5KYLA

Crystal structure of staphylococcal nuclease variant delta+phs t62k/v66e ph 7 at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFKKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62K/V66E pH 7 at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kylA00
5KYLA 5IGGA 2EXZA 1STHA 4PMBA 5JOBA 4EQOA 2EY5A 1KABA 4ODGA 5C4ZA 4K8JA 4HMIA 2F0GA 4I65A 4ME5A 4NMZA 4RKBA 3SK5A 1KDAA 2EY6A 2O4XA 1EYAA 3P1HA 1TT2A 4KTAA 2F3WA 4KY5A 5KRUA 2ENBA 4KJNA 4K5XA 1STAA 2F3VA 4PNYA 4ID6A 4S3SA 4DF7A 4K14A 3D8GA 2F0SA 4DFAA 5C3XA 4KY7A 5J1ZA 2PW5A 1A2UA 1SYBA 4KV6A 4NKLA 1EY7A 3P75A 1SYGA 3H6MA 3VA5A 3NK9A 3S9WA 2KHSA 1A3TA 1NSNS 5IOCA 2F0MA 3NUCA 4K5WA 4NDXA 5J39A 2PZTA 3EROA 2F0PA 3D4WA 4K5VA 2F0EA 2PYKA 3C1FA 5KYIA 1EY0A 1TQOA 2EY1A 2WACA 4YIJA 5F2DA 4WRDA 1II3A 1A2TA 1KAAA 3BDCA 4EQNA 3ITPA 4QB4A 4F8MA 5CC4A 2EYMA 5CR3A 4B9WA 3MEHA 5CV7A 5I9PA 2F0DA 2EYPA 2EYHA 5EGTA 5M9OA 3MVVA 2RDFA 3BDLA 4KY6A 1KDCA 2SNSA 3SHLA 3TP6A 5IGBA 1SYDA 1ENCA 3R3OA 5CV6A 2F0OA 2F0TA 1SNQA 4J1MA 4HMJA 4G57A 4IUNA 4KD3A 4R8NA 1STGA 1TR5A 2RKSA 1SYFA 3SXHA 3SK8A 5CGKA 2EYOA 1EY6A 3ERQA 1RKNA 1SNPA 3SK4A 3V2TA 5I6YA 4LAAA 2F0FA 3MXPA 4RKLA 1IHZA 5C5MA 1EQVA 3TP5A 1SNCA 4N9TA 2F0NA 3D4DA 2NUCA 2F0JA 3EJIA 2EY2A 4F7XA 1SNOA 3D6CA 3SR1A 1F2YA 3C1EA 3QOJA 4IALA 4EVOA 5HURA 1EY5A 2F0HA 2SNMA 5NUCA 1AEXA 1JOQA 5ISRA 5KIXA 4WORA 1SNMA 4DU9A 3MZ5A 5E3FA 3TP7A 5E1FA 5K5PA 1JORA 2PW7A 3OWFA 2F0VA 3E5SA 4ZQ3A 2M00A 5IODA 5HGTA 1KDBA 5KEEA 4DGZA 4ZUIA 1SNDA 4QF4A 4PMCA 5KGUA 1EYDA 5C3WA 3OSOA 3MHBA 3DHQA 4K2KA 2HQEA 1F2MA 3DMUA 1JOKA 5IIFA 3T16A 1SYEA 1EY4A 2EYLA 2PZWA 2LKVA 2SOBA 3HZXA 4KHVA 1STNA 1STYA 4KD4A 5I9OA 5JAVA 5CV4A 3SK6A 4K8IA 1ENAA 3OMCA 1EYCA 2EYFA 5CV8A 3QOLA 1SYCA 5DAUA 4EQPA 5I6WA 4N9PA 2OXPA 5EKLA 3QB3A 1F2ZA 4H7BA 2F0QA 5C4HA 1EY9A 2F0IA 5CV9A 4TRDA 2EYJA 4B9XA 5IGFA 2QDBA 1EZ8A 1STBA 4K6DA 2F0WA 2OEOA 5CV5A 1EZ6A 4E6IA 3TP8A 3LX0A 5J22A 4KJOA 3NP8A 1JOOA 4J6HA 3HEJA 2RBMA 4MIUA 1NUCA 4OL7A 5C5LA 1A3UA 3RUZA 3OMGA 4K2LA 4NP5A 3U9OA 5IGCA 5IGDA 4ZUJA 2OF1A 2PZUA 2PQEA 2F0LA 3NHHA 3NQTA 3NXWA 4IZ8A 5C6AA 1U9RA 4HTHA 1A3VA 1EY8A 3PMFA 5IGEA 2F0UA 3T13A 5DEHA 2F0KA 3TMEA 5EKKA 3EVQA 2KQ3A 4QMGA
chains in the Genus database with same CATH superfamily
1C48A 1BOSA 1R4QB 1DM0B 2MO0A 3QJYA 3CMAA 4GNXA 1Y1WH 4K5XA 2K5DA 1Q82C 2N3SA 2GN5A 3CC4A 2NZOA 3AMUA 2X69A 1FD7D 3OWEB 5CBAE 4MHEA 3QWNA 1PYSB 1STEA 5C4XH 4POFA 2JA8G 1Y1VH 1IBLQ 3EROA 2F0PA 4XDXA 3CQZH 1DD2A 1TWGB 2CWAA 4LFCL 2VZAA 4WRDA 4JCVE 1HJPA 2RHQB 3KUPA 1HA6A 2AKWB 1L2FA 4DR3Q 4A76A 2EYPA 3NPPA 4KMUC 2NZHA 4A3MH 2JXMB 5IGBA 1TWAH 4P2CB 1ESFA 3DWAA 3O13A 4JI5Q 3KBGA 1B7YB 3NTIA 4L63B 3MXNB 1AZQA 4PG3A 2B2TA 4DNIA 2Z6BA 1EIHA 1F9SA 1DOKA 1P16A 4IO9A 5I4DA 1ESRA 1EEID 4DAMA 5HURA 1J5EL 5C0XJ 2QCPX 4DR4L 4POGA 4A3BG 1Y8OB 4HCSA 3MZ5A 3TP7A 2K75A 5D65A 4JBMA 4OIJA 3H94A 4GLXA 4LFCQ 3S2DH 2B63H 2UUAL 5M5WB 2JP1A 4KN4C 5FLMH 2PZWA 2Q8IB 4L5SA 1CTMA 5JVG3 2R93B 3OMCA 4XXEA 4WJ4A 4XQNA 2WV6D 5I6WA 3PQIA 3W1BA 3UDIA 1RDPD 4ZKBB 3A55A 1SJED 3K8AA 3TZUA 1SR3A 1VQGA 2R3ZA 3C2PA 1Q1BA 3HEJA 4GN3B 1KIXA 3U50C 1GUTA 3HKSA 2B29A 2Z0SA 1D5ZC 2HCCA 4C1NK 1J5EQ 2E8GA 3I4MH 4DR4Q 2B8FA 4N8X1 1EY8A 3S1NB 3S14B 4QMGA 5FKAC 2HIXA 1K73C 5JOBA 1Y1VG 4AIMA 3OIQA 5G3LF 3SVMA 1UAPA 2F0GA 2WP8J 5M9OA 3S16H 2QKIC 2RCNA 4QJFA 2NVQH 1DOMA 2UXCL 1G8ZD 3PO3B 3JAML 1L1OC 1JB3A 1LYLA 1B9NA 3CD6A 1JT8A 1EWHA 1PTOH 1X9NA 1HTPA 5EKIA 3G71A 1DJRD 1E1TA 1L1OA 2WB1G 5KYIA 4LFAL 3EQLC 1A8VA 4DNTB 4JI4L 4R4QA 4JI3L 1PRTD 1JB7A 3IL8A 3FRPB 2UUBL 2F0DA 2G5DA 1I50B 3M4OH 2Z4IA 4LW1A 2E2DC 1VDZA 3D4RA 2F0OA 2ICIA 3ULLA 1UUPA 1QB5D 1ET9A 5IP9H 5CGKA 4JI1Q 2Z4HA 2QW7A 5ELDA 1G6PA 2F0NA 4HAEA 2WFWA 1OXTA 4I7AA 3BVMA 2WINB 4A3KB 3SR1A 5A2QE 4JI6L 4QUCA 4DK1A 2I07B 1UEBA 1AZPA 3WWVA 1TWFH 1CZGA 1OXUA 1S4ZA 2F0VA 5M5YH 3M3YH 1CQFA 4LFAQ 4HJ9A 1LTID 1F9PA 3DHQA 1FYCA 1F2MA 4HIMA 1SYEA 1JMCA 1RTOA 2KEDA 2UUBQ 2JA7H 3HOYB 1ENAA 1F77A 4G4KA 4WJ3M 3I8ZA 1TY2A 3ERSX 3V96A 5IGFA 4JI0L 5ELEA 1EWIA 4IQZA 4DV0L 1M1KC 4X62Q 3X3NA 4LFBL 2LS01 1XYIA 2YU9B 2K7VA 4LUOA 1VQIA 3OW7A 4LWCA 1F9RA 3S15H 3HOXG 1T5XD 1YNNC 5T1GA 2A6HD 3ULJA 3T51B 2A69D 3TREA 4IZ8A 4JI6Q 1WTVA 3DWQA 1IW7D 1EOTA 4IUTA 1VQOA 4BBSG 3K5MA 4N9TA 3A5ZB 2PNHA 1MD2D 2Y0SG 3GTPB 4EQOA 5FLXc 3KJOA 4ME5A 2A5HA 1C8CA 1EYAA 1HFGA 4DK6C 1IBKL 1NMFA 1WTPA 4GKJL 1GUWA 1CSPA 4S3SA 2LXJA 4DUZL 2NYZD 3KDFB 1SYBA 5I2XA 1H95A 2EJFC 2F4VL 3MFGA 2IX3A 2AWNA 2KHSA 4R9WA 3PIO3 5IOCA 4A3GB 2XRSD 5IP9G 4B3MQ 1K8AC 4LFBQ 3T53B 4AYBE 1II3A 4R4TA 1VQKA 5LL6X 3CCLA 3GTLH 5CC4A 5HGQA 3K58A 4ZKCB 1O7YA 5KNCA 5A35A 1S72A 4H0LC 3PO2B 3C46A 1P8LA 2DJGC 5BN5A 2EJMA 5E7NA 1N9WA 5C44G 1BBUA 2XNAC 3I3CA 1O78A 1TR5A 1PA6A 3EBEA 2EOTA 2N88A 5EPJA 4RKLA 2KCCA 1EQVA 4KKSA 4DPGA 4DUZQ 4DUYL 2F0JA 4DAYA 4U673 2C5CA 3J81j 4JI2L 2KECA 2F4VQ 2K5VA 2K5WA 5LL6S 4B3TQ 2K32A 1E22A 2H5XA 4DR1L 3BZKA 2PW7A 1PH3A 1AFPA 1PH4A 5AFWA 4BBRH 2A6HC 2A69C 4JI8L 4DGZA 2F03A 3T1YQ 1XWEA 1SLJA 1IW7C 2JA8B 3MHBA 2HQEA 1C7YA 1G291 2LKVA 2ZM6L 4BS9A 2PMZB 1N32L 3JAMc 2L0CA 3NTHA 1PRTB 5C4HA 1UE1A 5DNFA 4IUVA 2J4XA 4TRDA 4B9XA 4A3DG 3HFZB 3E0JA 4J6HA 4GN4B 1D5XC 4LNQA 4DUYQ 4K2LA 1S40A 3MWYW 1AH9A 4C3JG 1KQSA 1XXGA 3NXWA 2OT2A 3H0GH 4JI2Q 5IGEA 2M9VA 1RODA 4LF8Q 3J81E 5G3LD 3BVZA 5D3IB 2LFNA 2I0QA 5IYCG 5C0XI 2NN6H 3FPUB 1YNJD 4JI8Q 4A3BB 5GAGC 3F2BA 3DXJC 2MHVA 2F3WA 2ENBA 4PNYA 2RF4A 4IPHA 2FJ2A 2ZM6Q 4A3IH 1N32Q 4DV4L 2F0MA 3PSIA 1C4QA 2VB2X 3KK7A 3KYHC 1W6JA 2DJFC 1EUJA 2V4DA 1HNWQ 2EY1A 3S17H 1DCZA 1VQNA 4MNOA 3J81i 4DAVA 2EYMA 1QWYA 5IT9c 3FPPA 3M9BA 4K0KQ 2XIWA 5ELBA 3FKIH 1SYDA 1I4PA 3ER0A 5CV6A 1TWCH 2ATWA 1LTTD 2NTTA 4ZRZA 3A7LA 1BO0A 4HN7A 4KN7C 2Q2TA 2R92G 2KBNA 1SFOH 4BBRG 3VYSA 4DR5L 3NEMA 5D14A 4IJLA 1XTCD 4F7XA 4A3CH 1EYGA 3VYTA 1MIUA 2CCZA 4OONA 2MJ8A 4I7ZC 3GTGB 3S1QB 3PUVA 1D5MC 1JWMD 3HOZH 5E1FA 5K5PA 1Q3LA 1AE2A 4APVA 2NVYH 1LM0A 2IX1A 4ZUIA 1Y69U 1PHJA 3SEBA 2A73B 3J80E 5C3WA 1XPOA 1W6KA 4KLKA 2SDFA 3EA6A 2WB1B 4Z9CB 1STYA 4IURA 2R61A 1K0RA 3H0GG 4H7BA 1FNWA 1J9OA 1LABA 5M5XH 2QDBA 3CF5A 1YI2A 3GTMB 1X3EA 1I4RA 3G7LA 1HCZA 1K83H 1VQDA 4DR5Q 1XMOL 1WD0A 1N34Q 1TVXA 1QVFA 3K80C 1I3QB 3K7AB 4RG1A 4NXNL 3S2DB 2K5QA 2PQAA 3J80i 3CCQA 3TEHB 1VMCA 1BF4A 3HGBA 5M3MH 4RKBA 4G7ZC 3U4ZA 1Q7YC 4UDUC 3DLLA 4QIWE 3K5OA 1YHAA 1ZYRD 3NE5B 1B2TA 2B2VA 2K33A 1V1QA 3DM3A 1NNXA 4C3HH 1YITA 1GOZA 1QJOA 4LF9L 2NWGA 5ELCA 4YY3Q 1XMOQ 1E7ZA 4OEMB 4DV1L 2R7ZH 3BDCA 3PV0A 2GA4B 2MNAA 2ICEC 3FVQA 4PZ8A 1XMQQ 4FDBA 3PGZA 2NVTH 4DR2Q 2RDFA 3TSSA 5JPMC 1S5CD 3RZOH 1ILPA 3LWUA 5GADC 5LMNL 3HOXB 4LK1C 5C3EG 1NR4A 3HOWH 3HOZG 3T56B 3SK4A 4BBSB 5GAEC 3T1HL 2Y0SB 1QUQA 5C5MA 5FJ8H 1PTOB 1Q86C 4A3JG 2PPBC 2A6ED 3GTJB 1MSHA 4C3IH 1CSQA 1WI5A 4UP8A 4UY8C 5KIXA 2R6GA 3PCOB 4GZYC 2VL6A 2OQKA 1I94L 3E5SA 4LF9Q 4JI7L 1I5FA 2O5JC 4DV1Q 3S2HH 1S5ED 2L1BA 2E2HH 1GHJA 1QOHA 1HNZL 2IPKD 4GN5A 2E5LL 3Q6SA 3RMHA 4HJAA 2JK8A 5IWAQ 2C9OA 5LMNW 3STBD 5CV8A 3QOLA 4C1NI 1VMPA 2ZTCA 4N9PA 4IJHA 5LMNQ 2L5TA 2HCIA 2VS1A 2CW0C 2HHHL 2YTYA 3I4NB 4RCOA 4BY1H 5M3MG 4M1UB 2I5MX 2TMPA 5C44B 1NUCA 4RGTA 2XRQD 1U4LA 4L8JA 1L0XB 2ZXOA 1EL0A 2F0UA 2LSSA 2B2UC 1EOVA 3EVQA 1I94Q 2K05A 4JW0A 1BBWA 5ELFA 4A3EG 2EY5A 5C4ZA 4K8JA 3G6EA 2ZJQA 1Q90A 4HSPA 1R9TH 3MXNA 1IBLL 2UXDQ 2B2UA 4ID6A 4BWGB 3H15A 1S5FD 2WAQE 2J7ZA 2HD3A 1A2UA 1SYGA 1JWUD 5EPLA 4X3TA 2V1CC 1QCBD 3E0EA 2EVBA 3RZDH 2QEJC 3A8KE 2VUMH 3I91A 2MQHA 1CM9A 2HQLA 4JI5L 4A3DB 1A0IA 1SDFA 5FJ8G 1U4RA 1SEBD 1CKNB 4JV5Q 1XNQL 3TP6A 3S1RB 1VQHA 3V05A 1B3QA 4LF5L 4C3JB 1STGA 1CFMA 4IFDH 3HOUB 4DK3C 1IBMQ 1SYFA 2QGQA 1WTQA 4HJ8A 4JPBW 1Q81C 3R8BA 5GAHC 3PF5A 1VF5C 2CKZB 1J8IA 5C4JB 1X3FA 4X66L 4RGNA 2RCFA 1VQBA 4YWKA 4OELB 4OXPA 3M7NA 4YCUA 1F9QA 2QDLA 4B3SL 1KL9A 3OWFA 1CKOA 3TBIB 5FLXL 3BYTB 1NTGA 1K9MC 4BY1G 1V1OA 4RHRA 2CQAA 1UNSA 3HZXA 1D1KA 3AEVA 2PNRC 2AUKA 4K8IA 5IYBG 4LF7Q 1PH1A 2O5IC 1XNQQ 3A5UA 4A3FH 2D9UA 1BCPB 4LF5Q 1WCMH 3RN2A 2DN8A 1STBA 4CKBA 2GVAA 2OEOA 4HSVA 4E6IA 3TP8A 4QUFA 3GDEA 1PXUA 4DV3L 1UE6A 5FO9B 2NBFA 3F2UA 2R92B 4CJ0B 4X66Q 3CC7A 2OF1A 5AJ3Q 1YHQA 1SMYC 4BBRB 3TQYA 4H44C 2BA1A 1H9SB 5EJWA 2KQ3A 2F52A 4B3SQ 5IGGA 2YV5A 3H3VC 3K81C 4ZYSA 1HR0L 4YCVA 5IP7G 5EPKA 2VUMG 4NB3A 5ELNA 3WOFA 3GTOH 4A93G 3OTOL 4CHTB 4K14A 3L0OA 1N8RC 4NKLA 1Y1WG 1VS0A 3BJUA 3P75A 4KHZA 1AP0A 4IPDA 3NUCA 4J15A 4NPSA 2BH8A 2IW3A 1GXDC 3C3LA 4IFDG 1PMRA 1XPUA 2PYKA 3L7ZC 4YIJA 5C4XG 1M8AA 1ICFB 1YHBA 3QIAA 5F2DA 4DV3Q 1RF2D 