5KYIA

Crystal structure of staphylococcal nuclease variant delta+phs t62k/v66e ph 9 at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFKKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62K/V66E pH 9 at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kyiA00
4HMJA 1KDCA 4K5WA 1F2ZA 3D6CA 3EROA 3MZ5A 2F0FA 3NHHA 3P1HA 3QOLA 4IUNA 5EKKA 4DFAA 4EQPA 5KGUA 4F7XA 5C3WA 2F0NA 5EKLA 3DMUA 4KV6A 4DGZA 2EYLA 2PYKA 1NSNS 2F0OA 5IGEA 4KHVA 4S3SA 2SNMA 4J6HA 2M00A 5CR3A 2EY1A 1U9RA 3SK8A 5CGKA 3DHQA 1JORA 4HTHA 5J39A 1STYA 5IODA 4KTAA 1ENAA 2F0TA 3E5SA 5ISRA 1A3VA 3NUCA 3OWFA 1EY6A 5CV4A 1A2TA 4K8JA 5IGFA 2F0KA 5HGTA 5F2DA 2NUCA 2EYMA 3S9WA 2EXZA 5JAVA 4NKLA 2PZTA 3RUZA 4PNYA 3MVVA 1STBA 3EJIA 2F0MA 2WACA 5C5LA 3VA5A 1KDAA 4I65A 2F0QA 2QDBA 5DEHA 5HURA 3D4DA 3BDLA 1SYGA 2EYJA 4RKBA 1A3TA 3HEJA 4EQNA 4H7BA 1TQOA 1SNDA 1SYBA 2OXPA 1RKNA 3LX0A 5C3XA 5IGBA 1EY4A 4N9PA 2PZUA 1KAAA 2O4XA 3P75A 4KD3A 4ID6A 4RKLA 4N9TA 2F0JA 1EY9A 1SNPA 2EYFA 3H6MA 4QB4A 1JOKA 4EQOA 2EYOA 3TP7A 4KY7A 1STAA 3D4WA 4KY5A 5KYLA 3C1EA 3SK5A 1EY7A 3BDCA 2F0GA 4NP5A 1F2YA 5IOCA 1TT2A 2LKVA 3HZXA 4K14A 3R3OA 4ZUIA 3TP6A 3NXWA 3MHBA 5J22A 3NP8A 4K5XA 4ZQ3A 5E1FA 4PMBA 4DF7A 3OSOA 2F0UA 2F0IA 3NQTA 4ME5A 5K5PA 1SNCA 4DU9A 3SK4A 5IIFA 3T13A 4G57A 1A2UA 1NUCA 3TP8A 2SNSA 1EY5A 4TRDA 1SYDA 2RKSA 2EY6A 5I6WA 1A3UA 4EVOA 2KQ3A 2EY5A 1KDBA 2F3VA 4HMIA 3SR1A 5CC4A 5IGDA 3SHLA 2F0PA 3D8GA 2ENBA 5I9OA 1JOQA 1EY8A 4KJNA 5EGTA 4IALA 2PW5A 5C6AA 4OL7A 5CV5A 3ERQA 5KEEA 1EYAA 1JOOA 1SNQA 4IZ8A 1KABA 4QMGA 2F3WA 2KHSA 4YIJA 1EZ8A 3MEHA 4LAAA 2F0VA 1STHA 4KD4A 5CV7A 5CV9A 2F0DA 3TP5A 5C4HA 3QB3A 3MXPA 4K6DA 5KRUA 3QOJA 2EY2A 2OF1A 4B9XA 5IGGA 1SYFA 1EQVA 2PZWA 2PQEA 5IGCA 2SOBA 2F0SA 4KJOA 1STGA 2HQEA 2F0EA 5JOBA 3TMEA 2F0HA 3OMGA 5J1ZA 3SK6A 4ZUJA 1SYCA 5CV6A 2OEOA 4K8IA 4QF4A 5E3FA 4J1MA 4NDXA 3SXHA 1EY0A 5KYIA 2F0LA 2PW7A 5DAUA 3EVQA 4NMZA 4R8NA 3T16A 4E6IA 4K2KA 1EZ6A 3PMFA 2EYHA 4MIUA 5KIXA 4B9WA 1SYEA 4WORA 1SNMA 5C4ZA 4WRDA 2RDFA 2EYPA 4ODGA 3ITPA 4K5VA 4KY6A 4PMCA 5I6YA 3C1FA 5CV8A 3V2TA 1EYCA 2RBMA 5NUCA 4F8MA 1TR5A 5M9OA 4K2LA 5C5MA 3NK9A 3U9OA 1IHZA 1STNA 1EYDA 1II3A 1F2MA 1ENCA 1SNOA 5I9PA 2F0WA 1AEXA 3OMCA
chains in the Genus database with same CATH superfamily
3ICEA 1TWFB 1GO3E 1F2ZA 2WB1B 2B2WC 3J80i 1VCIA 3TSSA 1PH1A 2KOLA 4F7XA 1CFMA 3I4NH 4A3DG 1HZBA 1I4XA 1RTOA 5FJ8H 2UUAL 2AWNA 4JC0A 1YNND 2VQFQ 4AIMA 5J39A 4LMQD 4DV5L 2R3ZA 4X65Q 1XNRL 1LTAD 1DYQA 2KJXA 2RCNA 4QUCA 5C5LA 1C0AA 1LTSD 3TS0A 3HG9A 3BDLA 1GUTA 3F2CA 5M5XB 2J4XA 3HOWG 4AQYL 3OHXC 1SNDA 2PZUA 3P75A 2HD3A 1ESFA 3HGBA 4QGUA 1SAPA 4RCOA 4LFAQ 1ILQA 1TT2A 3EQLC 1XWEA 2MJ8A 2NZHA 4BY1H 2IW3A 4F88A 1GUWA 5EAYA 4LF4Q 1KD1C 5E1FA 3CD6A 5C44G 4IUPA 4IOAA 4LFBL 1KIXA 3LGJA 2B2YC 3KF8B 1D6EC 1CQVA 1S5BD 2BH2A 1SE2A 4GS3A 2XNAC 1KDBA 3W2DA 2JA5B 5JVG3 1EEID 1PTOH 1RTNA 4JV5Q 3JAMi 4IUQA 1EQTA 5CV9A 4A3KH 4L5RC 3M85A 1TWFH 4DR4L 4GKKL 4XYQA 4GN5A 3S24A 4DR5L 4JK1C 4C56C 1EQVA 1VQJA 2PZWA 5IGCA 2G9DA 2SOBA 3A5UA 2F0SA 1VQ5A 1WTPA 1D8LA 2NB0A 4FF3A 1CHQD 2R7ZH 5LMNL 1DOKA 3I3CA 2ZTEA 1S4ZA 1Y1VH 1PH6A 1GKHA 3T1HQ 2B2VA 2BE5D 5G3LF 5E7NA 1HZCA 1AZPA 2JP1A 1YJNA 1IYUA 2I5MX 3HOXH 2IWHA 5IYBH 2XSCA 1U4LA 2RF4A 1MD2D 3MA2B 2F0WA 3A5ZB 1WTQA 1ESRA 5ELBA 2D9UA 4KHPQ 2Q2IA 1BO0A 4C2MB 2J0TD 5JEAJ 1U4RA 2K32A 4FVMA 4CJ2C 1RJTA 1NSNS 1VMPA 1VS0A 5IGEA 4HCSA 4S3SA 2M00A 4XT1B 2ZJQA 4A3CG 1S72A 3C46A 1U0LA 2BE5C 2VQFL 1S5FD 4P71A 5CV4A 4K8JA 2XWJB 1ONLA 5F2DA 3PGZA 1I6HB 2F0MA 3U50C 5HURA 3R8BA 2EJGC 5JEAG 1VQIA 2NN6H 1VQ9A 1HNZQ 1CKNB 2C35B 2GN5A 4XDXA 2JA5H 3HOUB 1GUSA 4Z9CB 3CCJA 3H91A 3LX0A 1LTID 2AKWB 3QG1A 1J5EQ 4IPGA 1W2BA 1O7IA 1I50B 3STBD 5EPJA 2L15A 1FNWA 1VQCA 4A3LH 2NBFA 3G48A 4LFAL 5IP9H 4KKUA 3NP8A 3T53B 3CXCA 5K5PA 4YY3Q 2UXBQ 4LF6Q 5IIFA 1JE4A 4LF4L 3D0FA 1PH4A 3QO2A 5K36G 4DV6Q 4OWXB 2K52A 1MIUA 3GTMB 3I70A 2M2LA 2F0PA 3D8GA 3I73A 4P2CB 3BYYB 2JQOA 1D7QA 3STBC 1BCPD 3S15H 2A6HD 4YIJA 2CQOA 4JV5L 2VQEQ 2F1MA 2WKCA 3FMCA 2UUCQ 2N3SA 3VR4A 3CCQA 2K03A 4UP7A 4JBKA 1DZ1A 2VL6A 3SVMA 1DJRD 4LW1A 3L2PA 1K3BC 1I4RA 4V190 3K5OA 3PF5A 1Q1BA 3T1HL 1YEZA 3FHWA 3NEMA 4BA1I 2RDFA 3DLLA 3WOFA 1KRTA 4TQUS 1I6HH 1BCPC 5M3FB 5M9OA 2A6HC 3RN2A 4KN4C 5C5MA 1WFQA 3CHBD 4IOCA 3U4ZA 5C3EG 1GUGA 1DXMA 2G9HD 4DFAA 4KHPL 2ZJPA 3U4VA 1DM0B 1E1OA 4A93H 4LF9L 5L37A 3P20A 5D3IB 1S5ED 5CGKA 5CR3A 3FKIH 3J80L 1WCMB 5IWAQ 2CVRA 1AE2A 5DLQE 5M3FG 2KUMA 2E74C 3AU7A 3WOEA 2NUCA 2XVSA 1SMXA 1L1OB 4QIWB 3ULJA 4JOIA 1U4MA 4KHZA 1GHJA 1FJGQ 3GTMH 5IP7H 3HEJA 1ZYRC 5C4JB 1KXLA 3KLWA 1BQQT 3IFDA 2OXPA 1HNZL 1BOSA 2B2WA 1K8AC 4A3IB 4BXXG 4JI8Q 1KAAA 1Y8OB 2L9HA 4FDBA 2LSSA 4LF7Q 4FXDA 1SE3A 1LT3D 2NN6I 3CF5A 1Z9FA 1HZAA 2QCPX 2JA6G 2BA0A 2Z4IA 1BBUA 2AUJD 2K5WA 3E3XA 2F0UA 5M5WH 4G7OC 3PSIA 4A3IG 1HXYD 2A69D 3Q6SA 1TWHB 4YY3L 5ELDA 2UXBL 4LF6L 2RKSA 3D6WA 3UDXA 4IFDH 2NVXH 3Q8DA 1GUOA 4DAYB 4DV6L 2RCFA 5CC4A 3CPFA 1G291 3ERQA 2UUBQ 3LWEA 4O42A 1KABA 1L0YB 2KECA 4RFBA 3GO5A 3A74A 4MZ9A 3QB3A 2VQEL 3EBEA 4GKJQ 1QUQB 1UE5A 3JAML 2Y0SE 2DNCA 1SFOH 5EBCA 2UUCL 3OMGA 2A69C 4QF4A 1QVFA 1JB3A 5GQOA 2B2YA 3HOYB 1R4PB 3NBHB 3S16B 3GTPB 3GTQB 3CP0A 1TR5A 2R92H 4X3UA 3CRKC 4KV6A 4POGA 1IBLQ 3D6CA 4XQQA 3HOYG 4A3JH 4GOPC 2JA7B 1EQQA 3DMUA 1E2ZA 3C3LA 3VYRA 4HJAA 2CH4A 3MFGA 4OXPA 2FMCA 4M1UB 1XNQQ 3PUVA 3Q23A 1B8AA 3GTOH 1WYDA 2MO0A 2X6GA 1L0XB 2KENA 3KF6B 4JVZA 5IWAL 4K0KQ 1CHPD 2BA1A 2F0KA 2VB2X 1X3PA 1A63A 1JQYD 1FL0A 1BR9A 1PYWD 1TWHH 2KEEA 1O7LA 5JPMC 2L1BA 2RSNA 1JJ2A 3U58A 4MTNA 1KC8C 2C9OA 4OO1H 2Z6KC 3QIAA 3CCVA 4ZKBB 3CMEA 3WWVA 4LJZC 2QGQA 1PYSB 1FGUA 4JI8L 2F0JA 3I56A 2XTIA 2Y0SG 1IL8A 3M9BA 4KY7A 4R9WA 5EPLA 4LF7L 1SRUA 3I7FA 1C8CA 2R93G 3L3OC 3HOZB 2R6GA 3M4QA 2C5CA 2A19A 1Y1WG 5DNFA 4R4OA 5FLXL 2WKDA 2WP8J 1IBKL 3GTGB 1QCBD 3I55A 1Q12A 4IPCA 2ZM6Q 1XJVA 1YHBA 2K01A 4HIOA 4FO2A 4HMIA 3RZOB 3SHLA 1N34L 1QNUA 1EY8A 2EPBA 5CV5A 4JW0A 5AFWA 4IZ8A 4Y7NH 2B2TC 1ENFA 4IFDI 2UUBL 3S1MH 4BBRB 4LF5Q 2JA7H 1SYFA 2PQEA 4DAYA 1PH8A 5JOBA 2Q2HA 4GKJL 5J1ZA 1E3PA 4DAVA 5E3FA 1BBWA 4NMZA 4YCVA 4E6IA 5ELEA 4MIUA 4DV0Q 4R1JA 1Q8IA 2AUKA 4UDUC 3HS0C 3RD4A 1QUQA 2EYPA 3VR6A 1ZEQX 3K81C 2Q8IB 1VQPA 1Q81C 1Z47A 5EJWA 4A3EH 1Y8NB 1HUNA 1EYDA 3K7AH 4KLKA 1PZKD 2YTYA 4HJ9A 4YWKA 1UUPA 2HT1A 3EROA 1PV4A 3P1HA 1EWCA 4RGTA 4IUNA 4A3MH 1IBLL 2B3GA 3NBHA 1BCPF 1B3QA 1X3FA 4DGZA 2E2JH 4FNFA 4ULLA 1F9QA 5D65A 1WTXA 1UAPA 3PUZA 4WFN3 3I4MG 2Q2TA 3EA6A 4XQNA 1XNQL 1ENAA 1E22A 4GOPB 1LV9A 1A3VA 3NUCA 1EY6A 3S1QB 3K57A 1G6PA 4K0KL 3HP3A 3K5LA 4ALPA 4FP5D 2K5VA 1KHIA 2VUMB 3D4DA 5M3MB 4CKBA 5KNCA 4OEMB 2JA8H 4R4IA 2A1AA 5COYA 3RZOH 5IYCG 3FVQA 5CMDA 1D5ZC 2NVQB 4RKLA 3NSWA 3NE5B 2EQSA 4OO1I 4LUZA 1STAA 4BY7G 1EY7A 5D14A 1MKHA 4BBRH 3ND9A 2K05A 5M3MG 5HGQA 4HJ8A 5I4DA 1JORA 1NUCA 1OO9B 2ZTDA 1U5KA 1NMGA 1JCKB 2B63B 2ZM6L 1EQRA 1I3QB 1F9RA 5JJZA 4CDEC 1YNXA 3HOVB 1VQAA 3S1NB 1TWAH 1STHA 5CV7A 2F0DA 1YNJD 1TXYA 3PIPA 3HKSA 4ZKCB 2IX0A 1LM0A 1CM9A 1JWUD 4HR7B 2HQEA 4LF5L 4POFA 4HSPA 1B70B 3H0GB 5C4XG 3SXHA 1S5CD 1TVXA 2K1BA 4RMFA 4DNIA 3HOVG 4RWSC 1H95A 4B9WA 2K04A 3KOJA 1HHVA 1VQGA 4QY7A 2WV6D 3A8JE 4DV7Q 1TWCH 3MXGA 1QOHA 3ITPA 2B8FA 2A68C 5CYUA 1TS4A 4C3IG 2VUMH 1Q90A 3VR3A 1YNJC 1II3A 1I4GA 2OCEA 3OWEB 5IT9L 3H0GG 1TIID 4RGNA 3I4NG 3CC4A 3G4SA 2EZVA 1XPRA 2NVQH 4EQPA 1B9MA 2EDGA 1RF2D 1XX8A 2CHBD 1TS3A 3M3YB 2AQ1B 2EYLA 4XXEA 2F0OA 3TREA 1IW7D 4KHVA 3NELA 2E76C 5C0XJ 5CBAE 5IY0A 3F8TA 4PV1C 2UU9Q 3A7LA 2CW0D 4A3GB 5M5YB 1Q82C 1D5MC 1F2LA 2YTXA 3OTOQ 3H3VC 3IFTA 2WACA 1KDAA 5DEHA 2B63H 2KCNA 2QDBA 3G71A 1IYJB 1SYGA 2NVTB 1X3QA 2A5HA 4O2DA 3QJYA 3W1GA 3S1RB 3M4YA 1KLGD 1EY4A 4C3JG 4GOPA 1KRSA 4WJWA 1EU4A 5C0XG 3DWAA 1AP0A 4QB4A 3HOWB 1HR0W 4A3GG 1JOKA 4EQOA 2XGTA 1ZXTA 2NVYB 5T1GA 1Y69U 3SK5A 1K9MC 3G6JB 1B9NA 2RHQB 1CK1A 2CW0C 4ZUIA 3NXWA 1H9SB 1WTHA 4DF7A 4ME5A 2A73B 4BS9A 1HNWQ 3GTKB 5EKIA 3UE0A 2Z6KA 3A8IE 1STEA 3J7YW 4PG3A 5C44B 3JC66 3PV0A 5IGDA 4RGOS 2MFIA 4FF2A 1NR2A 1A62A 1YNNC 2R61A 1VQ7A 3M7NA 2D0PA 1Y14B 1VQ6A 2ZTCA 4J15A 1EOTA 3ONAB 2EY2A 1SEBD 4B08A 3M3YH 3T4AC 2D62A 3GTJB 3TMEA 2ZXPA 3PO2B 3J81c 3RNUA 4A3DH 2N8NA 1EYGA 2VNUD 3KFUA 5A2QL 4ABNA 3RLOA 3J81L 5A2QE 1X55A 2K5HA 1HR0Q 4K5VA 4KKTA 1E2WA 1HPCA 4DV7L 3J81E 3S14B 1BXTA 4Q5VA 1EYCA 2MGSA 5NUCA 2ZT9C 2B2TA 2F4VL 1X54A 3PO2G 2PQAB 1WI5A 1LACA 5GAHC 4RG1A 4V0BA 2K50A 3QOLA 5EKKA 5GADC 2BCOA 1Z6HA 4B3SQ 3LNNA 3X3NA 3BS1A 3TBIB 2EY1A 4DAPA 1CKMA 4OIJA 1SROA 1H9KA 2TMPA 1EOVA 2HDMA 1YHAA 