1AR61

P1/mahoney poliovirus, double mutant v1160i +p1095s
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
283
structure length
283
Chain Sequence
AATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNSASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYIPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 46
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ar6100
1MQTA 2X5IA 1PO23 1NG0A 4IV1A 3HAGA 1NA1C 2GSYA 2RM21 1AYM2 4YVSC 2RMU1 3ZFFC 1POV3 2BFUS 1AR61 1NA1B 5D8AA 4YVSB 1VRH3 4LLFA 4QPGC 3ZFFB 3J8F3 1D4M2 2R042 3ZFGC 1BMV2 1ZBE1 5BNOA 1AYN1 3ZFEA 4QPGB 5C8CA 1RUH2 2R072 3ZFGB 1RMU3 1BEV2 2IZWA 1FOD3 1RUG1 2MEV1 1MEC1 3VBOC 1MQTC 2TBVA 2ZZQA 1VBA3 1RUC3 4Q4Y1 3M8LA 4IV1C 1MQTB 1Z7S2 1RUF2 2FZ2A 4IV1B 5D8AC 4IV3A 5FMOL 2HWE1 1R093 1V9U1 5ACA2 1HRV2 1RUI2 5D8AB 5J98B 5BNOC 1POV0 2BPA2 1FPN3 1PVC3 5C8CC 3VBFA 1VBB3 4GB32 1PIV3 2HWC3 3NAPA 3VBSA 5BNOB 1RUE3 1AUYA 2HWD3 3JB4C 5C8CB 3VDDA 1AYM1 4YVWA 4CDWA 5BNNA 5J96B 1DDLA 4CDXC 4RR3A 1D4M1 2R041 2WZR2 3IDEA 1WCDJ 1BMV1 1EV12 1AR62 1RVF3 4Y4YA 1RUH1 4Q4V2 2R071 4AEDA 2WS93 1BEV1 2HWB2 2RM23 1M06G 2RMU3 1VBE2 3CJIA 4RHV2 2RS31 4IV3B 3S6PA 1AL0G 2ZAHA 1RUG2 4BCUA 3VBFC 3FBMA 1IHMA 1PO13 2R063 3NAPC 3VBSC 2RS12 2GH8A 1ZBE3 2Y26A 1AYN3 1Z7S1 1RUF1 3VDDC 1NCRA 4Q4X3 3VBFB 4YVWC 4CDWC 3NAPB 1SMVA 4CEYC 3VBSB 2MEV3 5BNNC 5JZGA 2XBO2 4NWVA 3VDDB 2RS53 4YVWB 5GKAC 4CDWB 5BNNB 1QJY2 1GFF2 5ACA1 1HRV1 1RUI1 1AR72 2RR13 4AEDC 2PLV3 4GB31 3VBOA 3CJIC 4AEDB 1QJZA 4WM7A 1RHI2 1AR92 1V9U3 3CJIB 1TMF3 2WFF3 5BNPA 2WZR1 5A33B 1NCRC 1EV11 5CFCA 5JZGC 4Q4V1 1NOVA 2HWB1 1NCRB 4CEWA 2HWF3 3JD72 1PGW2 1HRI3 1AL21 4RFT0 5JZGB 1RUD1 1VBE1 4RHV1 4CDQA 2R043 2VQ0A 1QJX2 3JBG2 2RS11 2RS32 3VBUC 3TN93 4GH4A 1RUH3 2R073 1HXS2 1BEV3 4WM7C 1RMU2 4FSJA 1AR82 1CJDA 1FOD2 1HX6A 3LOBA 3VBUB 2XBO1 1QJU1 3VBOB 4CDXA 2ZTNA 4Q4W3 4WM7B 5BNPC 1HQNA 1QJY1 4JGZC 1C8M1 1AR71 5CFCC 5BNPB 4CEWC 4JGZB 5CFCB 4CDQC 4N43A 1VBD2 4CEWB 1RHI1 1AR91 3DPRA 1R1A2 5ACA3 1RUI3 4CDQB 1FMD2 1RUJ2 4GH4C 1PVC2 4CEYA 1ND2A 5A32A 4GB33 5C4WC 4GH4B 4Y5Z0 5FOJB 1RB8G 3JD71 1PGW1 1POV1 4RQPC 5C4WB 4PDWA 4CDXB 1NCQA 1VRH1 5K0UA 2WZR3 3VBHA 1ASJ2 1QJX1 1ZBA2 5LK7B 1AL22 3JBG1 1RUD2 1ND3A 1AR63 3JB8A 1RVF2 4Q4V3 1HXS1 3ZXAC 5A33A 4N43C 2WS92 1RMU1 1AR81 1FOD1 3DPRC 1B35A 1VBE3 4RHV3 4N43B 4Z92B 1RUG3 3DPRB 1ND2C 4FTEA 1QJU2 2BFUL 1A6CA 1PO12 2RS13 1EAH2 1MEC3 4CEYB 1ND2B 5A32B 4FTSA 1R082 1BBT2 2BUKA 1C8M2 4PDWC 4Q4Y3 1OHFA 2DF7A 1VBD1 1QQP2 4RS5A 1NY72 1NCQC 2RS52 1F2NA 5K0UC 3VBHC 1CD3G 1R1A1 4PDWB 3VBUA 1ND3C 1W39A 1FMD1 1AR73 1NCQB 1RUJ1 1X33A 1PVC1 1VBC2 2HWE3 2RR12 1COV2 5K0UB 4N53A 3VBHB 1TME2 4EJRA 2PLV2 5DDJ2 1ND3B 5AC92 1RUE1 1B35C 2QQPA 4FTBA 4JGZA 4WM8A 1AR93 1K5MA 1PO22 1B35B 1AYM3 4GMP1 2WFF2 1ASJ1 1ZBA1 5ABJA 1PGL2 1RVF1 1VRH2 1D4M3 2WS91 4RS5C 3J8F2 2HWF2 3JD73 1HRI2 4RS5B 5CFDA 4N53C 1QJX3 5C4WA 3JBG3 1PO11 2R061 1EAH1 2RS33 1VB2A 4N53B 1HXS3 3TN92 1H8TA 4Q4X1 4RQPA 1AR83 1R081 1BBT1 4WM8C 1VBA2 1RUC2 1K5MC 1QQP1 1Z7S3 1NY71 1RUF3 2RS51 4JGYA 4Q4W2 4WM8B 1F8VA 2X5IC 1K5MB 3VBRA 5ABJC 1VBC1 2RR11 1COV1 4CDUA 1TME1 2X5IB 1R092 2PLV1 4QPIA 5DDJ1 1HRV3 2WWSA 5AC91 5ABJB 1FPN2 1OPOA 5L7OA 1VBD3 1VBB2 5CFDC 1PIV2 1PO21 2HWC2 1R1A3 1RUE2 1TMF1 2HWD2 1FMD3 1RUJ3 2WFF1 3ZFEC 5CFDB 1H8TC 1VAKA 1PGL1 1X36A 3ZFEB 1H8TB 3J8F1 4RQPB 2HWF1 4JGYC 1EV13 1HRI1 1OOPA 5C9AA 3VBRC 2HWB3 2WLPA 2RM22 4JGYB 4GMP3 4CDUC 2BBVA 1ASJ3 1ZBA3 2RMU2 1AL23 4QPIC 1VB4A 3VBRB 1RUD3 1C8NA 5FMOS 3TN91 4CDUB 4SBVA 5L7OC 4IV3C 4QPIB 1VBA1 1RUC1 4NWWA 2R062 1ZBE2 1AYN2 5L7OB 4Q4W1 4Q4X2 2MEV2 2XBO3 1QJU3 1EAH3 1NA1A 4YVSA 1MEC2 1R091 2XPJA 3ZFFA 1QJY3 1R083 1BBT3 2FZ1A 1C8M3 1OOPC 5C9AC 1FPN1 4Q4Y2 1QQP3 4QPGA 3ZFGA 1VBB1 4RR3C 1PIV1 2HWC1 1OOPB 5C9AB 2HWD1 1VBC3 1COV3 4RR3B 1RHI3 2HWE2 1TME3 1E57A 5DDJ3 1V9U2 5AC93 4GMP0 1TMF2
chains in the Genus database with same CATH superfamily
2ZZJA 1MQTA 1NXMA 2B4KA 5CKNA 1DG6A 3T3YA 4A3XA 1PO23 3I4IA 4WZFA 5HCHA 1LR5A 3OGVA 2GSYA 4PF5A 5K4LA 3MV01 1YQ5A 3ZYPA 4YVSC 3UKVA 3ZFFC 4CXYA 1POV3 3M4FA 2W1SA 3FUOA 1MS0A 2VL4A 2D3SA 1YQCA 4CUCA 3KQ4B 5E16A 3NWKA 4CU8A 4QM8A 2QDRA 5DAWA 4LLFA 1REEA 2P2KA 3J8F3 5J7MA 1N3PA 3UKTA 5BY5A 3FUQA 3DECA 3MPBA 4B29A 4BM8A 1BMV2 2F4LA 2O8QA 2DVAA 4QPGB 3FWEA 3OUIA 3ZFGB 1G6NA 1WZXA 2V5DA 2WNOA 4Y1UA 5EPAA 3FLPA 4YW4A 1IGOA 5L73A 1HN0A 1W8WA 2QKDA 3DN7A 5J1XA 4URAA 1FV2A 1L7RA 1CZTA 1JN2P 3PUSA 4XIKA 1MEC1 2K46A 3OY8A 3VUOA 4QXCA 3KHCA 1MQTC 3USUB 2RJ2A 2XWJB 1QGLA 2J1AA 2TBVA 1DCSA 3IIIA 4KQ7A 1RUC3 2FCTA 3I2OA 5FIXA 2VMIA 4Q4Y1 2LRPA 3UT0A 4ZHNA 3T0DA 4MVTA 4FPLA 3RZGA 4BQYA 1N47A 4CUBA 4LO5B 5LRSA 4TWTA 2J1SA 1LRHA 5F2SA 5FLIA 4UAPA 1BVVA 3WP4A 5JXJA 2AGSA 1VMHA 1ENSA 2YFZA 4M3CF 2NP0A 1H2NA 2WNVB 4KMQA 4XBNA 4GAZA 4NMIA 2Q8DA 3UGHA 4AVCA 1R093 3H8XA 3QACA 4W6YA 2Q1FA 3K75B 5FBJA 2G9GA 1UYPA 4AQSA 5CADA 1SG3A 3WZ1A 5DAVA 4CPBA 2XHKA 1CZSA 1VLNA 2JIJA 1PIV3 2HWC3 3NAPA 4I2OA 3VBSA 5BNOB 1IS6A 4ZXEA 1PMIA 2C26A 2CL2A 1FT9A 5FZOA 4DQAA 4ORFA 1YI9A 4HLTA 4BU2A 3ZVXA 