1A63A

The nmr structure of the rna binding domain of e.coli rho factor suggests possible rna-protein interactions, 10 structures
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
130
structure length
130
Chain Sequence
b'MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPENARNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHO
publication title The NMR structure of the RNA binding domain of E. coli rho factor suggests possible RNA-protein interactions.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Transcription termination
total genus 26
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 1998-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07497 Rho_RNA_bind Rho termination factor, RNA-binding domain
A PF07498 Rho_N Rho termination factor, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.10 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 1a63A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1a63A02
3I4OA 1LYLA 1HZBA 2CWAA 2B3GA 1XMOL 1WFQA 1N8RC 4DR6Q 4GKJQ 3CCQA 3I4NG 2OTLA 4OWWB 1SROA 4C3HH 2WFWA 4X66Q 4JI6L 4X64L 4POGA 2NVYH 4Y52H 3BZKA 1HZ9A 3M85A 2N78A 1Q86C 3PUWA 4L5TA 4BBRH 3CMEA 1PFSA 4OONA 2QNFA 4QJFA 4A3MH 3UDFA 2JA7H 3RLFA 5E7NA 2NN6I 3F2BA 1QUQA 4LF9Q 3S14H 2OTJA 1GM5A 2R7ZH 3KJOA 3I56A 2UXDL 4DV7Q 1V9PA 2PI2E 1VQBA 3PCOB 4DK6C 4ALPA 2AWNA 1Q7YC 1E7DA 1MIUA 2K5HA 1OXSC 2IHEA 1UE7A 3GO5A 4GN4B 1AE3A 3F1ZA 3J81j 3PIPA 4DUYL 1I6HH 3HOYH 3GTMH 1CKNA 5JJLA 1NMFA 4B3SQ 3TREA 3CF5A 1OXXK 2JQOA 3S16H 1AE2A 4JI3L 3STBC 4JI5Q 4LFAQ 4HIMA 1G291 2E8GA 5IP7H 3T1HL 1PH1A 2JE6I 4JI2L 1FJGL 5AJ3Q 1N32L 4YY3L 2HIXA 4BBSH 3ERSX 3UDGA 4DAMA 2YTXA 5C0XG 4HIKA 1V1QA 4YWLA 2Q2TA 4QY7A 2ASBA 4A93G 2VY3A 2MQHA 4P72A 3W5OA 1VQKA 1L2FA 4HJAA 1VQJA 2HHHL 1YBYA 5IYDG 4LF7L 1PH3A 1NBWA 1YNXA 2OCEA 1HJPA 2UUCL 5LMUL 2F52A 2K52A 3U58A 1CUKA 4JBJA 1WYDA 2JEBI 3MEFA 1X3GA 4R4IA 4A3IG 3CC4A 4IFDG 1N33L 4P75A 4DV0Q 4UP8A 1YEZA 2VQEL 1PH2A 3PO2H 2AMCB 3S17H 1RIPA 2IT1A 2CWPA 3KFUA 3A5UA 1N36Q 2D0PA 4JI7L 3A74A 3RLOA 1XNQQ 1MJEA 2ZTDA 4O2DA 1JB7A 4JI4Q 2NVTH 1UE1A 3F2CA 4DV3Q 4JI1Q 4GKKQ 5GADC 3ULLA 1LTLA 2BH2A 3FKIH 1VS0A 4DK3C 2NZOA 2BH8A 4JI0Q 1X6OA 2QA4A 3EBEA 4BY1G 3CXCA 4DR3L 2MFIA 2NVQH 3RZDH 3A5ZB 2E5LL 3PGZA 1L1OA 1HNXQ 1S40A 4A3EH 3UE1A 1VQ7A 4DV6L 3CD6A 2WB1G 3HOVH 1VQ9A 1VQGA 2LXJA 1I94Q 4JG2A 1MJCA 1PH8A 2JA7G 1Y1VH 5C44H 5M5XH 4JV5L 3PIOA 3KDFB 1XPUA 1Q1BA 2R7ZG 5M3MH 2R6GA 3L7ZC 4OWXB 2PQAB 2YTVA 4L5SA 4OXPA 2I5MX 3JC66 1K9MC 1G6PA 3HOYG 2Z6KA 2L15A 4DR7L 1PH4A 1YZ6A 3TS0A 1Q8KA 4LF8Q 4DAYB 5IYBH 4DR2L 4A3BH 4PG3A 2UXBL 1TWGH 3S1MH 2Q2HA 2EXDA 3JAMc 3SGIA 1MKHA 1UWVA 5C0XI 3T1YL 1NJIC 5IP7G 5FJ8H 1K8GA 1K8AC 1CKMA 2WAQE 1YJNA 4X62Q 1KC8C 4HJ8A 4J15A 4DV2L 2UU9Q 4BBSG 1EFWA 1VQLA 1HNWL 4LF6Q 1O7IA 4AIMA 2IX1A 1UE5A 2VNUD 5FLMH 3PUYA 1E7LA 4IFDI 1SN8A 3BJUA 4K0KQ 3S2HH 3KDFA 2UXCL 2ID0A 1TXYA 4IPHA 3UDXA 2JA8H 4A3DH 1C9OA 2EIFA 3GTQH 3UE0A 1HZCA 3OYYA 2F4VL 4YWKA 1NE3A 2ZTCA 1XMQL 4AQYL 2JA9A 1P16A 1X3FA 4LFCL 2CFMA 1L0WA 3CCSA 4OX9L 4JYAL 3PO2G 4B3RL 1IBML 4LF4L 2ATWA 2WAQG 1XNRQ 4X66L 4LFBL 2ALYB 4R4TA 4LUVA 3ULJA 2ZJPA 4B3MQ 5IYCH 1YITA 1PYBA 1IBLQ 2Z0SA 3GTJH 3CCEA 3K81C 5LMNQ 4LW1A 4EQ5A 3FKIG 4IPDA 4BY7H 3DLLA 2YTYA 4GN3B 5IP9H 5BR8Q 4DV1L 3RN5A 3W1BA 2JJQA 4BXXH 4A3CG 4OO1G 1A0IA 2BA0A 2DGYA 3PV0A 2R92G 4GLXA 4X65Q 3RR5A 2KCTA 4A3GG 3GTOH 1Q1EA 1G51A 2HIVA 2VQFQ 4YCWA 3HOVG 4A3LH 2VUMH 1IBKL 3IRBA 4JI8L 1HR0W 1I3QH 1Y1VG 5C44G 2MNAA 2FXQA 4A3JH 2UUBQ 5M3MG 4WJ4A 4IJHA 1J5EL 1U0LA 4QQBX 1AH9A 5ELOA 4DUZQ 1XJVA 5GROA 4HJ5A 3KF6B 4LNQA 1OXUA 4A3BG 3CCJA 3I7FA 4MZ9A 2R93H 4IO9A 1VCIA 1UE6A 2H5XA 1Q46A 1VQFA 1SR3A 3M4PA 5FJ8G 5M3FH 2B63H 3GTLH 4A3FH 1XMOQ 1VQHA 4KHPL 2OWOA 1X3EA 1QZGA 4JI6Q 4X64Q 5JJIA 1Y14B 3U4VA 3GDEA 2IHFA 2MO0A 4DV5L 4YCVA 1HZAA 1K3RA 4DV4L 1HNZL 3G71A 4IPCA 5HGQA 5FLMG 3CMAA 2K4KA 2YYZA 3U4ZA 1KIXA 5C4XG 2IY5B 2KHJA 4DR4Q 1H95A 1IL2A 1VQMA 2VZAA 2ZTEA 2JA8G 4A3DG 2I5HA 1D7QA 2UXDQ 4JI1L 4PZ6A 1E1OA 3STBD 3KF6A 3CQZH 1KL9A 4DUYQ 2LSSA 4X6AH 3M4QA 3H3VH 3M9BA 3RLNA 4C3IH 3TRZA 4APVA 2E2HH 3HOZH 4JI3Q 5C4JH 3AFPA 4IJLA 4DR5L 1N34L 1GVPA 1SMXA 4JOIC 2MO1A 4MTNA 4JI2Q 3T1HQ 1FJGQ 2JA6H 2AHOB 5C3EG 1N32Q 4YY3Q 3TEHB 4NXNL 3K8AA 3J81c 1QVFA 4OO1I 5K36G 2N8NA 2YU9H 2BA1A 1EIYB 2JA5H 3KYHC 3TS2A 4BY7G 2JEAI 1E7ZA 3FP9A 3ZJYC 5IP9G 1K73C 1BKBA 1B7YB 4KHZA 3I4MH 1EIFA 2HHHQ 3S1NH 3H0GH 4BXXG 1U5KA 2Q2UA 4LF7Q 5ELNA 3PSIA 1W2BA 2ZJQA 4JBMA 2UUCQ 1D8LA 3BZCA 4BBRG 5LMUQ 3I2ZA 4A3MG 5DLQE 5H1SE 3K80C 5GAGC 1N33Q 2ZJRA 4P73A 5IWAL 2HJQA 4QL5A 2VUMG 4A3LG 4R4CA 4C3JH 1EWIA 2HQLA 1KXLA 1YHQA 2GN5A 3KJPA 1JJGA 5GQOA 4RG1A 2UUAQ 3PF4A 4A3JG 3W1GA 4JBWA 1PH6A 4JI7Q 2K50A 1FL0A 5J3BA 4DR1L 1M90C 1V43A 4K0KL 4LF5L 4LUZA 1Q81C 1X56A 4EX5A 1ASYA 4UY8C 2E2IH 3F8TA 4DR3Q 3D31A 2NVXH 2ZM6L 1X55A 3KOJA 4A3FG 4NXML 2E5LQ 3HOUH 4LWCA 2E2JH 1NTGA 5IE8A 4B3TL 3EIVA 1HH2P 4DV6Q 4GOPC 4HJ9A 3J80c 1WJJA 3I55A 1X9NA 3L2PA 2PI2A 2PQAA 3M3YH 1CSQA 3A0JA 1PYSB 1HR0L 1EOVA 3ULPA 2K5NA 4JV5Q 1JT8A 3S1RH 1KHIA 1L1OC 4KI0A 4C2MH 3RN2A 1ASZA 2ES2A 4GKJL 4P74A 4DR6L 1C0AA 3ER0A 3AEVA 3L0OA 4H02A 4BA1I 4DR7Q 2UXBQ 1XTDA 3OTOQ 1Z9FA 1TWHH 2WP8J 4DR2Q 3U50C 3RZOH 1WCMH 2LXKA 3JAMi 4R1JA 3OW2A 3T1YQ 2QNCA 1C7YA 3HKSA 3RNUA 2JA6G 4GNXC 1A62A 2A19A 4LF9L 2Y0SE 2RHSB 3K7AH 1VQPA 4DV2Q 1FGUA 3HKZE 2OQ0A 1EQRA 4AH6A 3CPWA 4DV7L 4YHHQ 4HIDA 1HNWQ 1JJCB 2JA5G 3KF8B 2I5LX 1Z47A 4GLAC 1R9TH 1EQQA 4A3EG 1TWCH 1WI5A 2AKWB 4JC0A 3J80i 4B3SL 2UXCQ 3H0GG 2I0QA 1TWFH 1GO3E 1KD1C 1VQOA 2VS1A 3K7UC 4JI5L 1PH7A 4LFAL 1UEBA 3CP0A 2F4VQ 1XMQQ 3NBHB 4AQYQ 1QZHA 1NMGA 4LFCQ 4OX9Q 5AJ3L 4JBKA 4BY1H 4JYAQ 4AYBE 4UP9A 4B3RQ 1OXTA 1YHAA 5LMNW 1IBMQ 2YV5A 3UDIA 4DNIA 4LF4Q 4GLVB 4GS3A 4LFBQ 1M1KC 2Y0SG 4GN5A 3HKZG 3E9IA 4WJ3M 5IYBG 4IOAA 3EN2A 4OWTB 3H15A 3DM3A 4R4QA 1EYGA 1PV4A 1PHJA 4DR4L 4L5RC 4JOIA 2K14A 5IT9c 4DV1Q 2CCZA 2K5VA 1VQEA 4DV0L 3GTGH 1X54A 2JK8A 1YIJA 1XPOA 3HOUG 1KQSA 3S2DH 2KCMA 3Q8DA 3GTKH 1IYJB 4HJ7A 3TQYA 3PO3H 4AYBG 1N36L 4Y7NH 1SE8A 1B70B 1XNQL 2PNHA 3B6YA 3MXNB 1NY4A 1IBKQ 4JI4L 1E22A 4DV3L 4GKKL 1FVIA 4JI8Q 1A63A 3AYHB 1VQDA 3H3VI 1Y1WH 4JI0L 2VW9A 3NENA 2GVAA 1K0RA 4GOPB 1J5EQ 1VQIA 2K75A 4PMWA 3HOXH 4A75A 3CC7A 4JCVE 1HNXL 2PMZE 3M4OH 4XIGS 4TQUS 2R7DA 3PUZA 3E0EA 5JJKA 5IYCG 3NELA 5GAEC 1WCMG 2NZHA 2RF4A 1XPRA 3S1QH 1L1OB 4FDBA 4R4OA 4IOCA 4A4IA 1I94L 3PUXA 3CC2A 4KHPQ 2Q2IA 3K0XA 3S15H 4HIOA 3J7ZC 2A8VA 2R7FA 2QGQA 4QIWE 4A3KH 1OTCA 1I50H 2CKZB 2WB1E 2N49A 3CW2C 4DV5Q 3CAMA 4DV4Q 1HNZQ 4PZ8A 1PH5A 3HOWH 4MNOA 2UUAL 2N3SA 2RCNA 5FLXc 5IY0A 1BBUA 2F3IA 4LF8L 4O0AA 2A1AA 4GNXB 1PH9A 1E24A 5JEAG 4GOPA 1Q82C 5IYDH 4P71A 1BBWA 1X65A 1VQAA 2AWOA 3LGJA 2VQEQ 1PVOA 2CQOA 3I4NH 4L5QA 3PF5A 1VQ8A 4UPAA 1P8LA 4UP7A 4PZ7A 4X62L 3J7A5 1EN7A 2UU9L 5M5YH 4A3CH 5C0XJ 2R92H 1GKHA 4LF6L 5GAHC 1SLJA 4DR5Q 1N34Q 4A3GH 1RL2A 4NB3A 3E9HA 1J6QA 1A8VA 2EQSA 4ME3A 3G4SA 2OQKA 3CCVA 3FHWA 2R93G 3F2DA 1N9WA 1JJ2A 3ICEA 3WWVA 3S24A 3J81i 2GVBA 4DPGA 5M3FG 1JE5A 1QVGA 4NXNQ 3CCRA 2B63G 4XTCS 3KLWA 1CSPA 3AFQA 1VQ5A 4IFDJ 1T9HA 2KENA 2NN6G 2KBNA 3HFZB 4GNXA 1TWAH 3NEMA 5EAYA 2DUDA 1OXVA 2QEXA 1LUZA 1XNRL 1S3OA 2V1CC 4RMFA 3CCMA 3PO3G 3PUVA 5HY6A 1VQ6A 3BU2A 1WOCA 1SFOH 3OTOL 4B3ML 1S72A 1VQNA 5IWAQ 1IBLL 1PA6A 5JEAJ 5LMNL 5C4XH 1YI2A 4A93H 3VDYA 4A76A 3CPFA 1KRSA 1QVCA 2XTIA 1CKOA 1EUJA 1K83H 1Y1WG 5BR8L 1YHBA 3G48A 1Q12A 1IZ6A 4YHHL 1VQ4A 3HOZG 3HOXG 1DGSA 2HT1A 4DR1Q 4NPSA 3CCLA 4POFA 4LUOA 4X65L 4IPGA 2XGTA 1GD7A 2D62A 1E3PA 4A3IH 4LF5Q 2VQFL 1YVCA 3GTPH 1I5FA 4QGUA 1LM0A 1YJ9A 4TVAB 1W3SA 2IX0A 2D0OA 3GD7A 4DKAC 2ZM6Q 3D0FA 1VQCA 4YCUA 4NXMQ 4BA2I 4KLKA 2Z6KC 4B3TQ 1JMCA 4A3KG 5M5WH 2UUBL 1QUQB 2KHIA 2RHQB 2C35B 3I4MG 1SRUA 3HOWG 2B29A 3G6EA 1E1TA 4DUZL 1YJWA 1B8AA 2VL6A 1IXRA 1KRTA 3CCUA 1HR0Q 1BVSA 1CKNB 1KAWA 5C3EH 4YWMA 3M7NA 3AQQA
chains in the Genus database with same CATH superfamily
2B8FA 2B3GA 5J39A 1N8RC 4DR6Q 3S2DB 3I4NG 1FYCA 4JI6L 4Y52H 1U4PA 5EQ0A 3M85A 2EY6A 1Q86C 3V2TA 4L5TA 3SHLA 4BBRH 4RWSC 2JA7H 3FLGA 3RLFA 5E7NA 1Y1WB 4KN7C 2OTJA 3S14H 4B9XA 3KJOA 4DV7Q 3HOZB 4KHZA 3GO5A 1WTHA 1UE7A 5C4JB 4DUYL 3PIPA 1JC7A 5JJLA 1OXXK 2JQOA 1AE2A 5EBCA 2KFVA 4QCLA 4LFAQ 2E8GA 5IP7H 1PH1A 1BCPD 2LMCB 4NMZA 4KKTA 3OW7A 1N32L 2L4NA 3ERSX 3I4MB 5C4XG 1HRJA 4YWLA 1U4MA 2MQHA 2OXPA 4KK7A 4HJAA 4ZUIA 3SK5A 5FLXL 1NBWA 1YNXA 2OCEA 3NE5B 5LMUL 1H1JS 2F52A 1CUKA 1HFNA 3OMCA 4QB4A 2EYMA 5E1FA 1R4QB 1SNMA 4DV0Q 3OPOA 4CKEA 1YEZA 2AMCB 1RIPA 2D0PA 3RLOA 2WINB 2A68D 2ZTDA 5IGDA 1ONLA 4O2DA 5EKIA 2E2IB 3UI2A 2NVXB 3F2CA 4JI1Q 5GADC 2B8GA 1LTLA 1VS0A 3OWEB 4BY1G 3RZDH 3A5ZB 2Q8RE 3PGZA 1CT1D 1L1OA 4C3HG 1JB3A 1ESFA 1M8AA 4DV6L 3CD6A 4FF3A 4R8IA 3HOVH 1EZ6A 4C2MB 5C44H 3PIOA 1B9NA 3QB3A 3HEJA 2PQAB 3L9AX 2YTVA 4V0BA 3JC66 2Z6KA 1SDFA 1YZ6A 3I8ZA 1TY0A 3NHHA 3T1YL 1NJIC 5FJ8H 1LTAD 1JCKB 1H9FA 1GHKA 2WAQE 3RMHA 1EFWA 1VQLA 1HNWL 1KABA 2OF1A 1JWSD 2PMZB 3BJUA 2RA4A 5C6AA 1V8QA 1NR2A 4BY1B 1Z7TA 4A3DH 1C9OA 3OYYA 5COYA 1NE3A 1XPRA 4C3HB 2L11A 1P16A 4OX9L 3CCSA 4JYAL 2X6GA 1HTLD 3PO2G 5A35A 1IBML 3NP8A 3FPPA 4QUCA 1XNRQ 4X66L 2G9HD 3ULJA 2DNEA 4ZRZA 5IYCH 1PYBA 2L5TA 4IZ8A 5LL6S 2ODCI 3DEPA 5K36H 3FKIG 4MTKA 3C2PA 4BY7H 3CRLC 3GTKB 3T53B 5BR8Q 3PO3B 4CHTB 2EY5A 4BXXH 3S16B 2BA0A 3PV0A 2R92G 2LD7A 2B2YC 1EY7A 2VQFQ 4K2KA 4WORA 3IRBA 3LWUA 1HR0W 1I3QH 4IUVA 1TS5A 1U0LA 4QQBX 4G7ZC 4ULLA 3IKJA 5GROA 3S1QB 3R2IA 1F9SA 1QCBD 3S15B 3I7FA 4MZ9A 3LLRA 1F2YA 1SYGA 1SXTA 4IQZA 5ELFA 4IO9A 2H5XA 2R93H 1WD0A 