1IKLA 1X56A 2UU9L 1DOLA 3UE1A 3PIOA 2FFKB 1HRJA 1DD2A 2VB3X 3GTKH 4DK3C 5M5XH 2NN6G 1ZKOA 2F0QA 3OTOL 1X65A 5C44H 2I46A 2OTLA 1V43A 4ME3A 4JPBW 3FPPA 4H0LC 5FO7B 3TN2A 2EJFC 2O2LD 3MAQA 4P74A 4WJ3M 3L0OA 1CSQA 1UEAB 4H44C 3PUYA 4HCEA 1CT1D 3ZYYX 2KVMA 3S2HB 1CUKA 3R2IA 4EGVA 3GTJH 4B3TQ 2KEDA 3J7AF 1WOCA 1MHWC 4X65L 4K6LA 4NPSA 2IHFA 5AJ3Q 1XPUA 4YWMA 1VMCA 3V05A 5JJLA 3SK4A 4G57A 1PYBA 3EFXD 4HSVA 1GUNA 1H9RA 4LNQA 1SE8A 2DNEA 5EPKA 4HIMA 1HNWL 3Q22A 2HIXA 1I4PA 2F3VA 3F2DA 1SLJA 3K58A 4G4KA 1SDFA 2R7DA 4DK0A 2L0CA 5EGTA 1FNUA 5C6AA 1H9SA 1JOOA 4QMGA 3AEVA 1QWYA 1EZ8A 1VQHA 4CDDC 1I5FA 4ZAIA 1MSGA 3OIQA 3BG3A 2HUGA 3BJUA 4HJ5A 1A0IA 1TWGB 1SYCA 4H02A 3MWYW 2F0LA 1QVCA 1UE6A 1FYCA 4Y52H 4XT3B 2YYZA 3L9AX 1NCVA 4A3CH 1HR0L 4JBMA 3U9OA 4DAMA 3KJPA 1A8VA 3H15A 4C2MH 5IODA 1X6OA 1AEXA 1KNEA 1NJIC 2VY3A 3NTKA 1KDCA 2WINB 2I07B 5JEAH 1SJED 3I90A 2KBNA 4JCVE 1LTRD 3BVMA 4A75A 3DEPA 3FKIG 4DA2A 5C3EB 1TS5A 2SNMA 1U9RA 4RH6A 3AB9A 3DM1A 2PQAA 4KKSA 1N9WA 1JJGA 1BKBA 3D31A 1ASYA 2JE6I 2V4DA 3MVVA 2TSSA 3HOUH 2IX1A 1WTOA 2V1CC 4QIWE 4RKBA 4C3HG 4H7BA 4GLVB 4IFDJ 1PH2A 3W3AA 5IGBA 1SSOA 5K36H 3TDQA 3AQQA 1I50H 2R7FA 2YU9B 1G8ZD 1SNPA 5E4XA 4JI4Q 3D4WA 3VR5A 1LT5D 2RDGA 4B3MQ 1JICA 4L63B 4DXFA 1K83B 1HA5A 4GN4B 1VQLA 1EIFA 1IBMQ 1RODA 4JI2Q 1PFMA 1ASZA 3O13A 2AMCB 4B3TL 1CZGA 4L6TB 2JA6B 1QG7A 5TSSA 4JI6Q 2YV5A 2KQ3A 4MN3A 1SJHD 2EY5A 1CA6A 2XRSD 2ENBA 1GJXA 4AYBE 4U673 1J5EL 1EIYB 1U4PA 2WIIB 2H5XA 1FNVA 4KD4A 2E2HB 3HFZB 2FXQA 4K6DA 1RL2A 3K6OA 1L0WA 3VYSA 1O7YA 2B2UC 1STGA 4HN7A 5C3EH 1GVPA 3CQZB 2O5IC 3CMAA 4R8NA 5KNDA 3NTHA 3MC0B 5IYDG 2PMZB 2QEXA 3HKZE 1X3GA 5M3FH 3W5OA 3C1FA 4F8MA 1CZWA 1Q1EA 2RVLA 2PO4A 2Z6BA 1STNA 5DM73 1ICFB 2PNRC 3E0JA 3RN5A 1AN8A 3GP7A 2F03A 1F9SA 3TZUA 1ET9A 1HQRD 1K0SA 5HY6A 1B44D 1R9TB 1WCMH 2CWPA 4BXXH 5FLMH 3SK8A 1EWIA 3K80C 4HTHA 1STYA 4A3BB 1OXTA 3BDOA 1V1OA 4P73A 3OWFA 1JJCB 1PA6A 1SN8A 4N8FA 4CKEA 2AWOA 5JAVA 4DR7Q 1Z7TA 5A35A 5C4JH 3F2UA 4AYBG 4DV3Q 2K28A 4A3IH 1N8RC 4MHEA 1T5XD 2CWAA 3RLFA 2K75A 5JPNC 4M8AA 1BCPB 4A3BG 2Z1CA 1XTCD 4DNRB 3TP7A 4CKCA 5KYLA 1K73C 2N49A 4JI4L 4K14A 3E0EA 3N52A 4UY8C 4B3ML 3KLRA 3PCOB 2Y0SB 1C48A 4X6AH 4JYAQ 3J7ZC 1C9OA 3NWSA 2R93B 4PMBA 5DM63 1UEBA 4OWWB 1PRTD 1IBML 3HKZG 3OOCA 1Y1WB 1EFWA 1HH2P 2EY6A 4MNOA 1FJGL 2PI2E 1E0BA 4JI6L 2N88A 4JI0Q 3CCEA 4OONA 1VQDA 1JE5A 3ND8A 1IYVA 1JWSD 2F0VA 4ZLTF 1VQFA 2JN4A 5I2YA 1VQEA 5IGGA 1PRTC 1C7YA 1Q86C 1HFGA 2F0HA 3RR5A 3UDFA 3HOYH 5GROA 4J1MA 3R93A 3S17B 3CW2C 3N6RA 4OX9Q 2K7VA 1VQNA 2E75C 3S2DB 5KIXA 3S16H 4RHSA 3GTPH 1D5XC 1PFNA 1SXTA 2X69A 3GV3A 3GTQH 1PZJD 1HUMA 1KLUD 1PMRA 2OQ0A 1K28A 1PZID 4GZYC 3ER0A 1V8QA 2I0QA 1FGBD 3H94A 2MPMA 2X6LA 3TEHB 2ICIA 4GNXC 3URYA 3D3RA 2Z9HA 3M4OB 3KYHC 3J81i 2IY5B 2PYKA 4APVA 3NPPA 4BWGB 4LK1C 2IL8A 3F2BA 4RHRA 5JJIA 2R93H 4L8JA 3K0YA 1EUJA 1LTTD 3DWPA 3I4MB 2EYMA 4ZCKA 1CI3M 5G3LD 1Y1WH 3RUZA 3ZJYC 4CDCC 1PH5A 3T51B 4DR7L 4I65A 2JA8G 2PNHA 1PTOD 4DV3L 3KLSX 3M4PA 5JVH3 3A54A 4RA8A 5E4WC 1QE6A 1EY9A 2LXJA 1UE7A 4DNTB 2L12A 3HOZH 1CQFA 1F2YA 5J3BA 2A6ED 3HZXA 1SMYD 1V9PA 2ALYB 1XYIA 3NQIA 4UAIA 4BY7B 3GTGH 3AFPA 4DUZQ 3OSOA 3CCLA 1XMQQ 4JYAL 3S17H 1J9OA 1H9MA 2D0OA 3UI2A 2NYZD 1EY5A 1SYDA 3KBXA 1EU3A 4ILWA 1PTOC 3BYTB 3U9SA 2KCCA 2FINB 1WD1A 4A3FB 2O5JC 4JI0L 4WJ4A 4DXGA 4OL7A 4ZYSA 1WTRA 4LUVA 4DR6Q 3MEHA 2CQAA 1LABA 1F77A 4UP9A 1GHKA 2JJQA 2E5LQ 4KJOA 4DR3Q 4TKOB 1N36Q 4A3FG 2UUAQ 1NAPA 4BBSB 3I4OA 4NDXA 1AFPA 2PW7A 3PO3B 2DJGC 4K2KA 2RDHA 1RD9D 2WAQE 1AW7A 4OX9L 1I4QA 5C4XB 1Q46A 4R8IA 1E24A 4R4CA 4ODGA 3SDZA 4KY6A 3SGIA 1QB5D 2RBMA 1GM5A 4K2LA 1S3OA 1QZHA 1NBWA 4BBSG 1ENCA 2E2IB 3FPUB 4FXKC 4C3IB 3X3MA 1NNXA 3PO3G 3NHHA 1M90C 2B2UA 5C3WA 1VDZA 2LMCB 3TQYA 2CKZB 5IYCH 3I4NB 4J6HA 2BH8A 3S1QH 4GNXB 2F0TA 2RQXA 4DV0L 2D2CC 2JSOA 4QCLA 4X62Q 5M3MH 1AH9A 4DPGA 3OIPA 2SDFA 4FF4A 1TQOA 1M1KC 5FJ8G 4N9PA 4YCWA 1HTPA 1XXGA 2O4XA 2WB1E 2M9VA 2OTJA 2Z8LA 2EYFA 2OQKA 2SEBD 1YHQA 4C3JB 4NP5A 2EIFA 1LLRD 3I8ZA 5EBDA 2NWGA 3CAMA 1G91A 3OW7A 1HCZA 3TP6A 4BY1B 1QJOA 2IPKD 1YJWA 3BVGA 1YBYA 2MHVA 4DUZL 4C1NI 2SNSA 1W6KA 3SEBA 1B4OA 1L2FA 1XMQL 1RIPA 4FF1A 5BN3A 1VQ8A 1IZ6A 2EOTA 1I3QH 5C4XH 2CCZA 3HOVH 3S1NH 4B3RQ 1IW7C 4JG2A 4BY1G 3CCMA 1BNZA 2KHSA 1RCVD 2E2IH 4UPAA 4DR6L 3BZCA 3MXUA 4C3IH 3QOJA 4RGMA 3AYHB 3H0GH 3J7AV 4UHVA 5CV6A 2E5LL 4DR3L 1N36L 1JT8A 4KMUC 2R7ZB 5FKAC 1B2TA 3GDEA 1Y1VB 1LO5D 2F3IA 1PRTF 2OWOA 4XYOA 1DOMA 5I6YA 4A3KG 1GOZA 1NMFA 3V2TA 2WB1G 4HJ7A 3HOXB 1F2MA 1KQSA 4X66Q 1K8OA 4Q0FA 1QILA 2R7ZG 5BR8Q 1S5DD 4JI1Q 1OXXK 1YVCA 1Y1VG 3QR8A 5EKLA 2MNAA 2ID0A 4KN7C 3H09A 2PCFB 5CORA 4C3JH 4PZ7A 1E2VA 2ZXRA 2Q8RE 5C0XH 1HTLD 1QNKA 1WVLA 4A3GH 4G7HC 5M5YH 1K3RA 2DY8A 3IAYA 3HOXG 3CC7A 2YTVA 3KK7A 1MJCA 3OYYA 5HGTA 5IYBG 4JI3Q 2JK8A 4IJLA 4PNYA 2NVTH 4X62L 1KTKA 5T1IA 1CTMA 3S1RH 3MFYA 1A3TA 2EJMA 3MEFA 2H1EA 4OHJA 2KCTA 4GNXA 3HOWH 4TVAB 2NVYH 1ET6A 1PHJA 3A55A 4DV2Q 3KBGA 1KNAA 1V1PA 4IO9A 3UDGA 1VF5C 1DONA 3TZDA 2BDNA 3NWTA 2JEBI 1CA5A 2NTSA 3BZKA 3IKJA 3G7LA 4I7ZC 5J22A 4K5XA 4QJFA 2NTTA 2QKIC 1SNCA 2JXMB 3GV6A 3K5MA 4U68A 3TP8A 1VQKA 2JA5G 1EWHA 4DV1Q 3VA7A 3ULPA 4LUOA 4C1NK 2JYOA 3DEOA 1DGSA 2UXCQ 4B3RL 4A3LG 5I2XA 1PTOF 3K7UC 2Z4HA 2KHJA 2JA9A 5IP9G 1QVGA 3S15B 2K5QA 1B7YB 2ZXOA 4O1NA 4PZ6A 5BN4A 1LTLA 2JEAI 3PO2H 4LF9Q 1ILPA 2OT2A 2VZAA 1VF7A 2DJFC 1MSHA 4EQ5A 1L1OC 3FEWX 2EXDA 1G51A 2CFMA 3KLSA 1F9PA 1P8LA 2A74C 2DUDA 2PPBC 3PUXA 3S14H 2EVBA 1WTWA 1T5EA 1X3EA 4IQZA 1CKOA 3NK9A 2UXDQ 2LS01 2P5ZX 3FDTA 3C2PA 4P75A 3W1BA 3J81j 2DY7A 3F1ZA 3I72A 1I94Q 2N55A 2F0FA 4X66L 4HAEA 4PMWA 5ELNA 1MGSA 1B3AA 4TSSA 5BR8L 4JI1L 1H9JA 1I6VC 4IUVA 3NENA 4A93B 1LTBD 4IN3A 5ELCA 4NXNQ 2XN9C 3FKIB 2K5NA 4X3KA 1VQMA 3HOUG 3GQBA 3S9WA 2EXZA 3ERSX 1M4VA 4JI3L 5C0XI 3E9IA 2VXWA 2B39A 2FMMA 3AMUA 3H3VH 4CJ1B 4A93G 1D1IA 2A8VA 4X3TA 1N32Q 4KD3A 3K5NA 4C3HB 3UDIA 3H6MA 4B3SL 4QUFA 1X9NA 4DV2L 3BDCA 1JB7A 3DWQA 4LFCQ 3S2HH 1E1TA 3PUWA 4GN3B 1Q3LA 3R3OA 4L5TA 1PXUA 3KF8A 2BDOA 5IP7G 2I5LX 4DU9A 3T13A 1PLFA 5M5WB 2K33A 4DV1L 1OTCA 1KL9A 4RAUC 1EIHA 2RSOA 4FXGC 5ELOA 1MBYA 1YJ9A 3CKIB 3SE0A 2H4OA 2NVXB 3PIP3 1EYAA 4DN4M 2UXCL 1YITA 4DR1Q 5C4HA 1FR3A 1LTGD 3MXPA 1MJEA 1NR4A 3VR2A 5GAEC 1Q8KA 2AQ3B 5FOBB 1JWMD 1TWGH 1ZYRD 2L5TA 3J80c 5AJ3L 4IFDG 2OEOA 4K8IA 1JR0D 1SFOB 1EY0A 5KYIA 3DXJC 3T16A 3I91A 1EL0A 1YIJA 4DV4Q 5LHY1 3J80E 4WRDA 2PMZE 3IRBA 4J8QA 2MQHA 1A6XA 5JJKA 1WTVA 3CCSA 2AHOB 3EN2A 2XWBB 1RDPD 2BOSA 1E7ZA 4NXMQ 3I2ZA 1O80A 1YZ6A 3CCUA 2UXDL 2R92B 5KGUA 3T56B 4C3HH 1I94L 1WCMG 3E9HA 3J7A5 1V1QA 5FLMG 4A3JB 3DUZA 4XIGS 1OXVA 1NTGA 3WDNA 2I5HA 1WJJA 4IJHA 2RA4A 1HA6A 5ISRA 3GTLB 5BN5A 3GTOB 4OIKA 4NXNL 1CKNA 2R92G 1K8GA 4DR2Q 2KA7A 2WFWA 1IBKQ 1FD7D 2K6AA 2QW7A 4BA2I 4YHHQ 4EQNA 4A3JG 1X32A 1BUVT 1AZQA 1SYBA 1K8MA 1N34Q 1RKNA 2YU9H 2ASBA 3P7JA 4AYBB 4PQXA 2QDLA 4ID6A 1N32L 1K0RA 2IT1A 3FP9A 4KY5A 3JAMc 2F0GA 1K83H 2FJ2A 3T1YQ 2Q2UA 3H3VI 1GXDC 1D2BA 5D3DA 4LFCL 2G5DA 1UE1A 3K0XA 5LMUQ 1TKWB 4ZQ3A 2JA6H 4OO1G 5EQ0A 4DK1A 3JAME 5H1SE 1A15A 2MP1A 1EEFD 4MTKA 3HKZB 2QF7A 1VQ4A 2L11A 1Y8PB 3SR1A 5I9OA 1JOQA 4O0AA 5IYDH 1HFNA 2E2HH 1SNQA 4NB3A 2GVAA 4CJ0B 2B29A 1XPOA 4Y7NB 5KRUA 4DR1L 2B8GA 3V96A 2DGYA 2OF1A 1I4HA 3BVZA 2LFNA 2HQLA 3CQZH 3S1MB 4JI2L 3SK6A 1PDQA 3MTSA 4ZUJA 3VDYA 1BF4A 4P72A 3KDFB 1BBXC 1YI2A 1PFSA 2EYHA 4HIKA 4KK7A 3GTLH 1XTDA 2XRQD 1SYEA 4WORA 1SNMA 5C4ZA 1J8IA 4PMCA 4DV4L 3NBIA 4H13C 4LF8Q 1RHPA 3R2TA 2HCCA 4GLAC 2ICEC 2JA7G 1WD0A 1LT4D 4A3EB 2VS1A 4NXML 3K7AB 3CC2A 1UNSA 3MZ5A 1R9TH 2F0NA 4F87A 2HHHQ 4A3MB 4HIDA 2HIVA 3KUPA 1B1ZA 3OPOA 4QQBX 3CRLC 3PIO3 4A3BH 4RCNA 2E2JB 2IJ0A 1L1OA 4JI5Q 3DHQA 1DCZA 1S40A 5FLXc 3M7GA 3BU2A 4KTAA 1LT6D 3E5SA 3GD7A 2J7ZA 3RZDB 1A2TA 1IL2A 4A3EG 5LL6X 2XIWA 3HRZC 4IPHA 5FO9B 1LUZA 2LY7A 3FRPB 3EJIA 3KJOA 4DR2L 1HNXQ 1MI2A 4A3MG 5FLXE 4X3SA 2EYJA 2MUYA 4GLXA 2F52A 1T9HA 4OGQC 5FK9C 4YHHL 3MXNB 1N33Q 2JA8B 3A56A 3HOZG 2F4IA 1OXUA 4N9TA 1JMCA 1XMOQ 1PH9A 3B6YA 4CDFC 3PF4A 1EIGA 4PZ8A 1G6ZA 2IX3A 2LKVA 4A4IA 2ZJRA 1R4QB 3E6ZX 4ZK9B 4X64Q 3T1YL 3MHBA 1D1KA 4CHTB 5LMUL 2QA4A 1VQOA 4JI7Q 3G6EA 1HJPA 2MO1A 5I6WA 3K59A 1A3UA 4EVOA 2B2VC 4I7AA 4IPDA 4UP8A 2N78A 4DKAC 4AH6A 4KJNA 4L5QA 4IALA 2LXKA 1TY2A 1P16A 2L55A 2QILA 4BBRG 5KNBA 4G7ZC 2KCMA 4DUYQ 1Q7YC 1M8AA 3AFQA 2Q8TA 3TP5A 2ATWA 1TWAB 3CPWA 2NZ1D 2L4NA 4IUUA 4B9XA 2AQ2B 3EIVA 2IHEA 2D5DA 4OWTB 5CBEE 3S2DH 3IL8A 5DAUA 3A7AB 3EVQA 2KHIA 3PMFA 3Q24A 2Z0SA 3RZDH 1EFID 1GD7A 3D4RA 1J6QA 2K5DA 3CU7A 1TU2B 3PQIA 4R4QA 4XTCS 2QEJC 1KAWA 5CV8A 1TWCB 2A6EC 3TRZA 2NZOA 1SMYC 1IHZA 3BZDB 4LF8L 1ML0D 2RHSB 3KDFA 3OMCA 4HMJA 4K5WA 3M4OH 4XQJA 1JC7A 4L5SA 3KF6A 1VQBA 2E2DC 3ULLA 2HHHL 1PVOA 4DV5Q 3DM3A 3I4LA 3I4MH 1C4QA 1PRTB 4JI5L 4YWLA 1XNRQ 5FO8B 2VUMG 5IGFA 3A0JA 4NKLA 3NTIA 2PZTA 5GAGC 5LMNW 4ZRZA 4YCUA 1PH7A 1B53A 1STBA 3RMHA 3VA5A 3VYTA 3OW2A 1SR3A 1PFBA 2HCIA 4CGYB 4AQYQ 1SE4A 4KI0A 2EE1A 1HNXL 1HZ9A 1O78A 1NY4A 1TY0A 2E8GA 1BVSA 5C3XA 2ES2A 2VW9A 2K4KA 1W6JA 1AE3A 1N33L 1G2TA 3VYUA 1NE3A 2EYOA 4N8X1 1LYLA 2A68D 3C1EA 5IOCA 1XMOL 3CCRA 4BY7H 4IURA 3TS2A 2PI2A 4IUTA 1SBBB 1V1PB 4X64L 3MXNA 4LFBQ 2B63G 4EX5A 4R4TA 2F0IA 3NQTA 1B50A 1PH3A 1A2UA 3K8AA 4TRDA 2FHTA 4LWCA 1TS2A 4QL5A 2WAQB 4A3FH 4JBJA 3Q0AA 4JI7L 1BDOA 4HEDA 1OXSC 2K14A 2PW5A 5IT9c 4FYDA 5KEEA 2HDLA 2F4VQ 1W3SA 2F3WA 4OELB 1FVIA 4LAAA 3RLNA 4DR4Q 2DN8A 4JBWA 4GKKQ 4DR5Q 4DUYL 4NW2A 5ELFA 1CSPA 1QZGA 2WAQG 5LMNQ 4BBSH 5IT9E 5LL6S 2F0EA 1IXRA 4CBVA 3PO3H 3LWUA 1ICWA 1UWVA 1G2SA 2GA4B 2CH4W 1EZ6A 4A3DB 1IKMA 1HQMC 3L7ZC 2GVBA 3QWNA 1PTOB 3A8KE 4JOIC 5IE8A 4A76A 1SNOA 4DK6C 5I9PA 4A3KB 1O7ZA
