5A70A

Structure of the lecb lectin from pseudomonas aeruginosa strain pa14 in complex with lewis x tetrasaccharide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
113
Chain Sequence
ATQGVFTLPANTQFGVTAFANSAGTQTVNVQVNNETVATFTGQSTNNAIIGSKVLNSGGGGKVQILVSVNGRSSDLVSAQILANELNFALVGSEDSTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords LECB
publication title Analysis of the Lectin Lecb from Highly Virulent P. Aeruginosa Pa14 Reveals Lecb as Strain Marker and Pan-Strain Anti-Virulence Target
rcsb
source organism Pseudomonas aeruginosa
total genus 22
structure length 113
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5a70A00
2BOJA 2BV4A 2XR4A 1UQXA 2BP6A 2JDPA 5D2AA 5A6QA 4AOCA 2CHHA 1OVSA 5A3OA 2JDYA 4UT5A 3DCQA 2VNVA 4CE8A 1W8FA 2JDMA 2VUDA 2JDUA 5A6ZA 1W8HA 3ZDVA 1OXCA 1OUXA 5A6YA 1OUSA 1OURA 2VUCA 2JDHA 5HCHA 1OVPA 2BOIA 2JDNA 5A70A 5A6XA 2JDKA 2WR9A 1UZVA 2WRAA 1GZTA
chains in the Genus database with same CATH superfamily
3H3LA 3JD73 1OQEA 1RMU1 4NIGA 1TZOA 1E5HA 2WT2A 5FY5A 5FZCA 3RJ2X 2VPVA 3D3AA 1N3PA 2RDRA 4P5YA 4RFT0 5FP9A 4EN9B 1US2A 4H2AA 2QFEA 1XQNA 2GH2A 4OUSA 3MLJA 2R7EB 1VJ2A 1ULOA 1GANA 1DF0A 2VZ3A 1QJU3 4UFHA 4B1MA 4MX3A 2VVDA 4FP2A 3A4UA 3AXEA 4DXTA 2OZJA 3AMNA 3H7JA 1F31A 1VAVA 3MIEA 4IEQA 2NQYA 2WL1A 4XQDA 5EP9A 4QM8A 3SQOA 5ANQA 4FQZA 5FXVA 3T0AA 1H8TA 4A41A 4QU2A 1SZBA 2CGNA 1OC1A 3ZR5A 4XF4A 2IVJA 4E2QA 3AP7A 4JDNA 5CEHA 1Z7S1 1GFF2 2WBKA 3RFRA 3E5XA 2PTMA 1OSGA 2CAVA 1JOBA 1ALYA 1KDMA 3EYPA 4AK3A 2WO7A 2TEPA 2W92A 4NIHA 2XKOA 2HWE3 1GQGA 4GWNA 4KGGA 5T55A 2VNRA 4M3CB 2X5IB 2HWB1 2VTXA 1UMHA 1DLCA 4WM7B 3KV5A 4KU8A 2WZEA 1HRI3 3E6DA 5ERLA 4HKLA 3WNPA 1C8M2 4LNVA 4N9IA 3LEIA 2XBO1 4LA2A 1MS8A 3MW2A 3GALA 1VBC1 3MO4A 5D8AA 4A6SA 4ATEA 4BXFA 5F6LB 3SC7X 4GMP3 1N1YA 2R49A 4XTPA 1NZCA 1NUKA 1BBT3 5FZEA 2B45X 3UL2A 4XBLA 2VQTA 1R1ZA 5FWEA 1Y9MA 1RUH2 1S2BA 1UXZA 4P9GA 4NIAA 3U78A 4CXXA 1RUNA 1IZ3A 4PT6A 1CZSA 3N9LA 4RA0A 1UX7A 2CDPA 1CX4A 3DYPA 1W2AX 4S2GA 4L99A 2VMHA 1DG6A 2VO5A 3TEXA 1N3QA 1R1A1 4WVMB 1UWWA 1FV2A 5T5LA 3VD9A 3A22A 3WSOA 4LK7A 3HWJA 1BJQA 4RGAA 1IS4A 4HMZA 2OS2A 5EXOA 4NIIA 3TEYA 1L7RA 1RHI2 5KBFA 2VY0A 1RUD2 5F3CA 2BNOA 1OQDA 3VDDB 2QDNA 4N53A 1W8FA 1X8EA 3MYXA 2JDMA 1OOPC 3I3QA 2QJVA 2ZXQA 2JD4A 3H8RA 4NAOA 4N8MA 1NCQB 1SCRA 3OTFA 1DGRA 1MS9A 1VE0A 2Y6LA 1ZZBA 2RV9A 5DAVA 5I8TA 2XPJA 2HWD1 1BEV2 4NPMA 4EZ4A 1AUYA 1QH7A 4BQ1A 1HJFA 3H1MA 4IERA 2CSGA 3OGJA 1XNBA 3Q8CA 2JECA 5FY4A 5FYUA 5DABA 3WW3A 4DXSA 1PMHX 3W59A 5ABJC 3M2MA 2ZKNA 3C7EA 4PDWB 2JKBA 2XWJB 1GNYA 2DF7A 1W2NA 4EN7B 2RR13 2XQXA 3LSDA 1O59A 1RUE2 2AREA 2DCTA 4RHV1 5FYVA 5FZFA 5A33A 1IKPA 5IJRA 1POV0 5ISLA 3JD72 4CCMA 1AR93 2V5YA 2W52A 3HQRA 3OPWA 4JDOA 1KS5A 1FYUA 5HBAA 1GP6A 2VMCA 2LRPA 3NKGA 4IEUA 4XQ4A 1XC6A 2E51A 3IWZA 2D3RA 1AHSA 2XLFA 1QJY3 3H1YA 4MGZE 4F3JA 1W9FA 4HK9A 3E1F1 5E16A 2VMDA 5K4LA 1BLZA 2ZGLA 3UETA 2GNDA 5F5IA 4Y24A 3Q8FA 5EHDA 3I2KA 1HRV3 4MUVA 2P3JA 4UF0A 5FYMA 2LM3A 4IE0A 1HXS3 4BYYA 4J1WA 3RWNA 4CSWA 4D7TA 1Q5OA 1R091 1COV3 1NQDA 2BWCA 2ZPXA 4MXWA 2BRTA 1DZRA 4X6RB 2CGPA 1B09A 2AEYA 1QF3A 2HWE2 3F95A 2ZGRA 4JDMA 3POYA 5A3LA 5FO8B 2R062 1UZVA 2RJKA 3BGAA 1JOPA 5IAXA 4P08A 5JAXA 1VRBA 2VQAA 4R9AA 5K8SA 1CPMA 1HRI2 2BU9A 2PHLA 5DN2A 5JI9A 4CXYA 4YW7A 1ACCA 2BWAA 3DGTA 4PF5A 2IXJA 4BZ4A 2EA7A 4Z2WA 5FPXA 1O3TA 5A3NA 1B35B 3KV9A 1JU3A 4YVSA 2UY9A 4Q4W1 3NJXA 3OBRA 4RFRB 4TN7A 5AC93 5CFCC 3LWCA 1DZTA 3WDTA 4YARA 5I0UA 1FPN3 5H9QA 1GOGA 2P5BA 4PCRA 1BBT2 1NA1B 4RD7A 2W08A 5KXEA 1PK6B 1OOPA 4JV4A 1I5PA 4PQ9A 3J7MA 4CCDA 2NMOA 3MIHA 3LGRA 1WLTA 1V9U1 4E2SA 1CAVB 4LUKA 2VECA 2PN5A 4RS5B 1KJLA 4P9XA 3K4AA 4XFFA 2QQLA 5J96B 2B42B 1DLLA 4GIQA 2ZZQA 2OQ6A 2R1BA 5DQ0A 3J7LA 4K3UA 1WLDA 4IGPA 3HT1A 1W8WA 5IVBA 3THPA 3OY8A 3LD8A 4CCJA 5K0UB 3KD4A 1CIWA 2ARBA 3KF3A 4O7XA 3X29B 5ABJA 3O1OA 1KFXL 4XPVA 4YM0A 4H7LA 2Q4SA 4XJAA 2C9AA 1F35A 3HPNA 5APAA 3BKZA 1UW8A 1WBLA 2XVLA 4N43C 5FR3A 2VBDA 4Q5OA 2V4AA 1UY0A 2JDKA 2QQUA 5A6XA 1FNYA 4KWKA 4QPGB 3GBGA 3GZTB 4AQ6A 4UI9L 4E9KA 1JHJA 1D2SA 1HDKA 3O12A 4C0HA 1SLTA 4I2OA 5HI0A 4CUCA 1DHKB 1DQ6A 2R1DA 4K7JA 1EYBA 4R9BA 1ZNPA 1MQTB 3I54A 4D8MA 5LRSA 4Y33A 4YFZA 3BTXA 3MIFA 1D0HA 2YU1A 3IPVB 3VB9A 3CNAA 1RUJ1 2HWB3 3N7JA 3EXUA 1W6MB 2VOVA 2WS93 3AZYA 1LHWA 3OJBA 5FQ0B 1RXFA 4A3XA 1EPWA 2OPKA 2RS11 5DDJ2 2NN8A 3RJRA 2EF6A 4LBLA 1C57A 3VGIA 4FPFA 1CN1A 5FY7A 2RR12 1UKRA 2XL9A 3I2GA 5CNAA 2BDRA 2P6HA 2ZGTA 4K1YA 2FCUA 3N9OA 1KEXA 2XJRA 5J36A 3M3CA 1I1EA 1VBE3 2W95A 1QH6A 4LO6B 3UV9A 4PLMA 4D6SA 5CADA 4I30A 4Y22B 4JQRA 4QX2A 4GH4C 4P9LA 1GMMA 1SHWB 4LBKA 3UT0A 1H4GA 2GAUA 4MO3M 4ZXKA 1QJY2 2ET7A 1UNBA 1D0GA 3P3NA 2RJLA 4CUBA 2J1TA 1YRZA 2VOTA 2D5HA 1AR81 5DG1A 3GYDA 5LY2A 4KU7A 1HRV2 3VD7A 4NOTA 4F83A 5IVVA 3KWVA 2Y8KA 3M3OA 2WNEA 1JYXA 2ZX2A 1NKGA 1R1A3 1HXS2 5CFCA 5T50A 4EROA 1PVC3 1COV2 4IXLA 3I2FA 2WZR1 1UYXA 2QE3A 1ZRFA 1DYOA 2GC0A 1PNGA 4AOCA 4QPYA 4B8EA 4IDZA 3K4ZA 5J7MA 3I2HA 2YGMA 3ZFGC 4NMIA 3SH5A 2QQVA 1W8HA 1OUXA 4JGYB 5KXCA 4OI0A 1NY71 2ORXA 1V6LA 5IW0A 1F9KA 2JB4A 4LBOA 1GZCA 5A32B 4NVPA 5IWFA 5EIYB 4AFDA 3VZMA 3AP5A 4R9CA 2PHRA 3I2IA 3DKQA 3DECA 4SLIA 3GBFA 1LOGA 1RUG3 2CV6A 4JHZA 3RDIA 1X8MA 4H3WA 5A70A 2DVDA 2P2KA 5GZCA 2CYFA 1W6NB 4XILA 1KS4A 1VAKA 4PHZA 4XF9A 1H1IA 3P1IA 2XUMA 3AZVA 3TBDA 4HG6B 5FY8A 4N43A 1PGL1 3VBFB 5HXMA 2XLAA 1JZ3A 4C1WA 1XSQA 3ZDVA 3H9AA 1LOFC 2GNMA 4AR2A 3N9NA 2IVIB 2VOWA 4ONUA 2O14A 2DU0A 3AVSA 1H1MA 3RVHA 1RMU2 3VZKA 4RQPB 2VXJA 5C5TA 4BCUA 1IS3A 3M3QA 5LBCA 3AYDA 5CYYA 3SMHA 1LAJA 1TQ5A 3HN3A 1PIV1 2VULA 3ZXJA 3NRUA 1CAUB 1RUF1 2YBSA 4GB31 1F4AA 4XVHA 4JKLA 4Y20A 5FZ0A 5FZAA 4R52A 4AG4A 1OLMA 2DWRA 4UFLA 1ONAA 1REEA 4RR3C 3RQ0A 1CD3G 1WCQA 3T0BA 4L2NA 3USUA 4XZPA 5FLIA 1ENQA 3OOXA 1PVXA 1OA2A 2QZ3A 4W4ZA 3U07A 4AYUA 2Z4FA 5GLTA 1YNAA 2Y26A 3WQBA 1O91A 3S30A 1RINA 4ATFA 3C2UA 1R093 3D6EA 4B29A 2YC0A 2W1WA 2PFWA 2ZX3A 3POFA 4LTAA 1O8PA 1Z7S2 2VMFA 4K8RB 4Y26A 4LHLA 4GH4A 4DEVA 4BJ0A 1LENA 3N35A 3CZJA 3B00A 4J1XA 5IVFA 2XL7A 1QU0A 4IEZA 1AJKA 1QNYA 2KA3A 5CU1A 2WFF1 1UIJA 3HBZA 5L9VA 3LPGA 4EV0A 2HWB2 1HW5A 2WS92 4ASLA 2FZ1A 2IXLA 1G86A 2GMMA 4ZU4A 4HPKA 5IVYA 3T1MA 4ASMB 1W6PA 4M0NA 4XJWA 4AVBA 3CO2A 3EBRA 3NNFA 5BPXA 2XBO2 4R4ZA 1HKDA 4CCCA 2DV9A 1W8NA 4BLJA 1VBC2 3HJRA 1MR5A 3CF6E 1JOJA 1Q8VA 4Q4W3 1ZRIA 2GH8A 4QPWA 1AR71 1VBE2 4XJZA 1OA4A 3M3EA 2L9LA 4UW3A 5FREA 4JZRA 3VKOA 5A6YA 4O9EA 5BNNB 3ACHA 3UJQA 4A42A 4QU1A 4QQOA 3WNXA 3ZFGA 2RMU1 4LHSA 5C8CC 1DQ1A 1H2MA 3KT1A 3G7DA 2WR9A 4RN5A 5KHKA 3URFA 4AFMA 2WWSA 3WXPA 3JQXA 5JMOA 3MV01 4LKDA 1G9FA 2RDNA 2BV4A 5FZIA 3WF1A 4AI3A 1V9U3 2VM9A 3OPZA 2MEV1 3CHXA 3VBSC 1WLCA 1VB2A 3TEWA 4RL7A 4XDPA 2VCAA 3SKJE 4BWOA 4DUXA 4CU9A 2B39A 1R1A2 4CP0A 4ET7A 5L9BA 4OMCA 2D6PA 4XIKA 1OI6A 3MEPA 4YVWC 5E89A 1TMF1 3ZFEB 4QPIC 1QOTA 1CJPA 4A4AA 4XEZA 4JAAA 1V6OA 1PO21 2F4LA 3SH3A 1WMDA 3HQUA 4N9HA 5H9RA 4CP9B 1APNA 1LOFA 3L2YA 3SHRA 5BUVA 1EY2A 4ISRA 4PI2A 3T2PA 1MEC1 3Q8EA 1F5JA 4JRLA 4YWAA 2GC1A 3FE5A 5A7SA 3RYKA 1LB2A 5LK7B 2PYTA 4CDUB 1XJAA 2QDRA 3VKMA 1QEXA 3O1TA 3KT4A 3C3VA 4KWLA 2AGSA 3LIGA 1RUG2 1POV1 5E6HA 5K7PA 3BUCA 3GHNA 1N47A 2XJQA 2YB7A 1SLIA 3IZOA 3KGLA 2LW8A 4UAPA 5D21A 5JZGB 1O3RA 1RUJ3 1X9TA 3FN9A 3AZZA 5H9PA 1V6JA 3VZOA 4FOQA 5JXIA 4RR3A 4U36A 5AVAA 4YSFA 5A1FA 4DXRA 5HV4A 3CJIB 3NKTA 2ZEWA 3OUIA 5IT6A 2SLIA 4AI2A 2I07B 5IVJA 3IDAA 3WOGA 3H50A 2OXBA 4KNCA 3BVCA 1K12A 3LF7A 2WT1A 2VXRA 4RHV2 3MF9A 1D4M3 4NROA 2J1RA 5BXXA 1XB9A 2W1SA 1D4VB 1XPWA 2BP6A 5FXZA 2Q8DA 2ZX1A 2PAMA 2ZBJA 3OGVA 4DQAA 4X8PA 2XB6C 5F8PA 1SPPB 1WCKA 1ULDA 3FMGA 1UKGA 1RXGA 2VOXA 4NE9A 3T08A 3W5MA 5FFOC 4FPEA 5FYHA 2WN3A 4LKFA 3VDDA 3BIWE 1QOOA 4A7KA 1WMEA 4CVUA 2QCSB 2V4VA 4LIVA 3VKFC 1IKQA 4LOTA 5CG8A 4JVAA 1NCQA 4CDQC 4CEWB 2DCJA 4YM3A 3VHNA 5FPUA 4PF1A 2D44A 3WNMA 1XYOA 1ZX5A 1XXNA 1R092 3S0MA 5IK7A 2VZTA 1BCXA 3K3NA 1JODA 1DBNA 2WZR3 4NWVA 4MGTA 2XMLA 3LA2A 4D3WA 4W65A 4WZFA 1KFUL 5C8CA 1PZ8A 1AYM1 3AKTA 3ZXGA 2EIEA 3O7OA 4A6OA 2GN3A 3AM2A 1CESA 5K0UC 2ZEXA 4MGSA 3I8TA 1VP6A 2ZS6B 4JTNA 1QMJA 4PDWA 5CKNA 3VBSA 1UOGA 1W3XA 1Q43A 5KWRA 1AL0G 2FDGA 1QKQA 1W9YA 2JXAA 5FYTA 3WZ1A 1YQ6A 5HCHA 4HL0A 1REFA 3SISA 3I4IA 3ORJA 1KJRA 4QKDA 4XDOA 4QB2A 2D98A 1OH3A 4YVWA 5FTTC 4F8AA 4Q4W2 3LKJA 4QPIA 2BOJA 2ZA9A 5JSOA 3OCPA 3WNKA 1A6CA 1OVSA 1LHUA 2WO2A 2ZMKA 1GBGA 5JLVA 2VNGA 4IE4A 4OHVA 1Y7BA 4BIOA 1UY4A 2R0FA 3OGGA 4LO8A 5GLZA 3T0DA 1NLQA 3TRSB 2HWC1 3QBQA 4K40A 3WNOA 4RGKA 