1AR61

P1/mahoney poliovirus, double mutant v1160i +p1095s
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
283
structure length
283
Chain Sequence
AATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDTVQTRHVVQHRSRSESSIESFFARGACVTIMTVDNSASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYIPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Virus
total genus 46
structure length 283
sequence length 283
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1ar6100
2WZR1 5LK7B 2RS31 4IV3B 1VBD2 1PO21 4Q4X2 1BEV1 1PO11 3VBOA 1C8M3 1AYM2 1ZBA3 1M06G 1RUI1 1QJX2 1RUE2 1HXS3 2HWC2 2HWF1 1QJU3 2HWD1 3NAPA 5A33B 1NCQC 3JB8A 1PIV3 4Q4V2 1WCDJ 4IV1B 1QQP2 2WWSA 5CFCA 1COV3 4Q4Y1 1AL23 4JGYA 3VDDB 4CDWB 1CJDA 5ACA2 1NA1C 3JBG1 4N43C 5A32B 1V9U1 4YVSC 1TME3 5GKAC 1AR71 1PVC1 1ND3B 1R092 2MEV1 1AYN1 4Q4W2 1BMV2 1X33A 1D4M2 4N53B 4Q4X3 5C4WA 5C8CA 1DDLA 4RFT0 2PLV2 1AYM3 1TMF3 1VBA2 4AEDB 3VBHB 1RUE3 4GH4A 3VBOC 3M8LA 1ASJ3 1VBE1 2HWC3 1F8VA 1FMD2 2WZR2 2RS32 1AR81 1PO22 1EV11 4BCUA 1BEV2 1PO12 1RUH1 1RUF1 4Q4V3 4FSJA 1QQP3 3NAPC 1RUI2 5ACA3 1Z7S1 5CFCC 2R072 2HWF2 4JGYC 2HWE2 2HWD2 1QJY3 2R062 1TME1 3ZFFA 1NCQB 1PGW1 4Q4W3 4Q4Y2 1AL0G 1D4M3 5AC93 1RUC2 1NG0A 3JBG2 1BBT1 1NA1B 1H8TC 4N43B 4CDUA 1V9U2 5C4WC 2XBO1 5C8CC 4YVSB 1RB8G 3VBRA 4RHV3 2WZR3 1PVC2 3DPRA 2RS33 3JD71 5CFDA 2MEV2 4GH4C 1C8NA 2WS91 1R1A1 1PO23 4FTSA 1BEV3 2RS51 4PDWA 1RUI3 4CDQA 1ZBA2 1VBE2 1AR63 1OOPA 3VBOB 1HX6A 1MQTA 2HWF3 3J8F1 2HWD3 1AR91 1NCRB 1QJU2 4CEWB 1AR82 1EV12 5K0UA 1RUH2 5J98B 1RMU1 4FTEA 1CD3G 4Q4Y3 3NAPB 5D8AA 3S6PA 1COV2 3ZFFC 3ZFGC 5L7OA 3JBG3 1MEC1 1Z7S2 1V9U3 5CFCB 1FOD1 4JGYB 2VQ0A 2ZTNA 1OPOA 1TME2 1AR73 1PVC3 1RUJ1 2MEV3 1AYN3 5BNOA 3VBUA 3VBRC 2GH8A 4RQPA 3DPRC 4YVWA 4NWWA 1BBT2 4GMP0 1H8TB 2XBO2 1TMF2 1VBE3 5C4WB 4CDXA 3TN91 4PDWC 2X5IB 2RMU1 1ASJ2 1AR61 2RS11 4CDQC 3JD72 1AR83 1F2NA 1EV13 1RUF3 1MQTC 1RUH3 5BNNA 1VB2A 5C9AA 4JGZA 4WM7A 1RUD1 1RVF1 4RR3A 5K0UC 4CEYA 1Z7S3 3J8F2 1R081 1AR92 1QJZA 5L7OC 1QJY2 2RM21 2WFF1 1VBB1 1RMU2 2BFUL 3VBFA 5DDJ1 4EJRA 3ZFEA 1MEC2 4WM8A 5AC92 3ZFFB 5FMOL 1BBT3 4QPGA 3ZFGB 5BNOC 5ABJA 2XBO3 4RQPC 2BFUS 4YVWC 1RUJ2 5FOJB 3JD73 2WS93 1R1A3 4RHV2 2BPA2 1E57A 5FMOS 4CDXC 1POV0 4IV3A 2RS53 3VBRB 3DPRB 5BNNC 5C9AC 3TN92 3J8F3 4JGZC 4WM7C 2RMU2 2ZAHA 4PDWB 1AR62 2RS12 4RR3C 1AR93 3VBSA 4NWVA 4CDQB 4CEYC 2BUKA 1ZBE1 4GB33 1MQTB 1RMU3 1RVF2 1RUG1 1MEC3 4CDWA 5K0UB 2TBVA 1VRH1 1FOD3 3VBFC 1R082 3CJIA 4GMP1 3ZFEC 4WM8C 2R041 4QPGC 1RUJ3 2RM22 5ABJC 2WFF2 1EAH1 1AR72 1AYN2 5DDJ2 5BNOB 4FTBA 4IV3C 1VBD1 4RQPB 3TN93 4AEDA 4Z92B 4YVWB 2RMU3 2RS13 1B35A 4LLFA 1QJX1 3VBSC 1RUF2 4QPIA 5BNPA 4GB31 1RUD3 1RVF3 2QQPA 5BNNB 5C9AB 1R083 4JGZB 4WM7B 4RR3B 2GSYA 2RM23 1FPN1 4CEYB 1VBC1 2WFF3 1NY71 1VBB3 2DF7A 3CJIC 4CDUC 2Y26A 1PGW2 5DDJ3 1RUG2 5JZGA 1RHI3 1POV1 1A6CA 5CFDC 1R091 3VBFB 2R042 1ND2A 3IDEA 4YVSA 4QPGB 5C8CB 1EAH2 5ABJB 2PLV1 4AEDC 2WS92 1R1A2 4GH4B 1OOPC 1HRV1 2RS52 1B35C 1FMD1 4QPIC 5BNPC 2HWB1 1VB4A 2ZZQA 5D8AC 1ZBE3 1NCRA 4CEWA 4GB32 3VBSB 2R071 1RUG3 2HWE1 4RS5A 2R061 1VRH3 1NOVA 1RHI1 4GMP3 3VBUC 3ZXAC 5J96B 5JZGC 1FOD2 2R043 1VAKA 1RUC1 1FPN2 1VBC2 1OHFA 1EAH3 1NY72 2RR11 1GFF2 1K5MA 1HRI3 3CJIB 1ND2C 4CDUB 1PGL1 4SBVA 5CFDB 2XPJA 1VBD3 1H8TA 2FZ2A 2X5IA 1QJX3 1C8M1 1ZBA1 1W39A 1OOPB 5A33A 1HRV2 2IZWA 1HXS1 1NCRC 1B35B 1SMVA 4CEWC 1RUD2 4IV1A 1QJU1 4QPIB 3VDDA 5BNPB 4RS5C 2HWB2 1X36A 3HAGA 1PIV1 5A32A 1FPN3 5D8AB 1VBC3 5L7OB 1COV1 1AL21 1VBB2 2FZ1A 2BBVA 1ND3A 1HRI1 1POV3 2WLPA 1K5MC 1RHI2 4N53A 3ZFGA 1R093 3VBUB 5JZGB 3VBHA 2RR12 2PLV3 4Q4X1 1VBA3 1PGL2 1ND2B 1AYM1 1TMF1 4CDXB 2X5IC 1HRV3 1RUE1 1ASJ1 1FMD3 2HWC1 1PO13 2HWB3 4IV1C 4Q4V1 1QQP1 1C8M2 3VDDC 4CDWC 1ZBE2 2R073 5ACA1 2HWE3 1HXS2 1NCQA 2R063 1QJY1 1IHMA 1AUYA 1ND3C 1VRH2 4RS5B 1PIV2 1NA1A 1RUC3 4N43A 1HQNA 4Y4YA 4Q4W1 4N53C 1BMV1 3ZFEB 2RR13 1AL22 1D4M1 4WM8B 5AC91 3FBMA 3JB4C 1HRI2 1VBA1 4Y5Z0 3VBHC 1K5MB 3LOBA 4RHV1
chains in the Genus database with same CATH superfamily
1LU1A 2RS31 5FZDA 4BHPA 1CWPA 5LBFA 1BEV1 1B09A 3MW4A 2HH9A 2FDJA 4U2AA 1C8M3 3ZXKA 2OYZA 1RL3A 1UIKA 4M4PA 3E97A 4XBLA 3T2PA 4YG3A 2HWC2 4QU1A 3U10A 3IWZA 2DU0A 1QJU3 4AZZA 2HWD1 4RL7A 2GC3A 2B7YA 2EAKA 1DP0A 1MVEA 2OQ7A 5A33B 3FJSA 3GM8A 3JB8A 4Y1UA 1W6PB 3CIHA 1QQP2 4IUGA 4LO4B 5FK8A 5JSPA 1V70A 3LEKA 4JGYA 2VZQA 3OEBA 3ZDSA 4NAOA 3PUSA 2CYFA 2BYVE 1NA1C 3CEWA 4QKNA 4UF0A 3E6CC 1PMIA 1W2TA 4RGKA 3RSJA 3KT1A 5GKAC 4XABA 1I9RA 1R092 1O3RA 3TNPB 1W0NA 1L7RA 2Y6HA 4MG2A 3F2ZA 5KWRA 1SZBA 1GWKA 2WYFA 4KQ7A 5GLTA 5C4WA 4YZ5A 4LLOA 3EBRA 3ZN5A 3O0WA 5HPOA 1W04A 1VBA2 4QD2A 4YW6A 3PDQA 4QB2A 1H9WA 2VL4A 2HWC3 2P17A 3ALQA 1WCKA 3M1HA 3M8LA 2EAAA 5AC92 1F8VA 1A3KA 3GJAA 4MH0E 5K4LA 1HJGA 2J1RA 2RS32 3OGRA 3RRDA 4BCUA 3RYRA 1BEV2 1RUF1 2VULA 4FSJA 2WAAA 5KHJA 1QQP3 2FDKA 3ZPOA 2IVIB 5GZFA 3IPVA 4FBFA 3NV3A 4XZUG 2DYCA 3AYDA 4L0PA 2JDKA 3IMNA 2R072 1UMIA 3DYPA 3HT2A 2KA3A 4JGYC 5FYCA 4DEVA 3LDBA 2HWD2 4OUEA 3FLPA 1ULGA 2R062 5T3NA 1GZ9A 1OH4A 3CO2A 3WF1A 1JBCA 3FLRA 1XE0A 1GP6A 1PGW1 