1E2ZA 1QVCA 1PVOA 2HDLA 5FO8B 1AN8A 1LO5D 4UP9A 4R8IA 4JI1L 1JC7A 1PTOF 3BDLA 1FR3A 3SHLA 1HR0W 2H1EA 1HR0Q 2JA5H 3U58A 4A3MG 1DZ1A 4R4IA 4HJ7A 2KA7A 3RR5A 3OTOQ 3F8TA 4LAAA 5JEAH 2EY2A 1X54A 1K8OA 1HZCA 4WFN3 1BNZA 1YJ9A 2NVXB 1KD1C 4DU9A 4YHHQ 1O80A 3TS2A 4G7OC 3TRZA 4ZQ3A 4XTCS 1VQCA 5HGTA 4C2MH 1K28A 2M2LA 2VNUD 1B50A 5T1IA 5M3FH 1TWCB 3DMUA 1U4MA 3T4AC 2RDHA 1MJEA 2ALYB 2EYLA 2RDGA 4X62L 1HFNA 5COYA 1BBXC 1VQ6A 3KDFA 1IYUA 3SK6A 5DAUA 1UE5A 3W2DA 2B63G 1X65A 4KHPL 1JJGA 4P72A 5FLMG 4CJ1B 2EYJA 1EZ8A 4HIDA 1EZ6A 4FYDA 4MTKA 1PZID 3VYRA 5C3EB 3VR6A 2L11A 2MPMA 1CZWA 1WJJA 2BOSA 3FEWX 2DY7A 3RUZA 3HOZB 5IGCA 1N33L 4P71A 5IGDA 1I6HH 3NQTA 2VQFL 5IT9L 2N55A 3HG9A 2B2WC 3BZCA 2XTIA 3GTKH 3S1MH 4QGUA 4A3JB 1BUVT 2EPBA 3BU2A 2MO1A 3I4MG 1VQEA 2B2WA 4Y7NB 1C0AA 1CHPD 1MBYA 3UDGA 3GQBA 2F0SA 5M5XB 2JN4A 1TU2B 4B3ML 4OO1H 4FF3A 2PW5A 3KLWA 3Q8DA 4IFDJ 2JE6I 4KHPQ 1I4QA 4FXDA 1PZKD 1SJHD 2L15A 1VCIA 3OOCA 1VQJA 4P75A 2MFIA 3D4WA 2JA6H 3CCJA 2JA5G 2UU9L 2WACA 1PRTC 1EFID 2K1BA 5HY6A 3ITPA 1I6VC 1N33Q 4BA2I 1FJGQ 2N78A 3J7AF 3A7AB 4IUPA 2VQFQ 1EFWA 1AE3A 3J7AV 3MVVA 2K6AA 3KF6B 2QILA 1O7ZA 1SROA 1CI3M 4AQYL 3HKZB 1FL0A 3ND9A 3JAME 5KNBA 3SXHA 4ZAIA 2ASBA 2VQEL 2Q8TA 2EE1A 5E4WC 4B3TL 3H09A 1E2VA 2K5HA 4IOCA 1Q1EA 3J7ZC 1TKWB 4A3EB 1IKLA 1VQFA 1SNOA 4AH6A 3T1YL 2CFMA 3D6CA 3DUZA 2K52A 1NJIC 4V190 4BY7B 1PFSA 1LTSD 2E75C 2R7DA 3I2ZA 4JBJA 1B4OA 1OXXK 1BCPF 2YTXA 1FGUA 1SE2A 3L3OC 2UU9Q 4DNRB 2EXDA 4UPAA 4FP5D 4DV7L 3ULPA 1VQLA 2SOBA 3PIPA 2FHTA 1RHPA 2B8GA 1MHWC 3JAMi 2HT1A 1K3RA 4H13C 3IFTA 4AQYQ 3OPOA 2F0IA 1ILQA 1HXYD 2JA7G 4LF6Q 1V1PB 1YNXA 4LF8L 2XVSA 4G7HC 2VQEQ 4DR6Q 4QQBX 1Y8PB 4FXGC 3W1GA 1H9MA 4R4CA 4DV6Q 1GUGA 2Q2IA 2NB0A 2PZUA 4L5TA 2F0LA 1GHKA 1Q46A 3CXCA 1NBWA 4JC0A 3I4OA 1Z9FA 4MN3A 3T13A 2E2HB 3TMEA 4WJWA 5EKKA 4PQXA 2UXBL 2E2IH 4J8QA 4HMIA 1J6QA 2JA6G 3MFYA 2EY6A 1XPRA 1HRJA 1B53A 2EIFA 4X3UA 4X64Q 1U0LA 4IN3A 4DV7Q 5C3XA 1HNWL 4BY1B 3A8IE 5JJKA 1NSNS 1WFQA 4NDXA 4K0KL 4KKUA 3I55A 5JEAJ 3PF4A 2PI2E 1KLUD 1TY0A 3CKIB 4JYAQ 1PTOD 2XWJB 2IT1A 2LXKA 4QB4A 4F8MA 5L37A 1G2TA 4FNFA 5CR3A 1BQQT 1YJWA 4K6LA 2EYHA 5EGTA 1LT6D 3UDXA 2BE5D 3HKZE 2IY5B 2Z1CA 2UXBQ 1K8MA 4HCEA 3Q24A 3S1NH 4R8NA 5TSSA 3S14H 2KEEA 2I5HA 1RTNA 3G4SA 1HA5A 3V2TA 1V8QA 5I6YA 3UI2A 1IKMA 2DNCA 1TWHB 1XX8A 3GV3A 4TSSA 1Q8IA 5LHY1 2UUCQ 2KHIA 2OQ0A 2ZTEA 4IALA 4L5RC 3PO3H 4A93B 2D2CC 2DUDA 3ZJYC 4DN4M 3DM1A 2E2JH 2CH4W 2AUJD 1SRUA 1Y1WB 1XTDA 2AQ1B 3SDZA 3MEFA 1SNDA 1HPCA 3PUZA 1IYVA 3E9HA 4OWXB 4NW2A 4XQQA 4C56C 3NENA 2A8VA 1KRSA 5H1SE 2RHSB 3KLSA 2EYFA 1N34L 5C4XB 1SYCA 1KRTA 1Y1VB 1I50H 4PMWA 1RL2A 1X32A 3TDQA 3CQZB 1E1OA 4K6DA 2F0WA 2VB3X 1NE3A 1B44D 1Z6HA 4HIKA 1H9KA 4ILWA 5IYDH 4NP5A 2L55A 4A3MB 3CPWA 4V0BA 4P74A 1ET6A 1TWAB 3NHHA 3J7A5 3NSWA 3H3VH 4A3LH 4EGVA 1FVIA 5DEHA 2PMZE 1O7LA 1PTOC 4RHSA 1YNJC 2EXZA 1SSOA 1STHA 4PMBA 2ZJPA 1YVCA 3QO2A 4NMZA 3UDFA 2E76C 3J81c 3F2CA 4KY5A 3CCSA 1QZGA 1WVLA 1ZEQX 1STAA 4DFAA 2NN6G 2B3GA 5EQ0A 4YY3L 1ZXTA 5J1ZA 2A19A 2MGSA 3CCUA 3HOYH 1IXRA 3I56A 1XMQL 4DR2L 2B63B 3D0FA 4A3IG 2B2YC 2YU9H 1JCKB 4GKKQ 3IAYA 2I5LX 2P5ZX 4XT3B 4CJ2C 3NELA 3X3MA 3PO3G 4J1MA 2F0TA 1X3PA 2B2YA 5IE8A 5J3BA 3BG3A 4JOIC 2HIVA 4CDFC 1PLFA 3FKIG 2EYOA 4O42A 4DKAC 2KHJA 2AQ3B 5FK9C 4NXMQ 4JOIA 4RFBA 3I4MB 3EJIA 3Q0AA 1JE5A 4AYBG 1JOQA 1BCPD 1SMXA 2XGTA 5IWAL 3L2PA 4A3CG 1SXTA 2D5DA 4IFDI 3S16B 1KDBA 2Z6KC 4A3GH 2NVQB 3HP3A 4ME3A 2IL8A 3SGIA 1LTAD 4DXGA 2IHFA 1BVSA 3T16A 1WOCA 3M4YA 5IYDG 1MKHA 4JK1C 3S24A 3K0XA 3J80c 3VYUA 3MA2B 2F0QA 3PO2H 5CV9A 4F87A 5BN4A 3VA7A 2Q2HA 1WD1A 1VQ4A 2PO4A 1G51A 3M4OB 1CUKA 3OMGA 1CK1A 4TQUS 1VQ8A 2FFKB 2QA4A 1XJVA 4B3RQ 1X55A 2WB1E 2UXDL 2VY3A 1CKNA 1O7IA 1PH9A 4IOAA 2BDNA 3NBHB 1PFNA 3W5OA 1ENFA 1KNEA 3RLFA 3MC0B 1W2BA 1W3SA 1KAWA 4RGOS 4GOPB 2F3VA 2LMCB 1ZYRC 3M7GA 5FO7B 2IHEA 1PH7A 1LT4D 4KY7A 4JBKA 3A54A 2JA8H 1G6ZA 1WTRA 4XYQA 1XNRQ 1TWFB 3TZDA 1IZ6A 4L5QA 4ZCKA 5M5YB 3M3YB 2RQXA 2JEBI 3HS0C 1E24A 1JJCB 4GLVB 2JEAI 3MXGA 2OTJA 2Z8LA 1NY4A 4JV5L 3C1FA 1EQTA 4EQ5A 1F2LA 3E9IA 1BCPC 1KAAA 4C3HG 1DYQA 4EQNA 2JA7B 1IBML 4RCNA 3QR8A 1D6EC 3RN5A 4CDCC 1MJCA 1X6OA 2D0OA 2R7ZG 4KY6A 2SNSA 3KF8B 1N36L 1GUOA 1ENCA 2ZJRA 2N8NA 3RLOA 1PFMA 5GQOA 2RKSA 3ERQA 1SNPA 3A8JE 3ZYYX 4Y52H 3S15B 2F0FA 4A3BH 3L9AX 3HOWG 1ZKOA 2A6EC 2IJ0A 3WOEA 1HQRD 1VQ9A 3KFUA 2WKDA 3CRKC 3A56A 1AEXA 1JWSD 1H9SA 4WORA 1ML0D 1EWCA 3WDNA 3PUWA 3PIP3 4LF7L 2HUGA 1X56A 1QUQB 1VQ5A 4C3IG 2ES2A 5DM63 3OSOA 4K2KA 4RWSC 4X65L 1EY4A 3A0JA 3STBC 4LUZA 1STNA 1RD9D 2Y0SE 2ZXPA 4KD4A 5CV4A 5JAVA 1GM5A 4DA2A 5K36H 3CRLC 1A62A 3M4PA 1N36Q 4BA1I 1T5EA 5AJ3L 3BDOA 2JSOA 3Q22A 1E0BA 1QG7A 3FDTA 2SEBD 3R93A 1YEZA 3GTLB 3NP8A 2EZVA 2L9HA 2PCFB 1PZJD 1HTLD 2FXQA 4ZUJA 1KXLA 3GV6A 2CWPA 2F4IA 2AHOB 1KHIA 5LMUL 3CCMA 3DEOA 1HZ9A 3S1QH 3GTGH 4H02A 3P20A 2NZ1D 4ODGA 3I70A 3P1HA 3Q23A 4KJNA 4X65Q 1I4GA 4Q5VA 2B2TC 1WYDA 2EJGC 1QVGA 3GTQH 1WTOA 3H6MA 2DY8A 3VA5A 3NK9A 1SE4A 5BN3A 4GLAC 4DV5L 3IKJA 1EY0A 5A2QL 3GTMH 4RA8A 3I7FA 1I4XA 4ABNA 1HZBA 2Q2UA 3K7UC 2O2LD 3HOVH 1E2WA 1EIFA 4OO1I 2E2IB 1WTHA 5CV7A 4YCWA 1T9HA 1I3QH 3K6OA 3K7AH 4HJ5A 1GVPA 3R3OA 5LMUQ 1GKHA 3EIVA 4KD3A 2ID0A 1EY6A 4YHHL 4GNXB 3NWTA 1YZ6A 4DR7L 3H0GB 4QY7A 3RD4A 2EQSA 3NQIA 4ULLA 3E3XA 5K36G 5KNDA 1L0YB 1SE8A 1LT3D 4B08A 5DLQE 4DV5Q 5E3FA 2ZT9C 2OWOA 1S5DD 4LF4L 1BKBA 4QF4A 5FOBB 1KLGD 3CCVA 3DWPA 1JOKA 2Q8RE 4A3IB 1DXMA 2J0TD 1EYCA 3J7YW 3E6ZX 2BH2A 1TS4A 3QB3A 1HNXL 1EY9A 3GD7A 3N52A 3HRZC 2JQOA 2UUAQ 4UP7A 3HOXH 3S17B 5ELOA 2RSNA 1SAPA 3KLSX 2FINB 4A3FG 1DGSA 1FNUA 1WCMG 2PI2A 3IFDA 4OL7A 5C5LA 2E2JB 4DR7Q 1A3UA 4X3KA 4BBSH 2DGYA 3FKIB 4O2DA 1I4HA 4R4OA 4CKCA 5FLXE 2KOLA 1QILA 1YNND 3KF6A 3ONAB 2H4OA 3OW2A 2F0KA 3GTJH 1K3BC 1SFOB 3NTKA 4AYBB 4LF4Q 3PUYA 4PZ6A 2G9DA 1A15A 1KDAA 5KRUA 1LTGD 1HUMA 1JE4A 3K5NA 3HOVG 1Z47A 2KVMA 2RA4A 1HNXQ 3URYA 4RGMA 1FJGL 1HH2P 2K50A 2KUMA 1D2BA 2NVYB 4K5WA 1E3PA 2PZTA 5E4XA 3JC66 2UXCQ 2F0EA 1BDOA 1PDQA 2LY7A 3I4NH 1G2SA 3NWSA 5BR8L 4B9WA 3FP9A 5C44H 1PYWD 1L0WA 1BR9A 1X3QA 2KCNA 1S5BD 4GS3A 4JI4Q 2WAQG 3LGJA 1K83B 5I2YA 1V1PA 4UAIA 2VW9A 4JI3Q 2KCMA 1EU4A 2YTVA 2GVBA 3R2TA 1LTRD 1Q12A 4KKTA 1NMGA 2NN6I 1TIID 2NUCA 3I90A 2A74C 3QOJA 2L4NA 4EVOA 1OO9B 2K03A 3AFQA 3D31A 1HQMC 1KNAA 5JEAG 4QCLA 2F1MA 1PH2A 1EEFD 2KJXA 5M3MB 4TVAB 1L1OB 1JQYD 3J81L 4LF6L 2NTSA 1B3AA 1YJNA 3I4LA 3K5LA 3SK8A 3QG1A 5BR8Q 3EN2A 4DR6L 4A3DH 4EQPA 1X3GA 2K14A 2CHBD 5M3FG 4C3HB 2OXPA 4DV6L 5JJZA 1KTKA 1UE7A 3KLRA 1PH8A 4FF2A 3S1RH 4HEDA 4U68A 2R7ZB 2X6LA 4C3JH 3LX0A 3HOUH 4KJOA 3AFPA 3VDYA 1B8AA 4JBWA 4X3SA 2NVTB 1NR2A 4ALPA 2CH4A 1S3OA 3RZOB 2PQEA 5IYCH 4JI0Q 2OCEA 5C4JH 4X64L 1TWGH 4DV0Q 3HOWB 5GROA 1MGSA 2B39A 1YIJA 2RSOA 4FF1A 1B9MA 4HIOA 4I65A 4OX9L 2WKCA 4DAPA 4KTAA 3GO5A 3CPFA 1TT2A 3CC2A 2R7FA 1QZHA 4A75A 1HUNA 1V43A 3D8GA 3I4NG 4C3IB 4JYAL 1DOLA 3AYHB 2K4KA 2A68D 3H3VI 3KOJA 3S9WA 1WTXA 1A63A 1VQPA 1IBKQ 4GKJQ 4OO1G 5J39A 4CDDC 1NCVA 2QEXA 1BXTA 4K5VA 3S2HB 3K0YA 5IT9E 3DEPA 1SE3A 3KJPA 1MSGA 3K57A 1VF7A 4OGQC 4OHJA 2R92H 3NBIA 3VR2A 3J80L 4P73A 5M5WH 2UUCL 1C9OA 4G57A 2AQ2B 3I73A 3K59A 3UE1A 1M4VA 2R93H 1QE6A 1V9PA 4OX9Q 4Q0FA 4XT1B 3VR4A 1RKNA 1VQ7A 1CKMA 1IHZA 2F3IA 4CKEA 1H9JA 1SNCA 1A6XA 3R2IA 5CMDA 2BDOA 1K8GA 3UE0A 1EY5A 2DNEA 5NUCA 2Z9HA 3I72A 1LV9A 1SNMA 2VXWA 2XWBB 4OIKA 1OXVA 1GD7A 2HDMA 4PV1C 3AQQA 1UEAB 1JORA 3W3AA 3OYYA 1R9TB 1NAPA 4PMCA 1EYDA 4IUQA 3HOUG 2IX0A 1EU3A 3CCRA 5IY0A 4IPGA 4KHVA 3D3RA 4DR1Q 4IUUA 5JPNC 3RZDB 2VUMB 1F2ZA 4IPCA 2AMCB 4A4IA 1OXSC 4OWWB 3IRBA 1JICA 5CV5A 1QNUA 3VR5A 1EQRA 2E74C 1JOOA 2A68C 2AWOA 4QIWB 1TS3A 5CYUA 3BS1A 4RMFA 4DAYB 4PZ7A 3BVGA 4N8FA 3PMFA 3BZDB 2I46A 2NVXH 5KYLA 1RIPA 4UHVA 4CDEC 2MP1A 2O4XA 1ICWA 3P7JA 4DF7A 5I9PA 1U4PA 1GUSA 2D0PA 2D62A 4KV6A 1UWVA 3CHBD 1A3TA 4GKKL 1IL2A 3MXUA 2X6GA 4ZK9B 4A3KH 1CT1D 3G48A 1ASZA 1VQAA 2R93G 1B1ZA 1Y8NB 1H9RA 4DV4Q 3VR3A 5C3EH 1HHVA 3MEHA 1Y14B 2BE5C 3H91A 3U4VA 4A3FB 3SE0A 1WCMB 4KI0A 4NXML 3RLNA 2G9HD 4IUNA 3CU7A 3M4QA 1PV4A 1MI2A 4A3JH 1PH5A 1ASYA 3GTQB 1EIYB 1D7QA 1CHQD 2XN9C 4RH6A 3TN2A 2YYZA 1WTWA 3MXPA 3F2DA 4Y7NH 3D4DA 1IYJB 2JYOA 3C1EA 1B70B 2F0HA 2SNMA 3AB9A 5ISRA 4GOPC 1LACA 4DXFA 3NBHA 3HOVB 3CCEA 4OWTB 2M00A 3GTOB 1LTBD 5KGUA 3LWEA 5D3DA 4GOPA 4XYOA 4ZLTF 4M8AA 4DV2L 3GTPH 1EIGA 4MTNA 5I9OA 1TXYA 1YBYA 2IWHA 5KEEA 1AW7A 2B2VC 1M90C 3GP7A 4B3RL 4MZ9A 1ONLA 1RCVD 5C0XH 1LUZA 4YWMA 2CW0D 3KBXA 2RBMA 1TS5A 2JJQA 2WAQB 3D6WA 3G6JB 3CAMA 3U9OA 1D1IA 3CW2C 4O1NA 2WIIB 4YWLA 2TSSA 5DM73 4A3EH 1SBBB 4X6AH 4EX5A 1LLRD 2K04A 3KF8A 2JA5B 2FMMA 4BY7H 5C6AA 4JG2A 2Z6KA 4XQJA 5JVH3 1KABA 1XNRL 4A3LG 3SK5A 4A3KG 1GJXA 3BYYB 4NXNQ 4L6TB 2L12A 3TS0A 4DV2Q 5EAYA 2K5NA 4JVZA 2KENA 5EBDA 1D8LA 4BXXH 1EY7A 3OHXC 1TS2A 3MAQA 4C2MB 1SN8A 3MTSA 1RJTA 2C35B 1CA6A 3PUXA 4TKOB 1PFBA 5M3FB 2K28A 1TQOA 3HOYG 3CP0A 1A2TA 1HZAA 4FF4A 3M85A 2RVLA 2BA0A 1Q8KA 3PIOA 2A1AA 3EFXD 4KK7A 5CBEE 1PRTF 4QL5A 3ICEA 1PYBA 1KDCA 2ZXRA 4CGYB 2PQAB 1LT5D 4LJZC 1SNQA 4HMJA 1OTCA 5JJLA 2CVRA 1EQQA 1K0SA 3N6RA 3F1ZA 1GO3E 4R1JA 1I6HB 1CQVA 1FGBD 3TP5A 1PH6A 1KC8C 5JJIA 3A74A 5EBCA 3FHWA 1VQMA 1F2YA 3GTKB 3S1MB 2EDGA 2CQOA 3RNUA 2FMCA 2ZTDA 3LNNA 4F88A 1QNKA 3CMEA 4LMQD 3OIPA 1FNVA 2BCOA 4FVMA 5IODA 3T1HQ 1DONA 3FMCA 5C0XG 1JJ2A 3HKZG 1IL8A 3AU7A 5IYBH 1JR0D 5IIFA 3U9SA 1GUNA 4XIGS 4A3GG 3B6YA 4RAUC 2MUYA 4JI7Q 5EKLA 2XSCA 2JA6B 4DK0A 2OTLA 4FO2A 4BY7G 2QF7A 1CA5A 1HNZQ 4FXKC 2E5LQ 5J22A 1LTLA 2KCTA 4LUVA 3PO2G 4HR7B 4MIUA 1R4PB 1Z7TA 4O0AA 2K01A 4DR3L 1TWHH 3ND8A 2HHHQ 4CBVA 5IP7H 4GNXC 1U9RA 1SMYD 1A3VA 4HTHA 4BXXG 2N49A 1U5KA 5CORA 1G91A 4A93H 2JA9A
