A;  2B2V A;  4H44 C;  5EBD A;  2EJM A;  3RZD B;  3DMU A;  1CQF A;  1QE6 A;  2B8F A;  1CI3 M;  3ERQ A;  3T53 B;  2PMZ B;  1EU4 A;  1MD2 D;  1LT4 D;  2KUM A;  3PIP 3;  2K6A A;  4X3S A;  4KN7 C;  4YIJ A;  2CQA A;  5J1Z A;  1B53 A;  2X6G A;  3W3A A;  2B2T C;  1Y69 U;  4NW2 A;  2K03 A;  1G8Z D;  3QB3 A;  1ILQ A;  1AZP A;  3HOY B;  2D9U A;  5EBC A;  1BCP C;  1B2T A;  1JOQ A;  1LTI D;  3P7J A;  3A8I E;  3SE0 A;  3S17 B;  1SND A;  4A3G B;  3D6C A;  3M7N A;  1BCP D;  2WAC A;  5D3I B;  1PFN A;  3TDQ A;  3URY A;  4NP5 A;  3VYT A;  2L12 A;  3P20 A;  1SJH D;  4HAE A;  2D5D A;  3RMH A;  3BDC A;  3MA2 B;  3M4Y A;  4H13 C;  3J81 E;  1SYC A;  2WB1 B;  1JOK A;  2DNE A;  1ESF A;  1Q1B A;  3LWE A;  4F8M A;  3ND8 A;  3U9O A;  1XTC D;  3C1F A;  5D14 A;  1YNN C;  3K0Y A;  4G57 A;  2KJX A;  2O4X A;  4FF1 A;  4KV6 A;  2PW5 A;  1F9S A;  2DNC A;  4GZY C;  1HTL D;  4RHR A;  1PMR A;  1TWG B;  2DY8 A;  3TN2 A;  5E4X A;  3OPO A;  4V0B A;  2NN6 H;  3GTQ B;  1YNN D;  3ERO A;  1S5B D;  1UAP A;  2R7Z B;  2H4O A;  2F0G A;  2VB3 X;  2F0W A;  2KVM A;  1IYU A;  1JC7 A;  5NUC A;  4A3F B;  1K83 B;  1KTK A;  1LV9 A;  3D4R A;  4B9W A;  1R4Q B;  2IL8 A;  2EY5 A;  1HQR D;  5IGE A;  4IUT A;  1J8I A;  2JA8 B;  2B8G A;  4NMZ A;  1VMC A;  4L6T B;  1LO5 D;  5CV5 A;  3NQI A;  3VYS A;  4ZYS A;  1V1P A;  1WTV A;  1F2L A;  4KHV A;  5FO9 B;  2F0M A;  1HTP A;  2F0P A;  2CHB D;  3GTL B;  1T5X D;  2NYZ D;  1Z47 A;  4ZUJ A;  3AMU A;  1PLF A;  2LS0 1;  3KF8 A;  3K6O A;  5FO8 B;  1KDC A;  2TMP A;  3EJI A;  2NTT A;  4QUC A;  4ILW A;  2NVX B;  4C1N I;  3OWE B;  1ENF A;  2DY7 A;  1B9M A;  1WTR A;  3RD4 A;  1K8M A;  2F3W A;  4HCE A;  1I3Q B;  3QIA A;  3S1Q B;  3MAQ A;  2A5H A;  5M5W B;  5CV9 A;  3G6J B;  3FDT A;  1Q12 A;  2B2U A;  1B44 D;  3MTS A;  2F0E A;  3L7Z C;  2YYZ A;  1RCV D;  5FK9 C;  1Y8P B;  5K36 H;  1W6K A;  3S14 B;  5JEA G;  1UUP A;  3U9S A;  4F88 A;  2D62 A;  3HOW B;  1I4H A;  4DGZ A;  2PPB C;  2SNS A;  2LFN A;  5D3D A;  4K8I A;  5EPK A;  4EQP A;  4DK0 A;  4FF4 A;  4A3B B;  5KIX A;  3H94 A;  1B3A A;  3PO3 B;  1LTB D;  1LTG D;  3CRK C;  2RBM A;  1HFN A;  2F0L A;  3I4N B;  3R93 A;  2B2V C;  2K5W A;  1STA A;  1Q1E A;  3NBI A;  4K5X A;  3FPP A;  1MSG A;  2XRS D;  3CHB D;  4XDX A;  4XQN A;  1WTO A;  5CR3 A;  2JA5 B;  3SEB A;  2NVQ B;  3TP5 A;  3T51 B;  5HGT A;  3R2T A;  2F1M A;  2OEO A;  1EIG A;  2FMM A;  3J7A V;  2IT1 A;  5KND A;  2ZXR A;  2LY7 A;  1KLU D;  5E4W C;  1BOS A;  1I6H B;  2YU9 B;  1TWF B;  2E2I B;  2F0O A;  1HA5 A;  1G2S A;  1GUG A;  1U4P A;  2IPK D;  4KY5 A;  5FLX E;  1FD7 D;  1CT1 D;  3HGB A;  2A68 C;  4R8N A;  4ZAI A;  5JVH 3;  3WDN A;  2WP8 J;  2QEJ C;  3RLF A;  1AN8 A;  1HXY D;  4U67 3;  1D2B A;  3TBI B;  1L0Y B;  5C3W A;  2FHT A;  