2W3JA 2I74A 1OXCA 3R4DB 5AC93 3WUCA 4AG4A 1PZ8A 4CZSA 2GP3A 3NNGA 5A3LA 4UXAA 1NA1B 3GDBA 3PVBB 4XAAA 1YQ2A 1O8SA 5C4WC 3UV9A 2YGLA 4AOCA 2XBO1 2OA2A 3GBWA 4LMFA 4CTEA 3NNFA 2V5DA 2WYSA 4ES8A 4RHV3 3Q9OA 4EZ4A 2VZVA 2RS33 4BQXA 3ACIA 1C8NA 1WLWA 1R1A1 3AP6A 3WQ1A 3POSA 4QPYA 3VKMA 1BEV3 4D69A 5HXMA 1BQPA 2E6VA 4IEVA 5JPNB 2RS51 1K3IA 3KV9A 2PHDA 4PDWA 3P5BA 4HXCA 1G9CA 1Q8QA 3KD4A 4UW6A 1ZBA2 4N7UA 2P5BA 3BIEA 4MVTA 3FBYA 4AE2A 3ACGA 3I49A 2HWD3 4BK4A 1AJOA 3SCFA 4EYUA 3MHZA 1HV1A 5IFTA 3AP9A 3POYA 3BCWA 2CTVA 3PUQA 4CCMA 3A21A 2QQUA 1OBNA 3P1IA 1RMU1 4OMDA 3ILRA 1EYBA 4FPYA 2XLGA 4Q0SA 1TNFA 4FI9A 3S6PA 2AZ5A 4A3ZA 3SISA 1G9DA 2IXKA 2BGCA 4NHMA 5A7QA 3KGZA 4XF3A 1N3QA 1WMEA 3H8XA 2C9AA 5DAVA 4CCCA 1FOD1 3V64A 2WLQA 2IXJA 1XBFA 1MZ5A 2GC1A 4JGYB 3B93A 2VQ0A 2XQRA 4HZFA 2W52A 5HCFA 3ZSKA 1QEXA 2J1SA 1H1AA 4N9HA 3TRSB 2Q8CA 4MHRA 2LROA 1LU2A 2PHTA 5IHRA 4UF0B 3ON7A 4CU9A 3O14A 2RV9A 3GBFA 3A0NA 1HV0A 2GH8A 4RQPA 1DQ5A 4LKEA 4L97A 2FCVA 2VU9A 5DAWA 1XB9A 3LPFA 2BW8A 4NWWA 4GMP0 2NQYA 5FZBA 2HBUA 2VZOA 3C7GA 2XBO2 2YPJA 5EYXA 3WG1A 5C4WB 1DYOA 5JSRA 5JXJA 3TN91 4PDWC 1SLBA 3EQEA 1SBEA 5IVVA 4IE0A 4HLTA 1F2NA 3MBWA 1K42A 4QXBA 1RUF3 3RZGA 5EPAA 2A5ZA 2CGOA 4IEZA 4UFIA 2BNOA 2CGNA 4JCKA 2QDNA 4CXWA 2ZHLA 1RUD1 1Z0HA 4RR3A 1ULDA 5DZFA 5LRRA 3URFA 2QE3A 4XDOA 1J1TA 1G9FA 4LTAA 1FV2A 2VJXA 1XU1A 1OD5A 4W65A 4K20A 5LK5A 4JTOA 1W3XA 4DQAA 3BYWA 2VCAA 3HMYA 2E7AA 1LB2A 1VBB1 1RMU2 2UWAA 2C1FA 3THDA 4RFRB 4CP0A 4EJRA 5DDJ1 1TEIA 3OPTA 5FYIA 1JUIA 1N1YA 2VZRA 2HYXA 3NMBA 2DFCA 4WM8A 5FMOL 4QPGA 5FPAA 1IQAA 3BU7A 2VM9A 3MFCA 1Y4WA 4FQ4A 3POWA 4OI2A 5J09A 3ATGA 2XBO3 1OA3A 3O0VA 2WFPA 3OD0A 4Q27A 4RQPC 2VZ1A 3CDZB 3A0KA 1GLHA 1HQWA 2DCKA 1WWYA 4IERA 3IBMA 1R1A3 1W9FA 2PHXA 1C3HA 5LB6A 3AP7A 1MS4A 5EP9A 4IV3A 1XXNA 3C3VA 3V0BA 2RS53 5HBAA 2Q1MA 3WNXA 4NIHA 1Q8OA 5LW9A 1LCLA 3WW2A 2GZWA 3KLSA 4ITCA 2A6YA 3TN92 2KD7A 2ZAHA 3OY8B 2JB4A 2XWJB 4PDWB 4RR3C 4NE9A 5F6KA 3VBSA 2XR4A 4AVAA 2D43A 1F4HA 4NHLA 2BUKA 1S0FA 4XETA 3D8CA 1ZBE1 3M3EA 3KMHA 4XMIA 1XRUA 5LATA 1ENXA 1RMU3 1UZYA 2VVEA 1RUG1 1DZQA 3C7EA 4XZPA 4XXAA 4AQTA 3O12A 2J22A 3C7FA 2HEWF 2TBVA 1VRH1 2AACA 1DYPA 1FOD3 1QXRA 2GDFA 1C1LA 4Y3OA 4WM8C 4XFHA 3OG2A 4QPGC 1N1SA 4Y5TA 5DAQA 1EAH1 5AVPA 2V09A 1JZ7A 4BU2A 1UKGA 5HV4A 4K9SA 4C1WA 1IOAA 3MF6A 2LS6A 1AYN2 1XYPA 4XJAA 5DDJ2 3WQ7A 3POGA 4W6XA 3BN6A 1CAXA 4Q8KA 2WQ4A 4O65A 4XF0A 2EVXA 4IV3C 1VJ2A 1QXJA 1W0PA 4WVVA 2Z4FA 3KM5A 4RQPB 3TN93 4AEDA 2ZX4A 2X29A 4YW3A 3ES1A 5GALA 3INAA 5FK7A 4KU7A 1OI6A 3UESA 3O1MA 3MIHA 4ZZ8A 4FPKA 4LLFA 3ILNA 4LHKA 3SEPA 2VOKA 2F6BA 3PUAA 3JQWA 3FC0A 3T0AA 3VBSC 4AFMA 2WZEA 3DF0A 1RUD3 4I0BA 1UX6A 5FY9A 4KU8A 2BP6A 1NQJA 2QQPA 1WW5A 5A7NA 2C24A 3PLQA 4BB3A 5C8WA 3ASIA 1AXKA 4WV8A 1S55A 4RR3B 5FREA 3U11A 3GZUC 4I02A 4B8EA 1UMHA 4BPZA 2Y8KA 1YFXA 3A7QA 1VBB3 3HQUA 4CDUC 5DG1A 2Y26A 3WP6A 2R7EB 4OI1A 2ZEZA 3I2HA 1ONAA 1RUG2 5DDJ3 3ST7A 3LF7A 3N9PA 2RE9A 4HKLA 1GR3A 3RZZA 3QCWA 3LEGA 3H3LA 1GP4A 4LORA 1O91A 3D0SA 3GHNA 4Y1XA 5FP4A 1ND2A 4AI9A 1VAVA 3HBZA 4Z1VA 4NPLA 4YVSA 2BV4A 4QPGB 5A6YA 3WF4A 1EAH2 5FIXA 2QQWA 1H0BA 4IEOA 3AFGA 2HKXA 1QWRA 4AEDC 4BLJA 2P6HA 5FZ3A 4GH4B 1LGBA 3SQOA 2QCSB 1JOJA 1HRV1 2WZPP 1SDDB 1UL9A 2PQSA 1LOBA 4X8NA 5FZCA 5IWFA 2FDIA 4OHWA 3V0BB 2O1QA 1YWKA 1K45A 2BBAA 1Q56A 2XVGA 5D8AC 1YJLA 1A8DA 4B29A 4XF4A 1ZBE3 4GXLA 5I91A 1ZRDA 4TLGA 4CEWA 1DZTA 2CGPA 1PNFA 4YZ3A 1OVSA 4AFDA 3K48A 1WBLA 3VBSB 1RUG3 3MW3A 2DCZA 3ZYPA 1YYNA 1ZNPA 3SEEA 3KVAA 3KS7A 4KH9A 3V0AA 2ERFA 4E2QA 1H2LA 1VRH3 4QX3A 1KDKA 2VQUA 2WNOA 3ZXAC 1VAMA 3J7NA 5IATA 2VUDA 1VAKA 3JUUA 3KF3A 1RUC1 5FJHA 4HONA 1QNYA 1EAH3 3W59A 4EWDA 5EJZB 5F5CA 2B5HA 1SPPB 1EP0A 1ND2C 4CDUB 3WDVA 1AXZA 5FZGA 2YY1A 3R4SA 4I09A 1YQ8A 1PGL1 1GNZA 1BK0A 5JOXA 1LGNA 1NYWA 4DB5A 2P3IA 3CLPA 1UY1A 2XPJA 1HB3A 1QF3A 4AQ6A 3U07A 3M3OA 3WVJA 4NJ4A 4BM8A 2FZ2A 4UBGA 1CAXB 1QOTA 3AJYA 2GC2A 2X5IA 3O5SA 2CY6A 3OGSA 5KHGA 2PHRA 4Q1RA 4QKBA 3WXPA 3PNAA 1W39A 2VMDA 1DGWX 2XOMA 1HRV2 5FY4A 1H2NA 1U5XA 1HXS1 3RZKA 2YC4A 1OQDA 2W1UA 3GZTB 4IV1A 4PI2A 2W1WA 5F3IA 3S5QA 4AHXA 5D2AA 1WCUA 2E31A 2BJSA 3VDDA 4R9DA 2ZHKA 4Q1PA 4M3CE 5FYTA 3T3YA 3U4XA 3PUIA 5D8AB 4ZU5A 3PIGA 3HWJA 4E4DX 5C5TA 3IMMA 4EZHA 3D6EA 3ZXLA 1GMMA 2D44A 1ND3A 1HRI1 1PZ7A 2DV9A 4AW7A 5FZOA 3O7OA 2XHKA 3AZZA 4N53A 3D3AA 3UGFA 3UGGA 2Q30A 1F4AA 3ZFGA 2O8OA 2WNUA 4H55A 2XH6A 1Y9QA 3R0RA 2SBAA 1W6QA 1ZM1A 4K1YA 4K8FA 1VE0A 4NAMA 5H9SA 3VBHA 5C71A 4IDZA 5J3UA 3N3HA 4Z82A 5CNAA 1PMHX 1ULFA 3CZJA 4BIOA 1PGL2 1ND2B 1AYM1 4MGZE 3T09A 2WAOA 1TMF1 1DGRN 4LE4A 4ATFA 4E4SA 3OF1A 2X5IC 1HRV3 1RUE1 4GWMA 4XW3A 5A3NA 1ASJ1 3CF6E 3I2GA 2CSGA 5IVCA 5KXCA 2W47A 1AJKA 1V6LA 3UT0A 3W58A 1MS8A 2PAEA 4BLIA 2A3XA 4LA3A 1FI2A 4IV1C 4BQ1A 4Q4V1 5IJRA 2VBDA 1A8MA 1G9AA 2JDHA 5I8TA 2XJVA 1HN1A 2D6OX 3WUDA 3VDDC 4XUPA 1ZRFA 1UNBA 3HJRA 5JOWA 1L3JA 1HXS2 2F4LA 1AF9A 1NCQA 5I0SA 5GLUA 1ACCA 4P14A 2UWBA 5GZCA 5A6QA 1QJY1 1J3QA 4GKXA 4LT5A 2EF6A 5FR3A 1IHMA 1AUYA 1ND3C 3SNMA 4DRVA 1UD1A 1RUC3 3B02A 4N43A 4Q4W1 3V0AB 4NIIA 4N53C 3WLUA 