2KCCA 5M3FH 3M4PA 5JPNC 2B63H 5E4WC 2FINB 3PO2B 1XMOQ 1VQHA 2MGSA 4X3UA 3E3XA 4CKBA 3MC0B 1PLFA 3EQLC 5JJIA 3SVMA 1Y14B 3LNNA 2IHFA 1HZAA 3E6ZX 1HNZL 3G71A 5FLMG 3CMAA 3U4ZA 3FKIB 4DR4Q 1AZQA 3A55A 1D1KA 2JA8G 2I5HA 4L8JA 2F3WA 4ZK9B 4PZ6A 2R92B 1KL9A 1EQVA 1LABA 1CI3M 3QIAA 4UHVA 2MUYA 5FO8B 5M9OA 3T1HQ 1SMXA 4MTNA 2MO1A 1FJGQ 2F4IA 3VYSA 1QVFA 1F9QA 1EYCA 2YU9H 3KYHC 2HDMA 2AUKA 4DNRB 4N8FA 1B7YB 4CBVA 2HHHQ 1E0BA 3H0GH 1TWGB 2F0OA 5KYLA 2K33A 3I70A 1W2BA 5EKLA 2ZJQA 2UUCQ 3S1MB 2DY7A 4BBRG 2F0DA 5D3IB 1Q8IA 2Z4HA 5DLQE 1K28A 2F3VA 3H6MA 1AZPA 1EOTA 2ZJRA 4P73A 2K03A 2HJQA 2CVRA 2K04A 4R4CA 2VUMG 5CGKA 1YHQA 5CV8A 2GN5A 5GQOA 1MI2A 4RG1A 1WTPA 3OOCA 2J0TD 4UAIA 4A3JG 4M8AA 4JBWA 1PH6A 2K50A 3EROA 2SEBD 1FL0A 3GTPB 1HTPA 3GTQB 3QR8A 4K0KL 4LF5L 1G2SA 4EX5A 1FGBD 5M5WB 3D31A 4NXML 2E5LQ 3HOUH 1LT3D 1QNUA 1ZYRD 1BCPB 1NTGA 1PTOC 3VR2A 4X3SA 1EY6A 3D6CA 3CHBD 3M3YH 1CSQA 2DJFC 1PYSB 1W6JA 3P7JA 4C56C 5CC4A 1L1OC 4DAYA 1V1PB 4P74A 4DA2A 1H9KA 4DR6L 4BBRB 3L0OA 3GTOB 4HMIA 2EY2A 4C3IG 1TWHH 2F0IA 3DUZA 3AU7A 4DXGA 1B3AA 4HCSA 1F2LA 3OW2A 1R4PB 3CRKC 1A62A 4FF2A 4A3JB 2N88A 3HKZE 2OQ0A 1EQRA 4AH6A 4DV7L 4YHHQ 2PYKA 3KF8B 5DAUA 2JA5G 2O5JC 1E2WA 3R3OA 4H0LC 2AKWB 1TWFH 3ND8A 4CJ1B 1VQOA 1H9RA 1A2TA 3K7UC 4LFAL 3MZ5A 1NMGA 4C3JG 4UP9A 2MPHA 5JJZA 3X3NA 2XN9C 4V190 3VYRA 3HZXA 4IOAA 4FF1A 4OWTB 3H15A 3DM3A 1XWEA 1EYGA 4IN3A 1PHJA 2K14A 2CCZA 4DV0L 4K14A 2JK8A 4C3IB 1QE6A 1ZBHA 3S2DH 4BITA 2KCMA 1CQFA 1Q90A 5DM73 1I4PA 4DK1A 3MWYW 4KKSA 5KNBA 1EEID 4Y7NH 3MXNB 4MHEA 1IBKQ 3RZDB 1NAPA 4JI8Q 1A63A 3AYHB 2JA5B 3QG1A 3Q22A 3H3VI 1Y1WH 2GVAA 1K0RA 5ISRA 2FMMA 4PMWA 1ZKOA 2IWHA 4Q0FA 3HOVB 1DD2A 3TDQA 2PMZE 1H9SB 2PW5A 3PUZA 1CA6A 2VXWA 3KLRA 5IYCG 1VF7A 3NELA 3BVMA 2RF4A 4FDBA 4IOCA 3PUXA 2MPMA 2XNAC 4O42A 2AUJD 2K5QA 4HIOA 3WDNA 1LTSD 4BS9A 4A3KH 4DV5Q 4DV4Q 3VR4A 2UUAL 2N3SA 2M00A 5CIUA 5IY0A 5DEHA 3VR6A 1PH9A 4NP5A 1E24A 5IYDH 1X65A 4WFN3 1HA5A 2RSNA 3MAQA 4M1UB 3I4NH 1P8LA 3H3VC 3J7A5 5M5YH 1YNJC 1SLJA 1RDPD 3E9HA 1J6QA 5A2QE 3CCVA 2OQKA 5A2QL 2ZXPA 3S1RB 2R93G 2PNRC 3M7GA 3WWVA 2GVBA 3J81i 5M3FG 1QVGA 2B63G 3CCRA 4FYDA 1CSPA 4IFDJ 1BOSA 2KBNA 1OXVA 3TZDA 1ZXTA 1XNRL 2K5DA 2RCFA 4RMFA 2J4XA 1HA6A 3FEWX 4IUUA 5EGTA 5IWAQ 1PA6A 2B2UA 5C4XH 3VDYA 1KRSA 1EUJA 1K83H 2NYZD 5ELCA 5BR8L 2DN8A 1YHBA 1Q12A 2BDNA 1VQ4A 1JICA 4NW2A 3HOXG 1DGSA 2QKIC 3SR1A 1W6KA 1GOZA 3CCLA 2XGTA 3A54A 2VQFL 1C4QA 4QGUA 1LM0A 5L37A 2BE5C 3GD7A 1STBA 3LX0A 4RA8A 4BA2I 4KY5A 4KLKA 5AFWA 1JOOA 1JMCA 1PTOF 1CTMA 1QUQB 1U4RA 3HOWG 2R93B 1RTNA 2EZVA 5M3FB 2VL6A 2B63B 2KVUA 1IXRA 5I4DA 3KLWA 1KAWA 4PMCA 3M7NA 3NXWA 1PFNA 1XMOL 4GKJQ 1AP0A 3CCQA 2OTLA 4QMGA 1SROA 4C3HH 4X66Q 1K3BC 4POGA 2JXMB 2QCPX 3SK6A 1U9RA 2N78A 3PUWA 3CMEA 4C1NI 4OONA 4LF9Q 3I56A 2BDOA 1V9PA 4DK6C 1VQBA 1OXSC 1AE3A 1ICWA 3F1ZA 3R93A 5CV5A 3GTMH 3IAYA 3CF5A 3S16H 3NPPA 5IGGA 2RKSA 4HIMA 2SDFA 3T1HL 3SK8A 2JE6I 1FJGL 1EIHA 2QILA 3MEHA 3J81E 5AJ3Q 1X3QA 3CU7A 2HIXA 2KOLA 2ASBA 4A93G 2Q2TA 4QY7A 1DOMA 2VY3A 4KTAA 4XT1B 1VQKA 2JVWA 2EPBA 2HHHL 1ENAA 1YBYA 5EKKA 2WKDA 3K59A 4LMQD 2UUCL 2K52A 3U58A 4JBJA 2JEBI 5IIFA 3OHXC 2A5HA 4UP8A 3R2TA 2VQEL 3PO2H 3KBGA 3KFUA 3K6OA 3W2DA 4JI4Q 2GA4B 1T5XD 1UE1A 3W3AA 1WD1A 4GKKQ 3FKIH 5FO9B 1A2UA 1WTRA 1X6OA 4OHJA 2QA4A 4JI0Q 2B2WA 1EQTA 2E5LL 5JVG3 1BDOA 2SNMA 4RH6A 1PTOH 1VQ7A 2K01A 2KUMA 1PZID 1L0XB 3LWEA 1I94Q 1MJCA 5CV6A 3KDFB 1XPUA 2RVLA 2R7ZG 1TWHB 1F9PA 1H9MA 1K9MC 3IFDA 2B2TA 1PH4A 5G3LF 1O7ZA 1Q8KA 3TS0A 4TKOB 2XRSD 1J8IA 1TWGH 3S1MH 1SMYC 3JAMc 1MKHA 1E2VA 2F0KA 1BNZA 1O7LA 3V96A 1CKMA 3BDOA 2EYHA 1RKNA 1XX8A 2DJGC 3CKIB 1O7IA 1ZEQX 2IX1A 1UE5A 2VNUD 5FLMH 3PUYA 1E7LA 4K0KQ 2L55A 2L0CA 1PTOD 3HG9A 2ID0A 4IPHA 1FR3A 3PQIA 2JA8H 1ESRA 3GTQH 2P5ZX 2NBFA 1HQRD 4YWKA 2F0JA 2JA9A 1VMCA 2IX3A 4QIWB 2NVYB 1PZKD 1SE2A 1H9EA 2F0FA 2ZT9C 4IURA 2R7ZB 3CCEA 3K81C 4LW1A 4EQ5A 4IPDA 3K5LA 3DLLA 2MJ8A 2F1MA 2YTYA 3VYUA 3FDTA 1EU3A 1RF2D 4Y7NB 1KTKA 4OO1G 1A0IA 2HDLA 4GLXA 5EJWA 2KCTA 3GTOH 1G51A 3F2UA 3T4AC 1HUNA 2B2UC 4KJOA 5C4HA 5LL6X 2B39A 4YCWA 2VUMH 1IBKL 4XYOA 4JI8L 1Y1VG 2MNAA 4UDUC 2E2DC 4A3JH 1WVLA 3MXGA 5EPKA 4HJ5A 1LV9A 3KF6B 4A3BG 2W51A 1DJRD 1LTBD 3DMUA 1VCIA 1UE6A 4A3KB 4Q5VA 2PO4A 1SR3A 1CHQD 5JVH3 2OWOA 3EFXD 4X64Q 4LK1C 1QB5D 2EJFC 3U4VA 2F03A 2MO0A 4DV5L 2CW0C 4YCVA 5FLXE 2EXZA 4K8JA 5KNCA 5J22A 4DV4L 2NVTB 3KLSX 2RSOA 1KIXA 1EWHA 2KHJA 2PZWA 3I4NB 3Q6SA 2ZTEA 5M5YB 1E1OA 3STBD 1C8CA 2A74C 3H3VH 3Q0AA 4C3IH 4E6IA 1SYCA 3DWPA 2R3ZA 4ZAIA 5IOCA 5C5MA 4DF7A 3AFPA 3DHQA 3H91A 4JI2Q 1K0SA 3K8AA 1GUWA 4OO1I 1GUSA 3P75A 2N8NA 1EIYB 2JA5H 1K73C 3ZJYC 2I46A 5IP9G 4JPBW 2EVBA 4G4KA 1EIFA 5JAVA 1H95A 3PSIA 1JWUD 3BZCA 5C4XB 4B9WA 5H1SE 1LTID 3O13A 4HSPA 3JAML 1K83B 5G3LD 5IWAL 2XWJB 4C3JH 1EWIA 2HQLA 2IPKD 1GL9B 1JJGA 2UUAQ 4HMJA 1M90C 1YNJD 1V43A 1DOLA 4F8MA 4LUZA 1X56A 3F8TA 3KOJA 5BN3A 1WTOA 4FO2A 4GOPC 3Q24A 4HJ9A 2F0MA 1WJJA 4KJNA 3L2PA 3BDCA 1JT8A 3S1RH 4ZYSA 1BXTA 3RN2A 1EWCA 4GKJL 3TP8A 1C0AA 3VR5A 4CKCA 3GQBA 4BA1I 4DR7Q 2FMCA 4ZUJA 2KQ3A 3TP6A 1CQVA 1HFGA 3HKSA 2JSOA 4IFDH 4GNXC 4RGOS 4LF9L 4ABNA 2RHSB 1FGUA 3GTMB 1EZ8A 1I4HA 3CPWA 2B2TC 2BE5D 3KK7A 4ZKBB 1R9TH 1EQQA 1TWCH 2L1BA 1UAPA 3BZDB 4JC0A 4RKLA 4DXFA 1KD1C 1V1PA 2VS1A 3DWAA 3J7AV 1UEBA 2MP1A 3NBHB 4AQYQ 4LFCQ 5AJ3L 4LJZC 4B3RQ 1YHAA 5IT9L 2YV5A 3U9OA 1A15A 5FK9C 1M1KC 2Y0SG 4ILWA 1CFMA 4WJ3M 4G57A 3EN2A 1A3UA 3IL8A 1NR4A 1PV4A 4L5RC 4EGVA 1A6XA 3BYYB 4JOIA 4X3TA 2K5VA 2FHTA 1X54A 1YIJA 1V1OA 2B2VA 1B1ZA 1KQSA 2E76C 2CH4A 3Q8DA 4HJ7A 4J8QA 3TQYA 2DNCA 4AYBG 1QILA 2N55A 4TRDA 4KN4C 1WTQA 4JI4L 4GKKL 4KMUC 3T16A 1PTOB 4JI0L 2VW9A 5CBAE 4R8NA 4CDFC 3HOXH 4BWGB 1GJJA 2HD3A 4TQUS 3E0EA 3MFYA 1WCMG 4RGNA 1KDAA 1F77A 3Q23A 1L1OB 1I94L 4KHPQ 3C3LA 3J7ZC 4JVZA 3FVQA 4QIWE 3MXNA 1I50H 2CKZB 2N49A 3CW2C 4QF4A 3HOWH 1PH5A 2PW7A 4RCOA 2IL8A 4MNOA 2KEDA 1S5BD 1BBUA 2Z1CA 1O80A 3OIPA 3D3RA 2VB2X 5JEAG 4P71A 4PNYA 1BBWA 3LGJA 2VQEQ 1PVOA 4ZKCB 1H9SA 1JWMD 1EY8A 4UPAA 4PZ7A 1EN7A 5C0XJ 1C48A 1Y69U 2E74C 3KLSA 3C46A 4DR5Q 1D5ZC 1N34Q 2JA8B 3K0YA 1I4QA 2EQSA 1A8VA 3G4SA 5KGUA 2M9VA 1RTOA 1NCVA 4DPGA 1SNPA 1VQ5A 3TMEA 1T9HA 3TBIB 2NN6G 1GUGA 3HFZB 4OIJA 1GUTA 3RZOB 1RCVD 1WCMB 1LUZA 2K32A 1S3OA 2V1CC 3FRPB 1HHVA 5EPJA 1VQ6A 1I4GA 5JEAJ 3M4YA 4A93H 1SMYD 5BN5A 1LT4D 1QVCA 4G7HC 1LT6D 4EVOA 4ZCKA 1UUPA 2VUMB 2ENBA 4H7BA 1B53A 4IUPA 2D62A 1E3PA 1H9JA 1KLUD 1QOHA 1I5FA 1YJ9A 4TVAB 2A6HD 2ZM6Q 2IX0A 1VF5C 3MXUA 2CH4W 2Z6KC 2ICEC 2Z8LA 3J7YW 2KHIA 1D2BA 1SRUA 1EY0A 2B29A 4XDXA 1YJWA 1S5CD 2NUCA 2FFKB 1II3A 1CKNB 5C3EH 2TSSA 3I4OA 1KLGD 1HZBA 1WFQA 3A7LA 3NQIA 5KIXA 4P2CB 1DZ1A 5CV4A 4X64L 2NVYH 1ET6A 4QJFA 1PXUA 3UDFA 2NN6I 3F2BA 1QUQA 1AW7A 5I6WA 3SEBA 1GM5A 2R7ZH 3PCOB 1SYBA 2PI2E 3I72A 1MIUA 2K5HA 2IHEA 3J81j 1KDBA 2O5IC 1NMFA 1YNNC 3STBC 3PIP3 1J9OA 1G291 1PYWD 2EYFA 4JI2L 4TSSA 3UDGA 1SJHD 2A6EC 2YTXA 1V1QA 4HIKA 3W5OA 1GJXA 3I4LA 2EJMA 4L6TB 1SNDA 4RHSA 5IYDG 1PH3A 3J7AF 4C3JB 2CW0D 4A3IG 4R4IA 4IFDG 3CC4A 2KECA 2AQ1B 3BS1A 4P75A 1XTCD 5T1GA 4WJWA 1PH2A 2F0WA 1EIGA 1SYEA 3A5UA 2DK4A 1N36Q 3A74A 1XNQQ 4G7OC 2R61A 2NVTH 4XXEA 3ULLA 4KKUA 2Z6BA 1JE4A 2B2VC 1QNKA 3EBEA 3CXCA 2MFIA 2NVQH 1G2TA 4OO1H 1TY2A 3IFTA 4ID6A 5T1IA 3KBXA 1S40A 3UE1A 5IODA 4CJ0B 1PFMA 3A8KE 3I90A 1VQGA 2LXJA 4JG2A 1Y1VH 2EYOA 5M5XH 2D9UA 2ICIA 4OWXB 2E75C 1IYVA 2QW7A 1ENCA 2QF7A 1ZS9A 1KHCA 3PIO3 1SJED 3X3MA 3HOYG 4A3IB 4DR7L 4A3BH 4DAYB 4K8IA 2Q2HA 3SGIA 2G80A 3P1HA 4HTHA 5I2YA 1RODA 1R9TB 2KVEA 4X62Q 1KC8C 4HJ8A 1TWCB 2H4OA 2F0HA 4BBSG 3VR3A 3HGBA 4I7ZC 3SE0A 4AIMA 5I2XA 2SNSA 4IFDI 1SN8A 3AB9A 3KDFA 1B4OA 1SEBD 3UDXA 2F0GA 2EIFA 2HUGA 1HZCA 2ZTCA 4AQYL 1X3FA 1D5XC 4LFCL 1G91A 1EYDA 1EY9A 4B3RL 2ATWA 2WAQG 4R4TA 1B9MA 1KAAA 2ZJPA 4B3MQ 4K6DA 4CDEC 1YITA 2Z0SA 1PZJD 4WRDA 5LMNQ 1JEIA 5ELDA 4GN3B 1I6HB 4N9TA 5IP9H 3T51B 5IGEA 1GUNA 1QG7A 1JQYD 2X69A 2DGYA 1CA5A 3MXPA 4X65Q 3D6WA 3RD4A 3MHBA 3RR5A 2HIVA 4K2LA 2O4XA 4BBSB 4IALA 1I4RA 3HOXB 4S3SA 5M3MG 4WJ4A 4IJHA 5ELOA 4X3KA 1K8MA 4DUZQ 1XJVA 5EBDA 1SYDA 3H09A 1OXUA 1TT2A 3CCJA 1PRTC 1I50B 3GTLH 4J1MA 1Y8NB 3S17B 4KHPL 3BVZA 3HOWB 1X3EA 2WAQB 4HN7A 4DGZA 1UNSA 5BN4A 4FNFA 2YYZA 5J1ZA 1VQMA 2XVSA 2UXDQ 3KF6A 1STEA 1HXYD 2TMPA 3M4QA 3M9BA 3RLNA 2E2HH 4JI3Q 1BO0A 1FD7D 4IJLA 4DR5L 5JPMC 1N34L 2K28A 2AHOB 3SK4A 5C3EG 4YY3Q 5M3MB 1STYA 2BA1A 3ZYYX 3TS2A 1E7ZA 3FP9A 3NWTA 1CM9A 2Q2UA 4LF7Q 4JBMA 1SE3A 1CK1A 3I2ZA 4A93B 1DCZA 5GAGC 1N33Q 4K6LA 4HAEA 2JP1A 3TZUA 3HP3A 4A3LG 2F0EA 5CV9A 1FNWA 1MD2D 2WKCA 3ITPA 3PF4A 3NSWA 4JI7Q 1CZGA 1OO9B 1CHPD 3FPUB 1I4XA 3J80L 2EYPA 2QDLA 1G8ZD 4HEDA 2K1BA 4FVMA 4DR3Q 2ZM6L 2PQEA 4A3FG 1STGA 4LWCA 1NUCA 1TS2A 5IE8A 5C3XA 1WTWA 1HH2P 5FKAC 4KV6A 2A6HC 3I55A 1X9NA 5C3EB 1L0YB 3V05A 1SBBB 2PI2A 1SNQA 2PQAA 3A0JA 1QJOA 3H94A 1EOVA 1GHJA 2ZXOA 2HQEA 3C1FA 4JV5Q 2O2LD 4R9WA 5C0XH 4KI0A 4K5XA 1XYIA 3ER0A 1BUVT 4H02A 1LACA 2A73B 1XTDA 5JOBA 1Z9FA 2WP8J 4DR2Q 1WTVA 2UXBQ 3U50C 3RZOH 1WCMH 3JAMi 4R1JA 1C7YA 2EY1A 3RNUA 2JA6G 1E2ZA 5IGCA 3K7AH 1B44D 4DV2Q 3BG3A 4CJ2C 2WIIB 1JJCB 2RBMA 4GLAC 4OIKA 1MGSA 2UXCQ 2I0QA 5JEAH 1IHZA 1Q3LA 2Z4IA 1PH7A 2MHVA 4A3FB 2F4VQ 1XMQQ 5F2DA 1HUMA 1Y8PB 4U673 4LF4Q 4DNIA 4LFBQ 4GLVB 3OSOA 4GN5A 4PMBA 3HKZG 3PMFA 3ND9A 3E9IA 2VB3X 3URYA 4F88A 4FP5D 2NTTA 2A69C 3CQZB 1EU4A 2CHBD 5IT9c 2F0PA 4DV1Q 1ICFB 2NN6H 5DNFA 1S5DD 3D4RA 1CZWA 1XPOA 3L3OC 1FNUA 3NBHA 1N36L 2JA6B 3S9WA 1B70B 1XNQL 2PNHA 3B6YA 2PZTA 1E22A 1YNND 2NVQB 2QEJC 3DWQA 4GOPB 1J5EQ 1VQIA 2K05A 3S1NB 2F0NA 1B50A 3CC7A 2A6ED 4JCVE 