4YVWA 3S30A 1W2NA 1PZ8A 3OPTA 5EP9A 1O5UA 5DZFA 2Q0AA 3FBYA 3FHAA 4QB6A 1OQ1A 1VR3A 1APNA 4CDXC 2D3PA 3DKWA 1NQDA 3MV11 1Q3EA 2WZR2 3IDEA 2YHJA 2VUAA 1CONA 1ZZBA 1EPZA 2YB7A 1HQWA 3HQXA 3JCIA 4BE3A 1BMV1 3ASIA 1F31A 1RVF3 1QDCA 4W65A 1CVNA 2QQOA 4Y4YA 4Z82A 1F15A 3PUHA 2WS93 4BHPA 4CU7A 4AQTA 1UYXA 1QY4A 2Y33A 4FAHA 3KT4A 4ZY9A 1CAUB 2R1DA 4IQPA 3DEMA 4LBMA 3WP3A 5C8WA 3JU9A 5FAXA 1OT5A 3QD6A 2RS31 1LOEA 2CNAA 5FZIA 1GNZA 4G9SB 3DYMA 5FLJA 5H9SA 3DL3A 1RUG2 2A6YA 2XJTA 5FZDA 2Q1MA 4PCRA 4R8HA 2ZGRA 1I5ZA 1PO13 1KJLA 1UN1A 2R063 3AKSA 1SHWB 3MHZA 3NAPC 2DUOA 5DQ0A 3VBSC 4LBQA 3ABZA 1YLLA 2DCJA 1ULDA 1J84A 2ID4A 4Q4X3 3VBFB 1LOFA 4YVWC 4XXAA 3NQHA 1XJAA 4I09A 5FYYA 2MEV3 4LBJA 4HN0A 5L9RA 3WSOA 5JZGA 2XBO2 3E5UA 2RJLA 2AEYA 3U14A 3VDDB 2VTXJ 2RS53 5I0SA 4S2FA 5AVPA 4ZPIA 4M0HA 5BNNB 3PMEA 1GFF2 3F2ZA 4D3WA 4JKLA 1LCLA 1ZYBA 3RG0A 3NKTA 2RR13 4XEZA 2MHFA 1JXNA 3C7OA 4CCJA 5DAQA 2PLV3 3PTYA 4LUKA 4OQ9A 1A3KA 3EXUA 1OUXA 4FPOB 2A7AA 4H55A 5DUXA 4OHWA 2DBNA 4HZFA 2JJ6A 4YW2A 5BPXA 2VCCA 3DYPA 3AKQA 2LTNA 4O61A 4P9WA 1OURA 1UY4A 1W3VA 4NR1A 1CAVA 3CJIB 3D6EA 2ZA9A 1NKGA 1A8MA 2OUHA 4OUSA 4E2SA 3KCXA 4FVVA 2BEOA 2V72A 4Q0SA 5BNPA 2WZR1 5DZEA 5A33B 4GIQA 3N7MA 1LOFC 5FY4A 4YWAA 1G9DA 3AP5A 4NHYA 1T2XA 1MVEA 5D2AA 5CFCA 2FDJA 5JZGC 4AQ6A 4IEUA 3OGGA 5JOWA 4UFHA 4CU9A 4CEWA 2GH2A 3VL9A 3S7IA 1ZVFA 4E8DA 1AL21 4RFT0 2XJRA 1RUD1 5CIRA 5FUPA 1UWWA 2VR4A 3DCQA 1YJLA 1GZWB 1LGCA 2FCVA 4AHWA 4DINB 1KDKA 1OVSA 4PLMA 2WZEA 3ZYJB 1RUOA 5ANQA 1UMZA 4AFDA 3PVOA 2JDMA 1IZ3A 2Z42A 3WY6A 3TN93 2XJUA 2O1QA 3GJAA 2R073 4ZU7A 5IVVA 4LO6B 4MGTA 3DGTA 3LE0A 2XJPA 1FOD2 3J7LA 2DCZA 4WVWA 4XETA 3W20A 2VC9A 3LOBA 3VHRA 2XBO1 1TNRA 1FI2A 5A7SA 2VZ1A 4UFMA 5GLTA 2ZKNA 3VBOB 5C3QA 4B4PA 5FJHA 1CWPA 5HV4A 1YCIA 4Q4W3 1UW8A 3K3OA 2SBAA 3ZX7A 5BNPC 1W9WA 2XMLA 2QQWA 3G7DA 1G86A 1W99A 4JRLA 2C4XA 4I30A 4QPYA 4UBHA 4AGVA 5CFCC 4K20A 2VD7A 2YBPA 4RN5A 4LO4B 3IT8A 4BLIA 4CEWC 3GCXA 4N90A 4AI0A 3CQOA 4Z2AA 2FDFA 2P4EA 1NT0A 4LKEA 4TN7A 1W03A 3H1WA 3KSCA 3NV2A 4HONA 5A3MA 3NJXA 2DTYA 2VU9A 2WT0A 2HEVF 4N43A 2L9LA 5ISLA 1LOAA 3BIWE 2D6NA 3LCPA 1SFYA 1VE0A 2GNTA 3DPRA 1PX3A 4P02B 5T5PA 4CUAA 3AZZA 1EPWA 1QHDA 1VIWB 4GWMA 1RUI3 3HMYA 4R9AA 2BWAA 3T0AA 2VGDA 3BTYA 3H1MA 3MI8A 1A34A 4M3CA 2ARCA 1RUJ2 4MGQA 1PVC2 4CCEA 4CEYA 2GMPA 2HKXA 3J26N 3N7KA 3ME2A 4XJ8A 1W8NA 3MFAA 1YFYA 2F6BA 4MH0E 4NAMA 4P5YA 5GLVA 4CA9A 5EQUA 3H3LA 4XJUA 1I5PA 4ZXKA 2IUWA 1US2A 2B9UA 2Z5WA 5FYIA 1JYTA 1QKQA 2W95A 1JH5A 1GP5A 1GOGA 1HIXA 3UV9A 1NCQA 5HI0A 1VRH1 3O1UA 3WF4A 4AWDA 1Q8PA 1YNAA 3NNFA 2VXRA 4BQXA 4XBLA 4AFBA 3VD7A 4YYOA 4XQ4A 2CGNA 2ENRA 2ZGTA 4YSFA 1AR63 3OGSA 4XDOA 4EN7B 1W8HA 3VDAA 5E1RA 2GNBA 1W8OA 1US3A 2XQXA 4N43C 5FPBA 3POWA 1HDKA 5A33A 1FOD1 2PA7A 1C3HA 4OZOA 3DPRC 1UL9A 4JDOA 5I91A 5CAZA 4RA0A 5E88A 1H2KA 1DQ4A 1DF0A 1MZ6A 1G9CA 1URXA 1WCKA 4XJZA 3AMNA 2BFUL 1A6CA 4CXXA 3NSTA 4CXWA 1DYOA 3JZVA 3U78A 1YQ6A 4YZ4A 1BCXA 4EN0A 2J1EA 3KQRA 4JAAA 3QOPA 5FXWA 5FYCA 5KXDA 5FPLA 4AQ2A 1R082 2YV8A 2BUKA 4XAEA 1C8M2 4LITA 5D21A 4NRMA 5JCTA 1YFXA 3B00A 1GZ9A 1W0OA 5JSPA 4RS5A 4XPVA 3CZJA 1NCQC 1WLCA 1DLCA 1D4VB 1ZREA 1CD3G 3AMMA 2GP3A 2C24A 2A73B 2PQQA 3PJYA 1X33A 1RUJ1 4FP3A 1PVC1 1VBC2 4DRVA 3WEZA 4ASLA 1YIFA 2VNRA 2RV9A 4DEVA 1S0JA 4JC1A 4FOVA 2Y6KA 1W9YA 4EJRA 4YZ2A 1S55A 1UXXX 4XVHA 1RUE1 3B9IA 4XUTA 1W3XA 4D94A 5F3EA 3HQUA 4IGOA 3RI8A 4FTBA 4L8QA 4J25A 3PVNA 3MBWA 4CVUA 1B35B 5T5JA 1C5HA 4K7JA 2B9VA 4FPEA 1RINA 1J59A 1G9FA 3THTA 2Q4SA 1PZ9A 4NIDA 2O8OA 3J7NA 3ZO0B 5FFOC 1JODA 2P5BA 2YXSA 2BW8A 3Q8AA 3UYJA 4AVSA 4XABA 3ALQA 4XBQA 2LM3A 2PHLA 3N9OA 1D4M3 1UNBA 1ZM1A 2VZUA 4RS5C 3JD73 3KV6A 5CNAA 1SFPA 3SITA 4A4AA 1IPKA 2ORZA 3AP6A 4WBBA 5HPOA 3IBMA 2QNKA 3NNJA 2Y0IA 3RZJA 1MVQA 2RDSA 3W59A 2RDQA 4L9BA 4PBPA 4CCKA 1MS4A 3R4UA 2WIIB 4OZXA 3RGBA 4AVAA 5FXVA 1T6GC 3Q8BA 4RQPA 1YYNA 2TEPA 1R081 4A7ZA 4EQVA 3WG3A 4QX3A 3R05A 2BNNA 4Y26A 3HPNA 2OIIA 4AI8A 5BNQA 5FMDA 2SLIA 3C3VA 1PK6C 4JGYA 5A3OA 2X53S 1OLME 2WL1A 2X5IC 1H6XA 4U36A 5K7PA 4AVTA 3GZEA 4M4PA 3TB0A 1W04A 1VBC1 5FYUA 2Q5TA 4FPKA 4YW7A 5IVYA 3AFGA 4X6QB 4Q8LA 2WWSA 5ABJB 2WO1A 3E6CC 2JB8A 2YPDA 2JB4A 5I8SA 4LA3A 3ZN6B 1OPOA 2EXJA 3M3QA 2OA2A 3LDKA 4F8AA 4YW6A 3SCGA 3IMNA 4E9KA 3E97A 1JU4A 1R1A3 2WO3A 4HKWA 4F7ZA 4ZZ8A 5FPZA 2VULA 3I2IA 1FMD3 1UOFA 2D43A 2ZX2A 4OCTA 2YMZA 1Q56A 4DRRA 1LTEA 2GP5A 5IAXA 1XBFA 3UETA 2BYVE 4IE0A 3FX3A 5AVAA 4D6QA 2Q8CA 4E4HA 1BXHA 1H8TB 1QOOA 4QDSA 3LEGA 4JGYC 4WZCA 4DIQA 3HNMA 1OOPA 4Y1VA 2VBDA 3O14A 3O1RA 1CX1A 1S0DA 2WFPA 3POSA 1WMFA 2RM22 3DUIA 2ET1A 4FP2A 5D1IA 2VUJA 5FBZA 4EWDA 2E32A 1ASJ3 2RMU2 2Z69A 2GC1A 2Y6GA 1U0AA 3LA2A 3C7GA 4XUPA 1O8PA 4Y5TA 5EYXA 1V6IA 3ZDSA 4FOWA 4JDNA 4XFIA 4ISQA 5A7OA 5FMOS 1OH4A 1LGNA 1N1SA 3FC0A 4JX0A 2VW2A 3MIHA 4FPCA 4SBVA 2GMEA 4XILA 1U5IA 2RE9A 1JYCA 2A75A 4QX8A 5FZ1A 5FZFA 3A0NA 2AZ5A 4F3JA 3GGLA 1W8FA 1GV9A 3O7OA 1OLMA 1NUKA 5DN2A 5L7OB 4LK7A 4FOQA 3PDQA 3K4AA 4G4FA 1QJU3 5H9QA 4CYDA 1DIWA 3C2UA 5F6KA 1TG7A 3KCCA 5APAA 5G04L 1JZ4A 2YC2A 2QZ2A 1NAEA 2YFUA 