chains in the Genus database with same CATH topology
1C48A 1BOSA 1R4QB 1DM0B 3QJYA 4K5XA 2K5DA 3AMUA 2X69A 1FD7D 3OWEB 5CBAE 4MHEA 3QWNA 1STEA 3EROA 2F0PA 4XDXA 1DD2A 1TWGB 4WRDA 3KUPA 1HA6A 2EYPA 3NPPA 4KMUC 2JXMB 5IGBA 4P2CB 1ESFA 3DWAA 3O13A 3KBGA 3NTIA 4L63B 1AZQA 2B2TA 1EIHA 1F9SA 1DOKA 5I4DA 1ESRA 1EEID 5HURA 5C0XJ 2QCPX 1Y8OB 4HCSA 3MZ5A 3TP7A 5D65A 4OIJA 3H94A 5M5WB 2JP1A 4KN4C 2PZWA 2Q8IB 1CTMA 5JVG3 2R93B 3OMCA 4XXEA 4XQNA 2WV6D 5I6WA 1RDPD 4ZKBB 3A55A 1SJED 3TZUA 2R3ZA 3C2PA 1Q1BA 3HEJA 1GUTA 1D5ZC 2HCCA 4C1NK 2B8FA 1EY8A 3S1NB 3S14B 4QMGA 5FKAC 5JOBA 3OIQA 5G3LF 3SVMA 1UAPA 2F0GA 2WP8J 5M9OA 2QKIC 1DOMA 1G8ZD 3PO3B 3JAML 1JB3A 1B9NA 1EWHA 1PTOH 1HTPA 5EKIA 1DJRD 5KYIA 3EQLC 4DNTB 1PRTD 3IL8A 3FRPB 2F0DA 1I50B 2Z4IA 2E2DC 1VDZA 2F0OA 2ICIA 3D4RA 1UUPA 1QB5D 1ET9A 5CGKA 2Z4HA 5ELDA 2F0NA 4HAEA 1OXTA 3BVMA 2WINB 4A3KB 3SR1A 5A2QE 4QUCA 4DK1A 2I07B 1AZPA 1CZGA 1OXUA 1S4ZA 2F0VA 1CQFA 1LTID 1F9PA 3DHQA 1FYCA 1F2MA 1SYEA 1RTOA 2KEDA 3HOYB 1ENAA 1F77A 4G4KA 3I8ZA 1TY2A 3V96A 5IGFA 5ELEA 4IQZA 3X3NA 2LS01 1XYIA 2YU9B 2K7VA 3OW7A 1F9RA 1T5XD 1YNNC 5T1GA 2A6HD 3T51B 2A69D 4IZ8A 1WTVA 3DWQA 1IW7D 1EOTA 4IUTA 3K5MA 4N9TA 1MD2D 3GTPB 4EQOA 4ME5A 2A5HA 1C8CA 1EYAA 1HFGA 1GUWA 1WTPA 4S3SA 2NYZD 1SYBA 5I2XA 2EJFC 3MFGA 2IX3A 2AWNA 2KHSA 4R9WA 3PIO3 5IOCA 4A3GB 2XRSD 3T53B 1II3A 5LL6X 5CC4A 3K58A 4ZKCB 1O7YA 5KNCA 5A35A 4H0LC 3PO2B 3C46A 5BN5A 2EJMA 2XNAC 3I3CA 1O78A 1TR5A 2EOTA 2N88A 5EPJA 4RKLA 2KCCA 1EQVA 4KKSA 2F0JA 4DAYA 4U673 2C5CA 2KECA 2K5WA 5LL6S 2K32A 1AFPA 2PW7A 5AFWA 2A6HC 2A69C 4DGZA 2F03A 1XWEA 2JA8B 1IW7C 3MHBA 2HQEA 1G291 2LKVA 4BS9A 2PMZB 2L0CA 3NTHA 1PRTB 5C4HA 5DNFA 4IUVA 2J4XA 4TRDA 4B9XA 3E0JA 4J6HA 1D5XC 4K2LA 3MWYW 4C3JG 1XXGA 3NXWA 2OT2A 5IGEA 2M9VA 1RODA 3J81E 5G3LD 3BVZA 5D3IB 2LFNA 5C0XI 2NN6H 3FPUB 1YNJD 4A3BB 3DXJC 2MHVA 2F3WA 2ENBA 4PNYA 2FJ2A 2F0MA 1C4QA 2VB2X 3KK7A 1W6JA 2V4DA 2EY1A 1DCZA 4DAVA 2EYMA 1QWYA 3FPPA 2XIWA 5ELBA 1SYDA 1I4PA 5CV6A 1LTTD 2NTTA 4ZRZA 3A7LA 1BO0A 4HN7A 4KN7C 3VYSA 5D14A 1XTCD 4F7XA 3VYTA 2MJ8A 4I7ZC 3GTGB 3S1QB 1D5MC 3PUVA 1JWMD 5K5PA 5E1FA 1Q3LA 2IX1A 4ZUIA 1Y69U 3SEBA 2A73B 3J80E 5C3WA 1W6KA 2SDFA 3EA6A 2WB1B 4Z9CB 1STYA 4IURA 2R61A 4H7BA 1FNWA 1J9OA 1LABA 2QDBA 3GTMB 1I4RA 3G7LA 1HCZA 1WD0A 1TVXA 1I3QB 3K7AB 3S2DB 2K5QA 1VMCA 1BF4A 3HGBA 4RKBA 4G7ZC 4UDUC 3K5OA 1ZYRD 3NE5B 1B2TA 2B2VA 2K33A 1GOZA 1QJOA 2NWGA 5ELCA 3BDCA 3PV0A 2GA4B 2ICEC 3FVQA 2RDFA 3TSSA 5JPMC 1S5CD 1ILPA 3LWUA 3HOXB 4LK1C 1NR4A 3T56B 3SK4A 4BBSB 5C5MA 2Y0SB 1PTOB 2PPBC 2A6ED 3GTJB 1MSHA 5KIXA 2R6GA 4GZYC 3E5SA 2O5JC 1S5ED 2L1BA 1GHJA 1QOHA 2IPKD 3Q6SA 3RMHA 2C9OA 5CV8A 3QOLA 4C1NI 1VMPA 4N9PA 2L5TA 2HCIA 2CW0C 3I4NB 4RCOA 4M1UB 2TMPA 5C44B 1NUCA 4RGTA 2XRQD 1U4LA 4L8JA 1L0XB 2ZXOA 1EL0A 2F0UA 2B2UC 3EVQA 2K05A 5ELFA 5C4ZA 2EY5A 4K8JA 1Q90A 4HSPA 3MXNA 2B2UA 4ID6A 4BWGB 1S5FD 2J7ZA 1A2UA 1SYGA 1JWUD 5EPLA 4X3TA 1QCBD 2EVBA 2QEJC 3A8KE 3I91A 1CM9A 4A3DB 1SDFA 1U4RA 1SEBD 3TP6A 3S1RB 3V05A 4C3JB 1STGA 1CFMA 4IFDH 3HOUB 1SYFA 1WTQA 3R8BA 1VF5C 1J8IA 5C4JB 4RGNA 3M7NA 1F9QA 3OWFA 3TBIB 5FLXL 3BYTB 1V1OA 4RHRA 2CQAA 1UNSA 3HZXA 1D1KA 2PNRC 2AUKA 4K8IA 2O5IC 2D9UA 1BCPB 2DN8A 1STBA 4CKBA 2OEOA 4E6IA 4HSVA 3TP8A 4QUFA 1PXUA 5FO9B 2NBFA 3F2UA 2R92B 4CJ0B 2OF1A 1SMYC 4BBRB 4H44C 2BA1A 1H9SB 5EJWA 2KQ3A 5IGGA 3H3VC 4ZYSA 5EPKA 3WOFA 4CHTB 4K14A 4NKLA 3P75A 4KHZA 1AP0A 3NUCA 2IW3A 1GXDC 3C3LA 4IFDG 1PMRA 2PYKA 3L7ZC 4YIJA 1M8AA 5F2DA 3QIAA 1RF2D 1E2ZA 2HDLA 5FO8B 1AN8A 1LO5D 4R8IA 1JC7A 1PTOF 3BDLA 1FR3A 3SHLA 2H1EA 1DZ1A 2KA7A 4LAAA 5JEAH 2EY2A 1K8OA 4WFN3 1BNZA 2NVXB 4DU9A 1O80A 4G7OC 4ZQ3A 4XTCS 5HGTA 2M2LA 2VNUD 1B50A 5T1IA 1TWCB 3DMUA 1U4MA 3T4AC 2RDHA 1HFNA 2EYLA 2RDGA 5COYA 1BBXC 1IYUA 3SK6A 5DAUA 3W2DA 4CJ1B 2EYJA 1EZ8A 1EZ6A 4FYDA 1PZID 3VYRA 5C3EB 3VR6A 2L11A 2MPMA 1CZWA 2BOSA 3HOZB 3FEWX 2DY7A 3RUZA 5IGCA 5IGDA 3NQTA 5IT9L 2N55A 3HG9A 2B2WC 4A3JB 1BUVT 2EPBA 2B2WA 4Y7NB 1CHPD 1MBYA 3GQBA 2F0SA 5M5XB 4OO1H 1TU2B 4FF3A 2PW5A 4IFDJ 2JE6I 1I4QA 4FXDA 1PZKD 1SJHD 1VCIA 3OOCA 3D4WA 2WACA 1PRTC 1EFID 2K1BA 3ITPA 1I6VC 4BA2I 3J7AF 3A7AB 4IUPA 3J7AV 3MVVA 2K6AA 2QILA 1O7ZA 1CI3M 3HKZB 3ND9A 3JAME 5KNBA 3SXHA 4ZAIA 2Q8TA 2EE1A 5E4WC 3H09A 1E2VA 1Q1EA 1TKWB 4A3EB 1IKLA 1SNOA 3D6CA 3DUZA 4V190 4BY7B 1LTSD 2E75C 1B4OA 1OXXK 1BCPF 1SE2A 3L3OC 4DNRB 4FP5D 2SOBA 2FHTA 1RHPA 2B8GA 4H13C 3IFTA 3OPOA 2F0IA 1ILQA 1HXYD 1V1PB 2XVSA 4G7HC 1Y8PB 4FXGC 1H9MA 1GUGA 2NB0A 2PZUA 2F0LA 1GHKA 4MN3A 3T13A 2E2HB 3TMEA 4WJWA 5EKKA 4PQXA 4J8QA 4HMIA 3MFYA 2EY6A 1HRJA 1B53A 4X3UA 4IN3A 5C3XA 4BY1B 3A8IE 1NSNS 4NDXA 4KKUA 5JEAJ 1KLUD 1TY0A 3CKIB 1PTOD 2XWJB 2IT1A 4QB4A 4F8MA 1G2TA 4FNFA 5CR3A 1BQQT 4K6LA 2EYHA 5EGTA 1LT6D 2BE5D 2Z1CA 1K8MA 4HCEA 3Q24A 4R8NA 5TSSA 2KEEA 1RTNA 1HA5A 3V2TA 1V8QA 5I6YA 3UI2A 1IKMA 2DNCA 1TWHB 1XX8A 3GV3A 4TSSA 1Q8IA 5LHY1 4IALA 4A93B 2D2CC 4DN4M 3DM1A 2AUJD 1Y1WB 2AQ1B 3SDZA 1SNDA 1HPCA 3PUZA 1IYVA 4NW2A 4XQQA 4C56C 3KLSA 2EYFA 5C4XB 1SYCA 1Y1VB 4PMWA 1X32A 3TDQA 3CQZB 4K6DA 2F0WA 2VB3X 1B44D 1Z6HA 1H9KA 4ILWA 4NP5A 2L55A 4A3MB 4V0BA 1ET6A 1TWAB 3NHHA 3NSWA 4EGVA 5DEHA 1PTOC 1O7LA 4RHSA 1YNJC 2EXZA 1SSOA 1STHA 4PMBA 3QO2A 4NMZA 2E76C 4KY5A 1WVLA 1ZEQX 1STAA 4DFAA 2NN6G 5EQ0A 1ZXTA 5J1ZA 2MGSA 2B63B 2B2YC 1JCKB 3IAYA 4XT3B 4CJ2C 3X3MA 4J1MA 2F0TA 1X3PA 2B2YA 3BG3A 1PLFA 2EYOA 4O42A 2AQ3B 5FK9C 4RFBA 3I4MB 3EJIA 3Q0AA 1JOQA 1BCPD 1SXTA 2D5DA 4IFDI 3S16B 1KDBA 2NVQB 3HP3A 2IL8A 1LTAD 4DXGA 3T16A 3M4YA 4JK1C 3VYUA 3MA2B 2F0QA 5CV9A 4F87A 5BN4A 3VA7A 1WD1A 2PO4A 3M4OB 3OMGA 1CK1A 4TQUS 2FFKB 2BDNA 1PFNA 1ENFA 1KNEA 3RLFA 3MC0B 4RGOS 2F3VA 2LMCB 1ZYRC 3M7GA 5FO7B 1LT4D 4KY7A 3A54A 1G6ZA 1WTRA 4XYQA 1TWFB 3TZDA 5M5YB 3M3YB 2RQXA 2JEBI 3HS0C 2JEAI 3MXGA 2Z8LA 3C1FA 1EQTA 1F2LA 1BCPC 1KAAA 4C3HG 1DYQA 4EQNA 2JA7B 4RCNA 1D6EC 4KY6A 2SNSA 1GUOA 1ENCA 1PFMA 2RKSA 3ERQA 1SNPA 3A8JE 3ZYYX 3S15B 2F0FA 3L9AX 1ZKOA 2A6EC 2IJ0A 3WOEA 1HQRD 2WKDA 3CRKC 3A56A 1AEXA 1JWSD 1H9SA 4WORA 1ML0D 1EWCA 3WDNA 3PUWA 3PIP3 2HUGA 4C3IG 5DM63 3OSOA 4K2KA 4RWSC 1EY4A 1STNA 1RD9D 2ZXPA 4KD4A 5JAVA 5CV4A 5K36H 4DA2A 3CRLC 4BA1I 1T5EA 3BDOA 2JSOA 3Q22A 1E0BA 1QG7A 3FDTA 2SEBD 3R93A 3GTLB 3NP8A 2EZVA 2L9HA 2PCFB 1PZJD 1HTLD 4ZUJA 3GV6A 2F4IA 3DEOA 3P20A 2NZ1D 4ODGA 3I70A 3P1HA 3Q23A 4KJNA 1I4GA 4Q5VA 2B2TC 2EJGC 1WTOA 3H6MA 2DY8A 3VA5A 3NK9A 1SE4A 5BN3A 3IKJA 1EY0A 5A2QL 4RA8A 1I4XA 4ABNA 2O2LD 1E2WA 4OO1I 2E2IB 5CV7A 3K6OA 3R3OA 4KD3A 2ID0A 1EY6A 3NWTA 3H0GB 3RD4A 4ULLA 3NQIA 5K36G 5KNDA 1L0YB 1LT3D 4B08A 5E3FA 2ZT9C 1S5DD 4QF4A 5FOBB 1KLGD 3DWPA 1JOKA 2Q8RE 4A3IB 1DXMA 2J0TD 1EYCA 3J7YW 3E6ZX 1TS4A 3QB3A 1EY9A 3GD7A 3N52A 3HRZC 3S17B 2RSNA 1SAPA 3KLSX 2FINB 1FNUA 3IFDA 5C5LA 4OL7A 2E2JB 1A3UA 4X3KA 3FKIB 1I4HA 4CKCA 5FLXE 2KOLA 1QILA 1YNND 3ONAB 2H4OA 2F0KA 1SFOB 3NTKA 4AYBB 3PUYA 2G9DA 1A15A 1KDAA 5KRUA 1LTGD 1HUMA 1JE4A 3K5NA 1Z47A 2KVMA 2RA4A 3URYA 4RGMA 2KUMA 1D2BA 2NVYB 4K5WA 2PZTA 5E4XA 2F0EA 1BDOA 1PDQA 2LY7A 1G2SA 3NWSA 4B9WA 1PYWD 1BR9A 1X3QA 2KCNA 1S5BD 1K83B 5I2YA 1V1PA 4UAIA 1EU4A 3R2TA 1LTRD 1Q12A 4KKTA 2NN6I 1TIID 2NUCA 3I90A 2A74C 2L4NA 3QOJA 4EVOA 1OO9B 2K03A 3D31A 1HQMC 1KNAA 5JEAG 4QCLA 2F1MA 1EEFD 2KJXA 5M3MB 1JQYD 3J81L 2NTSA 1B3AA 3I4LA 3K5LA 3SK8A 3QG1A 4EQPA 2CHBD 4C3HB 2OXPA 5JJZA 1KTKA 3KLRA 4FF2A 4HEDA 4U68A 2R7ZB 2X6LA 3LX0A 4KJOA 4JBWA 