3WW4A 4IE5A 2FCTA 2KD7A 1H9WA 1F4HA 3BU7A 1D2QA 3HNYM 5FMOS 5JR7B 1QXJA 4JGZC 1V9U2 2OA2A 1O6UA 2G9FA 4FOYA 3ZXKA 2X8KA 4LO7A 1BMV2 3DL3A 4ZU7A 3DXTA 4MHRA 2WWJA 2JE7A 4YG6A 1YYNA 4AEDC 5JUVA 1FT9A 1C1FA 1OPMA 2Z2SB 1PIV3 1RUH3 1RJ8A 4XZUG 5IK4A 1UPIA 4GB33 1Q8SA 5CB7A 4URTA 2W3JA 2H0BA 4A45A 4E2GA 4AI1A 5F1RA 3BOPA 4S2HA 3AL6A 1SBEA 5LA9A 1JZ7A 5LRRA 3N9MA 3WUCA 5IVEA 4YZ5A 3A7QA 4FFFA 4IV3C 1W2TA 4XUNA 2B8MA 2Y0IA 4QDRA 1FNZA 1PNFA 4JTOA 3NV4A 5F39A 1W99A 1JTZX 3FWEA 3LFMA 4EN0A 4LBQB 4FAGA 1UMZA 4QX0A 5IHRA 3FHIB 4MGYE 5JVVA 3AMMA 1QJZA 2XG3A 3PMEA 4Y5TA 3BB6A 5A7QA 1S2KA 1KGYA 1A8DA 1W39A 4IW3A 4O61A 2WFF3 3NAPC 1RUJ2 4EJRA 1DDLA 2CWSA 2XR4A 4QHOA 5CA6A 2I2SA 2X09A 4NRQA 5JSRA 1A34A 1S4CA 3NL1A 4HZFA 1GZWB 2Q0AA 1P8JA 4XAAA 4CDQA 3RPQA 1AX1A 1ASJ1 2PHXA 2UWAA 2UYAA 1CAVA 3PMSA 2P37A 3P6BA 4FPOB 4HK8A 4RS5A 4BQXA 1S0FA 3SH4A 1W3VA 5B4XA 4AAXA 1WBFA 1SDWA 4BIFA 3SEPA 2O1QA 2VTXJ 5CISA 5JDBA 5EJ1B 5DAQA 3ABZA 4XF3A 2J22A 5AVPA 1XBFA 4B4QA 4E4SA 5DPNA 5K0UA 1BHGA 3THCA 1MPXA 4W8JA 4A7ZA 3DEMA 4OQ9A 3MI8A 4FXGB 5L73A 1IG0A 2ID4A 2PAEA 5DXDA 4N53C 2N7GA 1WW7A 2AUYA 4CTEA 1EUUA 1SFYA 5L7OB 1JBCA 3KQ4B 3GJAA 3T3YA 3S7EA 3ZIXA 4MYEA 5LW9A 2DFCA 2AACA 4JKKA 1ND2B 5FPLA 2E6VA 2MEV3 3MPBA 5FOJB 3TN91 4IETA 3IDCB 3O1MA 4Q0VA 5FYZA 1V70A 2W1UA 1W6QA 4IEOA 3ACLA 1CAXA 1QJEA 2AH2A 1Q3EA 1UYZA 1MS5A 3K4DA 1UMIA 2XOMA 1ZZ8A 2RDSA 2YROA 1Q8OA 4OVEA 2WZR2 5I0TA 1TMF3 5GZGA 4UFKA 5C4WB 3VZNA 2OYZA 3IPVA 3PJYA 1PO23 4MHUA 2A3WA 4AHYA 3DPRB 3VBUB 2D7FA 1UY1A 4KH9A 1H2LA 1WKYA 5FKBA 4CZSA 2ERFA 3ZYIB 1PHMA 1JUHA 3AYEA 4JGZA 4YW3A 1NY72 1JYNA 3GZEA 1UOBA 4TSVA 3PVBB 2YMZA 1UU5A 1YQ2A 2NZ9A 1UOJA 3JQWA 3WG3A 2G4IA 3H3ZA 4HVRA 4AEDA 3B7MA 4D7SA 3T30A 1J83A 3LIHA 1HB3A 1UZWA 1WD3A 4Y5Z0 1GNHA 2R063 3JXSA 2DBIA 5FZHA 1K5MC 3LA7A 4Y22A 1BZWA 2X05A 4NHMA 5BNPB 1GQPA 3FBYA 1OF3A 3JB8A 1W90A 2HJIA 2RDQA 3PHMA 4CCLA 2YY1A 5HCBA 3A23A 3ZSEA 4IV3A 3ZO0B 3H0OA 3J7NA 3POSA 3V0BB 1PGL2 2ET1A 2H6BA 1PO11 2Y0OA 4IGQA 1T2XA 2BZDA 1JI6A 4YZ3A 2B9UA 2ZKLA 5ANNA 2DYCA 5FZ8A 4MGIE 1UIKA 3HIFA 4H14A 4QB1A 1CGPA 1W8OA 4OCTA 4UT5A 1ZBE1 2NMNA 4FT8A 4ITCA 4PBPA 4YGCA 1W04A 3K51A 5GM0A 1R64A 3WD5A 3NAPA 3B9IA 4AFCA 1J58A 3JZVA 4Y3OA 1PIV2 2GALA 4R9DA 2JG9B 1H30A 4GB32 1Z78A 2ES3A 3TEZA 4FQ4A 2D97A 2HYXA 4JGYA 4HOOA 1QJFA 4GWIA 4IV1C 3LEGA 1S0GA 3IDBB 3O1UA 3KCXA 3VBHC 5C3OA 4INDA 1XNDA 3HN1A 3ZYHA 3USSA 4YVSC 2JG8C 3BTAA 3CIHA 3INAA 2EALA 3CKHA 4FVVA 3THTA 3VD5A 4BU2A 2J42A 3C7HA 3BODA 3OSDA 1QGLA 1W8ZA 2VVEA 3BTZA 4LO4B 2BBVA 1SBFA 1KDKA 3I2DA 5KHGA 4I02A 2GMPA 2NP0A 1URXA 4BOWA 4FO9A 3K3OA 1AR61 2WFF2 2D6KA 2CTVA 2HLEA 1FMD1 2CU5A 4EN8B 3OBAA 5BNQA 1UL9A 2XHNA 3WW2A 4TYSA 4BHPA 5F7UA 2YPDA 1MZEA 1CZVA 3S7IA 5C3PA 4Q4X1 3WV6A 4QQLA 2VMGA 5FY1A 1A8MA 4NHKA 1L7LA 2GC3A 3AL5A 3IDEA 1S1AA 2CAUA 3OBZA 3DYMA 1AR72 4HKWA 2C26A 4MOAA 5DDJ3 5EJZB 1X50A 2W9XA 3VBRC 4BQ5A 5LEKA 4CU6A 3O0WA 1OFSA 2VG9A 3TAYA 3POIA 4S2DA 1WW6A 4DS0A 4Q2FA 2RMU2 4ZXEA 4BQ4A 4DEQA 5A6ZA 1NQJA 2WQ8A 4CEYB 1VBA1 3CJXA 4MV2A 1Y4WA 2OQ7A 3MFAA 4O9GA 5A1LA 3S6PA 4HKOA 2MEV2 1HIXA 1NCRB 2C24A 1ZRCA 5BNOC 5FPAA 3LPFA 3H7YA 3K2OA 2O0OA 1K5MA 3CMGA 1QHDA 3ZR6A 3ZYJB 1PX3A 3E5QA 2E9QA 2WZ8A 4C0BA 1VBB1 1J1TA 3OPTA 2D6NA 1VBD3 3DKWA 3RI8A 1TMF2 4AFBA 4A7YA 2ARXA 2JDYA 3AXDA 3GGLA 5FO9B 1MVQA 3HQXA 4DB5A 3ROUA 1PO22 4QQ2A 2A1XA 1ND3B 2W0XA 1IS6A 2WNVC 3OD4A 4IL7A 3ZIWA 2GMEA 4IGOA 2VCBA 3AP6A 3U14A 4UWDA 4I09A 1LOEA 1O7FA 1MEC2 1HQLA 3FC0A 1GWKA 1O5UA 4LE3A 4Q26A 4ES9A 3E5UA 4YW4A 4UOJA 2TNFA 4YFWA 1G7YA 3MICA 3IAPA 4YZ1A 3IIAA 4FPHA 4NPRA 3UGFA 1AVBA 2RS33 2ADEA 4GMP0 3WY6A 1RC6A 2ZGKA 3KSCA 3R05A 1KXGA 4UFMA 4QGNA 1MS3A 4GQ7A 5A3OA 4IV1A 1UOFA 1UZZA 2Y6FA 3VBHA 4YNIA 4TWTA 5FIXA 2JG8A 2VUAA 4AI8A 2P3YA 1ZZ6A 5C9AC 5JXJA 1BVP1 4IEYA 1H4HA 4OUEA 4Y1UA 1Q8PA 4YM1A 1G9BA 3U4XA 5C70A 1C3HA 3IKWA 1Y9GA 2LROA 3MGUA 3AZXA 3UESA 3UKTA 2B5HA 1WD4A 1WWYA 3ZFEA 2B9VA 4GJYA 4JX0A 3PUQA 3VV1A 3ZLIA 2EICA 1WLWA 5IATA 1RL3A 5IAVA 2A3XA 4CCEA 5BY5A 3QLQA 1RMU3 1K42A 3GZUC 4MLOA 2FDKA 1WA4A 1ZZ7A 1OBNA 3K75B 4M3CF 4ZONA 3TN93 4QDQA 4YPJA 4WM8B 5BYNA 2JDAA 4B7EA 4E8CA 1W2UA 1W28A 2V09A 4LBJA 4CDUA 3NV2A 3NNLA 2IZWA 3L2HA 4FBFA 1YFXA 2K46A 2A6WA 3OYWA 3VBRA 3S5AA 3POEA 3TYJA 1JZ5A 3SCHA 5BV6A 1D7PM 4FPCA 1DGLA 2PLV1 2JDHA 4GD4A 1CZTA 3MV11 5F2SA 3NJVA 5JZGA 4Z92B 1AYM2 1QWRA 2R071 5A7OA 4COUA 4DFSA 5I93A 3EQEA 1E5IA 3DV8A 1F2NA 4ZS3A 3ZFFB 2WQ4A 5I0SA 2ZAAA 4CU8A 5C3SA 2X53S 1N1TA 4NRMA 3VD3A 2JDZA 1Z7S3 2YDEA 3PVEA 5BNOA 2W2IA 1DQ2A 5FDBA 1DQ0A 1YUDA 2IXCA 2RJ2A 1PMIA 2QQMA 4FFHA 2UURA 4LJHA 3LE0A 2BNMA 4CDWB 5CAZA 2BERA 5GJ6A 1GNZA 4XFHA 4BA6A 3JB4C 2VE1A 3LDRA 1CIYA 3JU9A 4IEPA 1YQ8A 4XXPA 2WUHA 4FXKB 1V0AA 3PJQA 2Q1FA 1R081 1S0IA 2EIDA 1DGWX 4XUOA 3J8F1 1VIWB 2XBO3 2WNVA 4SBVA 3S57A 1O4TA 3LEKA 1PO13 1VBC3 5EYXA 4AQ2A 2HWC2 2F17A 4ZPIA 3SNMA 4QX8A 4TXWA 4XHXA 4DMIA 2VZQA 4QD2A 2D93A 3WF3A 3U37A 1ZBE3 1BYHA 2YC4A 3SLIA 1OLME 4QKNA 3V0AA 5JOZA 3C7GA 5GLUA 1H8TB 1TNFA 3ECQA 3B94A 4KI5M 3WHUA 1W6OB 4LMFA 3Q9OA 4Z8BA 3VZLA 1ULFA 3FLPA 3FHAA 4XE9A 1VBD2 4QGLA 3Q8AA 3WF0A 1LNSA 1POQA 1SLCA 1HQWA 4NWWA 4V1PA 5AFEA 4QGMA 2XKPA 2FBEA 5L7OC 5FV3A 4AXOA 1CPNA 1PM4A 5KHHA 2WC2A 4BQ2A 5C9AA 5F9TA 5L9RA 1JXNA 2BEOA 2OIIA 2Y6KA 4JC1A 4XJUA 3MIDA 4GAZA 2E32A 3H3UA 3N7LA 4MADA 2VW0A 3RWKX 3ACGA 5FPBA 4D6QA 2RE9A 1EUTA 2RS32 3KCYA 4OFGA 2C0ZA 3CBNA 4LULA 1FMD3 3HVDA 3ZXEA 4KG8A 5A7NA 2HEWF 4RGGA 4KWJA 3VBUC 2PAKA 1OLRA 2MHFA 4K6BA 2FMYA 2HWD3 2JKXA 1NXMA 3ME2A 1O3QA 1V6NA 1ASJ2 3KVBA 3LA3A 4Q0PA 3N7KA 1H1AA 4X6QB 2JDPA 3KHBA 3U10A 1W9SA 2HBUA 5JIUA 3LAGA 1WCDJ 2J1AA 2Z79A 2FZ2A 1RVF1 2X5IC 1VLNA 5FZLA 3ILNA 5IFPA 4V2VA 4WM7C 3S5QA 3ZN6B 5FZOB 1QDCA 2VH9A 3VLBB 2HWF1 2PXJA 3KF5A 5F5AA 3PVNA 1SCSA 4RHV3 5FWJA 4WV8A 3VBOB 3NSTA 3ZDSA 2CY6A 3FUQA 4M00A 3T09A 4E8DA 4EQVA 4GKXA 1BQPA 1XE8A 3O1PA 2ILMA 4NJ4A 5JXGA 3ZMOA 2ZABA 1CAWA 1JN2P 1SBDA 2VZPA 4XXAA 5FMOL 3TN92 4AAPA 4DO0A 4Q4V1 5A3TA 4ZZ5A 3K48A 4O65A 5C3RA 5E1RA 5DZFA 1ULCA 1H2KA 4KBZA 2VTFA 1JUIA 1DQ4A 4RSUA 2WIIB 4DXZA 1VBB3 2BFUS 2A6ZA 5C71A 1TME1 1ULGA 3LOIA 4FPJA 4BE3A 5A3UA 4FPLA 2F4PA 1JHNA 1NYWA 3FZ3A 1YI7A 3RYPA 3RZGA 2ZMNA 1YO8A 1L7QA 1GZWA 5H9SA 2E7TA 5GALA 4URAA 3I59A 1YIPA 4I3GA 1QIQA 4B4PA 2A71A 5CFDB 2BNNA 5JIAA 1E5SA 2C1FA 5I91A 3OBTA 1C4RA 2AR6A 1IGOA 2VZUA 5LBFA 1JZ4A 3IN9A 4EYUA 5LA1A 4QX3A 1QJX1 3KMHA 3H1WA 4COYA 5C33A 1GWMA 4QQHA 1YIFA 5J1XA 3PU8A 3VDDC 5CIRA 1IPKA 5DZEA 5A3PA 5B2GB 1PM7A 1VMJA 5L7OA 2IFRA 5T5PA 1MVEA 5GLVA 3TOJA 3VKLA 4D6RA 1PO12 3M1HA 1VRH1 1IS5A 1JMUB 1NCQC 1RHI1 3AFKA 3GM8A 3M70A 1RUD1 3UK9A 1US3A 3ZYBA 2P3KA 2K0GA 4AVSA 2ZHNA 3RZHA 3APBA 5JOXA 1YC61 2RM21 1ZBE2 1OFNA 4QDSA 3ILFA 2BOIA 2K9ZA 1AXKA 2J1UA 1W0NA 4UFIA 2J1VA 4XYXA 1HJGA 1FI2A 3C7OA 4Q0SA 3WEZA 3DN7A 4H55A 1GR3A 4MVTA 3VBUA 5CVRA 4E4HA 4PDWC 5IUQA 3SKVA 2DVBA 5FPVA 3WW1A 4BQ3A 4MXWB 1YXWA 2RHPA 5FMBA 3HT2A 5DMYA 3R6SA 2P17A 3BIEA 4YZ4A 1WW5A 3R4SA 1MZFA 4EN6B 4NAMA 1H2NA 2H0VA 4P5HA 3VUOA 4TLGA 3ZSMA 2VUCA 1T6GC 4QX5A 2Y6GA 4CPBD 4M3CA 2X5IA 2YGLA 3I97A 4EWEA 3B69A 4WM7A 2VBBA 4FCAA 4XUQA 1QQP1 3EJKA 4Q1PA 3UGHA 1AXZA 2VZSA 3P5BA 3K77A 4Q1RA 1DU3D 5FYSA 3IMNA 4AEMA 1AR62 1RUC1 3V0BA 3WDVA 1W0PA 1FMD2 1JS9A 3FX3A 4WVVA 3MPPG 4COZA 3WP6A 5LATA 4XCBA 2WYFA 1QJU1 3HEIA 3PVOA 5FZKA 5FP3A 3KHCA 2HWD2 1CR7A 3AMHA 4Q4X2 1WZXA 5JPNB 3WQ7A 2ZHMA 2CWMA 5ACA1 5LZ6A 3U0ZA 2BGPA 3UNPA 5C6CA 4FPGA 5FYBA 5KR7A 3ETPA 5IK5A 3ITQA 2ZX4A 4C8DA 4QWNA 1NG0A 5E8AA 3RZMA 1SFNA 4YG0A 3T2TA 2RS13 2GZWA 2YV8A 4Q0UA 4OI2A 1VMHA 4BDVB 4AE2A 2ORZA 4AVVA 1PZ7A 4XQWA 1RITA 1DFQA 4C91A 1CVNA 1J1LA 2I45A 4AGGA 1EAH1 2BYVE 2DVFA 4B4RA 3POGA 1VBA2 2NM1A 3RS6A 3OY8B 3ES4A 4GULA 4HONA 5FUIA 2HWE1 4WVMA 2LTNA 4QB6A 1MS0A 4AZZA 5ABJB 5LA0A 1B35C 5F5QA 4LOSA 2HBTA 4WBBA 4JHTA 3HMYA 1HRI1 2CL2A 2PHFA 4IE7A 1O3SA 4FFIA 3H42B 2PQSA 1SLAA 4Q27A 1UU4A 3CLPA 2PELA 2ZOEB 1LTEA 4W6WA 1VBB2 4IEVA 1NA1C 2D3SA 2E26A 1O5LA 1AR83 4KG0A 1PK6C 2OZ6A 3WG1A 1IG3A 4OI4A 4GMP1 4Y4RA 1JZ6A 2MNGA 2WA4A 2XONA 5T5OA 2V5DA 3SCFA 2DBNA 3N7MA 2Y6HA 4RS5C 3WUDA 4MG2A 4CRQA 4MZUA 1KRIA 3J4UH 1OMIA 3LB9A 2ZJCA 3OG2A 3BI3A 3A0KA 4LUMA 4WM8C 4XTMA 2Q8CA 2EIGA 2VNVA 3FLRA 3IM0A 5KHIA 2PHTA 3LSEA 3T2QA 4UW4A 1V6IA 4E4ZA 1IQAA 1H8VA 3OUJA 3PTRB 3VKNA 4XABA 4YGDA 1QNWA 2EIBA 3WP5A 4KWUA 2YC2A 3PTYA 4ARXA 3KZ4C 5CG9A 5FZ3A 4K20A 1SEFA 1OVPA 1KQRA 3LEMA 5DUXA 4LKEA 1XU2A 4QPGC 5FZ1A 3ZVXA 1GV9A 4XW3A 5FRAA 1ZREA 3LFIA 