3M4OH 3GV6A 2R7DA 1Y1VB 5JJKA 5M5XB 5GAEC 2NZHA 1PRTF 3CC2A 2PPBC 4A4IA 1M4VA 3AMUA 2JN4A 2A8VA 1OTCA 2QGQA 3HKZB 1DXMA 4FF4A 5LHY1 4A3BB 1STAA 2XIWA 3D4DA 2RCNA 1LT5D 5CBEE 2F3IA 4O0AA 2A1AA 2NTSA 3JAME 4GNXB 1Q82C 1VQAA 2H1EA 3K5OA 1JOQA 5IGBA 5E4XA 2E2JB 1D1IA 4L5QA 3PF5A 1VQ8A 4UP7A 4X62L 2RDHA 4FXKC 1TR5A 4A3CH 1GKHA 1S4ZA 4DFAA 5GAHC 4A3GH 1RL2A 1VMPA 3FHWA 3HRZC 1N9WA 1JJ2A 4NXNQ 5KYIA 2KENA 4JW0A 4CDCC 1BR9A 1TWAH 3NEMA 2QEXA 4KD4A 5E3FA 4CGYB 2ODGC 2JYOA 3QKJA 3PUVA 1IYUA 4OGQC 4ODGA 3PO3G 3OTOL 4B3ML 3I73A 2B2WC 4DN4M 1S72A 1EYAA 3EVQA 5LMNL 1SAPA 4A76A 3A8IE 2XTIA 2X6LA 2OEOA 3G48A 3QWNA 1RJTA 5NUCA 2HT1A 4DR1Q 3A8JE 4POFA 5C3WA 1NSNS 4XQQA 4X65L 5FOBB 4A3IH 1IL8A 3NQTA 1EY4A 2C9OA 4K5WA 1W3SA 4DKAC 2D0OA 4YCUA 4EQNA 1F9RA 3GP7A 4B3TQ 3BVGA 2RHQB 2C35B 3D4WA 3G6EA 1E1TA 4DUZL 1B8AA 2F0QA 4RCNA 3GTLB 3CCUA 1HR0Q 1MSHA 4IUQA 3G6JB 3D0FA 3GTGB 2KCNA 1LYLA 1X32A 1F2MA 2CWAA 2EJGC 2F0UA 5IT9E 4OWWB 2WFWA 1SYFA 3BZKA 2EE1A 1HZ9A 1PFSA 2QNFA 4A3MH 3KF8A 4L63B 3ONAB 3VA7A 3I91A 2UXDL 1Q7YC 3VYTA 1AFPA 4ALPA 2E2HB 2AWNA 1E7DA 2F0VA 4GN4B 4FXGC 1I6HH 4EQOA 3HOYH 5I6YA 1CKNA 4B3SQ 3TREA 1KNEA 2M2LA 4JI3L 4JI5Q 2WQGA 2KHSA 2ZXRA 1UEAB 4FXDA 1STHA 4ZQ3A 2KA7A 2XRQD 4I65A 4DAVA 4YY3L 4DAPA 5KNDA 5FO7B 4BBSH 1HQMC 2QDBA 4DAMA 5C0XG 1PRTD 1TVXA 4P72A 1TS4A 4B08A 1L2FA 1VQJA 4RKBA 1TU2B 4CDDC 4LF7L 1HJPA 1WYDA 3MEFA 1X3GA 1N33L 2L9HA 2Y0SB 3TSSA 3S17H 5C5LA 3RUZA 2IT1A 2CWPA 4JI7L 3GV3A 3P20A 1TQOA 4KD3A 1BQQT 1MJEA 4HSVA 3MVVA 4F7XA 1JB7A 1PFBA 4DV3Q 3TP5A 2BH2A 2KW9A 4DK3C 5KRUA 1TIID 2LS01 2BH8A 2NZOA 3K5NA 4DR3L 4AYBB 1G6ZA 2D5DA 2PZUA 1HNXQ 3VA5A 2HCCA 4A3EH 1SFOB 1K8OA 2K5WA 2WB1G 1AN8A 1VQ9A 3BDLA 5D65A 3N6RA 1PH8A 2JA7G 3U9SA 4JV5L 1Q1BA 1YNSA 5M3MH 2R6GA 3L7ZC 1LLRD 4L5SA 4OXPA 2I5MX 1G6PA 2L15A 1SNCA 4RFBA 1WTXA 4LF8Q 5IYBH 4DR2L 2UXBL 4PG3A 3K7AB 2EXDA 3R8BA 3QO2A 1UWVA 5C0XI 5IP7G 2IW3A 2CQAA 1K8GA 1K8AC 1AEXA 1YJNA 4J15A 4DV2L 2EOTA 1D6EC 2UU9Q 1STNA 4LF6Q 4XQJA 1NNXA 4J6HA 1I6VC 3TN2A 3QJYA 3S2HH 2UXCL 4EQPA 1TXYA 2C5CA 3UE0A 1EY5A 2F4VL 1XMQL 4LNQA 1IKLA 2CFMA 1L0WA 3HS0C 1S5ED 4DNTB 2WB1B 2BCOA 5I9OA 4LF4L 4LFBL 4LAAA 2ALYB 4LUVA 5CR3A 2JA7B 2HCIA 1IBLQ 3S14B 3GTJH 4MIUA 3DM1A 4ME5A 4DV1L 3RN5A 3W1BA 2JJQA 4A3CG 1JJRA 1RHPA 4A3GG 1IW7D 1Q1EA 4C1NK 1SSOA 2V4DA 5IGFA 3HOVG 1O7YA 4A3LH 1SNOA 5C44G 3M4OB 2FXQA 4IUTA 1Y8OB 4IUNA 2UUBQ 2F0SA 1J5EL 1AH9A 4MN3A 1BCPC 2Q8IB 2F0TA 3NBIA 2KJXA 1Q46A 5CORA 1VQFA 3DXJC 4N8X1 5FJ8G 4A3FH 3MTSA 3ERQA 1IKMA 3K5MA 1QZGA 2A69D 3NWSA 1SE4A 3T56B 4JI6Q 3GDEA 2G5DA 2RDGA 1K3RA 1GKUB 4IPCA 5HGQA 4RGMA 2K4KA 2IY5B 1IL2A 2VZAA 5CYUA 4A3DG 1D7QA 4JI1L 3CQZH 2Z9HA 4OEMB 1V66A 2LSSA 4DUYQ 4X6AH 4A3GB 2A68C 1EEFD 3TRZA 4APVA 3HOZH 5C4JH 4GZYC 2EYJA 1GVPA 4JOIC 4N9PA 5C44B 2JA6H 1N32Q 1BF4A 2EDGA 3TEHB 4NXNL 1TWAB 3J81c 3SXHA 5K36G 1MHWC 4BY7G 2KVDA 1JORA 2JEAI 2RNNA 1BKBA 1LO5D 3I4MH 3S1NH 4BXXG 1U5KA 5ELNA 1D8LA 5LMUQ 4H13C 4A3MG 1D5MC 3G7LA 3K80C 3MA2B 1B2TA 4QL5A 1KXLA 1Y02A 1Z6HA 4UZWA 2WV6D 3SDZA 1F2ZA 3KJPA 2D2CC 2EYLA 1PDQA 3NTKA 3W1GA 4HCEA 4F87A 5J3BA 4NKLA 4DR1L 3EJIA 4A3DB 1EL0A 1Q81C 1LTRD 1ASYA 1TKWB 3OMGA 2E2IH 4UY8C 2NVXH 1X55A 1HPCA 5EPLA 4XYQA 1TS3A 3E5SA 2E2JH 4B3TL 3EIVA 4DV6Q 3J80c 1PRTB 3EA6A 4KY6A 3E0JA 4U68A 5TSSA 4XQNA 1HR0L 2DY8A 4BY7B 3ULPA 2K5NA 2KEEA 1KHIA 4C2MH 1ENFA 1ASZA 2ES2A 1ILQA 1X3PA 3AEVA 4PQXA 4A3MB 4OL7A 3OTOQ 3T13A 2LKVA 1GXDC 2LXKA 2LY7A 3T1YQ 2QNCA 4RHRA 1I3QB 3NUCA 4K5VA 2A19A 2Y0SE 5ELEA 1VQPA 3HOYB 5I9PA 4HIDA 1HNWQ 2PCFB 2I5LX 1Z47A 2K7VA 2I07B 4A3EG 1WI5A 3J80i 5D3DA 1KNAA 3H0GG 4B3SL 1GO3E 3OIQA 3D8GA 3OWFA 4KY7A 4JK1C 4JI5L 4KHVA 3CP0A 1ML0D 1QZHA 2KVMA 4OX9Q 4JBKA 4BY1H 4JYAQ 4AYBE 2BOSA 1OXTA 2K6AA 5LMNW 1IBMQ 3UDIA 5C4ZA 4GS3A 5CMDA 2XWBB 3K58A 1JEQA 5IYBG 3KUPA 1LTTD 3NTIA 4R4QA 3N52A 2L12A 4DR4L 5K5PA 1VQEA 3GTGH 5D14A 3HOUG 1XXGA 3GTKH 1B3QA 1IYJB 3PO3H 5HURA 1DOKA 1RD9D 4H44C 1SE8A 1NY4A 2AQ3B 3TP7A 1EFID 4DV3L 2YU9B 1FVIA 2NB0A 1VQDA 3J81L 4A3EB 3NENA 3A56A 3H0GB 2K75A 3QOLA 4A75A 1MSGA 1HNXL 1BCPF 4XIGS 4DU9A 4XT3B 5CV7A 2WACA 1DONA 3S1QH 4R4OA 4DK0A 2NZ1D 4QUFA 3DEOA 2Q2IA 3K0XA 1ILPA 3S15H 2R7FA 4Z9CB 2WB1E 2F0LA 3CAMA 1HNZQ 4PZ8A 2G9DA 3C1EA 1PMRA 5FLXc 1T5EA 2RNOA 4LF8L 4OELB 2IJ0A 4GOPA 3NK9A 2AWOA 3HOUB 2CQOA 2FJ2A 4O1NA 1A3TA 1S5FD 4RAUC 2UU9L 5HGTA 4NDXA 3S2HB 5DM63 2R92H 2LC3A 4LF6L 3M3YB 3J80E 4NB3A 4ME3A 1LTGD 1FNVA 2NWGA 4RGTA 3F2DA 2LFNA 1KDCA 3ICEA 3MFGA 1DYQA 3S24A 1ZYRC 1JE5A 4XTCS 2AQ2B 3AFQA 1DM0B 4GNXA 5EAYA 2DUDA 2RQXA 3CCMA 2SOBA 3GTJB 5HY6A 3I3CA 3BU2A 1BBXC 4I7AA 5ELBA 1WOCA 1SFOH 2B2YA 1VQNA 1IBLL 4PV1C 4HR7B 2J7ZA 1YI2A 3CPFA 3NTHA 1VDZA 1CKOA 1Y1WG 2RDFA 2XSCA 1A3VA 1IZ6A 4YHHL 1TWFB 3HOZG 3WOEA 1HCZA 1U4LA 4NPSA 3A7AB 4LUOA 1JR0D 4IPGA 1GUOA 1GD7A 2Q8TA 5KEEA 3K57A 4LF5Q 1YVCA 3GTPH 1JOKA 1MBYA 4NXMQ 1QWYA 1VQCA 1ET9A 1IW7C 4A3KG 3FMCA 5M5WH 2UUBL 3I4MG 1O78A 2OT2A 4ZLTF 4YIJA 3QOJA 1KRTA 1BVSA 3WOFA 4YWMA 3BYTB 3AQQA
chains in the Genus database with same CATH topology
3I4OA 1LYLA 1HZBA 2CWAA 2B3GA 1XMOL 1WFQA 1N8RC 4DR6Q 4GKJQ 3CCQA 3I4NG 2OTLA 4OWWB 1SROA 4C3HH 2WFWA 4X66Q 4JI6L 4X64L 4POGA 2NVYH 4Y52H 3BZKA 1HZ9A 3M85A 2N78A 1Q86C 3PUWA 4L5TA 4BBRH 3CMEA 1PFSA 4OONA 2QNFA 4QJFA 4A3MH 3UDFA 2JA7H 3RLFA 5E7NA 2NN6I 3F2BA 1QUQA 4LF9Q 3S14H 2OTJA 1GM5A 2R7ZH 3KJOA 3I56A 2UXDL 4DV7Q 1V9PA 2PI2E 1VQBA 3PCOB 4DK6C 4ALPA 2AWNA 1Q7YC 1E7DA 1MIUA 2K5HA 1OXSC 2IHEA 1UE7A 3GO5A 4GN4B 1AE3A 3F1ZA 3J81j 3PIPA 4DUYL 1I6HH 3HOYH 3GTMH 1CKNA 5JJLA 1NMFA 4B3SQ 3TREA 3CF5A 1OXXK 2JQOA 3S16H 1AE2A 4JI3L 3STBC 4JI5Q 2KFVA 4LFAQ 4HIMA 1G291 2E8GA 5IP7H 3T1HL 1PH1A 2JE6I 4JI2L 1FJGL 5AJ3Q 1N32L 4YY3L 2HIXA 4BBSH 3ERSX 3UDGA 4DAMA 2YTXA 5C0XG 4HIKA 1V1QA 4YWLA 2Q2TA 4QY7A 2ASBA 4A93G 2VY3A 2MQHA 4P72A 3W5OA 1VQKA 1L2FA 4HJAA 1VQJA 2HHHL 1YBYA 5IYDG 4LF7L 1PH3A 1NBWA 1YNXA 2OCEA 1HJPA 2UUCL 5LMUL 2F52A 2K52A 3U58A 1CUKA 4JBJA 1WYDA 2JEBI 3MEFA 1X3GA 4R4IA 4A3IG 3CC4A 4IFDG 1N33L 4P75A 4DV0Q 4UP8A 1YEZA 2VQEL 1PH2A 3PO2H 2AMCB 3S17H 1RIPA 2IT1A 2CWPA 3KFUA 3A5UA 2DK4A 2D0PA 1N36Q 4JI7L 3A74A 3RLOA 1XNQQ 1MJEA 2ZTDA 4O2DA 1JB7A 4JI4Q 2NVTH 1UE1A 3F2CA 4DV3Q 4JI1Q 4GKKQ 5GADC 3ULLA 1LTLA 2BH2A 3FKIH 1VS0A 4DK3C 2NZOA 2BH8A 4JI0Q 1X6OA 2QA4A 3EBEA 4BY1G 3CXCA 4DR3L 2MFIA 2NVQH 3RZDH 3A5ZB 2E5LL 3PGZA 1L1OA 1HNXQ 1S40A 4A3EH 3UE1A 1VQ7A 4DV6L 3CD6A 2WB1G 3HOVH 1VQ9A 1VQGA 2LXJA 1I94Q 4JG2A 1MJCA 1PH8A 2JA7G 1Y1VH 5C44H 5M5XH 4JV5L 3PIOA 3KDFB 1XPUA 1Q1BA 2R7ZG 1YNSA 5M3MH 2R6GA 3L7ZC 4OWXB 2PQAB 2YTVA 4L5SA 4OXPA 2I5MX 1ZS9A 3JC66 1K9MC 1G6PA 3HOYG 2Z6KA 2L15A 4DR7L 1PH4A 1YZ6A 3TS0A 1Q8KA 4LF8Q 4DAYB 5IYBH 4DR2L 4A3BH 4PG3A 2UXBL 1TWGH 3S1MH 2Q2HA 2EXDA 3JAMc 3SGIA 2G80A 1MKHA 1UWVA 5C0XI 3T1YL 5IP7G 1NJIC 5FJ8H 1H9FA 1K8GA 1K8AC 1CKMA 2WAQE 1YJNA 4X62Q 1KC8C 4HJ8A 4J15A 4DV2L 2UU9Q 4BBSG 1EFWA 1VQLA 1HNWL 4LF6Q 1O7IA 4AIMA 2IX1A 1UE5A 2VNUD 5FLMH 3PUYA 1E7LA 4IFDI 1SN8A 3BJUA 4K0KQ 3S2HH 3KDFA 2UXCL 2ID0A 1TXYA 4IPHA 3UDXA 2JA8H 4A3DH 1C9OA 2EIFA 3GTQH 3UE0A 1HZCA 3OYYA 2F4VL 4YWKA 1NE3A 2ZTCA 1XMQL 4AQYL 2JA9A 1P16A 1X3FA 4LFCL 2CFMA 1L0WA 3CCSA 4OX9L 4JYAL 3PO2G 4B3RL 1IBML 4LF4L 2ATWA 2WAQG 1XNRQ 4X66L 1H9EA 4LFBL 2ALYB 4R4TA 4LUVA 3ULJA 2ZJPA 4B3MQ 5IYCH 1YITA 1PYBA 1IBLQ 2Z0SA 3GTJH 3CCEA 2ODCI 3K81C 5LMNQ 4LW1A 4EQ5A 3FKIG 4IPDA 1JEIA 3DLLA 4BY7H 2YTYA 4GN3B 5IP9H 5BR8Q 4DV1L 3RN5A 3W1BA 2JJQA 4BXXH 4A3CG 4OO1G 1A0IA 2BA0A 2DGYA 3PV0A 2R92G 4GLXA 4X65Q 2LD7A 3RR5A 2KCTA 4A3GG 3GTOH 1Q1EA 1G51A 2HIVA 2VQFQ 4YCWA 3HOVG 4A3LH 2VUMH 1IBKL 3IRBA 4JI8L 1HR0W 1I3QH 1Y1VG 5C44G 2MNAA 2FXQA 4A3JH 2UUBQ 5M3MG 4WJ4A 4IJHA 1J5EL 1U0LA 4QQBX 1AH9A 5ELOA 4DUZQ 1XJVA 5GROA 4HJ5A 3KF6B 4LNQA 1OXUA 4A3BG 3CCJA 2W51A 3I7FA 4MZ9A 2R93H 4IO9A 1VCIA 1UE6A 2H5XA 1Q46A 1VQFA 1SR3A 3M4PA 5FJ8G 5M3FH 2B63H 3GTLH 4A3FH 1XMOQ 1VQHA 4KHPL 2OWOA 1X3EA 1QZGA 4JI6Q 4X64Q 5JJIA 1Y14B 3U4VA 3GDEA 2IHFA 2MO0A 4DV5L 4YCVA 1HZAA 1K3RA 4DV4L 1HNZL 1GKUB 3G71A 4IPCA 5HGQA 5FLMG 3CMAA 2K4KA 2YYZA 3U4ZA 1KIXA 5C4XG 2IY5B 2KHJA 4DR4Q 1H95A 1IL2A 1VQMA 2VZAA 2ZTEA 2JA8G 4A3DG 2I5HA 1D7QA 2UXDQ 4JI1L 4PZ6A 1E1OA 3STBD 3KF6A 3CQZH 1KL9A 4DUYQ 2LSSA 4X6AH 3M4QA 3H3VH 3M9BA 3RLNA 4C3IH 3TRZA 4APVA 2E2HH 3HOZH 4JI3Q 5C4JH 3AFPA 4IJLA 4DR5L 1N34L 1GVPA 1SMXA 4JOIC 2MO1A 4MTNA 4JI2Q 3T1HQ 1FJGQ 2JA6H 2AHOB 5C3EG 1N32Q 4YY3Q 3TEHB 4NXNL 3K8AA 3J81c 1QVFA 4OO1I 5K36G 2N8NA 2YU9H 2BA1A 1EIYB 2JA5H 3KYHC 3TS2A 4BY7G 2JEAI 1E7ZA 3FP9A 3ZJYC 5IP9G 1K73C 1BKBA 1B7YB 4KHZA 3I4MH 1EIFA 2HHHQ 3S1NH 3H0GH 4BXXG 1U5KA 2Q2UA 4LF7Q 5ELNA 3PSIA 1W2BA 2ZJQA 4JBMA 2UUCQ 1D8LA 3BZCA 4BBRG 5LMUQ 3I2ZA 4A3MG 5DLQE 5H1SE 3K80C 5GAGC 1N33Q 2ZJRA 4P73A 5IWAL 2HJQA 4QL5A 2VUMG 4A3LG 4R4CA 4C3JH 1EWIA 2HQLA 1KXLA 1Y02A 1YHQA 1GL9B 2GN5A 3KJPA 1JJGA 5GQOA 4RG1A 2UUAQ 3PF4A 4A3JG 3W1GA 4JBWA 1PH6A 4JI7Q 2K50A 1FL0A 5J3BA 4DR1L 1M90C 1V43A 4K0KL 4LF5L 4LUZA 1Q81C 1X56A 4EX5A 1ASYA 4UY8C 2E2IH 3F8TA 4DR3Q 3D31A 2NVXH 2ZM6L 1X55A 3KOJA 4A3FG 4NXML 2E5LQ 3HOUH 4LWCA 2E2JH 1NTGA 5IE8A 4B3TL 3EIVA 1HH2P 4DV6Q 4GOPC 4HJ9A 3J80c 1WJJA 3I55A 1X9NA 3L2PA 2PI2A 2PQAA 3M3YH 1CSQA 3A0JA 1PYSB 1HR0L 1EOVA 3ULPA 2K5NA 4JV5Q 1JT8A 3S1RH 1KHIA 1L1OC 4KI0A 4C2MH 3RN2A 1ASZA 2ES2A 4GKJL 4P74A 4DR6L 1C0AA 3ER0A 3AEVA 3L0OA 4H02A 4BA1I 4DR7Q 2UXBQ 1XTDA 3OTOQ 1Z9FA 1TWHH 2WP8J 4DR2Q 3U50C 3RZOH 1WCMH 2LXKA 3JAMi 4R1JA 3OW2A 3T1YQ 2QNCA 1C7YA 3HKSA 3RNUA 2JA6G 4GNXC 1A62A 2A19A 4LF9L 2Y0SE 2RHSB 3K7AH 1VQPA 4DV2Q 1FGUA 3HKZE 2OQ0A 1EQRA 4AH6A 3CPWA 4DV7L 