5FXXA 3ZFEB 1D4M1 1UYPA 2F4PA 3T1LA 1WBFA 4DZGA 5AFEA 3BTXA 2WNUC 5B4XA 3IM0A 4UFJA 2BDRA 2N7GA 2RG4A 1HRI2 1CZVA 1HB2A 3BPSA 3VBHC 2G1MA 3BOPA 1BVVA 4PIYA 2ADEA 2VUJA 5FMDA 4AHZA 5LZ6A 4KG0A 4R9AA 5DPNA 2QTWB 2X10A 4GZ9A 2VAUA 4ARYA 3VDBA 5B2GB 2WA3A 4QX0A 1N1VA 1ENSA 5SV8A 3LD8A 4OHZA 1PO11 3VBOA 3BUCA 1IKPA 3NVCA 3B94A 4EN8B 2VOVA 3V56A 1AYM2 2WT1A 4Y22A 5LBEA 1M06G 3RJRA 3OOXA 4TSVA 4A42A 1RUE2 3WX5A 5A3TA 2IXIA 1HXS3 3M3QA 1OUSA 3MLKA 2VBPA 4XXPA 2D3PA 5FZ8A 4GJYA 4AWDA 3NAPA 4D7SA 4QX5A 4ISRA 1OD3A 4LOSA 4OUMA 1NCQC 2UYBA 3IIAA 4AR2A 1V0AA 4JRLA 4Q4V2 4IV1B 5JUVA 2J42A 3B3QE 3HNMA 4Q4Y1 4LQRA 4RGAA 4LBQA 3SH4A 1ZZBA 1AVBA 2YROA 4LO8A 3VDDB 3FFQA 4HVQA 1JZ8A 1OF4A 1ULOA 3OEAA 4N43C 4V2WA 5FY0A 2Q8DA 3VDAA 1KS5A 1PMJX 4PF5A 5CKMA 1X8EA 2VMHA 4MSVA 4BK5A 1BXHA 1TME3 2QDRA 2DDUA 3LKJA 4XQ4A 4YM3A 1V6KA 5DABA 1ND3B 4CCLA 4Q4W2 2JG8A 2WZ8A 4ATEA 5I0DA 4XJ8A 2ES3A 5A3MA 1D4M2 4JDNA 4N53B 1JYTA 2XKOA 1W3VA 3LDRA 1GOHA 5C8CA 1HDKA 1D7PM 4RFT0 4XFFA 1DDLA 2WNUB 1O59A 2DCYA 1DZRA 1AYM3 2EXKA 2PLV2 2UYAA 4UBHA 1TMF3 3FUQA 1W6QB 4DINB 2O0OA 2YGMA 4W4ZA 3VBHB 1RUE3 4RSUA 3VBOC 1W8HA 1ASJ3 1DU3D 4XHBA 3ZOIA 3MICA 5K8SA 3U0ZA 3RNSA 4YGDA 4AEMA 3R4UA 1FMD2 3CL1A 4R52A 3ZVXA 1AR81 4OHYA 5IFPA 2XUMA 4ONUA 2FDHA 1EV11 2BNMA 4DY3A 1PO12 4Q4V3 1LAJA 1OF3A 2VGDA 1R1ZA 3NAPC 1ULPA 4AVCA 2VW1A 2Y34A 1GZTA 4A6SA 2OZ6A 5DUUA 2VXRA 4CYDA 2PXJA 3EXUA 4JQRA 4XC9A 2HWE2 4HL0A 3UETA 3AKRA 1CR7A 1QJY3 5H9PA 4OUSA 4XQDA 4BZ4A 1DQ0A 5T5JA 3OYWA 1ENQA 1GWLA 1NCQB 1JI6A 1GZCA 4CU8A 4Q4W3 4NMIA 4LE3A 2QZ3A 5GZGA 4Q4Y2 3POBA 1D4M3 2PA7A 4CP9A 4HKOA 4TXWA 3VL9A 1UX7A 2ID4A 2XXZA 4FPOB 1ZZCA 3BTAA 1BBT1 2JG8C 2ENRA 4N43B 4NIAA 4B4QA 5JSOA 1OA4A 4QAWA 5C8CC 3NL1A 1QMJA 3KCCA 4CCKA 3B01A 4AI2A 5FO8B 5HI0A 1YIPA 1X9TA 2Y0IA 3DPRA 3VV1A 3JD71 3FE5A 1I3HA 2ZGPA 4LK6A 4P5HA 5CFDA 3TBDA 2WS91 3WDYA 5F3CA 1OLRA 1RJ7A 5BV6A 1H1IA 2V4AA 1XC6A 1EY2A 3WP5A 2VW2A 4E8DA 1KQRA 4NRPA 5DZEA 5FPZA 3IDAA 4CDQA 1NZCA 2LTNA 5FLHA 2DVFA 4GWJA 3A23A 3VBOB 1OOPA 1AX0A 3B7MA 1ODNA 5FV3A 1MQTA 3KVBA 2VZSA 3OBAA 3WG2A 2AH2A 4Y22B 4CE8A 1NCRB 5LA0A 1QJU2 1KRIA 1AR82 4FFHA 4IEPA 3KHBA 5BY5A 4FCAA 5E89A 1EV12 5A1FA 3AKTA 2R6QA 1C5HA 5K0UA 2V72A 4KBZA 2V4VA 4XTMA 2XVKA 5IK4A 1CD3G 4Q4Y3 3VD3A 1DLCA 1SLTA 2OQ6A 1CAWA 1H30A 3NAPB 3WDTA 4I30A 4ARXA 5CEHA 1MEC1 2WQZC 4JV4A 4YNIA 2VNVA 4E8CA 1YFUA 2RDSA 2XMLA 3A22A 4P08A 4L2NA 5FMCA 5FXZA 2H0VA 4LBQB 5A6ZA 1VMHA 2H6BA 1D0HA 2ZTNA 4KBBA 3I4IA 3E5UA 1MR5A 2ZGOA 4FPLA 5LBBA 4I2OA 3PUHA 3VBUA 5IT6A 3AXDA 3IT8A 3UKVA 1WA6X 3DPRC 1W6OA 4J25A 3I2OA 3VKLA 1BBT2 2G4IA 2ZMKA 1I6XA 2R1BA 4MO3M 4BDVB 1STMA 4XF1A 4PQ9A 1YQCA 4CDXA 3CHXA 2GNTA 1PHMA 2RS11 4UFMA 1PM7A 3JD72 2GN7A 2ZAAA 4Y20B 4CDQC 1H9PA 2BVVA 1AR83 4YGBA 5JR2A 5FDBA 1EV13 1MQTC 2C9KA 4OULA 3BTZA 4OVEA 2W94A 1PK6C 1VB2A 5C9AA 3LIGA 4WM7A 1UXXX 3NO8A 4IESA 5K0UC 4SLIA 1BCXA 1TNRA 2MNGA 4HVRA 4NROA 1P8JA 3C8XA 3WR0A 4WZCA 4JKLA 2EICA 1F5FA 2WO7A 4QX2A 3ZKUA 1GKBA 2WINB 2RM21 3AYAA 4Y4RA 2WFF1 3N9MA 2VOTA 4URAA 3HNYM 2WL1A 2BFUL 4PF1A 3DYMA 3WDWA 2ZGQA 2VECA 4QMAA 1MEC2 1ZZ7A 3H1MA 4FOYA 4FP2A 2EA7A 1BBT3 4R9CA 5GZDA 4F83A 1S4CA 4N90A 3USUA 3OUHA 1DQ6A 4QQ2A 1D2QA 3C2UA 4PLMA 1BYHA 1OLME 5IVYA 2CHHA 3S30A 3WF3A 5JI9A 1XSRA 4S2GA 2QBXA 3JD73 2Y6FA 1SFYA 3AKPA 5FZ9A 2WS93 3DEMA 4RHV2 5A3UA 5FMOS 5C33A 4CDXC 1POV0 4FP3A 3NNMA 2BVBA 5CU1A 2C4XA 3T0DA 1ODMA 3DPRB 4NRQA 3ACFA 4ASKA 1XYNA 2VH9A 1VALA 3BGAA 4YGEA 5C9AC 2PHLA 4URTA 1GOGA 2QQOA 4WM7C 3VD9A 2WIIB 3PVNA 3WDXA 2RJ2A 2RS12 4YM1A 3UL2A 2NZ9A 4CCOA 4CDQB 3TAYA 2H6CA 2GNBA 3AC0A 5IVFA 3O1RA 3ZSMA 1U0AA 1MQTB 2LRPA 5HV0A 2VNRA 4YZ2A 1PK6B 2FMDA 2VNOA 5LASA 4XIKA 4AF9A 1WA4A 4JZRA 5DQ0A 5LRSA 1V6MA 3AMPA 3LQCA 3QLQA 4GIQA 1MEC3 5A7SA 4YSFA 1O4YA 4LUMA 2ZMNA 4NHKA 3RJ2X 4ASLA 4OZXA 4CDWA 1SLAA 4LA2A 3RI8A 3RWNA 1UYYA 1D2SA 3KT4A 3RYPA 3UK9A 1JYVA 4GMP1 1NAEA 3VD4A 2Q0AA 2E63A 2XL9A 4YG6A 1OQEA 3AM2A 4N8MA 1JYWA 3E5XA 2CWMA 2RM22 3PL0A 3BU0A 2WFF2 5HCBA 3ZR6A 4EN0A 1NZIA 5F7UA 3ZDVA 4CPBD 1OT5A 3ZYBA 4M01A 3KCYA 1LOCA 2P37A 1XE8A 3L2YA 3BALA 3POJA 1HKDA 4ZHNA 3NNJA 1JZ4A 2PHFA 5IAXA 3SHRA 3AZWA 1CQ9A 4BQ5A 1W2OA 1GQPA 1VBD1 2HEVF 1JN2P 4Z92B 1W6OB 4LBNA 1JUHA 1Q3EA 2RS13 2MHFA 4GA9A 4HVOA 2YBPA 4XVHA 3OBRA 3VKOA 3W20A 2QQVA 4FAHA 2VQTA 1B35A 1YHFA 4O9EA 4FXKB 1W2AX 1QJX1 2VCCA 5FYZA 1WD3A 1RUF2 4QPIA 1O6UA 3LWCA 1OVPA 4K7JA 5D1IA 2V73A 5FXVA 1PVXA 4PJYA 1NUKA 1UIJA 5ABJA 1DYKA 2E7TA 4BQ3A 2WWJA 4DUXA 3O1SA 1ZZ8A 1BJQA 4QX8A 4COUA 5C9AB 3PMEA 3LSDA 3J26N 4WM7B 4CPBA 2WO3A 1DQ4A 1RIRA 4I01A 1G8WA 4PQQA 2VCBA 4FFIA 2RM23 3BODA 3U14A 1H6YA 1VBC1 2WFF3 4JQTA 4F8AA 4UOJA 5EIYB 1PGW2 1W9TA 4LHNA 3MGUA 1O5LA 3O1UA 1J1LA 1O8PA 5LA9A 5GZEA 4CUBA 2VMIA 2WQ8A 4NHYA 1UN1A 1GUIA 4HK8A 1QU0A 3JU9A 1QIQA 4S2DA 3WG4A 3H8OA 4NIGA 3IDEA 4A41A 1ALYA 2RDQA 4B4PA 2LM3A 3HVDA 3USUB 1SACA 3FN9A 3AP4A 5FQ0A 3B69A 1W8NA 1R1A2 1U12A 2JD4A 3EO6A 3H8UA 5JDBA 2G9GA 3NWKA 4HETA 1KEXA 3OUIA 4AGRA 2RS52 5HCAA 1B35C 5K7PA 2OW4A 3P3NA 4UW4A 3WHUA 5L9VA 4K8RB 1H8VA 2ZCWA 4FFGA 4QPIC 1UPSA 