4ISQA 1PGW1 5FJHA 4IUGA 1NCRA 1RB8G 1VMFA 1NAEA 1NX9A 4CYDA 1HB2A 4JCKA 2FDJA 3F2ZA 1XE0A 2ZMLA 4I0BA 1MQTC 1S55A 4MXVA 1EP0A 4F7ZA 3WDXA 3WDWA 2BPA2 4AHZA 4CDWC 3PL0A 4LEJA 2R041 3RZJA 4XMIA 2QKDA 3I3BA 4KQ7A 5CFCB 3I3MA 1WMXA 3ZSKA 1ZRDA 2PHWA 2OUJA 2VU9A 3LDKA 1RUI1 1ZZCA 1ZZ9A 1AL21 3N3HA 1W06A 5EYYA 3WG4A 2QQJA 3EHKA 4CP2A 2OVUA 3AYAA 5J37A 2JE8A 3IT8A 2HEYF 5HPOA 2Y34A 4META 1RUF3 4XURA 4KL1A 1N3OA 2UWBA 4IQPA 4TLFA 1U5IA 2Q1MA 3CDZB 4XFIA 4LHNA 1WA6X 2C5DA 2QTWB 4XUPA 1CWPA 4L11A 5KXBA 5JI7A 1N1SA 2R072 1AR91 1Y3TA 3ASIA 3N9PA 4K21A 5EPAA 5I8SA 3T2OA 2D40A 1O8SA 1IPJA 2B7YA 2V72A 1LU1A 4DPNA 4L8QA 3WF2A 1Y9QA 3AKPA 4GA9A 3AK0A 3ENRA 5JXHA 4HSLA 4QXKA 1B35A 2J1SA 2W47A 2C4XA 3VDCA 1HQNA 3D0SA 1IPSA 2B46X 3DYOA 4N43B 4DUVA 5L36A 3RZLA 4AEKA 1GZTA 1JU4A 4FPYA 4DRRA 4U2AA 1QJX3 4BK5A 3LOBA 1NA1A 3JBG1 5A6QA 5F2WA 5A7WB 1OQ1A 1PK6A 1WGPA 4FFGA 2RS12 3MLKA 1EV11 4FOVA 5FLHA 1LEMA 1R082 3OF1A 5GZFA 2G1MA 2WAAA 2QUOA 4Q8LA 3J8F2 4JGYC 1DP0A 2JDUA 5FK7A 3CZUA 1SLBA 2JEMA 3WINE 1LKNA 1VRH3 4L9BA 4W50A 5HCFA 3OGRA 1SMVA 1XRUA 2ARCA 3MBWA 4Y20B 3O1RA 1AR73 3R4DB 4WM8A 3VL8A 1G8WA 1J3RA 2BUKA 3V64A 3RZKA 1NE6A 2RM23 4NUBA 4BISA 2FDFA 4CUAA 5J3UA 3GHMA 4LORA 5FZGA 2ZGSA 3USUB 2RMU3 4XOGA 5J48A 1U5YA 2FMDA 1LOAA 2EXJA 4HN1A 2JWPA 1VAMA 3W20A 2WNOA 4M4PA 4NHXA 4LXLA 3VBFC 1AR82 4OI1A 1S0EA 5A80A 4GH4B 3ZFFA 4QPGA 3MLLA 1NZIA 1LEDA 2JX9A 3GF6A 5AC91 1FX5A 2GC2A 3WT3A 5IK8A 2J7MA 1YQCA 4DNYA 2IXKA 5F3IA 1FPN1 4COVA 4RQPC 1MQTA 1DYKA 4CDWA 2WINB 4D7YA 3OEBA 2VZVA 2W46A 1W6PB 1W6MA 4ZS2A 1CX1A 5FQ0A 2VNOA 3M8LA 2BTVC 1QQP3 4D94A 1U5ZA 3H8XA 1QXPA 3I2OA 1STMA 4XFBA 5FCCA 1RUC3 3VDBA 2TBVA 1MEC3 5KC5A 4OMDA 3MIGA 5FO7B 2FD8A 1YI9A 2G9GA 4LBMA 2P3IA 1CQ9A 1RYYA 3WCRA 3T1LA 3IMMA 4DRVA 2QQNA 1MZ6A 1WCUA 2EXHA 2ZHKA 4P9IA 4YW6A 1POV3 2ZGPA 5EQUA 3ZFGB 3ZXDA 4CUGA 1UYPA 2WNUB 5ACA3 2EAAA 1HN1A 1RUOA 5CFDC 4QXCA 4Q4Y1 4ASKA 1UU6A 2UU8A 2ENRA 2WLPA 5I8YA 1W6OA 5F6KA 4AQTA 2D43A 3W5NA 1UF2C 1REDA 1XYPA 2IWGB 2W39A 3POJA 1RVF2 5I0RA 5JOWA 4DUWA 1E5RA 1X7NA 2WAOA 2XGXA 2OX0A 5T52A 3TWIA 4BXSV 1EAH3 2HWF2 1HLCA 4QMAA 1DYPA 2Y33A 2QQIA 5D2AA 1YEWA 2PA7A 1ZA7A 4LBQD 1NXD1 4YW5A 4Z82A 3ILRA 5FUNA 1IHMA 1ZRRA 1LU2A 1DZQA 1H6XA 3WDUA 2DVGA 1BVVA 2CNAA 2WS91 3AKQA 4Q4V2 4FPKA 2QVSB 3EB7A 4XAEA 1GOHA 2WN2A 1ODNA 1RUF2 2ATFA 2W1QA 2Y6JA 2ZHLA 4UBHA 5BNNC 2GN7A 3HAGA 3E97A 3WVJA 2E33A 2BQPA 2VR4A 3FL7A 1TME2 3ZN5A 1ZYBA 1IQDC 2UYBA 5FP8A 4HETA 5A32A 1VBE1 2RS51 2BW8A 2WLQA 2ZGUA 4K1ZA 4XACA 2NYYA 3PUHA 4YGEA 2DFBA 5DUUA 3VHOA 5F3GA 3ETQA 4COWA 2A3YA 2D6LX 4X8NA 4FTBA 2XQRA 2VC9A 2NLRA 2PMWB 2KXLA 3JCIA 4RR3B 3RSJA 5FOBB 4BQWA 2YFZA 2BGOA 2AC1A 4GALA 2JENA 1VALA 1W6NA 1AYM3 1GU3A 3ZKYA 3PUSA 2VQUA 4WVWA 3K46A 2VCCA 4CPBA 5E88A 3ZFEC 4XCAA 2Y64A 1K5JA 2GP5A 2OPWA 5FY0A 1QJX2 4P9JA 1OURA 1QXRA 5DZGA 3VBFA 4CDXB 4LKSA 3HNMA 1ENXA 1NLRA 3ZN6A 3DUIA 2A70A 3IAQA 5FZOA 4YZ2A 1T6BX 3VBOA 4I0WB 2YG0A 2EVXA 1PVC1 1AX0A 2P4EA 4NRPA 2XJTA 2ZAHA 1C5HA 4NPLA 4RQPA 1VRH2 4W6XA 1TG7A 1ULEA 1ZBA1 4FP3A 4CDUC 3I2JA 3NJZA 3O0XA 3KB5A 3N9QA 3C8XA 2AENA 5J09A 2YFUA 1OA3A 4MGQA 1CAUA 2RM22 3Q8BA 2EAKA 5FZMA 5C3QA 3U11A 5JZGC 2WSVA 1SACA 5IFTA 1S2EA 4AHWA 1JYVA 3LZZA 2HWC3 2OT7A 2R043 3B5LB 1MZ5A 3V56A 5FMDA 3CJIC 1J59A 3QCWA 2VJXA 1RUG1 4CXWA 1BKZA 4DY3A 1LR5A 1RUI3 5KHJA 2WO3A 1AL23 2O8OA 4L97A 5C8CB 2KM2A 1JYCA 2Q30A 2VAUA 4QT6A 4C90A 1QOSA 1U5XA 5FXXA 4BPZA 2HH9A 5CFDA 2ADDA 4AI0A 3D4KA 4AEJA 1KITA 4HLTA 4OUMA 2ZZJA 2WO1A 3VBSB 3DXUA 4AF9A 3MF6A 3ZYGA 4AFAA 4PJYA 3B9CA 2BFUL 2VUDA 4P14A 3O5SA 3H8OA 5LWBA 1QQP2 3I49A 5HCAA 3PURA 2VQ0A 2FHRA 4GJZA 4YVWB 2DTYA 1RUC2 3E6BA 3G6JB 4QPIB 5HXVA 1SDDB 4L92A 3J9SA 2P34A 5D1IA 1IOAA 4LHKA 4J6GA 4UFJA 4N7UA 4BM8A 4D0QA 4CEWC 5M0TA 1QJU2 2C6SA 2FQPA 2YBKA 3QOPA 3WP4A 2WSUA 1WUVA 2LUWA 3VD4A 4LPLA 5ACA2 5BNNA 1G9DA 3VZJA 1RGSA 2CDOA 3WQ0A 5I0DA 1HV0A 1YQ5A 3N36A 3D0JA 3JBG3 3ON7A 2GNBA 3B01A 1PMJX 2D5FA 1GP4A 1F5FA 1LHVA 1VPHA 1EV13 2E53A 3WF4A 3ZSLA 3RZZA 4LBNA 1ASJ3 1Z0HA 4XFGA 5GLWA 4BLIA 4OHYA 3VDAA 4A3ZA 1Q8QA 1VB4A 1EAH2 2WWUA 1V6MA 3NMBA 4OULA 2BVBA 4IE6A 3BPZA 3VHRA 3PUIA 4CCKA 1ZA4A 1LECA 1LJ7A 5F3EA 4EE2A 3AP9A 2FDIA 5K9YA 1GKBA 1K3IA 1I5ZA 4Y4YA 2VW1A 2XXZA 4G4FA 4XDQA 3UYJA 3ZX7A 1LOBA 2GDFA 1UY3A 2JE9A 2Y38A 1G6NA 4CP9A 2XLGA 3AMQA 1YFWA 3NV1A 3PIJA 5SV5A 4CP1A 2LS6A 1UXXX 5LASA 4QX7A 5GZEA 1JZ2A 1V6KA 3THDA 3L9JT 4PIZA 3HR9A 1LGBA 4QAWA 3UKVA 4HT1T 2NPIA 4DZGA 1GICA 1W0OA 3B3QE 5LBBA 4AL9A 2Z42A 5F5CA 3ZKUA 3PLQA 1SQ4A 2GSYA 2Q8EA 3TNQA 3LCPA 2YBPA 1J84A 3MUY1 4CDQB 4QXBA 3O0VA 4Q0QA 1X82A 2WRAA 4UYBA 1AYN1 2C9KA 3ACIA 3OEAA 3CJIA 1BMV1 2ZX0A 3WDYA 4EWDA 1CONA 1A3KA 2X29A 5A3WA 2A5ZA 4CCOA 2VZOA 4YGBA 4YG3A 1GSLA 3GBWA 4PI0A 3U75A 4ZKTB 4OQ8A 1W2OA 1JW6A 2H6CA 1ENRA 3ZYPA 2AYHA 1XSRA 3AZWA 4QXHA 3ZYFA 3A21A 4PIXA 4A44A 1PGW2 3LQCA 1BK1A 1KD7A 1YFUA 1SLLA 4I3PA 1OD5A 4Q4Y3 4BQYA 1G9AA 4XBNA 1JYIA 1AX2A 4JKMA 4D69A 1SPPA 3T4HB 1V00A 2WABA 3BYWA 4CCNA 1XNTA 3BN6A 5LCWL 3OD0A 1W6QB 4DIQA 3UJOA 2W94A 1FOD1 1HV1A 4LITA 1NOVA 1CAXB 1UQXA 2R042 4QQPA 2Q5TA 5FK8A 3DCQA 5FZBA 4CEWA 4QKBA 1AXYA 3GZAA 2SBAA 1RUI2 1AL22 3PDQA 2JB8A 3T4VA 3U1XA 1PX4A 1HB1A 1OHFA 1I9RA 3AB0A 5JCTA 1GP5A 2JJ6A 1QY4A 3WQ1A 1FV3A 2QBXA 4XF0A 3BPSA 4FTSA 2Z69A 4L0PA 1LCLA 4JGZB 3ZYRA 3NVCA 3H8UA 3PU3A 3NJYA 1YLLA 4JQTA 2RVAA 4PBOA 3I3DA 1D4M1 5LB6A 4LE4A 4AEDB 2RS53 1AR92 4ES8A 1MS4A 4XF1A 1ND2C 2HEVF 5FKCA 2ZGOA 3QD6A 2O8QA 3D8CA 4OLLA 3KV6A 3FUOA 2JICA 4XFAA 5CKMA 3AX4A 4B7KA 4HXCA 4IV3B 1DGRN 1GQHA 2F6BA 3GJBA 5DG2A 3HD8B 2ZACA 2YXSA 5FPZA 5D8AB 5A1AA 3RMXA 1AR63 4OYUA 3WX5A 5C4WC 1AF9A 2VBPA 3ZSJA 2LALA 2VOKA 3JBG2 4OHXA 3ZMNA 3DPRC 2R30A 4LK6A 5DUVA 2WJSA 4KBBA 5FYCA 5FZDA 1EV12 2VD7A 3EO6A 3BCWA 3MDPA 4Q4X3 2ZGNA 1NT0A 4G3YC 4HN0A 5FZ6A 4FOWA 5GZDA 4KMQA 1H9PA 1FXZA 3NAPB 5CZKA 3VL9A 3GCXA 2P6CA 3ZXFA 1ZBA3 2X10A 2IXIA 4YYOA 1C28A 2R0HA 5DUWA 5IYYA 2Q1ZB 2EXKA 4BK4A 3NWKA 1OF4A 2WNUC 1O4ZA 1E57A 4NO4A 2AZ5A 2XJSA 1XE7A 5DAXA 4Y1VA 4BH9A 1LODA 5BNPC 3FFQA 4R4XA 1LGCA 4MGKE 3HOBA 1VBA3 4J25A 4XETA 1YWKA 1C5IA 3WHTA 2P1BA 4XBQA 2XDVA 2DUQA 2VVFA 2YYOA 2BJSA 1FAYA 3B02A 4AVCA 3FBMA 3FLTA 4PLOA 4M3CE 2YPJA 3UGGA 4LBQA 5AC92 5FJKA 5G04L 1C8M1 4N53B 1F8VA 1UAIA 4Y1ZA 1LGNA 3KVAA 4QKFA 1FPN2 1TNRA 4PQQA 4RYDA 4GWJA 4B3NA 1N1VA 2DU1A 4ORFA 4GKYA 5KXDA 5FYIA 5A7WA 1GYKA 2JG9C 2E7QA 5B4NA 3RNSA 2G9ZA 1DGWA 5JSPA 2E7AA 2QQKA 1EPZA 4LT5A 5C5UA 1Q56A 1XNKA 1XNAA 5L19A 1G9CA 1RUH1 1OKQA 3ZXLA 2Q8OA 1JH5A 2WFPA 1QDOA 3VN4A 2ZTNA 5F37A 3TNPB 1L3JA 4UW5A 4Q8KA 3QACA 4C1XA 3WLUA 2IXHA 2R16A 5J98B 2HKXA 4UXAA 5A33B 4LQRA 2VMEA 1UN1A 4Q4Y2 4IESA 3WP3A 4DINB 4CU7A 1JZ8A 3MFCA 2VZ1A 1MACA 4M0HA 1I3HA 5EV7A 1TEIA 1ND2A 2GP3A 3A0NA 2XUEA 3ZOIA 1K5MB 2GNTA 3M4FA 5DAWA 4CDXC 5A7PA 4WVZA 4YW1A 1UPSA 3EMRA 1NLSA 3R0RA 3ZXAC 2WQZC 2YZ4A 5FLJA 5JWPA 4P02B 4NR1A 3V65A 3O14A 1M4WA 3M3IA 4UF0B 3ST7A 2PHUA 5F32A 3U4SA 3OGSA 4QHZA 5C4WA 3BU0A 3WR0A 4I01A 1VR3A 4OHZA 3AFGA 3TB0A 1TVGA 1LESA 1W9TA 2JIJA 3DPRA 2OW4A 1BEV1 3HNBM 4AVAA 2UWCA 3NQHA 5LY1A 1LULA 2RG4A 2V73A 2G19A 1SG3A 1X33A 3HBKA 3GXUA 1W05A 2VCMA 4CEYC 5KC6A 4Z1VA 1K45A 2D6OX 2RS52 1GLHA 4N7IA 4XJ8A 2UY8A 3MIBA 3PIGA 3D82A 3AVRA 3WG2A 4MH0E 1NCRC 4K9SA 2YUEA 4NHLA 2DCKA 2WNUA 4ARYA 1W8UA 4Y1XA 1RUE1 2PLV3 5HV0A 3GNEA 1ODMA 5BNPA 4IV1B 4E27A 2BVVA 2A7AA 2R073 3GCWA 3JD71 3VBHB 1UYYA 2FCVA 1RIRA 4S2FA 4YM2A 5IVCA 4FTEA 5TSWA 1AYN3 5FAXA 4LA3A 1M06G 4XUTA 4YVSB 2JG8B 5JMCA 2ZGMA 2VUJA 4AW7A 1MS1A 3RRDA 4HFSA 1ENSA 3NNMA 1ND3C 4AVTA 1UX6A 2I74A 4CE8A 2VMIA 1ST8A 1U12A 5EZWA 3ZN4A 1F15A 1UCXA 1PVC2 1ULPA 4OZOA 4HANA 1OOPB 4OHWA 3SEEA 1I6XA 2QQOA 1FATA 1RTVA 1AZDA 1CJDA 1J3QA 2WT0A 2XJUA 2Z5WA 1ZBA2 2ZGQA 3MW3A 4CA9A 1R083 3ACFA 1DQ5A 2JDNA 2JG9A 3J8F3 1GUIA 3W9AA 2QQPA 5JOYA 5CBLA 3KCCA 2XVGA 2PQQA 4P9YA 1WMFA 3AMPA 2ZEYA 4QM9A 1FOD3 3CU7A 1JYWA 4NIDA 4HSJA 4YW2A 3OYWB 3RYRA 3VBRB 4GXLA 3SCGA 4IEXA 3M7AA 4ZU5A 2R061 3FHQA 4NHYA 5EFUA 5JPMB 3RMYA 5AFBA 4YRDA 3R4UA 5T54A 1LRHA 4IEWA 5SV8A 4H7MA 3PUAA 2A6XA 4MSVA 4BMBA 1W9WA 2E31A 2Y60A 3AKSA 1XYNA 3OB8A 2XJPA 3CQOA 4M4RA 4ZY9A 2JD9A 3KGZA 4Y5SA 1YHFA 2DTWA 1UY2A 2WA3A 3KM5A 5BNOB 3UKNA 1UZYA 3IB3A 3ZM8A 1JYTA 4CDXA 4B1LA 2D3PA 4ZHNA 4FAHA 4OZXA 1BK0A 1W03A 3MW4A 5C7GA 2CHHA 2QQWA 1BBT1 3AC0A 4E4DX 2B4KA 5EWSA 3DF0A 2QZ2A 3I3EA 5T3NA 3QH7A 3J7HA 4TZDA 3IBMA 4LLFA 1YJKA 1OXCA 2WNVB 2OKXA 4M01A 5LA2A 4A2UA 2OUHA 5JR2A 1LHNA 1OUSA 2DCYA 4PIYA 1NE4A 