4YHHQ 4HIDA 1HNWQ 1JJCB 2JA5G 3KF8B 2I5LX 1Z47A 4GLAC 1R9TH 1EQQA 4A3EG 1TWCH 1WI5A 2AKWB 4JC0A 3J80i 4B3SL 2UXCQ 3H0GG 2I0QA 1TWFH 1GO3E 1KD1C 1VQOA 2VS1A 3K7UC 4JI5L 1PH7A 4LFAL 1UEBA 3CP0A 2F4VQ 1XMQQ 3NBHB 4AQYQ 1QZHA 1NMGA 4LFCQ 4OX9Q 5AJ3L 4JBKA 4BY1H 4JYAQ 4AYBE 4UP9A 2MPHA 4B3RQ 1OXTA 1YHAA 5LMNW 1IBMQ 2YV5A 3UDIA 4DNIA 4LF4Q 4GLVB 4GS3A 4LFBQ 1M1KC 2Y0SG 4GN5A 3HKZG 3E9IA 4WJ3M 5IYBG 4IOAA 3EN2A 4OWTB 3H15A 3DM3A 4R4QA 1EYGA 1PV4A 1PHJA 4DR4L 4L5RC 4JOIA 2K14A 5IT9c 4DV1Q 2CCZA 2K5VA 1VQEA 4DV0L 3GTGH 1X54A 2JK8A 1YIJA 1XPOA 3HOUG 1KQSA 3S2DH 2KCMA 3Q8DA 3GTKH 1IYJB 4HJ7A 3TQYA 3PO3H 4AYBG 1N36L 4Y7NH 1SE8A 1B70B 1XNQL 2PNHA 3B6YA 3MXNB 1NY4A 1IBKQ 4JI4L 1E22A 4DV3L 4GKKL 1FVIA 4JI8Q 1A63A 3AYHB 1VQDA 3H3VI 1Y1WH 4JI0L 2VW9A 3NENA 2GVAA 1K0RA 4GOPB 1J5EQ 1VQIA 2K75A 4PMWA 3HOXH 4A75A 3CC7A 1GJJA 4JCVE 1HNXL 2PMZE 3M4OH 4XIGS 4TQUS 2R7DA 3PUZA 3E0EA 5JJKA 5IYCG 3NELA 5GAEC 1WCMG 2NZHA 2RF4A 1XPRA 3S1QH 1L1OB 4FDBA 4R4OA 4IOCA 4A4IA 1I94L 3PUXA 3CC2A 4KHPQ 2Q2IA 3K0XA 3S15H 4HIOA 3J7ZC 2A8VA 2R7FA 2QGQA 4QIWE 4A3KH 1OTCA 1I50H 2CKZB 2WB1E 2N49A 3CW2C 4DV5Q 3CAMA 4DV4Q 1HNZQ 4PZ8A 1PH5A 3HOWH 4MNOA 2UUAL 2N3SA 2RCNA 5FLXc 5IY0A 1BBUA 2F3IA 4LF8L 4O0AA 2A1AA 4GNXB 1PH9A 1E24A 5JEAG 4GOPA 1Q82C 5IYDH 4P71A 1BBWA 1X65A 1VQAA 2AWOA 3LGJA 2VQEQ 1PVOA 2CQOA 3I4NH 4L5QA 3PF5A 1VQ8A 4UPAA 1P8LA 4UP7A 4PZ7A 4X62L 3J7A5 1EN7A 2UU9L 5M5YH 4A3CH 5C0XJ 2R92H 2LC3A 1GKHA 4LF6L 5GAHC 1SLJA 4DR5Q 1N34Q 4A3GH 1RL2A 4NB3A 3E9HA 1J6QA 1A8VA 2EQSA 4ME3A 3G4SA 2OQKA 3CCVA 3FHWA 2R93G 3F2DA 1N9WA 1JJ2A 3ICEA 3WWVA 3S24A 3J81i 2GVBA 4DPGA 5M3FG 1JE5A 1QVGA 4NXNQ 3CCRA 2B63G 4XTCS 3KLWA 1CSPA 3AFQA 1VQ5A 4IFDJ 1T9HA 2KENA 2NN6G 2KBNA 3HFZB 4GNXA 1TWAH 3NEMA 5EAYA 2DUDA 1OXVA 2QEXA 2ODGC 1LUZA 1XNRL 1S3OA 2V1CC 4RMFA 3CCMA 3PO3G 3PUVA 5HY6A 1VQ6A 3BU2A 1WOCA 1SFOH 3OTOL 4B3ML 1S72A 1VQNA 5IWAQ 1IBLL 1PA6A 5JEAJ 5LMNL 5C4XH 1YI2A 4A93H 3VDYA 4A76A 3CPFA 1KRSA 1QVCA 2XTIA 1CKOA 1EUJA 1K83H 1Y1WG 5BR8L 1YHBA 3G48A 1Q12A 1IZ6A 4YHHL 1VQ4A 3HOZG 3HOXG 1DGSA 2HT1A 4DR1Q 4NPSA 3CCLA 4POFA 4LUOA 4X65L 4IPGA 2XGTA 1GD7A 2D62A 1E3PA 4A3IH 4LF5Q 2VQFL 1YVCA 3GTPH 1I5FA 4QGUA 1LM0A 1YJ9A 4TVAB 1W3SA 2IX0A 2D0OA 3GD7A 4DKAC 2ZM6Q 3D0FA 1VQCA 4YCUA 4NXMQ 4BA2I 4KLKA 2Z6KC 4B3TQ 1JMCA 4A3KG 5M5WH 2UUBL 1QUQB 2KHIA 2RHQB 2C35B 3I4MG 1SRUA 3HOWG 2B29A 3G6EA 1E1TA 4DUZL 1YJWA 1B8AA 2VL6A 1IXRA 1KRTA 3CCUA 1HR0Q 1BVSA 1CKNB 1KAWA 5C3EH 4YWMA 3M7NA 3AQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4O A;  1LYL A;  1HZB A;  2CWA A;  2B3G A;  1XMO L;  1WFQ A;  1N8R C;  4DR6 Q;  4GKJ Q;  3CCQ A;  3I4N G;  2OTL A;  4OWW B;  1SRO A;  4C3H H;  2WFW A;  4X66 Q;  4JI6 L;  4X64 L;  4POG A;  2NVY H;  4Y52 H;  3BZK A;  1HZ9 A;  3M85 A;  2N78 A;  1Q86 C;  3PUW A;  4L5T A;  4BBR H;  3CME A;  1PFS A;  4OON A;  2QNF A;  4QJF A;  4A3M H;  3UDF A;  2JA7 H;  3RLF A;  5E7N A;  2NN6 I;  3F2B A;  1QUQ A;  4LF9 Q;  3S14 H;  2OTJ A;  1GM5 A;  2R7Z H;  3KJO A;  3I56 A;  2UXD L;  4DV7 Q;  1V9P A;  2PI2 E;  1VQB A;  3PCO B;  4DK6 C;  4ALP A;  2AWN A;  1Q7Y C;  1E7D A;  1MIU A;  2K5H A;  1OXS C;  2IHE A;  1UE7 A;  3GO5 A;  4GN4 B;  1AE3 A;  3F1Z A;  3J81 j;  3PIP A;  4DUY L;  1I6H H;  3HOY H;  3GTM H;  1CKN A;  5JJL A;  1NMF A;  4B3S Q;  3TRE A;  3CF5 A;  1OXX K;  2JQO A;  3S16 H;  1AE2 A;  4JI3 L;  3STB C;  4JI5 Q;  4LFA Q;  4HIM A;  1G29 1;  2E8G A;  5IP7 H;  3T1H L;  1PH1 A;  2JE6 I;  4JI2 L;  1FJG L;  5AJ3 Q;  1N32 L;  4YY3 L;  2HIX A;  4BBS H;  3ERS X;  3UDG A;  4DAM A;  2YTX A;  5C0X G;  4HIK A;  1V1Q A;  4YWL A;  2Q2T A;  4QY7 A;  2ASB A;  4A93 G;  2VY3 A;  2MQH A;  4P72 A;  3W5O A;  1VQK A;  1L2F A;  4HJA A;  1VQJ A;  2HHH L;  1YBY A;  5IYD G;  4LF7 L;  1PH3 A;  1NBW A;  1YNX A;  2OCE A;  1HJP A;  2UUC L;  5LMU L;  2F52 A;  2K52 A;  3U58 A;  1CUK A;  4JBJ A;  1WYD A;  2JEB I;  3MEF A;  1X3G A;  4R4I A;  4A3I G;  3CC4 A;  4IFD G;  1N33 L;  4P75 A;  4DV0 Q;  4UP8 A;  1YEZ A;  2VQE L;  1PH2 A;  3PO2 H;  2AMC B;  3S17 H;  1RIP A;  2IT1 A;  2CWP A;  3KFU A;  3A5U A;  1N36 Q;  2D0P A;  4JI7 L;  3A74 A;  3RLO A;  1XNQ Q;  1MJE A;  2ZTD A;  4O2D A;  1JB7 A;  4JI4 Q;  2NVT H;  1UE1 A;  3F2C A;  4DV3 Q;  4JI1 Q;  4GKK Q;  5GAD C;  3ULL A;  1LTL A;  2BH2 A;  3FKI H;  1VS0 A;  4DK3 C;  2NZO A;  2BH8 A;  4JI0 Q;  1X6O A;  2QA4 A;  3EBE A;  4BY1 G;  3CXC A;  4DR3 L;  2MFI A;  2NVQ H;  3RZD H;  3A5Z B;  2E5L L;  3PGZ A;  1L1O A;  1HNX Q;  1S40 A;  4A3E H;  3UE1 A;  1VQ7 A;  4DV6 L;  3CD6 A;  2WB1 G;  3HOV H;  1VQ9 A;  1VQG A;  2LXJ A;  1I94 Q;  4JG2 A;  1MJC A;  1PH8 A;  2JA7 G;  1Y1V H;  5C44 H;  5M5X H;  4JV5 L;  3PIO A;  3KDF B;  1XPU A;  1Q1B A;  2R7Z G;  5M3M H;  2R6G A;  3L7Z C;  4OWX B;  2PQA B;  2YTV A;  4L5S A;  4OXP A;  2I5M X;  3JC6 6;  1K9M C;  1G6P A;  3HOY G;  2Z6K A;  2L15 A;  4DR7 L;  1PH4 A;  1YZ6 A;  3TS0 A;  1Q8K A;  4LF8 Q;  4DAY B;  5IYB H;  4DR2 L;  4A3B H;  4PG3 A;  2UXB L;  1TWG H;  3S1M H;  2Q2H A;  2EXD A;  3JAM c;  3SGI A;  1MKH A;  1UWV A;  5C0X I;  3T1Y L;  1NJI C;  5IP7 G;  5FJ8 H;  1K8G A;  1K8A C;  1CKM A;  2WAQ E;  1YJN A;  4X62 Q;  1KC8 C;  4HJ8 A;  4J15 A;  4DV2 L;  2UU9 Q;  4BBS G;  1EFW A;  1VQL A;  1HNW L;  4LF6 Q;  1O7I A;  4AIM A;  2IX1 A;  1UE5 A;  2VNU D;  5FLM H;  3PUY A;  1E7L A;  4IFD I;  1SN8 A;  3BJU A;  4K0K Q;  3S2H H;  3KDF A;  2UXC L;  2ID0 A;  1TXY A;  4IPH A;  3UDX A;  2JA8 H;  4A3D H;  1C9O A;  2EIF A;  3GTQ H;  3UE0 A;  1HZC A;  3OYY A;  2F4V L;  4YWK A;  1NE3 A;  2ZTC A;  1XMQ L;  4AQY L;  2JA9 A;  1P16 A;  1X3F A;  4LFC L;  2CFM A;  1L0W A;  3CCS A;  4OX9 L;  4JYA L;  3PO2 G;  4B3R L;  1IBM L;  4LF4 L;  2ATW A;  2WAQ G;  1XNR Q;  4X66 L;  4LFB L;  2ALY B;  4R4T A;  4LUV A;  3ULJ A;  2ZJP A;  4B3M Q;  5IYC H;  1YIT A;  1PYB A;  1IBL Q;  2Z0S A;  3GTJ H;  3CCE A;  3K81 C;  5LMN Q;  4LW1 A;  4EQ5 A;  3FKI G;  4IPD A;  4BY7 H;  3DLL A;  2YTY A;  4GN3 B;  5IP9 H;  5BR8 Q;  4DV1 L;  3RN5 A;  3W1B A;  2JJQ A;  4BXX H;  4A3C G;  4OO1 G;  1A0I A;  2BA0 A;  2DGY A;  3PV0 A;  2R92 G;  4GLX A;  4X65 Q;  3RR5 A;  2KCT A;  4A3G G;  3GTO H;  1Q1E A;  1G51 A;  2HIV A;  2VQF Q;  4YCW A;  3HOV G;  4A3L H;  2VUM H;  1IBK L;  3IRB A;  4JI8 L;  1HR0 W;  1I3Q H;  1Y1V G;  5C44 G;  2MNA A;  2FXQ A;  4A3J H;  2UUB Q;  5M3M G;  4WJ4 A;  4IJH A;  1J5E L;  1U0L A;  4QQB X;  1AH9 A;  5ELO A;  4DUZ Q;  1XJV A;  5GRO A;  4HJ5 A;  3KF6 B;  4LNQ A;  1OXU A;  4A3B G;  3CCJ A;  3I7F A;  4MZ9 A;  2R93 H;  4IO9 A;  1VCI A;  1UE6 A;  2H5X A;  1Q46 A;  1VQF A;  1SR3 A;  3M4P A;  5FJ8 G;  5M3F H;  2B63 H;  3GTL H;  4A3F H;  1XMO Q;  1VQH A;  4KHP L;  2OWO A;  1X3E A;  1QZG A;  4JI6 Q;  4X64 Q;  5JJI A;  1Y14 B;  3U4V A;  3GDE A;  2IHF A;  2MO0 A;  4DV5 L;  4YCV A;  1HZA A;  1K3R A;  4DV4 L;  1HNZ L;  3G71 A;  4IPC A;  5HGQ A;  5FLM G;  3CMA A;  2K4K A;  2YYZ A;  3U4Z A;  1KIX A;  5C4X G;  2IY5 B;  2KHJ A;  4DR4 Q;  1H95 A;  1IL2 A;  1VQM A;  2VZA A;  2ZTE A;  2JA8 G;  4A3D G;  2I5H A;  1D7Q A;  2UXD Q;  4JI1 L;  4PZ6 A;  1E1O A;  3STB D;  3KF6 A;  3CQZ H;  1KL9 A;  4DUY Q;  2LSS A;  4X6A H;  3M4Q A;  3H3V H;  3M9B A;  3RLN A;  4C3I H;  3TRZ A;  4APV A;  2E2H H;  3HOZ H;  4JI3 Q;  5C4J H;  3AFP A;  4IJL A;  4DR5 L;  1N34 L;  1GVP A;  1SMX A;  4JOI C;  2MO1 A;  4MTN A;  4JI2 Q;  3T1H Q;  1FJG Q;  2JA6 H;  2AHO B;  5C3E G;  1N32 Q;  4YY3 Q;  3TEH B;  4NXN L;  3K8A A;  3J81 c;  1QVF A;  4OO1 I;  5K36 G;  2N8N A;  2YU9 H;  2BA1 A;  1EIY B;  2JA5 H;  3KYH C;  3TS2 A;  4BY7 G;  2JEA I;  1E7Z A;  3FP9 A;  3ZJY C;  5IP9 G;  1K73 C;  1BKB A;  1B7Y B;  4KHZ A;  3I4M H;  1EIF A;  2HHH Q;  3S1N H;  3H0G H;  4BXX G;  1U5K A;  2Q2U A;  4LF7 Q;  5ELN A;  3PSI A;  1W2B A;  2ZJQ A;  4JBM A;  2UUC Q;  1D8L A;  3BZC A;  4BBR G;  5LMU Q;  3I2Z A;  4A3M G;  5DLQ E;  5H1S E;  3K80 C;  5GAG C;  1N33 Q;  2ZJR A;  4P73 A;  5IWA L;  2HJQ A;  4QL5 A;  2VUM G;  4A3L G;  4R4C A;  4C3J H;  1EWI A;  2HQL A;  1KXL A;  1YHQ A;  2GN5 A;  3KJP A;  1JJG A;  5GQO A;  4RG1 A;  2UUA Q;  3PF4 A;  4A3J G;  3W1G A;  4JBW A;  1PH6 A;  4JI7 Q;  2K50 A;  1FL0 A;  5J3B A;  4DR1 L;  1M90 C;  1V43 A;  4K0K L;  4LF5 L;  4LUZ A;  1Q81 C;  1X56 A;  4EX5 A;  1ASY A;  4UY8 C;  2E2I H;  3F8T A;  4DR3 Q;  3D31 A;  2NVX H;  2ZM6 L;  1X55 A;  3KOJ A;  4A3F G;  4NXM L;  2E5L Q;  3HOU H;  4LWC A;  2E2J H;  1NTG A;  5IE8 A;  4B3T L;  3EIV A;  1HH2 P;  4DV6 Q;  4GOP C;  4HJ9 A;  3J80 c;  1WJJ A;  3I55 A;  1X9N A;  3L2P A;  2PI2 A;  2PQA A;  3M3Y H;  1CSQ A;  3A0J A;  1PYS B;  1HR0 L;  1EOV A;  3ULP A;  2K5N A;  4JV5 Q;  1JT8 A;  3S1R H;  1KHI A;  1L1O C;  4KI0 A;  4C2M H;  3RN2 A;  1ASZ A;  2ES2 A;  4GKJ L;  4P74 A;  4DR6 L;  1C0A A;  3ER0 A;  3AEV A;  3L0O A;  4H02 A;  4BA1 I;  4DR7 Q;  2UXB Q;  1XTD A;  3OTO Q;  1Z9F A;  1TWH H;  2WP8 J;  4DR2 Q;  3U50 C;  3RZO H;  1WCM H;  2LXK A;  3JAM i;  4R1J A;  3OW2 A;  3T1Y Q;  2QNC A;  1C7Y A;  3HKS A;  3RNU A;  2JA6 G;  4GNX C;  1A62 A;  2A19 A;  4LF9 L;  2Y0S E;  2RHS B;  3K7A H;  1VQP A;  4DV2 Q;  1FGU A;  3HKZ E;  2OQ0 A;  1EQR A;  4AH6 A;  3CPW A;  4DV7 L;  4YHH Q;  4HID A;  1HNW Q;  1JJC B;  2JA5 G;  3KF8 B;  2I5L X;  1Z47 A;  4GLA C;  1R9T H;  1EQQ A;  4A3E G;  1TWC H;  1WI5 A;  2AKW B;  4JC0 A;  3J80 i;  4B3S L;  2UXC Q;  3H0G G;  2I0Q A;  1TWF H;  1GO3 E;  1KD1 C;  1VQO A;  2VS1 A;  3K7U C;  4JI5 L;  1PH7 A;  4LFA L;  1UEB A;  3CP0 A;  2F4V Q;  1XMQ Q;  3NBH B;  4AQY Q;  1QZH A;  1NMG A;  4LFC Q;  4OX9 Q;  5AJ3 