5A70A

Structure of the lecb lectin from pseudomonas aeruginosa strain pa14 in complex with lewis x tetrasaccharide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
114
structure length
113
Chain Sequence
ATQGVFTLPANTQFGVTAFANSAGTQTVNVQVNNETVATFTGQSTNNAIIGSKVLNSGGGGKVQILVSVNGRSSDLVSAQILANELNFALVGSEDSTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECB
publication title Analysis of the Lectin Lecb from Highly Virulent P. Aeruginosa Pa14 Reveals Lecb as Strain Marker and Pan-Strain Anti-Virulence Target
rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 22
structure length 113
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 5a70A00
2VUCA 1UQXA 5HCHA 2BV4A 5A6XA 1OVSA 2VUDA 1OVPA 4UT5A 4CE8A 2VNVA 1W8FA 5A6ZA 2BOIA 5A70A 3DCQA 2JDYA 1W8HA 2JDUA 2JDHA 2BOJA 1OUXA 3ZDVA 2JDKA 1GZTA 2JDNA 1UZVA 1OURA 5D2AA 5A3OA 5A6QA 1OUSA 1OXCA 2JDPA 4AOCA 2BP6A 2CHHA 5A6YA 2WRAA 2WR9A 2XR4A 2JDMA
chains in the Genus database with same CATH superfamily
4XQDA 1G86A 3RS6A 1ZZ6A 5FDBA 2RJKA 4IXLA 5EJ1B 4D6QA 2OZJA 4W6WA 5EPAA 5KWRA 2Q8DA 3VDCA 4RYDA 3MYXA 1OLMA 4RD7A 4ONUA 4HK9A 3WF3A 5F3EA 3NNFA 2BOJA 5LRRA 3T30A 3IAQA 1AX1A 1X36A 1X8EA 4B29A 3AMNA 3VZKA 4KGGA 4X6QB 5CBLA 1RMU2 1PVC2 2W92A 3PJQA 3D3AA 4Y1ZA 2ZHKA 5FMCA 2E33A 1L7RA 4XF3A 1N1VA 5FYBA 3VD4A 2VNOA 2RJ2A 5FUNA 1W05A 3H3ZA 4MG2A 4E2QA 4LO5B 1WD3A 4MXWA 3ROUA 5ACA1 1TE1B 5C3OA 1K5MB 5JXJA 4F7ZA 1WBLA 4IV3C 3O1UA 3L9JT 5EJ3A 3X29B 1LU2A 3J7HA 5AC93 1ULDA 1ZBE1 1G9BA 2K0GA 1VBA3 5A3LA 5H9RA 4XJWA 3H8RA 1KXGA 2QZ2A 3LDBA 3WVJA 4RGKA 2FD8A 3WT3A 1DDLA 4GQ7A 1S2BA 1QJU1 1MACA 5T5OA 4D8MA 2RMU3 3WXPA 3MIBA 1S1AA 4ZU5A 3U78A 4A45A 5KHHA 1ZRDA 4DMIA 3RPQA 1HB3A 3TB0A 1RITA 1XJAA 3ITQA 3ZXJA 3BKZA 2PTMA 4RFT0 3M7AA 1WCSA 4NIAA 4OYUA 1AVBA 1YRZA 4P9XA 3U4SA 1LKNA 2Q8OA 2PFWA 4D7TA 2BVBA 2J1AA 5LCWL 5FZKA 2VO5A 3V0BB 1BEV3 1C5IA 2PHFA 2Y64A 4W8JA 4JRAA 4Q4X2 4XETA 3DYMA 2WS92 2D98A 5HV4A 3CZJA 4NPLA 3VN4A 3ES1A 3T2QA 1JHJA 1H1AA 2JG9C 2XJQA 4IEYA 4P00B 2QTWB 1NOVA 5F9TA 2A75A 4XILA 2DWRA 4JHZA 4IGQA 3TYJA 1AJKA 1WCDJ 2G4IA 5GZDA 3CJIA 3NKGA 1EV12 1LHWA 1S0EA 2UYAA 2VBDA 5A1AA 1D0HA 2XXZA 5HXMA 4XJZA 5CNAA 1GQGA 5CFCC 1RUG1 1J1TA 3ZPYA 3N7MA 3N9PA 5L7OA 1R1A2 3FLPA 2DVGA 3KHCA 3GALA 2C1FA 4NVPA 1SPPA 2FDKA 1Q56A 1ENSA 1I6XA 4HK8A 5C9AB 4PIXA 5GKAC 3NJZA 3TN93 4L99A 2KM2A 2ZGOA 1HKDA 5DAXA 4ISRA 5FXVA 5T55A 4JGZA 2E51A 1JU4A 1IQAA 3O1VA 1OMIA 1L7QA 1VBA2 4HANA 4JKKA 3VL9A 5C8CA 4O7XA 2WZR2 1OSGA 5FBJA 1QWRA 3FLTA 1VJ2A 1FATA 1UPSA 1RUH2 3JQWA 2VW0A 5FIXA 4XW3A 2CDOA 1RHI3 4XAAA 1NE4A 3I2FA 4UT5A 2ET7A 2XVLA 2VU9A 4KNCA 4LLOA 4UI9L 2Q1ZB 1WKYA 5HBAA 4CVUA 3WDXA 4TTGA 3ZFGB 2E7TA 4QQOA 4B1LA 2D93A 1ZVFA 1ZBA3 3FMGA 5CB7A 1D0GA 1IGOA 4UBHA 4EN7B 1LHOA 4HPKB 4HOOA 5FY1A 1YQCA 1OKQA 1GOHA 1YQ8A 5FO8B 1R082 4C90A 1ZRFA 3VBFB 1TME2 3ZSLA 4I3GA 1UX7A 4PIZA 2ZKLA 3THDA 3HQRA 1Y7BA 2PXJA 2Z69A 3UK9A 4Q1PA 5J3UA 1FX5A 1H30A 2VVFA 4N43B 4FOVA 1SFPA 4CP2A 2PAMA 1LOEA 4UWDA 3MEPA 4CYDA 1NA1C 3POEA 3TEWA 1BK1A 4N90A 5I8YA 4NJ4A 3ZKUA 2EA7A 4QHOA 1YNAA 4QDSA 3CL1A 3OYWA 3S7IA 4LBKA 3ILFA 1DYKA 4K21A 2H6CA 1UXZA 2X5IB 3MUY1 2FDIA 4N43A 1K12A 1UMZA 4FPCA 4BISA 4Q27A 2LW8A 2D43A 2ZGMA 2GMEA 3ZYGA 4Y1YA 5FPXA 3WG3A 5DDJ2 5JPMB 3IKWA 3MV11 3QBQA 1XPWA 3WG2A 2FQPA 1N3OA 2R30A 2MPFA 4S2HA 4AI3A 2F4PA 3AYAA 2ERFA 1OD5A 2X5IA 5E1RA 4YW1A 2A5ZA 5C9AC 4DO0A 1W39A 4AGRA 4LHNA 1FPN1 4QPGC 3UGGA 4DRRA 4P9WA 4N9IA 1AR72 1KQRA 3KCXA 4P9GA 4CDXC 4FSJA 4GWIA 4HXCA 5L73A 5JI7A 5FY5A 5K0UC 3UKTA 1H4GA 4H7MA 1LOFC 2YBPA 4ISQA 5CIRA 4PDWC 4XF1A 1VBC3 2W3JA 3UNPA 3B94A 2J1VA 5ANQA 4Q4V2 1J3QA 1YJLA 2WR9A 3CZUA 3DEMA 3N9NA 2ID4A 3NNMA 5C6CA 2XPJA 4R9BA 5IYYA 1RUD2 2D5HA 1HRV2 1WZXA 3NV3A 4DXRA 1JYXA 2YB7A 2G1MA 1OVPA 2MEV2 4IEZA 5T50A 2FMYA 1H6YA 1JW6A 3U14A 1W0OA 1ZA7A 5L9VA 4AGVA 1NUKA 3QCWA 2PQQA 1W03A 4PJYA 1OH3A 3HR9A 2R062 4COUA 4QU1A 1XB9A 2R043 4XCAA 4K1YA 3SISA 2Q8EA 2ZEWA 4RHV2 3OF1A 3VBFC 3LEMA 1UPIA 4QQPA 4Y22B 5FZCA 2JE8A 3AP7A 5JR2A 1TEIA 3VHPA 1AR93 5FPVA 1CAXB 5A33B 2OUJA 2DTWA 3AZZA 4QPIA 1GOGA 1TNFA 3OD0A 1KGYA 4BE3A 4FOYA 2KD7A 4HVQA 5CFDB 1W8NA 4C1XA 1FI2A 4QXCA 2C6SA 1RYYA 2PHTA 2P34A 4GB32 1ZZBA 4R9CA 5BY5A 3O1TA 1RINA 1HN0A 4FI9A 3WUCA 2YUEA 1DGRN 4AL9A 1WCKA 1V6IA 2BOIA 4CSWA 5A70A 2WQZC 3WQBA 2P3JA 1KEXA 1JYNA 2P3IA 3H1MA 1R1ZA 2B39A 3KZ4C 2WWUA 4XTPA 4B1MA 1CAXA 1EPZA 5FYUA 5A33A 3UGFA 4I3PA 4BXSV 4P08A 1F2NA 4YM3A 2UWAA 2CTVA 2RDQA 3NAPC 5DZEA 5JOXA 4OCTA 2JDAA 3H50A 5A3WA 4NIIA 5EV7A 3VBOA 2DU0A 3BPZA 3M3OA 2CGNA 4XIKA 1OT5A 2D3RA 3NV2A 5I91A 1JH5A 2WAAA 4DXTA 2KR2A 1GQHA 4UOJA 4A3XA 1H6XA 4CUAA 1VBB1 4EROA 1W8FA 2RJLA 3I54A 5A6ZA 3NSTA 3MW4A 1OLRA 3ETPA 1CQ9A 2J22A 1BJQA 3SMHA 4DZGA 1K5JA 5FWJA 1XRUA 3LEGA 5FTTC 2W0XA 4NIDA 5IK8A 3LPFA 2QQLA 5L19A 1EAH2 4DB5A 1QY4A 5M0TA 2G9GA 3IMNA 1OKOA 5G04L 3I59A 1ND3B 3PHMA 3OGGA 1LGBA 2VM9A 2GH2A 2ZBJA 2AREA 4W6XA 4AVCA 2K46A 5D8AA 4YVSA 1NG0A 1E5HA 1R092 2VW1A 2BJSA 1OVSA 3NMBA 4NHKA 3VDBA 1UZ0A 3AZXA 1NCRC 3ON7A 2OQ6A 1AR81 3RMXA 4B7KA 5GLTA 4V2VA 1LNSA 1ENQA 4PCRA 4UW3A 1ND3A 4L0PA 4A7ZA 3VD9A 1N3QA 1W2NA 2RS31 4QGMA 3MZHA 3AVRA 1ZA4A 2Y8KA 4MGSA 5JLVA 3DUIA 1H2LA 5A32A 2VPVA 2FCUA 4CP9B 1OURA 1NZCA 2E9QA 3HNBM 3M3QA 4QQHA 2VTXJ 5F32A 3THPA 4CDQA 3SH4A 5FZBA 1AYM1 2HH9A 1OXCA 3KT4A 4LO8A 5CFDC 2YPJA 1RUE1 3ZSJA 1IS4A 5F3IA 1UOFA 3TRSB 1QGLA 4LIUA 1MEC1 3RVHA 1W6QB 1W6PB 2QQJA 3POBA 4XXAA 2RR11 1D7PM 5CAZA 5HV0A 1RVF1 1QOSA 2JG8C 3VBHA 4Y20A 1XE8A 1QH7A 4CP9A 5LEJA 4KU8A 1LEDA 4QX7A 3GYDA 2WA4A 2JDHA 4AK3A 2J1SA 1FT9A 2H0BA 2VZ3A 5CU1A 2HWD1 1JYTA 4QB1A 3R05A 4BH9A 1BKZA 2WIIB 2PELA 3MICA 5FZIA 1B35B 2QUOA 3WNKA 4JV4A 1UU4A 3M3EA 4LE4A 4AVVA 1W6PA 5C5UA 3I3DA 4LITA 1GNYA 3ZYBA 1PO22 1W99A 1QJY2 2LRPA 4AGGA 3J7NA 4HVRA 3D6EA 3SHRA 3H1WA 1VR3A 1PIV2 3FUQA 2VXJA 5FXZA 3ZYRA 5FJHA 4CDUC 1I1EA 4FPHA 1ALYA 3T0BA 3ZFEA 5F37A 4YZ2A 1EY2A 3LGRA 1WMFA 4L9BA 2QFEA 3LKJA 3JCIA 4L11A 4J1WA 1T6GC 5IVCA 4JGYB 4P5YA 2HBTA 3LCPA 5AVAA 1RUJ3 4YARA 1SBFA 3E6CC 1JS9A 2PHDA 1XNDA 5F8PA 4ZS2A 1UKRA 5LATA 1K3IA 1UF2C 4Q4W3 2W1WA 2MNGA 2WN3A 2ADDA 5FY7A 4I2OA 5F7UA 3CJXA 3N3HA 1CJPA 1NCQB 1XYNA 3HBZA 4IV1A 4INDA 4QGLA 3NNLA 4GH4C 4JZRA 1REFA 2RDNA 4WM8C 1C8M2 4JGYA 3WW3A 3OSDA 4HT1T 3JQXA 3CHXA 2Y38A 3AP4A 2EIGA 4NIHA 3K2OA 1OQ1A 2RS12 4MSVA 1J59A 3VD5A 5BNOA 1ZREA 2YMZA 4FPKA 1JZ6A 1RTVA 1NCQA 4Y1XA 5F2WA 3IMMA 5KHIA 1GKBA 2TEPA 4LLFA 1S0BA 1TZOA 2CU5A 3I3EA 3OPZA 4CA9A 1VBE1 5LA0A 1KFUL 5FY8A 4U36A 3AYCA 2R1BA 1HQNA 3ZYHA 2Q4SA 