2DURA 1SFPA 4BB3A 4XFCA 5FXWA 4AGRA 1W8TA 1PZ9A 4TTGA 2TUNA 3AYCA 1GWLA 1H0BA 4K8FA 4EWAA 2AEZA 2MPFA 1S0DA 4AI9A 4CEYA 3BTYA 2D6MA 1OH4A 5FBZA 3ZFFC 3BALA 2A6VA 2BGCA 2XHKA 3V0AB 2GU9A 5T5JA 2KR2A 2VL4A 1RJ7A 3J26N 5FUPA 3NO8A 4NN0A 2IC1A 4LLOA 2J1EA 4W6YA 5C8WA 1HX6A 3POWA 4P00B 4FI9A 1WW4A 1RVF3 2VGDA 5LK5A 3O1VA 2W91A 2A75A 3KLSA 2W68A 4XJ9A 2HWF3 4QHBA 4UBGA 5C9AB 4HVQA 2R32A 4LIUA 3NNGA 1AJOA 1ND3A 5FZ9A 3VHPA 4UW6A 1X9PA 1UD1A 5GKAC 3RG0A 3WNNA 2BBAA 1DIWA 1TE1B 3AJZA 3AP4A 3NNJA 1LHOA 3KV4A 5FP7A 4V2WA 1C1LA 3B93A 4Q4V3 4XHBA 3E6CC 3P3PA 3FFZA 4Y1YA 5LBEA 5DDJ1 4GWMA 1C8M3 3POBA 4AGVA 1XNCA 3FJSA 1H6YA 4P9WA 3ES1A 3NW4A 3KT7A 4I0AA 1TME3 1UO9A 1YJLA 2RR11 4N90A 4DY5A 3W58A 2XVKA 1H8TC 2PLV2 3CL1A 4Z07A 1XU1A 1DCSA 3JUUA 4HVOA 4AQSA 1BXHA 2DUOA 2WDBA 2DUPA 3QH6A 1C8NA 3D5OA 4YLZA 3ZPYA 1AYN2 4XC9A 2E63A 4QX1A 4FSJA 2QNKA 1J3PA 3AKRA 2YHJA 2XJVA 5FBJA 5FY9A 4AHXA 1A78A 3RGBA 5DAPA 1QJY1 2ZCWA 2XH6A 4R8HA 4XMAA 2XWBB 5EJ3A 4EZHA 1S0BA 1ZM1A 3ZPOA 3W21A 3OUHA 2WKKA 2DDUA 1OT5A 3ALQA 1VBD1 5G05L 3NV3A 3MZHA 1HRV1 4XIOA 4G9SB 1XOYA 1ZVFA 2W87A 1WCSA 2A6YA 1YCIA 2ARAA 4HBNA 3ATGA 1HXS1 3O1SA 2YU2A 5D8AC 1COV1 1CAWB 1UZ0A 3N4MA 1X36A 4DOUA 1S0CA 5FMCA 3LDBA 3RI9A 5A3MA 1OPOA 1GZ9A 1RHI3 3KQRA 3SITA 1FOD2 1YFYA 1RUD3 2VW2A 3SXWA 4LR4A 2JIGA 3CEWA 2IFWA 3MHZA 4AWDA 1U0AA 2RS31 1PGSA 4WZCA 1LOCA 1Y43B 2WYSA 3BOWA 1OKOA 2CGOA 2R6QA 3WCSA 1S0JA 2VZRA 4Q29A 2ZEZA 2K2SA 3WNLA 3KS7A 1HN0A 5LEJA 1HB4A 4BMEA 3I59B 3PNAA 1OD3A 1BEV3 5CKQA 3MUZ1 4LO5B 3VBOC 4Z2AA 1D4M2 3AJYA 1O4YA 4KGQA 5FZ7A 2IUWA 5FZ4A 2DVAA 2EXIA 3IIIA 4PLNA 2W5FA 5FYYA 2FDHA 4JRAA 2HYKA 2WZPP 2A73B 3I7DA 2PHDA 1OLQA 3C7FA 4ZZ8A 2ETEA 4HPKB 3ELNA 1RUE3 3GDBA 4GZ9A 2DCZA 5FP4A 1GOFA
chains in the Genus database with same CATH topology
2BOJA 2BV4A 2XR4A 1UQXA 2BP6A 2JDPA 5D2AA 5A6QA 4AOCA 2CHHA 1OVSA 5A3OA 2JDYA 4UT5A 3DCQA 2VNVA 4CE8A 1W8FA 2JDMA 2VUDA 2JDUA 5A6ZA 1W8HA 3ZDVA 1OXCA 1OUXA 5A6YA 1OUSA 1OURA 2VUCA 2JDHA 5HCHA 1OVPA 2BOIA 2JDNA 5A70A 5A6XA 2JDKA 2WR9A 1UZVA 2WRAA 1GZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOJ A;  2BV4 A;  2XR4 A;  1UQX A;  2BP6 A;  2JDP A;  5D2A A;  5A6Q A;  4AOC A;  2CHH A;  1OVS A;  5A3O A;  2JDY A;  4UT5 A;  3DCQ A;  2VNV A;  4CE8 A;  1W8F A;  2JDM A;  2VUD A;  2JDU A;  5A6Z A;  1W8H A;  3ZDV A;  1OXC A;  1OUX A;  5A6Y A;  1OUS A;  1OUR A;  2VUC A;  2JDH A;  5HCH A;  1OVP A;  2BOI A;  2JDN A;  5A70 A;  5A6X A;  2JDK A;  2WR9 A;  1UZV A;  2WRA A;  1GZT A; 
#chains in the Genus database with same CATH topology
 3H3L A;  3JD7 3;  1OQE A;  1RMU 1;  4NIG A;  1TZO A;  1E5H A;  2WT2 A;  5FY5 A;  5FZC A;  3RJ2 X;  2VPV A;  3D3A A;  1N3P A;  2RDR A;  4P5Y A;  4RFT 0;  5FP9 A;  4EN9 B;  1US2 A;  4H2A A;  2QFE A;  1XQN A;  2GH2 A;  4OUS A;  3MLJ A;  2R7E B;  1VJ2 A;  1ULO A;  1GAN A;  1DF0 A;  2VZ3 A;  1QJU 3;  4UFH A;  4B1M A;  4MX3 A;  2VVD A;  4FP2 A;  3A4U A;  3AXE A;  4DXT A;  2OZJ A;  3AMN A;  3H7J A;  1F31 A;  1VAV A;  3MIE A;  4IEQ A;  2NQY A;  2WL1 A;  4XQD A;  5EP9 A;  4QM8 A;  3SQO A;  5ANQ A;  4FQZ A;  5FXV A;  3T0A A;  1H8T A;  4A41 A;  4QU2 A;  1SZB A;  2CGN A;  1OC1 A;  3ZR5 A;  4XF4 A;  2IVJ A;  4E2Q A;  3AP7 A;  4JDN A;  5CEH A;  1Z7S 1;  1GFF 2;  2WBK A;  3RFR A;  3E5X A;  2PTM A;  1OSG A;  2CAV A;  1JOB A;  1ALY A;  1KDM A;  3EYP A;  4AK3 A;  2WO7 A;  2TEP A;  2W92 A;  4NIH A;  2XKO A;  2HWE 3;  1GQG A;  4GWN A;  4KGG A;  5T55 A;  2VNR A;  4M3C B;  2X5I B;  2HWB 1;  2VTX A;  1UMH A;  1DLC A;  4WM7 B;  3KV5 A;  4KU8 A;  2WZE A;  1HRI 3;  3E6D A;  5ERL A;  4HKL A;  3WNP A;  1C8M 2;  4LNV A;  4N9I A;  3LEI A;  2XBO 1;  4LA2 A;  1MS8 A;  3MW2 A;  3GAL A;  1VBC 1;  3MO4 A;  5D8A A;  4A6S A;  4ATE A;  4BXF A;  5F6L B;  3SC7 X;  4GMP 3;  1N1Y A;  2R49 A;  4XTP A;  1NZC A;  1NUK A;  1BBT 3;  5FZE A;  2B45 X;  3UL2 A;  4XBL A;  2VQT A;  1R1Z A;  5FWE A;  1Y9M A;  1RUH 2;  1S2B A;  1UXZ A;  4P9G A;  4NIA A;  3U78 A;  4CXX A;  1RUN A;  1IZ3 A;  4PT6 A;  1CZS A;  3N9L A;  4RA0 A;  1UX7 A;  2CDP A;  1CX4 A;  3DYP A;  1W2A X;  4S2G A;  4L99 A;  2VMH A;  1DG6 A;  2VO5 A;  3TEX A;  1N3Q A;  1R1A 1;  4WVM B;  1UWW A;  1FV2 A;  5T5L A;  3VD9 A;  3A22 A;  3WSO A;  4LK7 A;  3HWJ A;  1BJQ A;  4RGA A;  1IS4 A;  4HMZ A;  2OS2 A;  5EXO A;  4NII A;  3TEY A;  1L7R A;  1RHI 2;  5KBF A;  2VY0 A;  1RUD 2;  5F3C A;  2BNO A;  1OQD A;  3VDD B;  2QDN A;  4N53 A;  1W8F A;  1X8E A;  3MYX A;  2JDM A;  1OOP C;  3I3Q A;  2QJV A;  2ZXQ A;  2JD4 A;  3H8R A;  4NAO A;  4N8M A;  1NCQ B;  1SCR A;  3OTF A;  1DGR A;  1MS9 A;  1VE0 A;  2Y6L A;  1ZZB A;  2RV9 A;  5DAV A;  5I8T A;  2XPJ A;  2HWD 1;  1BEV 2;  4NPM A;  4EZ4 A;  1AUY A;  1QH7 A;  4BQ1 A;  1HJF A;  3H1M A;  4IER A;  2CSG A;  3OGJ A;  1XNB A;  3Q8C A;  2JEC A;  5FY4 A;  5FYU A;  5DAB A;  3WW3 A;  4DXS A;  1PMH X;  3W59 A;  5ABJ C;  3M2M A;  2ZKN A;  3C7E A;  4PDW B;  2JKB A;  2XWJ B;  1GNY A;  2DF7 A;  1W2N A;  4EN7 B;  2RR1 3;  2XQX A;  3LSD A;  1O59 A;  1RUE 2;  2ARE A;  2DCT A;  4RHV 1;  5FYV A;  5FZF A;  5A33 A;  1IKP A;  5IJR A;  1POV 0;  5ISL A;  3JD7 2;  4CCM A;  1AR9 3;  2V5Y A;  2W52 A;  3HQR A;  3OPW A;  4JDO A;  1KS5 A;  1FYU A;  5HBA A;  1GP6 A;  2VMC A;  2LRP A;  3NKG A;  4IEU A;  4XQ4 A;  1XC6 A;  2E51 A;  3IWZ A;  2D3R A;  1AHS A;  2XLF A;  1QJY 3;  3H1Y A;  4MGZ E;  4F3J A;  1W9F A;  4HK9 A;  3E1F 1;  5E16 A;  2VMD A;  5K4L A;  1BLZ A;  2ZGL A;  3UET A;  2GND A;  5F5I A;  4Y24 A;  3Q8F A;  5EHD A;  3I2K A;  1HRV 3;  4MUV A;  2P3J A;  4UF0 A;  5FYM A;  2LM3 A;  4IE0 A;  1HXS 3;  4BYY A;  4J1W A;  3RWN A;  4CSW A;  4D7T A;  1Q5O A;  1R09 1;  1COV 3;  1NQD A;  2BWC A;  2ZPX A;  4MXW A;  2BRT A;  1DZR A;  4X6R B;  2CGP A;  1B09 A;  2AEY A;  1QF3 A;  2HWE 2;  3F95 A;  2ZGR A;  4JDM A;  3POY A;  5A3L A;  5FO8 B;  2R06 2;  1UZV A;  2RJK A;  3BGA A;  1JOP A;  5IAX A;  4P08 A;  5JAX A;  1VRB A;  2VQA A;  4R9A A;  5K8S A;  1CPM A;  1HRI 2;  2BU9 A;  2PHL A;  5DN2 A;  5JI9 A;  4CXY A;  4YW7 A;  1ACC A;  2BWA A;  3DGT A;  4PF5 A;  2IXJ A;  4BZ4 A;  2EA7 A;  4Z2W A;  5FPX A;  1O3T A;  5A3N A;  1B35 B;  3KV9 A;  1JU3 A;  4YVS A;  2UY9 A;  4Q4W 1;  3NJX A;  3OBR A;  4RFR B;  4TN7 A;  5AC9 3;  5CFC C;  3LWC A;  1DZT A;  3WDT A;  4YAR A;  5I0U A;  1FPN 3;  5H9Q A;  1GOG A;  2P5B A;  4PCR A;  1BBT 2;  1NA1 B;  4RD7 A;  2W08 A;  5KXE A;  1PK6 B;  1OOP A;  4JV4 A;  1I5P A;  4PQ9 A;  3J7M A;  4CCD A;  2NMO A;  3MIH A;  3LGR A;  1WLT A;  1V9U 1;  4E2S A;  1CAV B;  4LUK A;  2VEC A;  2PN5 A;  4RS5 B;  1KJL A;  4P9X A;  3K4A A;  4XFF A;  2QQL A;  5J96 B;  2B42 B;  1DLL A;  4GIQ A;  2ZZQ A;  2OQ6 A;  2R1B A;  5DQ0 A;  3J7L A;  4K3U A;  1WLD A;  4IGP A;  3HT1 A;  1W8W A;  5IVB A;  3THP A;  3OY8 A;  3LD8 A;  4CCJ A;  5K0U B;  3KD4 A;  1CIW A;  2ARB A;  3KF3 A;  4O7X A;  3X29 B;  5ABJ A;  3O1O A;  1KFX L;  4XPV A;  4YM0 A;  4H7L A;  2Q4S A;  4XJA A;  2C9A A;  1F35 A;  3HPN A;  5APA A;  3BKZ A;  1UW8 A;  1WBL A;  2XVL A;  4N43 C;  5FR3 A;  2VBD A;  4Q5O A;  2V4A A;  1UY0 A;  2JDK A;  2QQU A;  5A6X A;  1FNY A;  4KWK A;  4QPG B;  3GBG A;  3GZT B;  4AQ6 A;  4UI9 L;  4E9K A;  1JHJ A;  1D2S A;  1HDK A;  3O12 A;  4C0H A;  1SLT A;  4I2O A;  5HI0 A;  4CUC A;  1DHK B;  1DQ6 A;  2R1D A;  4K7J A;  1EYB A;  4R9B A;  1ZNP A;  1MQT B;  3I54 A;  4D8M A;  5LRS A;  4Y33 A;  4YFZ A;  3BTX A;  3MIF A;  1D0H A;  2YU1 A;  3IPV B;  3VB9 A;  3CNA A;  1RUJ 1;  2HWB 3;  3N7J A;  3EXU A;  1W6M B;  2VOV A;  2WS9 3;  3AZY A;  1LHW A;  3OJB A;  5FQ0 B;  1RXF A;  4A3X A;  1EPW A;  2OPK A;  2RS1 1;  5DDJ 2;  2NN8 A;  3RJR A;  2EF6 A;  4LBL A;  1C57 A;  3VGI A;  4FPF A;  1CN1 A;  5FY7 A;  2RR1 2;  1UKR A;  2XL9 A;  3I2G A;  5CNA A;  2BDR A;  2P6H A;  2ZGT A;  4K1Y A;  2FCU A;  3N9O A;  1KEX A;  2XJR A;  5J36 A;  3M3C A;  1I1E A;  1VBE 3;  2W95 A;  1QH6 A;  4LO6 B;  3UV9 A;  4PLM A;  4D6S A;  5CAD A;  4I30 A;  4Y22 B;  4JQR A;  4QX2 A;  4GH4 C;  4P9L A;  1GMM A;  1SHW B;  4LBK A;  3UT0 A;  1H4G A;  2GAU A;  4MO3 M;  4ZXK A;  1QJY 2;  2ET7 A;  1UNB A;  1D0G A;  3P3N A;  2RJL A;  4CUB A;  2J1T A;  1YRZ A;  2VOT A;  2D5H A;  1AR8 1;  5DG1 A;  3GYD A;  5LY2 A;  4KU7 A;  1HRV 2;  3VD7 A;  4NOT A;  4F83 A;  5IVV A;  3KWV A;  2Y8K A;  3M3O A;  2WNE A;  1JYX A;  2ZX2 A;  1NKG A;  1R1A 3;  1HXS 2;  5CFC A;  5T50 A;  4ERO A;  1PVC 3;  1COV 2;  4IXL A;  3I2F A;  2WZR 1;  1UYX A;  2QE3 A;  1ZRF A;  1DYO A;  2GC0 