chains in the Genus database with same CATH topology
1TWFB 1F2ZA 2WB1B 2B2WC 1VCIA 3TSSA 2KOLA 4F7XA 1CFMA 1I4XA 1RTOA 2AWNA 1YNND 5J39A 4LMQD 2R3ZA 1LTAD 1DYQA 2KJXA 4QUCA 5C5LA 1LTSD 3HG9A 3BDLA 1GUTA 5M5XB 2J4XA 3OHXC 1SNDA 2PZUA 3P75A 1ESFA 3HGBA 1SAPA 4RCOA 1ILQA 1TT2A 3EQLC 1XWEA 2MJ8A 2IW3A 4F88A 1GUWA 5E1FA 4IUPA 2B2YC 1D6EC 1CQVA 1S5BD 1SE2A 2XNAC 1KDBA 3W2DA 2JA5B 5JVG3 1EEID 1PTOH 1RTNA 4IUQA 1EQTA 5CV9A 3M85A 4XYQA 4JK1C 4C56C 1EQVA 2PZWA 5IGCA 2G9DA 2SOBA 2F0SA 1WTPA 2NB0A 4FF3A 1CHQD 1DOKA 3I3CA 1S4ZA 2B2VA 2BE5D 5G3LF 1AZPA 2JP1A 1IYUA 2IWHA 2XSCA 1U4LA 1MD2D 3MA2B 2F0WA 1WTQA 1ESRA 5ELBA 2D9UA 1BO0A 4C2MB 2J0TD 5JEAJ 1U4RA 2K32A 4FVMA 4CJ2C 1RJTA 1NSNS 1VMPA 5IGEA 4HCSA 4S3SA 2M00A 4XT1B 3C46A 2BE5C 1S5FD 5CV4A 4K8JA 2XWJB 1ONLA 5F2DA 1I6HB 2F0MA 5HURA 3R8BA 2EJGC 5JEAG 2NN6H 3HOUB 4XDXA 1GUSA 4Z9CB 3H91A 3LX0A 1LTID 3QG1A 1I50B 5EPJA 1FNWA 2NBFA 4KKUA 3NP8A 3T53B 5K5PA 5IIFA 1JE4A 3QO2A 5K36G 3GTMB 3I70A 2M2LA 2F0PA 3D8GA 3I73A 4P2CB 3BYYB 1BCPD 2A6HD 4YIJA 2F1MA 2WKCA 3FMCA 3VR4A 2K03A 1DZ1A 3SVMA 1DJRD 1I4RA 4V190 3K5OA 1Q1BA 4BA1I 2RDFA 3WOFA 4TQUS 1BCPC 5M3FB 5M9OA 2A6HC 4KN4C 5C5MA 3CHBD 1GUGA 1DXMA 2G9HD 4DFAA 1DM0B 3P20A 5D3IB 5CGKA 1S5ED 5CR3A 3J80L 1WCMB 2CVRA 2KUMA 2E74C 3AU7A 3WOEA 2NUCA 2XVSA 4QIWB 1U4MA 4KHZA 1GHJA 3HEJA 1ZYRC 5C4JB 1BQQT 3IFDA 2OXPA 1BOSA 2B2WA 4A3IB 1KAAA 1Y8OB 2L9HA 4FXDA 1SE3A 1LT3D 2NN6I 2QCPX 2BA0A 2Z4IA 2AUJD 2K5WA 4G7OC 2F0UA 1HXYD 2A69D 3Q6SA 1TWHB 5ELDA 2RKSA 3D6WA 4IFDH 1GUOA 5CC4A 1G291 3ERQA 3LWEA 4O42A 1KABA 1L0YB 2KECA 4RFBA 3GO5A 3QB3A 3JAML 2DNCA 5EBCA 3OMGA 2A69C 4QF4A 1JB3A 2B2YA 3HOYB 1R4PB 3S16B 3GTPB 3GTQB 1TR5A 4X3UA 3CRKC 4KV6A 3D6CA 4XQQA 2JA7B 3C3LA 3DMUA 1E2ZA 3VYRA 3MFGA 2FMCA 4M1UB 3PUVA 3Q23A 2X6GA 1L0XB 1CHPD 2BA1A 2F0KA 2VB2X 1X3PA 1JQYD 1BR9A 1PYWD 2KEEA 1O7LA 5JPMC 2L1BA 2RSNA 2C9OA 4OO1H 3QIAA 4ZKBB 4LJZC 2F0JA 5EPLA 1IL8A 4R9WA 4KY7A 1C8CA 3L3OC 3HOZB 2R6GA 2C5CA 5DNFA 5FLXL 2WKDA 2WP8J 3GTGB 1QCBD 1Q12A 2K01A 4FO2A 4HMIA 3RZOB 3SHLA 1QNUA 1EY8A 2EPBA 5CV5A 5AFWA 4IZ8A 2B2TC 1ENFA 4IFDI 4BBRB 1SYFA 2PQEA 4DAYA 5JOBA 5J1ZA 4DAVA 5E3FA 4NMZA 4E6IA 5ELEA 4MIUA 1Q8IA 2AUKA 4UDUC 3HS0C 3RD4A 2EYPA 3VR6A 1ZEQX 2Q8IB 1Z47A 5EJWA 1Y8NB 1HUNA 1EYDA 1PZKD 1UUPA 3EROA 3P1HA 1EWCA 4RGTA 4IUNA 3NBHA 1BCPF 4DGZA 4FNFA 4ULLA 1F9QA 5D65A 1WTXA 1UAPA 3PUZA 4WFN3 3EA6A 4XQNA 1ENAA 1LV9A 1A3VA 3NUCA 1EY6A 3S1QB 3K57A 3HP3A 3K5LA 4FP5D 2VUMB 3D4DA 5M3MB 4CKBA 5KNCA 5COYA 3FVQA 5CMDA 1D5ZC 2NVQB 4RKLA 3NSWA 3NE5B 4OO1I 1STAA 1EY7A 5D14A 3ND9A 2K05A 5I4DA 1JORA 1NUCA 1OO9B 1JCKB 2B63B 1I3QB 1F9RA 5JJZA 3HOVB 3S1NB 1STHA 5CV7A 2F0DA 1YNJD 4ZKCB 2IX0A 1CM9A 1JWUD 4HR7B 2HQEA 4HSPA 3H0GB 3SXHA 1S5CD 1TVXA 2K1BA 4RWSC 4B9WA 2K04A 1HHVA 2WV6D 3A8JE 3MXGA 1QOHA 3ITPA 2B8FA 2A68C 5CYUA 1TS4A 4C3IG 1Q90A 3VR3A 1YNJC 1II3A 1I4GA 3OWEB 5IT9L 1TIID 4RGNA 2EZVA 4EQPA 1B9MA 2EDGA 1RF2D 1XX8A 2CHBD 1TS3A 3M3YB 2AQ1B 2EYLA 4XXEA 2F0OA 1IW7D 4KHVA 2E76C 5C0XJ 5CBAE 4PV1C 3A7LA 2CW0D 4A3GB 5M5YB 1D5MC 1F2LA 3H3VC 3IFTA 2WACA 1KDAA 5DEHA 2KCNA 2QDBA 1SYGA 2NVTB 1X3QA 2A5HA 3QJYA 3S1RB 3M4YA 1KLGD 1EY4A 4C3JG 4WJWA 1EU4A 5C0XG 3DWAA 1AP0A 4QB4A 3HOWB 1JOKA 4EQOA 1ZXTA 5T1GA 2NVYB 1Y69U 3SK5A 3G6JB 1B9NA 1CK1A 2CW0C 4ZUIA 3NXWA 1H9SB 4DF7A 4ME5A 2A73B 4BS9A 3GTKB 5EKIA 3A8IE 1STEA 3J7YW 5C44B 3PV0A 5IGDA 4RGOS 4FF2A 1NR2A 1YNNC 2R61A 3M7NA 1EOTA 3ONAB 2EY2A 1SEBD 4B08A 3T4AC 2D62A 3GTJB 3TMEA 2ZXPA 3PO2B 2VNUD 5A2QL 4ABNA 3J81L 5A2QE 4K5VA 4KKTA 1E2WA 1HPCA 3J81E 3S14B 1BXTA 4Q5VA 1EYCA 2MGSA 5NUCA 2ZT9C 2B2TA 1LACA 4V0BA 3QOLA 5EKKA 2BCOA 1Z6HA 3LNNA 3X3NA 3BS1A 3TBIB 2EY1A 4DAPA 4OIJA 1H9KA 2TMPA 2HDMA 1IKLA 1DOLA 2FFKB 1HRJA 1DD2A 2VB3X 2NN6G 1ZKOA 2F0QA 2I46A 1V43A 3FPPA 4H0LC 5FO7B 3TN2A 2EJFC 2O2LD 3MAQA 1UEAB 4H44C 3PUYA 4HCEA 1CT1D 3ZYYX 2KVMA 3S2HB 3R2IA 4EGVA 3J7AF 2KEDA 4K6LA 3V05A 1VMCA 3SK4A 4G57A 3EFXD 4HSVA 1GUNA 1H9RA 2DNEA 5EPKA 3Q22A 1I4PA 2F3VA 3K58A 4G4KA 1SDFA 4DK0A 2L0CA 5EGTA 1FNUA 5C6AA 1H9SA 1JOOA 4QMGA 1QWYA 1EZ8A 4ZAIA 1MSGA 3OIQA 3BG3A 2HUGA 1TWGB 1SYCA 3MWYW 2F0LA 1FYCA 4XT3B 2YYZA 3L9AX 1NCVA 3U9OA 5IODA 1AEXA 1KNEA 3NTKA 1KDCA 2WINB 2I07B 5JEAH 1SJED 3I90A 1LTRD 3BVMA 3DEPA 4DA2A 5C3EB 1TS5A 2SNMA 1U9RA 4RH6A 3AB9A 3DM1A 4KKSA 3D31A 2JE6I 2V4DA 3MVVA 2TSSA 2IX1A 1WTOA 4RKBA 4C3HG 4H7BA 4IFDJ 3W3AA 5IGBA 1SSOA 5K36H 3TDQA 2YU9B 1G8ZD 1SNPA 5E4XA 3D4WA 3VR5A 1LT5D 2RDGA 1JICA 4L63B 4DXFA 1K83B 1HA5A 1RODA 1PFMA 3O13A 1CZGA 4L6TB 2JA6B 1QG7A 5TSSA 2KQ3A 4MN3A 1SJHD 2EY5A 1CA6A 2XRSD 2ENBA 1GJXA 4U673 1U4PA 2WIIB 1FNVA 4KD4A 2E2HB 4K6DA 3K6OA 3VYSA 1O7YA 2B2UC 1STGA 4HN7A 3CQZB 2O5IC 4R8NA 5KNDA 3NTHA 3MC0B 2PMZB 3C1FA 4F8MA 1CZWA 1Q1EA 2RVLA 2PO4A 1STNA 5DM73 2PNRC 3E0JA 1AN8A 3GP7A 2F03A 1F9SA 3TZUA 1ET9A 1HQRD 1B44D 1R9TB 3SK8A 4HTHA 1STYA 4A3BB 1OXTA 3BDOA 1V1OA 3OWFA 4CKEA 2AWOA 5JAVA 1Z7TA 5A35A 3F2UA 2K28A 4MHEA 1T5XD 3RLFA 5JPNC 4M8AA 1BCPB 2Z1CA 1XTCD 4DNRB 3TP7A 4CKCA 5KYLA 4K14A 3N52A 3KLRA 2Y0SB 1C48A 3NWSA 2R93B 4PMBA 5DM63 1PRTD 3OOCA 1Y1WB 2EY6A 1E0BA 2N88A 3ND8A 1IYVA 1JWSD 2F0VA 4ZLTF 5I2YA 5IGGA 1PRTC 1HFGA 2F0HA 4J1MA 3R93A 3S17B 3N6RA 2K7VA 2E75C 3S2DB 5KIXA 4RHSA 1D5XC 1PFNA 1SXTA 2X69A 3GV3A 1PZJD 1HUMA 1KLUD 1PMRA 1PZID 4GZYC 1V8QA 1FGBD 3H94A 2MPMA 2X6LA 2ICIA 3URYA 3D3RA 3M4OB 2PYKA 3NPPA 4BWGB 4LK1C 2IL8A 4RHRA 4L8JA 3K0YA 1LTTD 3DWPA 3I4MB 2EYMA 1CI3M 5G3LD 3RUZA 3T51B 4I65A 1PTOD 3KLSX 5JVH3 3A54A 4RA8A 5E4WC 1QE6A 1EY9A 4DNTB 2L12A 1CQFA 1F2YA 2A6ED 3HZXA 1SMYD 1XYIA 3NQIA 4UAIA 4BY7B 3OSOA 1J9OA 1H9MA 3UI2A 2NYZD 1EY5A 1SYDA 3KBXA 1EU3A 4ILWA 1PTOC 3BYTB 3U9SA 2KCCA 2FINB 1WD1A 4A3FB 2O5JC 4DXGA 4OL7A 4ZYSA 1WTRA 3MEHA 2CQAA 1LABA 1F77A 1GHKA 4KJOA 4TKOB 4BBSB 1NAPA 4NDXA 1AFPA 2PW7A 3PO3B 4K2KA 2RDHA 1RD9D 1AW7A 1I4QA 5C4XB 4R8IA 4ODGA 3SDZA 4KY6A 1QB5D 2RBMA 4K2LA 1ENCA 2E2IB 3FPUB 4FXKC 4C3IB 3X3MA 3NHHA 2B2UA 5C3WA 1VDZA 2LMCB 3I4NB 4J6HA 2F0TA 2RQXA 2D2CC 2JSOA 4QCLA 3OIPA 2SDFA 4FF4A 1TQOA 4N9PA 1HTPA 1XXGA 2O4XA 2M9VA 2Z8LA 2EYFA 2SEBD 4C3JB 4NP5A 1LLRD 3I8ZA 5EBDA 2NWGA 1G91A 3OW7A 1HCZA 3TP6A 4BY1B 1QJOA 2IPKD 3BVGA 2MHVA 4C1NI 2SNSA 1W6KA 3SEBA 1B4OA 4FF1A 5BN3A 2EOTA 1IW7C 1BNZA 2KHSA 1RCVD 3MXUA 3QOJA 4RGMA 3J7AV 5CV6A 4KMUC 2R7ZB 5FKAC 1B2TA 1Y1VB 1LO5D 1PRTF 4XYOA 1DOMA 5I6YA 1GOZA 3V2TA 3HOXB 1F2MA 1K8OA 4Q0FA 1QILA 1S5DD 1OXXK 5EKLA 2ID0A 4KN7C 3H09A 2PCFB 5CORA 1E2VA 2ZXRA 2Q8RE 5C0XH 1HTLD 1QNKA 1WVLA 4G7HC 2DY8A 3IAYA 3KK7A 5HGTA 4PNYA 1KTKA 5T1IA 1CTMA 3MFYA 1A3TA 2EJMA 4OHJA 2H1EA 1ET6A 3A55A 3KBGA 1KNAA 1V1PA 1DONA 1VF5C 3TZDA 2BDNA 3NWTA 2JEBI 1CA5A 2NTSA 3IKJA 3G7LA 4I7ZC 5J22A 4K5XA 2NTTA 2QKIC 1SNCA 2JXMB 3GV6A 3K5MA 4U68A 3TP8A 1EWHA 3VA7A 4C1NK 2JYOA 3DEOA 5I2XA 1PTOF 2Z4HA 3S15B 2K5QA 2ZXOA 4O1NA 5BN4A 2JEAI 1ILPA 2OT2A 1VF7A 1MSHA 3FEWX 3KLSA 1F9PA 2A74C 2PPBC 3PUXA 2EVBA 1WTWA 1T5EA 4IQZA 3NK9A 2LS01 3FDTA 3C2PA 2DY7A 3I72A 2N55A 2F0FA 4HAEA 4PMWA 1MGSA 1B3AA 4TSSA 1H9JA 1I6VC 4IUVA 4A93B 1LTBD 4IN3A 5ELCA 2XN9C 3FKIB 4X3KA 3GQBA 3S9WA 2EXZA 1M4VA 5C0XI 2VXWA 2B39A 2FMMA 3AMUA 4CJ1B 1D1IA 4X3TA 4KD3A 3K5NA 4C3HB 3H6MA 4QUFA 3BDCA 3DWQA 3PUWA 1Q3LA 3R3OA 1PXUA 3KF8A 2BDOA 4DU9A 3T13A 1PLFA 5M5WB 2K33A 1EIHA 4RAUC 2RSOA 4FXGC 1MBYA 3CKIB 3SE0A 2H4OA 2NVXB 3PIP3 1EYAA 4DN4M 5C4HA 1FR3A 1LTGD 3MXPA 1NR4A 3VR2A 2AQ3B 5FOBB 