4X3SA 2NVTB 1NR2A 3RZOB 2PQEA 3HOWB 1MGSA 2B39A 2RSOA 4FF1A 1B9MA 4I65A 2WKCA 4DAPA 4KTAA 3GO5A 1TT2A 1HUNA 1V43A 3D8GA 4C3IB 1DOLA 2A68D 3S9WA 1WTXA 4OO1G 5J39A 1NCVA 1BXTA 4K5VA 3S2HB 3K0YA 5IT9E 3DEPA 1SE3A 1MSGA 3K57A 1VF7A 4OGQC 4OHJA 3NBIA 3VR2A 3J80L 4G57A 2AQ2B 3I73A 3K59A 1M4VA 1QE6A 4Q0FA 4XT1B 3VR4A 1RKNA 1IHZA 4CKEA 1H9JA 1SNCA 1A6XA 3R2IA 5CMDA 2BDOA 1EY5A 2DNEA 5NUCA 3I72A 1LV9A 1SNMA 2VXWA 2XWBB 4OIKA 1OXVA 2HDMA 4PV1C 1JORA 1UEAB 3W3AA 1R9TB 1NAPA 4PMCA 1EYDA 4IUQA 2IX0A 1EU3A 4KHVA 3D3RA 4IUUA 5JPNC 3RZDB 2VUMB 1F2ZA 1OXSC 1JICA 5CV5A 1QNUA 3VR5A 2E74C 1JOOA 2A68C 2AWOA 4QIWB 1TS3A 5CYUA 3BS1A 3BVGA 3PMFA 3BZDB 2I46A 5KYLA 2MP1A 2O4XA 1ICWA 3P7JA 4DF7A 5I9PA 1U4PA 1GUSA 2D62A 4KV6A 3CHBD 1A3TA 3MXUA 2X6GA 4ZK9B 1CT1D 1B1ZA 1Y8NB 1H9RA 3VR3A 1HHVA 3MEHA 2BE5C 3H91A 4A3FB 3SE0A 1WCMB 4KI0A 2G9HD 4IUNA 3CU7A 1MI2A 3GTQB 1CHQD 2XN9C 4RH6A 3TN2A 2YYZA 1WTWA 3MXPA 3D4DA 2JYOA 3C1EA 2F0HA 2SNMA 3AB9A 5ISRA 1LACA 4DXFA 3NBHA 3HOVB 2M00A 3GTOB 1LTBD 5KGUA 3LWEA 5D3DA 4XYOA 4ZLTF 4M8AA 1EIGA 5I9OA 5KEEA 2IWHA 1AW7A 2B2VC 3GP7A 1ONLA 1RCVD 5C0XH 2CW0D 3KBXA 2RBMA 1TS5A 2WAQB 3D6WA 3G6JB 3U9OA 1D1IA 4O1NA 2WIIB 2TSSA 5DM73 1SBBB 1LLRD 2K04A 3KF8A 2JA5B 2FMMA 5C6AA 4XQJA 5JVH3 1KABA 3SK5A 1GJXA 3BYYB 4L6TB 2L12A 5EBDA 1EY7A 3OHXC 1TS2A 3MAQA 4C2MB 3MTSA 1RJTA 1CA6A 3PUXA 4TKOB 1PFBA 5M3FB 2K28A 1TQOA 1A2TA 4FF4A 3M85A 2RVLA 2BA0A 3EFXD 4KK7A 5CBEE 1PRTF 4CGYB 1KDCA 2ZXRA 1LT5D 4LJZC 1SNQA 4HMJA 2CVRA 3N6RA 1I6HB 1CQVA 1FGBD 3TP5A 5EBCA 3GTKB 1F2YA 3S1MB 2EDGA 2FMCA 3LNNA 4F88A 1QNKA 4LMQD 3OIPA 1FNVA 2BCOA 4FVMA 5IODA 1DONA 3FMCA 5C0XG 1IL8A 3AU7A 1JR0D 5IIFA 3U9SA 1GUNA 4XIGS 4RAUC 2MUYA 5EKLA 2XSCA 2JA6B 4DK0A 4FO2A 2QF7A 1CA5A 4FXKC 5J22A 4HR7B 4MIUA 1R4PB 1Z7TA 2K01A 3ND8A 4CBVA 1U9RA 1SMYD 1A3VA 4HTHA 5CORA 1G91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KYL A;  5IGG A;  2EXZ A;  1STH A;  4PMB A;  5JOB A;  4EQO A;  2EY5 A;  1KAB A;  4ODG A;  5C4Z A;  4K8J A;  4HMI A;  2F0G A;  4I65 A;  4ME5 A;  4NMZ A;  4RKB A;  3SK5 A;  1KDA A;  2EY6 A;  2O4X A;  1EYA A;  3P1H A;  1TT2 A;  4KTA A;  2F3W A;  4KY5 A;  5KRU A;  2ENB A;  4KJN A;  4K5X A;  1STA A;  2F3V A;  4PNY A;  4ID6 A;  4S3S A;  4DF7 A;  4K14 A;  3D8G A;  2F0S A;  4DFA A;  5C3X A;  4KY7 A;  5J1Z A;  2PW5 A;  1A2U A;  1SYB A;  4KV6 A;  4NKL A;  1EY7 A;  3P75 A;  1SYG A;  3H6M A;  3VA5 A;  3NK9 A;  3S9W A;  2KHS A;  1A3T A;  1NSN S;  5IOC A;  2F0M A;  3NUC A;  4K5W A;  4NDX A;  5J39 A;  2PZT A;  3ERO A;  2F0P A;  3D4W A;  4K5V A;  2F0E A;  2PYK A;  3C1F A;  5KYI A;  1EY0 A;  1TQO A;  2EY1 A;  2WAC A;  4YIJ A;  5F2D A;  4WRD A;  1II3 A;  1A2T A;  1KAA A;  3BDC A;  4EQN A;  3ITP A;  4QB4 A;  4F8M A;  5CC4 A;  2EYM A;  5CR3 A;  4B9W A;  3MEH A;  5CV7 A;  5I9P A;  2F0D A;  2EYP A;  2EYH A;  5EGT A;  5M9O A;  3MVV A;  2RDF A;  3BDL A;  4KY6 A;  1KDC A;  2SNS A;  3SHL A;  3TP6 A;  5IGB A;  1SYD A;  1ENC A;  3R3O A;  5CV6 A;  2F0O A;  2F0T A;  1SNQ A;  4J1M A;  4HMJ A;  4G57 A;  4IUN A;  4KD3 A;  4R8N A;  1STG A;  1TR5 A;  2RKS A;  1SYF A;  3SXH A;  3SK8 A;  5CGK A;  2EYO A;  1EY6 A;  3ERQ A;  1RKN A;  1SNP A;  3SK4 A;  3V2T A;  5I6Y A;  4LAA A;  2F0F A;  3MXP A;  4RKL A;  1IHZ A;  5C5M A;  1EQV A;  3TP5 A;  1SNC A;  4N9T A;  2F0N A;  3D4D A;  2NUC A;  2F0J A;  3EJI A;  2EY2 A;  4F7X A;  1SNO A;  3D6C A;  3SR1 A;  1F2Y A;  3C1E A;  3QOJ A;  4IAL A;  4EVO A;  5HUR A;  1EY5 A;  2F0H A;  2SNM A;  5NUC A;  1AEX A;  1JOQ A;  5ISR A;  5KIX A;  4WOR A;  1SNM A;  4DU9 A;  3MZ5 A;  5E3F A;  3TP7 A;  5E1F A;  5K5P A;  1JOR A;  2PW7 A;  3OWF A;  2F0V A;  3E5S A;  4ZQ3 A;  2M00 A;  5IOD A;  5HGT A;  1KDB A;  5KEE A;  4DGZ A;  4ZUI A;  1SND A;  4QF4 A;  4PMC A;  5KGU A;  1EYD A;  5C3W A;  3OSO A;  3MHB A;  3DHQ A;  4K2K A;  2HQE A;  1F2M A;  3DMU A;  1JOK A;  5IIF A;  3T16 A;  1SYE A;  1EY4 A;  2EYL A;  2PZW A;  2LKV A;  2SOB A;  3HZX A;  4KHV A;  1STN A;  1STY A;  4KD4 A;  5I9O A;  5JAV A;  5CV4 A;  3SK6 A;  4K8I A;  1ENA A;  3OMC A;  1EYC A;  2EYF A;  5CV8 A;  3QOL A;  1SYC A;  5DAU A;  4EQP A;  5I6W A;  4N9P A;  2OXP A;  5EKL A;  3QB3 A;  1F2Z A;  4H7B A;  2F0Q A;  5C4H A;  1EY9 A;  2F0I A;  5CV9 A;  4TRD A;  2EYJ A;  4B9X A;  5IGF A;  2QDB A;  1EZ8 A;  1STB A;  4K6D A;  2F0W A;  2OEO A;  5CV5 A;  1EZ6 A;  4E6I A;  3TP8 A;  3LX0 A;  5J22 A;  4KJO A;  3NP8 A;  1JOO A;  4J6H A;  3HEJ A;  2RBM A;  4MIU A;  1NUC A;  4OL7 A;  5C5L A;  1A3U A;  3RUZ A;  3OMG A;  4K2L A;  4NP5 A;  3U9O A;  5IGC A;  5IGD A;  4ZUJ A;  2OF1 A;  2PZU A;  2PQE A;  2F0L A;  3NHH A;  3NQT A;  3NXW A;  4IZ8 A;  5C6A A;  1U9R A;  4HTH A;  1A3V A;  1EY8 A;  3PMF A;  5IGE A;  2F0U A;  3T13 A;  5DEH A;  2F0K A;  3TME A;  5EKK A;  3EVQ A;  2KQ3 A;  4QMG A; 
#chains in the Genus database with same CATH topology
 1C48 A;  1BOS A;  1R4Q B;  1DM0 B;  2MO0 A;  3QJY A;  3CMA A;  4GNX A;  1Y1W H;  4K5X A;  2K5D A;  1Q82 C;  2N3S A;  2GN5 A;  3CC4 A;  2NZO A;  3AMU A;  2X69 A;  1FD7 D;  3OWE B;  5CBA E;  4MHE A;  3QWN A;  1PYS B;  1STE A;  5C4X H;  4POF A;  2JA8 G;  1Y1V H;  1IBL Q;  3ERO A;  2F0P A;  4XDX A;  3CQZ H;  1DD2 A;  1TWG B;  2CWA A;  4LFC L;  2VZA A;  4WRD A;  4JCV E;  1HJP A;  2RHQ B;  3KUP A;  1HA6 A;  2AKW B;  1L2F A;  4DR3 Q;  4A76 A;  2EYP A;  3NPP A;  4KMU C;  2NZH A;  4A3M H;  2JXM B;  5IGB A;  1TWA H;  4P2C B;  1ESF A;  3DWA A;  3O13 A;  4JI5 Q;  3KBG A;  1B7Y B;  3NTI A;  4L63 B;  3MXN B;  1AZQ A;  4PG3 A;  2B2T A;  4DNI A;  2Z6B A;  1EIH A;  1F9S A;  1DOK A;  1P16 A;  4IO9 A;  5I4D A;  1ESR A;  1EEI D;  4DAM A;  5HUR A;  1J5E L;  5C0X J;  2QCP X;  4DR4 L;  4POG A;  4A3B G;  1Y8O B;  4HCS A;  3MZ5 A;  3TP7 A;  2K75 A;  5D65 A;  4JBM A;  4OIJ A;  3H94 A;  4GLX A;  4LFC Q;  3S2D H;  2B63 H;  2UUA L;  5M5W B;  2JP1 A;  4KN4 C;  5FLM H;  2PZW A;  2Q8I B;  4L5S A;  1CTM A;  5JVG 3;  2R93 B;  3OMC A;  4XXE A;  4WJ4 A;  4XQN A;  2WV6 D;  5I6W A;  3PQI A;  3W1B A;  3UDI A;  1RDP D;  4ZKB B;  3A55 A;  1SJE D;  3K8A A;  3TZU A;  1SR3 A;  1VQG A;  2R3Z A;  3C2P A;  1Q1B A;  3HEJ A;  4GN3 B;  1KIX A;  3U50 C;  1GUT A;  3HKS A;  2B29 A;  2Z0S A;  1D5Z C;  2HCC A;  4C1N K;  1J5E Q;  2E8G A;  3I4M H;  4DR4 Q;  2B8F A;  4N8X 1;  1EY8 A;  3S1N B;  3S14 B;  4QMG A;  5FKA C;  2HIX A;  1K73 C;  5JOB A;  1Y1V G;  4AIM A;  3OIQ A;  5G3L F;  3SVM A;  1UAP A;  2F0G A;  2WP8 J;  5M9O A;  3S16 H;  2QKI C;  2RCN A;  4QJF A;  2NVQ H;  1DOM A;  2UXC L;  1G8Z D;  3PO3 B;  3JAM L;  1L1O C;  1JB3 A;  1LYL A;  1B9N A;  3CD6 A;  1JT8 A;  1EWH A;  1PTO H;  1X9N A;  1HTP A;  5EKI A;  3G71 A;  1DJR D;  1E1T A;  1L1O A;  2WB1 G;  5KYI A;  4LFA L;  3EQL C;  1A8V A;  4DNT B;  4JI4 L;  4R4Q A;  4JI3 L;  1PRT D;  1JB7 A;  3IL8 A;  3FRP B;  2UUB L;  2F0D A;  2G5D A;  1I50 B;  3M4O H;  2Z4I A;  4LW1 A;  2E2D C;  1VDZ A;  3D4R A;  2F0O A;  2ICI A;  3ULL A;  1UUP A;  1QB5 D;  1ET9 A;  5IP9 H;  5CGK A;  4JI1 Q;  2Z4H A;  2QW7 A;  5ELD A;  1G6P A;  2F0N A;  4HAE A;  2WFW A;  1OXT A;  4I7A A;  3BVM A;  2WIN B;  4A3K B;  3SR1 A;  5A2Q E;  4JI6 L;  4QUC A;  4DK1 A;  2I07 B;  1UEB A;  1AZP A;  3WWV A;  1TWF H;  1CZG A;  1OXU A;  1S4Z A;  2F0V A;  5M5Y H;  3M3Y H;  1CQF A;  4LFA Q;  4HJ9 A;  1LTI D;  1F9P A;  3DHQ A;  1FYC A;  1F2M A;  4HIM A;  1SYE A;  1JMC A;  1RTO A;  2KED A;  2UUB Q;  2JA7 H;  3HOY B;  1ENA A;  1F77 A;  4G4K A;  4WJ3 M;  3I8Z A;  1TY2 A;  3ERS X;  3V96 A;  5IGF A;  4JI0 L;  5ELE A;  1EWI A;  4IQZ A;  4DV0 L;  1M1K C;  4X62 Q;  3X3N A;  4LFB L;  2LS0 1;  1XYI A;  2YU9 B;  2K7V A;  4LUO A;  1VQI A;  3OW7 A;  4LWC A;  1F9R A;  3S15 H;  3HOX G;  1T5X D;  1YNN C;  5T1G A;  2A6H D;  3ULJ A;  3T51 B;  2A69 D;  3TRE A;  4IZ8 A;  4JI6 Q;  1WTV A;  3DWQ A;  1IW7 D;  1EOT A;  4IUT A;  1VQO A;  4BBS G;  3K5M A;  4N9T A;  3A5Z B;  2PNH A;  1MD2 D;  2Y0S G;  3GTP B;  4EQO A;  5FLX c;  3KJO A;  4ME5 A;  2A5H A;  1C8C A;  1EYA A;  1HFG A;  4DK6 C;  1IBK L;  1NMF A;  1WTP A;  4GKJ L;  1GUW A;  1CSP A;  4S3S A;  2LXJ A;  4DUZ L;  2NYZ D;  3KDF B;  1SYB A;  5I2X A;  1H95 A;  2EJF C;  2F4V L;  3MFG A;  2IX3 A;  2AWN A;  2KHS A;  4R9W A;  3PIO 3;  5IOC A;  4A3G B;  2XRS D;  5IP9 G;  4B3M Q;  1K8A C;  4LFB Q;  3T53 B;  4AYB E;  1II3 A;  4R4T A;  1VQK A;  5LL6 X;  3CCL A;  3GTL H;  5CC4 A;  5HGQ A;  3K58 A;  4ZKC B;  1O7Y A;  5KNC A;  5A35 A;  1S72 A;  4H0L C;  3PO2 B;  3C46 A;  1P8L A;  2DJG C;  5BN5 A;  2EJM A;  5E7N