A;  1PNG A;  4AOC A;  4QPY A;  4B8E A;  4IDZ A;  3K4Z A;  5J7M A;  3I2H A;  2YGM A;  3ZFG C;  4NMI A;  3SH5 A;  2QQV A;  1W8H A;  1OUX A;  4JGY B;  5KXC A;  4OI0 A;  1NY7 1;  2ORX A;  1V6L A;  5IW0 A;  1F9K A;  2JB4 A;  4LBO A;  1GZC A;  5A32 B;  4NVP A;  5IWF A;  5EIY B;  4AFD A;  3VZM A;  3AP5 A;  4R9C A;  2PHR A;  3I2I A;  3DKQ A;  3DEC A;  4SLI A;  3GBF A;  1LOG A;  1RUG 3;  2CV6 A;  4JHZ A;  3RDI A;  1X8M A;  4H3W A;  5A70 A;  2DVD A;  2P2K A;  5GZC A;  2CYF A;  1W6N B;  4XIL A;  1KS4 A;  1VAK A;  4PHZ A;  4XF9 A;  1H1I A;  3P1I A;  2XUM A;  3AZV A;  3TBD A;  4HG6 B;  5FY8 A;  4N43 A;  1PGL 1;  3VBF B;  5HXM A;  2XLA A;  1JZ3 A;  4C1W A;  1XSQ A;  3ZDV A;  3H9A A;  1LOF C;  2GNM A;  4AR2 A;  3N9N A;  2IVI B;  2VOW A;  4ONU A;  2O14 A;  2DU0 A;  3AVS A;  1H1M A;  3RVH A;  1RMU 2;  3VZK A;  4RQP B;  2VXJ A;  5C5T A;  4BCU A;  1IS3 A;  3M3Q A;  5LBC A;  3AYD A;  5CYY A;  3SMH A;  1LAJ A;  1TQ5 A;  3HN3 A;  1PIV 1;  2VUL A;  3ZXJ A;  3NRU A;  1CAU B;  1RUF 1;  2YBS A;  4GB3 1;  1F4A A;  4XVH A;  4JKL A;  4Y20 A;  5FZ0 A;  5FZA A;  4R52 A;  4AG4 A;  1OLM A;  2DWR A;  4UFL A;  1ONA A;  1REE A;  4RR3 C;  3RQ0 A;  1CD3 G;  1WCQ A;  3T0B A;  4L2N A;  3USU A;  4XZP A;  5FLI A;  1ENQ A;  3OOX A;  1PVX A;  1OA2 A;  2QZ3 A;  4W4Z A;  3U07 A;  4AYU A;  2Z4F A;  5GLT A;  1YNA A;  2Y26 A;  3WQB A;  1O91 A;  3S30 A;  1RIN A;  4ATF A;  3C2U A;  1R09 3;  3D6E A;  4B29 A;  2YC0 A;  2W1W A;  2PFW A;  2ZX3 A;  3POF A;  4LTA A;  1O8P A;  1Z7S 2;  2VMF A;  4K8R B;  4Y26 A;  4LHL A;  4GH4 A;  4DEV A;  4BJ0 A;  1LEN A;  3N35 A;  3CZJ A;  3B00 A;  4J1X A;  5IVF A;  2XL7 A;  1QU0 A;  4IEZ A;  1AJK A;  1QNY A;  2KA3 A;  5CU1 A;  2WFF 1;  1UIJ A;  3HBZ A;  5L9V A;  3LPG A;  4EV0 A;  2HWB 2;  1HW5 A;  2WS9 2;  4ASL A;  2FZ1 A;  2IXL A;  1G86 A;  2GMM A;  4ZU4 A;  4HPK A;  5IVY A;  3T1M A;  4ASM B;  1W6P A;  4M0N A;  4XJW A;  4AVB A;  3CO2 A;  3EBR A;  3NNF A;  5BPX A;  2XBO 2;  4R4Z A;  1HKD A;  4CCC A;  2DV9 A;  1W8N A;  4BLJ A;  1VBC 2;  3HJR A;  1MR5 A;  3CF6 E;  1JOJ A;  1Q8V A;  4Q4W 3;  1ZRI A;  2GH8 A;  4QPW A;  1AR7 1;  1VBE 2;  4XJZ A;  1OA4 A;  3M3E A;  2L9L A;  4UW3 A;  5FRE A;  4JZR A;  3VKO A;  5A6Y A;  4O9E A;  5BNN B;  3ACH A;  3UJQ A;  4A42 A;  4QU1 A;  4QQO A;  3WNX A;  3ZFG A;  2RMU 1;  4LHS A;  5C8C C;  1DQ1 A;  1H2M A;  3KT1 A;  3G7D A;  2WR9 A;  4RN5 A;  5KHK A;  3URF A;  4AFM A;  2WWS A;  3WXP A;  3JQX A;  5JMO A;  3MV0 1;  4LKD A;  1G9F A;  2RDN A;  2BV4 A;  5FZI A;  3WF1 A;  4AI3 A;  1V9U 3;  2VM9 A;  3OPZ A;  2MEV 1;  3CHX A;  3VBS C;  1WLC A;  1VB2 A;  3TEW A;  4RL7 A;  4XDP A;  2VCA A;  3SKJ E;  4BWO A;  4DUX A;  4CU9 A;  2B39 A;  1R1A 2;  4CP0 A;  4ET7 A;  5L9B A;  4OMC A;  2D6P A;  4XIK A;  1OI6 A;  3MEP A;  4YVW C;  5E89 A;  1TMF 1;  3ZFE B;  4QPI C;  1QOT A;  1CJP A;  4A4A A;  4XEZ A;  4JAA A;  1V6O A;  1PO2 1;  2F4L A;  3SH3 A;  1WMD A;  3HQU A;  4N9H A;  5H9R A;  4CP9 B;  1APN A;  1LOF A;  3L2Y A;  3SHR A;  5BUV A;  1EY2 A;  4ISR A;  4PI2 A;  3T2P A;  1MEC 1;  3Q8E A;  1F5J A;  4JRL A;  4YWA A;  2GC1 A;  3FE5 A;  5A7S A;  3RYK A;  1LB2 A;  5LK7 B;  2PYT A;  4CDU B;  1XJA A;  2QDR A;  3VKM A;  1QEX A;  3O1T A;  3KT4 A;  3C3V A;  4KWL A;  2AGS A;  3LIG A;  1RUG 2;  1POV 1;  5E6H A;  5K7P A;  3BUC A;  3GHN A;  1N47 A;  2XJQ A;  2YB7 A;  1SLI A;  3IZO A;  3KGL A;  2LW8 A;  4UAP A;  5D21 A;  5JZG B;  1O3R A;  1RUJ 3;  1X9T A;  3FN9 A;  3AZZ A;  5H9P A;  1V6J A;  3VZO A;  4FOQ A;  5JXI A;  4RR3 A;  4U36 A;  5AVA A;  4YSF A;  5A1F A;  4DXR A;  5HV4 A;  3CJI B;  3NKT A;  2ZEW A;  3OUI A;  5IT6 A;  2SLI A;  4AI2 A;  2I07 B;  5IVJ A;  3IDA A;  3WOG A;  3H50 A;  2OXB A;  4KNC A;  3BVC A;  1K12 A;  3LF7 A;  2WT1 A;  2VXR A;  4RHV 2;  3MF9 A;  1D4M 3;  4NRO A;  2J1R A;  5BXX A;  1XB9 A;  2W1S A;  1D4V B;  1XPW A;  2BP6 A;  5FXZ A;  2Q8D A;  2ZX1 A;  2PAM A;  2ZBJ A;  3OGV A;  4DQA A;  4X8P A;  2XB6 C;  5F8P A;  1SPP B;  1WCK A;  1ULD A;  3FMG A;  1UKG A;  1RXG A;  2VOX A;  4NE9 A;  3T08 A;  3W5M A;  5FFO C;  4FPE A;  5FYH A;  2WN3 A;  4LKF A;  3VDD A;  3BIW E;  1QOO A;  4A7K A;  1WME A;  4CVU A;  2QCS B;  2V4V A;  4LIV A;  3VKF C;  1IKQ A;  4LOT A;  5CG8 A;  4JVA A;  1NCQ A;  4CDQ C;  4CEW B;  2DCJ A;  4YM3 A;  3VHN A;  5FPU A;  4PF1 A;  2D44 A;  3WNM A;  1XYO A;  1ZX5 A;  1XXN A;  1R09 2;  3S0M A;  5IK7 A;  2VZT A;  1BCX A;  3K3N A;  1JOD A;  1DBN A;  2WZR 3;  4NWV A;  4MGT A;  2XML A;  3LA2 A;  4D3W A;  4W65 A;  4WZF A;  1KFU L;  5C8C A;  1PZ8 A;  1AYM 1;  3AKT A;  3ZXG A;  2EIE A;  3O7O A;  4A6O A;  2GN3 A;  3AM2 A;  1CES A;  5K0U C;  2ZEX A;  4MGS A;  3I8T A;  1VP6 A;  2ZS6 B;  4JTN A;  1QMJ A;  4PDW A;  5CKN A;  3VBS A;  1UOG A;  1W3X A;  1Q43 A;  5KWR A;  1AL0 G;  2FDG A;  1QKQ A;  1W9Y A;  2JXA A;  5FYT A;  3WZ1 A;  1YQ6 A;  5HCH A;  4HL0 A;  1REF A;  3SIS A;  3I4I A;  3ORJ A;  1KJR A;  4QKD A;  4XDO A;  4QB2 A;  2D98 A;  1OH3 A;  4YVW A;  5FTT C;  4F8A A;  4Q4W 2;  3LKJ A;  4QPI A;  2BOJ A;  2ZA9 A;  5JSO A;  3OCP A;  3WNK A;  1A6C A;  1OVS A;  1LHU A;  2WO2 A;  2ZMK A;  1GBG A;  5JLV A;  2VNG A;  4IE4 A;  4OHV A;  1Y7B A;  4BIO A;  1UY4 A;  2R0F A;  3OGG A;  4LO8 A;  5GLZ A;  3T0D A;  1NLQ A;  3TRS B;  2HWC 1;  3QBQ A;  4K40 A;  3WNO A;  4RGK A;  3WW4 A;  4IE5 A;  2FCT A;  2KD7 A;  1H9W A;  1F4H A;  3BU7 A;  1D2Q A;  3HNY M;  5FMO S;  5JR7 B;  1QXJ A;  4JGZ C;  1V9U 2;  2OA2 A;  1O6U A;  2G9F A;  4FOY A;  3ZXK A;  2X8K A;  4LO7 A;  1BMV 2;  3DL3 A;  4ZU7 A;  3DXT A;  4MHR A;  2WWJ A;  2JE7 A;  4YG6 A;  1YYN A;  4AED C;  5JUV A;  1FT9 A;  1C1F A;  1OPM A;  2Z2S B;  1PIV 3;  1RUH 3;  1RJ8 A;  4XZU G;  5IK4 A;  1UPI A;  4GB3 3;  1Q8S A;  5CB7 A;  4URT A;  2W3J A;  2H0B A;  4A45 A;  4E2G A;  4AI1 A;  5F1R A;  3BOP A;  4S2H A;  3AL6 A;  1SBE A;  5LA9 A;  1JZ7 A;  5LRR A;  3N9M A;  3WUC A;  5IVE A;  4YZ5 A;  3A7Q A;  4FFF A;  4IV3 C;  1W2T A;  4XUN A;  2B8M A;  2Y0I A;  4QDR A;  1FNZ A;  1PNF A;  4JTO A;  3NV4 A;  5F39 A;  1W99 A;  1JTZ X;  3FWE A;  3LFM A;  4EN0 A;  4LBQ B;  4FAG A;  1UMZ A;  4QX0 A;  5IHR A;  3FHI B;  4MGY E;  5JVV A;  3AMM A;  1QJZ A;  2XG3 A;  3PME A;  4Y5T A;  3BB6 A;  5A7Q A;  1S2K A;  1KGY A;  1A8D A;  1W39 A;  4IW3 A;  4O61 A;  2WFF 3;  3NAP C;  1RUJ 2;  4EJR A;  1DDL A;  2CWS A;  2XR4 A;  4QHO A;  5CA6 A;  2I2S A;  2X09 A;  4NRQ A;  5JSR A;  1A34 A;  1S4C A;  3NL1 A;  4HZF A;  1GZW B;  2Q0A A;  1P8J A;  4XAA A;  4CDQ A;  3RPQ A;  1AX1 A;  1ASJ 1;  2PHX A;  2UWA A;  2UYA A;  1CAV A;  3PMS A;  2P37 A;  3P6B A;  4FPO B;  4HK8 A;  4RS5 A;  4BQX A;  1S0F A;  3SH4 A;  1W3V A;  5B4X A;  4AAX A;  1WBF A;  1SDW A;  4BIF A;  3SEP A;  2O1Q A;  2VTX J;  5CIS A;  5JDB A;  5EJ1 B;  5DAQ A;  3ABZ A;  4XF3 A;  2J22 A;  5AVP A;  1XBF A;  4B4Q A;  4E4S A;  5DPN A;  5K0U A;  1BHG A;  3THC A;  1MPX A;  4W8J A;  4A7Z A;  3DEM A;  4OQ9 A;  3MI8 A;  4FXG B;  5L73 A;  1IG0 A;  2ID4 A;  2PAE A;  5DXD A;  4N53 C;  2N7G A;  1WW7 A;  2AUY A;  4CTE A;  1EUU A;  1SFY A;  5L7O B;  1JBC A;  3KQ4 B;  3GJA A;  3T3Y A;  3S7E A;  3ZIX A;  4MYE A;  5LW9 A;  2DFC A;  2AAC A;  4JKK A;  1ND2 B;  5FPL A;  2E6V A;  2MEV 3;  3MPB A;  5FOJ B;  3TN9 1;  4IET A;  3IDC B;  3O1M A;  4Q0V A;  5FYZ A;  1V70 A;  2W1U A;  1W6Q A;  4IEO A;  3ACL A;  1CAX A;  1QJE A;  2AH2 A;  1Q3E A;  1UYZ A;  1MS5 A;  3K4D A;  1UMI A;  2XOM A;  1ZZ8 A;  2RDS A;  2YRO A;  1Q8O A;  4OVE A;  2WZR 2;  5I0T A;  1TMF 3;  5GZG A;  4UFK A;  5C4W B;  3VZN A;  2OYZ A;  3IPV A;  3PJY A;  1PO2 3;  4MHU A;  2A3W A;  4AHY A;  3DPR B;  3VBU B;  2D7F A;  1UY1 A;  4KH9 A;  1H2L A;  1WKY A;  5FKB A;  4CZS A;  2ERF A;  3ZYI B;  1PHM A;  1JUH A;  3AYE A;  4JGZ A;  4YW3 A;  1NY7 2;  1JYN A;  3GZE A;  1UOB A;  4TSV A;  3PVB B;  2YMZ A;  1UU5 A;  1YQ2 A;  2NZ9 A;  1UOJ A;  3JQW A;  3WG3 A;  2G4I A;  3H3Z A;  4HVR A;  4AED A;  3B7M A;  4D7S A;  3T30 A;  1J83 A;  3LIH A;  1HB3 A;  1UZW A;  1WD3 A;  4Y5Z 0;  1GNH A;  2R06 3;  3JXS A;  2DBI A;  5FZH A;  1K5M C;  3LA7 A;  4Y22 A;  1BZW A;  2X05 A;  4NHM A;  5BNP B;  1GQP A;  3FBY A;  1OF3 A;  3JB8 A;  1W90 A;  2HJI A;  2RDQ A;  3PHM A;  4CCL A;  2YY1 A;  5HCB A;  3A23 A;  3ZSE A;  4IV3 A;  3ZO0 B;  3H0O A;  3J7N A;  3POS A;  3V0B B;  1PGL 2;  2ET1 A;  2H6B A;  1PO1 1;  2Y0O A;  4IGQ A;  1T2X A;  2BZD A;  1JI6 A;  4YZ3 A;  2B9U A;  2ZKL A;  5ANN A;  2DYC A;  5FZ8 A;  4MGI E;  1UIK A;  3HIF A;  4H14 A;  