4XQ4A 2C4XA 1HRI1 5EP9A 4ATEA 2KA3A 1IS6A 4HL0A 2VGDA 1J3PA 2AUYA 2QZ3A 3AFGA 1YQ6A 2WA3A 4Z1VA 4S2GA 3O1SA 4CCNA 3A21A 1KDKA 3K51A 2IVIB 3ECQA 4O9EA 2WNEA 4AWDA 5I0SA 1RIRA 1XOYA 3I2HA 5IVYA 3ENRA 1B35C 2FDHA 5GALA 5CEHA 4MGKE 3PUSA 1CAWA 2VE1A 2D6MA 1S0FA 2VUJA 1HXS2 4GWMA 3UKVA 2R073 1COV2 1LGCA 5D2AA 5KXCA 4DOUA 2QCSB 3OGVA 4LIVA 2DV9A 1OBNA 4XJ9A 4BYYA 3HT1A 4DRVA 3O1PA 3MPBA 4QB6A 5FMBA 4Z2AA 5J98B 1S2KA 4EWAA 4MH0E 1JOJA 2BDRA 2DCKA 2QQNA 3SH5A 3VZOA 1QXJA 4KG0A 1C8NA 5FREA 1POV0 4ZY9A 3U10A 4OUEA 1SMVA 3IIAA 4BK5A 5J36A 1MS0A 2UWCA 2ATFA 5JDBA 3ZN6B 4A6OA 5DPNA 1MZEA 4LBNA 1BZWA 2EVXA 1OUXA 3ME2A 4XFBA 2E7AA 5AC91 4OZXA 2J1TA 2W52A 2WUHA 4YGCA 3RRDA 1DQ1A 2ZCWA 1ND2A 1U5XA 2WAOA 4FOWA 3BTAA 2WLPA 4KQ7A 3LIHA 3RJ2X 5A1LA 5IFTA 1C3HA 3AKRA 3GF6A 4CDWC 2DDUA 5GZCA 1UU6A 2WJSA 4AHYA 5J1XA 1QH6A 1WA4A 2RMU1 3AYEA 4YG0A 1HJFA 3T1LA 2O8OA 2BV4A 3OB8A 3VZMA 3R0RA 1JZ7A 4RGGA 4FPEA 1W6OB 5HI0A 2PLV2 4GULA 4MUVA 2YROA 1MVEA 2BFUS 3BB6A 2FBEA 1DQ5A 3ATGA 3J8F3 1QOTA 3LSEA 4NWWA 3I4IA 1GLHA 4Q0UA 1BEV1 5F5AA 2J1RA 1FPN2 1D4M2 1QQP3 4AI9A 4M0NA 4Z82A 3POFA 2XOMA 1VBD3 2ZHMA 4Y1UA 4D0QA 4FTSA 1ASJ2 2A73B 2Z4FA 3LSDA 2VMEA 3RWNA 1G9DA 1V9U2 2QDRA 5LRSA 2A1XA 2QBXA 3OUIA 3WNLA 4DINB 3B5LB 4BIFA 3ZMNA 3BIWE 4GMP3 3VKMA 4M3CF 4JQRA 2WFF3 4LEJA 4D94A 1GYKA 2XR4A 3MFAA 4URAA 1XSQA 1CPMA 3EMRA 1UZYA 4LHSA 5A7OA 3PJYA 2JWPA 1NKGA 4BOWA 4YVWA 2WSVA 5DUXA 3HAGA 1SLTA 3ALQA 1XC6A 1PO12 3OY8B 1APNA 2BU9A 5FRAA 3I3QA 1DF0A 2QNKA 3VD3A 3MO4A 2C24A 1ZNPA 1QDCA 4AVAA 4NN0A 1IPJA 2XDVA 4BQXA 3WW1A 1AR62 4AEKA 4EE2A 3O12A 1LEMA 3TN91 4LOTA 1SEFA 4NPMA 3JU9A 5LBFA 4K1ZA 5F5IA 3RI9A 2BERA 4GJYA 2Y6KA 4L97A 2HWC3 1O3QA 4EZHA 4URTA 1RC6A 5K8SA 2XQRA 1GANA 3FHQA 3ZPOA 5A6XA 3OBAA 4S2DA 1P8JA 4HN0A 3SCFA 4D3WA 3VDDA 4FAGA 2NMNA 1YLLA 3IDAA 1RHI1 3JD71 3RFRA 2YZ4A 3AL5A 4XUNA 1WLCA 3ABZA 4FPGA 4ITCA 1W8HA 4NRPA 4ZONA 3ZSEA 1QJX2 2R7EB 3DPRB 4JDOA 3VBUC 1LOCA 2H6BA 4OQ8A 1LCLA 2C26A 1URXA 4LQRA 1O5LA 3F95A 1E5IA 5DMYA 1ZBA1 1UZVA 4XC9A 5T5JA 1KS5A 5FUPA 4AFAA 2VD7A 3DYOA 2LALA 3J8F2 2WLQA 4AOCA 5FK8A 5LY2A 4LKSA 3A4UA 3AKSA 1AX0A 2ZTNA 3ACLA 3V0AB 4XBQA 3POWA 2GC1A 1XNAA 5JSOA 1LAJA 2HEVF 2EF6A 3HWJA 1V00A 2DURA 1SHWB 1STMA 3N7JA 4RS5C 1O4YA 3Q8BA 1RMU3 4OMCA 1PVC3 2TBVA 5JZGC 1PM7A 4YPJA 1JZ5A 5I0RA 4XJUA 5FJKA 1MQTA 3H9AA 1FAYA 2Y34A 1S0JA 4IUGA 1X9TA 1AYN1 3V0AA 3JB4C 3M70A 2ARXA 5EXOA 2WINB 1IG3A 5DAVA 4AQSA 4X8PA 4YZ1A 3RMYA 3JBG2 4XABA 3CF6E 2X10A 4RQPB 1A8DA 3PIJA 4TWTA 3THTA 1YHFA 3PVOA 1X82A 4FCAA 3B01A 3HN3A 4AEMA 4BQWA 1GMMA 4FXGB 3WUDA 4WM7B 3LA3A 3N7LA 1PK6C 2EAAA 4XYXA 4CU9A 5D1IA 1GOFA 4LBOA 1GP6A 1LHNA 4LA2A 5LY1A 2PA7A 2QQUA 5BNPC 4AAXA 3LFIA 4LKFA 5L9RA 5T52A 3ACIA 2ZAHA 2LS6A 2RS32 4BHPA 3EB7A 1D4VB 4Q4Y2 2J7MA 4XACA 2RV9A 4BB3A 3BVCA 1GICA 2I07B 3CDZB 1OA2A 3VKFC 1H0BA 2HWB3 3POYA 1E5RA 2B9VA 4IE0A 4QWNA 2VMDA 2HYXA 2O14A 2A70A 2XONA 3P3NA 1W2OA 2ZGNA 1PGSA 2VQUA 1JHNA 4IV3A 4Q0PA 3BIEA 4LNVA 3VLBB 1Q43A 1XSRA 1VBC1 3CQOA 3IM0A 1OFNA 4Q4X3 5DG2A 3SKJE 2WS93 4OFGA 5C4WA 3UJQA 2X8KA 4CE8A 4LUKA 1WLWA 3AKPA 2VQAA 1HW5A 1LRHA 1TMF3 1UIKA 5FMDA 3DPRC 4I0WB 3Q8FA 5I8SA 4MXWB 1W6MB 1QJZA 3ES4A 1PVXA 3K4DA 1EV13 2A6WA 2ZEYA 3WY6A 1N3PA 4IEXA 2R041 4C8DA 3EJKA 1YFWA 1H2KA 3E6BA 5DUVA 3ZLIA 1YQ5A 2Y6FA 2QE3A 3IDBB 1R1A3 5FY4A 2IXJA 2VZ1A 4WZFA 1AR91 4F8AA 2CWSA 2P1BA 5KHKA 4COYA 4KBBA 3TBDA 2VTXA 2PAKA 3MLJA 3ZMOA 1X33A 1Y3TA 5DN2A 1W6MA 2W5FA 4WZCA 1GSLA 4XF0A 4XXPA 4Y4RA 3WNNA 4P9YA 4E8DA 3LOIA 1GZ9A 2HWE2 3VHOA 2Q1MA 1V6OA 2EXKA 2XLGA 3VKOA 1SDDB 5IUQA 4ES8A 5GZGA 1LJ7A 2WZR3 5FUIA 3O14A 1DGWX 2RS52 1RUH3 1Y9MA 3J26N 4LHKA 3AZVA 3T08A 3UYJA 3LFMA 5J96B 3H42B 5A3PA 4HKLA 4LO7A 4RQPC 1DGLA 2CDPA 1H8TB 4AQ2A 4CCEA 1J3RA 2ETEA 3AP5A 4LJHA 3VBSC 4WM7C 1F15A 2GSYA 5A3UA 2O0OA 1BBT2 3CMGA 4IEVA 1HDKA 2RDSA 4NAMA 4EN9B 1EUUA 5GJ6A 1ODNA 1UD1A 2HWB2 3PUQA 2YDEA 1IS5A 1H2MA 1R083 3CJIB 4LE3A 1TME3 3OEBA 5FZHA 3USSA 3ZKYA 1W90A 2JB4A 3GM8A 4JC1A 5FP7A 2HEYF 2IUWA 3GZEA 3PDQA 3TOJA 2IFWA 1H8TA 3KGLA 3DYPA 2VAUA 5L7OB 1C28A 1NLSA 3L2HA 1TMF2 5A7WB 5ISLA 5FLHA 4Z2WA 1SPPB 1DP0A 3J7MA 3A22A 4IEOA 1QXPA 4JVAA 2GN7A 2WNVC 4YG3A 5BNNB 2BWAA 1HX6A 3E5QA 3ZSKA 5FZLA 4W6YA 3A0NA 2DVDA 5FR3A 3H8XA 4LBQA 3ZXAC 1QXRA 2XBO2 1X8MA 3BGAA 4JGZB 2GDFA 2ZX2A 3FL7A 4MGTA 3U11A 1DLLA 3MV01 4J1XA 5C8CB 1PGL1 4CUCA 1UZWA 5A7WA 1G7YA 4B4QA 1O7FA 1RUI2 1KS4A 2WSUA 5A7SA 3U75A 4KWJA 3B69A 4FTEA 3LEIA 2XLFA 4NE9A 3S30A 3U1XA 4ARYA 3VGIA 5BNNA 5DDJ3 4H14A 2EICA 2HEWF 4O9GA 4Y24A 4QQ2A 3ZVXA 1KJLA 5JOZA 3MI8A 3D82A 1OUSA 2GALA 2PHXA 2VQ0A 3MIFA 3P3PA 4R4ZA 4U2AA 4CUBA 5JXIA 2IVJA 1SBDA 1OQDA 2VZQA 1ZRIA 1BQPA 3ELNA 1OA4A 4W65A 4I02A 4META 4B7EA 1K5MC 3CO2A 3QLQA 4MYEA 2VMHA 4A41A 2OPKA 1AR73 3H3UA 3O0VA 2O1QA 2X05A 5JIUA 1W8UA 2HWF2 5C5TA 4DEQA 4IEQA 4QX1A 3WHTA 3F2ZA 1LR5A 3GDBA 2VW2A 4Q4V3 2NP0A 3IB3A 2EIDA 1VE0A 2GP3A 1RUC3 4PIYA 5FPUA 5DQ0A 5IVVA 1RUD3 1HRV3 5ABJA 5LW9A 4UFHA 2BNOA 3AK0A 4AHZA 2MEV3 3OYWB 4BQYA 5A7PA 3PVNA 1SBEA 3QOPA 2EXIA 3WP5A 1NAEA 3KCYA 4N7IA 4CEWB 1SCSA 1WBFA 2R063 2VVEA 3WV6A 1DZTA 2Y60A 3D5OA 3NVCA 5CVRA 4LO4B 2Z5WA 1OF4A 1BMV2 3CJIC 4RHV3 3M3CA 1OHFA 3SC7X 3ZYJB 4KL1A 1XE0A 1ZYBA 3CBNA 2UYBA 3ACHA 1OLME 3C7GA 5IK4A 5L7OC 3MIDA 1S55A 1W3XA 1GWKA 1RUJ1 2ARCA 3EYPA 3QH6A 4CEWA 4IDZA 4GB33 5E88A 1NY71 4Z07A 4Q4W1 3M2MA 4G3YC 4KGQA 2AZ5A 2WYFA 1DG6A 1XNBA 4YZ4A 4AFDA 1YFXA 1JMUB 1O91A 3UL2A 3E97A 3KVBA 5C8CC 2O8QA 1QOOA 3K3NA 1DQ6A 1UAIA 2NQYA 2DCYA 4YFWA 3WEZA 1G8WA 2F17A 1EP0A 3DCQA 2H0VA 2DVFA 1BXHA 3MFCA 5DG1A 3AVSA 2WN2A 5FMOS 2XUMA 2UU8A 1ULOA 2E53A 3O1RA 1RUF2 4W4ZA 3RZKA 3T0DA 2ORXA 5FZ4A 1HQWA 1LOAA 3WDTA 1U12A 1L3JA 4BPZA 5DAPA 4QU2A 1V6MA 4Z92B 2G19A 3H8OA 2Y6LA 2ZGTA 1VB2A 3KS7A 3O1MA 1NQDA 5AFEA 4FP2A 4Q1RA 2PN5A 3FFQA 3ZXFA 1FV2A 2XL7A 1QIQA 1RUC2 3GBFA 3FFZA 5I93A 3W20A 3ZN5A 1CIYA 2JJ6A 3ZDSA 3Q8AA 1EAH3 4Q0VA 1I3HA 3RSJA 2RE9A 5F3CA 4J6GA 3I2JA 2AC1A 5JVVA 4QPIB 4ZPIA 1KRIA 2KXLA 3ZFGC 1V6KA 4ARXA 4HKOA 4JTOA 3NAPA 3JD72 2CAUA 4GD4A 4CPBD 2BQPA 2IXLA 3S5QA 2LUWA 1LGNA 1FOD2 4CP1A 1R093 2RM23 2WL1A 4RR3A 3RZHA 1AL21 5F2SA 3O0XA 3VHNA 2FCTA 2ZX3A 2R071 4ZHNA 4N43C 3PIGA 4FFGA 3WG4A 1CIWA 5IVEA 2VOKA 3C7HA 5K9YA 1UQXA 1VAKA 2JE7A 4LOSA 1VALA 4UFKA 2R0FA 2YPDA 3CNAA 5FPBA 3VBOB 3E5UA 2IFRA 3TWIA 2VMGA 1R64A 1Q8VA 2QQKA 3AZWA 3ZXKA 3TNPB 1Z7S2 5JSPA 1FMD1 3PVEA 1JYVA 4CRQA 2BPA2 1D2QA 1CVNA 4GKYA 2X5IC 3EXUA 4M4RA 2ADEA 5FZGA 1YFYA 3HN1A 4ZS3A 1G9CA 4IE6A 5LK7B 1PGW1 5DABA 1A78A 2VVDA 2P4EA 4CTEA 1NCRA 