1JWMD 1ZYRD 2L5TA 4IFDG 2OEOA 4K8IA 1JR0D 1SFOB 1EY0A 5KYIA 3DXJC 3T16A 3I91A 1EL0A 5LHY1 3J80E 4WRDA 4J8QA 1A6XA 1WTVA 2XWBB 1RDPD 2BOSA 1O80A 2R92B 5KGUA 3T56B 4A3JB 3DUZA 4XIGS 1OXVA 3WDNA 2RA4A 1HA6A 5ISRA 3GTLB 5BN5A 3GTOB 4OIKA 2KA7A 1FD7D 2K6AA 4BA2I 4EQNA 1X32A 1BUVT 1AZQA 1SYBA 1K8MA 1RKNA 3P7JA 4AYBB 4PQXA 4ID6A 2IT1A 4KY5A 2F0GA 2FJ2A 1GXDC 1D2BA 5D3DA 1TKWB 4ZQ3A 4OO1G 5EQ0A 4DK1A 3JAME 1A15A 2MP1A 1EEFD 3HKZB 2QF7A 2L11A 1Y8PB 3SR1A 5I9OA 1JOQA 1HFNA 1SNQA 4CJ0B 4Y7NB 5KRUA 2B8GA 3V96A 2OF1A 1I4HA 3BVZA 2LFNA 3S1MB 3SK6A 1PDQA 3MTSA 4ZUJA 1BF4A 1BBXC 2EYHA 4KK7A 2XRQD 1SYEA 4WORA 1SNMA 5C4ZA 1J8IA 4PMCA 3NBIA 4H13C 1RHPA 3R2TA 2HCCA 2ICEC 1WD0A 1LT4D 4A3EB 3K7AB 1UNSA 3MZ5A 2F0NA 4F87A 4A3MB 3KUPA 1B1ZA 3OPOA 3CRLC 3PIO3 2E2JB 4RCNA 2IJ0A 3DHQA 1DCZA 3M7GA 4KTAA 1LT6D 3E5SA 3GD7A 2J7ZA 3RZDB 1A2TA 5LL6X 2XIWA 3HRZC 5FO9B 2LY7A 3FRPB 3EJIA 1MI2A 5FLXE 4X3SA 2EYJA 2MUYA 4OGQC 5FK9C 2JA8B 3A56A 2F4IA 1OXUA 4N9TA 1EIGA 1G6ZA 2IX3A 2LKVA 1R4QB 3E6ZX 4ZK9B 1D1KA 3MHBA 4CHTB 3K59A 5I6WA 1A3UA 4EVOA 2B2VC 4KJNA 4IALA 1TY2A 2L55A 2QILA 5KNBA 4G7ZC 1M8AA 3TP5A 2Q8TA 1TWAB 2NZ1D 2L4NA 4IUUA 4B9XA 2AQ2B 2D5DA 5CBEE 3IL8A 5DAUA 3A7AB 3EVQA 3PMFA 3Q24A 1EFID 3D4RA 2K5DA 3CU7A 1TU2B 4XTCS 2QEJC 5CV8A 1TWCB 2A6EC 1SMYC 1IHZA 3BZDB 1ML0D 3OMCA 4HMJA 4K5WA 4XQJA 1JC7A 2E2DC 3I4LA 1C4QA 1PRTB 5FO8B 5IGFA 4NKLA 3NTIA 2PZTA 4ZRZA 1B53A 1STBA 3RMHA 3VA5A 3VYTA 1PFBA 2HCIA 4CGYB 1SE4A 4KI0A 2EE1A 1O78A 1TY0A 5C3XA 1W6JA 1G2TA 3VYUA 2EYOA 2A68D 3C1EA 5IOCA 4IURA 4IUTA 1SBBB 1V1PB 3MXNA 2F0IA 3NQTA 1B50A 1A2UA 4TRDA 2FHTA 1TS2A 2WAQB 3Q0AA 1BDOA 4HEDA 1OXSC 2PW5A 4FYDA 5KEEA 2HDLA 2F3WA 4LAAA 2DN8A 4JBWA 4NW2A 5ELFA 5IT9E 5LL6S 2F0EA 4CBVA 3LWUA 1ICWA 1G2SA 2GA4B 1EZ6A 4A3DB 1IKMA 1HQMC 3L7ZC 3QWNA 1PTOB 3A8KE 1SNOA 5I9PA 4A3KB 1O7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HMJ A;  1KDC A;  4K5W A;  1F2Z A;  3D6C A;  3ERO A;  3MZ5 A;  2F0F A;  3NHH A;  3P1H A;  3QOL A;  4IUN A;  5EKK A;  4DFA A;  4EQP A;  5KGU A;  4F7X A;  5C3W A;  2F0N A;  5EKL A;  3DMU A;  4KV6 A;  4DGZ A;  2EYL A;  2PYK A;  1NSN S;  2F0O A;  5IGE A;  4KHV A;  4S3S A;  2SNM A;  4J6H A;  2M00 A;  5CR3 A;  2EY1 A;  1U9R A;  3SK8 A;  5CGK A;  3DHQ A;  1JOR A;  4HTH A;  5J39 A;  1STY A;  5IOD A;  4KTA A;  1ENA A;  2F0T A;  3E5S A;  5ISR A;  1A3V A;  3NUC A;  3OWF A;  1EY6 A;  5CV4 A;  1A2T A;  4K8J A;  5IGF A;  2F0K A;  5HGT A;  5F2D A;  2NUC A;  2EYM A;  3S9W A;  2EXZ A;  5JAV A;  4NKL A;  2PZT A;  3RUZ A;  4PNY A;  3MVV A;  1STB A;  3EJI A;  2F0M A;  2WAC A;  5C5L A;  3VA5 A;  1KDA A;  4I65 A;  2F0Q A;  2QDB A;  5DEH A;  5HUR A;  3D4D A;  3BDL A;  1SYG A;  2EYJ A;  4RKB A;  1A3T A;  3HEJ A;  4EQN A;  4H7B A;  1TQO A;  1SND A;  1SYB A;  2OXP A;  1RKN A;  3LX0 A;  5C3X A;  5IGB A;  1EY4 A;  4N9P A;  2PZU A;  1KAA A;  2O4X A;  3P75 A;  4KD3 A;  4ID6 A;  4RKL A;  4N9T A;  2F0J A;  1EY9 A;  1SNP A;  2EYF A;  3H6M A;  4QB4 A;  1JOK A;  4EQO A;  2EYO A;  3TP7 A;  4KY7 A;  1STA A;  3D4W A;  4KY5 A;  5KYL A;  3C1E A;  3SK5 A;  1EY7 A;  3BDC A;  2F0G A;  4NP5 A;  1F2Y A;  5IOC A;  1TT2 A;  2LKV A;  3HZX A;  4K14 A;  3R3O A;  4ZUI A;  3TP6 A;  3NXW A;  3MHB A;  5J22 A;  3NP8 A;  4K5X A;  4ZQ3 A;  5E1F A;  4PMB A;  4DF7 A;  3OSO A;  2F0U A;  2F0I A;  3NQT A;  4ME5 A;  5K5P A;  1SNC A;  4DU9 A;  3SK4 A;  5IIF A;  3T13 A;  4G57 A;  1A2U A;  1NUC A;  3TP8 A;  2SNS A;  1EY5 A;  4TRD A;  1SYD A;  2RKS A;  2EY6 A;  5I6W A;  1A3U A;  4EVO A;  2KQ3 A;  2EY5 A;  1KDB A;  2F3V A;  4HMI A;  3SR1 A;  5CC4 A;  5IGD A;  3SHL A;  2F0P A;  3D8G A;  2ENB A;  5I9O A;  1JOQ A;  1EY8 A;  4KJN A;  5EGT A;  4IAL A;  2PW5 A;  5C6A A;  4OL7 A;  5CV5 A;  3ERQ A;  5KEE A;  1EYA A;  1JOO A;  1SNQ A;  4IZ8 A;  1KAB A;  4QMG A;  2F3W A;  2KHS A;  4YIJ A;  1EZ8 A;  3MEH A;  4LAA A;  2F0V A;  1STH A;  4KD4 A;  5CV7 A;  5CV9 A;  2F0D A;  3TP5 A;  5C4H A;  3QB3 A;  3MXP A;  4K6D A;  5KRU A;  3QOJ A;  2EY2 A;  2OF1 A;  4B9X A;  5IGG A;  1SYF A;  1EQV A;  2PZW A;  2PQE A;  5IGC A;  2SOB A;  2F0S A;  4KJO A;  1STG A;  2HQE A;  2F0E A;  5JOB A;  3TME A;  2F0H A;  3OMG A;  5J1Z A;  3SK6 A;  4ZUJ A;  1SYC A;  5CV6 A;  2OEO A;  4K8I A;  4QF4 A;  5E3F A;  4J1M A;  4NDX A;  3SXH A;  1EY0 A;  5KYI A;  2F0L A;  2PW7 A;  5DAU A;  3EVQ A;  4NMZ A;  4R8N A;  3T16 A;  4E6I A;  4K2K A;  1EZ6 A;  3PMF A;  2EYH A;  4MIU A;  5KIX A;  4B9W A;  1SYE A;  4WOR A;  1SNM A;  5C4Z A;  4WRD A;  2RDF A;  2EYP A;  4ODG A;  3ITP A;  4K5V A;  4KY6 A;  4PMC A;  5I6Y A;  3C1F A;  5CV8 A;  3V2T A;  1EYC A;  2RBM A;  5NUC A;  4F8M A;  1TR5 A;  5M9O A;  4K2L A;  5C5M A;  3NK9 A;  3U9O A;  1IHZ A;  1STN A;  1EYD A;  1II3 A;  1F2M A;  1ENC A;  1SNO A;  5I9P A;  2F0W A;  1AEX A;  3OMC A; 
#chains in the Genus database with same CATH topology
 3ICE A;  1TWF B;  1GO3 E;  1F2Z A;  2WB1 B;  2B2W C;  3J80 i;  1VCI A;  3TSS A;  1PH1 A;  2KOL A;  4F7X A;  1CFM A;  3I4N H;  4A3D G;  1HZB A;  1I4X A;  1RTO A;  5FJ8 H;  2UUA L;  2AWN A;  4JC0 A;  1YNN D;  2VQF Q;  4AIM A;  5J39 A;  4LMQ D;  4DV5 L;  2R3Z A;  4X65 Q;  1XNR L;  1LTA D;  1DYQ A;  2KJX A;  2RCN A;  4QUC A;  5C5L A;  1C0A A;  1LTS D;  3TS0 A;  3HG9 A;  3BDL A;  1GUT A;  3F2C A;  5M5X B;  2J4X A;  3HOW G;  4AQY L;  3OHX C;  1SND A;  2PZU A;  3P75 A;  2HD3 A;  1ESF A;  3HGB A;  4QGU A;  1SAP A;  4RCO A;  4LFA Q;  1ILQ A;  1TT2 A;  3EQL C;  1XWE A;  2MJ8 A;  2NZH A;  4BY1 H;  2IW3 A;  4F88 A;  1GUW A;  5EAY A;  4LF4 Q;  1KD1 C;  5E1F A;  3CD6 A;  5C44 G;  4IUP A;  4IOA A;  4LFB L;  1KIX A;  3LGJ A;  2B2Y C;  3KF8 B;  1D6E C;  1CQV A;  1S5B D;  2BH2 A;  1SE2 A;  4GS3 A;  2XNA C;  1KDB A;  3W2D A;  2JA5 B;  5JVG 3;  1EEI D;  1PTO H;  1RTN A;  4JV5 Q;  3JAM i;  4IUQ A;  1EQT A;  5CV9 A;  4A3K H;  4L5R C;  3M85 A;  1TWF H;  4DR4 L;  4GKK L;  4XYQ A;  4GN5 A;  3S24 A;  4DR5 L;  4JK1 C;  4C56 C;  1EQV A;  1VQJ A;  2PZW A;  5IGC A;  2G9D A;  2SOB A;  3A5U A;  2F0S A;  1VQ5 A;  1WTP A;  1D8L A;  2NB0 A;  4FF3 A;  1CHQ D;  2R7Z H;  5LMN L;  1DOK A;  3I3C A;  2ZTE A;  1S4Z A;  1Y1V H;  1PH6 A;  1GKH A;  3T1H Q;  2B2V A;  2BE5 D;  5G3L F;  5E7N A;  1HZC A;  1AZP A;  2JP1 A;  1YJN A;  1IYU A;  2I5M X;  3HOX H;  2IWH A;  5IYB H;  2XSC A;  1U4L A;  2RF4 A;  1MD2 D;  3MA2 B;  2F0W A;  3A5Z B;  1WTQ A;  1ESR A;  5ELB A;  2D9U A;  4KHP Q;  2Q2I A;  1BO0 A;  4C2M B;  2J0T D;  5JEA J;  1U4R A;  2K32 A;  4FVM A;  4CJ2 C;  1RJT A;  1NSN S;  1VMP A;  1VS0 A;  5IGE A;  4HCS A;  4S3S A;  2M00 A;  4XT1 B;  2ZJQ A;  4A3C G;  1S72 A;  3C46 A;  1U0L A;  2BE5 C;  2VQF L;  1S5F D;  4P71 A;  5CV4 A;  4K8J A;  2XWJ B;  1ONL A;  5F2D A;  3PGZ A;  1I6H B;  2F0M A;  3U50 C;  5HUR A;  3R8B A;  2EJG C;  5JEA G;  1VQI A;  2NN6 H;  1VQ9 A;  1HNZ Q;  1CKN B;  2C35 B;  2GN5 A;  4XDX A;  2JA5 H;  3HOU B;  1GUS A;  4Z9C B;  3CCJ A;  3H91 A;  3LX0 A;  1LTI D;  2AKW B;  3QG1 A;  1J5E Q;  4IPG A;  1W2B A;  1O7I A;  1I50 B;  3STB D;  5EPJ A;  2L15 A;  1FNW A;  1VQC A;  4A3L H;  2NBF A;  3G48 A;  4LFA L;  5IP9 H;  4KKU A;  3NP8 A;  3T53 B;  3CXC A;  5K5P A;  4YY3 Q;  2UXB Q;  4LF6 Q;  5IIF A;  1JE4 A;  4LF4 L;  3D0F A;  1PH4 A;  3QO2 A;  5K36 G;  4DV6 Q;  4OWX B;  2K52 A;  1MIU A;  3GTM B;  3I70 A;  2M2L A;  2F0P A;  3D8G A;  3I73 A;  4P2C B;  3BYY B;  2JQO A;  1D7Q A;  3STB C;  1BCP D;  3S15 H;  2A6H D;  4YIJ A;  2CQO A;  4JV5 L;  2VQE Q;  2F1M A;  2WKC A;  3FMC A;  2UUC Q;  2N3S A;  3VR4 A;  3CCQ A;  2K03 A;  4UP7 A;  4JBK A;  1DZ1 A;  2VL6 A;  3SVM A;  1DJR D;  4LW1 A;  3L2P A;  1K3B C;  1I4R A;  4V19 0;  3K5O A;  3PF5 A;  1Q1B A;  3T1H L;  1YEZ A;  3FHW A;  3NEM A;  4BA1 I;  2RDF A;  3DLL A;  3WOF A;  1KRT A;  4TQU S;  1I6H H;  1BCP C;  5M3F B;  5M9O A;  2A6H C;  3RN2 A;  4KN4 C;  5C5M A;  1WFQ A;  3CHB D;  4IOC A;  3U4Z A;  5C3E G;  1GUG A;  1DXM A;  2G9H D;  4DFA A;  4KHP L;  2ZJP A;  3U4V A;  1DM0 B;  1E1O A;  4A93 H;  4LF9 L;  5L37 A;  3P20 A;  5D3I B;  1S5E D;  5CGK A;  5CR3 A;  3FKI H;  3J80 L;  1WCM B;  5IWA Q;  2CVR A;  1AE2 A;  5DLQ E;  5M3F G;  2KUM A;  2E74 C;  3AU7 A;  3WOE A;  2NUC A;  2XVS A;  1SMX A;  1L1O B;  4QIW B;  3ULJ A;  4JOI A;  1U4M A;  4KHZ A;  1GHJ A;  1FJG Q;  3GTM H;  5IP7 H;  3HEJ A;  1ZYR C;  5C4J B;  1KXL A;  3KLW A;  1BQQ T;  3IFD A;  2OXP A;  1HNZ L;  1BOS A;  2B2W A;  1K8A C;  4A3I B;  4BXX G;  4JI8 Q;  1KAA A;  1Y8O B;  2L9H A;  4FDB A;  2LSS A;  4LF7 Q;  4FXD A;  1SE3 