4QB1 A;  1CGP A;  1W8O A;  4OCT A;  4UT5 A;  1ZBE 1;  2NMN A;  4FT8 A;  4ITC A;  4PBP A;  4YGC A;  1W04 A;  3K51 A;  5GM0 A;  1R64 A;  3WD5 A;  3NAP A;  3B9I A;  4AFC A;  1J58 A;  3JZV A;  4Y3O A;  1PIV 2;  2GAL A;  4R9D A;  2JG9 B;  1H30 A;  4GB3 2;  1Z78 A;  2ES3 A;  3TEZ A;  4FQ4 A;  2D97 A;  2HYX A;  4JGY A;  4HOO A;  1QJF A;  4GWI A;  4IV1 C;  3LEG A;  1S0G A;  3IDB B;  3O1U A;  3KCX A;  3VBH C;  5C3O A;  4IND A;  1XND A;  3HN1 A;  3ZYH A;  3USS A;  4YVS C;  2JG8 C;  3BTA A;  3CIH A;  3INA A;  2EAL A;  3CKH A;  4FVV A;  3THT A;  3VD5 A;  4BU2 A;  2J42 A;  3C7H A;  3BOD A;  3OSD A;  1QGL A;  1W8Z A;  2VVE A;  3BTZ A;  4LO4 B;  2BBV A;  1SBF A;  1KDK A;  3I2D A;  5KHG A;  4I02 A;  2GMP A;  2NP0 A;  1URX A;  4BOW A;  4FO9 A;  3K3O A;  1AR6 1;  2WFF 2;  2D6K A;  2CTV A;  2HLE A;  1FMD 1;  2CU5 A;  4EN8 B;  3OBA A;  5BNQ A;  1UL9 A;  2XHN A;  3WW2 A;  4TYS A;  4BHP A;  5F7U A;  2YPD A;  1MZE A;  1CZV A;  3S7I A;  5C3P A;  4Q4X 1;  3WV6 A;  4QQL A;  2VMG A;  5FY1 A;  1A8M A;  4NHK A;  1L7L A;  2GC3 A;  3AL5 A;  3IDE A;  1S1A A;  2CAU A;  3OBZ A;  3DYM A;  1AR7 2;  4HKW A;  2C26 A;  4MOA A;  5DDJ 3;  5EJZ B;  1X50 A;  2W9X A;  3VBR C;  4BQ5 A;  5LEK A;  4CU6 A;  3O0W A;  1OFS A;  2VG9 A;  3TAY A;  3POI A;  4S2D A;  1WW6 A;  4DS0 A;  4Q2F A;  2RMU 2;  4ZXE A;  4BQ4 A;  4DEQ A;  5A6Z A;  1NQJ A;  2WQ8 A;  4CEY B;  1VBA 1;  3CJX A;  4MV2 A;  1Y4W A;  2OQ7 A;  3MFA A;  4O9G A;  5A1L A;  3S6P A;  4HKO A;  2MEV 2;  1HIX A;  1NCR B;  2C24 A;  1ZRC A;  5BNO C;  5FPA A;  3LPF A;  3H7Y A;  3K2O A;  2O0O A;  1K5M A;  3CMG A;  1QHD A;  3ZR6 A;  3ZYJ B;  1PX3 A;  3E5Q A;  2E9Q A;  2WZ8 A;  4C0B A;  1VBB 1;  1J1T A;  3OPT A;  2D6N A;  1VBD 3;  3DKW A;  3RI8 A;  1TMF 2;  4AFB A;  4A7Y A;  2ARX A;  2JDY A;  3AXD A;  3GGL A;  5FO9 B;  1MVQ A;  3HQX A;  4DB5 A;  3ROU A;  1PO2 2;  4QQ2 A;  2A1X A;  1ND3 B;  2W0X A;  1IS6 A;  2WNV C;  3OD4 A;  4IL7 A;  3ZIW A;  2GME A;  4IGO A;  2VCB A;  3AP6 A;  3U14 A;  4UWD A;  4I09 A;  1LOE A;  1O7F A;  1MEC 2;  1HQL A;  3FC0 A;  1GWK A;  1O5U A;  4LE3 A;  4Q26 A;  4ES9 A;  3E5U A;  4YW4 A;  4UOJ A;  2TNF A;  4YFW A;  1G7Y A;  3MIC A;  3IAP A;  4YZ1 A;  3IIA A;  4FPH A;  4NPR A;  3UGF A;  1AVB A;  2RS3 3;  2ADE A;  4GMP 0;  3WY6 A;  1RC6 A;  2ZGK A;  3KSC A;  3R05 A;  1KXG A;  4UFM A;  4QGN A;  1MS3 A;  4GQ7 A;  5A3O A;  4IV1 A;  1UOF A;  1UZZ A;  2Y6F A;  3VBH A;  4YNI A;  4TWT A;  5FIX A;  2JG8 A;  2VUA A;  4AI8 A;  2P3Y A;  1ZZ6 A;  5C9A C;  5JXJ A;  1BVP 1;  4IEY A;  1H4H A;  4OUE A;  4Y1U A;  1Q8P A;  4YM1 A;  1G9B A;  3U4X A;  5C70 A;  1C3H A;  3IKW A;  1Y9G A;  2LRO A;  3MGU A;  3AZX A;  3UES A;  3UKT A;  2B5H A;  1WD4 A;  1WWY A;  3ZFE A;  2B9V A;  4GJY A;  4JX0 A;  3PUQ A;  3VV1 A;  3ZLI A;  2EIC A;  1WLW A;  5IAT A;  1RL3 A;  5IAV A;  2A3X A;  4CCE A;  5BY5 A;  3QLQ A;  1RMU 3;  1K42 A;  3GZU C;  4MLO A;  2FDK A;  1WA4 A;  1ZZ7 A;  1OBN A;  3K75 B;  4M3C F;  4ZON A;  3TN9 3;  4QDQ A;  4YPJ A;  4WM8 B;  5BYN A;  2JDA A;  4B7E A;  4E8C A;  1W2U A;  1W28 A;  2V09 A;  4LBJ A;  4CDU A;  3NV2 A;  3NNL A;  2IZW A;  3L2H A;  4FBF A;  1YFX A;  2K46 A;  2A6W A;  3OYW A;  3VBR A;  3S5A A;  3POE A;  3TYJ A;  1JZ5 A;  3SCH A;  5BV6 A;  1D7P M;  4FPC A;  1DGL A;  2PLV 1;  2JDH A;  4GD4 A;  1CZT A;  3MV1 1;  5F2S A;  3NJV A;  5JZG A;  4Z92 B;  1AYM 2;  1QWR A;  2R07 1;  5A7O A;  4COU A;  4DFS A;  5I93 A;  3EQE A;  1E5I A;  3DV8 A;  1F2N A;  4ZS3 A;  3ZFF B;  2WQ4 A;  5I0S A;  2ZAA A;  4CU8 A;  5C3S A;  2X53 S;  1N1T A;  4NRM A;  3VD3 A;  2JDZ A;  1Z7S 3;  2YDE A;  3PVE A;  5BNO A;  2W2I A;  1DQ2 A;  5FDB A;  1DQ0 A;  1YUD A;  2IXC A;  2RJ2 A;  1PMI A;  2QQM A;  4FFH A;  2UUR A;  4LJH A;  3LE0 A;  2BNM A;  4CDW B;  5CAZ A;  2BER A;  5GJ6 A;  1GNZ A;  4XFH A;  4BA6 A;  3JB4 C;  2VE1 A;  3LDR A;  1CIY A;  3JU9 A;  4IEP A;  1YQ8 A;  4XXP A;  2WUH A;  4FXK B;  1V0A A;  3PJQ A;  2Q1F A;  1R08 1;  1S0I A;  2EID A;  1DGW X;  4XUO A;  3J8F 1;  1VIW B;  2XBO 3;  2WNV A;  4SBV A;  3S57 A;  1O4T A;  3LEK A;  1PO1 3;  1VBC 3;  5EYX A;  4AQ2 A;  2HWC 2;  2F17 A;  4ZPI A;  3SNM A;  4QX8 A;  4TXW A;  4XHX A;  4DMI A;  2VZQ A;  4QD2 A;  2D93 A;  3WF3 A;  3U37 A;  1ZBE 3;  1BYH A;  2YC4 A;  3SLI A;  1OLM E;  4QKN A;  3V0A A;  5JOZ A;  3C7G A;  5GLU A;  1H8T B;  1TNF A;  3ECQ A;  3B94 A;  4KI5 M;  3WHU A;  1W6O B;  4LMF A;  3Q9O A;  4Z8B A;  3VZL A;  1ULF A;  3FLP A;  3FHA A;  4XE9 A;  1VBD 2;  4QGL A;  3Q8A A;  3WF0 A;  1LNS A;  1POQ A;  1SLC A;  1HQW A;  4NWW A;  4V1P A;  5AFE A;  4QGM A;  2XKP A;  2FBE A;  5L7O C;  5FV3 A;  4AXO A;  1CPN A;  1PM4 A;  5KHH A;  2WC2 A;  4BQ2 A;  5C9A A;  5F9T A;  5L9R A;  1JXN A;  2BEO A;  2OII A;  2Y6K A;  4JC1 A;  4XJU A;  3MID A;  4GAZ A;  2E32 A;  3H3U A;  3N7L A;  4MAD A;  2VW0 A;  3RWK X;  3ACG A;  5FPB A;  4D6Q A;  2RE9 A;  1EUT A;  2RS3 2;  3KCY A;  4OFG A;  2C0Z A;  3CBN A;  4LUL A;  1FMD 3;  3HVD A;  3ZXE A;  4KG8 A;  5A7N A;  2HEW F;  4RGG A;  4KWJ A;  3VBU C;  2PAK A;  1OLR A;  2MHF A;  4K6B A;  2FMY A;  2HWD 3;  2JKX A;  1NXM A;  3ME2 A;  1O3Q A;  1V6N A;  1ASJ 2;  3KVB A;  3LA3 A;  4Q0P A;  3N7K A;  1H1A A;  4X6Q B;  2JDP A;  3KHB A;  3U10 A;  1W9S A;  2HBU A;  5JIU A;  3LAG A;  1WCD J;  2J1A A;  2Z79 A;  2FZ2 A;  1RVF 1;  2X5I C;  1VLN A;  5FZL A;  3ILN A;  5IFP A;  4V2V A;  4WM7 C;  3S5Q A;  3ZN6 B;  5FZO B;  1QDC A;  2VH9 A;  3VLB B;  2HWF 1;  2PXJ A;  3KF5 A;  5F5A A;  3PVN A;  1SCS A;  4RHV 3;  5FWJ A;  4WV8 A;  3VBO B;  3NST A;  3ZDS A;  2CY6 A;  3FUQ A;  4M00 A;  3T09 A;  4E8D A;  4EQV A;  4GKX A;  1BQP A;  1XE8 A;  3O1P A;  2ILM A;  4NJ4 A;  5JXG A;  3ZMO A;  2ZAB A;  1CAW A;  1JN2 P;  1SBD A;  2VZP A;  4XXA A;  5FMO L;  3TN9 2;  4AAP A;  4DO0 A;  4Q4V 1;  5A3T A;  4ZZ5 A;  3K48 A;  4O65 A;  5C3R A;  5E1R A;  5DZF A;  1ULC A;  1H2K A;  4KBZ A;  2VTF A;  1JUI A;  1DQ4 A;  4RSU A;  2WII B;  4DXZ A;  1VBB 3;  2BFU S;  2A6Z A;  5C71 A;  1TME 1;  1ULG A;  3LOI A;  4FPJ A;  4BE3 A;  5A3U A;  4FPL A;  2F4P A;  1JHN A;  1NYW A;  3FZ3 A;  1YI7 A;  3RYP A;  3RZG A;  2ZMN A;  1YO8 A;  1L7Q A;  1GZW A;  5H9S A;  2E7T A;  5GAL A;  4URA A;  3I59 A;  1YIP A;  4I3G A;  1QIQ A;  4B4P A;  2A71 A;  5CFD B;  2BNN A;  5JIA A;  1E5S A;  2C1F A;  5I91 A;  3OBT A;  1C4R A;  2AR6 A;  1IGO A;  2VZU A;  5LBF A;  1JZ4 A;  3IN9 A;  4EYU A;  5LA1 A;  4QX3 A;  1QJX 1;  3KMH A;  3H1W A;  4COY A;  5C33 A;  1GWM A;  4QQH A;  1YIF A;  5J1X A;  3PU8 A;  3VDD C;  5CIR A;  1IPK A;  5DZE A;  5A3P A;  5B2G B;  1PM7 A;  1VMJ A;  5L7O A;  2IFR A;  5T5P A;  1MVE A;  5GLV A;  3TOJ A;  3VKL A;  4D6R A;  1PO1 2;  3M1H A;  1VRH 1;  1IS5 A;  1JMU B;  1NCQ C;  1RHI 1;  3AFK A;  3GM8 A;  3M70 A;  1RUD 1;  3UK9 A;  1US3 A;  3ZYB A;  2P3K A;  2K0G A;  4AVS A;  2ZHN A;  3RZH A;  3APB A;  5JOX A;  1YC6 1;  2RM2 1;  1ZBE 2;  1OFN A;  4QDS A;  3ILF A;  2BOI A;  2K9Z A;  1AXK A;  2J1U A;  1W0N A;  4UFI A;  2J1V A;  4XYX A;  1HJG A;  1FI2 A;  3C7O A;  4Q0S A;  3WEZ A;  3DN7 A;  4H55 A;  1GR3 A;  4MVT A;  3VBU A;  5CVR A;  4E4H A;  4PDW C;  5IUQ A;  3SKV A;  2DVB A;  5FPV A;  3WW1 A;  4BQ3 A;  4MXW B;  1YXW A;  2RHP A;  5FMB A;  3HT2 A;  5DMY A;  3R6S A;  2P17 A;  3BIE A;  4YZ4 A;  1WW5 A;  3R4S A;  1MZF A;  4EN6 B;  4NAM A;  1H2N A;  2H0V A;  4P5H A;  3VUO A;  4TLG A;  3ZSM A;  2VUC A;  1T6G C;  4QX5 A;  2Y6G A;  4CPB D;  4M3C A;  2X5I A;  2YGL A;  3I97 A;  4EWE A;  3B69 A;  4WM7 A;  2VBB A;  4FCA A;  4XUQ A;  1QQP 1;  3EJK A;  4Q1P A;  3UGH A;  1AXZ A;  2VZS A;  3P5B A;  3K77 A;  4Q1R A;  1DU3 D;  5FYS A;  3IMN A;  4AEM A;  1AR6 2;  1RUC 1;  3V0B A;  3WDV A;  1W0P A;  1FMD 2;  1JS9 A;  3FX3 A;  4WVV A;  3MPP G;  4COZ A;  3WP6 A;  5LAT A;  4XCB A;  2WYF A;  1QJU 1;  3HEI A;  3PVO A;  5FZK A;  5FP3 A;  3KHC A;  2HWD 2;  1CR7 A;  3AMH A;  4Q4X 2;  1WZX A;  5JPN B;  3WQ7 A;  2ZHM A;  2CWM A;  5ACA 1;  5LZ6 A;  3U0Z A;  2BGP A;  3UNP A;  5C6C A;  4FPG A;  5FYB A;  5KR7 A;  3ETP A;  5IK5 A;  3ITQ A;  2ZX4 A;  4C8D A;  4QWN A;  1NG0 A;  5E8A A;  3RZM A;  1SFN A;  4YG0 A;  3T2T A;  2RS1 3;  2GZW A;  2YV8 A;  4Q0U A;  4OI2 A;  1VMH A;  4BDV B;  4AE2 A;  2ORZ A;  4AVV A;  1PZ7 A;  4XQW A;  1RIT A;  1DFQ A;  4C91 A;  1CVN A;  1J1L A;  2I45 A;  4AGG A;  1EAH 1;  2BYV E;  2DVF A;  4B4R A;  3POG A;  1VBA 2;  2NM1 A;  3RS6 A;  3OY8 B;  3ES4 A;  4GUL A;  4HON A;  5FUI A;  2HWE 1;  4WVM A;  2LTN A;  