5ACA3 4N8MA 2QVSB 3HT2A 1X9PA 4FT8A 5FZAA 4LTAA 3LDKA 4MGZE 2AACA 4JAAA 2VUCA 3BN6A 4FPYA 3T4HB 3WOGA 1UOJA 3J9SA 2A3WA 2JKBA 2A6XA 3I59B 4OI4A 5JSRA 5B2GB 3HIFA 4UBGA 3I2IA 5T5PA 5ERLA 1DQ2A 4GA9A 2A3XA 4NO4A 4LORA 5D8AB 4N53B 4KG8A 4YVSB 1W04A 2W2IA 3T09A 3VZNA 2VUAA 2DUOA 3GZAA 4Q2FA 5JIAA 1PO23 1Q8SA 5FZMA 1EYBA 3ZSMA 1QJY3 2OPWA 5FZEA 2JICA 1GR3A 2X09A 2FDFA 2ZGSA 1PIV3 2V5DA 2XUEA 3LQCA 1N1SA 1XQNA 2B7YA 3OBTA 1QQP1 4LK6A 5H9PA 2OUHA 3T2TA 1VBD1 5FKBA 2BW8A 3MW3A 4QMAA 1I5PA 5A32B 3POGA 4N53A 4FFIA 4Y33A 3TEXA 2RM22 1JBCA 2HLEA 4GMP1 1UXXX 4CDQB 2WFF1 4QPIC 4Y3OA 1DQ4A 3ZX7A 1HLCA 3RG0A 1CWPA 4YGDA 3A23A 2GH8A 1OC1A 2ZX4A 2VTFA 4DFSA 4AW7A 3VBHB 3LEKA 4Y20B 4BMEA 1C8M3 1F9KA 4PBPA 2VMCA 5FZ1A 5FZ0A 2VZPA 1F5FA 3VD7A 1SFYA 5LBBA 3H7YA 3HPNA 2QQIA 2RS13 1S2EA 2JIJA 5J7MA 1IS3A 5FZOA 4QAWA 5FCCA 2HWC1 2NPIA 4XUQA 5CG9A 2CWMA 5E89A 3VBOC 4OULA 2GMMA 3AKTA 1IKPA 1YXWA 3WQ1A 4AVBA 2EIBA 1PMIA 1ULCA 3RZZA 5ACA2 2GU9A 1SCRA 1MS5A 4M00A 2Z2SB 1W3VA 2Y6HA 4A2UA 3N9LA 3WINE 4QDQA 2B9UA 3OBRA 5FYHA 5C3QA 1ZBE2 2W87A 1OPMA 2D6PA 3KHBA 3NWKA 4TYSA 4C1WA 3ZFEB 2G9ZA 4GH4A 5A3MA 1C57A 1POQA 1MS1A 2P6HA 4Y26A 4AVSA 4S2FA 1JODA 2B8MA 5F6LB 3BU0A 1QJU2 4A6SA 1ENRA 3WG1A 4Y1VA 4C0HA 2AYHA 4WVVA 1UU5A 3HOBA 1AHSA 4LO6B 4OVEA 4XDQA 3DL3A 2J1EA 2VZTA 1GP5A 5JAXA 1UY1A 5D8AC 4YVSC 2BNNA 4IV1B 4M3CA 1HXS3 3E5XA 1COV3 3WR0A 3FJSA 1CAUA 2ES3A 4Z8BA 1OOPB 4YGBA 1RMU1 2QQPA 1PVC1 3BTXA 5IVBA 4QX3A 4WVMA 5I0UA 2WO1A 4FOQA 4AEDA 1ND3C 5L36A 3IIIA 1GWLA 4UFJA 5FLJA 2FZ2A 4MHUA 2BNMA 5BNOB 2YFUA 5HCAA 1DZRA 1PX3A 4CU7A 3MBWA 1UNBA 1XYPA 4NHLA 5JUVA 4EZ4A 3IPVA 4XFGA 3ZXGA 1J58A 2W68A 3UGHA 4CDQC 4B4RA 1OOPA 3EHKA 1MZFA 5FPAA 1DCSA 2DU1A 4HSLA 2AENA 4FQ4A 5GM0A 2JDZA 1VRH1 3IT8A 5AVPA 1RUG2 3KWVA 5EIYB 1CAVA 5EHDA 3WSOA 2DF7A 4LKEA 3VBRB 3ZYPA 2R6QA 3ZDVA 1WMEA 2W9XA 3D8CA 3PUAA 4LUMA 2XJPA 3KQRA 3LA7A 1DZQA 3OCPA 1AUYA 4AE2A 5BYNA 1A3KA 2PLV3 3KGZA 2WWSA 1RXFA 3OPWA 1A8MA 3HVDA 4BA6A 4BIOA 1CAWB 1Q8PA 5KR7A 1WLDA 3AC0A 4XEZA 4YG6A 1LOBA 4FO9A 4OI0A 3FBYA 3VBRA 3ZR6A 2D3PA 1RJ7A 1AL0G 1D4M3 1FPN3 1V70A 2VNVA 2QDNA 4Q4X1 2VBPA 4XFIA 5EJZB 1ST8A 2WS91 4EYUA 2JEMA 5FOJB 1ASJ3 4AG4A 4AHXA 1V9U3 4R4XA 4FQZA 4A44A 3TAYA 3RYKA 4MADA 4XE9A 4BQ1A 3ZFEC 3T3YA 4BLJA 4CDWA 2B45X 3OD4A 1FYUA 3PMSA 4CEYB 2NN8A 1YUDA 3DGTA 1FXZA 1J83A 1UY3A 1V0AA 1EV11 2Y6JA 4O65A 1AJOA 1F35A 4H55A 3FZ3A 4WV8A 1O3SA 4LXLA 5HCBA 3OJBA 4RL7A 1PO13 1ND2B 1REEA 4NHYA 5EYXA 4QGNA 2W39A 2IXHA 1R1A1 5A3NA 3FHIB 4IV1C 4PF1A 1AR63 3P5BA 1EUTA 4UFLA 3C8XA 4V2WA 4CEYA 1GUIA 1HB2A 2VECA 5BXXA 4JGYC 2BWCA 4GAZA 3H3LA 3K48A 3MIEA 2I74A 1PNGA 2V4AA 3R4UA 4XIOA 1VMHA 3ZXEA 1YFUA 3T2PA 2YXSA 4DQAA 1VBA1 4TN7A 5BNOC 2WZR1 2WWJA 5GZEA 1RUH1 4AFBA 3AL6A 4DIQA 1NCQC 2R16A 1YC61 1OQEA 3B00A 2BP6A 1ZX5A 3WZ1A 4YSFA 2ZS6B 2PAEA 3B93A 5SV8A 1JYCA 1QJX3 2FZ1A 1N1YA 1GV9A 2ZABA 1HIXA 1XNCA 1H9PA 2D44A 4D7YA 5IVJA 2DFCA 1IPSA 1WW4A 3B7MA 3RNSA 4E9KA 5KC6A 1U5IA 5C8WA 1X7NA 2Y33A 3ZR5A 5CKNA 2TUNA 1HV1A 1JZ2A 4OUSA 1R081 1LHUA 2CAVA 3QD6A 3HNMA 4OUMA 1TME1 1H1IA 1NXD1 2VZOA 3AJZA 5CYYA 4YVWB 3U37A 1W0NA 5FYMA 5A3OA 3MUZ1 4QPWA 5EQUA 1UWWA 4QQLA 1QHDA 1Q8QA 2JDPA 4ATFA 1JTZX 3NO8A 3INAA 3TEZA 2DYCA 4YRDA 3I8TA 2JDMA 1O8SA 4MV2A 5IATA 1UYPA 2OKXA 3M4FA 1QF3A 4YZ5A 3PUHA 5CA6A 1UOGA 4XAEA 3VKLA 2Y6GA 4RGAA 4I0BA 2UWBA 5JWPA 4OLLA 1SLLA 2WT0A 3JBG3 4RA0A 2ILMA 2HJIA 3VZLA 4A3ZA 1VLNA 3VDDB 4DNYA 2JDKA 2BGOA 2DUQA 1U0AA 2VOXA 2YU1A 2D6KA 4HBNA 4TSVA 4QB2A 2F6BA 1OH4A 1D2SA 2PHRA 5DDJ1 2JE9A 3AP6A 2WZPP 2PHWA 2W95A 5T5LA 4PI2A 1WMDA 2NMOA 3URFA 4COZA 1YI7A 1AZDA 2A3YA 1MR5A 1CX4A 3AJYA 3ZIXA 3KV6A 4P14A 4DXSA 4QKNA 4NR1A 2YC2A 3N36A 1MZ6A 2RS33 2ZZQA 4Q4Y3 2E6VA 3LOBA 4LPLA 3M1HA 5IW0A 4YW4A 5FZ7A 1AR71 4UFMA 3PMEA 3W21A 3HD8B 1J1LA 1ENXA 3IDCB 3WHUA 5KXEA 3J4UH 3A0KA 2ZX0A 2WKKA 3O7OA 1AYM3 1FMD2 2WNUB 3I7DA 4M0HA 5FP4A 5FYZA 3ZFFB 3I2OA 2OVUA 2IC1A 3MLKA 4Q4V1 4N7UA 5A7NA 2ZGRA 1UY4A 5JCTA 3FC0A 1MQTB 3BTYA 4K20A 1RUD1 4NAOA 1HRV1 5A6YA 2JD4A 3WCSA 2MEV1 3I97A 4QXHA 5FZ8A 5FPLA 3FUOA 1PNFA 5HCHA 5BNPA 3AB0A 2BEOA 3BODA 4BK4A 4ZZ8A 2CGOA 5C70A 1E5SA 2OW4A 2R061 3QACA 3JB8A 2WNUA 3KF5A 4P9LA 2QQOA 3ZFFA 1VB4A 3QH7A 1E57A 1VBB2 4RHV1 4XCBA 4AZZA 3AP9A 4KBZA 5JXHA 4YVWC 1PZ9A 2P3KA 5DAWA 3FE5A 3PVBB 4OHXA 4XF4A 4XURA 3N4MA 3OPTA 3RDIA 1ACCA 2I2SA 4XQWA 3NL1A 5TSWA 4E4ZA 2W94A 2HBUA 3WNXA 4GB31 2HWE3 5FLIA 5FYYA 4UXAA 4LMFA 1O3RA 1OPOA 4KMQA 2JIGA 2RS53 1Y9GA 1O8PA 3VHRA 4XHXA 1YIFA 1YJKA 2OQ7A 3B9IA 4IV3B 4K3UA 4YZ3A 5KC5A 1MZ5A 1YEWA 4D6RA 1WWYA 3WX5A 4IE4A 2ENRA 1AR82 4XF9A 3VDDC 2DCTA 1MS9A 4PLMA 2WC2A 3AXDA 4R9DA 1JYIA 2C9KA 3K77A 5C4WB 3IAPA 3RZMA 4JX0A 1SACA 4N9HA 1GNZA 2FDGA 3HQXA 1F4AA 1HB4A 1BBT3 2A6VA 1OD3A 3ZO0B 1TG7A 1WD4A 2D5FA 3LPGA 5IJRA 4OI1A 4I01A 1LOGA 5CISA 3HMYA 3UETA 4ZKTB 2A6ZA 5DAQA 4LBJA 5FYTA 2C0ZA 2MHFA 1T6BX 3ZXLA 1AYM2 2FDJA 1Q5OA 1WW6A 2YBSA 1OFSA 2VULA 2K9ZA 1RUE2 2VG9A 5IAVA 4YM1A 4YYOA 2ZPXA 2B46X 3N9OA 1MEC2 3FN9A 2TNFA 3AYDA 4YWAA 5LEKA 2ZGLA 2NYYA 3RQ0A 4Q29A 1NLRA 2RR12 2ZAAA 3NQHA 4Q8LA 2BTVC 3HNYM 1EAH1 2WO7A 2YFZA 1A34A 1RVF2 1XE7A 3PUIA 3T1MA 4AR2A 4JDNA 2GMPA 3VV1A 1CX1A 4BQ4A 2JG9B 3VBSA 4A7KA 1JYWA 2GN3A 4NUBA 1H8VA 1MQTC 2HWD2 2XBO3 4BDVB 4DPNA 2WZEA 3I2GA 1DBNA 2YC4A 3P6BA 2BRTA 1R091 1WA6X 4JCKA 4XUPA 2JX9A 3KVAA 4FPJA 3OGRA 1RUI3 5T54A 4X6RB 1VPHA 3MPPG 2IXIA 3WF0A 2NM1A 1IKQA 3KLSA 1XU1A 3ZN4A 3OUJA 4JKLA 3V65A 4AHWA 2CSGA 1U5ZA 2ZMKA 3LE0A 3NRUA 4SLIA 4XFAA 4ES9A 5CFCB 4UF0A 4P02B 3CIHA 4EWDA 1NT0A 2JG9A 2VMIA 5FP3A 4PQ9A 3AM2A 3DECA 1JZ3A 2VNRA 1EPWA 1Y4WA 2XLAA 5JOWA 3S0MA 2ARBA 2ZA9A 2WNVA 3DV8A 5IHRA 1F31A 1AXKA 4QKFA 4WVZA 5GLWA 3GZUC 3FBMA 2V72A 1ZZCA 4OI2A 4QX5A 3NV1A 3T4VA 4XFCA 3L2YA 5BV6A 3TEYA 2QJVA 3GZTB 1HQLA 5A6QA 1TQ5A 3JXSA 2XHNA 3RGBA 5CFCA 3KMHA 4YW7A 2HWF3 3I2KA 3ACGA 4QM8A 5FYCA 3OEAA 3WD5A 5JPNB 4IETA 4QKBA 3FWEA 5DXDA 1NQJA 4LA3A 2BFUL 4MGYE 3C7FA 2ZMNA 4PQQA 2ZGPA 2OX0A 1ONAA 3M8LA 5E6HA 4E8CA 1C1LA 1GQPA 4M01A 3O1OA 5FP8A 1ZZ8A 5FV3A 3AX4A 4LBQB 1GZCA 5C4WC 1VRH2 4ASLA 3NNJA 5FQ0B 5FPZA 4MLOA 5J37A 2VXRA 4GALA 1W2AX 4YW2A 4AI0A 4QX0A 4NPRA 1JZ4A 5C7GA 5IVFA 1PO21 5GZFA 2WYSA 4P9JA 1QJY1 1VP6A 5I0TA 1CN1A 4O61A 4XDOA 1K5MA 1LHVA 2Y0IA 1PIV1 3C3VA 3R4DB 3POJA 4LBLA 3AMQA 4EWEA 2CY6A 4E4SA 1VBE2 1VMJA 2PHUA 2Y0OA 3VUOA 1XU2A 5FAXA 1NA1B 5FQ0A 3SQOA 1HRI2 4UW6A 2FCVA 1O4TA 2D6NA 3PL0A 2JDYA 3KB5A 3I2DA 3BU7A 3AFKA 4K7JA 5F39A 1W9TA 1QDOA 5LWBA 4G9SB 1UYYA 4RN5A 2WFPA 3H7JA 1L7LA 3SCHA 4Q8KA 1ULFA 3C7EA 2ORZA 4L92A 