A;  1LT3 D;  2NN6 I;  3CF5 A;  1Z9F A;  1HZA A;  2QCP X;  2JA6 G;  2BA0 A;  2Z4I A;  1BBU A;  2AUJ D;  2K5W A;  3E3X A;  2F0U A;  5M5W H;  4G7O C;  3PSI A;  4A3I G;  1HXY D;  2A69 D;  3Q6S A;  1TWH B;  4YY3 L;  5ELD A;  2UXB L;  4LF6 L;  2RKS A;  3D6W A;  3UDX A;  4IFD H;  2NVX H;  3Q8D A;  1GUO A;  4DAY B;  4DV6 L;  2RCF A;  5CC4 A;  3CPF A;  1G29 1;  3ERQ A;  2UUB Q;  3LWE A;  4O42 A;  1KAB A;  1L0Y B;  2KEC A;  4RFB A;  3GO5 A;  3A74 A;  4MZ9 A;  3QB3 A;  2VQE L;  3EBE A;  4GKJ Q;  1QUQ B;  1UE5 A;  3JAM L;  2Y0S E;  2DNC A;  1SFO H;  5EBC A;  2UUC L;  3OMG A;  2A69 C;  4QF4 A;  1QVF A;  1JB3 A;  5GQO A;  2B2Y A;  3HOY B;  1R4P B;  3NBH B;  3S16 B;  3GTP B;  3GTQ B;  3CP0 A;  1TR5 A;  2R92 H;  4X3U A;  3CRK C;  4KV6 A;  4POG A;  1IBL Q;  3D6C A;  4XQQ A;  3HOY G;  4A3J H;  4GOP C;  2JA7 B;  1EQQ A;  3DMU A;  1E2Z A;  3C3L A;  3VYR A;  4HJA A;  2CH4 A;  3MFG A;  4OXP A;  2FMC A;  4M1U B;  1XNQ Q;  3PUV A;  3Q23 A;  1B8A A;  3GTO H;  1WYD A;  2MO0 A;  2X6G A;  1L0X B;  2KEN A;  3KF6 B;  4JVZ A;  5IWA L;  4K0K Q;  1CHP D;  2BA1 A;  2F0K A;  2VB2 X;  1X3P A;  1A63 A;  1JQY D;  1FL0 A;  1BR9 A;  1PYW D;  1TWH H;  2KEE A;  1O7L A;  5JPM C;  2L1B A;  2RSN A;  1JJ2 A;  3U58 A;  4MTN A;  1KC8 C;  2C9O A;  4OO1 H;  2Z6K C;  3QIA A;  3CCV A;  4ZKB B;  3CME A;  3WWV A;  4LJZ C;  2QGQ A;  1PYS B;  1FGU A;  4JI8 L;  2F0J A;  3I56 A;  2XTI A;  2Y0S G;  1IL8 A;  3M9B A;  4KY7 A;  4R9W A;  5EPL A;  4LF7 L;  1SRU A;  3I7F A;  1C8C A;  2R93 G;  3L3O C;  3HOZ B;  2R6G A;  3M4Q A;  2C5C A;  2A19 A;  1Y1W G;  5DNF A;  4R4O A;  5FLX L;  2WKD A;  2WP8 J;  1IBK L;  3GTG B;  1QCB D;  3I55 A;  1Q12 A;  4IPC A;  2ZM6 Q;  1XJV A;  1YHB A;  2K01 A;  4HIO A;  4FO2 A;  4HMI A;  3RZO B;  3SHL A;  1N34 L;  1QNU A;  1EY8 A;  2EPB A;  5CV5 A;  4JW0 A;  5AFW A;  4IZ8 A;  4Y7N H;  2B2T C;  1ENF A;  4IFD I;  2UUB L;  3S1M H;  4BBR B;  4LF5 Q;  2JA7 H;  1SYF A;  2PQE A;  4DAY A;  1PH8 A;  5JOB A;  2Q2H A;  4GKJ L;  5J1Z A;  1E3P A;  4DAV A;  5E3F A;  1BBW A;  4NMZ A;  4YCV A;  4E6I A;  5ELE A;  4MIU A;  4DV0 Q;  4R1J A;  1Q8I A;  2AUK A;  4UDU C;  3HS0 C;  3RD4 A;  1QUQ A;  2EYP A;  3VR6 A;  1ZEQ X;  3K81 C;  2Q8I B;  1VQP A;  1Q81 C;  1Z47 A;  5EJW A;  4A3E H;  1Y8N B;  1HUN A;  1EYD A;  3K7A H;  4KLK A;  1PZK D;  2YTY A;  4HJ9 A;  4YWK A;  1UUP A;  2HT1 A;  3ERO A;  1PV4 A;  3P1H A;  1EWC A;  4RGT A;  4IUN A;  4A3M H;  1IBL L;  2B3G A;  3NBH A;  1BCP F;  1B3Q A;  1X3F A;  4DGZ A;  2E2J H;  4FNF A;  4ULL A;  1F9Q A;  5D65 A;  1WTX A;  1UAP A;  3PUZ A;  4WFN 3;  3I4M G;  2Q2T A;  3EA6 A;  4XQN A;  1XNQ L;  1ENA A;  1E22 A;  4GOP B;  1LV9 A;  1A3V A;  3NUC A;  1EY6 A;  3S1Q B;  3K57 A;  1G6P A;  4K0K L;  3HP3 A;  3K5L A;  4ALP A;  4FP5 D;  2K5V A;  1KHI A;  2VUM B;  3D4D A;  5M3M B;  4CKB A;  5KNC A;  4OEM B;  2JA8 H;  4R4I A;  2A1A A;  5COY A;  3RZO H;  5IYC G;  3FVQ A;  5CMD A;  1D5Z C;  2NVQ B;  4RKL A;  3NSW A;  3NE5 B;  2EQS A;  4OO1 I;  4LUZ A;  1STA A;  4BY7 G;  1EY7 A;  5D14 A;  1MKH A;  4BBR H;  3ND9 A;  2K05 A;  5M3M G;  5HGQ A;  4HJ8 A;  5I4D A;  1JOR A;  1NUC A;  1OO9 B;  2ZTD A;  1U5K A;  1NMG A;  1JCK B;  2B63 B;  2ZM6 L;  1EQR A;  1I3Q B;  1F9R A;  5JJZ A;  4CDE C;  1YNX A;  3HOV B;  1VQA A;  3S1N B;  1TWA H;  1STH A;  5CV7 A;  2F0D A;  1YNJ D;  1TXY A;  3PIP A;  3HKS A;  4ZKC B;  2IX0 A;  1LM0 A;  1CM9 A;  1JWU D;  4HR7 B;  2HQE A;  4LF5 L;  4POF A;  4HSP A;  1B70 B;  3H0G B;  5C4X G;  3SXH A;  1S5C D;  1TVX A;  2K1B A;  4RMF A;  4DNI A;  3HOV G;  4RWS C;  1H95 A;  4B9W A;  2K04 A;  3KOJ A;  1HHV A;  1VQG A;  4QY7 A;  2WV6 D;  3A8J E;  4DV7 Q;  1TWC H;  3MXG A;  1QOH A;  3ITP A;  2B8F A;  2A68 C;  5CYU A;  1TS4 A;  4C3I G;  2VUM H;  1Q90 A;  3VR3 A;  1YNJ C;  1II3 A;  1I4G A;  2OCE A;  3OWE B;  5IT9 L;  3H0G G;  1TII D;  4RGN A;  3I4N G;  3CC4 A;  3G4S A;  2EZV A;  1XPR A;  2NVQ H;  4EQP A;  1B9M A;  2EDG A;  1RF2 D;  1XX8 A;  2CHB D;  1TS3 A;  3M3Y B;  2AQ1 B;  2EYL A;  4XXE A;  2F0O A;  3TRE A;  1IW7 D;  4KHV A;  3NEL A;  2E76 C;  5C0X J;  5CBA E;  5IY0 A;  3F8T A;  4PV1 C;  2UU9 Q;  3A7L A;  2CW0 D;  4A3G B;  5M5Y B;  1Q82 C;  1D5M C;  1F2L A;  2YTX A;  3OTO Q;  3H3V C;  3IFT A;  2WAC A;  1KDA A;  5DEH A;  2B63 H;  2KCN A;  2QDB A;  3G71 A;  1IYJ B;  1SYG A;  2NVT B;  1X3Q A;  2A5H A;  4O2D A;  3QJY A;  3W1G A;  3S1R B;  3M4Y A;  1KLG D;  1EY4 A;  4C3J G;  4GOP A;  1KRS A;  4WJW A;  1EU4 A;  5C0X G;  3DWA A;  1AP0 A;  4QB4 A;  3HOW B;  1HR0 W;  4A3G G;  1JOK A;  4EQO A;  2XGT A;  1ZXT A;  2NVY B;  5T1G A;  1Y69 U;  3SK5 A;  1K9M C;  3G6J B;  1B9N A;  2RHQ B;  1CK1 A;  2CW0 C;  4ZUI A;  3NXW A;  1H9S B;  1WTH A;  4DF7 A;  4ME5 A;  2A73 B;  4BS9 A;  1HNW Q;  3GTK B;  5EKI A;  3UE0 A;  2Z6K A;  3A8I E;  1STE A;  3J7Y W;  4PG3 A;  5C44 B;  3JC6 6;  3PV0 A;  5IGD A;  4RGO S;  2MFI A;  4FF2 A;  1NR2 A;  1A62 A;  1YNN C;  2R61 A;  1VQ7 A;  3M7N A;  2D0P A;  1Y14 B;  1VQ6 A;  2ZTC A;  4J15 A;  1EOT A;  3ONA B;  2EY2 A;  1SEB D;  4B08 A;  3M3Y H;  3T4A C;  2D62 A;  3GTJ B;  3TME A;  2ZXP A;  3PO2 B;  3J81 c;  3RNU A;  4A3D H;  2N8N A;  1EYG A;  2VNU D;  3KFU A;  5A2Q L;  4ABN A;  3RLO A;  3J81 L;  5A2Q E;  1X55 A;  2K5H A;  1HR0 Q;  4K5V A;  4KKT A;  1E2W A;  1HPC A;  4DV7 L;  3J81 E;  3S14 B;  1BXT A;  4Q5V A;  1EYC A;  2MGS A;  5NUC A;  2ZT9 C;  2B2T A;  2F4V L;  1X54 A;  3PO2 G;  2PQA B;  1WI5 A;  1LAC A;  5GAH C;  4RG1 A;  4V0B A;  2K50 A;  3QOL A;  5EKK A;  5GAD C;  2BCO A;  1Z6H A;  4B3S Q;  3LNN A;  3X3N A;  3BS1 A;  3TBI B;  2EY1 A;  4DAP A;  1CKM A;  4OIJ A;  1SRO A;  1H9K A;  2TMP A;  1EOV A;  2HDM A;  1YHA A;  1IKL A;  1X56 A;  2UU9 L;  1DOL A;  3UE1 A;  3PIO A;  2FFK B;  1HRJ A;  1DD2 A;  2VB3 X;  3GTK H;  4DK3 C;  5M5X H;  2NN6 G;  1ZKO A;  2F0Q A;  3OTO L;  1X65 A;  5C44 H;  2I46 A;  2OTL A;  1V43 A;  4ME3 A;  4JPB W;  3FPP A;  4H0L C;  5FO7 B;  3TN2 A;  2EJF C;  2O2L D;  3MAQ A;  4P74 A;  4WJ3 M;  3L0O A;  1CSQ A;  1UEA B;  4H44 C;  3PUY A;  4HCE A;  1CT1 D;  3ZYY X;  2KVM A;  3S2H B;  1CUK A;  3R2I A;  4EGV A;  3GTJ H;  4B3T Q;  2KED A;  3J7A F;  1WOC A;  1MHW C;  4X65 L;  4K6L A;  4NPS A;  2IHF A;  5AJ3 Q;  1XPU A;  4YWM A;  1VMC A;  3V05 A;  5JJL A;  3SK4 A;  4G57 A;  1PYB A;  3EFX D;  4HSV A;  1GUN A;  1H9R A;  4LNQ A;  1SE8 A;  2DNE A;  5EPK A;  4HIM A;  1HNW L;  3Q22 A;  2HIX A;  1I4P A;  2F3V A;  3F2D A;  1SLJ A;  3K58 A;  4G4K A;  1SDF A;  2R7D A;  4DK0 A;  2L0C A;  5EGT A;  1FNU A;  5C6A A;  1H9S A;  1JOO A;  4QMG A;  3AEV A;  1QWY A;  1EZ8 A;  1VQH A;  4CDD C;  1I5F A;  4ZAI A;  1MSG A;  3OIQ A;  3BG3 A;  2HUG A;  3BJU A;  4HJ5 A;  1A0I A;  1TWG B;  1SYC A;  4H02 A;  3MWY W;  2F0L A;  1QVC A;  1UE6 A;  1FYC A;  4Y52 H;  4XT3 B;  2YYZ A;  3L9A X;  1NCV A;  4A3C H;  1HR0 L;  4JBM A;  3U9O A;  4DAM A;  3KJP A;  1A8V A;  3H15 A;  4C2M H;  5IOD A;  1X6O A;  1AEX A;  1KNE A;  1NJI C;  2VY3 A;  3NTK A;  1KDC A;  2WIN B;  2I07 B;  5JEA H;  1SJE D;  3I90 A;  2KBN A;  4JCV E;  1LTR D;  3BVM A;  4A75 A;  3DEP A;  3FKI G;  4DA2 A;  5C3E B;  1TS5 A;  2SNM A;  1U9R A;  4RH6 A;  3AB9 A;  3DM1 A;  2PQA A;  4KKS A;  1N9W A;  1JJG A;  1BKB A;  3D31 A;  1ASY A;  2JE6 I;  2V4D A;  3MVV A;  2TSS A;  3HOU H;  2IX1 A;  1WTO A;  2V1C C;  4QIW E;  4RKB A;  4C3H G;  4H7B A;  4GLV B;  4IFD J;  1PH2 A;  3W3A A;  5IGB A;  1SSO A;  5K36 H;  3TDQ A;  3AQQ A;  1I50 H;  2R7F A;  2YU9 B;  1G8Z D;  1SNP A;  5E4X A;  4JI4 Q;  3D4W A;  3VR5 A;  1LT5 D;  2RDG A;  4B3M Q;  1JIC A;  4L63 B;  4DXF A;  1K83 B;  1HA5 A;  4GN4 B;  1VQL A;  1EIF A;  1IBM Q;  1ROD A;  4JI2 Q;  1PFM A;  1ASZ A;  3O13 A;  2AMC B;  4B3T L;  1CZG A;  4L6T B;  2JA6 B;  1QG7 A;  5TSS A;  4JI6 Q;  2YV5 A;  2KQ3 A;  4MN3 A;  1SJH D;  2EY5 A;  1CA6 A;  2XRS D;  2ENB A;  1GJX A;  4AYB E;  4U67 3;  1J5E L;  1EIY B;  1U4P A;  2WII B;  2H5X A;  1FNV A;  4KD4 A;  2E2H B;  3HFZ B;  2FXQ A;  4K6D A;  1RL2 A;  3K6O A;  1L0W A;  3VYS A;  1O7Y A;  2B2U C;  1STG A;  4HN7 A;  5C3E H;  1GVP A;  3CQZ B;  2O5I C;  3CMA A;  4R8N A;  5KND A;  3NTH A;  3MC0 B;  5IYD G;  2PMZ B;  2QEX A;  3HKZ E;  1X3G A;  5M3F H;  3W5O A;  3C1F A;  4F8M A;  1CZW A;  1Q1E A;  2RVL A;  2PO4 A;  2Z6B A;  1STN A;  5DM7 3;  1ICF B;  2PNR C;  3E0J A;  3RN5 A;  1AN8 A;  3GP7 A;  2F03 A;  1F9S A;  3TZU A;  1ET9 A;  1HQR D;  1K0S A;  5HY6 A;  1B44 D;  1R9T B;  1WCM H;  2CWP A;  4BXX H;  5FLM H;  3SK8 A;  1EWI A;  