3I49A 1BBT3 3LFIA 1OOPC 1X8EA 2D6LX 1CAWA 4BIOA 2X29A 2W2IA 5F3CA 1LHWA 4FQ4A 2VH9A 4LO7A 3WDUA 1LOBA 4CCOA 4LBNA 3RPQA 1HB3A 3HQRA 3FL7A 3OBRA 3POYA 1LU1A 1TQ5A 1N1TA 3HN3A 5IAVA 2IXJA 1WLDA 1COV3 2XR4A 3Q8EA 3BCWA 4RR3B 2HWE2 1J1LA 4ES9A 2ZS6B 3PURA 1ODMA 5LY2A 2DVGA 2JDNA 1V9U2 3DV8A 3WNXA 4JQTA 5AC93 3NJVA 3B3QE 4Q26A 4L0PA 2W68A 3ZM8A 4ONUA 2VNVA 1ACCA 3VHOA 4JTOA 4OVEA 4XFBA 5FY5A 3ZYGA 4A44A 4MZUA 3VZNA 2QCSB 3S57A 1BZWA 1FNZA 1UPSA 4IV1A 1GWMA 5IK8A 2RM21 2OKXA 4P14A 2RMU1 4QGLA 1JZ8A 2Y38A 2EXIA 5LBFA 4Y24A 3MEPA 3MPPG 5D8AA 1UU4A 4LBKA 4BMEA 4CCDA 4YVSB 4K8FA 3ZFFB 4KG0A 3ZYBA 1RTVA 3NL1A 2YGLA 2QQJA 4GULA 3POGA 4AI2A 2GC3A 2PTMA 2W1UA 2XOMA 5FY8A 2GALA 3KZ4C 3PL0A 3BPZA 3LFMA 3BKZA 1Q8SA 1BEV2 1YO8A 2IZWA 1V6JA 2NQYA 1BKZA 3SKVA 2C6SA 4UXAA 2RDNA 3ORJA 5C71A 4N9IA 1KS4A 1SDDB 1W6MA 2PHDA 1ZZ7A 2XLFA 5F7UA 3N9LA 1NXD1 2D6PA 3P5BA 3BI3A 3HJRA 3RMYA 3FLTA 4XJ9A 2VECA 3IMMA 1F4AA 4O7XA 3ZR6A 1VBA3 4NHMA 4P9IA 2JDYA 3G6JB 1YI7A 2BOIA 4FXGB 3RFRA 3M8LA 1YQ8A 4IV1C 4CP0A 1MQTB 3GZUC 5KHKA 1RUF2 3ACHA 2J1TA 5FYVA 3I7DA 4GZ9A 2DUQA 2UWAA 3GHMA 3UGFA 2EIBA 1DQ0A 1YQ2A 4DMIA 1PGSA 5D8AC 3VV1A 3ZXLA 4IV3A 4GJZA 2HWE1 3HEIA 3SCHA 4NROA 1N3OA 4AK3A 4A7YA 4EZHA 2P3KA 2JENA 3O0XA 1UZ0A 1V9U1 1XE7A 2W94A 5ACA2 1HRV2 4DO0A 3E5XA 4MO3M 3C8XA 1FPN3 1HKDA 2YUEA 2WUHA 5M0TA 1H9PA 4H14A 3ACIA 1GLHA 4PLOA 1DZQA 4LHLA 5JI7A 1R1ZA 3I59A 2Z2SB 1AUYA 3H8OA 3UJQA 3JB4C 4RFRB 2B7YA 1JW6A 4W50A 4A45A 2JDKA 5FYSA 2NM1A 3N9PA 4NPMA 5ANNA 5CKMA 4DS0A 2J42A 2WRAA 4V1PA 3GXUA 2A71A 3AZYA 1WMXA 4RR3A 3TWIA 3N36A 5LASA 3I3MA 1EV12 5F9TA 2HEWF 1RXGA 2CY6A 5CG8A 1OA3A 4C90A 4Q4V2 3ZXJA 4AEDA 1BEV1 1M06G 4IEVA 2E31A 5HCAA 2IVJA 1JMUB 1QNWA 2HYXA 1KFXL 1VBE2 3MFCA 3H1YA 4H7MA 1VAVA 2DV9A 1RC6A 3HIFA 3THPA 3HVDA 1AL0G 2PHXA 5CISA 4HN1A 4SLIA 1UX7A 4ASKA 3E1F1 4BCUA 3I97A 1SLBA 2VUDA 4LKDA 4XZPA 2LS6A 5CA6A 3QH6A 3JQXA 1ZA7A 2XXZA 2RS12 4P9JA 2VY0A 4AFMA 2Y26A 2D5HA 2VZRA 4K8RB 4MLOA 2QQKA 1RUF1 1NCRA 3SNMA 3NV4A 3U1XA 1WW4A 3NAPB 3VD4A 1GSLA 1LENA 2JE7A 3ATGA 3VBSB 1AHSA 4I0BA 2HBTA 3A23A 4NWVA 1SLCA 5FZOB 3WXPA 5F1RA 5KXCA 1SPPA 2VTXA 2ZBJA 4YVWB 4IEYA 5H9PA 4MYEA 2D40A 5GZFA 2ZPXA 3LGRA 4JKMA 2BTVC 2ZCWA 5ACA1 1HRV1 1GMMA 4LHSA 2ETEA 2OXBA 4OI4A 1WWYA 5FTTC 1S2EA 2DFBA 3NV3A 5IW0A 5IK4A 1AR72 5FZ8A 3WCRA 4QHBA 2VZPA 4QT6A 4AEDC 1O3SA 3ZYIB 1O7FA 2NMOA 2YU1A 3TOJA 3OEAA 2VNGA 4BK5A 4C1XA 4HOOA 2ORXA 4COVA 1QJZA 2Q8OA 2YZ4A 3OOXA 3THDA 3WW1A 4WM7A 1RHI2 2WABA 4O65A 2VZTA 2P6CA 4OMDA 2JDUA 1TMF3 1O8SA 3V0BA 2JDHA 2VOTA 4LUMA 2WFF3 4HL0A 1UZZA 1NCRC 2ZGLA 4JZRA 5BYNA 4S2GA 5FZLA 3ZN5A 1FNYA 1X7NA 1EV11 1TE1B 1U12A 4UFJA 4LBQB 3VDCA 5B4NA 4Q4V1 4EN8B 5DAPA 4FT8A 1WW7A 1NOVA 1O91A 2A6VA 1UOGA 1XNKA 2VW1A 4GJYA 1UCXA 2HWF3 4AVVA 1JZ3A 5FZAA 1V6MA 1HRI3 4EYUA 4BDVB 5JZGB 1VBE1 3J7HA 4K21A 3PIJA 2J1VA 1CQ9A 5A1FA 3QH7A 1H0BA 4LIUA 4XHBA 5LEJA 1QJX2 2KD7A 2JECA 4GWJA 2RS11 5A6YA 2N7GA 3AP7A 3AXDA 2E9QA 2RS32 4WVVA 3GZAA 2G1MA 4LA2A 4OHVA 3J4UH 4GH4A 5EV7A 5A7QA 4INDA 1AXZA 1W0NA 2OW4A 4WM7C 1AXKA 1XC6A 2CAUA 3ES1A 3L2YA 2DU1A 1GICA 2BGOA 2WSUA 1LULA 4CDXA 3CMGA 5FP9A 2YBKA 2WWUA 4XFGA 3NV1A 1GQGA 5DG1A 1OD3A 3OGRA 5HXVA 4HT1T 5DUUA 1WMDA 1BVP1 4H7LA 1UMHA 4YW3A 1W8UA 4FAGA 1UO9A 1CAVB 1JOBA 4XFHA 3ILRA 4X8PA 1AR71 2QQVA 4TXWA 4NVPA 4DPNA 4Q5OA 5BNPB 2A6XA 5A6XA 1SCRA 3BOWA 3I2HA 3IWZA 3ZSKA 4A7KA 1LNSA 4BA6A 5FRAA 5CFCB 2BVVA 5FZMA 5E8AA 2WN2A 4CEWB 1UQXA 1RHI1 2BJSA 3IDCB 3PNAA 4NN0A 1HV1A 5C3OA 1W6PA 1P8JA 4G3YC 5JUVA 2ZX3A 2IXKA 2OX0A 4XCBA 3KGZA 2AUYA 4LTAA 3QBQA 1S0EA 1WLWA 2AREA 1H1AA 4GH4C 3H8UA 1PMHX 3S5QA 1ND2A 5A32A 1JYXA 3C7FA 2X05A 1LJ7A 1C1LA 5I93A 2D6OX 1HJFA 1XNDA 4Y5Z0 5JOZA 1F4HA 1JZ2A 5B4XA 5G05L 1KS5A 4L99A 4UFKA 1POV1 1UAIA 2B39A 4PDWA 1NQJA 4XF0A 3ZOIA 3RSJA 4GQ7A 1Z0HA 2R32A 1G8WA 5FWJA 4BQ3A 2Y6JA 2WZR3 5I8YA 3VBHA 1QJX1 1AL22 3B02A 2R0FA 3ZPOA 1RUD2 5C6CA 1ND3A 3ZLIA 4BZ4A 3FHQA 4BJ0A 2C1FA 2ZGSA 3AYCA 2R0HA 1RVF2 4Q0QA 3ZMNA 5JXHA 3WVJA 5IVCA 2WS92 5KC5A 2IFWA 5JSRA 5JIAA 2WC2A 5FO8B 3DKQA 3HNYM 1PNGA 4AZZA 2VZQA 1JI6A 3QCWA 3I3BA 1ULFA 2VPVA 2ZGNA 3EBRA 4N43B 5EXOA 1VJ2A 4EV0A 1RUG3 3APBA 3DPRB 4YM2A 3O0WA 3I2FA 1ND2C 4PIXA 5JXIA 3W5MA 2JKXA 1DZTA 3GM8A 2VMEA 4K1YA 1PO12 2WINB 3SMHA 3AM2A 5JMOA 1EAH2 1VALA 4M3CB 3WNNA 3USSA 4R4ZA 1CAXA 4CEYB 4LT5A 2KA3A 4NIGA 4FTSA 1CPNA 4J6GA 5F5AA 4UW5A 4BXFA 2A3WA 5FYMA 1PNFA 3HN1A 3LA7A 4OHXA 4PDWC 2MPFA 1D0HA 4BQ4A 1OHFA 3OYWA 1Q8OA 1QQP2 1FX5A 1QU0A 4FPYA 2OUJA 2RS52 3GYDA 4TZDA 2YGMA 1WUVA 3VBHC 2EIDA 1ND3C 4LHKA 4NAOA 1HB2A 1NCQB 4WVMA 2HYKA 2RG4A 2RR12 4LEJA 2VMDA 3WCSA 1TME2 4ZS2A 4XURA 1OD5A 2PLV2 5A70A 3M7AA 4YNIA 1MS1A 3IKWA 3KLSA 4YGCA 1GNHA 1C28A 1KJRA 3DF0A 1S1AA 4Q0PA 3OD0A 2ADEA 4FPFA 2QQPA 2BDRA 4WM8A 1G7YA 4M3CE 4HKOA 2YYOA 2D7FA 3CNAA 4X8NA 3ZXGA 1BHGA 2R6QA 3WHUA 1AYM3 4QQPA 4QXBA 3LAGA 4ZONA 4QXKA 3KD4A 3TRSB 1PHMA 4MADA 1I3HA 2QBXA 5A1AA 4DNYA 1H1IA 2Z4FA 4R9CA 4IGPA 2GMMA 3GZTB 2PQSA 1RVF1 2YC4A 1XE8A 4XC9A 3T2TA 2ZACA 1KGYA 1VRH2 1YUDA 2WS91 4AVBA 2YC0A 3EQEA 1ZZ9A 3MF9A 