3WEZA 1JU3A 4DY5A 3GNEA 3QOPA 2IWGB 1CESA 1FNZA 2QQNA 2Y0OA 3H7YA 2ZA9A 5FBZA 1DIWA 3ES4A 3IPVB 5H9RA 2BOIA 4D7TA 3JCIA 4PI0A 1J3RA 3DCQA 1AX2A 3IKWA 2HLEA 3I3QA 4CEWC 2J1UA 1CAVA 1DLLA 2D98A 3AL5A 5FLIA 4UFLA 4P00B 1NXMA 3HN1A 4Z2WA 1NOVA 3ZSLA 3MV01 3W5NA 1UCXA 3PVOA 4GMP3 3U4SA 1G6NA 5FYYA 3AXEA 5J96B 1FOD2 3MIDA 4KGGA 3LDKA 2A6VA 1VBC2 4MYEA 4HOOA 3I3MA 2ARAA 2RR11 3AMQA 2O8QA 1EUTA 4C0BA 3ZYHA 4IEXA 4EN9B 3EJKA 5A7OA 1XNKA 3ECQA 3NQHA 4OHXA 4AFAA 1NLSA 1ZRIA 4SBVA 3HR9A 3H42B 2P34A 4JDOA 3IAPA 4OQ9A 5CA6A 1VBD3 1W2UA 2WDBA 1H8TA 3M2MA 3GXUA 3LIHA 3PURA 2VMFA 2JDZA 5E1RA 2XJSA 1LNSA 4XJZA 3PHMA 1REFA 1FATA 2P3KA 4LO5B 5I0TA 3WG3A 3APBA 2XVLA 1QJX3 4LBOA 4MGYE 3MIFA 3ACLA 1VMFA 2VPVA 1NXD1 3HEIA 5GLWA 4AL9A 4C90A 1B35B 2CDOA 2Z69A 1SMVA 4HT1T 1RUD2 5F2WA 5K9YA 4DXSA 2VUAA 1E5RA 4NHXA 5BNQA 4LXLA 5FY7A 4QPIB 5T54A 5AFBA 3MFAA 1GBGA 1UAIA 2RDNA 2GAUA 1W8FA 5SV5A 4CSWA 1X36A 5FYSA 5A32A 2K2SA 1VBC3 3BOWA 1COV1 4QT6A 4CUCA 1AL21 5FXWA 2WSVA 1UOGA 4QKDA 1VBB2 1RJ8A 2EXJA 2Z42A 5JMCA 2BBVA 4QWNA 1GWMA 2Q8EA 3RS6A 5T52A 1CPNA 3CBNA 3WW3A 2W5FA 3VHOA 3GCWA 1US3A 1IPSA 2G9ZA 5A80A 4LHSA 2NP0A 5IK7A 1ZX5A 2RR12 4CCDA 1XE7A 4Q4X1 4CA9A 5KXEA 1SLCA 3E1F1 5FPVA 4KWLA 4MADA 4CU6A 1G86A 4JHTA 5IAVA 5I8SA 3AFKA 1DHKB 2NLRA 4BJ0A 1W6NA 4FOQA 4GD4A 2DVAA 1SDWA 4Q29A 4QU2A 1W8WA 4EROA 2NN8A 2PAMA 2YBKA 1RTVA 3OBTA 1WW6A 2A3YA 3K46A 4CXXA 4ZU7A 1JS9A 1VP6A 4AK3A 3GGLA 3J4UH 4HMZA 2ADDA 2OUJA 2D3SA 2UWCA 4FPFA 4XAEA 3WOGA 1ZBE2 1F15A 1GQHA 4AEJA 4L8QA 1S0IA 4K1ZA 3MUZ1 4DO0A 4IEWA 1TVGA 5E8AA 4NN0A 4M0NA 1HIXA 3AYCA 3N7MA 5A3WA 3I3BA 5JCTA 1CAUA 4ET7A 5CADA 1VRH2 1GANA 4FOVA 1V6OA 1CAVB 1UWWA 4BISA 1BMV1 1POQA 1BLZA 3SKJE 2RR13 1AL22 2BZDA 4WM8B 5FYMA 1JZ6A 4CRQA 3KCXA 5FYVA 2K9ZA 1CONA 1GV9A 1HQLA 3DV8A 3FBMA 1LHOA 1MS0A 3JB4C 4QDSA 1C4RA 5GLZA 2ZX2A 3ZYFA 4JVAA 2AR6A 1I5PA 2QKDA 2ZX1A 4ZPIA 4BWOA 3H8RA 2ZBJA 1YQ6A 5A7WA 1ZRRA 4IV3B 5EFUA 5FY5A 1GOFA 1PNGA 1PO21 1H4HA 3Q8CA 4Q4X2 1ZA7A 2JDAA 3ITQA 1BK1A 4ES9A 2X09A 1RUI1 2R30A 4JHZA 4XCAA 4H7MA 3ZN4A 1LRHA 1QXPA 5L9RA 3RZJA 2YU2A 4H3WA 2XL7A 3AMHA 2WJSA 2VZUA 5APAA 1X9PA 1HB1A 3MZHA 3LA7A 4A6OA 3AZVA 4ZU4A 1HB4A 1F35A 2DCTA 5G04L 1COV3 1AL23 5FTTC 4WVZA 1JHNA 2ZABA 3JBG1 4O9GA 2W92A 3RZHA 5A32B 2TNFA 4YVSC 2XJTA 4ISQA 3DXUA 5J36A 2VUCA 2RDRA 4P9XA 1NLRA 3LB9A 4FPHA 4CUAA 4XJUA 2Y6LA 1AR71 1PVC1 3FX3A 1ZZ9A 4IEYA 5DZGA 5FZLA 1JZ5A 1RUNA 2MEV1 4QPWA 1YNAA 5GM0A 1BMV2 1X33A 5D21A 4DFSA 1SCRA 3K2OA 4Q4X3 4BIFA 1E5SA 2OT7A 4OYUA 5FO9B 1IKQA 4QQHA 2DTWA 3VZMA 3P3PA 1MS3A 1XNAA 2SLIA 4HFSA 4XJ9A 4KNCA 2XJUA 3AYEA 4AEDB 2W1QA 4WVMA 1QY4A 1YO8A 2VTXJ 3PMSA 3VB9A 5F9TA 3B5LB 4J1XA 5FZEA 1XOYA 4IGOA 5FY8A 1IS6A 2WRAA 5JAXA 1X50A 5KHHA 1GZWA 5CIRA 4Y26A 1PO22 3T4VA 1RC6A 1RYYA 1OLQA 5ERLA 3SXWA 1WUVA 1KITA 3WNNA 4PCRA 1W6NB 3M3CA 3TOJA 4DNYA 2CNAA 2YUEA 3DECA 1RUI2 5IVEA 3WZ1A 2E53A 3D4KA 4Q0QA 3MIBA 1GICA 2ZKNA 4LK7A 2VNGA 1Z7S1 4IW3A 1U5YA 2XB6C 4PBPA 1OH3A 4HBNA 1J3PA 3N4MA 4FO9A 2XDVA 2CV6A 4D7YA 4DOUA 1FNYA 2WC2A 4H14A 4DEQA 3VHPA 3PTRB 1TME1 3F95A 1IPJA 3JQXA 3LA2A 4IE7A 1BHGA 4MXVA 4R8HA 1UZVA 3LAGA 1AL0G 1YFYA 4AYUA 1RUC2 3M4FA 3VLBB 1CAUB 1R64A 1DGRA 3JBG2 1JODA 2P3JA 3K75B 4JRAA 3WQ0A 1KJRA 3FLTA 3HOBA 4UT5A 4D8MA 3NV1A 4YVSB 3J9SA 3WQBA 1RB8G 1CJPA 1JOBA 3TYJA 2QJVA 2ZXQA 4YPJA 1PVC2 5LEJA 3HIFA 3CNAA 2MEV2 4GQ7A 4IGQA 3TNQA 3ZO0B 4E4ZA 3S57A 1PO23 4QHZA 1LHNA 4OI0A 1T6BX 4FTSA 1SCSA 2VTXA 2XLAA 5FY1A 1Q8PA 1ZYBA 3PJYA 5A7WB 5FPUA 3H1WA 4B1LA 5JIUA 1W0OA 1RUI3 3I2IA 2QQKA 3I2JA 3VZOA 3ZYJB 1WW7A 3FMGA 3WV6A 1AR63 1IS3A 4WZFA 3L9JT 1AR91 4FPJA 4CEWB 2J1TA 3ORJA 3O1PA 3DL3A 3U75A 5FO7B 5J98B 1JXNA 1UU4A 3VZLA 1O4TA 4E2SA 5T5PA 2WA4A 2G9FA 1UXZA 2G19A 2WN3A 3ZFGC 5L7OA 3JBG3 3WHTA 5BUVA 5FZIA 1Z7S2 2B39A 1EUUA 4EN7B 3ZMNA 4XFIA 2JDUA 2DU1A 1JYIA 2RJKA 2EIEA 1OPOA 3NV2A 5FUIA 1TME2 2OZJA 2YU1A 1AR73 1PVC3 2NYYA 5F3EA 4B1MA 2MEV3 1SHWB 5BNOA 4OMCA 4YW7A 3Q8AA 5FPBA 2PMWB 2DVBA 4LJHA 4NRMA 3NJXA 3S7EA 2YDEA 4YVWA 4D0QA 1UYXA 5A1AA 3KZ4C 3ZXFA 3VKFC 1IQDC 3HBKA 1PX3A 5IW0A 3S7IA 1TMF2 2QQIA 1MS5A 1QDOA 5JIAA 5FYUA 4E9KA 4YM2A 2X5IB 1ASJ2 1LR5A 2WABA 4MGIE 5AVAA 3KV6A 2EXHA 4WVMB 5DMYA 2WKKA 1QH7A 3VHNA 1IPKA 4LIVA 3T2TA 2WO2A 2O14A 2TUNA 1LHWA 4MX3A 1LEDA 1RVF1 1UQXA 4YZ4A 3I2KA 2UURA 3K51A 4KL1A 2DUPA 1LOFA 1Z7S3 4UFHA 3QH6A 4EE2A 1VLNA 3HD8B 4QKFA 3GF6A 5LY2A 2ZKLA 1R081 1AR92 3D0JA 3LCPA 5L7OC 4MGTA 4R4XA 1QJY2 4HANA 4HPKA 1W9SA 4B7KA 4XJWA 4M00A 1REDA 3KV5A 1IG0A 5FZOB 3VBFA 4OZOA 4BE3A 3H9AA 3ACHA 2CWSA 3HT1A 5EJ1B 5I0RA 1BKZA 2KM2A 3C7HA 4U36A 3ZFGB 2ATFA 2ZHNA 5BNOC 5JLVA 5M0TA 3DKQA 2XG3A 2VCMA 4Q2FA 4M4RA 4EV0A 2BFUS 2PQQA 2VW0A 3I3EA 4YVWC 3SCHA 1OFNA 4QGMA 2ARBA 2ZS6B 2BERA 4QB1A 3VDCA 5C70A 3RVHA 3W5MA 4XILA 3WNPA 1E57A 1WKYA 4QQOA 2E51A 2YFZA 1F5JA 3X29B 1REEA 1W6MA 3NKGA 3LOIA 1J83A 5I8YA 5CKQA 4XQWA 2B42B 3IAQA 3NKTA 4Q26A 2Q8OA 4QM9A 3WNOA 4C91A 2ZGRA 2XJPA 2JDNA 5IUQA 2CDPA 2TEPA 2R49A 2J1EA 1AR93 4NWVA 3BPZA 4E2GA 2JE9A 1PM4A 1LOEA 3C7OA 1LOFC 2W39A 4UAPA 5LEKA 4YW1A 2D3RA 5IYYA 1S0DA 