A;  1N9W A;  5C44 G;  1BBU A;  2XNA C;  3I3C A;  1O78 A;  1TR5 A;  1PA6 A;  3EBE A;  2EOT A;  2N88 A;  5EPJ A;  4RKL A;  2KCC A;  1EQV A;  4KKS A;  4DPG A;  4DUZ Q;  4DUY L;  2F0J A;  4DAY A;  4U67 3;  2C5C A;  3J81 j;  4JI2 L;  2KEC A;  2F4V Q;  2K5V A;  2K5W A;  5LL6 S;  4B3T Q;  2K32 A;  1E22 A;  2H5X A;  4DR1 L;  3BZK A;  2PW7 A;  1PH3 A;  1AFP A;  1PH4 A;  5AFW A;  4BBR H;  2A6H C;  2A69 C;  4JI8 L;  4DGZ A;  2F03 A;  3T1Y Q;  1XWE A;  1SLJ A;  1IW7 C;  2JA8 B;  3MHB A;  2HQE A;  1C7Y A;  1G29 1;  2LKV A;  2ZM6 L;  4BS9 A;  2PMZ B;  1N32 L;  3JAM c;  2L0C A;  3NTH A;  1PRT B;  5C4H A;  1UE1 A;  5DNF A;  4IUV A;  2J4X A;  4TRD A;  4B9X A;  4A3D G;  3HFZ B;  3E0J A;  4J6H A;  4GN4 B;  1D5X C;  4LNQ A;  4DUY Q;  4K2L A;  1S40 A;  3MWY W;  1AH9 A;  4C3J G;  1KQS A;  1XXG A;  3NXW A;  2OT2 A;  3H0G H;  4JI2 Q;  5IGE A;  2M9V A;  1ROD A;  4LF8 Q;  3J81 E;  5G3L D;  3BVZ A;  5D3I B;  2LFN A;  2I0Q A;  5IYC G;  5C0X I;  2NN6 H;  3FPU B;  1YNJ D;  4JI8 Q;  4A3B B;  5GAG C;  3F2B A;  3DXJ C;  2MHV A;  2F3W A;  2ENB A;  4PNY A;  2RF4 A;  4IPH A;  2FJ2 A;  2ZM6 Q;  4A3I H;  1N32 Q;  4DV4 L;  2F0M A;  3PSI A;  1C4Q A;  2VB2 X;  3KK7 A;  3KYH C;  1W6J A;  2DJF C;  1EUJ A;  2V4D A;  1HNW Q;  2EY1 A;  3S17 H;  1DCZ A;  1VQN A;  4MNO A;  3J81 i;  4DAV A;  2EYM A;  1QWY A;  5IT9 c;  3FPP A;  3M9B A;  4K0K Q;  2XIW A;  5ELB A;  3FKI H;  1SYD A;  1I4P A;  3ER0 A;  5CV6 A;  1TWC H;  2ATW A;  1LTT D;  2NTT A;  4ZRZ A;  3A7L A;  1BO0 A;  4HN7 A;  4KN7 C;  2Q2T A;  2R92 G;  2KBN A;  1SFO H;  4BBR G;  3VYS A;  4DR5 L;  3NEM A;  5D14 A;  4IJL A;  1XTC D;  4F7X A;  4A3C H;  1EYG A;  3VYT A;  1MIU A;  2CCZ A;  4OON A;  2MJ8 A;  4I7Z C;  3GTG B;  3S1Q B;  3PUV A;  1D5M C;  1JWM D;  3HOZ H;  5E1F A;  5K5P A;  1Q3L A;  1AE2 A;  4APV A;  2NVY H;  1LM0 A;  2IX1 A;  4ZUI A;  1Y69 U;  1PHJ A;  3SEB A;  2A73 B;  3J80 E;  5C3W A;  1XPO A;  1W6K A;  4KLK A;  2SDF A;  3EA6 A;  2WB1 B;  4Z9C B;  1STY A;  4IUR A;  2R61 A;  1K0R A;  3H0G G;  4H7B A;  1FNW A;  1J9O A;  1LAB A;  5M5X H;  2QDB A;  3CF5 A;  1YI2 A;  3GTM B;  1X3E A;  1I4R A;  3G7L A;  1HCZ A;  1K83 H;  1VQD A;  4DR5 Q;  1XMO L;  1WD0 A;  1N34 Q;  1TVX A;  1QVF A;  3K80 C;  1I3Q B;  3K7A B;  4RG1 A;  4NXN L;  3S2D B;  2K5Q A;  2PQA A;  3J80 i;  3CCQ A;  3TEH B;  1VMC A;  1BF4 A;  3HGB A;  5M3M H;  4RKB A;  4G7Z C;  3U4Z A;  1Q7Y C;  4UDU C;  3DLL A;  4QIW E;  3K5O A;  1YHA A;  1ZYR D;  3NE5 B;  1B2T A;  2B2V A;  2K33 A;  1V1Q A;  3DM3 A;  1NNX A;  4C3H H;  1YIT A;  1GOZ A;  1QJO A;  4LF9 L;  2NWG A;  5ELC A;  4YY3 Q;  1XMO Q;  1E7Z A;  4OEM B;  4DV1 L;  2R7Z H;  3BDC A;  3PV0 A;  2GA4 B;  2MNA A;  2ICE C;  3FVQ A;  4PZ8 A;  1XMQ Q;  4FDB A;  3PGZ A;  2NVT H;  4DR2 Q;  2RDF A;  3TSS A;  5JPM C;  1S5C D;  3RZO H;  1ILP A;  3LWU A;  5GAD C;  5LMN L;  3HOX B;  4LK1 C;  5C3E G;  1NR4 A;  3HOW H;  3HOZ G;  3T56 B;  3SK4 A;  4BBS B;  5GAE C;  3T1H L;  2Y0S B;  1QUQ A;  5C5M A;  5FJ8 H;  1PTO B;  1Q86 C;  4A3J G;  2PPB C;  2A6E D;  3GTJ B;  1MSH A;  4C3I H;  1CSQ A;  1WI5 A;  4UP8 A;  4UY8 C;  5KIX A;  2R6G A;  3PCO B;  4GZY C;  2VL6 A;  2OQK A;  1I94 L;  3E5S A;  4LF9 Q;  4JI7 L;  1I5F A;  2O5J C;  4DV1 Q;  3S2H H;  1S5E D;  2L1B A;  2E2H H;  1GHJ A;  1QOH A;  1HNZ L;  2IPK D;  4GN5 A;  2E5L L;  3Q6S A;  3RMH A;  4HJA A;  2JK8 A;  5IWA Q;  2C9O A;  5LMN W;  3STB D;  5CV8 A;  3QOL A;  4C1N I;  1VMP A;  2ZTC A;  4N9P A;  4IJH A;  5LMN Q;  2L5T A;  2HCI A;  2VS1 A;  2CW0 C;  2HHH L;  2YTY A;  3I4N B;  4RCO A;  4BY1 H;  5M3M G;  4M1U B;  2I5M X;  2TMP A;  5C44 B;  1NUC A;  4RGT A;  2XRQ D;  1U4L A;  4L8J A;  1L0X B;  2ZXO A;  1EL0 A;  2F0U A;  2LSS A;  2B2U C;  1EOV A;  3EVQ A;  1I94 Q;  2K05 A;  4JW0 A;  1BBW A;  5ELF A;  4A3E G;  2EY5 A;  5C4Z A;  4K8J A;  3G6E A;  2ZJQ A;  1Q90 A;  4HSP A;  1R9T H;  3MXN A;  1IBL L;  2UXD Q;  2B2U A;  4ID6 A;  4BWG B;  3H15 A;  1S5F D;  2WAQ E;  2J7Z A;  2HD3 A;  1A2U A;  1SYG A;  1JWU D;  5EPL A;  4X3T A;  2V1C C;  1QCB D;  3E0E A;  2EVB A;  3RZD H;  2QEJ C;  3A8K E;  2VUM H;  3I91 A;  2MQH A;  1CM9 A;  2HQL A;  4JI5 L;  4A3D B;  1A0I A;  1SDF A;  5FJ8 G;  1U4R A;  1SEB D;  1CKN B;  4JV5 Q;  1XNQ L;  3TP6 A;  3S1R B;  1VQH A;  3V05 A;  1B3Q A;  4LF5 L;  4C3J B;  1STG A;  1CFM A;  4IFD H;  3HOU B;  4DK3 C;  1IBM Q;  1SYF A;  2QGQ A;  1WTQ A;  4HJ8 A;  4JPB W;  1Q81 C;  3R8B A;  5GAH C;  3PF5 A;  1VF5 C;  2CKZ B;  1J8I A;  5C4J B;  1X3F A;  4X66 L;  4RGN A;  2RCF A;  1VQB A;  4YWK A;  4OEL B;  4OXP A;  3M7N A;  4YCU A;  1F9Q A;  2QDL A;  4B3S L;  1KL9 A;  3OWF A;  1CKO A;  3TBI B;  5FLX L;  3BYT B;  1NTG A;  1K9M C;  4BY1 G;  1V1O A;  4RHR A;  2CQA A;  1UNS A;  3HZX A;  1D1K A;  3AEV A;  2PNR C;  2AUK A;  4K8I A;  5IYB G;  4LF7 Q;  1PH1 A;  2O5I C;  1XNQ Q;  3A5U A;  4A3F H;  2D9U A;  1BCP B;  4LF5 Q;  1WCM H;  3RN2 A;  2DN8 A;  1STB A;  4CKB A;  2GVA A;  2OEO A;  4HSV A;  4E6I A;  3TP8 A;  4QUF A;  3GDE A;  1PXU A;  4DV3 L;  1UE6 A;  5FO9 B;  2NBF A;  3F2U A;  2R92 B;  4CJ0 B;  4X66 Q;  3CC7 A;  2OF1 A;  5AJ3 Q;  1YHQ A;  1SMY C;  4BBR B;  3TQY A;  4H44 C;  2BA1 A;  1H9S B;  5EJW A;  2KQ3 A;  2F52 A;  4B3S Q;  5IGG A;  2YV5 A;  3H3V C;  3K81 C;  4ZYS A;  1HR0 L;  4YCV A;  5IP7 G;  5EPK A;  2VUM G;  4NB3 A;  5ELN A;  3WOF A;  3GTO H;  4A93 G;  3OTO L;  4CHT B;  4K14 A;  3L0O A;  1N8R C;  4NKL A;  1Y1W G;  1VS0 A;  3BJU A;  3P75 A;  4KHZ A;  1AP0 A;  4IPD A;  3NUC A;  4J15 A;  4NPS A;  2BH8 A;  2IW3 A;  1GXD C;  3C3L A;  4IFD G;  1PMR A;  1XPU A;  2PYK A;  3L7Z C;  4YIJ A;  5C4X G;  1M8A A;  1ICF B;  1YHB A;  3QIA A;  5F2D A;  4DV3 Q;  1RF2 D;  1E2Z A;  1QVC A;  1PVO A;  2HDL A;  5FO8 B;  1AN8 A;  1LO5 D;  4UP9 A;  4R8I A;  4JI1 L;  1JC7 A;  1PTO F;  3BDL A;  1FR3 A;  3SHL A;  1HR0 W;  2H1E A;  1HR0 Q;  2JA5 H;  3U58 A;  4A3M G;  1DZ1 A;  4R4I A;  4HJ7 A;  2KA7 A;  3RR5 A;  3OTO Q;  3F8T A;  4LAA A;  5JEA H;  2EY2 A;  1X54 A;  1K8O A;  1HZC A;  4WFN 3;  1BNZ A;  1YJ9 A;  2NVX B;  1KD1 C;  4DU9 A;  4YHH Q;  1O80 A;  3TS2 A;  4G7O C;  3TRZ A;  4ZQ3 A;  4XTC S;  1VQC A;  5HGT A;  4C2M H;  1K28 A;  2M2L A;  2VNU D;  1B50 A;  5T1I A;  5M3F H;  1TWC B;  3DMU A;  1U4M A;  3T4A C;  2RDH A;  1MJE A;  2ALY B;  2EYL A;  2RDG A;  4X62 L;  1HFN A;  5COY A;  1BBX C;  1VQ6 A;  3KDF A;  1IYU A;  3SK6 A;  5DAU A;  1UE5 A;  3W2D A;  2B63 G;  1X65 A;  4KHP L;  1JJG A;  4P72 A;  5FLM G;  4CJ1 B;  2EYJ A;  1EZ8 A;  4HID A;  1EZ6 A;  4FYD A;  4MTK A;  1PZI D;  3VYR A;  5C3E B;  3VR6 A;  2L11 A;  2MPM A;  1CZW A;  1WJJ A;  2BOS A;  3FEW X;  2DY7 A;  3RUZ A;  3HOZ B;  5IGC A;  1N33 L;  4P71 A;  5IGD A;  1I6H H;  3NQT A;  2VQF L;  5IT9 L;  2N55 A;  3HG9 A;  2B2W C;  3BZC A;  2XTI A;  3GTK H;  3S1M H;  4QGU A;  4A3J B;  1BUV T;  2EPB A;  3BU2 A;  2MO1 A;  3I4M G;  1VQE A;  2B2W A;  4Y7N B;  1C0A A;  1CHP D;  1MBY A;  3UDG A;  3GQB A;  2F0S A;  5M5X B;  2JN4 A;  1TU2 B;  4B3M L;  4OO1 H;  4FF3 A;  2PW5 A;  3KLW A;  3Q8D A;  4IFD J;  2JE6 I;  4KHP Q;  1I4Q A;  4FXD A;  1PZK D;  1SJH D;  2L15 A;  1VCI A;  3OOC A;  1VQJ A;  4P75 A;  2MFI A;  3D4W A;  2JA6 H;  3CCJ A;  2JA5 G;  2UU9 L;  2WAC A;  1PRT C;  1EFI D;  2K1B A;  5HY6 A;  3ITP A;  1I6V C;  1N33 Q;  4BA2 I;  1FJG Q;  2N78 A;  3J7A F;  3A7A B;  4IUP A;  2VQF Q;  1EFW A;  1AE3 A;  3J7A V;  3MVV A;  2K6A A;  3KF6 B;  2QIL A;  1O7Z A;  1SRO A;  1CI3 M;  4AQY L;  3HKZ B;  1FL0 A;  3ND9 A;  3JAM E;  5KNB A;  3SXH A;  4ZAI A;  2ASB A;  2VQE L;  2Q8T A;  2EE1 A;  5E4W C;  4B3T L;  3H09 A;  1E2V A;  2K5H A;  4IOC A;  1Q1E A;  3J7Z C;  1TKW B;  4A3E B;  1IKL A;  1VQF A;  1SNO A;  4AH6 A;  3T1Y L;  2CFM A;  3D6C A;  3DUZ A;  2K52 A;  1NJI C;  4V19 0;  4BY7 B;  1PFS A;  1LTS D;  2E75 C;  2R7D A;  3I2Z A;  4JBJ A;  1B4O A;  1OXX K;  1BCP F;  2YTX A;  1FGU A;  1SE2 A;  3L3O C;  2UU9 Q;  4DNR B;  2EXD A;  4UPA A;  4FP5 D;  4DV7 L;  3ULP A;  1VQL A;  2SOB A;  3PIP A;  2FHT A;  1RHP A;  2B8G A;  1MHW C;  3JAM i;  2HT1 A;  1K3R A;  4H13 C;  3IFT A;  4AQY Q;  3OPO A;  2F0I A;  1ILQ A;  1HXY D;  2JA7 G;  4LF6 Q;  1V1P B;  1YNX A;  4LF8 L;  2XVS A;  4G7H C;  2VQE Q;  4DR6 Q;  4QQB X;  1Y8P B;  4FXG C;  3W1G A;  1H9M A;  4R4C A;  4DV6 Q;  1GUG A;  2Q2I A;  2NB0 A;  2PZU A;  4L5T A;  2F0L A;  1GHK A;  1Q46 A;  3CXC A;  1NBW A;  4JC0 A;  3I4O A;  1Z9F A;  4MN3 A;  3T13 A;  2E2H B;  3TME A;  4WJW A;  5EKK A;  4PQX A;  2UXB L;  2E2I H;  4J8Q A;  