4QB6 A;  1MS0 A;  4AZZ A;  5ABJ B;  5LA0 A;  1B35 C;  5F5Q A;  4LOS A;  2HBT A;  4WBB A;  4JHT A;  3HMY A;  1HRI 1;  2CL2 A;  2PHF A;  4IE7 A;  1O3S A;  4FFI A;  3H42 B;  2PQS A;  1SLA A;  4Q27 A;  1UU4 A;  3CLP A;  2PEL A;  2ZOE B;  1LTE A;  4W6W A;  1VBB 2;  4IEV A;  1NA1 C;  2D3S A;  2E26 A;  1O5L A;  1AR8 3;  4KG0 A;  1PK6 C;  2OZ6 A;  3WG1 A;  1IG3 A;  4OI4 A;  4GMP 1;  4Y4R A;  1JZ6 A;  2MNG A;  2WA4 A;  2XON A;  5T5O A;  2V5D A;  3SCF A;  2DBN A;  3N7M A;  2Y6H A;  4RS5 C;  3WUD A;  4MG2 A;  4CRQ A;  4MZU A;  1KRI A;  3J4U H;  1OMI A;  3LB9 A;  2ZJC A;  3OG2 A;  3BI3 A;  3A0K A;  4LUM A;  4WM8 C;  4XTM A;  2Q8C A;  2EIG A;  2VNV A;  3FLR A;  3IM0 A;  5KHI A;  2PHT A;  3LSE A;  3T2Q A;  4UW4 A;  1V6I A;  4E4Z A;  1IQA A;  1H8V A;  3OUJ A;  3PTR B;  3VKN A;  4XAB A;  4YGD A;  1QNW A;  2EIB A;  3WP5 A;  4KWU A;  2YC2 A;  3PTY A;  4ARX A;  3KZ4 C;  5CG9 A;  5FZ3 A;  4K20 A;  1SEF A;  1OVP A;  1KQR A;  3LEM A;  5DUX A;  4LKE A;  1XU2 A;  4QPG C;  5FZ1 A;  3ZVX A;  1GV9 A;  4XW3 A;  5FRA A;  1ZRE A;  3LFI A;  4ISQ A;  1PGW 1;  5FJH A;  4IUG A;  1NCR A;  1RB8 G;  1VMF A;  1NAE A;  1NX9 A;  4CYD A;  1HB2 A;  4JCK A;  2FDJ A;  3F2Z A;  1XE0 A;  2ZML A;  4I0B A;  1MQT C;  1S55 A;  4MXV A;  1EP0 A;  4F7Z A;  3WDX A;  3WDW A;  2BPA 2;  4AHZ A;  4CDW C;  3PL0 A;  4LEJ A;  2R04 1;  3RZJ A;  4XMI A;  2QKD A;  3I3B A;  4KQ7 A;  5CFC B;  3I3M A;  1WMX A;  3ZSK A;  1ZRD A;  2PHW A;  2OUJ A;  2VU9 A;  3LDK A;  1RUI 1;  1ZZC A;  1ZZ9 A;  1AL2 1;  3N3H A;  1W06 A;  5EYY A;  3WG4 A;  2QQJ A;  3EHK A;  4CP2 A;  2OVU A;  3AYA A;  5J37 A;  2JE8 A;  3IT8 A;  2HEY F;  5HPO A;  2Y34 A;  4MET A;  1RUF 3;  4XUR A;  4KL1 A;  1N3O A;  2UWB A;  4IQP A;  4TLF A;  1U5I A;  2Q1M A;  3CDZ B;  4XFI A;  4LHN A;  1WA6 X;  2C5D A;  2QTW B;  4XUP A;  1CWP A;  4L11 A;  5KXB A;  5JI7 A;  1N1S A;  2R07 2;  1AR9 1;  1Y3T A;  3ASI A;  3N9P A;  4K21 A;  5EPA A;  5I8S A;  3T2O A;  2D40 A;  1O8S A;  1IPJ A;  2B7Y A;  2V72 A;  1LU1 A;  4DPN A;  4L8Q A;  3WF2 A;  1Y9Q A;  3AKP A;  4GA9 A;  3AK0 A;  3ENR A;  5JXH A;  4HSL A;  4QXK A;  1B35 A;  2J1S A;  2W47 A;  2C4X A;  3VDC A;  1HQN A;  3D0S A;  1IPS A;  2B46 X;  3DYO A;  4N43 B;  4DUV A;  5L36 A;  3RZL A;  4AEK A;  1GZT A;  1JU4 A;  4FPY A;  4DRR A;  4U2A A;  1QJX 3;  4BK5 A;  3LOB A;  1NA1 A;  3JBG 1;  5A6Q A;  5F2W A;  5A7W B;  1OQ1 A;  1PK6 A;  1WGP A;  4FFG A;  2RS1 2;  3MLK A;  1EV1 1;  4FOV A;  5FLH A;  1LEM A;  1R08 2;  3OF1 A;  5GZF A;  2G1M A;  2WAA A;  2QUO A;  4Q8L A;  3J8F 2;  4JGY C;  1DP0 A;  2JDU A;  5FK7 A;  3CZU A;  1SLB A;  2JEM A;  3WIN E;  1LKN A;  1VRH 3;  4L9B A;  4W50 A;  5HCF A;  3OGR A;  1SMV A;  1XRU A;  2ARC A;  3MBW A;  4Y20 B;  3O1R A;  1AR7 3;  3R4D B;  4WM8 A;  3VL8 A;  1G8W A;  1J3R A;  2BUK A;  3V64 A;  3RZK A;  1NE6 A;  2RM2 3;  4NUB A;  4BIS A;  2FDF A;  4CUA A;  5J3U A;  3GHM A;  4LOR A;  5FZG A;  2ZGS A;  3USU B;  2RMU 3;  4XOG A;  5J48 A;  1U5Y A;  2FMD A;  1LOA A;  2EXJ A;  4HN1 A;  2JWP A;  1VAM A;  3W20 A;  2WNO A;  4M4P A;  4NHX A;  4LXL A;  3VBF C;  1AR8 2;  4OI1 A;  1S0E A;  5A80 A;  4GH4 B;  3ZFF A;  4QPG A;  3MLL A;  1NZI A;  1LED A;  2JX9 A;  3GF6 A;  5AC9 1;  1FX5 A;  2GC2 A;  3WT3 A;  5IK8 A;  2J7M A;  1YQC A;  4DNY A;  2IXK A;  5F3I A;  1FPN 1;  4COV A;  4RQP C;  1MQT A;  1DYK A;  4CDW A;  2WIN B;  4D7Y A;  3OEB A;  2VZV A;  2W46 A;  1W6P B;  1W6M A;  4ZS2 A;  1CX1 A;  5FQ0 A;  2VNO A;  3M8L A;  2BTV C;  1QQP 3;  4D94 A;  1U5Z A;  3H8X A;  1QXP A;  3I2O A;  1STM A;  4XFB A;  5FCC A;  1RUC 3;  3VDB A;  2TBV A;  1MEC 3;  5KC5 A;  4OMD A;  3MIG A;  5FO7 B;  2FD8 A;  1YI9 A;  2G9G A;  4LBM A;  2P3I A;  1CQ9 A;  1RYY A;  3WCR A;  3T1L A;  3IMM A;  4DRV A;  2QQN A;  1MZ6 A;  1WCU A;  2EXH A;  2ZHK A;  4P9I A;  4YW6 A;  1POV 3;  2ZGP A;  5EQU A;  3ZFG B;  3ZXD A;  4CUG A;  1UYP A;  2WNU B;  5ACA 3;  2EAA A;  1HN1 A;  1RUO A;  5CFD C;  4QXC A;  4Q4Y 1;  4ASK A;  1UU6 A;  2UU8 A;  2ENR A;  2WLP A;  5I8Y A;  1W6O A;  5F6K A;  4AQT A;  2D43 A;  3W5N A;  1UF2 C;  1RED A;  1XYP A;  2IWG B;  2W39 A;  3POJ A;  1RVF 2;  5I0R A;  5JOW A;  4DUW A;  1E5R A;  1X7N A;  2WAO A;  2XGX A;  2OX0 A;  5T52 A;  3TWI A;  4BXS V;  1EAH 3;  2HWF 2;  1HLC A;  4QMA A;  1DYP A;  2Y33 A;  2QQI A;  5D2A A;  1YEW A;  2PA7 A;  1ZA7 A;  4LBQ D;  1NXD 1;  4YW5 A;  4Z82 A;  3ILR A;  5FUN A;  1IHM A;  1ZRR A;  1LU2 A;  1DZQ A;  1H6X A;  3WDU A;  2DVG A;  1BVV A;  2CNA A;  2WS9 1;  3AKQ A;  4Q4V 2;  4FPK A;  2QVS B;  3EB7 A;  4XAE A;  1GOH A;  2WN2 A;  1ODN A;  1RUF 2;  2ATF A;  2W1Q A;  2Y6J A;  2ZHL A;  4UBH A;  5BNN C;  2GN7 A;  3HAG A;  3E97 A;  3WVJ A;  2E33 A;  2BQP A;  2VR4 A;  3FL7 A;  1TME 2;  3ZN5 A;  1ZYB A;  1IQD C;  2UYB A;  5FP8 A;  4HET A;  5A32 A;  1VBE 1;  2RS5 1;  2BW8 A;  2WLQ A;  2ZGU A;  4K1Z A;  4XAC A;  2NYY A;  3PUH A;  4YGE A;  2DFB A;  5DUU A;  3VHO A;  5F3G A;  3ETQ A;  4COW A;  2A3Y A;  2D6L X;  4X8N A;  4FTB A;  2XQR A;  2VC9 A;  2NLR A;  2PMW B;  2KXL A;  3JCI A;  4RR3 B;  3RSJ A;  5FOB B;  4BQW A;  2YFZ A;  2BGO A;  2AC1 A;  4GAL A;  2JEN A;  1VAL A;  1W6N A;  1AYM 3;  1GU3 A;  3ZKY A;  3PUS A;  2VQU A;  4WVW A;  3K46 A;  2VCC A;  4CPB A;  5E88 A;  3ZFE C;  4XCA A;  2Y64 A;  1K5J A;  2GP5 A;  2OPW A;  5FY0 A;  1QJX 2;  4P9J A;  1OUR A;  1QXR A;  5DZG A;  3VBF A;  4CDX B;  4LKS A;  3HNM A;  1ENX A;  1NLR A;  3ZN6 A;  3DUI A;  2A70 A;  3IAQ A;  5FZO A;  4YZ2 A;  1T6B X;  3VBO A;  4I0W B;  2YG0 A;  2EVX A;  1PVC 1;  1AX0 A;  2P4E A;  4NRP A;  2XJT A;  2ZAH A;  1C5H A;  4NPL A;  4RQP A;  1VRH 2;  4W6X A;  1TG7 A;  1ULE A;  1ZBA 1;  4FP3 A;  4CDU C;  3I2J A;  3NJZ A;  3O0X A;  3KB5 A;  3N9Q A;  3C8X A;  2AEN A;  5J09 A;  2YFU A;  1OA3 A;  4MGQ A;  1CAU A;  2RM2 2;  3Q8B A;  2EAK A;  5FZM A;  5C3Q A;  3U11 A;  5JZG C;  2WSV A;  1SAC A;  5IFT A;  1S2E A;  4AHW A;  1JYV A;  3LZZ A;  2HWC 3;  2OT7 A;  2R04 3;  3B5L B;  1MZ5 A;  3V56 A;  5FMD A;  3CJI C;  1J59 A;  3QCW A;  2VJX A;  1RUG 1;  4CXW A;  1BKZ A;  4DY3 A;  1LR5 A;  1RUI 3;  5KHJ A;  2WO3 A;  1AL2 3;  2O8O A;  4L97 A;  5C8C B;  2KM2 A;  1JYC A;  2Q30 A;  2VAU A;  4QT6 A;  4C90 A;  1QOS A;  1U5X A;  5FXX A;  4BPZ A;  2HH9 A;  5CFD A;  2ADD A;  4AI0 A;  3D4K A;  4AEJ A;  1KIT A;  4HLT A;  4OUM A;  2ZZJ A;  2WO1 A;  3VBS B;  3DXU A;  4AF9 A;  3MF6 A;  3ZYG A;  4AFA A;  4PJY A;  3B9C A;  2BFU L;  2VUD A;  4P14 A;  3O5S A;  3H8O A;  5LWB A;  1QQP 2;  3I49 A;  5HCA A;  3PUR A;  2VQ0 A;  2FHR A;  4GJZ A;  4YVW B;  2DTY A;  1RUC 2;  3E6B A;  3G6J B;  4QPI B;  5HXV A;  1SDD B;  4L92 A;  3J9S A;  2P34 A;  5D1I A;  1IOA A;  4LHK A;  4J6G A;  4UFJ A;  4N7U A;  4BM8 A;  4D0Q A;  4CEW C;  5M0T A;  1QJU 2;  2C6S A;  2FQP A;  2YBK A;  3QOP A;  3WP4 A;  2WSU A;  1WUV A;  2LUW A;  3VD4 A;  4LPL A;  5ACA 2;  5BNN A;  1G9D A;  3VZJ A;  1RGS A;  2CDO A;  3WQ0 A;  5I0D A;  1HV0 A;  1YQ5 A;  3N36 A;  3D0J A;  3JBG 3;  3ON7 A;  2GNB A;  3B01 A;  1PMJ X;  2D5F A;  1GP4 A;  1F5F A;  1LHV A;  1VPH A;  1EV1 3;  2E53 A;  3WF4 A;  3ZSL A;  3RZZ A;  4LBN A;  1ASJ 3;  1Z0H A;  4XFG A;  5GLW A;  4BLI A;  4OHY A;  3VDA A;  4A3Z A;  1Q8Q A;  1VB4 A;  1EAH 2;  2WWU A;  1V6M A;  3NMB A;  4OUL A;  2BVB A;  4IE6 A;  3BPZ A;  3VHR A;  3PUI A;  4CCK A;  1ZA4 A;  1LEC A;  1LJ7 A;  5F3E A;  4EE2 A;  3AP9 A;  2FDI A;  5K9Y A;  1GKB A;  1K3I A;  1I5Z A;  4Y4Y A;  2VW1 A;  2XXZ A;  4G4F A;  4XDQ A;  3UYJ A;  3ZX7 A;  1LOB A;  2GDF A;  1UY3 A;  2JE9 A;  2Y38 A;  1G6N A;  4CP9 A;  2XLG A;  3AMQ A;  1YFW A;  3NV1 A;  3PIJ A;  5SV5 A;  4CP1 A;  2LS6 A;  1UXX X;  5LAS A;  4QX7 A;  5GZE A;  1JZ2 A;  1V6K A;  3THD A;  3L9J T;  4PIZ A;  3HR9 A;  1LGB A;  4QAW A;  3UKV A;  4HT1 T;  2NPI A;  4DZG A;  1GIC A;  1W0O A;  3B3Q E;  5LBB A;  4AL9 A;  2Z42 A;  5F5C A;  3ZKU A;  3PLQ A;  1SQ4 A;  2GSY A;  2Q8E A;  3TNQ A;  3LCP A;  2YBP A;  1J84 A;  3MUY 1;  4CDQ B;  4QXB A;  3O0V A;  4Q0Q A;  1X82 A;  2WRA A;  4UYB A;  1AYN 1;  2C9K A;  3ACI A;  3OEA A;  3CJI A;  1BMV 1;  2ZX0 A;  3WDY A;  4EWD A;  1CON A;  1A3K A;  2X29 A;  5A3W A;  2A5Z A;  4CCO A;  2VZO A;  4YGB A;  4YG3 A;  1GSL A;  3GBW A;  4PI0 A;  3U75 A;  4ZKT B;  4OQ8 A;  1W2O A;  1JW6 A;  2H6C A;  1ENR A;  3ZYP A;  2AYH A;  1XSR A;  3AZW A;  4QXH A;  3ZYF A;  3A21 A;  4PIX A;  4A44 A;  1PGW 2;  3LQC A;  1BK1 A;  1KD7 A;  1YFU A;  1SLL A;  4I3P A;  1OD5 A;  4Q4Y 3;  4BQY A;  1G9A A;  4XBN