L;  4JBK A;  4BY1 H;  4JYA Q;  4AYB E;  4UP9 A;  4B3R Q;  1OXT A;  1YHA A;  5LMN W;  1IBM Q;  2YV5 A;  3UDI A;  4DNI A;  4LF4 Q;  4GLV B;  4GS3 A;  4LFB Q;  1M1K C;  2Y0S G;  4GN5 A;  3HKZ G;  3E9I A;  4WJ3 M;  5IYB G;  4IOA A;  3EN2 A;  4OWT B;  3H15 A;  3DM3 A;  4R4Q A;  1EYG A;  1PV4 A;  1PHJ A;  4DR4 L;  4L5R C;  4JOI A;  2K14 A;  5IT9 c;  4DV1 Q;  2CCZ A;  2K5V A;  1VQE A;  4DV0 L;  3GTG H;  1X54 A;  2JK8 A;  1YIJ A;  1XPO A;  3HOU G;  1KQS A;  3S2D H;  2KCM A;  3Q8D A;  3GTK H;  1IYJ B;  4HJ7 A;  3TQY A;  3PO3 H;  4AYB G;  1N36 L;  4Y7N H;  1SE8 A;  1B70 B;  1XNQ L;  2PNH A;  3B6Y A;  3MXN B;  1NY4 A;  1IBK Q;  4JI4 L;  1E22 A;  4DV3 L;  4GKK L;  1FVI A;  4JI8 Q;  1A63 A;  3AYH B;  1VQD A;  3H3V I;  1Y1W H;  4JI0 L;  2VW9 A;  3NEN A;  2GVA A;  1K0R A;  4GOP B;  1J5E Q;  1VQI A;  2K75 A;  4PMW A;  3HOX H;  4A75 A;  3CC7 A;  4JCV E;  1HNX L;  2PMZ E;  3M4O H;  4XIG S;  4TQU S;  2R7D A;  3PUZ A;  3E0E A;  5JJK A;  5IYC G;  3NEL A;  5GAE C;  1WCM G;  2NZH A;  2RF4 A;  1XPR A;  3S1Q H;  1L1O B;  4FDB A;  4R4O A;  4IOC A;  4A4I A;  1I94 L;  3PUX A;  3CC2 A;  4KHP Q;  2Q2I A;  3K0X A;  3S15 H;  4HIO A;  3J7Z C;  2A8V A;  2R7F A;  2QGQ A;  4QIW E;  4A3K H;  1OTC A;  1I50 H;  2CKZ B;  2WB1 E;  2N49 A;  3CW2 C;  4DV5 Q;  3CAM A;  4DV4 Q;  1HNZ Q;  4PZ8 A;  1PH5 A;  3HOW H;  4MNO A;  2UUA L;  2N3S A;  2RCN A;  5FLX c;  5IY0 A;  1BBU A;  2F3I A;  4LF8 L;  4O0A A;  2A1A A;  4GNX B;  1PH9 A;  1E24 A;  5JEA G;  4GOP A;  1Q82 C;  5IYD H;  4P71 A;  1BBW A;  1X65 A;  1VQA A;  2AWO A;  3LGJ A;  2VQE Q;  1PVO A;  2CQO A;  3I4N H;  4L5Q A;  3PF5 A;  1VQ8 A;  4UPA A;  1P8L A;  4UP7 A;  4PZ7 A;  4X62 L;  3J7A 5;  1EN7 A;  2UU9 L;  5M5Y H;  4A3C H;  5C0X J;  2R92 H;  1GKH A;  4LF6 L;  5GAH C;  1SLJ A;  4DR5 Q;  1N34 Q;  4A3G H;  1RL2 A;  4NB3 A;  3E9H A;  1J6Q A;  1A8V A;  2EQS A;  4ME3 A;  3G4S A;  2OQK A;  3CCV A;  3FHW A;  2R93 G;  3F2D A;  1N9W A;  1JJ2 A;  3ICE A;  3WWV A;  3S24 A;  3J81 i;  2GVB A;  4DPG A;  5M3F G;  1JE5 A;  1QVG A;  4NXN Q;  3CCR A;  2B63 G;  4XTC S;  3KLW A;  1CSP A;  3AFQ A;  1VQ5 A;  4IFD J;  1T9H A;  2KEN A;  2NN6 G;  2KBN A;  3HFZ B;  4GNX A;  1TWA H;  3NEM A;  5EAY A;  2DUD A;  1OXV A;  2QEX A;  1LUZ A;  1XNR L;  1S3O A;  2V1C C;  4RMF A;  3CCM A;  3PO3 G;  3PUV A;  5HY6 A;  1VQ6 A;  3BU2 A;  1WOC A;  1SFO H;  3OTO L;  4B3M L;  1S72 A;  1VQN A;  5IWA Q;  1IBL L;  1PA6 A;  5JEA J;  5LMN L;  5C4X H;  1YI2 A;  4A93 H;  3VDY A;  4A76 A;  3CPF A;  1KRS A;  1QVC A;  2XTI A;  1CKO A;  1EUJ A;  1K83 H;  1Y1W G;  5BR8 L;  1YHB A;  3G48 A;  1Q12 A;  1IZ6 A;  4YHH L;  1VQ4 A;  3HOZ G;  3HOX G;  1DGS A;  2HT1 A;  4DR1 Q;  4NPS A;  3CCL A;  4POF A;  4LUO A;  4X65 L;  4IPG A;  2XGT A;  1GD7 A;  2D62 A;  1E3P A;  4A3I H;  4LF5 Q;  2VQF L;  1YVC A;  3GTP H;  1I5F A;  4QGU A;  1LM0 A;  1YJ9 A;  4TVA B;  1W3S A;  2IX0 A;  2D0O A;  3GD7 A;  4DKA C;  2ZM6 Q;  3D0F A;  1VQC A;  4YCU A;  4NXM Q;  4BA2 I;  4KLK A;  2Z6K C;  4B3T Q;  1JMC A;  4A3K G;  5M5W H;  2UUB L;  1QUQ B;  2KHI A;  2RHQ B;  2C35 B;  3I4M G;  1SRU A;  3HOW G;  2B29 A;  3G6E A;  1E1T A;  4DUZ L;  1YJW A;  1B8A A;  2VL6 A;  1IXR A;  1KRT A;  3CCU A;  1HR0 Q;  1BVS A;  1CKN B;  1KAW A;  5C3E H;  4YWM A;  3M7N A;  3AQQ A; 
#chains in the Genus database with same CATH topology
 2B8F A;  2B3G A;  5J39 A;  1N8R C;  4DR6 Q;  3S2D B;  3I4N G;  1FYC A;  4JI6 L;  4Y52 H;  1U4P A;  5EQ0 A;  3M85 A;  2EY6 A;  1Q86 C;  3V2T A;  4L5T A;  3SHL A;  4BBR H;  4RWS C;  2JA7 H;  3FLG A;  3RLF A;  5E7N A;  1Y1W B;  4KN7 C;  2OTJ A;  3S14 H;  4B9X A;  3KJO A;  4DV7 Q;  3HOZ B;  4KHZ A;  3GO5 A;  1WTH A;  1UE7 A;  5C4J B;  4DUY L;  3PIP A;  1JC7 A;  5JJL A;  1OXX K;  2JQO A;  1AE2 A;  5EBC A;  2KFV A;  4QCL A;  4LFA Q;  2E8G A;  5IP7 H;  1PH1 A;  1BCP D;  2LMC B;  4NMZ A;  4KKT A;  3OW7 A;  1N32 L;  2L4N A;  3ERS X;  3I4M B;  5C4X G;  1HRJ A;  4YWL A;  1U4M A;  2MQH A;  2OXP A;  4KK7 A;  4HJA A;  4ZUI A;  3SK5 A;  5FLX L;  1NBW A;  1YNX A;  2OCE A;  3NE5 B;  5LMU L;  1H1J S;  2F52 A;  1CUK A;  1HFN A;  3OMC A;  4QB4 A;  2EYM A;  5E1F A;  1R4Q B;  1SNM A;  4DV0 Q;  3OPO A;  4CKE A;  1YEZ A;  2AMC B;  1RIP A;  2D0P A;  3RLO A;  2WIN B;  2A68 D;  2ZTD A;  5IGD A;  1ONL A;  4O2D A;  5EKI A;  2E2I B;  3UI2 A;  2NVX B;  3F2C A;  4JI1 Q;  5GAD C;  2B8G A;  1LTL A;  1VS0 A;  3OWE B;  4BY1 G;  3RZD H;  3A5Z B;  2Q8R E;  3PGZ A;  1CT1 D;  1L1O A;  4C3H G;  1JB3 A;  1ESF A;  1M8A A;  4DV6 L;  3CD6 A;  4FF3 A;  4R8I A;  3HOV H;  1EZ6 A;  4C2M B;  5C44 H;  3PIO A;  1B9N A;  3QB3 A;  3HEJ A;  2PQA B;  3L9A X;  2YTV A;  4V0B A;  3JC6 6;  2Z6K A;  1SDF A;  1YZ6 A;  3I8Z A;  1TY0 A;  3NHH A;  3T1Y L;  1NJI C;  5FJ8 H;  1LTA D;  1JCK B;  1H9F A;  1GHK A;  2WAQ E;  3RMH A;  1EFW A;  1VQL A;  1HNW L;  1KAB A;  2OF1 A;  1JWS D;  2PMZ B;  3BJU A;  2RA4 A;  5C6A A;  1V8Q A;  1NR2 A;  4BY1 B;  1Z7T A;  4A3D H;  1C9O A;  3OYY A;  5COY A;  1NE3 A;  1XPR A;  4C3H B;  2L11 A;  1P16 A;  4OX9 L;  3CCS A;  4JYA L;  2X6G A;  1HTL D;  3PO2 G;  5A35 A;  1IBM L;  3NP8 A;  3FPP A;  4QUC A;  1XNR Q;  4X66 L;  2G9H D;  3ULJ A;  2DNE A;  4ZRZ A;  5IYC H;  1PYB A;  2L5T A;  4IZ8 A;  5LL6 S;  2ODC I;  3DEP A;  5K36 H;  3FKI G;  4MTK A;  3C2P A;  4BY7 H;  3CRL C;  3GTK B;  3T53 B;  5BR8 Q;  3PO3 B;  4CHT B;  2EY5 A;  4BXX H;  3S16 B;  2BA0 A;  3PV0 A;  2R92 G;  2LD7 A;  2B2Y C;  1EY7 A;  2VQF Q;  4K2K A;  4WOR A;  3IRB A;  3LWU A;  1HR0 W;  1I3Q H;  4IUV A;  1TS5 A;  1U0L A;  4QQB X;  4G7Z C;  4ULL A;  3IKJ A;  5GRO A;  3S1Q B;  3R2I A;  1F9S A;  1QCB D;  3S15 B;  3I7F A;  4MZ9 A;  3LLR A;  1F2Y A;  1SYG A;  1SXT A;  4IQZ A;  5ELF A;  4IO9 A;  2H5X A;  2R93 H;  1WD0 A;  2KCC A;  5M3F H;  3M4P A;  5JPN C;  2B63 H;  5E4W C;  2FIN B;  3PO2 B;  1XMO Q;  1VQH A;  2MGS A;  4X3U A;  3E3X A;  4CKB A;  3MC0 B;  1PLF A;  3EQL C;  5JJI A;  3SVM A;  1Y14 B;  3LNN A;  2IHF A;  1HZA A;  3E6Z X;  1HNZ L;  3G71 A;  5FLM G;  3CMA A;  3U4Z A;  3FKI B;  4DR4 Q;  1AZQ A;  3A55 A;  1D1K A;  2JA8 G;  2I5H A;  4L8J A;  2F3W A;  4ZK9 B;  4PZ6 A;  2R92 B;  1KL9 A;  1EQV A;  1LAB A;  1CI3 M;  3QIA A;  4UHV A;  2MUY A;  5FO8 B;  5M9O A;  3T1H Q;  1SMX A;  4MTN A;  2MO1 A;  1FJG Q;  2F4I A;  3VYS A;  1QVF A;  1F9Q A;  1EYC A;  2YU9 H;  3KYH C;  2HDM A;  2AUK A;  4DNR B;  4N8F A;  1B7Y B;  4CBV A;  2HHH Q;  1E0B A;  3H0G H;  1TWG B;  2F0O A;  5KYL A;  2K33 A;  3I70 A;  1W2B A;  5EKL A;  2ZJQ A;  2UUC Q;  3S1M B;  2DY7 A;  4BBR G;  2F0D A;  5D3I B;  1Q8I A;  2Z4H A;  5DLQ E;  1K28 A;  2F3V A;  3H6M A;  1AZP A;  1EOT A;  2ZJR A;  4P73 A;  2K03 A;  2HJQ A;  2CVR A;  2K04 A;  4R4C A;  2VUM G;  5CGK A;  1YHQ A;  5CV8 A;  2GN5 A;  5GQO A;  1MI2 A;  4RG1 A;  1WTP A;  3OOC A;  2J0T D;  4UAI A;  4A3J G;  4M8A A;  4JBW A;  1PH6 A;  2K50 A;  3ERO A;  2SEB D;  1FL0 A;  3GTP B;  1HTP A;  3GTQ B;  3QR8 A;  4K0K L;  4LF5 L;  1G2S A;  4EX5 A;  1FGB D;  5M5W B;  3D31 A;  4NXM L;  2E5L Q;  3HOU H;  1LT3 D;  1QNU A;  1ZYR D;  1BCP B;  1NTG A;  1PTO C;  3VR2 A;  4X3S A;  1EY6 A;  3D6C A;  3CHB D;  3M3Y H;  1CSQ A;  2DJF C;  1PYS B;  1W6J A;  3P7J A;  4C56 C;  5CC4 A;  1L1O C;  4DAY A;  1V1P B;  4P74 A;  4DA2 A;  1H9K A;  4DR6 L;  4BBR B;  3L0O A;  3GTO B;  4HMI A;  2EY2 A;  4C3I G;  1TWH H;  2F0I A;  3DUZ A;  3AU7 A;  4DXG A;  1B3A A;  4HCS A;  1F2L A;  3OW2 A;  1R4P B;  3CRK C;  1A62 A;  4FF2 A;  4A3J B;  2N88 A;  3HKZ E;  2OQ0 A;  1EQR A;  4AH6 A;  4DV7 L;  4YHH Q;  2PYK A;  3KF8 B;  5DAU A;  2JA5 G;  2O5J C;  1E2W A;  3R3O A;  4H0L C;  2AKW B;  1TWF H;  3ND8 A;  4CJ1 B;  1VQO A;  1H9R A;  1A2T A;  3K7U C;  4LFA L;  3MZ5 A;  1NMG A;  4C3J G;  4UP9 A;  2MPH A;  5JJZ A;  3X3N A;  2XN9 C;  4V19 0;  3VYR A;  3HZX A;  4IOA A;  4FF1 A;  4OWT B;  3H15 A;  3DM3 A;  1XWE A;  1EYG A;  4IN3 A;  1PHJ A;  2K14 A;  2CCZ A;  4DV0 L;  4K14 A;  2JK8 A;  4C3I B;  1QE6 A;  1ZBH A;  3S2D H;  4BIT A;  2KCM A;  1CQF A;  1Q90 A;  5DM7 3;  1I4P A;  4DK1 A;  3MWY W;  4KKS A;  5KNB A;  1EEI D;  4Y7N H;  3MXN B;  4MHE A;  1IBK Q;  3RZD B;  1NAP A;  4JI8 Q;  1A63 A;  3AYH B;  2JA5 B;  3QG1 A;  3Q22 A;  3H3V I;  1Y1W H;  2GVA A;  1K0R A;  5ISR A;  2FMM A;  4PMW A;  1ZKO A;  2IWH A;  4Q0F A;  3HOV B;  1DD2 A;  3TDQ A;  2PMZ E;  1H9S B;  2PW5 A;  3PUZ A;  1CA6 A;  2VXW A;  3KLR A;  5IYC G;  1VF7 A;  3NEL A;  3BVM A;  2RF4 A;  4FDB A;  4IOC A;  3PUX A;  2MPM A;  2XNA C;  4O42 A;  2AUJ D;  2K5Q A;  4HIO A;  3WDN A;  1LTS D;  4BS9 A;  4A3K H;  4DV5 Q;  4DV4 Q;  3VR4 A;  2UUA L;  2N3S A;  2M00 A;  5CIU A;  5IY0 A;  5DEH A;  3VR6 A;  1PH9 A;  4NP5 A;  1E24 A;  5IYD H;  1X65 A;  4WFN 3;  1HA5 A;  2RSN A;  3MAQ A;  4M1U B;  3I4N H;  1P8L A;  3H3V C;  3J7A 5;  5M5Y H;  1YNJ C;  1SLJ A;  1RDP D;  3E9H A;  1J6Q A;  5A2Q E;  3CCV A;  2OQK A;  5A2Q L;  2ZXP A;  3S1R B;  2R93 G;  2PNR C;  3M7G A;  3WWV A;  2GVB A;  3J81 i;  5M3F G;  1QVG A;  2B63 G;  3CCR A;  4FYD A;  1CSP A;  4IFD J;  1BOS A;  2KBN A;  1OXV A;  3TZD A;  1ZXT A;  1XNR L;  2K5D A;  2RCF A;  4RMF A;  2J4X A;  1HA6 A;  3FEW X;  4IUU A;  5EGT A;  5IWA Q;  1PA6 A;  2B2U A;  5C4X H;  3VDY A;  1KRS A;  1EUJ A;  1K83 H;  2NYZ D;  5ELC A;  5BR8 L;  2DN8 A;  1YHB A;  1Q12 A;  2BDN A;  1VQ4 A;  1JIC A;  4NW2 A;  3HOX G;  1DGS A;  2QKI C;  3SR1 A;  1W6K A;  1GOZ A;  3CCL A;  2XGT A;  3A54 A;  2VQF L;  1C4Q A;  4QGU A;  1LM0 A;  5L37 A;  2BE5 C;  3GD7 A;  1STB A;  3LX0 A;  4RA8 A;  4BA2 I;  4KY5 A;  