4HMI A;  1J6Q A;  2JA6 G;  3MFY A;  2EY6 A;  1XPR A;  1HRJ A;  1B53 A;  2EIF A;  4X3U A;  4X64 Q;  1U0L A;  4IN3 A;  4DV7 Q;  5C3X A;  1HNW L;  4BY1 B;  3A8I E;  5JJK A;  1NSN S;  1WFQ A;  4NDX A;  4K0K L;  4KKU A;  3I55 A;  5JEA J;  3PF4 A;  2PI2 E;  1KLU D;  1TY0 A;  3CKI B;  4JYA Q;  1PTO D;  2XWJ B;  2IT1 A;  2LXK A;  4QB4 A;  4F8M A;  5L37 A;  1G2T A;  4FNF A;  5CR3 A;  1BQQ T;  1YJW A;  4K6L A;  2EYH A;  5EGT A;  1LT6 D;  3UDX A;  2BE5 D;  3HKZ E;  2IY5 B;  2Z1C A;  2UXB Q;  1K8M A;  4HCE A;  3Q24 A;  3S1N H;  4R8N A;  5TSS A;  3S14 H;  2KEE A;  2I5H A;  1RTN A;  3G4S A;  1HA5 A;  3V2T A;  1V8Q A;  5I6Y A;  3UI2 A;  1IKM A;  2DNC A;  1TWH B;  1XX8 A;  3GV3 A;  4TSS A;  1Q8I A;  5LHY 1;  2UUC Q;  2KHI A;  2OQ0 A;  2ZTE A;  4IAL A;  4L5R C;  3PO3 H;  4A93 B;  2D2C C;  2DUD A;  3ZJY C;  4DN4 M;  3DM1 A;  2E2J H;  2CH4 W;  2AUJ D;  1SRU A;  1Y1W B;  1XTD A;  2AQ1 B;  3SDZ A;  3MEF A;  1SND A;  1HPC A;  3PUZ A;  1IYV A;  3E9H A;  4OWX B;  4NW2 A;  4XQQ A;  4C56 C;  3NEN A;  2A8V A;  1KRS A;  5H1S E;  2RHS B;  3KLS A;  2EYF A;  1N34 L;  5C4X B;  1SYC A;  1KRT A;  1Y1V B;  1I50 H;  4PMW A;  1RL2 A;  1X32 A;  3TDQ A;  3CQZ B;  1E1O A;  4K6D A;  2F0W A;  2VB3 X;  1NE3 A;  1B44 D;  1Z6H A;  4HIK A;  1H9K A;  4ILW A;  5IYD H;  4NP5 A;  2L55 A;  4A3M B;  3CPW A;  4V0B A;  4P74 A;  1ET6 A;  1TWA B;  3NHH A;  3J7A 5;  3NSW A;  3H3V H;  4A3L H;  4EGV A;  1FVI A;  5DEH A;  2PMZ E;  1O7L A;  1PTO C;  4RHS A;  1YNJ C;  2EXZ A;  1SSO A;  1STH A;  4PMB A;  2ZJP A;  1YVC A;  3QO2 A;  4NMZ A;  3UDF A;  2E76 C;  3J81 c;  3F2C A;  4KY5 A;  3CCS A;  1QZG A;  1WVL A;  1ZEQ X;  1STA A;  4DFA A;  2NN6 G;  2B3G A;  5EQ0 A;  4YY3 L;  1ZXT A;  5J1Z A;  2A19 A;  2MGS A;  3CCU A;  3HOY H;  1IXR A;  3I56 A;  1XMQ L;  4DR2 L;  2B63 B;  3D0F A;  4A3I G;  2B2Y C;  2YU9 H;  1JCK B;  4GKK Q;  3IAY A;  2I5L X;  2P5Z X;  4XT3 B;  4CJ2 C;  3NEL A;  3X3M A;  3PO3 G;  4J1M A;  2F0T A;  1X3P A;  2B2Y A;  5IE8 A;  5J3B A;  3BG3 A;  4JOI C;  2HIV A;  4CDF C;  1PLF A;  3FKI G;  2EYO A;  4O42 A;  4DKA C;  2KHJ A;  2AQ3 B;  5FK9 C;  4NXM Q;  4JOI A;  4RFB A;  3I4M B;  3EJI A;  3Q0A A;  1JE5 A;  4AYB G;  1JOQ A;  1BCP D;  1SMX A;  2XGT A;  5IWA L;  3L2P A;  4A3C G;  1SXT A;  2D5D A;  4IFD I;  3S16 B;  1KDB A;  2Z6K C;  4A3G H;  2NVQ B;  3HP3 A;  4ME3 A;  2IL8 A;  3SGI A;  1LTA D;  4DXG A;  2IHF A;  1BVS A;  3T16 A;  1WOC A;  3M4Y A;  5IYD G;  1MKH A;  4JK1 C;  3S24 A;  3K0X A;  3J80 c;  3VYU A;  3MA2 B;  2F0Q A;  3PO2 H;  5CV9 A;  4F87 A;  5BN4 A;  3VA7 A;  2Q2H A;  1WD1 A;  1VQ4 A;  2PO4 A;  1G51 A;  3M4O B;  1CUK A;  3OMG A;  1CK1 A;  4TQU S;  1VQ8 A;  2FFK B;  2QA4 A;  1XJV A;  4B3R Q;  1X55 A;  2WB1 E;  2UXD L;  2VY3 A;  1CKN A;  1O7I A;  1PH9 A;  4IOA A;  2BDN A;  3NBH B;  1PFN A;  3W5O A;  1ENF A;  1KNE A;  3RLF A;  3MC0 B;  1W2B A;  1W3S A;  1KAW A;  4RGO S;  4GOP B;  2F3V A;  2LMC B;  1ZYR C;  3M7G A;  5FO7 B;  2IHE A;  1PH7 A;  1LT4 D;  4KY7 A;  4JBK A;  3A54 A;  2JA8 H;  1G6Z A;  1WTR A;  4XYQ A;  1XNR Q;  1TWF B;  3TZD A;  1IZ6 A;  4L5Q A;  4ZCK A;  5M5Y B;  3M3Y B;  2RQX A;  2JEB I;  3HS0 C;  1E24 A;  1JJC B;  4GLV B;  2JEA I;  3MXG A;  2OTJ A;  2Z8L A;  1NY4 A;  4JV5 L;  3C1F A;  1EQT A;  4EQ5 A;  1F2L A;  3E9I A;  1BCP C;  1KAA A;  4C3H G;  1DYQ A;  4EQN A;  2JA7 B;  1IBM L;  4RCN A;  3QR8 A;  1D6E C;  3RN5 A;  4CDC C;  1MJC A;  1X6O A;  2D0O A;  2R7Z G;  4KY6 A;  2SNS A;  3KF8 B;  1N36 L;  1GUO A;  1ENC A;  2ZJR A;  2N8N A;  3RLO A;  1PFM A;  5GQO A;  2RKS A;  3ERQ A;  1SNP A;  3A8J E;  3ZYY X;  4Y52 H;  3S15 B;  2F0F A;  4A3B H;  3L9A X;  3HOW G;  1ZKO A;  2A6E C;  2IJ0 A;  3WOE A;  1HQR D;  1VQ9 A;  3KFU A;  2WKD A;  3CRK C;  3A56 A;  1AEX A;  1JWS D;  1H9S A;  4WOR A;  1ML0 D;  1EWC A;  3WDN A;  3PUW A;  3PIP 3;  4LF7 L;  2HUG A;  1X56 A;  1QUQ B;  1VQ5 A;  4C3I G;  2ES2 A;  5DM6 3;  3OSO A;  4K2K A;  4RWS C;  4X65 L;  1EY4 A;  3A0J A;  3STB C;  4LUZ A;  1STN A;  1RD9 D;  2Y0S E;  2ZXP A;  4KD4 A;  5CV4 A;  5JAV A;  1GM5 A;  4DA2 A;  5K36 H;  3CRL C;  1A62 A;  3M4P A;  1N36 Q;  4BA1 I;  1T5E A;  5AJ3 L;  3BDO A;  2JSO A;  3Q22 A;  1E0B A;  1QG7 A;  3FDT A;  2SEB D;  3R93 A;  1YEZ A;  3GTL B;  3NP8 A;  2EZV A;  2L9H A;  2PCF B;  1PZJ D;  1HTL D;  2FXQ A;  4ZUJ A;  1KXL A;  3GV6 A;  2CWP A;  2F4I A;  2AHO B;  1KHI A;  5LMU L;  3CCM A;  3DEO A;  1HZ9 A;  3S1Q H;  3GTG H;  4H02 A;  3P20 A;  2NZ1 D;  4ODG A;  3I70 A;  3P1H A;  3Q23 A;  4KJN A;  4X65 Q;  1I4G A;  4Q5V A;  2B2T C;  1WYD A;  2EJG C;  1QVG A;  3GTQ H;  1WTO A;  3H6M A;  2DY8 A;  3VA5 A;  3NK9 A;  1SE4 A;  5BN3 A;  4GLA C;  4DV5 L;  3IKJ A;  1EY0 A;  5A2Q L;  3GTM H;  4RA8 A;  3I7F A;  1I4X A;  4ABN A;  1HZB A;  2Q2U A;  3K7U C;  2O2L D;  3HOV H;  1E2W A;  1EIF A;  4OO1 I;  2E2I B;  1WTH A;  5CV7 A;  4YCW A;  1T9H A;  1I3Q H;  3K6O A;  3K7A H;  4HJ5 A;  1GVP A;  3R3O A;  5LMU Q;  1GKH A;  3EIV A;  4KD3 A;  2ID0 A;  1EY6 A;  4YHH L;  4GNX B;  3NWT A;  1YZ6 A;  4DR7 L;  3H0G B;  4QY7 A;  3RD4 A;  2EQS A;  3NQI A;  4ULL A;  3E3X A;  5K36 G;  5KND A;  1L0Y B;  1SE8 A;  1LT3 D;  4B08 A;  5DLQ E;  4DV5 Q;  5E3F A;  2ZT9 C;  2OWO A;  1S5D D;  4LF4 L;  1BKB A;  4QF4 A;  5FOB B;  1KLG D;  3CCV A;  3DWP A;  1JOK A;  2Q8R E;  4A3I B;  1DXM A;  2J0T D;  1EYC A;  3J7Y W;  3E6Z X;  2BH2 A;  1TS4 A;  3QB3 A;  1HNX L;  1EY9 A;  3GD7 A;  3N52 A;  3HRZ C;  2JQO A;  2UUA Q;  4UP7 A;  3HOX H;  3S17 B;  5ELO A;  2RSN A;  1SAP A;  3KLS X;  2FIN B;  4A3F G;  1DGS A;  1FNU A;  1WCM G;  2PI2 A;  3IFD A;  4OL7 A;  5C5L A;  2E2J B;  4DR7 Q;  1A3U A;  4X3K A;  4BBS H;  2DGY A;  3FKI B;  4O2D A;  1I4H A;  4R4O A;  4CKC A;  5FLX E;  2KOL A;  1QIL A;  1YNN D;  3KF6 A;  3ONA B;  2H4O A;  3OW2 A;  2F0K A;  3GTJ H;  1K3B C;  1SFO B;  3NTK A;  4AYB B;  4LF4 Q;  3PUY A;  4PZ6 A;  2G9D A;  1A15 A;  1KDA A;  5KRU A;  1LTG D;  1HUM A;  1JE4 A;  3K5N A;  3HOV G;  1Z47 A;  2KVM A;  2RA4 A;  1HNX Q;  3URY A;  4RGM A;  1FJG L;  1HH2 P;  2K50 A;  2KUM A;  1D2B A;  2NVY B;  4K5W A;  1E3P A;  2PZT A;  5E4X A;  3JC6 6;  2UXC Q;  2F0E A;  1BDO A;  1PDQ A;  2LY7 A;  3I4N H;  1G2S A;  3NWS A;  5BR8 L;  4B9W A;  3FP9 A;  5C44 H;  1PYW D;  1L0W A;  1BR9 A;  1X3Q A;  2KCN A;  1S5B D;  4GS3 A;  4JI4 Q;  2WAQ G;  3LGJ A;  1K83 B;  5I2Y A;  1V1P A;  4UAI A;  2VW9 A;  4JI3 Q;  2KCM A;  1EU4 A;  2YTV A;  2GVB A;  3R2T A;  1LTR D;  1Q12 A;  4KKT A;  1NMG A;  2NN6 I;  1TII D;  2NUC A;  3I90 A;  2A74 C;  3QOJ A;  2L4N A;  4EVO A;  1OO9 B;  2K03 A;  3AFQ A;  3D31 A;  1HQM C;  1KNA A;  5JEA G;  4QCL A;  2F1M A;  1PH2 A;  1EEF D;  2KJX A;  5M3M B;  4TVA B;  1L1O B;  1JQY D;  3J81 L;  4LF6 L;  2NTS A;  1B3A A;  1YJN A;  3I4L A;  3K5L A;  3SK8 A;  3QG1 A;  5BR8 Q;  3EN2 A;  4DR6 L;  4A3D H;  4EQP A;  1X3G A;  2K14 A;  2CHB D;  5M3F G;  4C3H B;  2OXP A;  4DV6 L;  5JJZ A;  1KTK A;  1UE7 A;  3KLR A;  1PH8 A;  4FF2 A;  3S1R H;  4HED A;  4U68 A;  2R7Z B;  2X6L A;  4C3J H;  3LX0 A;  3HOU H;  4KJO A;  3AFP A;  3VDY A;  1B8A A;  4JBW A;  4X3S A;  2NVT B;  1NR2 A;  4ALP A;  2CH4 A;  1S3O A;  3RZO B;  2PQE A;  5IYC H;  4JI0 Q;  2OCE A;  5C4J H;  4X64 L;  1TWG H;  4DV0 Q;  3HOW B;  5GRO A;  1MGS A;  2B39 A;  1YIJ A;  2RSO A;  4FF1 A;  1B9M A;  4HIO A;  4I65 A;  4OX9 L;  2WKC A;  4DAP A;  4KTA A;  3GO5 A;  3CPF A;  1TT2 A;  3CC2 A;  2R7F A;  1QZH A;  4A75 A;  1HUN A;  1V43 A;  3D8G A;  3I4N G;  4C3I B;  4JYA L;  1DOL A;  3AYH B;  2K4K A;  2A68 D;  3H3V I;  3KOJ A;  3S9W A;  1WTX A;  1A63 A;  1VQP A;  1IBK Q;  4GKJ Q;  4OO1 G;  5J39 A;  4CDD C;  1NCV A;  2QEX A;  1BXT A;  4K5V A;  3S2H B;  3K0Y A;  5IT9 E;  3DEP A;  1SE3 A;  3KJP A;  1MSG A;  3K57 A;  1VF7 A;  4OGQ C;  4OHJ A;  2R92 H;  3NBI A;  3VR2 A;  3J80 L;  4P73 A;  5M5W H;  2UUC L;  1C9O A;  4G57 A;  2AQ2 B;  3I73 A;  3K59 A;  3UE1 A;  1M4V A;  2R93 H;  1QE6 A;  1V9P A;  4OX9 Q;  4Q0F A;  4XT1 B;  3VR4 A;  1RKN A;  1VQ7 A;  1CKM A;  1IHZ A;  2F3I A;  4CKE A;  1H9J A;  1SNC A;  1A6X A;  3R2I A;  5CMD A;  2BDO A;  1K8G A;  3UE0 A;  1EY5 A;  2DNE A;  5NUC A;  2Z9H A;  3I72 A;  1LV9 A;  1SNM A;  2VXW A;  2XWB B;  4OIK A;  1OXV A;  1GD7 A;  2HDM A;  4PV1 C;  3AQQ A;  1UEA B;  1JOR A;  3W3A A;  3OYY A;  1R9T B;  1NAP A;  4PMC A;  1EYD A;  4IUQ A;  3HOU G;  2IX0 A;  1EU3 A;  3CCR A;  5IY0 A;  4IPG A;  4KHV A;  3D3R A;  4DR1 Q;  4IUU A;  5JPN C;  3RZD B;  2VUM B;  1F2Z A;  4IPC A;  2AMC B;  