1D0GA 1KDMA 4GB33 4LEJA 3ME2A 1UMZA 5EQUA 5KXDA 2WR9A 2JDMA 3ETQA 3N35A 1W6PA 4I3PA 1RVF2 4YW2A 1E5HA 2JIJA 3MLJA 3D82A 2VC9A 5JR7B 3ZYGA 5FZMA 5FP7A 1MVQA 2A7AA 4AVVA 4CXYA 2VTFA 4Y5SA 3ILFA 3VBFC 1R082 3CJIA 2FDFA 1YXWA 2K46A 2JICA 3QD6A 5EV7A 2R041 2JX9A 3GHMA 4AVBA 1K12A 1WCQA 2WNEA 1AX1A 4NVPA 3JXSA 3I97A 4XURA 5IVBA 1RITA 1V6IA 5FKCA 1NKGA 1WZXA 4BQ2A 2NPIA 4NO4A 4BMEA 4XTPA 5BNOB 4FTBA 4AXOA 3RZLA 2JDYA 4YW5A 1RXFA 3USSA 2XQXA 5FPXA 4YVWB 2J1VA 3KQ4B 4GWNA 4X8PA 1JU4A 1Y3TA 4XDQA 4COZA 1MACA 4BQWA 4PBOA 1WCSA 5F32A 2JB8A 1FX5A 4HKWA 1ULEA 2WSUA 2ZGKA 4OLLA 3BVCA 4N7IA 2R32A 2ETEA 2AYHA 2XLFA 2BGOA 5BNPA 3AL6A 1RVF3 1WLTA 2HEYF 2A73B 4CP2A 3WNLA 5HCHA 4QHOA 3ETPA 1N3PA 4XFBA 1ZZ6A 1UF2C 4MZUA 3KWVA 4K3UA 4Q0VA 2W2IA 3Q8EA 1R083 4W50A 5EYYA 5LCWL 2JG9A 5DN2A 2ORZA 2UY9A 4YWAA 1C5IA 1XJAA 2OIIA 3ABZA 4JX0A 5IK5A 1FPN1 5H9QA 1YEWA 3T1MA 4AFCA 1JOPA 2OX0A 3CJIC 2Z5WA 1NLQA 1DQ2A 2VZPA 4XBQA 4EWEA 5JZGA 1RHI3 1POV1 2Z2SB 4XUOA 3L2HA 4UYBA 1QDCA 5CG9A 3QBQA 2X8KA 1A6CA 1QKQA 3ENRA 1DFQA 1QOSA 2D6NA 1R091 5CFDC 4TZDA 3PTYA 3FL7A 3VBFB 2HYKA 2JG8B 4D6RA 2R042 1W8UA 3VUOA 3GYDA 3WF2A 5C8CB 2A1XA 1N3OA 4YLZA 4DMIA 5LWBA 2WS92 5FYHA 4D3WA 1OOPC 1AXYA 1HLCA 1KGYA 1VRBA 3T4HB 3V65A 3WNKA 2DVDA 3QACA 5KC6A 2E32A 4MGQA 4LBMA 1H1MA 4G3YC 5BNPC 1W6MB 2UU8A 5FP8A 2Y60A 2PELA 2ZGNA 1V00A 3U1XA 2ZZQA 1VB4A 1G7YA 4C0HA 2YC2A 4PIZA 2VY0A 4R9BA 3ZSJA 1WLCA 2JG9C 2R071 1MZ6A 2VMEA 4RS5A 3T08A 2GC0A 2R061 3MIEA 3OYWB 1S2BA 2RHPA 1O4ZA 4UWDA 1WW4A 2Y33A 4AQSA 2IUWA 3ZR5A 3THTA 5KBFA 3VBUC 2JECA 5JZGC 2R043 3S5AA 4CP9B 2YC0A 1FPN2 2A3WA 3DGTA 4GKYA 3NJYA 4Q5OA 5E16A 3RMYA 1T2XA 1S0CA 3WW4A 4AHWA 1K5MA 1KFUL 4AI0A 2C6SA 4CUGA 2IFRA 3CJIB 3SLIA 4AI8A 1ULCA 4D94A 4S2FA 5KC5A 4G4FA 1GNHA 1LESA 3IDCB 1YI9A 2VQAA 2WO1A 3M3IA 2ZGSA 1UO9A 1WD4A 2ZGTA 2ZPXA 4IL7A 4J6GA 4W8JA 4H7LA 1MS9A 1ZRCA 2FD8A 2GU9A 5CFDB 4XEZA 4NIDA 3H3ZA 1UZWA 3N36A 5F5AA 5FZ6A 4DXRA 4WBBA 2VVFA 1JZ3A 3CMGA 4AGVA 2W68A 3AZYA 2W95A 4XOGA 3U37A 4M3CF 2PN5A 2ILMA 2XJRA 2DVGA 4CCEA 3ZSEA 3R6SA 5B4NA 1ZBA1 2YB7A 3THPA 3R05A 2AREA 1OOPB 2QUOA 2XGXA 3H0OA 5FKBA 1DF0A 4F3JA 1RUOA 2FHRA 5A7PA 3AKQA 3AVSA 1DGLA 1XNTA 3MIGA 4LKDA 4MGSA 1XYOA 3UKTA 4K6BA 4X6QB 2L9LA 3GJBA 5BNPB 2AC1A 4RS5C 3HAGA 1PIV1 4XUTA 4TN7A 1FPN3 3DXTA 4DXTA 1CAWB 4GWIA 5KXBA 2GMPA 2BEOA 3LE0A 2ZEWA 4P9IA 1X8MA 3CJXA 3T2OA 2B9UA 2JG9B 3UKNA 4M3CA 2NMOA 3SH5A 3MLLA 4W6YA 1POV3 5GJ6A 2DUOA 5JPMB 1K5MC 2QQJA 2E9QA 1PZ9A 1Z78A 2VG9A 1TG7A 4FQZA 3SCGA 4Y1ZA 1R093 4FOWA 4LO6B 5C3QA 3T30A 3K77A 3VBUB 5JZGB 3M7AA 4LR4A 2YFUA 3H50A 3AX4A 4PLNA 3FFZA 4KMQA 1N47A 1VBA3 2DCJA 1LHVA 5FPLA 4DRRA 5CISA 1APNA 3HQRA 4E4HA 4CDXB 2Y64A 4QM8A 2HBTA 3N7KA 1JMUB 5CBLA 1OKQA 1SG3A 4XPVA 3OD4A 3MEPA 1WLDA 4F7ZA 2D97A 3BIWE 3WDUA 1JYXA 3O0XA 3ZXGA 4JTNA 5L9BA 1OFSA 3E6BA 2D6KA 3ZYRA 3OY8A 5FLJA 2X05A 3VKNA 4S2HA 4ZONA 1MZEA 4CDWC 1TZOA 1UOJA 2CAVA 2GNMA 3GCXA 1Q8SA 2R073 3UNPA 5ACA1 1ZA4A 4LPLA 1OA2A 4XUQA 5BPXA 2KR2A 3AP5A 4EWAA 2R063 1PX4A 3RG0A 1A34A 3HNBM 1Y7BA 2Y6JA 5C5UA 1UZZA 1YJKA 2WWUA 2AUYA 3IN9A 3MPPG 5KHKA 4RS5B 3I3DA 1PIV2 2WUHA 1CZSA 2C0ZA 4ZXKA 2XUEA 2QQLA 4UI9L 5T5LA 3NV4A 2B4KA 5L73A 2A70A 4P5YA 3VN4A 4FPCA 3SH3A 2A71A 4LBLA 5CYYA 3UYJA 2A6ZA 1IGOA 4I0AA 1K5MB 1OQ1A 1Q8VA 5EHDA 4QQLA 5DG2A 3A4UA 2WZR1 5LK7B 1FYUA 1VBD2 1ST8A 4FXGB 1RGSA 4C1XA 2VZ3A 3OTFA 1M4WA 3T2QA 1ZBA3 4OI4A 4QQPA 1ENRA 2BWCA 1QJX2 3KV4A 5DUXA 5F39A 2LUWA 1KS4A 3WP4A 2MPFA 1YI7A 2DURA 4AI3A 1GP5A 3WCRA 2HWF1 4DUVA 1N1TA 3G6JB 4ZS3A 4IE5A 1UU6A 1RXGA 4QDQA 5T5OA 1W99A 1CIWA 1XQNA 3CZUA 1SBDA 4L92A 5DXDA 3ZX7A 4YARA 4DIQA 1PIV3 4Y1VA 1WCDJ 4CVUA 2WWSA 5FJKA 3VGIA 5CFCA 4YM0A 4OFGA 4CDWB 1X82A 1CJDA 2BRTA 4Z8BA 2BU9A 2E7QA 3MF9A 5ACA2 5I93A 2VE1A 1W05A 4FPEA 4NR1A 5F5QA 1V9U1 2OS2A 2VVDA 2J1AA 3LSEA 2QFEA 4L11A 4UW5A 1JTZX 2QNKA 1O5UA 2PAKA 1S2KA 1FAYA 4M3CB 1F9KA 5LBCA 2BOJA 3N7JA 4MHUA 4P9JA 5FZ4A 1AYN1 1LGCA 5FZ0A 4AFBA 2P6CA 1W9WA 1LENA 2LALA 3SITA 1QHDA 4Z07A 2CU5A 3NW4A 5A3OA 3T0BA 4LUKA 2BGPA 3ZIXA 4AHYA 4ORFA 5A3PA 3H3UA 1UOFA 2IC1A 2YXSA 1C1FA 4GH4A 1VBE1 5T50A 3LFMA 5FZ7A 3HN3A 5EZWA 2WZR2 3RQ0A 2P2KA 5LA1A 4LOTA 1PGSA 4RA0A 1J59A 4PT6A 4LNVA 3W21A 3FUOA 2Z79A 1FT9A 2B46X 2ZMLA 1RUH1 4LHLA 2ZOEB 2VXJA 1LKNA 5JVVA 3O1TA 4XUNA 1FXZA 3G7DA 4IEQA 2YZ4A 3OBZA 5ACA3 3GBGA 1AZDA 1GQGA 2A6WA 4QX1A 4GAZA 5A1LA 3H1YA 5CFCC 1QGLA 2HWF2 4P9LA 4BA6A 4META 3TEXA 4RYDA 1W06A 2IVJA 4TYSA 4ASMB 3ZFFA 4NPRA 5FWEA 2FBEA 4A4AA 1O3SA 2ZGUA 4AGGA 1VR3A 4BMBA 3NJZA 1G9BA 5ANQA 1NG0A 1SFNA 5E88A 2VO5A 3ZN6A 4DPNA 1I1EA 2VMGA 4BOWA 2VZTA 4QDRA 3HPNA 4M0HA 1KJLA 4B3NA 4JKMA 1H8TC 1SPPA 5I0UA 4CDUA 3KQRA 1V9U2 3N9OA 4IE4A 3ZXEA 1W2NA 2OUHA 2WNVA 5CZKA 2AEZA 4L99A 3Q8BA 4XE9A 3VBRA 3DYOA 1V6NA 2WZR3 2GMEA 3EHKA 4NPMA 1OPMA 5FQ0B 3FWEA 4GH4C 2JKXA 2IXLA 3POEA 2GNDA 3D5OA 4Q0PA 4LKFA 3RZMA 3GZEA 5C3OA 4INDA 3I2FA 4QXCA 3Q8FA 2JWPA 3LEMA 1VBE2 2ZACA 1WMDA 1H2MA 1HX6A 3J7HA 2HWF3 4MUVA 1YFWA 3J8F1 5E6HA 2FDGA 3WD5A 4JKKA 2XHNA 4JAAA 1SFPA 1US2A 4YG0A 1O3QA 2Y6GA 3VHRA 2FCTA 1RUH2 