4KLK A;  5AFW A;  1JOO A;  1JMC A;  1PTO F;  1CTM A;  1QUQ B;  1U4R A;  3HOW G;  2R93 B;  1RTN A;  2EZV A;  5M3F B;  2VL6 A;  2B63 B;  2KVU A;  1IXR A;  5I4D A;  3KLW A;  1KAW A;  4PMC A;  3M7N A;  3NXW A;  1PFN A;  1XMO L;  4GKJ Q;  1AP0 A;  3CCQ A;  2OTL A;  4QMG A;  1SRO A;  4C3H H;  4X66 Q;  1K3B C;  4POG A;  2JXM B;  2QCP X;  3SK6 A;  1U9R A;  2N78 A;  3PUW A;  3CME A;  4C1N I;  4OON A;  4LF9 Q;  3I56 A;  2BDO A;  1V9P A;  4DK6 C;  1VQB A;  1OXS C;  1AE3 A;  1ICW A;  3F1Z A;  3R93 A;  5CV5 A;  3GTM H;  3IAY A;  3CF5 A;  3S16 H;  3NPP A;  5IGG A;  2RKS A;  4HIM A;  2SDF A;  3T1H L;  3SK8 A;  2JE6 I;  1FJG L;  1EIH A;  2QIL A;  3MEH A;  3J81 E;  5AJ3 Q;  1X3Q A;  3CU7 A;  2HIX A;  2KOL A;  2ASB A;  4A93 G;  2Q2T A;  4QY7 A;  1DOM A;  2VY3 A;  4KTA A;  4XT1 B;  1VQK A;  2JVW A;  2EPB A;  2HHH L;  1ENA A;  1YBY A;  5EKK A;  2WKD A;  3K59 A;  4LMQ D;  2UUC L;  2K52 A;  3U58 A;  4JBJ A;  2JEB I;  5IIF A;  3OHX C;  2A5H A;  4UP8 A;  3R2T A;  2VQE L;  3PO2 H;  3KBG A;  3KFU A;  3K6O A;  3W2D A;  4JI4 Q;  2GA4 B;  1T5X D;  1UE1 A;  3W3A A;  1WD1 A;  4GKK Q;  3FKI H;  5FO9 B;  1A2U A;  1WTR A;  1X6O A;  4OHJ A;  2QA4 A;  4JI0 Q;  2B2W A;  1EQT A;  2E5L L;  5JVG 3;  1BDO A;  2SNM A;  4RH6 A;  1PTO H;  1VQ7 A;  2K01 A;  2KUM A;  1PZI D;  1L0X B;  3LWE A;  1I94 Q;  1MJC A;  5CV6 A;  3KDF B;  1XPU A;  2RVL A;  2R7Z G;  1TWH B;  1F9P A;  1H9M A;  1K9M C;  3IFD A;  2B2T A;  1PH4 A;  5G3L F;  1O7Z A;  1Q8K A;  3TS0 A;  4TKO B;  2XRS D;  1J8I A;  1TWG H;  3S1M H;  1SMY C;  3JAM c;  1MKH A;  1E2V A;  2F0K A;  1BNZ A;  1O7L A;  3V96 A;  1CKM A;  3BDO A;  2EYH A;  1RKN A;  1XX8 A;  2DJG C;  3CKI B;  1O7I A;  1ZEQ X;  2IX1 A;  1UE5 A;  2VNU D;  5FLM H;  3PUY A;  1E7L A;  4K0K Q;  2L55 A;  2L0C A;  1PTO D;  3HG9 A;  2ID0 A;  4IPH A;  1FR3 A;  3PQI A;  2JA8 H;  1ESR A;  3GTQ H;  2P5Z X;  2NBF A;  1HQR D;  4YWK A;  2F0J A;  2JA9 A;  1VMC A;  2IX3 A;  4QIW B;  2NVY B;  1PZK D;  1SE2 A;  1H9E A;  2F0F A;  2ZT9 C;  4IUR A;  2R7Z B;  3CCE A;  3K81 C;  4LW1 A;  4EQ5 A;  4IPD A;  3K5L A;  3DLL A;  2MJ8 A;  2F1M A;  2YTY A;  3VYU A;  3FDT A;  1EU3 A;  1RF2 D;  4Y7N B;  1KTK A;  4OO1 G;  1A0I A;  2HDL A;  4GLX A;  5EJW A;  2KCT A;  3GTO H;  1G51 A;  3F2U A;  3T4A C;  1HUN A;  2B2U C;  4KJO A;  5C4H A;  5LL6 X;  2B39 A;  4YCW A;  2VUM H;  1IBK L;  4XYO A;  4JI8 L;  1Y1V G;  2MNA A;  4UDU C;  2E2D C;  4A3J H;  1WVL A;  3MXG A;  5EPK A;  4HJ5 A;  1LV9 A;  3KF6 B;  4A3B G;  2W51 A;  1DJR D;  1LTB D;  3DMU A;  1VCI A;  1UE6 A;  4A3K B;  4Q5V A;  2PO4 A;  1SR3 A;  1CHQ D;  5JVH 3;  2OWO A;  3EFX D;  4X64 Q;  4LK1 C;  1QB5 D;  2EJF C;  3U4V A;  2F03 A;  2MO0 A;  4DV5 L;  2CW0 C;  4YCV A;  5FLX E;  2EXZ A;  4K8J A;  5KNC A;  5J22 A;  4DV4 L;  2NVT B;  3KLS X;  2RSO A;  1KIX A;  1EWH A;  2KHJ A;  2PZW A;  3I4N B;  3Q6S A;  2ZTE A;  5M5Y B;  1E1O A;  3STB D;  1C8C A;  2A74 C;  3H3V H;  3Q0A A;  4C3I H;  4E6I A;  1SYC A;  3DWP A;  2R3Z A;  4ZAI A;  5IOC A;  5C5M A;  4DF7 A;  3AFP A;  3DHQ A;  3H91 A;  4JI2 Q;  1K0S A;  3K8A A;  1GUW A;  4OO1 I;  1GUS A;  3P75 A;  2N8N A;  1EIY B;  2JA5 H;  1K73 C;  3ZJY C;  2I46 A;  5IP9 G;  4JPB W;  2EVB A;  4G4K A;  1EIF A;  5JAV A;  1H95 A;  3PSI A;  1JWU D;  3BZC A;  5C4X B;  4B9W A;  5H1S E;  1LTI D;  3O13 A;  4HSP A;  3JAM L;  1K83 B;  5G3L D;  5IWA L;  2XWJ B;  4C3J H;  1EWI A;  2HQL A;  2IPK D;  1GL9 B;  1JJG A;  2UUA Q;  4HMJ A;  1M90 C;  1YNJ D;  1V43 A;  1DOL A;  4F8M A;  4LUZ A;  1X56 A;  3F8T A;  3KOJ A;  5BN3 A;  1WTO A;  4FO2 A;  4GOP C;  3Q24 A;  4HJ9 A;  2F0M A;  1WJJ A;  4KJN A;  3L2P A;  3BDC A;  1JT8 A;  3S1R H;  4ZYS A;  1BXT A;  3RN2 A;  1EWC A;  4GKJ L;  3TP8 A;  1C0A A;  3VR5 A;  4CKC A;  3GQB A;  4BA1 I;  4DR7 Q;  2FMC A;  4ZUJ A;  2KQ3 A;  3TP6 A;  1CQV A;  1HFG A;  3HKS A;  2JSO A;  4IFD H;  4GNX C;  4RGO S;  4LF9 L;  4ABN A;  2RHS B;  1FGU A;  3GTM B;  1EZ8 A;  1I4H A;  3CPW A;  2B2T C;  2BE5 D;  3KK7 A;  4ZKB B;  1R9T H;  1EQQ A;  1TWC H;  2L1B A;  1UAP A;  3BZD B;  4JC0 A;  4RKL A;  4DXF A;  1KD1 C;  1V1P A;  2VS1 A;  3DWA A;  3J7A V;  1UEB A;  2MP1 A;  3NBH B;  4AQY Q;  4LFC Q;  5AJ3 L;  4LJZ C;  4B3R Q;  1YHA A;  5IT9 L;  2YV5 A;  3U9O A;  1A15 A;  5FK9 C;  1M1K C;  2Y0S G;  4ILW A;  1CFM A;  4WJ3 M;  4G57 A;  3EN2 A;  1A3U A;  3IL8 A;  1NR4 A;  1PV4 A;  4L5R C;  4EGV A;  1A6X A;  3BYY B;  4JOI A;  4X3T A;  2K5V A;  2FHT A;  1X54 A;  1YIJ A;  1V1O A;  2B2V A;  1B1Z A;  1KQS A;  2E76 C;  2CH4 A;  3Q8D A;  4HJ7 A;  4J8Q A;  3TQY A;  2DNC A;  4AYB G;  1QIL A;  2N55 A;  4TRD A;  4KN4 C;  1WTQ A;  4JI4 L;  4GKK L;  4KMU C;  3T16 A;  1PTO B;  4JI0 L;  2VW9 A;  5CBA E;  4R8N A;  4CDF C;  3HOX H;  4BWG B;  1GJJ A;  2HD3 A;  4TQU S;  3E0E A;  3MFY A;  1WCM G;  4RGN A;  1KDA A;  1F77 A;  3Q23 A;  1L1O B;  1I94 L;  4KHP Q;  3C3L A;  3J7Z C;  4JVZ A;  3FVQ A;  4QIW E;  3MXN A;  1I50 H;  2CKZ B;  2N49 A;  3CW2 C;  4QF4 A;  3HOW H;  1PH5 A;  2PW7 A;  4RCO A;  2IL8 A;  4MNO A;  2KED A;  1S5B D;  1BBU A;  2Z1C A;  1O80 A;  3OIP A;  3D3R A;  2VB2 X;  5JEA G;  4P71 A;  4PNY A;  1BBW A;  3LGJ A;  2VQE Q;  1PVO A;  4ZKC B;  1H9S A;  1JWM D;  1EY8 A;  4UPA A;  4PZ7 A;  1EN7 A;  5C0X J;  1C48 A;  1Y69 U;  2E74 C;  3KLS A;  3C46 A;  4DR5 Q;  1D5Z C;  1N34 Q;  2JA8 B;  3K0Y A;  1I4Q A;  2EQS A;  1A8V A;  3G4S A;  5KGU A;  2M9V A;  1RTO A;  1NCV A;  4DPG A;  1SNP A;  1VQ5 A;  3TME A;  1T9H A;  3TBI B;  2NN6 G;  1GUG A;  3HFZ B;  4OIJ A;  1GUT A;  3RZO B;  1RCV D;  1WCM B;  1LUZ A;  2K32 A;  1S3O A;  2V1C C;  3FRP B;  1HHV A;  5EPJ A;  1VQ6 A;  1I4G A;  5JEA J;  3M4Y A;  4A93 H;  1SMY D;  5BN5 A;  1LT4 D;  1QVC A;  4G7H C;  1LT6 D;  4EVO A;  4ZCK A;  1UUP A;  2VUM B;  2ENB A;  4H7B A;  1B53 A;  4IUP A;  2D62 A;  1E3P A;  1H9J A;  1KLU D;  1QOH A;  1I5F A;  1YJ9 A;  4TVA B;  2A6H D;  2ZM6 Q;  2IX0 A;  1VF5 C;  3MXU A;  2CH4 W;  2Z6K C;  2ICE C;  2Z8L A;  3J7Y W;  2KHI A;  1D2B A;  1SRU A;  1EY0 A;  2B29 A;  4XDX A;  1YJW A;  1S5C D;  2NUC A;  2FFK B;  1II3 A;  1CKN B;  5C3E H;  2TSS A;  3I4O A;  1KLG D;  1HZB A;  1WFQ A;  3A7L A;  3NQI A;  5KIX A;  4P2C B;  1DZ1 A;  5CV4 A;  4X64 L;  2NVY H;  1ET6 A;  4QJF A;  1PXU A;  3UDF A;  2NN6 I;  3F2B A;  1QUQ A;  1AW7 A;  5I6W A;  3SEB A;  1GM5 A;  2R7Z H;  3PCO B;  1SYB A;  2PI2 E;  3I72 A;  1MIU A;  2K5H A;  2IHE A;  3J81 j;  1KDB A;  2O5I C;  1NMF A;  1YNN C;  3STB C;  3PIP 3;  1J9O A;  1G29 1;  1PYW D;  2EYF A;  4JI2 L;  4TSS A;  3UDG A;  1SJH D;  2A6E C;  2YTX A;  1V1Q A;  4HIK A;  3W5O A;  1GJX A;  3I4L A;  2EJM A;  4L6T B;  1SND A;  4RHS A;  5IYD G;  1PH3 A;  3J7A F;  4C3J B;  2CW0 D;  4A3I G;  4R4I A;  4IFD G;  3CC4 A;  2KEC A;  2AQ1 B;  3BS1 A;  4P75 A;  1XTC D;  5T1G A;  4WJW A;  1PH2 A;  2F0W A;  1EIG A;  1SYE A;  3A5U A;  2DK4 A;  1N36 Q;  3A74 A;  1XNQ Q;  4G7O C;  2R61 A;  2NVT H;  4XXE A;  3ULL A;  4KKU A;  2Z6B A;  1JE4 A;  2B2V C;  1QNK A;  3EBE A;  3CXC A;  2MFI A;  2NVQ H;  1G2T A;  4OO1 H;  1TY2 A;  3IFT A;  4ID6 A;  5T1I A;  3KBX A;  1S40 A;  3UE1 A;  5IOD A;  4CJ0 B;  1PFM A;  3A8K E;  3I90 A;  1VQG A;  2LXJ A;  4JG2 A;  1Y1V H;  2EYO A;  5M5X H;  2D9U A;  2ICI A;  4OWX B;  2E75 C;  1IYV A;  2QW7 A;  1ENC A;  2QF7 A;  1ZS9 A;  1KHC A;  3PIO 3;  1SJE D;  3X3M A;  3HOY G;  4A3I B;  4DR7 L;  4A3B H;  4DAY B;  4K8I A;  2Q2H A;  3SGI A;  2G80 A;  3P1H A;  4HTH A;  5I2Y A;  1ROD A;  1R9T B;  2KVE A;  4X62 Q;  1KC8 C;  4HJ8 A;  1TWC B;  2H4O A;  2F0H A;  4BBS G;  3VR3 A;  3HGB A;  4I7Z C;  3SE0 A;  4AIM A;  5I2X A;  2SNS A;  4IFD I;  1SN8 A;  3AB9 A;  3KDF A;  1B4O A;  1SEB D;  3UDX A;  2F0G A;  2EIF A;  2HUG A;  1HZC A;  2ZTC A;  4AQY L;  1X3F A;  1D5X C;  4LFC L;  1G91 A;  1EYD A;  1EY9 A;  4B3R L;  2ATW A;  2WAQ G;  4R4T A;  1B9M A;  1KAA A;  2ZJP A;  4B3M Q;  4K6D A;  4CDE C;  1YIT A;  2Z0S A;  1PZJ D;  4WRD A;  5LMN Q;  1JEI A;  5ELD A;  4GN3 B;  1I6H B;  4N9T A;  5IP9 H;  3T51 B;  5IGE A;  1GUN A;  1QG7 A;  1JQY D;  2X69 A;  2DGY A;  1CA5 A;  3MXP A;  4X65 Q;  3D6W A;  3RD4 A;  3MHB A;  3RR5 A;  2HIV A;  4K2L A;  2O4X A;  4BBS B;  4IAL A;  1I4R A;  3HOX B;  4S3S A;  5M3M G;  4WJ4 A;  4IJH A;  5ELO A;  4X3K A;  1K8M A;  4DUZ Q;  1XJV A;  5EBD A;  1SYD A;  3H09 A;  1OXU A;  1TT2 A;  3CCJ A;  1PRT C;  1I50 B;  3GTL H;  4J1M A;  1Y8N B;  3S17 B;  4KHP L;  3BVZ A;  3HOW B;  1X3E A;  2WAQ B;  4HN7 A;  4DGZ A;  1UNS A;  5BN4 A;  4FNF A;  2YYZ A;  5J1Z A;  1VQM A;  2XVS A;  2UXD Q;  3KF6 A;  1STE A;  1HXY D;  2TMP A;  3M4Q A;  3M9B A;  3RLN A;  2E2H H;  4JI3 Q;  1BO0 A;  1FD7 D;  4IJL A;  4DR5 L;  5JPM C;  1N34 L;  2K28 A;  2AHO B;  3SK4 A;  5C3E G;  4YY3 Q;  5M3M B;  1STY A;  2BA1 A;  3ZYY X;  3TS2 A;  1E7Z A;  3FP9 A;  3NWT A;  1CM9 A;  2Q2U A;  4LF7 Q;  4JBM A;  1SE3 A;  1CK1 A;  3I2Z A;  4A93 B;  1DCZ A;  5GAG C;  1N33 Q;  4K6L A;  4HAE A;  2JP1 A;  3TZU A;  3HP3 A;  4A3L G;  2F0E A;  5CV9 A;  1FNW A;  1MD2 D;  2WKC A;  3ITP A;  3PF4 A;  3NSW A;  4JI7 Q;  1CZG A;  1OO9 B;  1CHP D;  3FPU B;  1I4X A;  3J80 L;  2EYP A;  2QDL A;  1G8Z D;  4HED A;  2K1B A;  4FVM A;  4DR3 Q;  2ZM6 L;  2PQE A;  4A3F G;  1STG A;  4LWC A;  1NUC A;  1TS2 A;  5IE8 A;  5C3X A;  1WTW A;  1HH2 P;  5FKA C;  4KV6 A;  2A6H C;  3I55 A;  1X9N A;  5C3E B;  1L0Y B;  3V05 A;  1SBB B;  2PI2 A;  1SNQ A;  2PQA A;  3A0J A;  1QJO A;  3H94 A;  1EOV A;  1GHJ A;  2ZXO A;  2HQE A;  3C1F A;  4JV5 Q;  2O2L D;  4R9W A;  5C0X H;  4KI0 A;  4K5X A;  