2E31A 5E8AA 1NA1A 3K46A 3MIGA 4CU6A 1C8M1 3B02A 4A42A 1OI6A 1UN1A 5LZ6A 3U4XA 3V0BA 3S57A 5J48A 2WT1A 5JMOA 2L9LA 5ABJB 2IWGB 2RS11 2W91A 1QU0A 3MGUA 3H8UA 4FP3A 5FZ6A 1RUF3 2IZWA 3PU8A 1X50A 1YQ2A 3N9QA 3Q9OA 4UW5A 1Q3EA 3SITA 4YFZA 2Q0AA 4XOGA 1OA3A 5BUVA 1JUHA 4MGIE 1DIWA 3MLLA 3VL8A 2XB6C 3ASIA 2W1QA 4Q0QA 4QPGB 4E2GA 5CKMA 2VL4A 4K6BA 4IEPA 4QKDA 3ILRA 4CDXB 3BOPA 2YYOA 1US3A 3CLPA 4KU7A 5AC92 4XUOA 4LT5A 1IG0A 5K0UB 4WBBA 1ODMA 1H8TC 2CNAA 2JB8A 4OHWA 4GMP0 1W28A 1CZSA 3EBRA 4PDWB 3RWKX 3T2OA 4AFMA 3S7EA 1JU3A 2VQTA 5L9BA 5IWFA 5FXWA 1OF3A 5C9AA 3JD73 2RMU2 4QHBA 3AXEA 2RG4A 4AF9A 1IQDC 2VZRA 4QPGA 2GC2A 4DUXA 1FOD3 4AAPA 4CDXA 1JOPA 4IGOA 3WDYA 3NJXA 2Q1FA 4CU8A 3CEWA 3NNGA 3NW4A 2D6OX 1BK0A 4R52A 5EFUA 5K0UA 1HXS1 3PURA 1LOFA 2YG0A 1COV1 4QXKA 4PDWA 1YIPA 2GNDA 2ZGQA 3B3QE 2VZVA 3HQUA 1AX2A 4JTNA 5D21A 1VAMA 4HONA 3ZYIB 4ZXKA 1BEV2 1UYZA 4TLGA 1LECA 5BNNC 2ZHNA 2XKPA 2YGMA 4YM0A 3VKNA 2X29A 2VZUA 4QXBA 3ZFGA 1Z7S3 4JGZC 3WNOA 4COVA 3UESA 4F3JA 4AFCA 5APAA 2VCBA 2VJXA 3S6PA 4HPKA 4Q5OA 1BLZA 1IZ3A 2VCMA 2NZ9A 5C33A 3RI8A 3CU7A 4NRQA 4HG6B 1PZ8A 4HZFA 3VBFA 3U0ZA 1AYN3 2R32A 5KBFA 4PT6A 2XJVA 4K8FA 3K75B 5LBEA 3MDPA 4FPFA 1LULA 1SLAA 3NJYA 4MXVA 4FXKB 2BZDA 3UT0A 1S4CA 2PQSA 3NAPB 5A7QA 4FVVA 4SBVA 3PNAA 1JI6A 5FYIA 3VZJA 2ZGUA 3TN92 3OUHA 3LAGA 1UX6A 4AI2A 3ZM8A 5ABJC 1YO8A 5C3PA 4YW6A 1OLQA 3R6SA 5B4NA 3SEEA 3RZLA 1SQ4A 2PLV1 2WZ8A 2VUDA 4RR3B 5FXXA 1V6NA 4COWA 1Z0HA 1O4ZA 2XMLA 1F8VA 3KV5A 2GZWA 1POV3 4IQPA 3K4AA 3GCWA 4AI1A 4BQ2A 1D4M1 4X8NA 1RHI2 5GLUA 4HKWA 1WCQA 2VZSA 4LR4A 3OTFA 4JKMA 4KWLA 1ASJ1 4QX2A 3WW4A 3IZOA 4CCCA 4EN8B 1JZ8A 4XPVA 1V9U1 2DBIA 3AZYA 2XJUA 4XBNA 4I0AA 5HPOA 5KHJA 1DFQA 1O6UA 4DUVA 1QEXA 1REDA 3ACFA 3D0JA 4H7LA 5FFOC 4ZZ5A 3NJVA 3WQ7A 2UY9A 1ZBA2 4QT6A 2OA2A 1S0CA 4K9SA 5BPXA 3UJOA 2AH2A 4CEWC 2Q8CA 4YNIA 1H1MA 4JQTA 2AR6A 3ZXDA 4BZ4A 1WW5A 4P5HA 2EALA 2YGLA 4FAHA 1PO11 3PU3A 1JOBA 4ORFA 1ULEA 1NCRB 4HSJA 5FYVA 3WDVA 4DXZA 2VC9A 2Q30A 4CUGA 1SLIA 1AR61 1VIWB 4ZXEA 4I09A 1MPXA 2ARAA 5C3SA 3GBGA 4LK7A 3P1IA 1FNYA 2RVAA 2FHRA 2Y26A 4XHBA 1W9FA 2VBBA 1CJDA 2VOTA 4IL7A 5CKQA 1RUNA 4MO3M 1AYN2 1WLTA 2GC0A 2ZMLA 4GXLA 4IEWA 3KV9A 4KWUA 2BGCA 1O5UA 5FP9A 4B4PA 4B8EA 4NMIA 1UY0A 2HYKA 2ZZJA 3AKQA 3FLRA 3OGSA 4H3WA 1ZBE3 4PI0A 1F4HA 3WNMA 1QJX1 2WNOA 4CP0A 4FTBA 4PLNA 1BHGA 4Y22A 2JG8B 3E1F1 3GJAA 5IK7A 1CGPA 3GNEA 4IE5A 3IN9A 1QJU3 5FZ9A 2EAKA 1FNZA 1LTEA 2RDRA 4ET7A 1GZTA 2J1UA 3BTZA 3J8F1 5CFDA 2E32A 1WGPA 3DKQA 3HEIA 1IOAA 4R8HA 3SCGA 1CONA 1H4HA 2XHKA 3CKHA 4CZSA 5HXVA 2XGXA 3KT1A 3LB9A 2JXAA 4RFRB 2JG8A 4RR3C 3UKNA 1VMFA 2ZX1A 1VRBA 4NHMA 2WQ4A 5IAXA 3U07A 4Y5SA 1GZWB 1SLCA 3POIA 1QNWA 1VBC2 3GXUA 4XZUG 1HB1A 2DBNA 4EJRA 4MHRA 2A7AA 5FZOB 5SV5A 1PM4A 1W8WA 5K7PA 1XYOA 3OBZA 5JI9A 2V5YA 5CZKA 3RJRA 3THCA 4AQTA 1RUOA 1RXGA 3B9CA 5FWEA 4BMBA 3JBG1 4EQVA 5FOBB 1AF9A 1QJFA 4F83A 4HMZA 1QNYA 4NOTA 2YHJA 1W0PA 5DUUA 1C1FA 1CESA 1GZWA 1K45A 1UW8A 2R042 2YY1A 3HBKA 3KT7A 5F5QA 1M4WA 2DCJA 2HKXA 1W8OA 2ZEZA 1RUG3 2A71A 2ZEXA 3PTYA 4JRLA 4GH4B 5FO7B 1UZZA 3KQ4B 4IGPA 4WM8B 3C2UA 1AR92 1HN1A 1VAVA 2OIIA 3GHMA 1RB8G 3K4ZA 4XFFA 1A6CA 1RJ8A 4GJZA 3I49A 1W8ZA 3WLUA 4HN1A 5LA9A 4Q4Y1 2SBAA 2EXHA 1YYNA 3LD8A 1DQ0A 5E16A 2WABA 3VB9A 5I0DA 4M3CB 5DZFA 3LIGA 2V09A 4QDRA 3KM5A 2XQXA 4AQ6A 1XXNA 1CAUB 4MOAA 4WM8A 1DGWA 2XG3A 2GNTA 5EZWA 5H9QA 2ET1A 5LK5A 4GWNA 3APBA 1YWKA 4WVMB 4AEDB 2P37A 3N7KA 4OQ9A 4XFHA 4BJ0A 4AXOA 4C0BA 2GNBA 2VOWA 4LBMA 1M06G 1S0IA 2RHPA 4N53C 4PBOA 4GWJA 3IPVB 2OXBA 2D7FA 4MGQA 3NKTA 2R49A 3EO6A 3ORJA 3DXTA 3KF3A 5EYYA 5JOYA 1W6QA 3D0SA 4IW3A 2BBAA 1WCUA 1KFXL 5B4XA 1CAVB 2EXJA 4I30A 3HJRA 3LWCA 3W59A 2ZKNA 2XL9A 2WO3A 2CYFA 5K4LA 5KXDA 1JUIA 3PLQA 3MW2A 2VH9A 4R9AA 3ST7A 4AVTA 4GZ9A 4FFHA 2HWE1 1O59A 1B09A 1UOBA 1W2TA 2C9AA 3W58A 1GBGA 3BI3A 1J84A 4LBQD 2B5HA 2W1SA 1ZRCA 4W50A 1B35A 1ZZ7A 3BPSA 3SLIA 2QQVA 3DN7A 2CGPA 3E6DA 5BNQA 4DY3A 2RS51 5FMOL 3EQEA 4KH9A 1PGL2 1KDMA 4BU2A 3VBHC 2NLRA 5LASA 5JXGA 3KV4A 2UY8A 4NROA 2JD9A 4BCUA 4CCOA 1YCIA 2DUPA 4Y5TA 5FK7A 1AXYA 2W46A 4CDWB 1BBT1 2CHHA 4FBFA 3T0AA 4CCKA 2YU2A 2BGPA 2HWB1 1SG3A 2VCCA 4M4PA 4NRMA 3WF4A 2WT2A 2DTYA 5FZDA 1ZRRA 3DKWA 3RYRA 2BBVA 2UURA 1GFF2 2X53S 4AI8A 3LA2A 2XJTA 3BUCA 2LROA 4JHTA 5FBZA 1Q8OA 5IFPA 4ZU7A 1TMF1 3LZZA 5DUWA 3WP6A 2QQMA 2ZOEB 1W8TA 4A7YA 4YM2A 1PMHX 1ULGA 2C5DA 4MX3A 2E63A 3MHZA 4G4FA 5KHGA 3GBWA 1G9FA 3BYWA 3LF7A 1N1TA 5F5CA 1CR7A 1NXMA 4HLTA 5G05L 4AEDC 5IK5A 2PYTA 2XBO1 1PMJX 2XJSA 4YLZA 5FZ3A 1RL3A 1XNTA 3USUB 4DUWA 4XMIA 3WP3A 4EN6B 1UKGA 3ZOIA 5F6KA 4XJ8A 3M3IA 5A80A 4OHYA 1RUI1 1IHMA 2G9FA 3V56A 1PZ7A 2JENA 2ZHLA 3NV4A 1OOPC 3DF0A 1DLCA 2P5BA 2XWBB 2XVKA 1ZZ9A 1V6JA 4XDPA 3MF9A 5F1RA 1TNRA 1W6NB 3GCXA 1AL23 3S5AA 2V4VA 3BALA 3Q8CA 3RZJA 3D4KA 2DVAA 3USUA 2SLIA 2I45A 1UYXA 3WF2A 1XBFA 2XH6A 4RSUA 4XMAA 1BVP1 4PLOA 1UO9A 5LA2A 1Z78A 5FY9A 4PHZA 2VR4A 4L2NA 4XBLA 3VDAA 4E27A 1NYWA 5IT6A 1RUJ2 3GJBA 4BLIA 1PHMA 3G7DA 2QKDA 1NY72 4NHXA 1QJEA 4Q4W2 5A3TA 3WQ0A 1G6NA 1W9WA 5GLZA 1QKQA 4A4AA 2HWF1 4Y4YA 1LESA 4YW3A 1W6NA 1WUVA 5CG8A 2GC3A 2W47A 2K2SA 1FMD3 2VMFA 2YV8A 1JXNA 2PHLA 4HVOA 2R0HA 3J7LA 1HV0A 1T2XA 4E2SA 1GU3A 2JDUA 4CDUB 3VBRC 3W9AA 1WW7A 3BCWA 2VOVA 3FX3A 3OOXA 2DCZA 4FPLA 4XJAA 2B42B 1UL9A 3SKVA 4OHVA 3VBUB 1CPNA 4C91A 2JDNA 3FHAA 4L8QA 3WDUA 1NX9A 2WO2A 3GHNA 5T3NA 1H9WA 2OZ6A 2Z42A 4CXXA 4XTMA 3IWZA 2JKXA 3JZVA 4XUTA 1MS8A 3G6JB 3KCCA 4CCDA 2A6YA 4QM9A 4WVWA 3R4SA 1BMV1 1RGSA 4TZDA 3ZN6A 2BVVA 1DHKB 1VBB3 1GNHA 4Y5Z0 3N35A 4XVHA 4CDUA 4PF5A 4MZUA 4FFFA 4E4DX 1K42A 2P17A 4GIQA 4MVTA 5J09A 1UMHA 1JN2P 3VBUA 4CXWA 2WQ8A 5C71A 4RS5B 2OT7A 3IDEA 3POSA 4M3CE 1US2A 5JZGB 4YW5A 3Q8EA 1LB2A 3LDRA 2LM3A 5F3GA 3BOWA 4CEYC 1Y9QA 2AGSA 2IXCA 3V64A 1LENA 2FMDA 5HCFA 2DFBA 1O3TA 5H9SA 4DS0A 2ZXQA 5FZFA 4H2AA 4D7SA 1SDWA 4IESA 4CCLA 4K8RB 1W6OA 4QPYA 2XVGA 2W08A 1ND2C 3K3OA 1AL22 4DY5A 2GAUA 4RS5A 1AR83 5AFBA 1ULPA 1DYPA 4TLFA 2D40A 2IXKA 2R072 2WBKA 3DXUA 5JZGA 3W5NA 2VCAA 4OMDA 2ZGKA 1PK6B 2J42A 4CCMA 5EWSA 4CXYA 5I8TA 4BXFA 1KITA 2CV6A 2Q5TA 1RUF1 3GGLA 2F4LA 4IERA 4UW4A 4BM8A 5BNPB 2AEYA 1TVGA 2Z79A 1G9AA 1KJRA 5FY0A 1QMJA 3SXWA 3AMPA 3O0WA 3W5MA 3WNPA 4B3NA 1RUE3 1W9YA 3RYPA 1BVVA 5KXBA 3AMHA 2R1DA 2BYVE 4XZPA 1MEC3 1RUC1 3WP4A 3C7OA 4HFSA 2XKOA 1PGW2 1PK6A 2RR13 2YC0A 3I3BA 4TXWA 3OY8A 1PX4A 2LTNA 3N9MA 5LA1A 1RVF3 1SZBA 1KD7A 3SNMA 5LBCA 5ANNA 1IPKA 2ZJCA 4NIGA 1UMIA 2D3SA 1LODA 4UFIA 4AYUA 4CPBA 3I3MA 3SEPA 2HWD3 4NWVA 3SH3A 2PMWB 3O5SA 1U5YA 4Q26A 1FOD1 2D6LX 