1S1AA 2OVUA 2BTVC 2BNNA 5CB7A 4Q0UA 1EPZA 2OPWA 4X6RB 4FTEA 4GJZA 4QXKA 1QOOA 3K4ZA 5D8AA 1IZ3A 3TEZA 2AGSA 3WT3A 5C3SA 1COV2 5FZAA 3ZFFC 1WMFA 1UU5A 3K3OA 2YMZA 2YBSA 1V9U3 3WSOA 2GP5A 1LULA 5CFCB 1CVNA 1NQDA 3OGVA 1YCIA 2PHWA 3IB3A 1FV3A 1Y9MA 1RUJ1 4RN5A 1BZWA 3NRUA 4XIOA 4XCBA 1AYN3 2R1DA 3OGGA 2WNVC 2YHJA 1MZFA 1XNCA 4XFCA 1S0GA 4QX7A 3N9NA 4YW4A 3RDIA 3VBRC 4AVTA 5A70A 3NSTA 4AAPA 1MPXA 1EPWA 4DS0A 1MS1A 4BH9A 1H8TB 3BKZA 4MV2A 1VBE3 2IXCA 5EJ3A 5TSWA 4COYA 2B8MA 3U78A 2XJQA 2RMU1 4Y33A 1AR61 4IETA 1UPIA 5GLVA 4A7YA 1JYNA 3CQOA 1NE6A 3W9AA 3DUIA 3MYXA 4HN1A 1RUH3 2GMMA 2GALA 4MXWA 5BNNA 1A78A 3J7MA 2DBIA 4HSJA 1F31A 1NT0A 4JGZA 4P02B 4AVSA 4LKSA 4A3XA 5A6XA 3FZ3A 3DKWA 4CEYA 4TWTA 1DQ1A 5JMOA 4KWKA 3J8F2 4AAXA 5L19A 2I45A 4JC1A 4XDPA 4EN6B 3K4AA 1QJZA 2FQPA 3J7LA 4Z2AA 2ET7A 2HJIA 3MI8A 5LA2A 3THCA 1HN0A 3BTYA 1CGPA 3LFIA 1UZ0A 4RD7A 2V5YA 1CIYA 2H0BA 4KWUA 5J1XA 4YRDA 3B9CA 3FHQA 3H7JA 1D4VB 1SBFA 2D5HA 3K4DA 4GULA 4P9GA 1O7FA 4IGPA 3RGBA 3ZFEA 5FWJA 1J84A 3ZFFB 2PTMA 3AMMA 2LW8A 1J58A 1XSQA 1L7QA 1S0BA 1YC61 3AB0A 3PU3A 4FVVA 3POFA 4O61A 2EXIA 2ZJCA 1LODA 4PIXA 1OURA 2F17A 3KHCA 3ZN6B 4COWA 4PLOA 3MDPA 4ZY9A 1Y43B 1RUJ2 5FOJB 2QZ2A 3WCSA 3ZLIA 2ZEYA 4OQ8A 4W6WA 4A7KA 1QH6A 5F3GA 2BPA2 3RMXA 2Q4SA 1OSGA 2WNVB 3ZKYA 4A7ZA 1CPMA 5EWSA 3VBRB 1ZREA 1OLMA 1X7NA 2ZX0A 2P3YA 2DFBA 3N9QA 1CN1A 2IXHA 4ZZ5A 1NE4A 3AZXA 3EB7A 3MV11 5BNNC 2DWRA 3ROUA 4K40A 3J8F3 3SMHA 4JGZC 4LULA 2RMU2 1U5IA 3E5QA 4QHBA 4CP1A 1AR62 1I5ZA 2UY8A 2EIGA 1W28A 2D5FA 5FFOC 4CEYC 2J7MA 2VBBA 2DBNA 4PHZA 1E5IA 4NOTA 3VD5A 2K0GA 4Y24A 3ZPYA 4CCNA 3I2DA 3LZZA 4LBJA 3LEIA 4HK9A 5JXGA 3IDBB 1C28A 5FCCA 5FUPA 3LGRA 4XBNA 1W8OA 1LOGA 2FCUA 4LBKA 2D93A 2ZGLA 3O1OA 2R16A 2YPDA 1YQ5A 1K5JA 5T55A 4FT8A 4MLOA 4KWJA 3POIA 3ZFEC 5F8PA 3I59A 1RUJ3 3RYKA 5ABJC 5DAXA 1Q43A 1S2EA 1JW6A 1AR72 4BXFA 2W9XA 4YFZA 1L7LA 4QGLA 5JI7A 3ZXJA 3B00A 3EYPA 5KR7A 2ARCA 4Q8LA 1SQ4A 4XHXA 1RINA 4ZKTB 3PIJA 1SEFA 2PHUA 1LJ7A 3OCPA 2BQPA 3I7DA 4GALA 2RMU3 2ORXA 1OC1A 2W91A 3WP3A 1UY3A 5FRAA 3MO4A 3MUY1 4G9SB 2EALA 1VIWB 3KT7A 4TTGA 3QH7A 1LECA 4YZ1A 1DG6A 4GB31 4WVWA 5K0UB 1VPHA 1LEMA 1YRZA 1TQ5A 2KXLA 4V1PA 1CX4A 2JXAA 2WT2A 4MXWB 4N9IA 3ZIWA 5BNNB 1JZ2A 5FP3A 1H4GA 3VL8A 5FZKA 5JXHA 4JGZB 4HSLA 4FFFA 2GSYA 5EXOA 2R0FA 2JE8A 4L9BA 4CEYB 4FAGA 3AK0A 2B9VA 3KSCA 3VZNA 1NY71 2W46A 2VOWA 2DF7A 2A75A 2IFWA 3CU7A 3ZXDA 4YFWA 2EIBA 2W1SA 1OMIA 3UJOA 3TEYA 2XONA 4IXLA 3KF5A 4HN0A 3I54A 5C7GA 1T6GC 5FOBB 1OKOA 3OSDA 2ZGMA 2AEYA 2D6MA 4I3GA 4K21A 2YG0A 2GH2A 3JZVA 1XPWA 3WY6A 1HJFA 5BYNA 3AJZA 2NM1A 2JJ6A 1Q5OA 5ABJB 2JENA 4XFGA 4NUBA 2PLV1 2WBKA 3RPQA 3ELNA 3IZOA 5ISLA 2JEMA 3CKHA 4LBQD 4QGNA 4UFKA 3UGHA 4XF9A 3WF0A 2JKBA 3B9IA 2E33A 5JOYA 1FMD1 1GZWB 3N9LA 3DN7A 4I0WB 2ARXA 1DCSA 4XYXA 5CKNA 3NNLA 3UJQA 2HWB1 4D6QA 5DUVA 2FMYA 3AVRA 4E27A 3ZM8A 2B45X 2X53S 3MW2A 1NCRA 2D40A 3SKVA 1YUDA 3ZYIB 4D6SA 3S0MA 2VD7A 1U5ZA 5LY1A 4GB32 2W08A 3TEWA 1JYCA 5C6CA 2VR4A 2ZEXA 2HWE1 1OUXA 4BYYA 2Q1ZB 3VZJA 2RVAA 4A44A 2E26A 1RHI1 3MPBA 2D6PA 1UOBA 1CZTA 1ZVFA 3BB6A 1WGPA 1URXA 4P9YA 1XU2A 2Y6KA 1NX9A 3NJVA 2PYTA 2ZZJA 2AENA 1IG3A 5F6LB 1OHFA 4C8DA 1NY72 1Y9GA 5CAZA 1GFF2 1HRI3 4YGCA 3TWIA 4TLFA 1GU3A 4LO7A 4AI1A 2YV8A 2EIDA 4YYOA 2GN3A 3AMNA 5FZFA 5C3RA 2ZX3A 3I59B 5F1RA 1H2KA 4IEUA 4MGKE 2QQMA 4V2VA 4QB6A 1DGWA 4DUWA 2D7FA 1QJEA 3KB5A 3VD7A 4A45A 3WW1A 4QXHA 5JOZA 3GALA 2CL2A 2OPKA 1S0JA 1TE1B 3LPGA 5J37A 3O1VA 4P9WA 2C26A 1GSLA 2A6XA 3RI9A 4Y20A 4B7EA 2P1BA 4ZXEA 5F5IA 2Q5TA 2WT0A 4B4RA 2OXBA 1C8M1 4CCJA 5FZ1A 4AQ2A 3OPZA 5A33A 4A2UA 4HG6B 4XACA 3FHAA 1O3TA 1YIFA 2IZWA 4R4ZA 1NCRC 1QJFA 3TB0A 4CU7A 2CAUA 1QJU1 1KD7A 1LOAA 2RJLA 4XMAA 3KGLA 1SLLA 3FHIB 1S0EA 2HWB2 3SC7X 2QVSB 1LHUA 2ZHMA 2PFWA 2I2SA 4ZS2A 1UKRA 3PU8A 1CX1A 4DXZA 5L7OB 1UY0A 3AKSA 3VZKA 3WINE 2VOXA 3OUJA 4KG8A 1SLIA 1KXGA 1XNDA 3ZMOA 2I07B 3E6DA 2FZ1A 1XNBA 2WLPA 1UYZA 4LIUA 4LITA 2YYOA 3IIIA 3N7LA 3PVEA 1RHI2 5FMBA 4BQ4A 5ANNA 2OKXA 2BWAA 4FPGA 5JXIA 3BI3A 5BXXA 3OGJA 3P6BA 5FAXA 3OPWA 5DAPA 5G05L 1DBNA 2PLV3 4AEKA 1C57A 4H2AA 3OB8A 5FUNA 5C3PA 5FZHA 5JWPA 1QNWA 4IE6A 5J7MA 1VMJA 2R0HA 1W9YA 2NMNA 3EMRA 4RGGA 5J48A 3GZAA 2HWC1 1FMD3 2W0XA 5FBJA 5FYBA 3PJQA 5CG8A 1UW8A 4JDMA 5IVJA 1PO13 2Q1FA 4OCTA 2P4EA 1BVP1 2HWB3 4KI5M 2C5DA 4BXSV 1YLLA 5L36A 1QQP1 2XKPA 2ET1A 3I8TA 4KGQA 1C8M2 4Y1YA 5KHIA 5HXVA 1W8TA 5F37A 1KFXL 1LTEA 1W90A 2HWE3 2Y38A 4IQPA 1PK6A 4OHVA 1JH5A 1UY4A 3OJBA 5CVRA 2JE7A 5FP9A 4EQVA 3LA3A 4HPKB 2JD9A 5DUWA 4UW3A 3M70A 1NA1A 1W03A 3HQXA 1HQNA 1V6JA 1HW5A 2JIGA 2VMCA 4Y4YA 3RWKX 5AC91 1GNYA 1GYKA 1JHJA 2W87A 2JDPA 3WNMA 1WMXA 5F2SA 1VBA1 2D6LX 2XWBB 4Y5Z0 1W8ZA 5IK8A 4XFAA 4J1WA 1IS5A 1AHSA 4BQYA 1IS4A 1UY2A 2DTYA 3K3NA 1H6XA 2WN2A 2DUQA 4MOAA 4COVA 3LOBA 3RFRA 4RHV1 4O7XA
chains in the Genus database with same CATH topology