4A4I A;  1OXS C;  4OWW B;  3IRB A;  1JIC A;  5CV5 A;  1QNU A;  3VR5 A;  1EQR A;  2E74 C;  1JOO A;  2A68 C;  2AWO A;  4QIW B;  1TS3 A;  5CYU A;  3BS1 A;  4RMF A;  4DAY B;  4PZ7 A;  3BVG A;  4N8F A;  3PMF A;  3BZD B;  2I46 A;  2NVX H;  5KYL A;  1RIP A;  4UHV A;  4CDE C;  2MP1 A;  2O4X A;  1ICW A;  3P7J A;  4DF7 A;  5I9P A;  1U4P A;  1GUS A;  2D0P A;  2D62 A;  4KV6 A;  1UWV A;  3CHB D;  1A3T A;  4GKK L;  1IL2 A;  3MXU A;  2X6G A;  4ZK9 B;  4A3K H;  1CT1 D;  3G48 A;  1ASZ A;  1VQA A;  2R93 G;  1B1Z A;  1Y8N B;  1H9R A;  4DV4 Q;  3VR3 A;  5C3E H;  1HHV A;  3MEH A;  1Y14 B;  2BE5 C;  3H91 A;  3U4V A;  4A3F B;  3SE0 A;  1WCM B;  4KI0 A;  4NXM L;  3RLN A;  2G9H D;  4IUN A;  3CU7 A;  3M4Q A;  1PV4 A;  1MI2 A;  4A3J H;  1PH5 A;  1ASY A;  3GTQ B;  1EIY B;  1D7Q A;  1CHQ D;  2XN9 C;  4RH6 A;  3TN2 A;  2YYZ A;  1WTW A;  3MXP A;  3F2D A;  4Y7N H;  3D4D A;  1IYJ B;  2JYO A;  3C1E A;  1B70 B;  2F0H A;  2SNM A;  3AB9 A;  5ISR A;  4GOP C;  1LAC A;  4DXF A;  3NBH A;  3HOV B;  3CCE A;  4OWT B;  2M00 A;  3GTO B;  1LTB D;  5KGU A;  3LWE A;  5D3D A;  4GOP A;  4XYO A;  4ZLT F;  4M8A A;  4DV2 L;  3GTP H;  1EIG A;  4MTN A;  5I9O A;  1TXY A;  1YBY A;  2IWH A;  5KEE A;  1AW7 A;  2B2V C;  1M90 C;  3GP7 A;  4B3R L;  4MZ9 A;  1ONL A;  1RCV D;  5C0X H;  1LUZ A;  4YWM A;  2CW0 D;  3KBX A;  2RBM A;  1TS5 A;  2JJQ A;  2WAQ B;  3D6W A;  3G6J B;  3CAM A;  3U9O A;  1D1I A;  3CW2 C;  4O1N A;  2WII B;  4YWL A;  2TSS A;  5DM7 3;  4A3E H;  1SBB B;  4X6A H;  4EX5 A;  1LLR D;  2K04 A;  3KF8 A;  2JA5 B;  2FMM A;  4BY7 H;  5C6A A;  4JG2 A;  2Z6K A;  4XQJ A;  5JVH 3;  1KAB A;  1XNR L;  4A3L G;  3SK5 A;  4A3K G;  1GJX A;  3BYY B;  4NXN Q;  4L6T B;  2L12 A;  3TS0 A;  4DV2 Q;  5EAY A;  2K5N A;  4JVZ A;  2KEN A;  5EBD A;  1D8L A;  4BXX H;  1EY7 A;  3OHX C;  1TS2 A;  3MAQ A;  4C2M B;  1SN8 A;  3MTS A;  1RJT A;  2C35 B;  1CA6 A;  3PUX A;  4TKO B;  1PFB A;  5M3F B;  2K28 A;  1TQO A;  3HOY G;  3CP0 A;  1A2T A;  1HZA A;  4FF4 A;  3M85 A;  2RVL A;  2BA0 A;  1Q8K A;  3PIO A;  2A1A A;  3EFX D;  4KK7 A;  5CBE E;  1PRT F;  4QL5 A;  3ICE A;  1PYB A;  1KDC A;  2ZXR A;  4CGY B;  2PQA B;  1LT5 D;  4LJZ C;  1SNQ A;  4HMJ A;  1OTC A;  5JJL A;  2CVR A;  1EQQ A;  1K0S A;  3N6R A;  3F1Z A;  1GO3 E;  4R1J A;  1I6H B;  1CQV A;  1FGB D;  3TP5 A;  1PH6 A;  1KC8 C;  5JJI A;  3A74 A;  5EBC A;  3FHW A;  1VQM A;  1F2Y A;  3GTK B;  3S1M B;  2EDG A;  2CQO A;  3RNU A;  2FMC A;  2ZTD A;  3LNN A;  4F88 A;  1QNK A;  3CME A;  4LMQ D;  3OIP A;  1FNV A;  2BCO A;  4FVM A;  5IOD A;  3T1H Q;  1DON A;  3FMC A;  5C0X G;  1JJ2 A;  3HKZ G;  1IL8 A;  3AU7 A;  5IYB H;  1JR0 D;  5IIF A;  3U9S A;  1GUN A;  4XIG S;  4A3G G;  3B6Y A;  4RAU C;  2MUY A;  4JI7 Q;  5EKL A;  2XSC A;  2JA6 B;  4DK0 A;  2OTL A;  4FO2 A;  4BY7 G;  2QF7 A;  1CA5 A;  1HNZ Q;  4FXK C;  2E5L Q;  5J22 A;  1LTL A;  2KCT A;  4LUV A;  3PO2 G;  4HR7 B;  4MIU A;  1R4P B;  1Z7T A;  4O0A A;  2K01 A;  4DR3 L;  1TWH H;  3ND8 A;  2HHH Q;  4CBV A;  5IP7 H;  4GNX C;  1U9R A;  1SMY D;  1A3V A;  4HTH A;  4BXX G;  2N49 A;  1U5K A;  5COR A;  1G91 A;  4A93 H;  2JA9 A; 
#chains in the Genus database with same CATH homology
 1C48 A;  1BOS A;  1R4Q B;  1DM0 B;  3QJY A;  4K5X A;  2K5D A;  3AMU A;  2X69 A;  1FD7 D;  3OWE B;  5CBA E;  4MHE A;  3QWN A;  1STE A;  3ERO A;  2F0P A;  4XDX A;  1DD2 A;  1TWG B;  4WRD A;  3KUP A;  1HA6 A;  2EYP A;  3NPP A;  4KMU C;  2JXM B;  5IGB A;  4P2C B;  1ESF A;  3DWA A;  3O13 A;  3KBG A;  3NTI A;  4L63 B;  1AZQ A;  2B2T A;  1EIH A;  1F9S A;  1DOK A;  5I4D A;  1ESR A;  1EEI D;  5HUR A;  5C0X J;  2QCP X;  1Y8O B;  4HCS A;  3MZ5 A;  3TP7 A;  5D65 A;  4OIJ A;  3H94 A;  5M5W B;  2JP1 A;  4KN4 C;  2PZW A;  2Q8I B;  1CTM A;  5JVG 3;  2R93 B;  3OMC A;  4XXE A;  4XQN A;  2WV6 D;  5I6W A;  1RDP D;  4ZKB B;  3A55 A;  1SJE D;  3TZU A;  2R3Z A;  3C2P A;  1Q1B A;  3HEJ A;  1GUT A;  1D5Z C;  2HCC A;  4C1N K;  2B8F A;  1EY8 A;  3S1N B;  3S14 B;  4QMG A;  5FKA C;  5JOB A;  3OIQ A;  5G3L F;  3SVM A;  1UAP A;  2F0G A;  2WP8 J;  5M9O A;  2QKI C;  1DOM A;  1G8Z D;  3PO3 B;  3JAM L;  1JB3 A;  1B9N A;  1EWH A;  1PTO H;  1HTP A;  5EKI A;  1DJR D;  5KYI A;  3EQL C;  4DNT B;  1PRT D;  3IL8 A;  3FRP B;  2F0D A;  1I50 B;  2Z4I A;  2E2D C;  1VDZ A;  2F0O A;  2ICI A;  3D4R A;  1UUP A;  1QB5 D;  1ET9 A;  5CGK A;  2Z4H A;  5ELD A;  2F0N A;  4HAE A;  1OXT A;  3BVM A;  2WIN B;  4A3K B;  3SR1 A;  5A2Q E;  4QUC A;  4DK1 A;  2I07 B;  1AZP A;  1CZG A;  1OXU A;  1S4Z A;  2F0V A;  1CQF A;  1LTI D;  1F9P A;  3DHQ A;  1FYC A;  1F2M A;  1SYE A;  1RTO A;  2KED A;  3HOY B;  1ENA A;  1F77 A;  4G4K A;  3I8Z A;  1TY2 A;  3V96 A;  5IGF A;  5ELE A;  4IQZ A;  3X3N A;  2LS0 1;  1XYI A;  2YU9 B;  2K7V A;  3OW7 A;  1F9R A;  1T5X D;  1YNN C;  5T1G A;  2A6H D;  3T51 B;  2A69 D;  4IZ8 A;  1WTV A;  3DWQ A;  1IW7 D;  1EOT A;  4IUT A;  3K5M A;  4N9T A;  1MD2 D;  3GTP B;  4EQO A;  4ME5 A;  2A5H A;  1C8C A;  1EYA A;  1HFG A;  1GUW A;  1WTP A;  4S3S A;  2NYZ D;  1SYB A;  5I2X A;  2EJF C;  3MFG A;  2IX3 A;  2AWN A;  2KHS A;  4R9W A;  3PIO 3;  5IOC A;  4A3G B;  2XRS D;  3T53 B;  1II3 A;  5LL6 X;  5CC4 A;  3K58 A;  4ZKC B;  1O7Y A;  5KNC A;  5A35 A;  4H0L C;  3PO2 B;  3C46 A;  5BN5 A;  2EJM A;  2XNA C;  3I3C A;  1O78 A;  1TR5 A;  2EOT A;  2N88 A;  5EPJ A;  4RKL A;  2KCC A;  1EQV A;  4KKS A;  2F0J A;  4DAY A;  4U67 3;  2C5C A;  2KEC A;  2K5W A;  5LL6 S;  2K32 A;  1AFP A;  2PW7 A;  5AFW A;  2A6H C;  2A69 C;  4DGZ A;  2F03 A;  1XWE A;  2JA8 B;  1IW7 C;  3MHB A;  2HQE A;  1G29 1;  2LKV A;  4BS9 A;  2PMZ B;  2L0C A;  3NTH A;  1PRT B;  5C4H A;  5DNF A;  4IUV A;  2J4X A;  4TRD A;  4B9X A;  3E0J A;  4J6H A;  1D5X C;  4K2L A;  3MWY W;  4C3J G;  1XXG A;  3NXW A;  2OT2 A;  5IGE A;  2M9V A;  1ROD A;  3J81 E;  5G3L D;  3BVZ A;  5D3I B;  2LFN A;  5C0X I;  2NN6 H;  3FPU B;  1YNJ D;  4A3B B;  3DXJ C;  2MHV A;  2F3W A;  2ENB A;  4PNY A;  2FJ2 A;  2F0M A;  1C4Q A;  2VB2 X;  3KK7 A;  1W6J A;  2V4D A;  2EY1 A;  1DCZ A;  4DAV A;  2EYM A;  1QWY A;  3FPP A;  2XIW A;  5ELB A;  1SYD A;  1I4P A;  5CV6 A;  1LTT D;  2NTT A;  4ZRZ A;  3A7L A;  1BO0 A;  4HN7 A;  4KN7 C;  3VYS A;  5D14 A;  1XTC D;  4F7X A;  3VYT A;  2MJ8 A;  4I7Z C;  3GTG B;  3S1Q B;  1D5M C;  3PUV A;  1JWM D;  5K5P A;  5E1F A;  1Q3L A;  2IX1 A;  4ZUI A;  1Y69 U;  3SEB A;  2A73 B;  3J80 E;  5C3W A;  1W6K A;  2SDF A;  3EA6 A;  2WB1 B;  4Z9C B;  1STY A;  4IUR A;  2R61 A;  4H7B A;  1FNW A;  1J9O A;  1LAB A;  2QDB A;  3GTM B;  1I4R A;  3G7L A;  1HCZ A;  1WD0 A;  1TVX A;  1I3Q B;  3K7A B;  3S2D B;  2K5Q A;  1VMC A;  1BF4 A;  3HGB A;  4RKB A;  4G7Z C;  4UDU C;  3K5O A;  1ZYR D;  3NE5 B;  1B2T A;  2B2V A;  2K33 A;  1GOZ A;  1QJO A;  2NWG A;  5ELC A;  3BDC A;  3PV0 A;  2GA4 B;  2ICE C;  3FVQ A;  2RDF A;  3TSS A;  5JPM C;  1S5C D;  1ILP A;  3LWU A;  3HOX B;  4LK1 C;  1NR4 A;  3T56 B;  3SK4 A;  4BBS B;  5C5M A;  2Y0S B;  1PTO B;  2PPB C;  2A6E D;  3GTJ B;  1MSH A;  5KIX A;  2R6G A;  4GZY C;  3E5S A;  2O5J C;  1S5E D;  2L1B A;  1GHJ A;  1QOH A;  2IPK D;  3Q6S A;  3RMH A;  2C9O A;  5CV8 A;  3QOL A;  4C1N I;  1VMP A;  4N9P A;  2L5T A;  2HCI A;  2CW0 C;  3I4N B;  4RCO A;  4M1U B;  2TMP A;  5C44 B;  1NUC A;  4RGT A;  2XRQ D;  1U4L A;  4L8J A;  1L0X B;  2ZXO A;  1EL0 A;  2F0U A;  2B2U C;  3EVQ A;  2K05 A;  5ELF A;  5C4Z A;  2EY5 A;  4K8J A;  1Q90 A;  4HSP A;  3MXN A;  2B2U A;  4ID6 A;  4BWG B;  1S5F D;  2J7Z A;  1A2U A;  1SYG A;  1JWU D;  5EPL A;  4X3T A;  1QCB D;  2EVB A;  2QEJ C;  3A8K E;  3I91 A;  1CM9 A;  4A3D B;  1SDF A;  1U4R A;  1SEB D;  3TP6 A;  3S1R B;  3V05 A;  4C3J B;  1STG A;  1CFM A;  4IFD H;  3HOU B;  1SYF A;  1WTQ A;  3R8B A;  1VF5 C;  1J8I A;  5C4J B;  4RGN A;  3M7N A;  1F9Q A;  3OWF A;  3TBI B;  5FLX L;  3BYT B;  1V1O A;  4RHR A;  2CQA A;  1UNS A;  3HZX A;  1D1K A;  2PNR C;  2AUK A;  4K8I A;  2O5I C;  2D9U A;  1BCP B;  2DN8 A;  1STB A;  4CKB A;  2OEO A;  4E6I A;  4HSV A;  3TP8 A;  4QUF A;  1PXU A;  5FO9 B;  2NBF A;  3F2U A;  2R92 B;  4CJ0 B;  2OF1 A;  1SMY C;  4BBR B;  4H44 C;  2BA1 A;  1H9S B;  5EJW A;  2KQ3 A;  5IGG A;  3H3V C;  4ZYS A;  5EPK A;  3WOF A;  4CHT B;  4K14 A;  4NKL A;  3P75 A;  4KHZ A;  1AP0 A;  3NUC A;  2IW3 A;  1GXD C;  3C3L A;  4IFD G;  1PMR A;  2PYK A;  3L7Z C;  4YIJ A;  1M8A A;  5F2D A;  3QIA A;  1RF2 D;  1E2Z A;  2HDL A;  5FO8 B;  1AN8 A;  1LO5 D;  4R8I A;  1JC7 A;  1PTO F;  3BDL A;  1FR3 A;  3SHL A;  2H1E A;  1DZ1 A;  2KA7 