3LWU A;  2M00 A;  1TR5 A;  2H1E A;  5ELB A;  1DCZ A;  2BE5 C;  1G2T A;  2G9D A;  4JK1 C;  1LTT D;  4K6D A;  5BN4 A;  4M8A A;  2PZW A;  4G7Z C;  2A6E C;  1J9O A;  3C3L A;  4C3J G;  3IFD A;  2BE5 D;  1PRT D;  4XXE A;  4DXG A;  4H0L C;  1EYA A;  2SOB A;  4O1N A;  1A2T A;  2A6E D;  2Q8R E;  1IKL A;  2BA1 A;  1ET9 A;  5IGB A;  5FOB B;  1SNO A;  1STH A;  5IOC A;  4XTC S;  4NKL A;  3I90 A;  2J7Z A;  2EYL A;  3MHB A;  1DXM A;  3NUC A;  1MGS A;  1TWA B;  1U4R A;  3VR3 A;  4HR7 B;  2F0T A;  1JWM D;  2NVT B;  2WKC A;  1O78 A;  2ZT9 C;  5C0X G;  3AU7 A;  1IKM A;  1ZKO A;  2KA7 A;  2N55 A;  3BYY B;  4C3H G;  4DF7 A;  4KI0 A;  3NQT A;  1Y1V B;  3V96 A;  3A7L A;  2JEA I;  1IW7 C;  4OHJ A;  1GOZ A;  4UAI A;  1PTO F;  3S2H B;  2D2C C;  2EY2 A;  4U68 A;  4A93 B;  1EZ8 A;  5KNB A;  4RHS A;  4BS9 A;  4IFD H;  5A2Q L;  4A3E B;  1VMP A;  2V4D A;  2WAQ B;  2A6H C;  4IUN A;  3KK7 A;  1RF2 D;  1SYG A;  1IHZ A;  2IX0 A;  4HN7 A;  4DNT B;  4OO1 G;  1I4X A;  5C4X B;  3F2U A;  1GXD C;  1PYW D;  1QOH A;  3S1R B;  4C1N K;  3HKZ B;  5CV4 A;  2DN8 A;  4FP5 D;  3GTK B;  1B1Z A;  3SXH A;  1S5C D;  3JAM L;  3HS0 C;  1SYE A;  2QDB A;  1H9J A;  3M85 A;  2JYO A;  1FNV A;  3TP6 A;  3AB9 A;  1HRJ A;  3UI2 A;  4A3K B;  5JJZ A;  3DWQ A;  3VYR A;  3MEH A;  3NHH A;  1KDA A;  1GUT A;  2E75 C;  3BYT B;  1ILP A;  2B2U C;  2XWJ B;  3WOE A;  1SNP A;  1LTR D;  4OO1 I;  1U4L A;  2BA0 A;  2ZXP A;  4BY1 B;  2FMC A;  2E2J B;  3MVV A;  5DNF A;  1CFM A;  5I4D A;  3GTO B;  5EPJ A;  3TZU A;  4ABN A;  1D1K A;  5IIF A;  3I4M B;  2NBF A;  3VA5 A;  3GTJ B;  1EY6 A;  3BS1 A;  3SK6 A;  1HHV A;  2AUJ D;  3SR1 A;  3DWP A;  2TSS A;  4FXG C;  2Q8I B;  2EJF C;  1GHJ A;  2NTS A;  2ID0 A;  2I46 A;  2AQ3 B;  3MWY W;  1F2Z A;  4F87 A;  2MP1 A;  3SVM A;  1S5E D;  2B63 B;  1C8C A;  2AUK A;  1Z6H A;  4BA2 I;  2MGS A;  5HUR A;  5F2D A;  3R8B A;  4HMJ A;  4J1M A;  2MHV A;  5DM7 3;  2FFK B;  2EYO A;  1BR9 A;  3S2D B;  2Z4I A;  1SBB B;  2F3V A;  3FKI B;  1XWE A;  4B9X A;  4KMU C;  2OT2 A;  1WTX A;  1FNU A;  1AW7 A;  3OSO A;  3ONA B;  1SNQ A;  3G7L A;  4FXK C;  1EWH A;  2K01 A;  1JWS D;  3EA6 A;  4TRD A;  2K32 A;  1A3V A;  5IT9 L;  3GD7 A;  2F03 A;  4NDX A;  5I6W A;  2K28 A;  1ZXT A;  1SYB A;  3K5O A;  1ROD A;  3PV0 A;  3FEW X;  4RGO S;  3L3O C;  1ONL A;  1RTO A;  1M4V A;  4ID6 A;  1EY7 A;  3D4W A;  1WTW A;  2AQ2 B;  5KEE A;  1HPC A;  2K5Q A;  2BOS A;  4H7B A;  4IAL A;  4R8I A;  3GV6 A;  1OO9 B;  2JP1 A;  2RA4 A;  1V1O A;  1PZJ D;  4XYQ A;  4ZK9 B;  4CKE A;  1Z7T A;  4QF4 A;  1GJX A;  1LT3 D;  2CW0 C;  1II3 A;  1HFG A;  3VR6 A;  1SE4 A;  3MXU A;  3HOZ B;  1QCB D;  1EWC A;  3A56 A;  3HP3 A;  3DEP A;  1KAA A;  5C3X A;  4KJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...