A;  1JYI A;  1AX2 A;  4JKM A;  4D69 A;  1SPP A;  3T4H B;  1V00 A;  2WAB A;  3BYW A;  4CCN A;  1XNT A;  3BN6 A;  5LCW L;  3OD0 A;  1W6Q B;  4DIQ A;  3UJO A;  2W94 A;  1FOD 1;  1HV1 A;  4LIT A;  1NOV A;  1CAX B;  1UQX A;  2R04 2;  4QQP A;  2Q5T A;  5FK8 A;  3DCQ A;  5FZB A;  4CEW A;  4QKB A;  1AXY A;  3GZA A;  2SBA A;  1RUI 2;  1AL2 2;  3PDQ A;  2JB8 A;  3T4V A;  3U1X A;  1PX4 A;  1HB1 A;  1OHF A;  1I9R A;  3AB0 A;  5JCT A;  1GP5 A;  2JJ6 A;  1QY4 A;  3WQ1 A;  1FV3 A;  2QBX A;  4XF0 A;  3BPS A;  4FTS A;  2Z69 A;  4L0P A;  1LCL A;  4JGZ B;  3ZYR A;  3NVC A;  3H8U A;  3PU3 A;  3NJY A;  1YLL A;  4JQT A;  2RVA A;  4PBO A;  3I3D A;  1D4M 1;  5LB6 A;  4LE4 A;  4AED B;  2RS5 3;  1AR9 2;  4ES8 A;  1MS4 A;  4XF1 A;  1ND2 C;  2HEV F;  5FKC A;  2ZGO A;  3QD6 A;  2O8Q A;  3D8C A;  4OLL A;  3KV6 A;  3FUO A;  2JIC A;  4XFA A;  5CKM A;  3AX4 A;  4B7K A;  4HXC A;  4IV3 B;  1DGR N;  1GQH A;  2F6B A;  3GJB A;  5DG2 A;  3HD8 B;  2ZAC A;  2YXS A;  5FPZ A;  5D8A B;  5A1A A;  3RMX A;  1AR6 3;  4OYU A;  3WX5 A;  5C4W C;  1AF9 A;  2VBP A;  3ZSJ A;  2LAL A;  2VOK A;  3JBG 2;  4OHX A;  3ZMN A;  3DPR C;  2R30 A;  4LK6 A;  5DUV A;  2WJS A;  4KBB A;  5FYC A;  5FZD A;  1EV1 2;  2VD7 A;  3EO6 A;  3BCW A;  3MDP A;  4Q4X 3;  2ZGN A;  1NT0 A;  4G3Y C;  4HN0 A;  5FZ6 A;  4FOW A;  5GZD A;  4KMQ A;  1H9P A;  1FXZ A;  3NAP B;  5CZK A;  3VL9 A;  3GCX A;  2P6C A;  3ZXF A;  1ZBA 3;  2X10 A;  2IXI A;  4YYO A;  1C28 A;  2R0H A;  5DUW A;  5IYY A;  2Q1Z B;  2EXK A;  4BK4 A;  3NWK A;  1OF4 A;  2WNU C;  1O4Z A;  1E57 A;  4NO4 A;  2AZ5 A;  2XJS A;  1XE7 A;  5DAX A;  4Y1V A;  4BH9 A;  1LOD A;  5BNP C;  3FFQ A;  4R4X A;  1LGC A;  4MGK E;  3HOB A;  1VBA 3;  4J25 A;  4XET A;  1YWK A;  1C5I A;  3WHT A;  2P1B A;  4XBQ A;  2XDV A;  2DUQ A;  2VVF A;  2YYO A;  2BJS A;  1FAY A;  3B02 A;  4AVC A;  3FBM A;  3FLT A;  4PLO A;  4M3C E;  2YPJ A;  3UGG A;  4LBQ A;  5AC9 2;  5FJK A;  5G04 L;  1C8M 1;  4N53 B;  1F8V A;  1UAI A;  4Y1Z A;  1LGN A;  3KVA A;  4QKF A;  1FPN 2;  1TNR A;  4PQQ A;  4RYD A;  4GWJ A;  4B3N A;  1N1V A;  2DU1 A;  4ORF A;  4GKY A;  5KXD A;  5FYI A;  5A7W A;  1GYK A;  2JG9 C;  2E7Q A;  5B4N A;  3RNS A;  2G9Z A;  1DGW A;  5JSP A;  2E7A A;  2QQK A;  1EPZ A;  4LT5 A;  5C5U A;  1Q56 A;  1XNK A;  1XNA A;  5L19 A;  1G9C A;  1RUH 1;  1OKQ A;  3ZXL A;  2Q8O A;  1JH5 A;  2WFP A;  1QDO A;  3VN4 A;  2ZTN A;  5F37 A;  3TNP B;  1L3J A;  4UW5 A;  4Q8K A;  3QAC A;  4C1X A;  3WLU A;  2IXH A;  2R16 A;  5J98 B;  2HKX A;  4UXA A;  5A33 B;  4LQR A;  2VME A;  1UN1 A;  4Q4Y 2;  4IES A;  3WP3 A;  4DIN B;  4CU7 A;  1JZ8 A;  3MFC A;  2VZ1 A;  1MAC A;  4M0H A;  1I3H A;  5EV7 A;  1TEI A;  1ND2 A;  2GP3 A;  3A0N A;  2XUE A;  3ZOI A;  1K5M B;  2GNT A;  3M4F A;  5DAW A;  4CDX C;  5A7P A;  4WVZ A;  4YW1 A;  1UPS A;  3EMR A;  1NLS A;  3R0R A;  3ZXA C;  2WQZ C;  2YZ4 A;  5FLJ A;  5JWP A;  4P02 B;  4NR1 A;  3V65 A;  3O14 A;  1M4W A;  3M3I A;  4UF0 B;  3ST7 A;  2PHU A;  5F32 A;  3U4S A;  3OGS A;  4QHZ A;  5C4W A;  3BU0 A;  3WR0 A;  4I01 A;  1VR3 A;  4OHZ A;  3AFG A;  3TB0 A;  1TVG A;  1LES A;  1W9T A;  2JIJ A;  3DPR A;  2OW4 A;  1BEV 1;  3HNB M;  4AVA A;  2UWC A;  3NQH A;  5LY1 A;  1LUL A;  2RG4 A;  2V73 A;  2G19 A;  1SG3 A;  1X33 A;  3HBK A;  3GXU A;  1W05 A;  2VCM A;  4CEY C;  5KC6 A;  4Z1V A;  1K45 A;  2D6O X;  2RS5 2;  1GLH A;  4N7I A;  4XJ8 A;  2UY8 A;  3MIB A;  3PIG A;  3D82 A;  3AVR A;  3WG2 A;  4MH0 E;  1NCR C;  4K9S A;  2YUE A;  4NHL A;  2DCK A;  2WNU A;  4ARY A;  1W8U A;  4Y1X A;  1RUE 1;  2PLV 3;  5HV0 A;  3GNE A;  1ODM A;  5BNP A;  4IV1 B;  4E27 A;  2BVV A;  2A7A A;  2R07 3;  3GCW A;  3JD7 1;  3VBH B;  1UYY A;  2FCV A;  1RIR A;  4S2F A;  4YM2 A;  5IVC A;  4FTE A;  5TSW A;  1AYN 3;  5FAX A;  4LA3 A;  1M06 G;  4XUT A;  4YVS B;  2JG8 B;  5JMC A;  2ZGM A;  2VUJ A;  4AW7 A;  1MS1 A;  3RRD A;  4HFS A;  1ENS A;  3NNM A;  1ND3 C;  4AVT A;  1UX6 A;  2I74 A;  4CE8 A;  2VMI A;  1ST8 A;  1U12 A;  5EZW A;  3ZN4 A;  1F15 A;  1UCX A;  1PVC 2;  1ULP A;  4OZO A;  4HAN A;  1OOP B;  4OHW A;  3SEE A;  1I6X A;  2QQO A;  1FAT A;  1RTV A;  1AZD A;  1CJD A;  1J3Q A;  2WT0 A;  2XJU A;  2Z5W A;  1ZBA 2;  2ZGQ A;  3MW3 A;  4CA9 A;  1R08 3;  3ACF A;  1DQ5 A;  2JDN A;  2JG9 A;  3J8F 3;  1GUI A;  3W9A A;  2QQP A;  5JOY A;  5CBL A;  3KCC A;  2XVG A;  2PQQ A;  4P9Y A;  1WMF A;  3AMP A;  2ZEY A;  4QM9 A;  1FOD 3;  3CU7 A;  1JYW A;  4NID A;  4HSJ A;  4YW2 A;  3OYW B;  3RYR A;  3VBR B;  4GXL A;  3SCG A;  4IEX A;  3M7A A;  4ZU5 A;  2R06 1;  3FHQ A;  4NHY A;  5EFU A;  5JPM B;  3RMY A;  5AFB A;  4YRD A;  3R4U A;  5T54 A;  1LRH A;  4IEW A;  5SV8 A;  4H7M A;  3PUA A;  2A6X A;  4MSV A;  4BMB A;  1W9W A;  2E31 A;  2Y60 A;  3AKS A;  1XYN A;  3OB8 A;  2XJP A;  3CQO A;  4M4R A;  4ZY9 A;  2JD9 A;  3KGZ A;  4Y5S A;  1YHF A;  2DTW A;  1UY2 A;  2WA3 A;  3KM5 A;  5BNO B;  3UKN A;  1UZY A;  3IB3 A;  3ZM8 A;  1JYT A;  4CDX A;  4B1L A;  2D3P A;  4ZHN A;  4FAH A;  4OZX A;  1BK0 A;  1W03 A;  3MW4 A;  5C7G A;  2CHH A;  2QQW A;  1BBT 1;  3AC0 A;  4E4D X;  2B4K A;  5EWS A;  3DF0 A;  2QZ2 A;  3I3E A;  5T3N A;  3QH7 A;  3J7H A;  4TZD A;  3IBM A;  4LLF A;  1YJK A;  1OXC A;  2WNV B;  2OKX A;  4M01 A;  5LA2 A;  4A2U A;  2OUH A;  5JR2 A;  1LHN A;  1OUS A;  2DCY A;  4PIY A;  1NE4 A;  2DUR A;  1SFP A;  4BB3 A;  4XFC A;  5FXW A;  4AGR A;  1W8T A;  1PZ9 A;  4TTG A;  2TUN A;  3AYC A;  1GWL A;  1H0B A;  4K8F A;  4EWA A;  2AEZ A;  2MPF A;  1S0D A;  4AI9 A;  4CEY A;  3BTY A;  2D6M A;  1OH4 A;  5FBZ A;  3ZFF C;  3BAL A;  2A6V A;  2BGC A;  2XHK A;  3V0A B;  2GU9 A;  5T5J A;  2KR2 A;  2VL4 A;  1RJ7 A;  3J26 N;  5FUP A;  3NO8 A;  4NN0 A;  2IC1 A;  4LLO A;  2J1E A;  4W6Y A;  5C8W A;  1HX6 A;  3POW A;  4P00 B;  4FI9 A;  1WW4 A;  1RVF 3;  2VGD A;  5LK5 A;  3O1V A;  2W91 A;  2A75 A;  3KLS A;  2W68 A;  4XJ9 A;  2HWF 3;  4QHB A;  4UBG A;  5C9A B;  4HVQ A;  2R32 A;  4LIU A;  3NNG A;  1AJO A;  1ND3 A;  5FZ9 A;  3VHP A;  4UW6 A;  1X9P A;  1UD1 A;  5GKA C;  3RG0 A;  3WNN A;  2BBA A;  1DIW A;  1TE1 B;  3AJZ A;  3AP4 A;  3NNJ A;  1LHO A;  3KV4 A;  5FP7 A;  4V2W A;  1C1L A;  3B93 A;  4Q4V 3;  4XHB A;  3E6C C;  3P3P A;  3FFZ A;  4Y1Y A;  5LBE A;  5DDJ 1;  4GWM A;  1C8M 3;  3POB A;  4AGV A;  1XNC A;  3FJS A;  1H6Y A;  4P9W A;  3ES1 A;  3NW4 A;  3KT7 A;  4I0A A;  1TME 3;  1UO9 A;  1YJL A;  2RR1 1;  4N90 A;  4DY5 A;  3W58 A;  2XVK A;  1H8T C;  2PLV 2;  3CL1 A;  4Z07 A;  1XU1 A;  1DCS A;  3JUU A;  4HVO A;  4AQS A;  1BXH A;  2DUO A;  2WDB A;  2DUP A;  3QH6 A;  1C8N A;  3D5O A;  4YLZ A;  3ZPY A;  1AYN 2;  4XC9 A;  2E63 A;  4QX1 A;  4FSJ A;  2QNK A;  1J3P A;  3AKR A;  2YHJ A;  2XJV A;  5FBJ A;  5FY9 A;  4AHX A;  1A78 A;  3RGB A;  5DAP A;  1QJY 1;  2ZCW A;  2XH6 A;  4R8H A;  4XMA A;  2XWB B;  5EJ3 A;  4EZH A;  1S0B A;  1ZM1 A;  3ZPO A;  3W21 A;  3OUH A;  2WKK A;  2DDU A;  1OT5 A;  3ALQ A;  1VBD 1;  5G05 L;  3NV3 A;  3MZH A;  1HRV 1;  4XIO A;  4G9S B;  1XOY A;  1ZVF A;  2W87 A;  1WCS A;  2A6Y A;  1YCI A;  2ARA A;  4HBN A;  3ATG A;  1HXS 1;  3O1S A;  2YU2 A;  5D8A C;  1COV 1;  1CAW B;  1UZ0 A;  3N4M A;  1X36 A;  4DOU A;  1S0C A;  5FMC A;  3LDB A;  3RI9 A;  5A3M A;  1OPO A;  1GZ9 A;  1RHI 3;  3KQR A;  3SIT A;  1FOD 2;  1YFY A;  1RUD 3;  2VW2 A;  3SXW A;  4LR4 A;  2JIG A;  3CEW A;  2IFW A;  3MHZ A;  4AWD A;  1U0A A;  2RS3 1;  1PGS A;  4WZC A;  1LOC A;  1Y43 B;  2WYS A;  3BOW A;  1OKO A;  2CGO A;  2R6Q A;  3WCS A;  1S0J A;  2VZR A;  4Q29 A;  2ZEZ A;  2K2S A;  3WNL A;  3KS7 A;  1HN0 A;  5LEJ A;  1HB4 A;  4BME A;  3I59 B;  3PNA A;  1OD3 A;  1BEV 3;  5CKQ A;  3MUZ 1;  4LO5 B;  3VBO C;  4Z2A A;  1D4M 2;  3AJY A;  1O4Y A;  4KGQ A;  5FZ7 A;  2IUW A;  5FZ4 A;  2DVA A;  2EXI A;  3III A;  4PLN A;  2W5F A;  5FYY A;  2FDH A;  4JRA A;  2HYK A;  2WZP P;  2A73 B;  3I7D A;  2PHD A;  1OLQ A;  3C7F A;  4ZZ8 A;  2ETE A;  4HPK B;  3ELN A;  1RUE 3;  3GDB A;  4GZ9 A;  2DCZ A;  5FP4 A;  1GOF A; 
#chains in the Genus database with same CATH homology
 2BOJ A;  2BV4 A;  2XR4 A;  1UQX A;  2BP6 A;  2JDP A;  5D2A A;  5A6Q A;  4AOC A;  2CHH A;  1OVS A;  5A3O A;  2JDY A;  4UT5 A;  3DCQ A;  2VNV A;  4CE8 A;  1W8F A;  2JDM A;  2VUD A;  2JDU A;  5A6Z A;  1W8H A;  3ZDV A;  1OXC A;  1OUX A;  5A6Y A;  1OUS A;  1OUR A;  2VUC A;  2JDH A;  5HCH A;  1OVP A;  2BOI A;  2JDN A;  5A70 A;  5A6X A;  2JDK A;  2WR9 A;  1UZV A;  2WRA A;  1GZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...