3K80 C;  4HTH A;  1STY A;  4A3B B;  1OXT A;  3BDO A;  1V1O A;  4P73 A;  3OWF A;  1JJC B;  1PA6 A;  1SN8 A;  4N8F A;  4CKE A;  2AWO A;  5JAV A;  4DR7 Q;  1Z7T A;  5A35 A;  5C4J H;  3F2U A;  4AYB G;  4DV3 Q;  2K28 A;  4A3I H;  1N8R C;  4MHE A;  1T5X D;  2CWA A;  3RLF A;  2K75 A;  5JPN C;  4M8A A;  1BCP B;  4A3B G;  2Z1C A;  1XTC D;  4DNR B;  3TP7 A;  4CKC A;  5KYL A;  1K73 C;  2N49 A;  4JI4 L;  4K14 A;  3E0E A;  3N52 A;  4UY8 C;  4B3M L;  3KLR A;  3PCO B;  2Y0S B;  1C48 A;  4X6A H;  4JYA Q;  3J7Z C;  1C9O A;  3NWS A;  2R93 B;  4PMB A;  5DM6 3;  1UEB A;  4OWW B;  1PRT D;  1IBM L;  3HKZ G;  3OOC A;  1Y1W B;  1EFW A;  1HH2 P;  2EY6 A;  4MNO A;  1FJG L;  2PI2 E;  1E0B A;  4JI6 L;  2N88 A;  4JI0 Q;  3CCE A;  4OON A;  1VQD A;  1JE5 A;  3ND8 A;  1IYV A;  1JWS D;  2F0V A;  4ZLT F;  1VQF A;  2JN4 A;  5I2Y A;  1VQE A;  5IGG A;  1PRT C;  1C7Y A;  1Q86 C;  1HFG A;  2F0H A;  3RR5 A;  3UDF A;  3HOY H;  5GRO A;  4J1M A;  3R93 A;  3S17 B;  3CW2 C;  3N6R A;  4OX9 Q;  2K7V A;  1VQN A;  2E75 C;  3S2D B;  5KIX A;  3S16 H;  4RHS A;  3GTP H;  1D5X C;  1PFN A;  1SXT A;  2X69 A;  3GV3 A;  3GTQ H;  1PZJ D;  1HUM A;  1KLU D;  1PMR A;  2OQ0 A;  1K28 A;  1PZI D;  4GZY C;  3ER0 A;  1V8Q A;  2I0Q A;  1FGB D;  3H94 A;  2MPM A;  2X6L A;  3TEH B;  2ICI A;  4GNX C;  3URY A;  3D3R A;  2Z9H A;  3M4O B;  3KYH C;  3J81 i;  2IY5 B;  2PYK A;  4APV A;  3NPP A;  4BWG B;  4LK1 C;  2IL8 A;  3F2B A;  4RHR A;  5JJI A;  2R93 H;  4L8J A;  3K0Y A;  1EUJ A;  1LTT D;  3DWP A;  3I4M B;  2EYM A;  4ZCK A;  1CI3 M;  5G3L D;  1Y1W H;  3RUZ A;  3ZJY C;  4CDC C;  1PH5 A;  3T51 B;  4DR7 L;  4I65 A;  2JA8 G;  2PNH A;  1PTO D;  4DV3 L;  3KLS X;  3M4P A;  5JVH 3;  3A54 A;  4RA8 A;  5E4W C;  1QE6 A;  1EY9 A;  2LXJ A;  1UE7 A;  4DNT B;  2L12 A;  3HOZ H;  1CQF A;  1F2Y A;  5J3B A;  2A6E D;  3HZX A;  1SMY D;  1V9P A;  2ALY B;  1XYI A;  3NQI A;  4UAI A;  4BY7 B;  3GTG H;  3AFP A;  4DUZ Q;  3OSO A;  3CCL A;  1XMQ Q;  4JYA L;  3S17 H;  1J9O A;  1H9M A;  2D0O A;  3UI2 A;  2NYZ D;  1EY5 A;  1SYD A;  3KBX A;  1EU3 A;  4ILW A;  1PTO C;  3BYT B;  3U9S A;  2KCC A;  2FIN B;  1WD1 A;  4A3F B;  2O5J C;  4JI0 L;  4WJ4 A;  4DXG A;  4OL7 A;  4ZYS A;  1WTR A;  4LUV A;  4DR6 Q;  3MEH A;  2CQA A;  1LAB A;  1F77 A;  4UP9 A;  1GHK A;  2JJQ A;  2E5L Q;  4KJO A;  4DR3 Q;  4TKO B;  1N36 Q;  4A3F G;  2UUA Q;  1NAP A;  4BBS B;  3I4O A;  4NDX A;  1AFP A;  2PW7 A;  3PO3 B;  2DJG C;  4K2K A;  2RDH A;  1RD9 D;  2WAQ E;  1AW7 A;  4OX9 L;  1I4Q A;  5C4X B;  1Q46 A;  4R8I A;  1E24 A;  4R4C A;  4ODG A;  3SDZ A;  4KY6 A;  3SGI A;  1QB5 D;  2RBM A;  1GM5 A;  4K2L A;  1S3O A;  1QZH A;  1NBW A;  4BBS G;  1ENC A;  2E2I B;  3FPU B;  4FXK C;  4C3I B;  3X3M A;  1NNX A;  3PO3 G;  3NHH A;  1M90 C;  2B2U A;  5C3W A;  1VDZ A;  2LMC B;  3TQY A;  2CKZ B;  5IYC H;  3I4N B;  4J6H A;  2BH8 A;  3S1Q H;  4GNX B;  2F0T A;  2RQX A;  4DV0 L;  2D2C C;  2JSO A;  4QCL A;  4X62 Q;  5M3M H;  1AH9 A;  4DPG A;  3OIP A;  2SDF A;  4FF4 A;  1TQO A;  1M1K C;  5FJ8 G;  4N9P A;  4YCW A;  1HTP A;  1XXG A;  2O4X A;  2WB1 E;  2M9V A;  2OTJ A;  2Z8L A;  2EYF A;  2OQK A;  2SEB D;  1YHQ A;  4C3J B;  4NP5 A;  2EIF A;  1LLR D;  3I8Z A;  5EBD A;  2NWG A;  3CAM A;  1G91 A;  3OW7 A;  1HCZ A;  3TP6 A;  4BY1 B;  1QJO A;  2IPK D;  1YJW A;  3BVG A;  1YBY A;  2MHV A;  4DUZ L;  4C1N I;  2SNS A;  1W6K A;  3SEB A;  1B4O A;  1L2F A;  1XMQ L;  1RIP A;  4FF1 A;  5BN3 A;  1VQ8 A;  1IZ6 A;  2EOT A;  1I3Q H;  5C4X H;  2CCZ A;  3HOV H;  3S1N H;  4B3R Q;  1IW7 C;  4JG2 A;  4BY1 G;  3CCM A;  1BNZ A;  2KHS A;  1RCV D;  2E2I H;  4UPA A;  4DR6 L;  3BZC A;  3MXU A;  4C3I H;  3QOJ A;  4RGM A;  3AYH B;  3H0G H;  3J7A V;  4UHV A;  5CV6 A;  2E5L L;  4DR3 L;  1N36 L;  1JT8 A;  4KMU C;  2R7Z B;  5FKA C;  1B2T A;  3GDE A;  1Y1V B;  1LO5 D;  2F3I A;  1PRT F;  2OWO A;  4XYO A;  1DOM A;  5I6Y A;  4A3K G;  1GOZ A;  1NMF A;  3V2T A;  2WB1 G;  4HJ7 A;  3HOX B;  1F2M A;  1KQS A;  4X66 Q;  1K8O A;  4Q0F A;  1QIL A;  2R7Z G;  5BR8 Q;  1S5D D;  4JI1 Q;  1OXX K;  1YVC A;  1Y1V G;  3QR8 A;  5EKL A;  2MNA A;  2ID0 A;  4KN7 C;  3H09 A;  2PCF B;  5COR A;  4C3J H;  4PZ7 A;  1E2V A;  2ZXR A;  2Q8R E;  5C0X H;  1HTL D;  1QNK A;  1WVL A;  4A3G H;  4G7H C;  5M5Y H;  1K3R A;  2DY8 A;  3IAY A;  3HOX G;  3CC7 A;  2YTV A;  3KK7 A;  1MJC A;  3OYY A;  5HGT A;  5IYB G;  4JI3 Q;  2JK8 A;  4IJL A;  4PNY A;  2NVT H;  4X62 L;  1KTK A;  5T1I A;  1CTM A;  3S1R H;  3MFY A;  1A3T A;  2EJM A;  3MEF A;  2H1E A;  4OHJ A;  2KCT A;  4GNX A;  3HOW H;  4TVA B;  2NVY H;  1ET6 A;  1PHJ A;  3A55 A;  4DV2 Q;  3KBG A;  1KNA A;  1V1P A;  4IO9 A;  3UDG A;  1VF5 C;  1DON A;  3TZD A;  2BDN A;  3NWT A;  2JEB I;  1CA5 A;  2NTS A;  3BZK A;  3IKJ A;  3G7L A;  4I7Z C;  5J22 A;  4K5X A;  4QJF A;  2NTT A;  2QKI C;  1SNC A;  2JXM B;  3GV6 A;  3K5M A;  4U68 A;  3TP8 A;  1VQK A;  2JA5 G;  1EWH A;  4DV1 Q;  3VA7 A;  3ULP A;  4LUO A;  4C1N K;  2JYO A;  3DEO A;  1DGS A;  2UXC Q;  4B3R L;  4A3L G;  5I2X A;  1PTO F;  3K7U C;  2Z4H A;  2KHJ A;  2JA9 A;  5IP9 G;  1QVG A;  3S15 B;  2K5Q A;  1B7Y B;  2ZXO A;  4O1N A;  4PZ6 A;  5BN4 A;  1LTL A;  2JEA I;  3PO2 H;  4LF9 Q;  1ILP A;  2OT2 A;  2VZA A;  1VF7 A;  2DJF C;  1MSH A;  4EQ5 A;  1L1O C;  3FEW X;  2EXD A;  1G51 A;  2CFM A;  3KLS A;  1F9P A;  1P8L A;  2A74 C;  2DUD A;  2PPB C;  3PUX A;  3S14 H;  2EVB A;  1WTW A;  1T5E A;  1X3E A;  4IQZ A;  1CKO A;  3NK9 A;  2UXD Q;  2LS0 1;  2P5Z X;  3FDT A;  3C2P A;  4P75 A;  3W1B A;  3J81 j;  2DY7 A;  3F1Z A;  3I72 A;  1I94 Q;  2N55 A;  2F0F A;  4X66 L;  4HAE A;  4PMW A;  5ELN A;  1MGS A;  1B3A A;  4TSS A;  5BR8 L;  4JI1 L;  1H9J A;  1I6V C;  4IUV A;  3NEN A;  4A93 B;  1LTB D;  4IN3 A;  5ELC A;  4NXN Q;  2XN9 C;  3FKI B;  2K5N A;  4X3K A;  1VQM A;  3HOU G;  3GQB A;  3S9W A;  2EXZ A;  3ERS X;  1M4V A;  4JI3 L;  5C0X I;  3E9I A;  2VXW A;  2B39 A;  2FMM A;  3AMU A;  3H3V H;  4CJ1 B;  4A93 G;  1D1I A;  2A8V A;  4X3T A;  1N32 Q;  4KD3 A;  3K5N A;  4C3H B;  3UDI A;  3H6M A;  4B3S L;  4QUF A;  1X9N A;  4DV2 L;  3BDC A;  1JB7 A;  3DWQ A;  4LFC Q;  3S2H H;  1E1T A;  3PUW A;  4GN3 B;  1Q3L A;  3R3O A;  4L5T A;  1PXU A;  3KF8 A;  2BDO A;  5IP7 G;  2I5L X;  4DU9 A;  3T13 A;  1PLF A;  5M5W B;  2K33 A;  4DV1 L;  1OTC A;  1KL9 A;  4RAU C;  1EIH A;  2RSO A;  4FXG C;  5ELO A;  1MBY A;  1YJ9 A;  3CKI B;  3SE0 A;  2H4O A;  2NVX B;  3PIP 3;  1EYA A;  4DN4 M;  2UXC L;  1YIT A;  4DR1 Q;  5C4H A;  1FR3 A;  1LTG D;  3MXP A;  1MJE A;  1NR4 A;  3VR2 A;  5GAE C;  1Q8K A;  2AQ3 B;  5FOB B;  1JWM D;  1TWG H;  1ZYR D;  2L5T A;  3J80 c;  5AJ3 L;  4IFD G;  2OEO A;  4K8I A;  1JR0 D;  1SFO B;  1EY0 A;  5KYI A;  3DXJ C;  3T16 A;  3I91 A;  1EL0 A;  1YIJ A;  4DV4 Q;  5LHY 1;  3J80 E;  4WRD A;  2PMZ E;  3IRB A;  4J8Q A;  2MQH A;  1A6X A;  5JJK A;  1WTV A;  3CCS A;  2AHO B;  3EN2 A;  2XWB B;  1RDP D;  2BOS A;  1E7Z A;  4NXM Q;  3I2Z A;  1O80 A;  1YZ6 A;  3CCU A;  2UXD L;  2R92 B;  5KGU A;  3T56 B;  4C3H H;  1I94 L;  1WCM G;  3E9H A;  3J7A 5;  1V1Q A;  5FLM G;  4A3J B;  3DUZ A;  4XIG S;  1OXV A;  1NTG A;  3WDN A;  2I5H A;  1WJJ A;  4IJH A;  2RA4 A;  1HA6 A;  5ISR A;  3GTL B;  5BN5 A;  3GTO B;  4OIK A;  4NXN L;  1CKN A;  2R92 G;  1K8G A;  4DR2 Q;  2KA7 A;  2WFW A;  1IBK Q;  1FD7 D;  2K6A A;  2QW7 A;  4BA2 I;  4YHH Q;  4EQN A;  4A3J G;  1X32 A;  1BUV T;  1AZQ A;  1SYB A;  1K8M A;  1N34 Q;  1RKN A;  2YU9 H;  2ASB A;  3P7J A;  4AYB B;  4PQX A;  2QDL A;  4ID6 A;  1N32 L;  1K0R A;  2IT1 A;  3FP9 A;  4KY5 A;  3JAM c;  2F0G A;  1K83 H;  2FJ2 A;  3T1Y Q;  2Q2U A;  3H3V I;  1GXD C;  1D2B A;  5D3D A;  4LFC L;  2G5D A;  1UE1 A;  3K0X A;  5LMU Q;  1TKW B;  4ZQ3 A;  2JA6 H;  4OO1 G;  5EQ0 A;  4DK1 A;  3JAM E;  5H1S E;  1A15 A;  2MP1 A;  1EEF D;  4MTK A;  3HKZ B;  2QF7 A;  1VQ4 A;  2L11 A;  1Y8P B;  3SR1 A;  5I9O A;  1JOQ A;  4O0A A;  5IYD H;  1HFN A;  2E2H H;  1SNQ A;  4NB3 A;  2GVA A;  4CJ0 B;  2B29 A;  1XPO A;  4Y7N B;  5KRU A;  4DR1 L;  2B8G A;  3V96 A;  2DGY A;  2OF1 A;  1I4H A;  3BVZ A;  2LFN A;  2HQL A;  3CQZ H;  3S1M B;  4JI2 L;  3SK6 A;  1PDQ A;  3MTS A;  4ZUJ A;  3VDY A;  1BF4 A;  4P72 A;  3KDF B;  1BBX C;  1YI2 A;  1PFS A;  2EYH A;  4HIK A;  4KK7 A;  3GTL H;  1XTD A;  2XRQ D;  1SYE A;  4WOR A;  1SNM A;  5C4Z A;  1J8I A;  4PMC A;  4DV4 L;  3NBI A;  4H13 C;  4LF8 Q;  1RHP A;  3R2T A;  2HCC A;  4GLA C;  2ICE C;  2JA7 G;  1WD0 A;  1LT4 D;  4A3E B;  2VS1 A;  4NXM L;  3K7A B;  3CC2 A;  1UNS A;  