1XYI A;  3ER0 A;  1BUV T;  4H02 A;  1LAC A;  2A73 B;  1XTD A;  5JOB A;  1Z9F A;  2WP8 J;  4DR2 Q;  1WTV A;  2UXB Q;  3U50 C;  3RZO H;  1WCM H;  3JAM i;  4R1J A;  1C7Y A;  2EY1 A;  3RNU A;  2JA6 G;  1E2Z A;  5IGC A;  3K7A H;  1B44 D;  4DV2 Q;  3BG3 A;  4CJ2 C;  2WII B;  1JJC B;  2RBM A;  4GLA C;  4OIK A;  1MGS A;  2UXC Q;  2I0Q A;  5JEA H;  1IHZ A;  1Q3L A;  2Z4I A;  1PH7 A;  2MHV A;  4A3F B;  2F4V Q;  1XMQ Q;  5F2D A;  1HUM A;  1Y8P B;  4U67 3;  4LF4 Q;  4DNI A;  4LFB Q;  4GLV B;  3OSO A;  4GN5 A;  4PMB A;  3HKZ G;  3PMF A;  3ND9 A;  3E9I A;  2VB3 X;  3URY A;  4F88 A;  4FP5 D;  2NTT A;  2A69 C;  3CQZ B;  1EU4 A;  2CHB D;  5IT9 c;  2F0P A;  4DV1 Q;  1ICF B;  2NN6 H;  5DNF A;  1S5D D;  3D4R A;  1CZW A;  1XPO A;  3L3O C;  1FNU A;  3NBH A;  1N36 L;  2JA6 B;  3S9W A;  1B70 B;  1XNQ L;  2PNH A;  3B6Y A;  2PZT A;  1E22 A;  1YNN D;  2NVQ B;  2QEJ C;  3DWQ A;  4GOP B;  1J5E Q;  1VQI A;  2K05 A;  3S1N B;  2F0N A;  1B50 A;  3CC7 A;  2A6E D;  4JCV E;  3M4O H;  3GV6 A;  2R7D A;  1Y1V B;  5JJK A;  5M5X B;  5GAE C;  2NZH A;  1PRT F;  3CC2 A;  2PPB C;  4A4I A;  1M4V A;  3AMU A;  2JN4 A;  2A8V A;  1OTC A;  2QGQ A;  3HKZ B;  1DXM A;  4FF4 A;  5LHY 1;  4A3B B;  1STA A;  2XIW A;  3D4D A;  2RCN A;  1LT5 D;  5CBE E;  2F3I A;  4O0A A;  2A1A A;  2NTS A;  3JAM E;  4GNX B;  1Q82 C;  1VQA A;  2H1E A;  3K5O A;  1JOQ A;  5IGB A;  5E4X A;  2E2J B;  1D1I A;  4L5Q A;  3PF5 A;  1VQ8 A;  4UP7 A;  4X62 L;  2RDH A;  4FXK C;  1TR5 A;  4A3C H;  1GKH A;  1S4Z A;  4DFA A;  5GAH C;  4A3G H;  1RL2 A;  1VMP A;  3FHW A;  3HRZ C;  1N9W A;  1JJ2 A;  4NXN Q;  5KYI A;  2KEN A;  4JW0 A;  4CDC C;  1BR9 A;  1TWA H;  3NEM A;  2QEX A;  4KD4 A;  5E3F A;  4CGY B;  2ODG C;  2JYO A;  3QKJ A;  3PUV A;  1IYU A;  4OGQ C;  4ODG A;  3PO3 G;  3OTO L;  4B3M L;  3I73 A;  2B2W C;  4DN4 M;  1S72 A;  1EYA A;  3EVQ A;  5LMN L;  1SAP A;  4A76 A;  3A8I E;  2XTI A;  2X6L A;  2OEO A;  3G48 A;  3QWN A;  1RJT A;  5NUC A;  2HT1 A;  4DR1 Q;  3A8J E;  4POF A;  5C3W A;  1NSN S;  4XQQ A;  4X65 L;  5FOB B;  4A3I H;  1IL8 A;  3NQT A;  1EY4 A;  2C9O A;  4K5W A;  1W3S A;  4DKA C;  2D0O A;  4YCU A;  4EQN A;  1F9R A;  3GP7 A;  4B3T Q;  3BVG A;  2RHQ B;  2C35 B;  3D4W A;  3G6E A;  1E1T A;  4DUZ L;  1B8A A;  2F0Q A;  4RCN A;  3GTL B;  3CCU A;  1HR0 Q;  1MSH A;  4IUQ A;  3G6J B;  3D0F A;  3GTG B;  2KCN A;  1LYL A;  1X32 A;  1F2M A;  2CWA A;  2EJG C;  2F0U A;  5IT9 E;  4OWW B;  2WFW A;  1SYF A;  3BZK A;  2EE1 A;  1HZ9 A;  1PFS A;  2QNF A;  4A3M H;  3KF8 A;  4L63 B;  3ONA B;  3VA7 A;  3I91 A;  2UXD L;  1Q7Y C;  3VYT A;  1AFP A;  4ALP A;  2E2H B;  2AWN A;  1E7D A;  2F0V A;  4GN4 B;  4FXG C;  1I6H H;  4EQO A;  3HOY H;  5I6Y A;  1CKN A;  4B3S Q;  3TRE A;  1KNE A;  2M2L A;  4JI3 L;  4JI5 Q;  2WQG A;  2KHS A;  2ZXR A;  1UEA B;  4FXD A;  1STH A;  4ZQ3 A;  2KA7 A;  2XRQ D;  4I65 A;  4DAV A;  4YY3 L;  4DAP A;  5KND A;  5FO7 B;  4BBS H;  1HQM C;  2QDB A;  4DAM A;  5C0X G;  1PRT D;  1TVX A;  4P72 A;  1TS4 A;  4B08 A;  1L2F A;  1VQJ A;  4RKB A;  1TU2 B;  4CDD C;  4LF7 L;  1HJP A;  1WYD A;  3MEF A;  1X3G A;  1N33 L;  2L9H A;  2Y0S B;  3TSS A;  3S17 H;  5C5L A;  3RUZ A;  2IT1 A;  2CWP A;  4JI7 L;  3GV3 A;  3P20 A;  1TQO A;  4KD3 A;  1BQQ T;  1MJE A;  4HSV A;  3MVV A;  4F7X A;  1JB7 A;  1PFB A;  4DV3 Q;  3TP5 A;  2BH2 A;  2KW9 A;  4DK3 C;  5KRU A;  1TII D;  2LS0 1;  2BH8 A;  2NZO A;  3K5N A;  4DR3 L;  4AYB B;  1G6Z A;  2D5D A;  2PZU A;  1HNX Q;  3VA5 A;  2HCC A;  4A3E H;  1SFO B;  1K8O A;  2K5W A;  2WB1 G;  1AN8 A;  1VQ9 A;  3BDL A;  5D65 A;  3N6R A;  1PH8 A;  2JA7 G;  3U9S A;  4JV5 L;  1Q1B A;  1YNS A;  5M3M H;  2R6G A;  3L7Z C;  1LLR D;  4L5S A;  4OXP A;  2I5M X;  1G6P A;  2L15 A;  1SNC A;  4RFB A;  1WTX A;  4LF8 Q;  5IYB H;  4DR2 L;  2UXB L;  4PG3 A;  3K7A B;  2EXD A;  3R8B A;  3QO2 A;  1UWV A;  5C0X I;  5IP7 G;  2IW3 A;  2CQA A;  1K8G A;  1K8A C;  1AEX A;  1YJN A;  4J15 A;  4DV2 L;  2EOT A;  1D6E C;  2UU9 Q;  1STN A;  4LF6 Q;  4XQJ A;  1NNX A;  4J6H A;  1I6V C;  3TN2 A;  3QJY A;  3S2H H;  2UXC L;  4EQP A;  1TXY A;  2C5C A;  3UE0 A;  1EY5 A;  2F4V L;  1XMQ L;  4LNQ A;  1IKL A;  2CFM A;  1L0W A;  3HS0 C;  1S5E D;  4DNT B;  2WB1 B;  2BCO A;  5I9O A;  4LF4 L;  4LFB L;  4LAA A;  2ALY B;  4LUV A;  5CR3 A;  2JA7 B;  2HCI A;  1IBL Q;  3S14 B;  3GTJ H;  4MIU A;  3DM1 A;  4ME5 A;  4DV1 L;  3RN5 A;  3W1B A;  2JJQ A;  4A3C G;  1JJR A;  1RHP A;  4A3G G;  1IW7 D;  1Q1E A;  4C1N K;  1SSO A;  2V4D A;  5IGF A;  3HOV G;  1O7Y A;  4A3L H;  1SNO A;  5C44 G;  3M4O B;  2FXQ A;  4IUT A;  1Y8O B;  4IUN A;  2UUB Q;  2F0S A;  1J5E L;  1AH9 A;  4MN3 A;  1BCP C;  2Q8I B;  2F0T A;  3NBI A;  2KJX A;  1Q46 A;  5COR A;  1VQF A;  3DXJ C;  4N8X 1;  5FJ8 G;  4A3F H;  3MTS A;  3ERQ A;  1IKM A;  3K5M A;  1QZG A;  2A69 D;  3NWS A;  1SE4 A;  3T56 B;  4JI6 Q;  3GDE A;  2G5D A;  2RDG A;  1K3R A;  1GKU B;  4IPC A;  5HGQ A;  4RGM A;  2K4K A;  2IY5 B;  1IL2 A;  2VZA A;  5CYU A;  4A3D G;  1D7Q A;  4JI1 L;  3CQZ H;  2Z9H A;  4OEM B;  1V66 A;  2LSS A;  4DUY Q;  4X6A H;  4A3G B;  2A68 C;  1EEF D;  3TRZ A;  4APV A;  3HOZ H;  5C4J H;  4GZY C;  2EYJ A;  1GVP A;  4JOI C;  4N9P A;  5C44 B;  2JA6 H;  1N32 Q;  1BF4 A;  2EDG A;  3TEH B;  4NXN L;  1TWA B;  3J81 c;  3SXH A;  5K36 G;  1MHW C;  4BY7 G;  2KVD A;  1JOR A;  2JEA I;  2RNN A;  1BKB A;  1LO5 D;  3I4M H;  3S1N H;  4BXX G;  1U5K A;  5ELN A;  1D8L A;  5LMU Q;  4H13 C;  4A3M G;  1D5M C;  3G7L A;  3K80 C;  3MA2 B;  1B2T A;  4QL5 A;  1KXL A;  1Y02 A;  1Z6H A;  4UZW A;  2WV6 D;  3SDZ A;  1F2Z A;  3KJP A;  2D2C C;  2EYL A;  1PDQ A;  3NTK A;  3W1G A;  4HCE A;  4F87 A;  5J3B A;  4NKL A;  4DR1 L;  3EJI A;  4A3D B;  1EL0 A;  1Q81 C;  1LTR D;  1ASY A;  1TKW B;  3OMG A;  2E2I H;  4UY8 C;  2NVX H;  1X55 A;  1HPC A;  5EPL A;  4XYQ A;  1TS3 A;  3E5S A;  2E2J H;  4B3T L;  3EIV A;  4DV6 Q;  3J80 c;  1PRT B;  3EA6 A;  4KY6 A;  3E0J A;  4U68 A;  5TSS A;  4XQN A;  1HR0 L;  2DY8 A;  4BY7 B;  3ULP A;  2K5N A;  2KEE A;  1KHI A;  4C2M H;  1ENF A;  1ASZ A;  2ES2 A;  1ILQ A;  1X3P A;  3AEV A;  4PQX A;  4A3M B;  4OL7 A;  3OTO Q;  3T13 A;  2LKV A;  1GXD C;  2LXK A;  2LY7 A;  3T1Y Q;  2QNC A;  4RHR A;  1I3Q B;  3NUC A;  4K5V A;  2A19 A;  2Y0S E;  5ELE A;  1VQP A;  3HOY B;  5I9P A;  4HID A;  1HNW Q;  2PCF B;  2I5L X;  1Z47 A;  2K7V A;  2I07 B;  4A3E G;  1WI5 A;  3J80 i;  5D3D A;  1KNA A;  3H0G G;  4B3S L;  1GO3 E;  3OIQ A;  3D8G A;  3OWF A;  4KY7 A;  4JK1 C;  4JI5 L;  4KHV A;  3CP0 A;  1ML0 D;  1QZH A;  2KVM A;  4OX9 Q;  4JBK A;  4BY1 H;  4JYA Q;  4AYB E;  2BOS A;  1OXT A;  2K6A A;  5LMN W;  1IBM Q;  3UDI A;  5C4Z A;  4GS3 A;  5CMD A;  2XWB B;  3K58 A;  1JEQ A;  5IYB G;  3KUP A;  1LTT D;  3NTI A;  4R4Q A;  3N52 A;  2L12 A;  4DR4 L;  5K5P A;  1VQE A;  3GTG H;  5D14 A;  3HOU G;  1XXG A;  3GTK H;  1B3Q A;  1IYJ B;  3PO3 H;  5HUR A;  1DOK A;  1RD9 D;  4H44 C;  1SE8 A;  1NY4 A;  2AQ3 B;  3TP7 A;  1EFI D;  4DV3 L;  2YU9 B;  1FVI A;  2NB0 A;  1VQD A;  3J81 L;  4A3E B;  3NEN A;  3A56 A;  3H0G B;  2K75 A;  3QOL A;  4A75 A;  1MSG A;  1HNX L;  1BCP F;  4XIG S;  4DU9 A;  4XT3 B;  5CV7 A;  2WAC A;  1DON A;  3S1Q H;  4R4O A;  4DK0 A;  2NZ1 D;  4QUF A;  3DEO A;  2Q2I A;  3K0X A;  1ILP A;  3S15 H;  2R7F A;  4Z9C B;  2WB1 E;  2F0L A;  3CAM A;  1HNZ Q;  4PZ8 A;  2G9D A;  3C1E A;  1PMR A;  5FLX c;  1T5E A;  2RNO A;  4LF8 L;  4OEL B;  2IJ0 A;  4GOP A;  3NK9 A;  2AWO A;  3HOU B;  2CQO A;  2FJ2 A;  4O1N A;  1A3T A;  1S5F D;  4RAU C;  2UU9 L;  5HGT A;  4NDX A;  3S2H B;  5DM6 3;  2R92 H;  2LC3 A;  4LF6 L;  3M3Y B;  3J80 E;  4NB3 A;  4ME3 A;  1LTG D;  1FNV A;  2NWG A;  4RGT A;  3F2D A;  2LFN A;  1KDC A;  3ICE A;  3MFG A;  1DYQ A;  3S24 A;  1ZYR C;  1JE5 A;  4XTC S;  2AQ2 B;  3AFQ A;  1DM0 B;  4GNX A;  5EAY A;  2DUD A;  2RQX A;  3CCM A;  2SOB A;  3GTJ B;  5HY6 A;  3I3C A;  3BU2 A;  1BBX C;  4I7A A;  5ELB A;  1WOC A;  1SFO H;  2B2Y A;  1VQN A;  1IBL L;  4PV1 C;  4HR7 B;  2J7Z A;  1YI2 A;  3CPF A;  3NTH A;  1VDZ A;  1CKO A;  1Y1W G;  2RDF A;  2XSC A;  1A3V A;  1IZ6 A;  4YHH L;  1TWF B;  3HOZ G;  3WOE A;  1HCZ A;  1U4L A;  4NPS A;  3A7A B;  4LUO A;  1JR0 D;  4IPG A;  1GUO A;  1GD7 A;  2Q8T A;  5KEE A;  3K57 A;  4LF5 Q;  1YVC A;  3GTP H;  1JOK A;  1MBY A;  4NXM Q;  1QWY A;  1VQC A;  1ET9 A;  1IW7 C;  4A3K G;  3FMC A;  5M5W H;  2UUB L;  3I4M G;  1O78 A;  2OT2 A;  4ZLT F;  4YIJ A;  3QOJ A;  1KRT A;  1BVS A;  3WOF A;  4YWM A;  3BYT B;  3AQQ A; 
#chains in the Genus database with same CATH homology