1JYNA 4E2GA 3EO6A 2XWBB 4HVOA 5I0UA 2WZPP 3WOGA 5FQ0A 4IW3A 2WSVA 4BQ5A 2BQPA 1XOYA 2JG8A 2UY9A 3OBZA 4RS5B 4LORA 4QMAA 4XMAA 3H8RA 1E5HA 2DTWA 2E6VA 2J1RA 4XACA 3T1MA 3N4MA 3H9AA 5EYYA 4ZU4A 3CDZB 1PO11 2R061 1EAH1 5E6HA 3AB0A 1JOPA 1QF3A 3D0SA 3V0AA 1VB2A 5F8PA 3TN92 4Q4X1 3MUZ1 2P3IA 4XFAA 3WQ0A 4WM8C 3R0RA 2EXHA 4K3UA 1ST8A 1QXPA 3KV9A 1BLZA 3DXUA 5GLWA 5CBLA 3GBFA 5T5OA 1QQP1 1Z7S3 2PHWA 3U37A 2XL9A 5JPMB 2RS51 3IAPA 3PUIA 4JCKA 3WINE 4Q4W2 2A3YA 2W1WA 4KU8A 5FOBB 3W58A 1HB1A 3SKJE 2RDRA 4MHUA 5T50A 2H6CA 1JHJA 4XUQA 2UU8A 3V56A 3D5OA 3SH5A 1Z78A 2IC1A 2W0XA 3ENRA 4QQHA 4C1WA 2RR11 1W9FA 2VBPA 3POIA 4NHXA 2GZWA 1TME1 1ZZ6A 2VUCA 2O0OA 2X5IB 3OCPA 4NO4A 4X6RB 2PLV1 3NJZA 2QZ3A 4QPIA 5K9YA 3OTFA 5J3UA 4QB1A 3U4XA 2ZEWA 1OKOA 1U5YA 5C3SA 2P6HA 2JG8C 4PI0A 3SCFA 3NKGA 4O9EA 2CAVA 2UURA 3K51A 1XXNA 1SACA 2WO2A 1UKRA 1VBB2 1GANA 4C91A 1RUE2 3MUY1 1QEXA 2HWD2 4P9YA 4R9DA 4XF3A 1RUJ3 2ZABA 3GHNA 3SLIA 1AX2A 3ZFEC 3QLQA 4ZS3A 3IZOA 4D7YA 2DWRA 4ES8A 1E5SA 1Q43A 2BERA 3K46A 1GWKA 1BK1A 4IEQA 3T2QA 4RQPB 4OI1A 1GWLA 3UJOA 2DURA 5F3GA 1W2OA 2PFWA 5C9AA 4YGBA 3DYOA 1GKBA 2IXIA 1M4WA 4MOAA 1FV3A 2HWB3 2WLPA 1O4TA 5FZ9A 4CTEA 4JGYB 4Z8BA 5L9BA 1HLCA 3Q8FA 4AE2A 4QPIC 1KFUL 3OD4A 2E63A 1UZVA 3IDAA 2GU9A 3WLUA 2ZMKA 5IFPA 5FYBA 1O3RA 4HK8A 3WF0A 1J58A 3TN91 2VVFA 3BU7A 4D7TA 2ZXQA 4XQWA 5JDBA 2D5FA 3RZZA 1ZBE2 2FDKA 2E7AA 3EJKA 1AYN2 2XJQA 1NLRA 3CU7A 4Q4W1 3MW2A 5F2WA 3PUAA 5A7WB 2DVBA 3RRDA 4AXOA 2UWCA 4COWA 1QIQA 3VDBA 2WNUA 4FQZA 3LPFA 3VZKA 4BMBA 3LPGA 3P3NA 1GZTA 1XNAA 1NA1A 1NZIA 1PMJX 1UU6A 2Q30A 2VMHA 1WBLA 2ZOEB 5IT6A 1QJY3 1R083 1MS9A 1ODNA 2FZ1A 3H50A 3AZVA 1C8M3 5DG2A 3K4DA 5C9AC 5A6QA 3S5AA 1RL3A 4PJYA 5IK5A 2ARXA 4UF0A 3ZKYA 5FZGA 1VBB1 2W9XA 1WMEA 4H2AA 1OOPB 2I74A 3OB8A 3WW2A 1DQ5A 1K5JA 4HSLA 2HWD1 2EA7A 5C3RA 2DDUA 1VBC3 4ASMB 1POQA 2WT2A 4CP9A 2VOVA 3VB9A 4A41A 4QB2A 4AW7A 3W21A 3NW4A 1GR3A 4K6BA 4MXWA 1X9PA 2PXJA 4XTPA 3B93A 4GMP0 4AI9A 1OVPA 1PK6A 1PZ7A 3WHTA 4KBZA 2W52A 2X5IA 2W87A 3OBTA 4QU1A 5I8TA 5JI9A 4JRAA 1LHUA 3NMBA 2OT7A 3KV4A 1I1EA 2FDIA 2WNUC 1NG0A 2XQRA 5FKBA 1O5LA 2XDVA 2CSGA 2XUEA 5L36A 3HAGA 2F17A 1NA1C 1JZ5A 2NN8A 3H42B 3HBZA 4OYUA 1MACA 4YZ3A 1AXYA 4Z07A 1JZ7A 3BIEA 3K48A 4EE2A 4B3NA 2R16A 5FXXA 2BFUS 1AR61 4OUMA 2ZEZA 3WQ1A 3ZPYA 3LIHA 4YGEA 1D4M2 2R042 3WUCA 3OSDA 1DHKB 3ZSLA 5F6LB 1JU3A 4LBOA 1S2KA 1ZBE1 2Y8KA 2JDZA 5A3UA 2IWGB 4MGKE 1AYN1 1EUUA 1CAWB 5C8CA 2D3RA 1RUH2 2EICA 1JUIA 1LEDA 1RMU3 4EWEA 4UYBA 5FUIA 3AC0A 2BV4A 3OBAA 4KGGA 5EIYB 3VZMA 2ZGKA 2UYAA 1F5FA 1H4HA 4BOWA 1UD1A 3O1VA 3BPSA 3VBOC 1W9TA 4AFCA 1NE4A 4I0WB 2VM9A 4IEOA 3Q9OA 2XGXA 2ZZQA 3RVHA 4QKNA 2LALA 1N1YA 3M3CA 2IXLA 3W9AA 1O4ZA 2VMGA 5J09A 4PT6A 5JR2A 2P17A 1EY2A 1W2UA 1CZVA 5LATA 3GALA 4DXTA 3N9QA 4HETA 4I01A 4QX7A 4IV1B 5FMOL 2EIGA 3ILFA 5A7WA 3U0ZA 1O3QA 1YFWA 1L7QA 2BVBA 4XUOA 1LAJA 5J98B 5D8AB 4UT5A 1SEFA 3LF7A 3WNPA 1POV0 5A80A 5C8CC 2DVDA 4YG6A 3B7MA 3IB3A 3LDBA 1DQ1A 2MNGA 2QFEA 5FY7A 4GB32 4S2DA 1VPHA 1YRZA 5A1LA 3K77A 3PU3A 3N7LA 4TLFA 3V65A 1W6QA 2G4IA 3K4ZA 2NPIA 5LA0A 2K0GA 4QKDA 2DCKA 1L3JA 2A5ZA 4YARA 4QQLA 1S0FA 2QQUA 3MO4A 1W0PA 2D98A 5F3IA 2YDEA 4IXLA 4CDWA 4IDZA 5KBFA 3AZWA 2BNOA 2KR2A 1SLAA 1SBFA 2PAMA 4TLGA 3A7QA 2D6KA 1UY3A 1W6MB 5A3LA 1DDLA 2E33A 4RGKA 4XF9A 4AR2A 1CJPA 1D4M1 2R041 4B4RA 1NE6A 1DGLA 5KHGA 4N8MA 5EZWA 1DGRA 1IG3A 4NIIA 3WQBA 4YFWA 1RUH1 2YPJA 5FWEA 3AKRA 5EJ3A 2RM23 4AHYA 4HK9A 1OQEA 2RMU3 3N35A 3AL5A 4LLOA 3N9MA 1LEMA 4JVAA 2G19A 3F95A 3ZXFA 3NNGA 1ZA4A 4RHV2 4IV3B 4AEMA 4AHZA 3S6PA 3WP5A 1EUTA 2ILMA 3MW3A 4COUA 2DVFA 1QMJA 4JHZA 1L7LA 2B5HA 2UWBA 1RITA 3GCWA 5LA9A 3WG1A 1XYOA 4IERA 1VMFA 2JD4A 4UOJA 5E89A 4IL7A 3TBDA 2VXJA 2CTVA 4CDWC 4CCLA 1SMVA 4QHZA 3I59B 1GBGA 1S0BA 3SQOA 4A6SA 4R4XA 5F37A 2JG9A 5FZ4A 2D97A 5A3TA 2WO7A 3WNKA 5CYYA 1J1TA 2LUWA 5GKAC 5I0DA 1O3TA 3LD8A 4FBFA 4QD2A 1K12A 3VL8A 5IVJA 1H2MA 4HMZA 2XH6A 3LIGA 3VD9A 4O9GA 5DAXA 4GWIA 3NNLA 3BTXA 3D4KA 1DYKA 4META 3SHRA 2V5YA 4GB31 2Y6HA 3KMHA 2QTWB 1W6NA 4BH9A 4KGQA 5LK5A 2UY8A 1GYKA 1QNYA 5KHHA 2JD9A 3NNMA 4AEDB 4HPKA 5IATA 5KHJA 5C7GA 1EYBA 1AR92 3GDBA 1OFSA 1XSQA 1V9U3 1FATA 1OI6A 1V6LA 1MPXA 4A2UA 5EJ1B 3HNBM 5FYTA 1GZCA 2WQ4A 2PAEA 3VLBB 4NIAA 1WA4A 2JG9C 3VKMA 3WG2A 1YIPA 3CEWA 3ZYHA 2XKOA 3T4VA 4OULA 1NCRB 3TEWA 1H30A 4FFHA 4L2NA 4XW3A 2WJSA 1PGW2 3PHMA 3LSDA 3KF3A 3C7HA 1VAMA 1OUSA 4RHV1 3O5SA 4CDQA 5FK7A 1SBEA 2DBIA 4XXPA 1SPPB 4CRQA 2ERFA 1YEWA 2VVEA 1UU5A 2RVAA 3H7YA 1IPJA 1UX6A 4P9GA 3KWVA 3JBG2 5FJKA 3TNPB 2BNMA 3PTRB 4UFLA 2WYSA 4HG6B 3VBUC 5KXEA 1HXS2 1BEV3 1DQ6A 1UF2C 1AR82 5FK8A 4FSJA 4K1ZA 3JQWA 1DGWX 1IS3A 3ZXEA 1I6XA 1QJU1 3WF1A 2ARAA 2IXCA 4IEPA 5EWSA 3VKNA 4GA9A 4A6OA 4M00A 4PIZA 4WM7B 2AEZA 4D6SA 2TNFA 4K40A 4RGAA 5J36A 1HQNA 1BK0A 1GU3A 3AFKA 4IE7A 4JGZC 4QU2A 4YW5A 5BUVA 5FUNA 3V0BB 4LBLA 3M2MA 3TNQA 1STMA 5FREA 4JKKA 4Q27A 4Q29A 1JOJA 1XYPA 5GJ6A 2ZX0A 3VZLA 3O1PA 4MV2A 3PUQA 3M3OA 3EHKA 1LGBA 5DMYA 3WP6A 2BGCA 2I2SA 3B9CA 5FYZA 3BTZA 4CDQC 1OSGA 4QX5A 1VBD2 5CU1A 2RHPA 1S0GA 1C4RA 