1LU1A 2RS31 4BHPA 1BEV1 1B09A 3MW4A 4U2AA 1C8M3 3ZXKA 2OYZA 1RL3A 1UIKA 3E97A 4XBLA 4YG3A 2HWC2 3U10A 3IWZA 2DU0A 1QJU3 2HWD1 4RL7A 2GC3A 2B7YA 2EAKA 5A33B 1MVEA 3FJSA 3JB8A 4Y1UA 1W6PB 1QQP2 4LO4B 5JSPA 1V70A 4JGYA 3ZDSA 2CYFA 2BYVE 1NA1C 3CEWA 3E6CC 1PMIA 3RSJA 3KT1A 5GKAC 1I9RA 1R092 1O3RA 3TNPB 5KWRA 5C4WA 4KQ7A 5GLTA 4YZ5A 4LLOA 3EBRA 3ZN5A 3O0WA 1VBA2 4QD2A 1H9WA 3ALQA 2HWC3 2P17A 3M8LA 1WCKA 3M1HA 2EAAA 5AC92 1F8VA 1A3KA 4MH0E 2RS32 3RRDA 4BCUA 3RYRA 1BEV2 1RUF1 2VULA 4FSJA 5KHJA 1QQP3 5GZFA 3IPVA 4FBFA 3NV3A 2DYCA 3AYDA 3IMNA 2R072 3HT2A 2KA3A 4JGYC 2HWD2 3FLPA 1ULGA 2R062 5T3NA 1GZ9A 3CO2A 1JBCA 3FLRA 1PGW1 2I74A 3R4DB 5AC93 3WUCA 4AG4A 1PZ8A 4CZSA 5A3LA 4UXAA 1NA1B 3PVBB 5C4WC 3UV9A 2YGLA 2XBO1 2OA2A 3GBWA 4CTEA 4ES8A 4RHV3 3Q9OA 2RS33 1C8NA 1WLWA 1R1A1 3AP6A 3WQ1A 3POSA 4QPYA 3VKMA 1BEV3 4D69A 1BQPA 2E6VA 4IEVA 5JPNB 2RS51 2PHDA 4PDWA 1G9CA 1Q8QA 3KD4A 4UW6A 1ZBA2 4N7UA 4MVTA 3FBYA 4AE2A 2HWD3 1AJOA 3SCFA 1HV1A 3AP9A 3POYA 3BCWA 2CTVA 1RMU1 3ILRA 1EYBA 4FPYA 2XLGA 4Q0SA 1TNFA 3S6PA 2AZ5A 3SISA 1G9DA 2IXKA 2BGCA 4NHMA 3KGZA 4XF3A 1N3QA 1WMEA 2C9AA 1FOD1 3V64A 2WLQA 2IXJA 2GC1A 1MZ5A 4JGYB 5HCFA 3B93A 2VQ0A 4HZFA 3ZSKA 2W52A 4N9HA 1H1AA 3TRSB 1LU2A 2PHTA 3O14A 3GBFA 3A0NA 1HV0A 2GH8A 4RQPA 1DQ5A 4L97A 2VU9A 4NWWA 2BW8A 4GMP0 2NQYA 5JSRA 2XBO2 2YPJA 5EYXA 3WG1A 5C4WB 3TN91 4PDWC 1SLBA 3EQEA 1SBEA 4HLTA 1F2NA 1RUF3 2A5ZA 2CGOA 4IEZA 2BNOA 2CGNA 4JCKA 2QDNA 2ZHLA 1RUD1 1Z0HA 4RR3A 1ULDA 5DZFA 5LRRA 3URFA 2QE3A 1J1TA 1G9FA 4LTAA 1FV2A 1XU1A 1OD5A 4W65A 4K20A 5LK5A 4JTOA 4DQAA 3HMYA 2E7AA 1LB2A 1VBB1 1RMU2 2UWAA 2C1FA 4CP0A 4EJRA 5DDJ1 1TEIA 1JUIA 1N1YA 4WM8A 2DFCA 5FMOL 3VZMA 4QPGA 1IQAA 3BU7A 4FQ4A 3MFCA 5J09A 3POWA 4OI2A 3ATGA 2XBO3 1OA3A 3O0VA 2WFPA 3OD0A 4Q27A 4RQPC 3A0KA 1GLHA 1HQWA 2DCKA 4IERA 3IBMA 1R1A3 2PHXA 1C3HA 3AP7A 1MS4A 4IV3A 1XXNA 3C3VA 3V0BA 2RS53 5HBAA 2Q1MA 3WNXA 1Q8OA 1LCLA 3WW2A 2GZWA 3KLSA 4ITCA 2A6YA 3TN92 2ZAHA 3OY8B 2XWJB 4PDWB 4RR3C 5F6KA 4AVAA 3VBSA 2D43A 4NHLA 4XETA 2BUKA 1S0FA 3D8CA 1ZBE1 3M3EA 3KMHA 4XMIA 1XRUA 1ENXA 1RMU3 1UZYA 2VVEA 1RUG1 1DZQA 4XZPA 4XXAA 4AQTA 3O12A 2HEWF 2TBVA 1VRH1 1DYPA 1FOD3 1QXRA 2GDFA 1C1LA 4WM8C 4XFHA 4QPGC 1N1SA 5AVPA 1EAH1 2V09A 1UKGA 4K9SA 4C1WA 1IOAA 3MF6A 1AYN2 1XYPA 4XJAA 5DDJ2 3WQ7A 4W6XA 1CAXA 4Q8KA 2WQ4A 4XF0A 2EVXA 4IV3C 1VJ2A 1QXJA 1W0PA 4WVVA 3KM5A 4RQPB 3TN93 4AEDA 2ZX4A 2X29A 4YW3A 3ES1A 5GALA 3INAA 4KU7A 1OI6A 3MIHA 4FPKA 4LLFA 3ILNA 4LHKA 2VOKA 2F6BA 3JQWA 3FC0A 3VBSC 4AFMA 3DF0A 1RUD3 4I0BA 1UX6A 4KU8A 1NQJA 2QQPA 1WW5A 5C8WA 3PLQA 3ASIA 1AXKA 4WV8A 1S55A 4RR3B 5FREA 3U11A 3GZUC 4I02A 4B8EA 4BPZA 1YFXA 1VBB3 4CDUC 5DG1A 2Y26A 3WP6A 4OI1A 1ONAA 1RUG2 5DDJ3 3ST7A 2RE9A 4HKLA 1GR3A 3RZZA 3QCWA 1O91A 3D0SA 3GHNA 4Y1XA 1ND2A 1VAVA 3HBZA 4Z1VA 4YVSA 4QPGB 1EAH2 1H0BA 4IEOA 3AFGA 2HKXA 1QWRA 4AEDC 4BLJA 4GH4B 1LGBA 2QCSB 1JOJA 1HRV1 2WZPP 1UL9A 1LOBA 4X8NA 4OHWA 3V0BB 2O1QA 1YWKA 1Q56A 2XVGA 5D8AC 1YJLA 1A8DA 4B29A 4XF4A 1ZBE3 4GXLA 5I91A 1ZRDA 4CEWA 1DZTA 2CGPA 1PNFA 4YZ3A 4AFDA 3K48A 1WBLA 3VBSB 1RUG3 3MW3A 2DCZA 3ZYPA 1YYNA 1ZNPA 3V0AA 3KS7A 4KH9A 2ERFA 4E2QA 1H2LA 1VRH3 1KDKA 3ZXAC 1VAMA 1VAKA 3JUUA 1RUC1 1QNYA 1EAH3 3W59A 4EWDA 2B5HA 4CDUB 1EP0A 1ND2C 3WDVA 1AXZA 1PGL1 2YY1A 3R4SA 4I09A 1GNZA 5JOXA 1LGNA 1NYWA 4DB5A 2P3IA 3CLPA 2XPJA 2FZ2A 1QF3A 4AQ6A 3U07A 3M3OA 3WVJA 4BM8A 4UBGA 1CAXB 1QOTA 3AJYA 2GC2A 2X5IA 3O5SA 2CY6A 5KHGA 2PHRA 4Q1RA 3WXPA 3PNAA 1W39A 1DGWX 1HRV2 1H2NA 1U5XA 1HXS1 3GZTB 1OQDA 4CEWC 4AHXA 4IV1A 3VDDA 4R9DA 2ZHKA 4Q1PA 4M3CE 3U4XA 5D8AB 4ZU5A 4E4DX 3HWJA 3D6EA 3ZXLA 2D44A 1ND3A 1HRI1 1PZ7A 2DV9A 4AW7A 3O7OA 2XHKA 3AZZA 4N53A 3ZFGA 2Q30A 2O8OA 2WNUA 4H55A 2XH6A 1Y9QA 3R0RA 2SBAA 1W6QA 1ZM1A 4K1YA 4K8FA 5H9SA 3VBHA 5J3UA 3N3HA 4Z82A 5CNAA 4BIOA 1ULFA 1PGL2 1ND2B 1AYM1 4MGZE 4LE4A 1TMF1 1DGRN 4ATFA 4E4SA 3OF1A 2X5IC 1HRV3 1RUE1 4GWMA 4XW3A 1ASJ1 3CF6E 5KXCA 1AJKA 1V6LA 3W58A 1MS8A 2PAEA 4BLIA 2A3XA 4LA3A 1FI2A 4IV1C 4BQ1A 4Q4V1 1G9AA 1A8MA 5I8TA 2XJVA 2D6OX 3WUDA 3VDDC 1ZRFA 5JOWA 1L3JA 1HXS2 5I0SA 1AF9A 1NCQA 5GLUA 4P14A 2UWBA 5GZCA 1QJY1 1J3QA 4GKXA 4LT5A 2EF6A 1IHMA 1AUYA 1ND3C 3SNMA 4DRVA 1UD1A 1RUC3 3B02A 4N43A 4Q4W1 3V0AB 4N53C 3ZFEB 1D4M1 2F4PA 3T1LA 4DZGA 1WBFA 5AFEA 2WNUC 3IM0A 2N7GA 1HRI2 3VBHC 3BOPA 1BVVA 4PIYA 4AHZA 2VUJA 4KG0A 4R9AA 5B2GB 2WA3A 1N1VA 1ENSA 5SV8A 4OHZA 1PO11 3VBOA 1IKPA 3NVCA 3B94A 4EN8B 2VOVA 3V56A 1AYM2 2WT1A 4Y22A 1M06G 3RJRA 4TSVA 1RUE2 3WX5A 2IXIA 1HXS3 3M3QA 3MLKA 4XXPA 2D3PA 4AWDA 3NAPA 4D7SA 4QX5A 4ISRA 4OUMA 1NCQC 2UYBA 3IIAA 4JRLA 4Q4V2 4IV1B 3B3QE 4Q4Y1 4RGAA 4LBQA 3SH4A 1ZZBA 1AVBA 2YROA 4LO8A 3VDDB 3FFQA 4HVQA 4N43C 1KS5A 4PF5A 1X8EA 2VMHA 4MSVA 1BXHA 1TME3 2QDRA 3LKJA 4XQ4A 4YM3A 1V6KA 1ND3B 4Q4W2 2JG8A 4ATEA 4XJ8A 2ES3A 5A3MA 1D4M2 4JDNA 4N53B 2XKOA 5C8CA 1HDKA 1DDLA 4RFT0 4XFFA 2WNUB 2DCYA 2EXKA 1DZRA 1AYM3 2PLV2 2UYAA 4UBHA 1TMF3 3FUQA 1W6QB 4DINB 2O0OA 2YGMA 3VBHB 1RUE3 4RSUA 3VBOC 1ASJ3 1DU3D 4XHBA 5K8SA 3MICA 3U0ZA 3RNSA 4YGDA 4AEMA 3R4UA 1FMD2 3CL1A 4R52A 3ZVXA 1AR81 4OHYA 2XUMA 4ONUA 1EV11 2BNMA 4DY3A 1PO12 4Q4V3 2VGDA 1R1ZA 3NAPC 4AVCA 2VW1A 2OZ6A 5DUUA 2VXRA 4CYDA 3EXUA 4JQRA 2HWE2 4HL0A 3AKRA 1CR7A 1QJY3 5H9PA 4OUSA 4XQDA 4BZ4A 1DQ0A 5T5JA 3OYWA 1ENQA 1NCQB 1GZCA 4Q4W3 4LE3A 2QZ3A 5GZGA 