5CADA 4QX8A 1I5ZA 2E26A 3ILNA 4IE7A 4YGEA 2B4KA 1W06A 1MS4A 1FV3A 1SFNA 4Q0SA 1NZIA 3KD4A 4UAPA 4BQ3A 2N7GA 4DEVA 4LHLA 1W9SA 3H0OA 2WRAA 1QQP2 1MVQA 1DYOA 1VBD2 5GLVA 3DPRA 1XNKA 4ASKA 1WMXA 1I9RA 3ZIWA 5FO9B 4EN0A 4BWOA 1Z7S1 3JUUA 1AXZA 1GWMA 1HJGA 2JECA 2WDBA 2VY0A 4OZOA 4OHZA 4AEJA 5A1FA 2WFF2 1UY2A 1GP4A 2P2KA 4KI5M 4QD2A 1DGRA 4J25A 1UCXA 1ZM1A 1V6LA 5JR7B 1CZTA 4V1PA 4EV0A 2P3YA 3OGJA 2XWJB 1YI9A 3UV9A 4BQ5A 2P6CA 2XJRA 1C5HA 1BYHA 4CCJA 1SLBA 5FKCA 3A7QA 4E4HA 4K40A 3AMMA 4QHZA 2CL2A 2ZACA 4UYBA 3TNQA 1Y43B 1CD3G 1LU1A 1NE6A 3PTRB 4KWKA 4ZU4A 1BCXA 1MS3A 2QQWA 5LB6A 5FYSA 3VBSB 2BUKA 2D97A 4FPOB 1VRH3 2YBKA 4GKXA 4LULA 2E7QA 3ZYFA 4ASMB 3WCRA 4HETA 2V73A 2HWC2 4P9IA 2GNMA 3MF6A 3RZGA 3KSCA 1UIJA 4LKDA 1S0GA 3WW2A 1DU3D 1N47A 1S0DA 3ETQA 2VNGA 5C3RA 1POV1 3WDWA 4D69A 2OS2A 2WNUC 3IBMA 4RQPA 1CZVA 3ZFFC 1VBE3 2AEZA 2GP5A 1H2NA 3H1YA 1F5JA 5DZGA 2W1UA 4UF0B 3OG2A 4D6SA 5JMCA 4WM7A 3WF1A 2EIEA 4JDMA 2DVBA 1HRI3 2OYZA 1C4RA 2RM21 1W2UA 3MIHA 2WNVB 1NLQA 4IEUA
chains in the Genus database with same CATH topology
2VUCA 1UQXA 5HCHA 2BV4A 5A6XA 1OVSA 2VUDA 1OVPA 4UT5A 4CE8A 2VNVA 1W8FA 5A6ZA 2BOIA 5A70A 3DCQA 2JDYA 1W8HA 2JDUA 2JDHA 2BOJA 1OUXA 3ZDVA 2JDKA 1GZTA 2JDNA 1UZVA 1OURA 5D2AA 5A3OA 5A6QA 1OUSA 1OXCA 2JDPA 4AOCA 2BP6A 2CHHA 5A6YA 2WRAA 2WR9A 2XR4A 2JDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUC A;  1UQX A;  5HCH A;  2BV4 A;  5A6X A;  1OVS A;  2VUD A;  1OVP A;  4UT5 A;  4CE8 A;  2VNV A;  1W8F A;  5A6Z A;  2BOI A;  5A70 A;  3DCQ A;  2JDY A;  1W8H A;  2JDU A;  2JDH A;  2BOJ A;  1OUX A;  3ZDV A;  2JDK A;  1GZT A;  2JDN A;  1UZV A;  1OUR A;  5D2A A;  5A3O A;  5A6Q A;  1OUS A;  1OXC A;  2JDP A;  4AOC A;  2BP6 A;  2CHH A;  5A6Y A;  2WRA A;  2WR9 A;  2XR4 A;  2JDM A; 
#chains in the Genus database with same CATH topology
 4XQD A;  1G86 A;  3RS6 A;  1ZZ6 A;  5FDB A;  2RJK A;  4IXL A;  5EJ1 B;  4D6Q A;  2OZJ A;  4W6W A;  5EPA A;  5KWR A;  2Q8D A;  3VDC A;  4RYD A;  3MYX A;  1OLM A;  4RD7 A;  4ONU A;  4HK9 A;  3WF3 A;  5F3E A;  3NNF A;  2BOJ A;  5LRR A;  3T30 A;  3IAQ A;  1AX1 A;  1X36 A;  1X8E A;  4B29 A;  3AMN A;  3VZK A;  4KGG A;  4X6Q B;  5CBL A;  1RMU 2;  1PVC 2;  2W92 A;  3PJQ A;  3D3A A;  4Y1Z A;  2ZHK A;  5FMC A;  2E33 A;  1L7R A;  4XF3 A;  1N1V A;  5FYB A;  3VD4 A;  2VNO A;  2RJ2 A;  5FUN A;  1W05 A;  3H3Z A;  4MG2 A;  4E2Q A;  4LO5 B;  1WD3 A;  4MXW A;  3ROU A;  5ACA 1;  1TE1 B;  5C3O A;  1K5M B;  5JXJ A;  4F7Z A;  1WBL A;  4IV3 C;  3O1U A;  3L9J T;  5EJ3 A;  3X29 B;  1LU2 A;  3J7H A;  5AC9 3;  1ULD A;  1ZBE 1;  1G9B A;  2K0G A;  1VBA 3;  5A3L A;  5H9R A;  4XJW A;  3H8R A;  1KXG A;  2QZ2 A;  3LDB A;  3WVJ A;  4RGK A;  2FD8 A;  3WT3 A;  1DDL A;  4GQ7 A;  1S2B A;  1QJU 1;  1MAC A;  5T5O A;  4D8M A;  2RMU 3;  3WXP A;  3MIB A;  1S1A A;  4ZU5 A;  3U78 A;  4A45 A;  5KHH A;  1ZRD A;  4DMI A;  3RPQ A;  1HB3 A;  3TB0 A;  1RIT A;  1XJA A;  3ITQ A;  3ZXJ A;  3BKZ A;  2PTM A;  4RFT 0;  3M7A A;  1WCS A;  4NIA A;  4OYU A;  1AVB A;  1YRZ A;  4P9X A;  3U4S A;  1LKN A;  2Q8O A;  2PFW A;  4D7T A;  2BVB A;  2J1A A;  5LCW L;  5FZK A;  2VO5 A;  3V0B B;  1BEV 3;  1C5I A;  2PHF A;  2Y64 A;  4W8J A;  4JRA A;  4Q4X 2;  4XET A;  3DYM A;  2WS9 2;  2D98 A;  5HV4 A;  3CZJ A;  4NPL A;  3VN4 A;  3ES1 A;  3T2Q A;  1JHJ A;  1H1A A;  2JG9 C;  2XJQ A;  4IEY A;  4P00 B;  2QTW B;  1NOV A;  5F9T A;  2A75 A;  4XIL A;  2DWR A;  4JHZ A;  4IGQ A;  3TYJ A;  1AJK A;  1WCD J;  2G4I A;  5GZD A;  3CJI A;  3NKG A;  1EV1 2;  1LHW A;  1S0E A;  2UYA A;  2VBD A;  5A1A A;  1D0H A;  2XXZ A;  5HXM A;  4XJZ A;  5CNA A;  1GQG A;  5CFC C;  1RUG 1;  1J1T A;  3ZPY A;  3N7M A;  3N9P A;  5L7O A;  1R1A 2;  3FLP A;  2DVG A;  3KHC A;  3GAL A;  2C1F A;  4NVP A;  1SPP A;  2FDK A;  1Q56 A;  1ENS A;  1I6X A;  4HK8 A;  5C9A B;  4PIX A;  5GKA C;  3NJZ A;  3TN9 3;  4L99 A;  2KM2 A;  2ZGO A;  1HKD A;  5DAX A;  4ISR A;  5FXV A;  5T55 A;  4JGZ A;  2E51 A;  1JU4 A;  1IQA A;  3O1V A;  1OMI A;  1L7Q A;  1VBA 2;  4HAN A;  4JKK A;  3VL9 A;  5C8C A;  4O7X A;  2WZR 2;  1OSG A;  5FBJ A;  1QWR A;  3FLT A;  1VJ2 A;  1FAT A;  1UPS A;  1RUH 2;  3JQW A;  2VW0 A;  5FIX A;  4XW3 A;  2CDO A;  1RHI 3;  4XAA A;  1NE4 A;  3I2F A;  4UT5 A;  2ET7 A;  2XVL A;  2VU9 A;  4KNC A;  4LLO A;  4UI9 L;  2Q1Z B;  1WKY A;  5HBA A;  4CVU A;  3WDX A;  4TTG A;  3ZFG B;  2E7T A;  4QQO A;  4B1L A;  2D93 A;  1ZVF A;  1ZBA 3;  3FMG A;  5CB7 A;  1D0G A;  1IGO A;  4UBH A;  4EN7 B;  1LHO A;  4HPK B;  4HOO A;  5FY1 A;  1YQC A;  1OKQ A;  1GOH A;  1YQ8 A;  5FO8 B;  1R08 2;  4C90 A;  1ZRF A;  3VBF B;  1TME 2;  3ZSL A;  4I3G A;  1UX7 A;  4PIZ A;  2ZKL A;  3THD A;  3HQR A;  1Y7B A;  2PXJ A;  2Z69 A;  3UK9 A;  4Q1P A;  5J3U A;  1FX5 A;  1H30 A;  2VVF A;  4N43 B;  4FOV A;  1SFP A;  4CP2 A;  2PAM A;  1LOE A;  4UWD A;  3MEP A;  4CYD A;  1NA1 C;  3POE A;  3TEW A;  1BK1 A;  4N90 A;  5I8Y A;  4NJ4 A;  3ZKU A;  2EA7 A;  4QHO A;  1YNA A;  4QDS A;  3CL1 A;  3OYW A;  3S7I A;  4LBK A;  3ILF A;  1DYK A;  4K21 A;  2H6C A;  1UXZ A;  2X5I B;  3MUY 1;  2FDI A;  4N43 A;  1K12 A;  1UMZ A;  4FPC A;  4BIS A;  4Q27 A;  2LW8 A;  2D43 A;  2ZGM A;  2GME A;  3ZYG A;  4Y1Y A;  5FPX A;  3WG3 A;  5DDJ 2;  5JPM B;  3IKW A;  3MV1 1;  3QBQ A;  1XPW A;  3WG2 A;  2FQP A;  1N3O A;  2R30 A;  2MPF A;  4S2H A;  4AI3 A;  2F4P A;  3AYA A;  2ERF A;  1OD5 A;  2X5I A;  5E1R A;  4YW1 A;  2A5Z A;  5C9A C;  4DO0 A;  1W39 A;  4AGR A;  4LHN A;  1FPN 1;  4QPG C;  3UGG A;  4DRR A;  4P9W A;  4N9I A;  1AR7 2;  1KQR A;  3KCX A;  4P9G A;  4CDX C;  4FSJ A;  4GWI A;  4HXC A;  5L73 A;  5JI7 A;  5FY5 A;  5K0U C;  3UKT A;  1H4G A;  4H7M A;  1LOF C;  2YBP A;  4ISQ A;  5CIR A;  4PDW C;  4XF1 A;  1VBC 3;  2W3J A;  3UNP A;  3B94 A;  2J1V A;  5ANQ A;  4Q4V 2;  1J3Q A;  1YJL A;  2WR9 A;  3CZU A;  3DEM A;  3N9N A;  2ID4 A;  3NNM A;  5C6C A;  2XPJ A;  4R9B A;  5IYY A;  1RUD 2;  2D5H A;  1HRV 2;  1WZX A;  3NV3 A;  4DXR A;  1JYX A;  2YB7 A;  2G1M A;  1OVP A;  2MEV 2;  4IEZ A;  5T50 A;  2FMY A;  1H6Y A;  1JW6 A;  3U14 A;  1W0O A;  1ZA7 A;  5L9V A;  4AGV A;  1NUK A;  3QCW A;  2PQQ A;  1W03 A;  4PJY A;  1OH3 A;  3HR9 A;  2R06 2;  4COU A;  4QU1 A;  1XB9 A;  2R04 3;  4XCA A;  4K1Y A;  3SIS A;  2Q8E A;  2ZEW A;  4RHV 2;  3OF1 A;  3VBF C;  3LEM A;  1UPI A;  4QQP A;  4Y22 B;  5FZC A;  2JE8 A;  3AP7 A;  5JR2 A;  1TEI A;  3VHP A;  1AR9 3;  5FPV A;  1CAX B;  5A33 B;  2OUJ A;  2DTW A;  3AZZ A;  4QPI A;  1GOG A;  1TNF A;  3OD0 A;  1KGY A;  4BE3 A;  4FOY A;  2KD7 