4D6RA 3VKLA 1AR91 1F9KA 3MYXA 1IS4A 5ACA3 1QJFA 2GAUA 3WDXA 3TEYA 4WVZA 4NPRA 4D8MA 3CIHA 4UI9L 3IM0A 4YM1A 4ITCA 5LBEA 3WF2A 5HXMA 5C4WC 2EAKA 3A22A 4GH4B 2JIGA 2VQAA 5FOJB 4BB3A 4IESA 3MIEA 5GLUA 1DQ2A 4BWOA 1RB8G 1PGW1 4FXKB 4OHZA 1AF9A 3KV5A 4CDXB 5JOXA 4EROA 4DUWA 4UW6A 4IEWA 1UIKA 1UY2A 4Q2FA 2VMFA 5K0UA 4Q1PA 2XG3A 4M4RA 2ZGQA 1BYHA 1ZBA2 3TEXA 1OH3A 2OZJA 3JBG1 4BYYA 4HBNA 2AENA 2I45A 4Y20B 1I9RA 4AEKA 1YHFA 1UOBA 4D69A 1XNBA 4Q4V3 1HXS1 3B94A 3E6DA 4J1XA 4Y22A 1SDWA 3ZXAC 2FBEA 4H3WA 1AR81 2YU2A 5BXXA 1GUIA 3WT3A 1O59A 1FYUA 2FDHA 2BU9A 5IK7A 1VBE3 4MGSA 3RWNA 2JE8A 4Z92B 1XU2A 3O1OA 2X09A 1VRBA 1W6PB 5LY1A 4PHZA 4FTEA 2ZMNA 1W6OA 2PELA 2RS13 3PMSA 2NZ9A 3N7JA 1MEC3 4RSUA 3KT7A 1HW5A 1ND2B 5A32B 4AF9A 1O6UA 3H0OA 2JXAA 2XJVA 5FY9A 2VJXA 4OI0A 1Y9QA 4Q4Y3 2VBBA 3U10A 1VBD1 1GQPA 1E5RA 2Y34A 4U2AA 3E6BA 4DUVA 5IVEA 1F2NA 5HCFA 5K0UC 2C0ZA 4RYDA 5J37A 4PDWB 1XSRA 5GZDA 3WNOA 4CCCA 4FPHA 3TYJA 1AR73 2HJIA 2ZX4A 3ILNA 1WD3A 4N53A 3VBHB 3I3EA 4UW4A 5GZGA 3MICA 2NMNA 3MGUA 5DDJ2 3VN4A 1ND3B 4E4ZA 4P00B 3RYKA 1D2QA 2P3JA 2Y64A 4NHLA 1RIRA 3KT1A 5LWBA 5LBCA 1XYNA 1DGWA 5CEHA 4HSJA 1H1MA 4HVRA 4UWDA 2JICA 2WYFA 3AXEA 3WV6A 3VD3A 4URTA 1K5MA 1PO22 2TUNA 1D0GA 2E51A 2CYFA 3AMHA 4L97A 4CP2A 4E4SA 4B1MA 5L9VA 4BXSV 4Y5SA 2G9ZA 2WFF2 4GMP1 3ACFA 3GF6A 1ZBA1 3WDWA 4DXRA 3AJYA 4S2HA 1S0CA 4XDQA 5FMBA 1JUHA 3OUJA 4MXVA 4CUGA 3FE5A 1CPMA 1OLRA 4I0AA 1PGL2 1EP0A 5J48A 1XE0A 1CAXB 1KDMA 2V73A 3AJZA 5FCCA 1RGSA 1CESA 3J8F2 1UYYA 4IETA 3RMXA 5C5TA 2HWF2 4P08A 4CE8A 2IXHA 2ZHMA 1HRI2 2JX9A 3RI9A 4C8DA 3OYWB 1FXZA 2KM2A 2HBUA 1HV0A 1W8TA 4GKYA 4B8EA 2XL7A 3HOBA 5CFDA 4N53C 5KHIA 1XB9A 1QJX3 4YGDA 1REFA 2FMYA 2R49A 3AVSA 3AX4A 3SEEA 2CV6A 3ZKUA 4QX2A 2RS33 4WVMB 3SEPA 1Y9GA 2VZVA 5CKQA 2IVIB 3MLKA 4KG8A 4L92A 4WV8A 4ATEA 4ARYA 2W92A 3H7JA 1RUC2 4HVQA 1K5MC 4Y20A 3POBA 3T30A 1PX4A 1IKPA 1CX4A 3ZSJA 4XYXA 1LB2A 1Q8QA 3H3ZA 5F5CA 5FP3A 4WM8B 1K42A 3J7MA 3AYEA 4D7SA 1MR5A 3VBRA 1B09A 1OFNA 3FJSA 4GALA 3GJBA 2GN7A 2ZX1A 5KWRA 3FFQA 3UK9A 3VHNA 5LBBA 1F35A 4CDUA 4DZGA 1R092 2CWSA 3S0MA 5DDJ1 5LCWL 4NIHA 5HV0A 3IPVA 5IJRA 3ETQA 4FFFA 3VKOA 4AEJA 3A21A 2I07B 1MS5A 4XFCA 4Y33A 4GWNA 2J7MA 4MX3A 5FQ0B 5CFDC 1S0IA 1PIV2 1PO21 1WKYA 2FMDA 2HWC2 4XF4A 3IIAA 4CCNA 1CGPA 4DB5A 1TMF1 2JG8B 2P34A 3EMRA 4L11A 2WFF1 3HD8B 3U11A 2VQUA 3AK0A 1W9SA 3NRUA 4HXCA 4XQDA 3FN9A 2XLGA 1PGL1 1KXGA 5GZEA 3FMGA 1ZRDA 3I2JA 3MZHA 3V0AB 3BALA 3OG2A 2X8KA 3ZFEB 3J8F1 4KU7A 2HWF1 3MDPA 1HRI1 3VBRC 2JWPA 5FPUA 2VZSA 4DY3A 1NYWA 4CDUC 2XVGA 2BBVA 1AL23 1RUD3 1HJGA 2XLAA 1ULGA 4RGGA 1TNFA 2VW0A 4ATFA 4CCMA 4V2VA 1AX0A 2E53A 1PVXA 2ET7A 4QPIB 1TZOA 2P3YA 1CIWA 1RUC1 4I3GA 2XONA 3AYDA 2R062 3U07A 1XPWA 5T54A 4Z2WA 5A3PA 1NZCA 4PF1A 1LHNA 4LMFA 4LIVA 4YRDA 3ECQA 4Q4X2 1E5IA 4LKFA 5KC6A 4BISA 2GNMA 2QDNA 1KITA 3T2OA 2MEV2 2J22A 2XBO3 3TAYA 2WAAA 1DP0A 1LHVA 2EVXA 1GNYA 1EAH3 3AP4A 1HQLA 1UYZA 2IFRA 3PIGA 1J3PA 3AZXA 1WLTA 3R4SA 4LE4A 2WZ8A 4OMCA 1R091 4DEQA 4B1LA 2WA3A 4XJWA 3BGAA 1PM7A 4P9XA 2Y6LA 2ZGUA 1QQP3 2BP6A 4QPGA 4AHXA 1Y3TA 4LR4A 3ZFGA 3TEZA 1XNCA 2ATFA 1PIV1 2HWC1 1OXCA 5DPNA 5C9AB 3ZXKA 3ZR5A 2FHRA 5C5UA 4QPWA 3SH3A 3I54A 1UY0A 5DXDA 2WKKA 3D8CA 1TME3 2W39A 3USUA 2ZGOA 3B01A 1E57A 5JXGA 2CWMA 3LDRA 4OQ8A 3OJBA 5GZCA 3KGLA 1DLLA 2CU5A 1U5ZA 2W46A 4EN9B 1XU1A 1XQNA 4QDRA 4NRPA 3SXWA 3I2DA 4EZ4A 2VZOA 4IEZA 4MHRA 2P37A 5CVRA 4OHYA 2E7TA 2EAAA 4W6XA 5TSWA 1CN1A 5JSOA 3RDIA 1QH6A 2WNVA 1QOTA 4LO8A 3WD5A 1AYM2 5IWFA 4ARXA 1NX9A 2BGPA 2VCAA 2ZEYA 3BN6A 4LNVA 2WNUB 2A1XA 2PHTA 1G9AA 2ZKLA 1GP6A 1NA1B 1O4YA 2W3JA 3PLQA 3ZYRA 2AC1A 3D3AA 1KEXA 1VRH3 4QM9A 4JTNA 4QPGC 1SLTA 1WCSA 1AVBA 3POFA 4YW1A 4Y3OA 5FZ3A 3ZFGC 5BNOA 4M01A 1OF4A 1R64A 4QXHA 4UF0B 1ENXA 4YG0A 3MLLA 3ZFEA 4BPZA 4MG2A 1UOJA 2R072 3LEIA 5HCBA 2VQTA 1FOD3 5LRRA 1RUG1 4EN6B 2MEV1 2ZMLA 3ZN4A 5CG9A 1D7PM 2WAOA 5FZ0A 3T09A 2XUMA 1JHNA 4NPLA 4LK6A 4CP9B 3K3NA 5IFTA 3ACLA 3A4UA 1LOGA 2QQIA 4MXWB 2XB6C 5HBAA 3NO8A 5AFBA 2DYCA 1OF3A 1PK6B 1U5XA 4QDQA 4Y4RA 3O1SA 1Z7S2 1YXWA 1NLSA 2BWCA 2WNVC 5A7NA 1C5IA 2A70A 1V6OA 1UIJA 1ZZCA 4N9HA 4OFGA 5K8SA 1CAUA 2FZ2A 1C57A 2NYYA 4XIOA 4MGIE 3GBGA 2G9FA 3KHBA 4GXLA 3BUCA 4AOCA 3HBKA 1V6KA 1PM4A 2Y60A 4XAAA 2VG9A 4XOGA 4Y1YA 3RYRA 4YG3A 3WNMA 4R9BA 1G9BA 3J9SA 1RUI2 5BNOC 5DABA 2BPA2 1PVC3 2H0BA 5C33A 1ULCA 4Q1RA 3I2KA 3VBFA 1W2TA 1VBB3 2PHUA 5JAXA 4DUXA 4MGYE 5FY0A 1RUE3 4XUNA 2HWD3 5C8CB 3U75A 1Y4WA 3CO2A 3VDDA 2WR9A 1AYM1 5AFEA 4FPGA 5IYYA 1MZ5A 3UESA 1SQ4A 2W08A 3IN9A 2DFCA 5BNNA 5J96B 5T3NA 1JYIA 4CU6A 3PU8A 2CDPA 4QGMA 2V4AA 2BOJA 2C9AA 2DU0A 2HH9A 3ON7A 3AMQA 4QKFA 3ZXDA 2CHHA 3CF6E 1ENQA 5JLVA 4FI9A 1WCDJ 1BQPA 3BODA 3PVEA 4I3PA 4FCAA 4J1WA 2XVLA 4LULA 4XF1A 4QX0A 1AR62 4IE5A 4CPBD 3AP9A 3KB5A 2BRTA 2P1BA 3FLRA 3RWKX 5I0TA 2R071 4OI2A 1Y7BA 4PQQA 2A6ZA 5FYHA 2HWB2 5FXZA 4IE6A 4NE9A 5F5QA 1IG0A 1QWRA 2WN3A 3KF5A 4A3ZA 4DXSA 2BZDA 4YM0A 3I8TA 2VAUA 3CJIA 3ETPA 5FPAA 5FZBA 3CL1A 1W2AX 2HEYF 4KL1A 3MLJA 2AYHA 2ZAHA 1MZFA 2DCYA 3VBFC 3FBMA 1IHMA 1RXFA 2E7QA 2WA4A 2XJSA 3LOIA 