3MZ5 A;  1R9T H;  2F0N A;  4F87 A;  2HHH Q;  4A3M B;  4HID A;  2HIV A;  3KUP A;  1B1Z A;  3OPO A;  4QQB X;  3CRL C;  3PIO 3;  4A3B H;  4RCN A;  2E2J B;  2IJ0 A;  1L1O A;  4JI5 Q;  3DHQ A;  1DCZ A;  1S40 A;  5FLX c;  3M7G A;  3BU2 A;  4KTA A;  1LT6 D;  3E5S A;  3GD7 A;  2J7Z A;  3RZD B;  1A2T A;  1IL2 A;  4A3E G;  5LL6 X;  2XIW A;  3HRZ C;  4IPH A;  5FO9 B;  1LUZ A;  2LY7 A;  3FRP B;  3EJI A;  3KJO A;  4DR2 L;  1HNX Q;  1MI2 A;  4A3M G;  5FLX E;  4X3S A;  2EYJ A;  2MUY A;  4GLX A;  2F52 A;  1T9H A;  4OGQ C;  5FK9 C;  4YHH L;  3MXN B;  1N33 Q;  2JA8 B;  3A56 A;  3HOZ G;  2F4I A;  1OXU A;  4N9T A;  1JMC A;  1XMO Q;  1PH9 A;  3B6Y A;  4CDF C;  3PF4 A;  1EIG A;  4PZ8 A;  1G6Z A;  2IX3 A;  2LKV A;  4A4I A;  2ZJR A;  1R4Q B;  3E6Z X;  4ZK9 B;  4X64 Q;  3T1Y L;  3MHB A;  1D1K A;  4CHT B;  5LMU L;  2QA4 A;  1VQO A;  4JI7 Q;  3G6E A;  1HJP A;  2MO1 A;  5I6W A;  3K59 A;  1A3U A;  4EVO A;  2B2V C;  4I7A A;  4IPD A;  4UP8 A;  2N78 A;  4DKA C;  4AH6 A;  4KJN A;  4L5Q A;  4IAL A;  2LXK A;  1TY2 A;  1P16 A;  2L55 A;  2QIL A;  4BBR G;  5KNB A;  4G7Z C;  2KCM A;  4DUY Q;  1Q7Y C;  1M8A A;  3AFQ A;  2Q8T A;  3TP5 A;  2ATW A;  1TWA B;  3CPW A;  2NZ1 D;  2L4N A;  4IUU A;  4B9X A;  2AQ2 B;  3EIV A;  2IHE A;  2D5D A;  4OWT B;  5CBE E;  3S2D H;  3IL8 A;  5DAU A;  3A7A B;  3EVQ A;  2KHI A;  3PMF A;  3Q24 A;  2Z0S A;  3RZD H;  1EFI D;  1GD7 A;  3D4R A;  1J6Q A;  2K5D A;  3CU7 A;  1TU2 B;  3PQI A;  4R4Q A;  4XTC S;  2QEJ C;  1KAW A;  5CV8 A;  1TWC B;  2A6E C;  3TRZ A;  2NZO A;  1SMY C;  1IHZ A;  3BZD B;  4LF8 L;  1ML0 D;  2RHS B;  3KDF A;  3OMC A;  4HMJ A;  4K5W A;  3M4O H;  4XQJ A;  1JC7 A;  4L5S A;  3KF6 A;  1VQB A;  2E2D C;  3ULL A;  2HHH L;  1PVO A;  4DV5 Q;  3DM3 A;  3I4L A;  3I4M H;  1C4Q A;  1PRT B;  4JI5 L;  4YWL A;  1XNR Q;  5FO8 B;  2VUM G;  5IGF A;  3A0J A;  4NKL A;  3NTI A;  2PZT A;  5GAG C;  5LMN W;  4ZRZ A;  4YCU A;  1PH7 A;  1B53 A;  1STB A;  3RMH A;  3VA5 A;  3VYT A;  3OW2 A;  1SR3 A;  1PFB A;  2HCI A;  4CGY B;  4AQY Q;  1SE4 A;  4KI0 A;  2EE1 A;  1HNX L;  1HZ9 A;  1O78 A;  1NY4 A;  1TY0 A;  2E8G A;  1BVS A;  5C3X A;  2ES2 A;  2VW9 A;  2K4K A;  1W6J A;  1AE3 A;  1N33 L;  1G2T A;  3VYU A;  1NE3 A;  2EYO A;  4N8X 1;  1LYL A;  2A68 D;  3C1E A;  5IOC A;  1XMO L;  3CCR A;  4BY7 H;  4IUR A;  3TS2 A;  2PI2 A;  4IUT A;  1SBB B;  1V1P B;  4X64 L;  3MXN A;  4LFB Q;  2B63 G;  4EX5 A;  4R4T A;  2F0I A;  3NQT A;  1B50 A;  1PH3 A;  1A2U A;  3K8A A;  4TRD A;  2FHT A;  4LWC A;  1TS2 A;  4QL5 A;  2WAQ B;  4A3F H;  4JBJ A;  3Q0A A;  4JI7 L;  1BDO A;  4HED A;  1OXS C;  2K14 A;  2PW5 A;  5IT9 c;  4FYD A;  5KEE A;  2HDL A;  2F4V Q;  1W3S A;  2F3W A;  4OEL B;  1FVI A;  4LAA A;  3RLN A;  4DR4 Q;  2DN8 A;  4JBW A;  4GKK Q;  4DR5 Q;  4DUY L;  4NW2 A;  5ELF A;  1CSP A;  1QZG A;  2WAQ G;  5LMN Q;  4BBS H;  5IT9 E;  5LL6 S;  2F0E A;  1IXR A;  4CBV A;  3PO3 H;  3LWU A;  1ICW A;  1UWV A;  1G2S A;  2GA4 B;  2CH4 W;  1EZ6 A;  4A3D B;  1IKM A;  1HQM C;  3L7Z C;  2GVB A;  3QWN A;  1PTO B;  3A8K E;  4JOI C;  5IE8 A;  4A76 A;  1SNO A;  4DK6 C;  5I9P A;  4A3K B;  1O7Z A; 
#chains in the Genus database with same CATH homology
 1TWF B;  1F2Z A;  2WB1 B;  2B2W C;  1VCI A;  3TSS A;  2KOL A;  4F7X A;  1CFM A;  1I4X A;  1RTO A;  2AWN A;  1YNN D;  5J39 A;  4LMQ D;  2R3Z A;  1LTA D;  1DYQ A;  2KJX A;  4QUC A;  5C5L A;  1LTS D;  3HG9 A;  3BDL A;  1GUT A;  5M5X B;  2J4X A;  3OHX C;  1SND A;  2PZU A;  3P75 A;  1ESF A;  3HGB A;  1SAP A;  4RCO A;  1ILQ A;  1TT2 A;  3EQL C;  1XWE A;  2MJ8 A;  2IW3 A;  4F88 A;  1GUW A;  5E1F A;  4IUP A;  2B2Y C;  1D6E C;  1CQV A;  1S5B D;  1SE2 A;  2XNA C;  1KDB A;  3W2D A;  2JA5 B;  5JVG 3;  1EEI D;  1PTO H;  1RTN A;  4IUQ A;  1EQT A;  5CV9 A;  3M85 A;  4XYQ A;  4JK1 C;  4C56 C;  1EQV A;  2PZW A;  5IGC A;  2G9D A;  2SOB A;  2F0S A;  1WTP A;  2NB0 A;  4FF3 A;  1CHQ D;  1DOK A;  3I3C A;  1S4Z A;  2B2V A;  2BE5 D;  5G3L F;  1AZP A;  2JP1 A;  1IYU A;  2IWH A;  2XSC A;  1U4L A;  1MD2 D;  3MA2 B;  2F0W A;  1WTQ A;  1ESR A;  5ELB A;  2D9U A;  1BO0 A;  4C2M B;  2J0T D;  5JEA J;  1U4R A;  2K32 A;  4FVM A;  4CJ2 C;  1RJT A;  1NSN S;  1VMP A;  5IGE A;  4HCS A;  4S3S A;  2M00 A;  4XT1 B;  3C46 A;  2BE5 C;  1S5F D;  5CV4 A;  4K8J A;  2XWJ B;  1ONL A;  5F2D A;  1I6H B;  2F0M A;  5HUR A;  3R8B A;  2EJG C;  5JEA G;  2NN6 H;  3HOU B;  4XDX A;  1GUS A;  4Z9C B;  3H91 A;  3LX0 A;  1LTI D;  3QG1 A;  1I50 B;  5EPJ A;  1FNW A;  2NBF A;  4KKU A;  3NP8 A;  3T53 B;  5K5P A;  5IIF A;  1JE4 A;  3QO2 A;  5K36 G;  3GTM B;  3I70 A;  2M2L A;  2F0P A;  3D8G A;  3I73 A;  4P2C B;  3BYY B;  1BCP D;  2A6H D;  4YIJ A;  2F1M A;  2WKC A;  3FMC A;  3VR4 A;  2K03 A;  1DZ1 A;  3SVM A;  1DJR D;  1I4R A;  4V19 0;  3K5O A;  1Q1B A;  4BA1 I;  2RDF A;  3WOF A;  4TQU S;  1BCP C;  5M3F B;  5M9O A;  2A6H C;  4KN4 C;  5C5M A;  3CHB D;  1GUG A;  1DXM A;  2G9H D;  4DFA A;  1DM0 B;  3P20 A;  5D3I B;  5CGK A;  1S5E D;  5CR3 A;  3J80 L;  1WCM B;  2CVR A;  2KUM A;  2E74 C;  3AU7 A;  3WOE A;  2NUC A;  2XVS A;  4QIW B;  1U4M A;  4KHZ A;  1GHJ A;  3HEJ A;  1ZYR C;  5C4J B;  1BQQ T;  3IFD A;  2OXP A;  1BOS A;  2B2W A;  4A3I B;  1KAA A;  1Y8O B;  2L9H A;  4FXD A;  1SE3 A;  1LT3 D;  2NN6 I;  2QCP X;  2BA0 A;  2Z4I A;  2AUJ D;  2K5W A;  4G7O C;  2F0U A;  1HXY D;  2A69 D;  3Q6S A;  1TWH B;  5ELD A;  2RKS A;  3D6W A;  4IFD H;  1GUO A;  5CC4 A;  1G29 1;  3ERQ A;  3LWE A;  4O42 A;  1KAB A;  1L0Y B;  2KEC A;  4RFB A;  3GO5 A;  3QB3 A;  3JAM L;  2DNC A;  5EBC A;  3OMG A;  2A69 C;  4QF4 A;  1JB3 A;  2B2Y A;  3HOY B;  1R4P B;  3S16 B;  3GTP B;  3GTQ B;  1TR5 A;  4X3U A;  3CRK C;  4KV6 A;  3D6C A;  4XQQ A;  2JA7 B;  3C3L A;  3DMU A;  1E2Z A;  3VYR A;  3MFG A;  2FMC A;  4M1U B;  3PUV A;  3Q23 A;  2X6G A;  1L0X B;  1CHP D;  2BA1 A;  2F0K A;  2VB2 X;  1X3P A;  1JQY D;  1BR9 A;  1PYW D;  2KEE A;  1O7L A;  5JPM C;  2L1B A;  2RSN A;  2C9O A;  4OO1 H;  3QIA A;  4ZKB B;  4LJZ C;  2F0J A;  5EPL A;  1IL8 A;  4R9W A;  4KY7 A;  1C8C A;  3L3O C;  3HOZ B;  2R6G A;  2C5C A;  5DNF A;  5FLX L;  2WKD A;  2WP8 J;  3GTG B;  1QCB D;  1Q12 A;  2K01 A;  4FO2 A;  4HMI A;  3RZO B;  3SHL A;  1QNU A;  1EY8 A;  2EPB A;  5CV5 A;  5AFW A;  4IZ8 A;  2B2T C;  1ENF A;  4IFD I;  4BBR B;  1SYF A;  2PQE A;  4DAY A;  5JOB A;  5J1Z A;  4DAV A;  5E3F A;  4NMZ A;  4E6I A;  5ELE A;  4MIU A;  1Q8I A;  2AUK A;  4UDU C;  3HS0 C;  3RD4 A;  2EYP A;  3VR6 A;  1ZEQ X;  2Q8I B;  1Z47 A;  5EJW A;  1Y8N B;  1HUN A;  1EYD A;  1PZK D;  1UUP A;  3ERO A;  3P1H A;  1EWC A;  4RGT A;  4IUN A;  3NBH A;  1BCP F;  4DGZ A;  4FNF A;  4ULL A;  1F9Q A;  5D65 A;  1WTX A;  1UAP A;  3PUZ A;  4WFN 3;  3EA6 A;  4XQN A;  1ENA A;  1LV9 A;  1A3V A;  3NUC A;  1EY6 A;  3S1Q B;  3K57 A;  3HP3 A;  3K5L A;  4FP5 D;  2VUM B;  3D4D A;  5M3M B;  4CKB A;  5KNC A;  5COY A;  3FVQ A;  5CMD A;  1D5Z C;  2NVQ B;  4RKL A;  3NSW A;  3NE5 B;  4OO1 I;  1STA A;  1EY7 A;  5D14 A;  3ND9 A;  2K05 A;  5I4D A;  1JOR A;  1NUC A;  1OO9 B;  1JCK B;  2B63 B;  1I3Q B;  1F9R A;  5JJZ A;  3HOV B;  3S1N B;  1STH A;  5CV7 A;  2F0D A;  1YNJ D;  4ZKC B;  2IX0 A;  1CM9 A;  1JWU D;  4HR7 B;  2HQE A;  4HSP A;  3H0G B;  3SXH A;  1S5C D;  1TVX A;  2K1B A;  4RWS C;  4B9W A;  2K04 A;  1HHV A;  2WV6 D;  3A8J E;  3MXG A;  1QOH A;  3ITP A;  2B8F A;  2A68 C;  5CYU A;  1TS4 A;  4C3I G;  1Q90 A;  3VR3 A;  1YNJ C;  1II3 A;  1I4G A;  3OWE B;  5IT9 L;  1TII D;  4RGN A;  2EZV A;  4EQP A;  1B9M A;  2EDG A;  1RF2 D;  1XX8 A;  2CHB D;  1TS3 A;  3M3Y B;  2AQ1 B;  2EYL A;  4XXE A;  2F0O A;  1IW7 D;  4KHV A;  2E76 C;  5C0X J;  5CBA E;  4PV1 C;  3A7L A;  2CW0 D;  4A3G B;  5M5Y B;  1D5M C;  1F2L A;  3H3V C;  3IFT A;  2WAC A;  1KDA A;  5DEH A;  2KCN A;  2QDB A;  1SYG A;  2NVT B;  1X3Q A;  2A5H A;  3QJY A;  3S1R B;  3M4Y A;  1KLG D;  1EY4 A;  4C3J G;  4WJW A;  1EU4 A;  5C0X G;  3DWA A;  1AP0 A;  4QB4 A;  3HOW B;  1JOK A;  4EQO A;  1ZXT A;  5T1G A;  2NVY B;  1Y69 U;  3SK5 A;  3G6J B;  1B9N A;  1CK1 A;  2CW0 C;  4ZUI A;  3NXW A;  1H9S B;  4DF7 A;  4ME5 A;  2A73 B;  4BS9 A;  3GTK B;  5EKI A;  3A8I E;  1STE A;  3J7Y W;  5C44 B;  3PV0 A;  5IGD A;  4RGO S;  4FF2 A;  1NR2 A;  1YNN C;  2R61 A;  3M7N A;  1EOT A;  3ONA B;  2EY2 A;  1SEB D;  4B08 A;  3T4A C;  2D62 A;  3GTJ B;  3TME A;  2ZXP A;  3PO2 B;  2VNU D;  5A2Q L;  4ABN A;  3J81 L;  5A2Q E;  4K5V A;  4KKT A;  1E2W A;  1HPC A;  3J81 E;  3S14 B;  1BXT A;  4Q5V A;  1EYC A;  2MGS A;  5NUC