A;  4HVQ A;  5CFD B;  1W8N A;  4C1X A;  1FI2 A;  4QXC A;  2C6S A;  1RYY A;  2PHT A;  2P34 A;  4GB3 2;  1ZZB A;  4R9C A;  5BY5 A;  3O1T A;  1RIN A;  1HN0 A;  4FI9 A;  3WUC A;  2YUE A;  1DGR N;  4AL9 A;  1WCK A;  1V6I A;  2BOI A;  4CSW A;  5A70 A;  2WQZ C;  3WQB A;  2P3J A;  1KEX A;  1JYN A;  2P3I A;  3H1M A;  1R1Z A;  2B39 A;  3KZ4 C;  2WWU A;  4XTP A;  4B1M A;  1CAX A;  1EPZ A;  5FYU A;  5A33 A;  3UGF A;  4I3P A;  4BXS V;  4P08 A;  1F2N A;  4YM3 A;  2UWA A;  2CTV A;  2RDQ A;  3NAP C;  5DZE A;  5JOX A;  4OCT A;  2JDA A;  3H50 A;  5A3W A;  4NII A;  5EV7 A;  3VBO A;  2DU0 A;  3BPZ A;  3M3O A;  2CGN A;  4XIK A;  1OT5 A;  2D3R A;  3NV2 A;  5I91 A;  1JH5 A;  2WAA A;  4DXT A;  2KR2 A;  1GQH A;  4UOJ A;  4A3X A;  1H6X A;  4CUA A;  1VBB 1;  4ERO A;  1W8F A;  2RJL A;  3I54 A;  5A6Z A;  3NST A;  3MW4 A;  1OLR A;  3ETP A;  1CQ9 A;  2J22 A;  1BJQ A;  3SMH A;  4DZG A;  1K5J A;  5FWJ A;  1XRU A;  3LEG A;  5FTT C;  2W0X A;  4NID A;  5IK8 A;  3LPF A;  2QQL A;  5L19 A;  1EAH 2;  4DB5 A;  1QY4 A;  5M0T A;  2G9G A;  3IMN A;  1OKO A;  5G04 L;  3I59 A;  1ND3 B;  3PHM A;  3OGG A;  1LGB A;  2VM9 A;  2GH2 A;  2ZBJ A;  2ARE A;  4W6X A;  4AVC A;  2K46 A;  5D8A A;  4YVS A;  1NG0 A;  1E5H A;  1R09 2;  2VW1 A;  2BJS A;  1OVS A;  3NMB A;  4NHK A;  3VDB A;  1UZ0 A;  3AZX A;  1NCR C;  3ON7 A;  2OQ6 A;  1AR8 1;  3RMX A;  4B7K A;  5GLT A;  4V2V A;  1LNS A;  1ENQ A;  4PCR A;  4UW3 A;  1ND3 A;  4L0P A;  4A7Z A;  3VD9 A;  1N3Q A;  1W2N A;  2RS3 1;  4QGM A;  3MZH A;  3AVR A;  1ZA4 A;  2Y8K A;  4MGS A;  5JLV A;  3DUI A;  1H2L A;  5A32 A;  2VPV A;  2FCU A;  4CP9 B;  1OUR A;  1NZC A;  2E9Q A;  3HNB M;  3M3Q A;  4QQH A;  2VTX J;  5F32 A;  3THP A;  4CDQ A;  3SH4 A;  5FZB A;  1AYM 1;  2HH9 A;  1OXC A;  3KT4 A;  4LO8 A;  5CFD C;  2YPJ A;  1RUE 1;  3ZSJ A;  1IS4 A;  5F3I A;  1UOF A;  3TRS B;  1QGL A;  4LIU A;  1MEC 1;  3RVH A;  1W6Q B;  1W6P B;  2QQJ A;  3POB A;  4XXA A;  2RR1 1;  1D7P M;  5CAZ A;  5HV0 A;  1RVF 1;  1QOS A;  2JG8 C;  3VBH A;  4Y20 A;  1XE8 A;  1QH7 A;  4CP9 A;  5LEJ A;  4KU8 A;  1LED A;  4QX7 A;  3GYD A;  2WA4 A;  2JDH A;  4AK3 A;  2J1S A;  1FT9 A;  2H0B A;  2VZ3 A;  5CU1 A;  2HWD 1;  1JYT A;  4QB1 A;  3R05 A;  4BH9 A;  1BKZ A;  2WII B;  2PEL A;  3MIC A;  5FZI A;  1B35 B;  2QUO A;  3WNK A;  4JV4 A;  1UU4 A;  3M3E A;  4LE4 A;  4AVV A;  1W6P A;  5C5U A;  3I3D A;  4LIT A;  1GNY A;  3ZYB A;  1PO2 2;  1W99 A;  1QJY 2;  2LRP A;  4AGG A;  3J7N A;  4HVR A;  3D6E A;  3SHR A;  3H1W A;  1VR3 A;  1PIV 2;  3FUQ A;  2VXJ A;  5FXZ A;  3ZYR A;  5FJH A;  4CDU C;  1I1E A;  4FPH A;  1ALY A;  3T0B A;  3ZFE A;  5F37 A;  4YZ2 A;  1EY2 A;  3LGR A;  1WMF A;  4L9B A;  2QFE A;  3LKJ A;  3JCI A;  4L11 A;  4J1W A;  1T6G C;  5IVC A;  4JGY B;  4P5Y A;  2HBT A;  3LCP A;  5AVA A;  1RUJ 3;  4YAR A;  1SBF A;  3E6C C;  1JS9 A;  2PHD A;  1XND A;  5F8P A;  4ZS2 A;  1UKR A;  5LAT A;  1K3I A;  1UF2 C;  4Q4W 3;  2W1W A;  2MNG A;  2WN3 A;  2ADD A;  5FY7 A;  4I2O A;  5F7U A;  3CJX A;  3N3H A;  1CJP A;  1NCQ B;  1XYN A;  3HBZ A;  4IV1 A;  4IND A;  4QGL A;  3NNL A;  4GH4 C;  4JZR A;  1REF A;  2RDN A;  4WM8 C;  1C8M 2;  4JGY A;  3WW3 A;  3OSD A;  4HT1 T;  3JQX A;  3CHX A;  2Y38 A;  3AP4 A;  2EIG A;  4NIH A;  3K2O A;  1OQ1 A;  2RS1 2;  4MSV A;  1J59 A;  3VD5 A;  5BNO A;  1ZRE A;  2YMZ A;  4FPK A;  1JZ6 A;  1RTV A;  1NCQ A;  4Y1X A;  5F2W A;  3IMM A;  5KHI A;  1GKB A;  2TEP A;  4LLF A;  1S0B A;  1TZO A;  2CU5 A;  3I3E A;  3OPZ A;  4CA9 A;  1VBE 1;  5LA0 A;  1KFU L;  5FY8 A;  4U36 A;  3AYC A;  2R1B A;  1HQN A;  3ZYH A;  2Q4S A;  4XQ4 A;  2C4X A;  1HRI 1;  5EP9 A;  4ATE A;  2KA3 A;  1IS6 A;  4HL0 A;  2VGD A;  1J3P A;  2AUY A;  2QZ3 A;  3AFG A;  1YQ6 A;  2WA3 A;  4Z1V A;  4S2G A;  3O1S A;  4CCN A;  3A21 A;  1KDK A;  3K51 A;  2IVI B;  3ECQ A;  4O9E A;  2WNE A;  4AWD A;  5I0S A;  1RIR A;  1XOY A;  3I2H A;  5IVY A;  3ENR A;  1B35 C;  2FDH A;  5GAL A;  5CEH A;  4MGK E;  3PUS A;  1CAW A;  2VE1 A;  2D6M A;  1S0F A;  2VUJ A;  1HXS 2;  4GWM A;  3UKV A;  2R07 3;  1COV 2;  1LGC A;  5D2A A;  5KXC A;  4DOU A;  2QCS B;  3OGV A;  4LIV A;  2DV9 A;  1OBN A;  4XJ9 A;  4BYY A;  3HT1 A;  4DRV A;  3O1P A;  3MPB A;  4QB6 A;  5FMB A;  4Z2A A;  5J98 B;  1S2K A;  4EWA A;  4MH0 E;  1JOJ A;  2BDR A;  2DCK A;  2QQN A;  3SH5 A;  3VZO A;  1QXJ A;  4KG0 A;  1C8N A;  5FRE A;  1POV 0;  4ZY9 A;  3U10 A;  4OUE A;  1SMV A;  3IIA A;  4BK5 A;  5J36 A;  1MS0 A;  2UWC A;  2ATF A;  5JDB A;  3ZN6 B;  4A6O A;  5DPN A;  1MZE A;  4LBN A;  1BZW A;  2EVX A;  1OUX A;  3ME2 A;  4XFB A;  2E7A A;  5AC9 1;  4OZX A;  2J1T A;  2W52 A;  2WUH A;  4YGC A;  3RRD A;  1DQ1 A;  2ZCW A;  1ND2 A;  1U5X A;  2WAO A;  4FOW A;  3BTA A;  2WLP A;  4KQ7 A;  3LIH A;  3RJ2 X;  5A1L A;  5IFT A;  1C3H A;  3AKR A;  3GF6 A;  4CDW C;  2DDU A;  5GZC A;  1UU6 A;  2WJS A;  4AHY A;  5J1X A;  1QH6 A;  1WA4 A;  2RMU 1;  3AYE A;  4YG0 A;  1HJF A;  3T1L A;  2O8O A;  2BV4 A;  3OB8 A;  3VZM A;  3R0R A;  1JZ7 A;  4RGG A;  4FPE A;  1W6O B;  5HI0 A;  2PLV 2;  4GUL A;  4MUV A;  2YRO A;  1MVE A;  2BFU S;  3BB6 A;  2FBE A;  1DQ5 A;  3ATG A;  3J8F 3;  1QOT A;  3LSE A;  4NWW A;  3I4I A;  1GLH A;  4Q0U A;  1BEV 1;  5F5A A;  2J1R A;  1FPN 2;  1D4M 2;  1QQP 3;  4AI9 A;  4M0N A;  4Z82 A;  3POF A;  2XOM A;  1VBD 3;  2ZHM A;  4Y1U A;  4D0Q A;  4FTS A;  1ASJ 2;  2A73 B;  2Z4F A;  3LSD A;  2VME A;  3RWN A;  1G9D A;  1V9U 2;  2QDR A;  5LRS A;  2A1X A;  2QBX A;  3OUI A;  3WNL A;  4DIN B;  3B5L B;  4BIF A;  3ZMN A;  3BIW E;  4GMP 3;  3VKM A;  4M3C F;  4JQR A;  2WFF 3;  4LEJ A;  4D94 A;  1GYK A;  2XR4 A;  3MFA A;  4URA A;  1XSQ A;  1CPM A;  3EMR A;  1UZY A;  4LHS A;  5A7O A;  3PJY A;  2JWP A;  1NKG A;  4BOW A;  4YVW A;  2WSV A;  5DUX A;  3HAG A;  1SLT A;  3ALQ A;  1XC6 A;  1PO1 2;  3OY8 B;  1APN A;  2BU9 A;  5FRA A;  3I3Q A;  1DF0 A;  2QNK A;  3VD3 A;  3MO4 A;  2C24 A;  1ZNP A;  1QDC A;  4AVA A;  4NN0 A;  1IPJ A;  2XDV A;  4BQX A;  3WW1 A;  1AR6 2;  4AEK A;  4EE2 A;  3O12 A;  1LEM A;  3TN9 1;  4LOT A;  1SEF A;  4NPM A;  3JU9 A;  5LBF A;  4K1Z A;  5F5I A;  3RI9 A;  2BER A;  4GJY A;  2Y6K A;  4L97 A;  2HWC 3;  1O3Q A;  4EZH A;  4URT A;  1RC6 A;  5K8S A;  2XQR A;  1GAN A;  3FHQ A;  3ZPO A;  5A6X A;  3OBA A;  4S2D A;  1P8J A;  4HN0 A;  3SCF A;  4D3W A;  3VDD A;  4FAG A;  2NMN A;  1YLL A;  3IDA A;  1RHI 1;  3JD7 1;  3RFR A;  2YZ4 A;  3AL5 A;  4XUN A;  1WLC A;  3ABZ A;  4FPG A;  4ITC A;  1W8H A;  4NRP A;  4ZON A;  3ZSE A;  1QJX 2;  2R7E B;  3DPR B;  4JDO A;  3VBU C;  1LOC