4PQ9A 3LKJA 2GH8A 1ZBE3 1LKNA 1AYN3 1JBCA 3OPWA 1Z7S1 4QQ2A 3ZIWA 3VDDC 2JEMA 2PHRA 3RJRA 3O12A 4Q0UA 4CEYC 5FP8A 4LE3A 4BIFA 1W6QB 2XVKA 5BNNC 4LJHA 5T5LA 3LSEA 2KXLA 1X8MA 1DGRN 1WCQA 5A3NA 4CDWB 2Z79A 2OPKA 4XDPA 1GZWA 1OC1A 3M3EA 5EJZB 2B8MA 1QJY2 2B45X 3UKNA 1RUI1 1XNTA 4HANA 4E2QA 2QQNA 1N1VA 2ZGPA 3OPZA 2Q8EA 2VVDA 4LBQD 5FR3A 1UXZA 2VO5A 4QHOA 2R7EB 1UMIA 3THCA 2D93A 3ACGA 3VBOA 4PIYA 3CJIC 3M1HA 4PI2A 5F32A 3JUUA 1QXJA 3CBNA 1QJEA 3GNEA 1GP4A 1ZX5A 3WW4A 1WBFA 2ES3A 4B4QA 5BV6A 2H0VA 1LESA 1N3QA 3LB9A 5FPVA 1ZNPA 1QH7A 3EYPA 1IOAA 3IAQA 1J3RA 1RJ8A 1VMJA 3NVCA 5DUVA 3ZIXA 2ARBA 3C7EA 4FO9A 1UZYA 5C3PA 2CGOA 1ZZ8A 4OUEA 2HWB1 4IGQA 2V4VA 1MS8A 5JWPA 2QVSB 3ROUA 3KM5A 3JD72 1ULOA 5KR7A 2JG9B 3MIBA 3I3DA 3WDTA 4MSVA 4OLLA 5FDBA 2K2SA 2FDGA 3PJQA 3CLPA 1S2BA 2LW8A 2UYBA 3AL6A 4LXLA 4P5HA 4MGZE 4NJ4A 1UY1A 1RYYA 2R043 1RJ7A 2VQ0A 3RNSA 2OVUA 1T6BX 3AYAA 5LA1A 5A6ZA 2AH2A 1J3QA 1YFUA 2QQMA 1IS5A 1HN1A 4XFFA 4FFIA 1RUH3 3ZYFA 1XRUA 2EF6A 5DZGA 5GLZA 1RMU2 3IDBB 1CJDA 1HX6A 3HT2A 4XZUG 3ST7A 1Q8VA 2VCMA 2EALA 1W6NB 1REDA 3E5QA 4NHKA 4UFIA 3VBUB 4DY5A 5FO9B 2WBKA 2ZTNA 3AKTA 2YROA 4HPKB 4DXZA 4AI1A 3VD5A 3T1LA 3LZZA 1H2LA 2VCBA 1QJY1 1LODA 4UW3A 4ET7A 4E8CA 5IHRA 1JTZX 1W90A 1C8M1 5FZ6A 4BQWA 1JZ6A 4M0NA 3FFZA 1WCUA 3L2HA 4FFGA 5I0RA 4XE9A 3AMPA 4JGZB 2PHFA 3V64A 2VTFA 3SH4A 5A7PA 4BQ2A 5FP7A 1MS3A 1WD4A 3KVAA 2F4PA 4W8JA 3KS7A 4N7IA 5GM0A 2R1BA 3WDYA 5KXBA 3O1MA 1K45A 2E26A 1Y9MA 4TSVA 3T4HB 4ISRA 4P9LA 1ALYA 3LEMA 3RZHA 1R1A2 2FCUA 3K2OA 3CZUA 5IUQA 3U4SA 1F5JA 4CDQB 1ZRCA 1W05A 1FMD2 3WF3A 4D0QA 1MZEA 2Y0OA 2Q1ZB 5FMCA 4GB33 4XTMA 2LROA 1X50A 2CGPA 3WDVA 5C70A 3KCYA 1NLQA 5LZ6A 1QDOA 2VMCA 3JD71 2AACA 2YG0A 4RQPC 5C4WB 2XHNA 4UBGA 3H3UA 2H6BA 1CIYA 4FPJA 3UNPA 4BQ1A 4E4DX 1ASJ2 1ZRIA 2VE1A 2VOWA 3AKPA 4KWLA 4YM3A 5LK7B 1DFQA 3MF6A 3POEA 3O0VA 4Q0VA 4QKBA 3BU0A 4ZZ5A 3JB8A 2FD8A 3WW3A 5EHDA 1KD7A 3PVBB 1RMU1 5FV3A 4Z1VA 4C0HA 3ZMOA 1W28A 5B2GB 4XHXA 4QX1A 1B35A 2K9ZA 4PLNA 4RHV3 4CZSA 2GC2A 3OGJA 1WA6X 1JS9A 2A6WA 2WDBA 3BOPA 4JDMA 1Y43B 2W5FA 3MIFA 4LKSA 4AI3A 4QGNA 1QXRA 4CP1A 1V6NA 2CDOA 1QJU2 5CZKA 4YLZA 4NOTA 4KWKA 3EB7A 4IUGA 3ZSMA 1H4GA 5JOYA 2HLEA 3R6SA 2W91A 3HR9A 1HB4A 1A78A 4BK4A 1BJQA 4AL9A 2XKPA 3LQCA 3P1IA 5JMCA 1W06A 1BBT2 1V0AA 5LB6A 2PMWB 1YWKA 5IVBA 2WNEA 4FOYA 1TEIA 1IQDC 2DF7A 1LHOA 1SBDA 1NY72 4E27A 3RZLA 1R1A1 3B5LB 1YJKA 3M3IA 5FO7B 3VBUA 4COZA 4EWAA 3D0JA 1W39A 1FMD1 2AR6A 1J83A 1X82A 2ZHLA 4W6WA 1ENRA 2HWE3 4NUBA 1COV2 1CR7A 4ZKTB 5K0UB 2GN3A 4LOSA 4DOUA 2JE9A 3INAA 2GC0A 3MIDA 2C5DA 1GOHA 4YPJA 5FP4A 5LW9A 4YZ1A 2BBAA 5F39A 4DFSA 5AC92 1B35C 3URFA 2A3XA 3ELNA 4Y22B 1ULPA 1V70A 3BYWA 1FAYA 4HFSA 4ZU5A 4AG4A 3W5NA 4JGZA 4KI5M 2JDAA 5JIUA 1AR93 2GDFA 4KH9A 3VHPA 3ZDVA 1A8DA 3JXSA 5JR7B 1KRIA 3ES4A 3X29B 4KWUA 2WT1A 3OUHA 1JYWA 4XCAA 3VZOA 2O14A 4YZ5A 1ASJ1 5F5IA 1W6OB 1AZDA 4N7UA 2PN5A 4KNCA 3N9NA 1RUNA 2Y6FA 2R30A 5ABJA 3NJYA 3ZN6A 2ZHNA 1ULEA 4F83A 1DZRA 2WLQA 3R4DB 5DUWA 1OA4A 5EFUA 1WW6A 5ERLA 3OEBA 2ZHKA 4BLJA 1OMIA 2QJVA 3CKHA 1DU3D 3WUDA 1X9TA 4JHTA 3T08A 4C0BA 5C4WA 3VZJA 2W1QA 3JBG3 3P6BA 1UZWA 3ITQA 4KWJA 1Q5OA 3LWCA 3WR0A 2JDPA 4N53B 1HXS3 1H8TA 2GNDA 5FLHA 2D6MA 1AR83 3I2GA 3CJXA 2JKBA 1BBT1 1VBA2 2ZEXA 3MIGA 4QQOA 5JVVA 1LECA 1GQHA 1NY71 1RUF3 1C1FA 2FQPA 4COYA 2YBSA 1F8VA 2J1UA 5FZHA 1K5MB 2EIEA 3LA3A 4TYSA 5ABJC 3O1TA 1H8VA 3VKFC 1VP6A 3HT1A 1AX1A 1GOFA 1COV1 1SCSA 2VOXA 4QWNA 1S4CA 4RD7A 3BB6A 5SV8A 4R52A 4AGRA 3AVRA 5FZEA 1YC61 1W8ZA 2DCTA 4HKLA 1HRV3 1D2SA 3M70A 5AC91 3DXTA 3KVBA 2D44A 1ZRFA 4LPLA 2YY1A 1FPN2 4Y1ZA 3P3PA 4K9SA 5L7OA 1VBD3 3UL2A 3GBWA 4A42A 4LQRA 4AAPA 1UKGA 2NLRA 4AFAA 5CB7A 1OBNA 3RZKA 1SLLA 3SC7X 2PAKA 4AYUA 2OS2A 4GD4A 1V00A 3UGGA 5CFDB 1JYVA 1KQRA 1H8TC 3HWJA 3FZ3A 1OLQA 1LU2A 1VAKA 2VNOA 1X36A 3CHXA 3RYPA 1SFNA 3Q8CA 1IQAA 1WW5A 2WQZC 2ZGMA 5LA2A 2OZ6A 3B69A 3ZSEA 1OPMA 5FPXA 1H6YA 3A0KA 1EV13 2OPWA 2OYZA 2VOKA 1UPIA 3N3HA 4B7EA 3WQ7A 2PYTA 2WWJA 4I02A 3OY8B 1OA2A 1QOSA 4GMP3 2B46X 2EXKA 1ZBA3 5GALA 1VB4A 3VBRB 5FZCA 1C8NA 3LEKA 3OF1A 5H9RA 2V09A 5IVFA 5JPNB 4XMIA 4CDUB 4Q8KA 4IE4A 4PBOA 3S7EA 3T2PA 4IV3C 3WG4A 4AAXA 5L7OC 4B7KA 1VBA1 1ONAA 4JQRA 4JV4A 2QQLA 4NWWA 5FKCA 3VGIA 4IEXA 2ADDA 3IPVB 2DUPA 1LOCA 1SZBA 3WX5A 4W4ZA 4LHNA 2OQ6A 3T0BA 5T55A 1DBNA 4LOTA 1SLIA 3MW4A 5FZKA 5SV5A 4TTGA 4RL7A 5FY1A 2WQ8A 2QUOA 1AJOA 2QE3A 4MUVA 5T52A 1OKQA 4V2WA 5FZ7A 4XJAA 1MEC2 2RJKA 2C9KA 4NRQA 4YVSA 2XPJA 3ZFFA 2ZAAA 4GKXA 3D82A 3RQ0A 3RZMA 3RJ2X 3L9JT 4KBBA 1K3IA 4QAWA 2B42B 1TVGA 4Y1XA 1FPN1 4Q4Y2 3WNLA 3SISA 1DYPA 2VZ3A 5A3WA 3BVCA 4RR3C 1OQDA 4YFZA 1ZRRA 1WGPA 2X10A 4AGGA 2W47A 1IKQA 4CSWA 5L19A 3BTAA 1AJKA 1RHI3 3I3QA 2OQ7A 3RS6A 1H9WA 5DDJ3 1IPSA 2ZJCA 1TMF2 3FHIB 5LEKA 3POJA
chains in the Genus database with same CATH topology