A;  2ZT9 C;  2B2T A;  1LAC A;  4V0B A;  3QOL A;  5EKK A;  2BCO A;  1Z6H A;  3LNN A;  3X3N A;  3BS1 A;  3TBI B;  2EY1 A;  4DAP A;  4OIJ A;  1H9K A;  2TMP A;  2HDM A;  1IKL A;  1DOL A;  2FFK B;  1HRJ A;  1DD2 A;  2VB3 X;  2NN6 G;  1ZKO A;  2F0Q A;  2I46 A;  1V43 A;  3FPP A;  4H0L C;  5FO7 B;  3TN2 A;  2EJF C;  2O2L D;  3MAQ A;  1UEA B;  4H44 C;  3PUY A;  4HCE A;  1CT1 D;  3ZYY X;  2KVM A;  3S2H B;  3R2I A;  4EGV A;  3J7A F;  2KED A;  4K6L A;  3V05 A;  1VMC A;  3SK4 A;  4G57 A;  3EFX D;  4HSV A;  1GUN A;  1H9R A;  2DNE A;  5EPK A;  3Q22 A;  1I4P A;  2F3V A;  3K58 A;  4G4K A;  1SDF A;  4DK0 A;  2L0C A;  5EGT A;  1FNU A;  5C6A A;  1H9S A;  1JOO A;  4QMG A;  1QWY A;  1EZ8 A;  4ZAI A;  1MSG A;  3OIQ A;  3BG3 A;  2HUG A;  1TWG B;  1SYC A;  3MWY W;  2F0L A;  1FYC A;  4XT3 B;  2YYZ A;  3L9A X;  1NCV A;  3U9O A;  5IOD A;  1AEX A;  1KNE A;  3NTK A;  1KDC A;  2WIN B;  2I07 B;  5JEA H;  1SJE D;  3I90 A;  1LTR D;  3BVM A;  3DEP A;  4DA2 A;  5C3E B;  1TS5 A;  2SNM A;  1U9R A;  4RH6 A;  3AB9 A;  3DM1 A;  4KKS A;  3D31 A;  2JE6 I;  2V4D A;  3MVV A;  2TSS A;  2IX1 A;  1WTO A;  4RKB A;  4C3H G;  4H7B A;  4IFD J;  3W3A A;  5IGB A;  1SSO A;  5K36 H;  3TDQ A;  2YU9 B;  1G8Z D;  1SNP A;  5E4X A;  3D4W A;  3VR5 A;  1LT5 D;  2RDG A;  1JIC A;  4L63 B;  4DXF A;  1K83 B;  1HA5 A;  1ROD A;  1PFM A;  3O13 A;  1CZG A;  4L6T B;  2JA6 B;  1QG7 A;  5TSS A;  2KQ3 A;  4MN3 A;  1SJH D;  2EY5 A;  1CA6 A;  2XRS D;  2ENB A;  1GJX A;  4U67 3;  1U4P A;  2WII B;  1FNV A;  4KD4 A;  2E2H B;  4K6D A;  3K6O A;  3VYS A;  1O7Y A;  2B2U C;  1STG A;  4HN7 A;  3CQZ B;  2O5I C;  4R8N A;  5KND A;  3NTH A;  3MC0 B;  2PMZ B;  3C1F A;  4F8M A;  1CZW A;  1Q1E A;  2RVL A;  2PO4 A;  1STN A;  5DM7 3;  2PNR C;  3E0J A;  1AN8 A;  3GP7 A;  2F03 A;  1F9S A;  3TZU A;  1ET9 A;  1HQR D;  1B44 D;  1R9T B;  3SK8 A;  4HTH A;  1STY A;  4A3B B;  1OXT A;  3BDO A;  1V1O A;  3OWF A;  4CKE A;  2AWO A;  5JAV A;  1Z7T A;  5A35 A;  3F2U A;  2K28 A;  4MHE A;  1T5X D;  3RLF A;  5JPN C;  4M8A A;  1BCP B;  2Z1C A;  1XTC D;  4DNR B;  3TP7 A;  4CKC A;  5KYL A;  4K14 A;  3N52 A;  3KLR A;  2Y0S B;  1C48 A;  3NWS A;  2R93 B;  4PMB A;  5DM6 3;  1PRT D;  3OOC A;  1Y1W B;  2EY6 A;  1E0B A;  2N88 A;  3ND8 A;  1IYV A;  1JWS D;  2F0V A;  4ZLT F;  5I2Y A;  5IGG A;  1PRT C;  1HFG A;  2F0H A;  4J1M A;  3R93 A;  3S17 B;  3N6R A;  2K7V A;  2E75 C;  3S2D B;  5KIX A;  4RHS A;  1D5X C;  1PFN A;  1SXT A;  2X69 A;  3GV3 A;  1PZJ D;  1HUM A;  1KLU D;  1PMR A;  1PZI D;  4GZY C;  1V8Q A;  1FGB D;  3H94 A;  2MPM A;  2X6L A;  2ICI A;  3URY A;  3D3R A;  3M4O B;  2PYK A;  3NPP A;  4BWG B;  4LK1 C;  2IL8 A;  4RHR A;  4L8J A;  3K0Y A;  1LTT D;  3DWP A;  3I4M B;  2EYM A;  1CI3 M;  5G3L D;  3RUZ A;  3T51 B;  4I65 A;  1PTO D;  3KLS X;  5JVH 3;  3A54 A;  4RA8 A;  5E4W C;  1QE6 A;  1EY9 A;  4DNT B;  2L12 A;  1CQF A;  1F2Y A;  2A6E D;  3HZX A;  1SMY D;  1XYI A;  3NQI A;  4UAI A;  4BY7 B;  3OSO A;  1J9O A;  1H9M A;  3UI2 A;  2NYZ D;  1EY5 A;  1SYD A;  3KBX A;  1EU3 A;  4ILW A;  1PTO C;  3BYT B;  3U9S A;  2KCC A;  2FIN B;  1WD1 A;  4A3F B;  2O5J C;  4DXG A;  4OL7 A;  4ZYS A;  1WTR A;  3MEH A;  2CQA A;  1LAB A;  1F77 A;  1GHK A;  4KJO A;  4TKO B;  4BBS B;  1NAP A;  4NDX A;  1AFP A;  2PW7 A;  3PO3 B;  4K2K A;  2RDH A;  1RD9 D;  1AW7 A;  1I4Q A;  5C4X B;  4R8I A;  4ODG A;  3SDZ A;  4KY6 A;  1QB5 D;  2RBM A;  4K2L A;  1ENC A;  2E2I B;  3FPU B;  4FXK C;  4C3I B;  3X3M A;  3NHH A;  2B2U A;  5C3W A;  1VDZ A;  2LMC B;  3I4N B;  4J6H A;  2F0T A;  2RQX A;  2D2C C;  2JSO A;  4QCL A;  3OIP A;  2SDF A;  4FF4 A;  1TQO A;  4N9P A;  1HTP A;  1XXG A;  2O4X A;  2M9V A;  2Z8L A;  2EYF A;  2SEB D;  4C3J B;  4NP5 A;  1LLR D;  3I8Z A;  5EBD A;  2NWG A;  1G91 A;  3OW7 A;  1HCZ A;  3TP6 A;  4BY1 B;  1QJO A;  2IPK D;  3BVG A;  2MHV A;  4C1N I;  2SNS A;  1W6K A;  3SEB A;  1B4O A;  4FF1 A;  5BN3 A;  2EOT A;  1IW7 C;  1BNZ A;  2KHS A;  1RCV D;  3MXU A;  3QOJ A;  4RGM A;  3J7A V;  5CV6 A;  4KMU C;  2R7Z B;  5FKA C;  1B2T A;  1Y1V B;  1LO5 D;  1PRT F;  4XYO A;  1DOM A;  5I6Y A;  1GOZ A;  3V2T A;  3HOX B;  1F2M A;  1K8O A;  4Q0F A;  1QIL A;  1S5D D;  1OXX K;  5EKL A;  2ID0 A;  4KN7 C;  3H09 A;  2PCF B;  5COR A;  1E2V A;  2ZXR A;  2Q8R E;  5C0X H;  1HTL D;  1QNK A;  1WVL A;  4G7H C;  2DY8 A;  3IAY A;  3KK7 A;  5HGT A;  4PNY A;  1KTK A;  5T1I A;  1CTM A;  3MFY A;  1A3T A;  2EJM A;  4OHJ A;  2H1E A;  1ET6 A;  3A55 A;  3KBG A;  1KNA A;  1V1P A;  1DON A;  1VF5 C;  3TZD A;  2BDN A;  3NWT A;  2JEB I;  1CA5 A;  2NTS A;  3IKJ A;  3G7L A;  4I7Z C;  5J22 A;  4K5X A;  2NTT A;  2QKI C;  1SNC A;  2JXM B;  3GV6 A;  3K5M A;  4U68 A;  3TP8 A;  1EWH A;  3VA7 A;  4C1N K;  2JYO A;  3DEO A;  5I2X A;  1PTO F;  2Z4H A;  3S15 B;  2K5Q A;  2ZXO A;  4O1N A;  5BN4 A;  2JEA I;  1ILP A;  2OT2 A;  1VF7 A;  1MSH A;  3FEW X;  3KLS A;  1F9P A;  2A74 C;  2PPB C;  3PUX A;  2EVB A;  1WTW A;  1T5E A;  4IQZ A;  3NK9 A;  2LS0 1;  3FDT A;  3C2P A;  2DY7 A;  3I72 A;  2N55 A;  2F0F A;  4HAE A;  4PMW A;  1MGS A;  1B3A A;  4TSS A;  1H9J A;  1I6V C;  4IUV A;  4A93 B;  1LTB D;  4IN3 A;  5ELC A;  2XN9 C;  3FKI B;  4X3K A;  3GQB A;  3S9W A;  2EXZ A;  1M4V A;  5C0X I;  2VXW A;  2B39 A;  2FMM A;  3AMU A;  4CJ1 B;  1D1I A;  4X3T A;  4KD3 A;  3K5N A;  4C3H B;  3H6M A;  4QUF A;  3BDC A;  3DWQ A;  3PUW A;  1Q3L A;  3R3O A;  1PXU A;  3KF8 A;  2BDO A;  4DU9 A;  3T13 A;  1PLF A;  5M5W B;  2K33 A;  1EIH A;  4RAU C;  2RSO A;  4FXG C;  1MBY A;  3CKI B;  3SE0 A;  2H4O A;  2NVX B;  3PIP 3;  1EYA A;  4DN4 M;  5C4H A;  1FR3 A;  1LTG D;  3MXP A;  1NR4 A;  3VR2 A;  2AQ3 B;  5FOB B;  1JWM D;  1ZYR D;  2L5T A;  4IFD G;  2OEO A;  4K8I A;  1JR0 D;  1SFO B;  1EY0 A;  5KYI A;  3DXJ C;  3T16 A;  3I91 A;  1EL0 A;  5LHY 1;  3J80 E;  4WRD A;  4J8Q A;  1A6X A;  1WTV A;  2XWB B;  1RDP D;  2BOS A;  1O80 A;  2R92 B;  5KGU A;  3T56 B;  4A3J B;  3DUZ A;  4XIG S;  1OXV A;  3WDN A;  2RA4 A;  1HA6 A;  5ISR A;  3GTL B;  5BN5 A;  3GTO B;  4OIK A;  2KA7 A;  1FD7 D;  2K6A A;  4BA2 I;  4EQN A;  1X32 A;  1BUV T;  1AZQ A;  1SYB A;  1K8M A;  1RKN A;  3P7J A;  4AYB B;  4PQX A;  4ID6 A;  2IT1 A;  4KY5 A;  2F0G A;  2FJ2 A;  1GXD C;  1D2B A;  5D3D A;  1TKW B;  4ZQ3 A;  4OO1 G;  5EQ0 A;  4DK1 A;  3JAM E;  1A15 A;  2MP1 A;  1EEF D;  3HKZ B;  2QF7 A;  2L11 A;  1Y8P B;  3SR1 A;  5I9O A;  1JOQ A;  1HFN A;  1SNQ A;  4CJ0 B;  4Y7N B;  5KRU A;  2B8G A;  3V96 A;  2OF1 A;  1I4H A;  3BVZ A;  2LFN A;  3S1M B;  3SK6 A;  1PDQ A;  3MTS A;  4ZUJ A;  1BF4 A;  1BBX C;  2EYH A;  4KK7 A;  2XRQ D;  1SYE A;  4WOR A;  1SNM A;  5C4Z A;  1J8I A;  4PMC A;  3NBI A;  4H13 C;  1RHP A;  3R2T A;  2HCC A;  2ICE C;  1WD0 A;  1LT4 D;  4A3E B;  3K7A B;  1UNS A;  3MZ5 A;  2F0N A;  4F87 A;  4A3M B;  3KUP A;  1B1Z A;  3OPO A;  3CRL C;  3PIO 3;  2E2J B;  4RCN A;  2IJ0 A;  3DHQ A;  1DCZ A;  3M7G A;  4KTA A;  1LT6 D;  3E5S A;  3GD7 A;  2J7Z A;  3RZD B;  1A2T A;  5LL6 X;  2XIW A;  3HRZ C;  5FO9 B;  2LY7 A;  3FRP B;  3EJI A;  1MI2 A;  5FLX E;  4X3S A;  2EYJ A;  2MUY A;  4OGQ C;  5FK9 C;  2JA8 B;  3A56 A;  2F4I A;  1OXU A;  4N9T A;  1EIG A;  1G6Z A;  2IX3 A;  2LKV A;  1R4Q B;  3E6Z X;  4ZK9 B;  1D1K A;  3MHB A;  4CHT B;  3K59 A;  5I6W A;  1A3U A;  4EVO A;  2B2V C;  4KJN A;  4IAL A;  1TY2 A;  2L55 A;  2QIL A;  5KNB A;  4G7Z C;  1M8A A;  3TP5 A;  2Q8T A;  1TWA B;  2NZ1 D;  2L4N A;  4IUU A;  4B9X A;  2AQ2 B;  2D5D A;  5CBE E;  3IL8 A;  5DAU A;  3A7A B;  3EVQ A;  3PMF A;  3Q24 A;  1EFI D;  3D4R A;  2K5D A;  3CU7 A;  1TU2 B;  4XTC S;  2QEJ C;  5CV8 A;  1TWC B;  2A6E C;  1SMY C;  1IHZ A;  3BZD B;  1ML0 D;  3OMC A;  4HMJ A;  4K5W A;  4XQJ A;  1JC7 A;  2E2D C;  3I4L A;  1C4Q A;  1PRT B;  5FO8 B;  5IGF A;  4NKL A;  3NTI A;  2PZT A;  4ZRZ A;  1B53 A;  1STB A;  3RMH A;  3VA5 A;  3VYT A;  1PFB A;  2HCI A;  4CGY B;  1SE4 A;  4KI0 A;  2EE1 A;  1O78 A;  1TY0 A;  5C3X A;  1W6J A;  1G2T A;  3VYU A;  2EYO A;  2A68 D;  3C1E A;  5IOC A;  4IUR A;  4IUT A;  1SBB B;  1V1P B;  3MXN A;  2F0I A;  3NQT A;  1B50 A;  1A2U A;  4TRD A;  2FHT A;  1TS2 A;  2WAQ B;  3Q0A A;  1BDO A;  4HED A;  1OXS C;  2PW5 A;  4FYD A;  5KEE A;  2HDL A;  2F3W A;  4LAA A;  2DN8 A;  4JBW A;  4NW2 A;  5ELF A;  5IT9 E;  5LL6 S;  2F0E A;  4CBV A;  3LWU A;  1ICW A;  1G2S A;  2GA4 B;  1EZ6 A;  4A3D B;  1IKM A;  1HQM C;  3L7Z C;  3QWN A;  1PTO B;  3A8K E;  1SNO A;  5I9P A;  4A3K B;  1O7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...