A;  2H6B A;  4OQ8 A;  1LCL A;  2C26 A;  1URX A;  4LQR A;  1O5L A;  3F95 A;  1E5I A;  5DMY A;  1ZBA 1;  1UZV A;  4XC9 A;  5T5J A;  1KS5 A;  5FUP A;  4AFA A;  2VD7 A;  3DYO A;  2LAL A;  3J8F 2;  2WLQ A;  4AOC A;  5FK8 A;  5LY2 A;  4LKS A;  3A4U A;  3AKS A;  1AX0 A;  2ZTN A;  3ACL A;  3V0A B;  4XBQ A;  3POW A;  2GC1 A;  1XNA A;  5JSO A;  1LAJ A;  2HEV F;  2EF6 A;  3HWJ A;  1V00 A;  2DUR A;  1SHW B;  1STM A;  3N7J A;  4RS5 C;  1O4Y A;  3Q8B A;  1RMU 3;  4OMC A;  1PVC 3;  2TBV A;  5JZG C;  1PM7 A;  4YPJ A;  1JZ5 A;  5I0R A;  4XJU A;  5FJK A;  1MQT A;  3H9A A;  1FAY A;  2Y34 A;  1S0J A;  4IUG A;  1X9T A;  1AYN 1;  3V0A A;  3JB4 C;  3M70 A;  2ARX A;  5EXO A;  2WIN B;  1IG3 A;  5DAV A;  4AQS A;  4X8P A;  4YZ1 A;  3RMY A;  3JBG 2;  4XAB A;  3CF6 E;  2X10 A;  4RQP B;  1A8D A;  3PIJ A;  4TWT A;  3THT A;  1YHF A;  3PVO A;  1X82 A;  4FCA A;  3B01 A;  3HN3 A;  4AEM A;  4BQW A;  1GMM A;  4FXG B;  3WUD A;  4WM7 B;  3LA3 A;  3N7L A;  1PK6 C;  2EAA A;  4XYX A;  4CU9 A;  5D1I A;  1GOF A;  4LBO A;  1GP6 A;  1LHN A;  4LA2 A;  5LY1 A;  2PA7 A;  2QQU A;  5BNP C;  4AAX A;  3LFI A;  4LKF A;  5L9R A;  5T52 A;  3ACI A;  2ZAH A;  2LS6 A;  2RS3 2;  4BHP A;  3EB7 A;  1D4V B;  4Q4Y 2;  2J7M A;  4XAC A;  2RV9 A;  4BB3 A;  3BVC A;  1GIC A;  2I07 B;  3CDZ B;  1OA2 A;  3VKF C;  1H0B A;  2HWB 3;  3POY A;  1E5R A;  2B9V A;  4IE0 A;  4QWN A;  2VMD A;  2HYX A;  2O14 A;  2A70 A;  2XON A;  3P3N A;  1W2O A;  2ZGN A;  1PGS A;  2VQU A;  1JHN A;  4IV3 A;  4Q0P A;  3BIE A;  4LNV A;  3VLB B;  1Q43 A;  1XSR A;  1VBC 1;  3CQO A;  3IM0 A;  1OFN A;  4Q4X 3;  5DG2 A;  3SKJ E;  2WS9 3;  4OFG A;  5C4W A;  3UJQ A;  2X8K A;  4CE8 A;  4LUK A;  1WLW A;  3AKP A;  2VQA A;  1HW5 A;  1LRH A;  1TMF 3;  1UIK A;  5FMD A;  3DPR C;  4I0W B;  3Q8F A;  5I8S A;  4MXW B;  1W6M B;  1QJZ A;  3ES4 A;  1PVX A;  3K4D A;  1EV1 3;  2A6W A;  2ZEY A;  3WY6 A;  1N3P A;  4IEX A;  2R04 1;  4C8D A;  3EJK A;  1YFW A;  1H2K A;  3E6B A;  5DUV A;  3ZLI A;  1YQ5 A;  2Y6F A;  2QE3 A;  3IDB B;  1R1A 3;  5FY4 A;  2IXJ A;  2VZ1 A;  4WZF A;  1AR9 1;  4F8A A;  2CWS A;  2P1B A;  5KHK A;  4COY A;  4KBB A;  3TBD A;  2VTX A;  2PAK A;  3MLJ A;  3ZMO A;  1X33 A;  1Y3T A;  5DN2 A;  1W6M A;  2W5F A;  4WZC A;  1GSL A;  4XF0 A;  4XXP A;  4Y4R A;  3WNN A;  4P9Y A;  4E8D A;  3LOI A;  1GZ9 A;  2HWE 2;  3VHO A;  2Q1M A;  1V6O A;  2EXK A;  2XLG A;  3VKO A;  1SDD B;  5IUQ A;  4ES8 A;  5GZG A;  1LJ7 A;  2WZR 3;  5FUI A;  3O14 A;  1DGW X;  2RS5 2;  1RUH 3;  1Y9M A;  3J26 N;  4LHK A;  3AZV A;  3T08 A;  3UYJ A;  3LFM A;  5J96 B;  3H42 B;  5A3P A;  4HKL A;  4LO7 A;  4RQP C;  1DGL A;  2CDP A;  1H8T B;  4AQ2 A;  4CCE A;  1J3R A;  2ETE A;  3AP5 A;  4LJH A;  3VBS C;  4WM7 C;  1F15 A;  2GSY A;  5A3U A;  2O0O A;  1BBT 2;  3CMG A;  4IEV A;  1HDK A;  2RDS A;  4NAM A;  4EN9 B;  1EUU A;  5GJ6 A;  1ODN A;  1UD1 A;  2HWB 2;  3PUQ A;  2YDE A;  1IS5 A;  1H2M A;  1R08 3;  3CJI B;  4LE3 A;  1TME 3;  3OEB A;  5FZH A;  3USS A;  3ZKY A;  1W90 A;  2JB4 A;  3GM8 A;  4JC1 A;  5FP7 A;  2HEY F;  2IUW A;  3GZE A;  3PDQ A;  3TOJ A;  2IFW A;  1H8T A;  3KGL A;  3DYP A;  2VAU A;  5L7O B;  1C28 A;  1NLS A;  3L2H A;  1TMF 2;  5A7W B;  5ISL A;  5FLH A;  4Z2W A;  1SPP B;  1DP0 A;  3J7M A;  3A22 A;  4IEO A;  1QXP A;  4JVA A;  2GN7 A;  2WNV C;  4YG3 A;  5BNN B;  2BWA A;  1HX6 A;  3E5Q A;  3ZSK A;  5FZL A;  4W6Y A;  3A0N A;  2DVD A;  5FR3 A;  3H8X A;  4LBQ A;  3ZXA C;  1QXR A;  2XBO 2;  1X8M A;  3BGA A;  4JGZ B;  2GDF A;  2ZX2 A;  3FL7 A;  4MGT A;  3U11 A;  1DLL A;  3MV0 1;  4J1X A;  5C8C B;  1PGL 1;  4CUC A;  1UZW A;  5A7W A;  1G7Y A;  4B4Q A;  1O7F A;  1RUI 2;  1KS4 A;  2WSU A;  5A7S A;  3U75 A;  4KWJ A;  3B69 A;  4FTE A;  3LEI A;  2XLF A;  4NE9 A;  3S30 A;  3U1X A;  4ARY A;  3VGI A;  5BNN A;  5DDJ 3;  4H14 A;  2EIC A;  2HEW F;  4O9G A;  4Y24 A;  4QQ2 A;  3ZVX A;  1KJL A;  5JOZ A;  3MI8 A;  3D82 A;  1OUS A;  2GAL A;  2PHX A;  2VQ0 A;  3MIF A;  3P3P A;  4R4Z A;  4U2A A;  4CUB A;  5JXI A;  2IVJ A;  1SBD A;  1OQD A;  2VZQ A;  1ZRI A;  1BQP A;  3ELN A;  1OA4 A;  4W65 A;  4I02 A;  4MET A;  4B7E A;  1K5M C;  3CO2 A;  3QLQ A;  4MYE A;  2VMH A;  4A41 A;  2OPK A;  1AR7 3;  3H3U A;  3O0V A;  2O1Q A;  2X05 A;  5JIU A;  1W8U A;  2HWF 2;  5C5T A;  4DEQ A;  4IEQ A;  4QX1 A;  3WHT A;  3F2Z A;  1LR5 A;  3GDB A;  2VW2 A;  4Q4V 3;  2NP0 A;  3IB3 A;  2EID A;  1VE0 A;  2GP3 A;  1RUC 3;  4PIY A;  5FPU A;  5DQ0 A;  5IVV A;  1RUD 3;  1HRV 3;  5ABJ A;  5LW9 A;  4UFH A;  2BNO A;  3AK0 A;  4AHZ A;  2MEV 3;  3OYW B;  4BQY A;  5A7P A;  3PVN A;  1SBE A;  3QOP A;  2EXI A;  3WP5 A;  1NAE A;  3KCY A;  4N7I A;  4CEW B;  1SCS A;  1WBF A;  2R06 3;  2VVE A;  3WV6 A;  1DZT A;  2Y60 A;  3D5O A;  3NVC A;  5CVR A;  4LO4 B;  2Z5W A;  1OF4 A;  1BMV 2;  3CJI C;  4RHV 3;  3M3C A;  1OHF A;  3SC7 X;  3ZYJ B;  4KL1 A;  1XE0 A;  1ZYB A;  3CBN A;  2UYB A;  3ACH A;  1OLM E;  3C7G A;  5IK4 A;  5L7O C;  3MID A;  1S55 A;  1W3X A;  1GWK A;  1RUJ 1;  2ARC A;  3EYP A;  3QH6 A;  4CEW A;  4IDZ A;  4GB3 3;  5E88 A;  1NY7 1;  4Z07 A;  4Q4W 1;  3M2M A;  4G3Y C;  4KGQ A;  2AZ5 A;  2WYF A;  1DG6 A;  1XNB A;  4YZ4 A;  4AFD A;  1YFX A;  1JMU B;  1O91 A;  3UL2 A;  3E97 A;  3KVB A;  5C8C C;  2O8Q A;  1QOO A;  3K3N A;  1DQ6 A;  1UAI A;  2NQY A;  2DCY A;  4YFW A;  3WEZ A;  1G8W A;  2F17 A;  1EP0 A;  3DCQ A;  2H0V A;  2DVF A;  1BXH A;  3MFC A;  5DG1 A;  3AVS A;  2WN2 A;  5FMO S;  2XUM A;  2UU8 A;  1ULO A;  2E53 A;  3O1R A;  1RUF 2;  4W4Z A;  3RZK A;  3T0D A;  2ORX A;  5FZ4 A;  1HQW A;  1LOA A;  3WDT A;  1U12 A;  1L3J A;  4BPZ A;  5DAP A;  4QU2 A;  1V6M A;  4Z92 B;  2G19 A;  3H8O A;  2Y6L A;  2ZGT A;  1VB2 A;  3KS7 A;  3O1M A;  1NQD A;  5AFE A;  4FP2 A;  4Q1R A;  2PN5 A;  3FFQ A;  3ZXF A;  1FV2 A;  2XL7 A;  1QIQ A;  1RUC 2;  3GBF A;  3FFZ A;  5I93 A;  3W20 A;  3ZN5 A;  1CIY A;  2JJ6 A;  3ZDS A;  3Q8A A;  1EAH 3;  4Q0V A;  1I3H A;  3RSJ A;  2RE9 A;  5F3C A;  4J6G A;  3I2J A;  2AC1 A;  5JVV A;  4QPI B;  4ZPI A;  1KRI A;  2KXL A;  3ZFG C;  1V6K A;  4ARX A;  4HKO A;  4JTO A;  3NAP A;  3JD7 2;  2CAU A;  4GD4 A;  4CPB D;  2BQP A;  2IXL A;  3S5Q A;  2LUW A;  1LGN A;  1FOD 2;  4CP1 A;  1R09 3;  2RM2 3;  2WL1 A;  4RR3 A;  3RZH A;  1AL2 1;  5F2S A;  3O0X A;  3VHN A;  2FCT A;  2ZX3 A;  2R07 1;  4ZHN A;  4N43 C;  3PIG A;  4FFG A;  3WG4 A;  1CIW A;  5IVE A;  2VOK A;  3C7H A;  5K9Y A;  1UQX A;  1VAK A;  2JE7 A;  4LOS A;  1VAL A;  4UFK A;  2R0F A;  2YPD A;  3CNA A;  5FPB A;  3VBO B;  3E5U A;  2IFR A;  3TWI A;  