2ZZJA 1MQTA 1NXMA 1DG6A 4A3XA 1PO23 3I4IA 4WZFA 1LR5A 2GSYA 4PF5A 3ZYPA 4YVSC 3UKVA 3ZFFC 1POV3 3M4FA 3FUOA 1MS0A 2D3SA 5E16A 3NWKA 4QM8A 2QDRA 4LLFA 1REEA 2P2KA 3J8F3 5J7MA 1N3PA 3UKTA 5BY5A 3FUQA 3MPBA 4B29A 4BM8A 1BMV2 2O8QA 2DVAA 4QPGB 3FWEA 3ZFGB 1G6NA 4Y1UA 3FLPA 4YW4A 1IGOA 5L73A 2QKDA 3DN7A 1FV2A 1JN2P 4XIKA 1MEC1 3OY8A 3VUOA 1MQTC 3USUB 2XWJB 1QGLA 2TBVA 4KQ7A 1RUC3 2VMIA 4Q4Y1 4MVTA 4FPLA 1N47A 4LO5B 5LRSA 4TWTA 1LRHA 5FLIA 1BVVA 3WP4A 2AGSA 1ENSA 4M3CF 2NP0A 1H2NA 2WNVB 4XBNA 4AVCA 1R093 3QACA 4W6YA 2G9GA 4AQSA 5CADA 3WZ1A 2XHKA 1VLNA 1PIV3 2HWC3 3NAPA 4I2OA 3VBSA 5BNOB 1IS6A 1PMIA 2CL2A 1FT9A 4DQAA 4ORFA 1YI9A 4HLTA 3ZVXA 4YVWA 3S30A 1PZ8A 1O5UA 5DZFA 2Q0AA 3FBYA 1OQ1A 1VR3A 1APNA 4CDXC 2D3PA 3DKWA 1NQDA 1Q3EA 2WZR2 3IDEA 2YHJA 2VUAA 1CONA 1ZZBA 1EPZA 3JCIA 1HQWA 3HQXA 1BMV1 4BE3A 3ASIA 1F31A 1RVF3 1QDCA 4W65A 1CVNA 4Y4YA 4Z82A 2WS93 4BHPA 4AQTA 1QY4A 4FAHA 3KT4A 1CAUB 2R1DA 4IQPA 4LBMA 3WP3A 5C8WA 3JU9A 5FAXA 3QD6A 2RS31 1LOEA 2CNAA 1GNZA 4G9SB 5H9SA 5FLJA 3DL3A 1RUG2 2A6YA 2XJTA 2Q1MA 4PCRA 4R8HA 2ZGRA 1I5ZA 1PO13 1KJLA 1UN1A 2R063 3AKSA 3NAPC 3VBSC 2DUOA 4LBQA 1YLLA 2DCJA 1ULDA 4Q4X3 3VBFB 1LOFA 4YVWC 4XXAA 4I09A 2MEV3 4LBJA 4HN0A 5JZGA 2XBO2 3E5UA 2RJLA 3VDDB 5I0SA 2RS53 4S2FA 5AVPA 4M0HA 5BNNB 3PMEA 1GFF2 4D3WA 1LCLA 1ZYBA 3RG0A 3NKTA 2RR13 4XEZA 2MHFA 1JXNA 2PLV3 3PTYA 4LUKA 1A3KA 3EXUA 4FPOB 2A7AA 4H55A 5DUXA 4OHWA 4HZFA 2JJ6A 4YW2A 5BPXA 3AKQA 2LTNA 4P9WA 4NR1A 1CAVA 3CJIB 3D6EA 2ZA9A 1A8MA 2OUHA 4OUSA 4E2SA 3KCXA 4FVVA 2BEOA 4Q0SA 5BNPA 2WZR1 5DZEA 5A33B 4GIQA 3N7MA 1LOFC 1G9DA 3AP5A 1MVEA 5CFCA 5JZGC 4AQ6A 4IEUA 3OGGA 5JOWA 4CEWA 2GH2A 3VL9A 3S7IA 1ZVFA 1AL21 4RFT0 2XJRA 1RUD1 5CIRA 1YJLA 1GZWB 1LGCA 4DINB 4AHWA 1KDKA 4PLMA 3ZYJB 1RUOA 1UMZA 4AFDA 3PVOA 1IZ3A 2Z42A 3WY6A 3TN93 2XJUA 2O1QA 2R073 4ZU7A 4LO6B 3DGTA 2XJPA 1FOD2 4WVWA 2DCZA 4XETA 3LOBA 3VHRA 2XBO1 1TNRA 1FI2A 3VBOB 5GLTA 2ZKNA 4B4PA 1YCIA 4Q4W3 1UW8A 2SBAA 3ZX7A 5BNPC 3G7DA 1G86A 4JRLA 4I30A 4QPYA 4UBHA 4AGVA 5CFCC 4K20A 4LO4B 3IT8A 4BLIA 4CEWC 4N90A 4AI0A 3H1WA 3KSCA 3NV2A 5A3MA 2DTYA 2VU9A 2WT0A 2HEVF 4N43A 1LOAA 3BIWE 2D6NA 3LCPA 1SFYA 2GNTA 3DPRA 5T5PA 3AZZA 1EPWA 1QHDA 1VIWB 4GWMA 1RUI3 3HMYA 4R9AA 2BWAA 2VGDA 3H1MA 3MI8A 4M3CA 1RUJ2 1PVC2 4CEYA 2GMPA 2HKXA 3J26N 3N7KA 3ME2A 4XJ8A 3MFAA 1YFYA 2F6BA 4MH0E 5GLVA 4XJUA 4ZXKA 2B9UA 2Z5WA 1QKQA 1JH5A 1HIXA 3UV9A 1NCQA 5HI0A 1VRH1 4AWDA 1Q8PA 1YNAA 2VXRA 4XBLA 4AFBA 4YYOA 4XQ4A 2CGNA 2ENRA 2ZGTA 4YSFA 1AR63 4EN7B 5E1RA 2GNBA 5A33A 4N43C 3POWA 1HDKA 1FOD1 2PA7A 1C3HA 3DPRC 1UL9A 4JDOA 5I91A 5CAZA 4RA0A 5E88A 1H2KA 1DQ4A 1DF0A 1MZ6A 1G9CA 1URXA 1WCKA 4XJZA 3AMNA 2BFUL 1A6CA 3NSTA 4EN0A 3JZVA 4YZ4A 1BCXA 3KQRA 4JAAA 3QOPA 5KXDA 4AQ2A 1R082 2YV8A 2BUKA 1C8M2 5JCTA 1YFXA 3B00A 1GZ9A 1W0OA 5JSPA 4RS5A 4XPVA 1NCQC 1WLCA 1D4VB 1ZREA 1CD3G 3AMMA 2A73B 2PQQA 3PJYA 1X33A 1RUJ1 4FP3A 1PVC1 1VBC2 4DRVA 4ASLA 1YIFA 2VNRA 1S0JA 4JC1A 4FOVA 4EJRA 4YZ2A 1S55A 1RUE1 3B9IA 4D94A 3RI8A 4FTBA 4L8QA 3PVNA 1B35B 5T5JA 1C5HA 4K7JA 4FPEA 1RINA 1J59A 1G9FA 3THTA 2Q4SA 1PZ9A 2O8OA 3ZO0B 5FFOC 2YXSA 2BW8A 4AVSA 3ALQA 4XBQA 2LM3A 2PHLA 1D4M3 1ZM1A 4RS5C 3JD73 5CNAA 3SITA 1IPKA 3AP6A 4WBBA 3IBMA 2QNKA 2Y0IA 1MVQA 3W59A 4PBPA 4L9BA 1MS4A 3R4UA 2WIIB 4OZXA 4AVAA 4A7ZA 1T6GC 4RQPA 1YYNA 2TEPA 1R081 3WG3A 3R05A 2BNNA 4Y26A 2OIIA 4AI8A 5BNQA 2SLIA 3C3VA 1PK6C 4JGYA 2X53S 4U36A 2WL1A 2X5IC 5K7PA 4AVTA 3TB0A 1VBC1 2Q5TA 4FPKA 3AFGA 4X6QB 4Q8LA 2WWSA 5ABJB 3E6CC 5I8SA 4LA3A 3ZN6B 1OPOA 2EXJA 3M3QA 2OA2A 4F8AA 3SCGA 3IMNA 4E9KA 3E97A 1R1A3 4F7ZA 4HKWA 5FPZA 2VULA 1FMD3 2D43A 2ZX2A 2YMZA 1Q56A 4DRRA 1LTEA 2BYVE 3FX3A 5AVAA 1BXHA 1H8TB 1QOOA 4JGYC 4WZCA 1OOPA 4Y1VA 3O14A 1S0DA 2WFPA 3POSA 1WMFA 2RM22 3DUIA 2ET1A 4FP2A 5D1IA 2VUJA 5FBZA 4EWDA 2Z69A 1ASJ3 2RMU2 3LA2A 2GC1A 3X29B 1U0AA 5EYXA 3ZDSA 1V6IA 4FOWA 4JDNA 4XFIA 4ISQA 5FMOS 1LGNA 1N1SA 3FC0A 2VW2A 3MIHA 4FPCA 4SBVA 2GMEA 4XILA 1U5IA 2RE9A 1JYCA 2A75A 3A0NA 2AZ5A 4F3JA 1GV9A 3O7OA 5L7OB 4FOQA 4G4FA 1QJU3 5H9QA 4CYDA 1DIWA 3C2UA 5F6KA 3KCCA 2QZ2A 1BBT3 1OOPC 1X8EA 2D6LX 1CAWA 4BIOA 2X29A 1LHWA 4FQ4A 2VH9A 4LO7A 3WDUA 1LOBA 4LBNA 3RPQA 3POYA 3OBRA 1LU1A 1TQ5A 1N1TA 2IXJA 1WLDA 1COV3 4RR3B 4ES9A 3BCWA 2HWE2 1J1LA 2ZS6B 2DVGA 1V9U2 3DV8A 3WNXA 5AC93 3B3QE 4Q26A 2W68A 4ONUA 3VHOA 4JTOA 4OVEA 4XFBA 3ZYGA 4MZUA 3VZNA 2QCSB 1BZWA 1FNZA 1UPSA 4IV1A 5IK8A 2RM21 4P14A 2RMU1 4QGLA 2Y38A 2EXIA 4Y24A 3MEPA 3MPPG 5D8AA 1UU4A 4LBKA 4BMEA 4YVSB 4K8FA 3ZFFB 4KG0A 1RTVA 3NL1A 2YGLA 4GULA 4AI2A 2GC3A 2PTMA 2GALA 3KZ4C 3BPZA 1Q8SA 1BEV2 1YO8A 2IZWA 1V6JA 2NQYA 1BKZA 4UXAA 4N9IA 1KS4A 1W6MA 2PHDA 1ZZ7A 2XLFA 1NXD1 2D6PA 3RMYA 3FLTA 4XJ9A 2VECA 1VBA3 4NHMA 4P9IA 3G6JB 1YI7A 4FXGB 3M8LA 4IV1C 4CP0A 1MQTB 3GZUC 5KHKA 1RUF2 3I7DA 2DUQA 2UWAA 3GHMA 4DMIA 1DQ0A 1PGSA 5D8AC 3VV1A 3ZXLA 4IV3A 2HWE1 3SCHA 4AK3A 1N3OA 4A7YA 2P3KA 2JENA 3O0XA 1V9U1 1XE7A 5ACA2 1HRV2 3E5XA 1FPN3 1HKDA 2YUEA 1H9PA 4H14A 1GLHA 4PLOA 1DZQA 4LHLA 5JI7A 1R1ZA 3I59A 2Z2SB 1AUYA 3UJQA 3JB4C 2B7YA 1JW6A 2NM1A 4DS0A 4V1PA 2A71A 3AZYA 4RR3A 3TWIA 3N36A 1EV12 5F9TA 2HEWF 2CY6A 5CG8A 1OA3A 4C90A 4Q4V2 3ZXJA 4AEDA 1BEV1 1M06G 4IEVA 5HCAA 1QNWA 1KFXL 1VBE2 3MFCA 3H1YA 4H7MA 1VAVA 2DV9A 1RC6A 3HIFA 3THPA 1AL0G 2PHXA 4HN1A 4SLIA 4BCUA 1SLBA 4XZPA 5CA6A 3QH6A 3JQXA 