A;  4LAA A;  5JEA H;  2EY2 A;  1K8O A;  4WFN 3;  1BNZ A;  2NVX B;  4DU9 A;  1O80 A;  4G7O C;  4ZQ3 A;  4XTC S;  5HGT A;  2M2L A;  2VNU D;  1B50 A;  5T1I A;  1TWC B;  3DMU A;  1U4M A;  3T4A C;  2RDH A;  1HFN A;  2EYL A;  2RDG A;  5COY A;  1BBX C;  1IYU A;  3SK6 A;  5DAU A;  3W2D A;  4CJ1 B;  2EYJ A;  1EZ8 A;  1EZ6 A;  4FYD A;  1PZI D;  3VYR A;  5C3E B;  3VR6 A;  2L11 A;  2MPM A;  1CZW A;  2BOS A;  3HOZ B;  3FEW X;  2DY7 A;  3RUZ A;  5IGC A;  5IGD A;  3NQT A;  5IT9 L;  2N55 A;  3HG9 A;  2B2W C;  4A3J B;  1BUV T;  2EPB A;  2B2W A;  4Y7N B;  1CHP D;  1MBY A;  3GQB A;  2F0S A;  5M5X B;  4OO1 H;  1TU2 B;  4FF3 A;  2PW5 A;  4IFD J;  2JE6 I;  1I4Q A;  4FXD A;  1PZK D;  1SJH D;  1VCI A;  3OOC A;  3D4W A;  2WAC A;  1PRT C;  1EFI D;  2K1B A;  3ITP A;  1I6V C;  4BA2 I;  3J7A F;  3A7A B;  4IUP A;  3J7A V;  3MVV A;  2K6A A;  2QIL A;  1O7Z A;  1CI3 M;  3HKZ B;  3ND9 A;  3JAM E;  5KNB A;  3SXH A;  4ZAI A;  2Q8T A;  2EE1 A;  5E4W C;  3H09 A;  1E2V A;  1Q1E A;  1TKW B;  4A3E B;  1IKL A;  1SNO A;  3D6C A;  3DUZ A;  4V19 0;  4BY7 B;  1LTS D;  2E75 C;  1B4O A;  1OXX K;  1BCP F;  1SE2 A;  3L3O C;  4DNR B;  4FP5 D;  2SOB A;  2FHT A;  1RHP A;  2B8G A;  4H13 C;  3IFT A;  3OPO A;  2F0I A;  1ILQ A;  1HXY D;  1V1P B;  2XVS A;  4G7H C;  1Y8P B;  4FXG C;  1H9M A;  1GUG A;  2NB0 A;  2PZU A;  2F0L A;  1GHK A;  4MN3 A;  3T13 A;  2E2H B;  3TME A;  4WJW A;  5EKK A;  4PQX A;  4J8Q A;  4HMI A;  3MFY A;  2EY6 A;  1HRJ A;  1B53 A;  4X3U A;  4IN3 A;  5C3X A;  4BY1 B;  3A8I E;  1NSN S;  4NDX A;  4KKU A;  5JEA J;  1KLU D;  1TY0 A;  3CKI B;  1PTO D;  2XWJ B;  2IT1 A;  4QB4 A;  4F8M A;  1G2T A;  4FNF A;  5CR3 A;  1BQQ T;  4K6L A;  2EYH A;  5EGT A;  1LT6 D;  2BE5 D;  2Z1C A;  1K8M A;  4HCE A;  3Q24 A;  4R8N A;  5TSS A;  2KEE A;  1RTN A;  1HA5 A;  3V2T A;  1V8Q A;  5I6Y A;  3UI2 A;  1IKM A;  2DNC A;  1TWH B;  1XX8 A;  3GV3 A;  4TSS A;  1Q8I A;  5LHY 1;  4IAL A;  4A93 B;  2D2C C;  4DN4 M;  3DM1 A;  2AUJ D;  1Y1W B;  2AQ1 B;  3SDZ A;  1SND A;  1HPC A;  3PUZ A;  1IYV A;  4NW2 A;  4XQQ A;  4C56 C;  3KLS A;  2EYF A;  5C4X B;  1SYC A;  1Y1V B;  4PMW A;  1X32 A;  3TDQ A;  3CQZ B;  4K6D A;  2F0W A;  2VB3 X;  1B44 D;  1Z6H A;  1H9K A;  4ILW A;  4NP5 A;  2L55 A;  4A3M B;  4V0B A;  1ET6 A;  1TWA B;  3NHH A;  3NSW A;  4EGV A;  5DEH A;  1PTO C;  1O7L A;  4RHS A;  1YNJ C;  2EXZ A;  1SSO A;  1STH A;  4PMB A;  3QO2 A;  4NMZ A;  2E76 C;  4KY5 A;  1WVL A;  1ZEQ X;  1STA A;  4DFA A;  2NN6 G;  5EQ0 A;  1ZXT A;  5J1Z A;  2MGS A;  2B63 B;  2B2Y C;  1JCK B;  3IAY A;  4XT3 B;  4CJ2 C;  3X3M A;  4J1M A;  2F0T A;  1X3P A;  2B2Y A;  3BG3 A;  1PLF A;  2EYO A;  4O42 A;  2AQ3 B;  5FK9 C;  4RFB A;  3I4M B;  3EJI A;  3Q0A A;  1JOQ A;  1BCP D;  1SXT A;  2D5D A;  4IFD I;  3S16 B;  1KDB A;  2NVQ B;  3HP3 A;  2IL8 A;  1LTA D;  4DXG A;  3T16 A;  3M4Y A;  4JK1 C;  3VYU A;  3MA2 B;  2F0Q A;  5CV9 A;  4F87 A;  5BN4 A;  3VA7 A;  1WD1 A;  2PO4 A;  3M4O B;  3OMG A;  1CK1 A;  4TQU S;  2FFK B;  2BDN A;  1PFN A;  1ENF A;  1KNE A;  3RLF A;  3MC0 B;  4RGO S;  2F3V A;  2LMC B;  1ZYR C;  3M7G A;  5FO7 B;  1LT4 D;  4KY7 A;  3A54 A;  1G6Z A;  1WTR A;  4XYQ A;  1TWF B;  3TZD A;  5M5Y B;  3M3Y B;  2RQX A;  2JEB I;  3HS0 C;  2JEA I;  3MXG A;  2Z8L A;  3C1F A;  1EQT A;  1F2L A;  1BCP C;  1KAA A;  4C3H G;  1DYQ A;  4EQN A;  2JA7 B;  4RCN A;  1D6E C;  4KY6 A;  2SNS A;  1GUO A;  1ENC A;  1PFM A;  2RKS A;  3ERQ A;  1SNP A;  3A8J E;  3ZYY X;  3S15 B;  2F0F A;  3L9A X;  1ZKO A;  2A6E C;  2IJ0 A;  3WOE A;  1HQR D;  2WKD A;  3CRK C;  3A56 A;  1AEX A;  1JWS D;  1H9S A;  4WOR A;  1ML0 D;  1EWC A;  3WDN A;  3PUW A;  3PIP 3;  2HUG A;  4C3I G;  5DM6 3;  3OSO A;  4K2K A;  4RWS C;  1EY4 A;  1STN A;  1RD9 D;  2ZXP A;  4KD4 A;  5JAV A;  5CV4 A;  5K36 H;  4DA2 A;  3CRL C;  4BA1 I;  1T5E A;  3BDO A;  2JSO A;  3Q22 A;  1E0B A;  1QG7 A;  3FDT A;  2SEB D;  3R93 A;  3GTL B;  3NP8 A;  2EZV A;  2L9H A;  2PCF B;  1PZJ D;  1HTL D;  4ZUJ A;  3GV6 A;  2F4I A;  3DEO A;  3P20 A;  2NZ1 D;  4ODG A;  3I70 A;  3P1H A;  3Q23 A;  4KJN A;  1I4G A;  4Q5V A;  2B2T C;  2EJG C;  1WTO A;  3H6M A;  2DY8 A;  3VA5 A;  3NK9 A;  1SE4 A;  5BN3 A;  3IKJ A;  1EY0 A;  5A2Q L;  4RA8 A;  1I4X A;  4ABN A;  2O2L D;  1E2W A;  4OO1 I;  2E2I B;  5CV7 A;  3K6O A;  3R3O A;  4KD3 A;  2ID0 A;  1EY6 A;  3NWT A;  3H0G B;  3RD4 A;  4ULL A;  3NQI A;  5K36 G;  5KND A;  1L0Y B;  1LT3 D;  4B08 A;  5E3F A;  2ZT9 C;  1S5D D;  4QF4 A;  5FOB B;  1KLG D;  3DWP A;  1JOK A;  2Q8R E;  4A3I B;  1DXM A;  2J0T D;  1EYC A;  3J7Y W;  3E6Z X;  1TS4 A;  3QB3 A;  1EY9 A;  3GD7 A;  3N52 A;  3HRZ C;  3S17 B;  2RSN A;  1SAP A;  3KLS X;  2FIN B;  1FNU A;  3IFD A;  5C5L A;  4OL7 A;  2E2J B;  1A3U A;  4X3K A;  3FKI B;  1I4H A;  4CKC A;  5FLX E;  2KOL A;  1QIL A;  1YNN D;  3ONA B;  2H4O A;  2F0K A;  1SFO B;  3NTK A;  4AYB B;  3PUY A;  2G9D A;  1A15 A;  1KDA A;  5KRU A;  1LTG D;  1HUM A;  1JE4 A;  3K5N A;  1Z47 A;  2KVM A;  2RA4 A;  3URY A;  4RGM A;  2KUM A;  1D2B A;  2NVY B;  4K5W A;  2PZT A;  5E4X A;  2F0E A;  1BDO A;  1PDQ A;  2LY7 A;  1G2S A;  3NWS A;  4B9W A;  1PYW D;  1BR9 A;  1X3Q A;  2KCN A;  1S5B D;  1K83 B;  5I2Y A;  1V1P A;  4UAI A;  1EU4 A;  3R2T A;  1LTR D;  1Q12 A;  4KKT A;  2NN6 I;  1TII D;  2NUC A;  3I90 A;  2A74 C;  2L4N A;  3QOJ A;  4EVO A;  1OO9 B;  2K03 A;  3D31 A;  1HQM C;  1KNA A;  5JEA G;  4QCL A;  2F1M A;  1EEF D;  2KJX A;  5M3M B;  1JQY D;  3J81 L;  2NTS A;  1B3A A;  3I4L A;  3K5L A;  3SK8 A;  3QG1 A;  4EQP A;  2CHB D;  4C3H B;  2OXP A;  5JJZ A;  1KTK A;  3KLR A;  4FF2 A;  4HED A;  4U68 A;  2R7Z B;  2X6L A;  3LX0 A;  4KJO A;  4JBW A;  4X3S A;  2NVT B;  1NR2 A;  3RZO B;  2PQE A;  3HOW B;  1MGS A;  2B39 A;  2RSO A;  4FF1 A;  1B9M A;  4I65 A;  2WKC A;  4DAP A;  4KTA A;  3GO5 A;  1TT2 A;  1HUN A;  1V43 A;  3D8G A;  4C3I B;  1DOL A;  2A68 D;  3S9W A;  1WTX A;  4OO1 G;  5J39 A;  1NCV A;  1BXT A;  4K5V A;  3S2H B;  3K0Y A;  5IT9 E;  3DEP A;  1SE3 A;  1MSG A;  3K57 A;  1VF7 A;  4OGQ C;  4OHJ A;  3NBI A;  3VR2 A;  3J80 L;  4G57 A;  2AQ2 B;  3I73 A;  3K59 A;  1M4V A;  1QE6 A;  4Q0F A;  4XT1 B;  3VR4 A;  1RKN A;  1IHZ A;  4CKE A;  1H9J A;  1SNC A;  1A6X A;  3R2I A;  5CMD A;  2BDO A;  1EY5 A;  2DNE A;  5NUC A;  3I72 A;  1LV9 A;  1SNM A;  2VXW A;  2XWB B;  4OIK A;  1OXV A;  2HDM A;  4PV1 C;  1JOR A;  1UEA B;  3W3A A;  1R9T B;  1NAP A;  4PMC A;  1EYD A;  4IUQ A;  2IX0 A;  1EU3 A;  4KHV A;  3D3R A;  4IUU A;  5JPN C;  3RZD B;  2VUM B;  1F2Z A;  1OXS C;  1JIC A;  5CV5 A;  1QNU A;  3VR5 A;  2E74 C;  1JOO A;  2A68 C;  2AWO A;  4QIW B;  1TS3 A;  5CYU A;  3BS1 A;  3BVG A;  3PMF A;  3BZD B;  2I46 A;  5KYL A;  2MP1 A;  2O4X A;  1ICW A;  3P7J A;  4DF7 A;  5I9P A;  1U4P A;  1GUS A;  2D62 A;  4KV6 A;  3CHB D;  1A3T A;  3MXU A;  2X6G A;  4ZK9 B;  1CT1 D;  1B1Z A;  1Y8N B;  1H9R A;  3VR3 A;  1HHV A;  3MEH A;  2BE5 C;  3H91 A;  4A3F B;  3SE0 A;  1WCM B;  4KI0 A;  2G9H D;  4IUN A;  3CU7 A;  1MI2 A;  3GTQ B;  1CHQ D;  2XN9 C;  4RH6 A;  3TN2 A;  2YYZ A;  1WTW A;  3MXP A;  3D4D A;  2JYO A;  3C1E A;  2F0H A;  2SNM A;  3AB9 A;  5ISR A;  1LAC A;  4DXF A;  3NBH A;  3HOV B;  2M00 A;  3GTO B;  1LTB D;  5KGU A;  3LWE A;  5D3D A;  4XYO A;  4ZLT F;  4M8A A;  1EIG A;  5I9O A;  5KEE A;  2IWH A;  1AW7 A;  2B2V C;  3GP7 A;  1ONL A;  1RCV D;  5C0X H;  2CW0 D;  3KBX A;  2RBM A;  1TS5 A;  2WAQ B;  3D6W A;  3G6J B;  3U9O A;  1D1I A;  4O1N A;  2WII B;  2TSS A;  5DM7 3;  1SBB B;  1LLR D;  2K04 A;  3KF8 A;  2JA5 B;  2FMM A;  5C6A A;  4XQJ A;  5JVH 3;  1KAB A;  3SK5 A;  1GJX A;  3BYY B;  4L6T B;  2L12 A;  5EBD A;  1EY7 A;  3OHX C;  1TS2 A;  3MAQ A;  4C2M B;  3MTS A;  1RJT A;  1CA6 A;  3PUX A;  4TKO B;  1PFB A;  5M3F B;  2K28 A;  1TQO A;  1A2T A;  4FF4 A;  3M85 A;  2RVL A;  2BA0 A;  3EFX D;  4KK7 A;  5CBE E;  1PRT F;  4CGY B;  1KDC A;  2ZXR A;  1LT5 D;  4LJZ C;  1SNQ A;  4HMJ A;  2CVR A;  3N6R A;  1I6H B;  1CQV A;  1FGB D;  3TP5 A;  5EBC A;  3GTK B;  1F2Y A;  3S1M B;  2EDG A;  2FMC A;  3LNN A;  4F88 A;  1QNK A;  4LMQ D;  3OIP A;  1FNV A;  2BCO A;  4FVM A;  5IOD A;  1DON A;  3FMC A;  5C0X G;  1IL8 A;  3AU7 A;  1JR0 D;  5IIF A;  3U9S A;  1GUN A;  4XIG S;  4RAU C;  2MUY A;  5EKL A;  2XSC A;  2JA6 B;  4DK0 A;  4FO2 A;  2QF7 A;  1CA5 A;  4FXK C;  5J22 A;  4HR7 B;  4MIU A;  1R4P B;  1Z7T A;  2K01 A;  3ND8 A;  4CBV A;  1U9R A;  1SMY D;  1A3V A;  4HTH A;  5COR A;  1G91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...