4Q4Y2 1D4M3 2PA7A 4HKOA 3VL9A 4FPOB 1ZZCA 3BTAA 1BBT1 2JG8C 2ENRA 4N43B 4B4QA 5JSOA 1OA4A 5C8CC 3NL1A 1QMJA 3KCCA 3B01A 4AI2A 5FO8B 5HI0A 1YIPA 3VV1A 2Y0IA 3DPRA 3JD71 3FE5A 1I3HA 2ZGPA 4P5HA 5CFDA 3TBDA 3WDYA 2WS91 1OLRA 1RJ7A 5BV6A 1H1IA 1EY2A 3WP5A 2VW2A 1KQRA 5DZEA 5FPZA 4CDQA 1NZCA 2LTNA 5FLHA 2DVFA 3VBOB 1OOPA 1AX0A 3B7MA 1MQTA 3WG2A 2AH2A 4Y22B 1NCRB 1QJU2 1KRIA 1AR82 4IEPA 5BY5A 4FCAA 5E89A 1EV12 3AKTA 2R6QA 1C5HA 5K0UA 4XTMA 2XVKA 5IK4A 1CD3G 4Q4Y3 3NAPB 1SLTA 1CAWA 1H30A 3WDTA 4I30A 1MEC1 2WQZC 4JV4A 4YNIA 1YFUA 4L2NA 2H0VA 4LBQB 2H6BA 1D0HA 2ZTNA 4KBBA 3I4IA 3E5UA 1MR5A 2ZGOA 4FPLA 4I2OA 3VBUA 5IT6A 3AXDA 3IT8A 3UKVA 3DPRC 1W6OA 3VKLA 1BBT2 2G4IA 2ZMKA 1I6XA 2R1BA 4XF1A 4PQ9A 4CDXA 2GNTA 1PHMA 2RS11 4Y20B 1PM7A 3JD72 2GN7A 2ZAAA 4CDQC 1H9PA 2BVVA 1AR83 4YGBA 5FDBA 1EV13 1MQTC 4OULA 4OVEA 1PK6C 1VB2A 5C9AA 4WM7A 3NO8A 4IESA 5K0UC 4SLIA 1BCXA 1TNRA 2MNGA 4HVRA 3WR0A 4WZCA 1F5FA 1GKBA 2WINB 2RM21 3AYAA 2WFF1 2WL1A 2BFUL 3WDWA 2ZGQA 2VECA 4QMAA 1MEC2 1ZZ7A 3H1MA 4FOYA 4FP2A 2EA7A 1BBT3 4R9CA 5GZDA 4F83A 4N90A 3USUA 1DQ6A 4QQ2A 1D2QA 3C2UA 4PLMA 1BYHA 3S30A 5JI9A 4S2GA 3JD73 1SFYA 3AKPA 2WS93 4RHV2 5C33A 5FMOS 4CDXC 1POV0 4FP3A 2BVBA 5CU1A 3DPRB 1XYNA 2VH9A 1VALA 4YGEA 5C9AC 2PHLA 4URTA 4WM7C 2WIIB 3PVNA 3WDXA 2RS12 4YM1A 3UL2A 2NZ9A 4CDQB 3TAYA 2H6CA 2GNBA 3ZSMA 1U0AA 1MQTB 2VNRA 4YZ2A 1PK6B 2FMDA 2VNOA 4XIKA 4AF9A 1WA4A 5LRSA 1V6MA 3AMPA 3QLQA 4GIQA 1MEC3 4YSFA 1O4YA 4LUMA 2ZMNA 4NHKA 3RJ2X 4ASLA 4OZXA 4CDWA 1SLAA 4LA2A 3RI8A 3RWNA 3KT4A 1D2SA 3RYPA 3UK9A 4GMP1 2Q0AA 2E63A 2XL9A 4YG6A 1OQEA 3AM2A 3E5XA 2CWMA 2RM22 2WFF2 5HCBA 4EN0A 4M01A 3KCYA 1LOCA 2P37A 1XE8A 3L2YA 3BALA 1HKDA 2PHFA 3SHRA 3AZWA 1CQ9A 1VBD1 2HEVF 1JN2P 4Z92B 1W6OB 4LBNA 1JUHA 1Q3EA 2RS13 2MHFA 4GA9A 4HVOA 3VKOA 3OBRA 4FAHA 1B35A 1YHFA 4O9EA 4FXKB 1QJX1 1WD3A 1RUF2 4QPIA 3LWCA 4K7JA 5D1IA 2V73A 1PVXA 4PJYA 1UIJA 1DYKA 2E7TA 1ZZ8A 1BJQA 4COUA 5C9AB 3PMEA 3LSDA 3J26N 4WM7B 1DQ4A 1RIRA 4I01A 1G8WA 4F8AA 2RM23 3BODA 1VBC1 2WFF3 1PGW2 4LHNA 3MGUA 1O5LA 1J1LA 5GZEA 2VMIA 1UN1A 4HK8A 1QU0A 3JU9A 4S2DA 3WG4A 3IDEA 1ALYA 4B4PA 2LM3A 3USUB 1SACA 3AP4A 5FQ0A 3B69A 1R1A2 1U12A 2JD4A 3EO6A 3H8UA 5JDBA 2G9GA 3NWKA 4HETA 4AGRA 5HCAA 2RS52 1B35C 5K7PA 2OW4A 3P3NA 4UW4A 3WHUA 1H8VA 2ZCWA 4QPIC 1UPSA 4DY5A 3GNEA 3QOPA 2IWGB 1CESA 1FNZA 2Y0OA 3H7YA 2ZA9A 5FBZA 1DIWA 3ES4A 3IPVB 5H9RA 4D7TA 3JCIA 1J3RA 1AX2A 3IKWA 1CAVA 1DLLA 2D98A 5FLIA 1NXMA 3HN1A 4Z2WA 1NOVA 3ZSLA 1UCXA 3PVOA 4GMP3 5J96B 1G6NA 3AXEA 1FOD2 3MIDA 4KGGA 2A6VA 1VBC2 4MYEA 4C0BA 2RR11 3AMQA 2O8QA 4IEXA 4EN9B 3EJKA 1XNKA 3ECQA 4OHXA 4AFAA 1NLSA 4SBVA 3HR9A 2P34A 4JDOA 5CA6A 1VBD3 1W2UA 1H8TA 3M2MA 2JDZA 5E1RA 2XJSA 4XJZA 3PHMA 1REFA 1FATA 2P3KA 4LO5B 5I0TA 3WG3A 3APBA 2XVLA 1QJX3 4LBOA 4MGYE 3MIFA 3ACLA 2VPVA 1NXD1 5GLWA 4C90A 1B35B 2Z69A 4HT1T 1SMVA 1RUD2 5K9YA 2VUAA 5BNQA 5AFBA 4QPIB 5T54A 3MFAA 1GBGA 1UAIA 5SV5A 2GAUA 1X36A 5A32A 2K2SA 1VBC3 3BOWA 1COV1 4QT6A 1AL21 2WSVA 1VBB2 1RJ8A 2EXJA 2Z42A 5JMCA 2BBVA 3RS6A 5T52A 1CPNA 3WW3A 3VHOA 2NP0A 5IK7A 1ZX5A 2RR12 1XE7A 4Q4X1 5KXEA 1SLCA 4KWLA 1G86A 5I8SA 3AFKA 1DHKB 2NLRA 1W6NA 4FOQA 4EROA 2DVAA 1SDWA 4Q29A 4QU2A 2NN8A 2PAMA 1RTVA 3OBTA 1WW6A 2A3YA 4ZU7A 1VP6A 4AK3A 3J4UH 4HMZA 2OUJA 2D3SA 2UWCA 4FPFA 3WOGA 1ZBE2 1GQHA 4AEJA 4L8QA 1S0IA 4K1ZA 4IEWA 5E8AA 4NN0A 4M0NA 1HIXA 3AYCA 3N7MA 5JCTA 1CAUA 5CADA 1VRH2 1GANA 4FOVA 1V6OA 1CAVB 1BMV1 2RR13 1AL22 4WM8B 4CRQA 3KCXA 2K9ZA 1CONA 1GV9A 1HQLA 3DV8A 3FBMA 1LHOA 1MS0A 3JB4C 1C4RA 5GLZA 2ZX2A 4JVAA 2AR6A 2ZX1A 2QKDA 4BWOA 2ZBJA 1ZRRA 4IV3B 5EFUA 1PO21 1PNGA 1H4HA 4Q4X2 1BK1A 4ES9A 1RUI1 2R30A 3ZN4A 4H7MA 1LRHA 1QXPA 4H3WA 2XL7A 3AMHA 2WJSA 3MZHA 3LA7A 3AZVA 4ZU4A 2DCTA 1COV3 1AL23 5FTTC 4WVZA 1JHNA 2ZABA 3JBG1 4O9GA 5A32B 2TNFA 4YVSC 2XJTA 4ISQA 5J36A 4P9XA 1NLRA 3LB9A 4FPHA 4XJUA 3FX3A 1AR71 1PVC1 4IEYA 1ZZ9A 5DZGA 1RUNA 2MEV1 1YNAA 5GM0A 1BMV2 1X33A 4DFSA 1SCRA 4Q4X3 4BIFA 5FO9B 1IKQA 4QQHA 2DTWA 3P3PA 1MS3A 2SLIA 4HFSA 4XJ9A 4KNCA 2XJUA 3AYEA 4AEDB 4WVMA 1QY4A 1YO8A 3PMSA 5F9TA 3B5LB 4J1XA 5JAXA 1IS6A 1X50A 5KHHA 1GZWA 5CIRA 4Y26A 1PO22 1RC6A 1OLQA 3SXWA 1WUVA 1KITA 4PCRA 1W6NB 3M3CA 3TOJA 4DNYA 2CNAA 2YUEA 1RUI2 3WZ1A 2E53A 3D4KA 4Q0QA 3MIBA 1GICA 2ZKNA 2VNGA 1Z7S1 1U5YA 2XB6C 4PBPA 4HBNA 1J3PA 3N4MA 4FO9A 2CV6A 4D7YA 4DOUA 1FNYA 2WC2A 4H14A 3VHPA 1TME1 1IPJA 3JQXA 3LA2A 4MXVA 4R8HA 3LAGA 1AL0G 1YFYA 4AYUA 1RUC2 3M4FA 3VLBB 1CAUB 1DGRA 3JBG2 2P3JA 4JRAA 3WQ0A 1KJRA 3FLTA 3NV1A 4YVSB 3J9SA 1RB8G 1CJPA 3TYJA 2QJVA 1PVC2 5LEJA 3HIFA 3CNAA 2MEV2 4GQ7A 3TNQA 3ZO0B 4OI0A 4E4ZA 1PO23 4FTSA 1LHNA 1SCSA 2XLAA 1Q8PA 1ZYBA 3PJYA 3H1WA 5JIUA 1W0OA 1RUI3 3VZOA 3ZYJB 1WW7A 3FMGA 3WV6A 1AR63 1IS3A 4WZFA 3L9JT 1AR91 4FPJA 4CEWB 3DL3A 5FO7B 5J98B 1JXNA 1UU4A 3VZLA 1O4TA 4E2SA 5T5PA 2WA4A 2G9FA 3ZFGC 5L7OA 3JBG3 3WHTA 5BUVA 1Z7S2 2B39A 4EN7B 3ZMNA 4XFIA 2DU1A 1JYIA 2RJKA 1OPOA 3NV2A 1TME2 2OZJA 1AR73 1PVC3 2NYYA 2MEV3 5BNOA 2DVBA 3S7EA 2YDEA 4YVWA 3KZ4C 3ZXFA 3VKFC 3S7IA 1TMF2 1MS5A 1QDOA 5JIAA 4E9KA 4YM2A 2X5IB 1ASJ2 1LR5A 4MGIE