2RS12 4P9JA 2VY0A 4AFMA 2Y26A 2D5HA 4MLOA 1RUF1 1NCRA 3SNMA 3NV4A 1WW4A 3NAPB 1GSLA 1LENA 2JE7A 3ATGA 3VBSB 1AHSA 4I0BA 4NWVA 3WXPA 1SLCA 5F1RA 5KXCA 2ZBJA 4YVWB 4IEYA 5H9PA 4MYEA 2D40A 5GZFA 2ZPXA 3LGRA 2BTVC 2ZCWA 5ACA1 1HRV1 4OI4A 2ETEA 5IK4A 5FTTC 2DFBA 3NV3A 1AR72 3WCRA 4QHBA 4QT6A 4AEDC 1O3SA 3ZYIB 1O7FA 2NMOA 3TOJA 2VNGA 4C1XA 4COVA 1QJZA 2Q8OA 2YZ4A 3WW1A 4WM7A 1RHI2 1TMF3 3V0BA 4LUMA 2WFF3 4HL0A 1UZZA 1NCRC 2ZGLA 5BYNA 4S2GA 3ZN5A 1FNYA 1X7NA 1EV11 1TE1B 1U12A 4LBQB 4Q4V1 4EN8B 4FT8A 1WW7A 1NOVA 1O91A 2A6VA 1XNKA 2VW1A 4AVVA 1UCXA 2HWF3 1V6MA 1HRI3 5JZGB 1VBE1 4K21A 1CQ9A 3QH7A 1H0BA 4XHBA 5LEJA 1QJX2 2JECA 2RS11 2N7GA 3AP7A 3AXDA 2E9QA 2RS32 4WVVA 3GZAA 4LA2A 5EV7A 4OHVA 3J4UH 4GH4A 4INDA 1AXZA 2OW4A 4WM7C 1AXKA 2CAUA 3ES1A 3L2YA 2DU1A 1GICA 2WSUA 1LULA 4CDXA 4XFGA 3NV1A 1GQGA 5DG1A 5HXVA 4HT1T 5DUUA 1WMDA 1BVP1 4H7LA 4YW3A 4FAGA 1CAVB 4XFHA 3ILRA 4X8PA 1AR71 4NVPA 4DPNA 5BNPB 2A6XA 1SCRA 3BOWA 3IWZA 3ZSKA 4A7KA 4BA6A 5FRAA 5CFCB 2BVVA 5E8AA 4CEWB 1RHI1 3IDCB 3PNAA 4NN0A 1HV1A 1W6PA 4G3YC 2ZX3A 2IXKA 3KGZA 2AUYA 4LTAA 3QBQA 1S0EA 1WLWA 2AREA 1H1AA 4GH4C 3H8UA 1ND2A 5A32A 1LJ7A 1C1LA 5I93A 2D6OX 1XNDA 4Y5Z0 5JOZA 1KS5A 4L99A 1POV1 1UAIA 2B39A 4PDWA 1NQJA 4XF0A 3RSJA 4GQ7A 1Z0HA 2R32A 1G8WA 2WZR3 5I8YA 3VBHA 1QJX1 1AL22 3B02A 2R0FA 1RUD2 5C6CA 1ND3A 4BZ4A 2C1FA 2ZGSA 3AYCA 2R0HA 1RVF2 4Q0QA 3ZMNA 3WVJA 2WS92 5KC5A 2IFWA 5JSRA 5JIAA 2WC2A 5FO8B 1PNGA 3QCWA 1ULFA 2VPVA 2ZGNA 3EBRA 4N43B 5EXOA 1VJ2A 4EV0A 1RUG3 3APBA 3DPRB 4YM2A 3O0WA 1ND2C 4PIXA 1DZTA 4K1YA 1PO12 2WINB 3SMHA 3AM2A 1EAH2 1VALA 4M3CB 3USSA 4R4ZA 1CAXA 4CEYB 4LT5A 2KA3A 4FTSA 1CPNA 4J6GA 4UW5A 2A3WA 1PNFA 3HN1A 3LA7A 4OHXA 4PDWC 2MPFA 1D0HA 1OHFA 3OYWA 1Q8OA 1QQP2 1FX5A 1QU0A 4FPYA 2OUJA 2RS52 3GYDA 4TZDA 2YGMA 1WUVA 3VBHC 1ND3C 4LHKA 1NCQB 4WVMA 2HYKA 2RR12 4LEJA 3WCSA 1TME2 1OD5A 2PLV2 3M7AA 4YNIA 1MS1A 3IKWA 3KLSA 4YGCA 1GNHA 1C28A 1KJRA 3DF0A 1S1AA 4Q0PA 3OD0A 4FPFA 2QQPA 4WM8A 1G7YA 4M3CE 4HKOA 2YYOA 2D7FA 3CNAA 4X8NA 3ZXGA 2R6QA 3WHUA 1AYM3 4QQPA 3TRSB 3LAGA 4QXKA 3KD4A 1PHMA 1I3HA 4DNYA 1H1IA 4R9CA 2GMMA 3GZTB 1RVF1 1XE8A 3T2TA 2ZACA 1VRH2 1YUDA 4AVBA 2WS91 2YC0A 3EQEA 1ZZ9A 3MF9A 4E2GA 3EO6A 2XWBB 4HVOA 5I0UA 2WZPP 3WOGA 5FQ0A 2WSVA 2BQPA 2JG8A 2UY9A 4RS5B 4QMAA 4XMAA 2DTWA 2E6VA 3T1MA 3N4MA 3H9AA 5EYYA 4ZU4A 1PO11 2R061 1EAH1 3AB0A 1QF3A 3D0SA 3V0AA 1VB2A 3TN92 4Q4X1 2P3IA 4XFAA 3WQ0A 4WM8C 3R0RA 2EXHA 4K3UA 1QXPA 5GLWA 5CBLA 3GBFA 5T5OA 1QQP1 1Z7S3 2PHWA 2XL9A 5JPMB 2RS51 4JCKA 3WINE 4Q4W2 2A3YA 4KU8A 5FOBB 3W58A 5T50A 3V56A 2H6CA 2UU8A 3D5OA 3SH5A 1Z78A 2IC1A 2W0XA 3ENRA 4QQHA 4C1WA 2RR11 2GZWA 1TME1 1ZZ6A 2X5IB 2O0OA 3OCPA 4X6RB 4NO4A 5K9YA 2PLV1 3NJZA 2QZ3A 4QPIA 3OTFA 5J3UA 3U4XA 1U5YA 2JG8C 3SCFA 3NKGA 4O9EA 2CAVA 2UURA 3K51A 1XXNA 1SACA 1UKRA 1VBB2 1GANA 4C91A 1RUE2 2HWD2 4P9YA 4R9DA 4XF3A 1RUJ3 2ZABA 3GHNA 3SLIA 1AX2A 3ZFEC 3QLQA 4D7YA 2DWRA 4ES8A 1Q43A 1BK1A 4IEQA 4RQPB 4OI1A 3UJOA 2DURA 2PFWA 5C9AA 4YGBA 1GKBA 2IXIA 1M4WA 1FV3A 2HWB3 2WLPA 1O4TA 4CTEA 4Z8BA 4JGYB 1HLCA 4AE2A 4QPIC 1KFUL 3OD4A 2E63A 2GU9A 3WLUA 2ZMKA 1O3RA 4HK8A 1J58A 3TN91 2VVFA 3BU7A 4D7TA 4XQWA 5JDBA 2D5FA 3RZZA 1ZBE2 2E7AA 3EJKA 1AYN2 2XJQA 1NLRA 3CU7A 4Q4W1 3MW2A 2DVBA 3RRDA 4AXOA 2UWCA 4COWA 2WNUA 4FQZA 3VZKA 4BMBA 3P3NA 1UU6A 1NA1A 2Q30A 2VMHA 1WBLA 2ZOEB 5IT6A 1QJY3 1R083 1MS9A 3H50A 2FZ1A 3AZVA 1C8M3 5DG2A 5C9AC 1RL3A 4PJYA 5IK5A 2ARXA 1VBB1 1WMEA 1OOPB 2I74A 3WW2A 1DQ5A 4HSLA 2HWD1 2EA7A 1VBC3 4ASMB 2WT2A 2VOVA 4AW7A 3NW4A 1GR3A 4K6BA 4MXWA 4XTPA 3B93A 4GMP0 1PK6A 1PZ7A 3WHTA 2W52A 2X5IA 3OBTA 5I8TA 5JI9A 4JRAA 1LHUA 1I1EA 2WNUC 1NG0A 5L36A 1O5LA 3HAGA 1NA1C 2NN8A 3HBZA 4Z07A 4YZ3A 1MACA 1AXYA 3K48A 4B3NA 2R16A 2BFUS 1AR61 4OUMA 3WQ1A 3ZPYA 4YGEA 1D4M2 2R042 3WUCA 1DHKB 3ZSLA 5F6LB 4LBOA 1S2KA 1ZBE1 2JDZA 2IWGB 4MGKE 1AYN1 1CAWB 5C8CA 2D3RA 1RUH2 1JUIA 1LEDA 1RMU3 4EWEA 4KGGA 3VZMA 2ZGKA 2UYAA 1F5FA 1H4HA 4BOWA 1UD1A 3VBOC 4AFCA 1NE4A 4I0WB 4IEOA 3Q9OA 2XGXA 2ZZQA 2LALA 1N1YA 3M3CA 2IXLA 3W9AA 1O4ZA 2VMGA 5J09A 2P17A 1EY2A 1W2UA 3GALA 4HETA 4I01A 4IV1B 5FMOL 2EIGA 3ILFA 3U0ZA 1O3QA 1YFWA 2BVBA 5J98B 5D8AB 1SEFA 1POV0 5C8CC 2DVDA 4YG6A 3B7MA 1DQ1A 2MNGA 2QFEA 4GB32 4S2DA 1YRZA 4TLFA 3N7LA 3V65A 1W6QA 2G4IA 2NPIA 2K0GA 2DCKA 1L3JA 2A5ZA 4YARA 4QQLA 1S0FA 5KBFA 1W0PA 2D98A 2YDEA 4IXLA 4CDWA 3AZWA 2BNOA 1SLAA 1SBFA 2PAMA 2D6KA 1W6MB 5A3LA 1DDLA 4XF9A 1CJPA 1D4M1 2R041 4B4RA 1NE6A 1DGLA 5KHGA 5EZWA 1DGRA 4YFWA 1RUH1 2YPJA 3AKRA 5EJ3A 2RM23 4AHYA 4HK9A 1OQEA 2RMU3 3N35A 4LLOA 1LEMA 4JVAA 3ZXFA 1ZA4A 4RHV2 4IV3B 4AEMA 4AHZA 3S6PA 3WP5A 4COUA 2ILMA 3MW3A 2DVFA 1QMJA 2B5HA 2UWBA 1RITA 3WG1A 1XYOA 4IERA 2JD4A 5E89A 4IL7A 3TBDA 2CTVA 4CDWC 1SMVA 3I59B 1GBGA 1S0BA 4R4XA 2JG9A 2D97A 1J1TA 2LUWA 5GKAC 1O3TA 4FBFA 4QD2A 3VL8A 1H2MA 4HMZA 2XH6A 4O9GA 3D4KA 1DYKA 4META 3SHRA 2V5YA 4GB31 3KMHA 1W6NA 4BH9A 4KGQA 5LK5A 2UY8A 1GYKA 1QNYA 5KHHA 4AEDB 4HPKA 5KHJA 1EYBA 1AR92 1OFSA 1V9U3 1FATA 1OI6A 1V6LA 4A2UA 1GZCA 2WQ4A 2PAEA 3VLBB 1WA4A 2JG9C 3VKMA 3WG2A 1YIPA 3CEWA 2XKOA