 3I4O A;  1LYL A;  1HZB A;  2CWA A;  2B3G A;  1XMO L;  1WFQ A;  1N8R C;  4DR6 Q;  4GKJ Q;  3CCQ A;  3I4N G;  2OTL A;  4OWW B;  1SRO A;  4C3H H;  2WFW A;  4X66 Q;  4JI6 L;  4X64 L;  4POG A;  2NVY H;  4Y52 H;  3BZK A;  1HZ9 A;  3M85 A;  2N78 A;  1Q86 C;  3PUW A;  4L5T A;  4BBR H;  3CME A;  1PFS A;  4OON A;  2QNF A;  4QJF A;  4A3M H;  3UDF A;  2JA7 H;  3RLF A;  5E7N A;  2NN6 I;  3F2B A;  1QUQ A;  4LF9 Q;  3S14 H;  2OTJ A;  1GM5 A;  2R7Z H;  3KJO A;  3I56 A;  2UXD L;  4DV7 Q;  1V9P A;  2PI2 E;  1VQB A;  3PCO B;  4DK6 C;  4ALP A;  2AWN A;  1Q7Y C;  1E7D A;  1MIU A;  2K5H A;  1OXS C;  2IHE A;  1UE7 A;  3GO5 A;  4GN4 B;  1AE3 A;  3F1Z A;  3J81 j;  3PIP A;  4DUY L;  1I6H H;  3HOY H;  3GTM H;  1CKN A;  5JJL A;  1NMF A;  4B3S Q;  3TRE A;  3CF5 A;  1OXX K;  2JQO A;  3S16 H;  1AE2 A;  4JI3 L;  3STB C;  4JI5 Q;  2KFV A;  4LFA Q;  4HIM A;  1G29 1;  2E8G A;  5IP7 H;  3T1H L;  1PH1 A;  2JE6 I;  4JI2 L;  1FJG L;  5AJ3 Q;  1N32 L;  4YY3 L;  2HIX A;  4BBS H;  3ERS X;  3UDG A;  4DAM A;  2YTX A;  5C0X G;  4HIK A;  1V1Q A;  4YWL A;  2Q2T A;  4QY7 A;  2ASB A;  4A93 G;  2VY3 A;  2MQH A;  4P72 A;  3W5O A;  1VQK A;  1L2F A;  4HJA A;  1VQJ A;  2HHH L;  1YBY A;  5IYD G;  4LF7 L;  1PH3 A;  1NBW A;  1YNX A;  2OCE A;  1HJP A;  2UUC L;  5LMU L;  2F52 A;  2K52 A;  3U58 A;  1CUK A;  4JBJ A;  1WYD A;  2JEB I;  3MEF A;  1X3G A;  4R4I A;  4A3I G;  3CC4 A;  4IFD G;  1N33 L;  4P75 A;  4DV0 Q;  4UP8 A;  1YEZ A;  2VQE L;  1PH2 A;  3PO2 H;  2AMC B;  3S17 H;  1RIP A;  2IT1 A;  2CWP A;  3KFU A;  3A5U A;  2DK4 A;  2D0P A;  1N36 Q;  4JI7 L;  3A74 A;  3RLO A;  1XNQ Q;  1MJE A;  2ZTD A;  4O2D A;  1JB7 A;  4JI4 Q;  2NVT H;  1UE1 A;  3F2C A;  4DV3 Q;  4JI1 Q;  4GKK Q;  5GAD C;  3ULL A;  1LTL A;  2BH2 A;  3FKI H;  1VS0 A;  4DK3 C;  2NZO A;  2BH8 A;  4JI0 Q;  1X6O A;  2QA4 A;  3EBE A;  4BY1 G;  3CXC A;  4DR3 L;  2MFI A;  2NVQ H;  3RZD H;  3A5Z B;  2E5L L;  3PGZ A;  1L1O A;  1HNX Q;  1S40 A;  4A3E H;  3UE1 A;  1VQ7 A;  4DV6 L;  3CD6 A;  2WB1 G;  3HOV H;  1VQ9 A;  1VQG A;  2LXJ A;  1I94 Q;  4JG2 A;  1MJC A;  1PH8 A;  2JA7 G;  1Y1V H;  5C44 H;  5M5X H;  4JV5 L;  3PIO A;  3KDF B;  1XPU A;  1Q1B A;  2R7Z G;  1YNS A;  5M3M H;  2R6G A;  3L7Z C;  4OWX B;  2PQA B;  2YTV A;  4L5S A;  4OXP A;  2I5M X;  1ZS9 A;  3JC6 6;  1K9M C;  1G6P A;  3HOY G;  2Z6K A;  2L15 A;  4DR7 L;  1PH4 A;  1YZ6 A;  3TS0 A;  1Q8K A;  4LF8 Q;  4DAY B;  5IYB H;  4DR2 L;  4A3B H;  4PG3 A;  2UXB L;  1TWG H;  3S1M H;  2Q2H A;  2EXD A;  3JAM c;  3SGI A;  2G80 A;  1MKH A;  1UWV A;  5C0X I;  3T1Y L;  5IP7 G;  1NJI C;  5FJ8 H;  1H9F A;  1K8G A;  1K8A C;  1CKM A;  2WAQ E;  1YJN A;  4X62 Q;  1KC8 C;  4HJ8 A;  4J15 A;  4DV2 L;  2UU9 Q;  4BBS G;  1EFW A;  1VQL A;  1HNW L;  4LF6 Q;  1O7I A;  4AIM A;  2IX1 A;  1UE5 A;  2VNU D;  5FLM H;  3PUY A;  1E7L A;  4IFD I;  1SN8 A;  3BJU A;  4K0K Q;  3S2H H;  3KDF A;  2UXC L;  2ID0 A;  1TXY A;  4IPH A;  3UDX A;  2JA8 H;  4A3D H;  1C9O A;  2EIF A;  3GTQ H;  3UE0 A;  1HZC A;  3OYY A;  2F4V L;  4YWK A;  1NE3 A;  2ZTC A;  1XMQ L;  4AQY L;  2JA9 A;  1P16 A;  1X3F A;  4LFC L;  2CFM A;  1L0W A;  3CCS A;  4OX9 L;  4JYA L;  3PO2 G;  4B3R L;  1IBM L;  4LF4 L;  2ATW A;  2WAQ G;  1XNR Q;  4X66 L;  1H9E A;  4LFB L;  2ALY B;  4R4T A;  4LUV A;  3ULJ A;  2ZJP A;  4B3M Q;  5IYC H;  1YIT A;  1PYB A;  1IBL Q;  2Z0S A;  3GTJ H;  3CCE A;  2ODC I;  3K81 C;  5LMN Q;  4LW1 A;  4EQ5 A;  3FKI G;  4IPD A;  1JEI A;  3DLL A;  4BY7 H;  2YTY A;  4GN3 B;  5IP9 H;  5BR8 Q;  4DV1 L;  3RN5 A;  3W1B A;  2JJQ A;  4BXX H;  4A3C G;  4OO1 G;  1A0I A;  2BA0 A;  2DGY A;  3PV0 A;  2R92 G;  4GLX A;  4X65 Q;  2LD7 A;  3RR5 A;  2KCT A;  4A3G G;  3GTO H;  1Q1E A;  1G51 A;  2HIV A;  2VQF Q;  4YCW A;  3HOV G;  4A3L H;  2VUM H;  1IBK L;  3IRB A;  4JI8 L;  1HR0 W;  1I3Q H;  1Y1V G;  5C44 G;  2MNA A;  2FXQ A;  4A3J H;  2UUB Q;  5M3M G;  4WJ4 A;  4IJH A;  1J5E L;  1U0L A;  4QQB X;  1AH9 A;  5ELO A;  4DUZ Q;  1XJV A;  5GRO A;  4HJ5 A;  3KF6 B;  4LNQ A;  1OXU A;  4A3B G;  3CCJ A;  2W51 A;  3I7F A;  4MZ9 A;  2R93 H;  4IO9 A;  1VCI A;  1UE6 A;  2H5X A;  1Q46 A;  1VQF A;  1SR3 A;  3M4P A;  5FJ8 G;  5M3F H;  2B63 H;  3GTL H;  4A3F H;  1XMO Q;  1VQH A;  4KHP L;  2OWO A;  1X3E A;  1QZG A;  4JI6 Q;  4X64 Q;  5JJI A;  1Y14 B;  3U4V A;  3GDE A;  2IHF A;  2MO0 A;  4DV5 L;  4YCV A;  1HZA A;  1K3R A;  4DV4 L;  1HNZ L;  1GKU B;  3G71 A;  4IPC A;  5HGQ A;  5FLM G;  3CMA A;  2K4K A;  2YYZ A;  3U4Z A;  1KIX A;  5C4X G;  2IY5 B;  2KHJ A;  4DR4 Q;  1H95 A;  1IL2 A;  1VQM A;  2VZA A;  2ZTE A;  2JA8 G;  4A3D G;  2I5H A;  1D7Q A;  2UXD Q;  4JI1 L;  4PZ6 A;  1E1O A;  3STB D;  3KF6 A;  3CQZ H;  1KL9 A;  4DUY Q;  2LSS A;  4X6A H;  3M4Q A;  3H3V H;  3M9B A;  3RLN A;  4C3I H;  3TRZ A;  4APV A;  2E2H H;  3HOZ H;  4JI3 Q;  5C4J H;  3AFP A;  4IJL A;  4DR5 L;  1N34 L;  1GVP A;  1SMX A;  4JOI C;  2MO1 A;  4MTN A;  4JI2 Q;  3T1H Q;  1FJG Q;  2JA6 H;  2AHO B;  5C3E G;  1N32 Q;  4YY3 Q;  3TEH B;  4NXN L;  3K8A A;  3J81 c;  1QVF A;  4OO1 I;  5K36 G;  2N8N A;  2YU9 H;  2BA1 A;  1EIY B;  2JA5 H;  3KYH C;  3TS2 A;  4BY7 G;  2JEA I;  1E7Z A;  3FP9 A;  3ZJY C;  5IP9 G;  1K73 C;  1BKB A;  1B7Y B;  4KHZ A;  3I4M H;  1EIF A;  2HHH Q;  3S1N H;  3H0G H;  4BXX G;  1U5K A;  2Q2U A;  4LF7 Q;  5ELN A;  3PSI A;  1W2B A;  2ZJQ A;  4JBM A;  2UUC Q;  1D8L A;  3BZC A;  4BBR G;  5LMU Q;  3I2Z A;  4A3M G;  5DLQ E;  5H1S E;  3K80 C;  5GAG C;  1N33 Q;  2ZJR A;  4P73 A;  5IWA L;  2HJQ A;  4QL5 A;  2VUM G;  4A3L G;  4R4C A;  4C3J H;  1EWI A;  2HQL A;  1KXL A;  1Y02 A;  1YHQ A;  1GL9 B;  2GN5 A;  3KJP A;  1JJG A;  5GQO A;  4RG1 A;  2UUA Q;  3PF4 A;  4A3J G;  3W1G A;  4JBW A;  1PH6 A;  4JI7 Q;  2K50 A;  1FL0 A;  5J3B A;  4DR1 L;  1M90 C;  1V43 A;  4K0K L;  4LF5 L;  4LUZ A;  1Q81 C;  1X56 A;  4EX5 A;  1ASY A;  4UY8 C;  2E2I H;  3F8T A;  4DR3 Q;  3D31 A;  2NVX H;  2ZM6 L;  1X55 A;  3KOJ A;  4A3F G;  4NXM L;  2E5L Q;  3HOU H;  4LWC A;  2E2J H;  1NTG A;  5IE8 A;  4B3T L;  3EIV A;  1HH2 P;  4DV6 Q;  4GOP C;  4HJ9 A;  3J80 c;  1WJJ A;  3I55 A;  1X9N A;  3L2P A;  2PI2 A;  2PQA A;  3M3Y H;  1CSQ A;  3A0J A;  1PYS B;  1HR0 L;  1EOV A;  3ULP A;  2K5N A;  4JV5 Q;  1JT8 A;  3S1R H;  1KHI A;  1L1O C;  4KI0 A;  4C2M H;  3RN2 A;  1ASZ A;  2ES2 A;  4GKJ L;  4P74 A;  4DR6 L;  1C0A A;  3ER0 A;  3AEV A;  3L0O A;  4H02 A;  4BA1 I;  4DR7 Q;  2UXB Q;  1XTD A;  3OTO Q;  1Z9F A;  1TWH H;  2WP8 J;  4DR2 Q;  3U50 C;  3RZO H;  1WCM H;  2LXK A;  3JAM i;  4R1J A;  3OW2 A;  3T1Y Q;  2QNC A;  1C7Y A;  3HKS A;  3RNU A;  2JA6 G;  4GNX C;  1A62 A;  2A19 A;  4LF9 L;  2Y0S E;  2RHS B;  3K7A H;  1VQP A;  4DV2 Q;  1FGU A;  3HKZ E;  2OQ0 A;  1EQR A;  4AH6 A;  3CPW A;  4DV7 L;  4YHH Q;  4HID A;  1HNW Q;  1JJC B;  2JA5 G;  3KF8 B;  2I5L X;  1Z47 A;  4GLA C;  1R9T H;  1EQQ A;  4A3E G;  1TWC H;  1WI5 A;  2AKW B;  4JC0 A;  3J80 i;  4B3S L;  2UXC Q;  3H0G G;  2I0Q A;  1TWF H;  1GO3 E;  1KD1 C;  1VQO A;  2VS1 A;  3K7U C;  4JI5 L;  1PH7 A;  4LFA L;  1UEB A;  3CP0 A;  2F4V Q;  1XMQ Q;  3NBH B;  4AQY Q;  1QZH A;  1NMG A;  4LFC Q;  4OX9 Q;  5AJ3 L;  4JBK A;  4BY1 H;  4JYA Q;  4AYB E;  4UP9 A;  2MPH A;  4B3R Q;  1OXT A;  1YHA A;  5LMN W;  1IBM Q;  2YV5 A;  3UDI A;  4DNI A;  4LF4 Q;  4GLV B;  4GS3 A;  4LFB Q;  1M1K C;  2Y0S G;  4GN5 A;  3HKZ G;  3E9I A;  4WJ3 M;  5IYB G;  4IOA A;  3EN2 A;  4OWT B;  3H15 A;  3DM3 A;  4R4Q A;  1EYG A;  1PV4 A;  1PHJ A;  4DR4 L;  4L5R C;  4JOI A;  2K14 A;  5IT9 c;  4DV1 Q;  2CCZ A;  2K5V A;  1VQE A;  4DV0 L;  3GTG H;  1X54 A;  2JK8 A;  1YIJ A;  1XPO A;  3HOU G;  1KQS A;  3S2D H;  2KCM A;  3Q8D A;  3GTK H;  1IYJ B;  4HJ7 A;  3TQY A;  3PO3 H;  4AYB G;  1N36 L;  4Y7N H;  1SE8 A;  1B70 B;  1XNQ L;  2PNH A;  3B6Y A;  3MXN B;  1NY4 A;  1IBK Q;  4JI4 L;  1E22 A;  4DV3 L;  4GKK L;  1FVI A;  4JI8 Q;  1A63 A;  3AYH B;  1VQD A;  3H3V I;  1Y1W H;  4JI0 L;  2VW9 A;  3NEN A;  2GVA A;  1K0R A;  4GOP B;  1J5E Q;  1VQI A;  2K75 A;  4PMW A;  3HOX H;  4A75 A;  3CC7 A;  1GJJ A;  4JCV E;  1HNX L;  2PMZ E;  3M4O H;  4XIG S;  4TQU S;  2R7D A;  3PUZ A;  3E0E A;  5JJK A;  5IYC G;  3NEL A;  5GAE C;  1WCM G;  2NZH A;  2RF4 A;  1XPR A;  3S1Q H;  1L1O B;  4FDB A;  4R4O A;  4IOC A;  4A4I A;  1I94 L;  3PUX A;  3CC2 A;  4KHP Q;  2Q2I A;  3K0X A;  3S15 H;  4HIO A;  3J7Z C;  2A8V A;  2R7F A;  2QGQ A;  4QIW E;  4A3K H;  1OTC A;  1I50 H;  2CKZ B;  2WB1 E;  2N49 A;  3CW2 C;  4DV5 Q;  3CAM A;  4DV4 Q;  1HNZ Q;  4PZ8 A;  1PH5 A;  3HOW H;  4MNO A;  2UUA L;  2N3S A;  2RCN A;  5FLX c;  5IY0 A;  1BBU A;  2F3I A;  4LF8 L;  4O0A A;  2A1A A;  4GNX B;  1PH9 A;  1E24 A;  5JEA G;  4GOP A;  1Q82 C;  5IYD H;  4P71 A;  1BBW A;  1X65 A;  1VQA A;  2AWO A;  3LGJ A;  2VQE Q;  1PVO A;  2CQO A;  3I4N H;  4L5Q A;  3PF5 A;  1VQ8 A;  4UPA A;  1P8L A;  4UP7 A;  4PZ7 A;  4X62 L;  3J7A 5;  1EN7 A;  2UU9 L;  5M5Y H;  4A3C H;  5C0X J;  2R92 H;  2LC3 A;  1GKH A;  4LF6 L;  5GAH C;  1SLJ A;  4DR5 Q;  1N34 Q;  4A3G H;  1RL2 A;  4NB3 A;  3E9H A;  1J6Q A;  1A8V A;  2EQS A;  4ME3 A;  3G4S A;  2OQK A;  3CCV A;  3FHW A;  2R93 G;  3F2D A;  1N9W A;  1JJ2 A;  3ICE A;  3WWV A;  3S24 A;  3J81 i;  2GVB A;  4DPG A;  5M3F G;  1JE5 A;  1QVG A;  4NXN Q;  3CCR A;  2B63 G;  4XTC S;  3KLW A;  1CSP A;  3AFQ A;  1VQ5 A;  4IFD J;  1T9H A;  2KEN A;  2NN6 G;  2KBN A;  3HFZ B;  4GNX A;  1TWA H;  3NEM A;  5EAY A;  2DUD A;  1OXV A;  2QEX A;  2ODG C;  1LUZ A;  1XNR L;  1S3O A;  2V1C C;  4RMF A;  3CCM A;  3PO3 G;  3PUV A;  5HY6 A;  1VQ6 A;  3BU2 A;  1WOC A;  1SFO H;  3OTO L;  4B3M L;  1S72 A;  1VQN A;  5IWA Q;  1IBL L;  1PA6 A;  5JEA J;  5LMN L;  5C4X H;  1YI2 A;  4A93 H;  3VDY A;  4A76 A;  3CPF A;  1KRS A;  1QVC A;  2XTI A;  1CKO A;  1EUJ A;  1K83 H;  1Y1W G;  5BR8 L;  1YHB A;  3G48 A;  1Q12 A;  1IZ6 A;  4YHH L;  1VQ4 A;  3HOZ G;  3HOX G;  1DGS A;  2HT1 A;  4DR1 Q;  4NPS A;  3CCL A;  4POF A;  4LUO A;  4X65 L;  4IPG A;  2XGT A;  1GD7 A;  2D62 A;  1E3P A;  4A3I H;  4LF5 Q;  2VQF L;  1YVC A;  3GTP H;  1I5F A;  4QGU A;  1LM0 A;  1YJ9 A;  4TVA B;  1W3S A;  2IX0 A;  2D0O A;  3GD7 A;  4DKA C;  2ZM6 Q;  3D0F A;  1VQC A;  4YCU A;  4NXM Q;  4BA2 I;  4KLK A;  2Z6K C;  4B3T Q;  1JMC A;  4A3K G;  5M5W H;  2UUB L;  1QUQ B;  2KHI A;  2RHQ B;  2C35 B;  3I4M G;  1SRU A;  3HOW G;  2B29 A;  3G6E A;  1E1T A;  4DUZ L;  1YJW A;  1B8A A;  2VL6 A;  1IXR A;  1KRT A;  3CCU A;  1HR0 Q;  1BVS A;  1CKN B;  1KAW A;  5C3E H;  4YWM A;  3M7N A;  3AQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...