2VMG A;  1R64 A;  1Q8V A;  2QQK A;  3AZW A;  3ZXK A;  3TNP B;  1Z7S 2;  5JSP A;  1FMD 1;  3PVE A;  1JYV A;  4CRQ A;  2BPA 2;  1D2Q A;  1CVN A;  4GKY A;  2X5I C;  3EXU A;  4M4R A;  2ADE A;  5FZG A;  1YFY A;  3HN1 A;  4ZS3 A;  1G9C A;  4IE6 A;  5LK7 B;  1PGW 1;  5DAB A;  1A78 A;  2VVD A;  2P4E A;  4CTE A;  1NCR A;  5ACA 3;  4N8M A;  2QVS B;  3HT2 A;  1X9P A;  4FT8 A;  5FZA A;  4LTA A;  3LDK A;  4MGZ E;  2AAC A;  4JAA A;  2VUC A;  3BN6 A;  4FPY A;  3T4H B;  3WOG A;  1UOJ A;  3J9S A;  2A3W A;  2JKB A;  2A6X A;  3I59 B;  4OI4 A;  5JSR A;  5B2G B;  3HIF A;  4UBG A;  3I2I A;  5T5P A;  5ERL A;  1DQ2 A;  4GA9 A;  2A3X A;  4NO4 A;  4LOR A;  5D8A B;  4N53 B;  4KG8 A;  4YVS B;  1W04 A;  2W2I A;  3T09 A;  3VZN A;  2VUA A;  2DUO A;  3GZA A;  4Q2F A;  5JIA A;  1PO2 3;  1Q8S A;  5FZM A;  1EYB A;  3ZSM A;  1QJY 3;  2OPW A;  5FZE A;  2JIC A;  1GR3 A;  2X09 A;  2FDF A;  2ZGS A;  1PIV 3;  2V5D A;  2XUE A;  3LQC A;  1N1S A;  1XQN A;  2B7Y A;  3OBT A;  1QQP 1;  4LK6 A;  5H9P A;  2OUH A;  3T2T A;  1VBD 1;  5FKB A;  2BW8 A;  3MW3 A;  4QMA A;  1I5P A;  5A32 B;  3POG A;  4N53 A;  4FFI A;  4Y33 A;  3TEX A;  2RM2 2;  1JBC A;  2HLE A;  4GMP 1;  1UXX X;  4CDQ B;  2WFF 1;  4QPI C;  4Y3O A;  1DQ4 A;  3ZX7 A;  1HLC A;  3RG0 A;  1CWP A;  4YGD A;  3A23 A;  2GH8 A;  1OC1 A;  2ZX4 A;  2VTF A;  4DFS A;  4AW7 A;  3VBH B;  3LEK A;  4Y20 B;  4BME A;  1C8M 3;  1F9K A;  4PBP A;  2VMC A;  5FZ1 A;  5FZ0 A;  2VZP A;  1F5F A;  3VD7 A;  1SFY A;  5LBB A;  3H7Y A;  3HPN A;  2QQI A;  2RS1 3;  1S2E A;  2JIJ A;  5J7M A;  1IS3 A;  5FZO A;  4QAW A;  5FCC A;  2HWC 1;  2NPI A;  4XUQ A;  5CG9 A;  2CWM A;  5E89 A;  3VBO C;  4OUL A;  2GMM A;  3AKT A;  1IKP A;  1YXW A;  3WQ1 A;  4AVB A;  2EIB A;  1PMI A;  1ULC A;  3RZZ A;  5ACA 2;  2GU9 A;  1SCR A;  1MS5 A;  4M00 A;  2Z2S B;  1W3V A;  2Y6H A;  4A2U A;  3N9L A;  3WIN E;  4QDQ A;  2B9U A;  3OBR A;  5FYH A;  5C3Q A;  1ZBE 2;  2W87 A;  1OPM A;  2D6P A;  3KHB A;  3NWK A;  4TYS A;  4C1W A;  3ZFE B;  2G9Z A;  4GH4 A;  5A3M A;  1C57 A;  1POQ A;  1MS1 A;  2P6H A;  4Y26 A;  4AVS A;  4S2F A;  1JOD A;  2B8M A;  5F6L B;  3BU0 A;  1QJU 2;  4A6S A;  1ENR A;  3WG1 A;  4Y1V A;  4C0H A;  2AYH A;  4WVV A;  1UU5 A;  3HOB A;  1AHS A;  4LO6 B;  4OVE A;  4XDQ A;  3DL3 A;  2J1E A;  2VZT A;  1GP5 A;  5JAX A;  1UY1 A;  5D8A C;  4YVS C;  2BNN A;  4IV1 B;  4M3C A;  1HXS 3;  3E5X A;  1COV 3;  3WR0 A;  3FJS A;  1CAU A;  2ES3 A;  4Z8B A;  1OOP B;  4YGB A;  1RMU 1;  2QQP A;  1PVC 1;  3BTX A;  5IVB A;  4QX3 A;  4WVM A;  5I0U A;  2WO1 A;  4FOQ A;  4AED A;  1ND3 C;  5L36 A;  3III A;  1GWL A;  4UFJ A;  5FLJ A;  2FZ2 A;  4MHU A;  2BNM A;  5BNO B;  2YFU A;  5HCA A;  1DZR A;  1PX3 A;  4CU7 A;  3MBW A;  1UNB A;  1XYP A;  4NHL A;  5JUV A;  4EZ4 A;  3IPV A;  4XFG A;  3ZXG A;  1J58 A;  2W68 A;  3UGH A;  4CDQ C;  4B4R A;  1OOP A;  3EHK A;  1MZF A;  5FPA A;  1DCS A;  2DU1 A;  4HSL A;  2AEN A;  4FQ4 A;  5GM0 A;  2JDZ A;  1VRH 1;  3IT8 A;  5AVP A;  1RUG 2;  3KWV A;  5EIY B;  1CAV A;  5EHD A;  3WSO A;  2DF7 A;  4LKE A;  3VBR B;  3ZYP A;  2R6Q A;  3ZDV A;  1WME A;  2W9X A;  3D8C A;  3PUA A;  4LUM A;  2XJP A;  3KQR A;  3LA7 A;  1DZQ A;  3OCP A;  1AUY A;  4AE2 A;  5BYN A;  1A3K A;  2PLV 3;  3KGZ A;  2WWS A;  1RXF A;  3OPW A;  1A8M A;  3HVD A;  4BA6 A;  4BIO A;  1CAW B;  1Q8P A;  5KR7 A;  1WLD A;  3AC0 A;  4XEZ A;  4YG6 A;  1LOB A;  4FO9 A;  4OI0 A;  3FBY A;  3VBR A;  3ZR6 A;  2D3P A;  1RJ7 A;  1AL0 G;  1D4M 3;  1FPN 3;  1V70 A;  2VNV A;  2QDN A;  4Q4X 1;  2VBP A;  4XFI A;  5EJZ B;  1ST8 A;  2WS9 1;  4EYU A;  2JEM A;  5FOJ B;  1ASJ 3;  4AG4 A;  4AHX A;  1V9U 3;  4R4X A;  4FQZ A;  4A44 A;  3TAY A;  3RYK A;  4MAD A;  4XE9 A;  4BQ1 A;  3ZFE C;  3T3Y A;  4BLJ A;  4CDW A;  2B45 X;  3OD4 A;  1FYU A;  3PMS A;  4CEY B;  2NN8 A;  1YUD A;  3DGT A;  1FXZ A;  1J83 A;  1UY3 A;  1V0A A;  1EV1 1;  2Y6J A;  4O65 A;  1AJO A;  1F35 A;  4H55 A;  3FZ3 A;  4WV8 A;  1O3S A;  4LXL A;  5HCB A;  3OJB A;  4RL7 A;  1PO1 3;  1ND2 B;  1REE A;  4NHY A;  5EYX A;  4QGN A;  2W39 A;  2IXH A;  1R1A 1;  5A3N A;  3FHI B;  4IV1 C;  4PF1 A;  1AR6 3;  3P5B A;  1EUT A;  4UFL A;  3C8X A;  4V2W A;  4CEY A;  1GUI A;  1HB2 A;  2VEC A;  5BXX A;  4JGY C;  2BWC A;  4GAZ A;  3H3L A;  3K48 A;  3MIE A;  2I74 A;  1PNG A;  2V4A A;  3R4U A;  4XIO A;  1VMH A;  3ZXE A;  1YFU A;  3T2P A;  2YXS A;  4DQA A;  1VBA 1;  4TN7 A;  5BNO C;  2WZR 1;  2WWJ A;  5GZE A;  1RUH 1;  4AFB A;  3AL6 A;  4DIQ A;  1NCQ C;  2R16 A;  1YC6 1;  1OQE A;  3B00 A;  2BP6 A;  1ZX5 A;  3WZ1 A;  4YSF A;  2ZS6 B;  2PAE A;  3B93 A;  5SV8 A;  1JYC A;  1QJX 3;  2FZ1 A;  1N1Y A;  1GV9 A;  2ZAB A;  1HIX A;  1XNC A;  1H9P A;  2D44 A;  4D7Y A;  5IVJ A;  2DFC A;  1IPS A;  1WW4 A;  3B7M A;  3RNS A;  4E9K A;  5KC6 A;  1U5I A;  5C8W A;  1X7N A;  2Y33 A;  3ZR5 A;  5CKN A;  2TUN A;  1HV1 A;  1JZ2 A;  4OUS A;  1R08 1;  1LHU A;  2CAV A;  3QD6 A;  3HNM A;  4OUM A;  1TME 1;  1H1I A;  1NXD 1;  2VZO A;  3AJZ A;  5CYY A;  4YVW B;  3U37 A;  1W0N A;  5FYM A;  5A3O A;  3MUZ 1;  4QPW A;  5EQU A;  1UWW A;  4QQL A;  1QHD A;  1Q8Q A;  2JDP A;  4ATF A;  1JTZ X;  3NO8 A;  3INA A;  3TEZ A;  2DYC A;  4YRD A;  3I8T A;  2JDM A;  1O8S A;  4MV2 A;  5IAT A;  1UYP A;  2OKX A;  3M4F A;  1QF3 A;  4YZ5 A;  3PUH A;  5CA6 A;  1UOG A;  4XAE A;  3VKL A;  2Y6G A;  4RGA A;  4I0B A;  2UWB A;  5JWP A;  4OLL A;  1SLL A;  2WT0 A;  3JBG 3;  4RA0 A;  2ILM A;  2HJI A;  3VZL A;  4A3Z A;  1VLN A;  3VDD B;  4DNY A;  2JDK A;  2BGO A;  2DUQ A;  1U0A A;  2VOX A;  2YU1 A;  2D6K A;  4HBN A;  4TSV A;  4QB2 A;  2F6B A;  1OH4 A;  1D2S A;  2PHR A;  5DDJ 1;  2JE9 A;  3AP6 A;  2WZP P;  2PHW A;  2W95 A;  5T5L A;  4PI2 A;  1WMD A;  2NMO A;  3URF A;  4COZ A;  1YI7 A;  1AZD A;  2A3Y A;  1MR5 A;  1CX4 A;  3AJY A;  3ZIX A;  3KV6 A;  4P14 A;  4DXS A;  4QKN A;  4NR1 A;  2YC2 A;  3N36 A;  1MZ6 A;  2RS3 3;  2ZZQ A;  4Q4Y 3;  2E6V A;  3LOB A;  4LPL A;  3M1H A;  5IW0 A;  4YW4 A;  5FZ7 A;  1AR7 1;  4UFM A;  3PME A;  3W21 A;  3HD8 B;  1J1L A;  1ENX A;  3IDC B;  3WHU A;  5KXE A;  3J4U H;  3A0K A;  2ZX0 A;  2WKK A;  3O7O A;  1AYM 3;  1FMD 2;  2WNU B;  3I7D A;  4M0H A;  5FP4 A;  5FYZ A;  3ZFF B;  3I2O A;  2OVU A;  2IC1 A;  3MLK A;  4Q4V 1;  4N7U A;  5A7N A;  2ZGR A;  1UY4 A;  5JCT A;  3FC0 A;  1MQT B;  3BTY A;  4K20 A;  1RUD 1;  4NAO A;  1HRV 1;  5A6Y A;  2JD4 A;  3WCS A;  2MEV 1;  3I97 A;  4QXH A;  5FZ8 A;  5FPL A;  3FUO A;  1PNF A;  5HCH A;  5BNP A;  3AB0 A;  2BEO A;  3BOD A;  4BK4 A;  4ZZ8 A;  2CGO A;  5C70 A;  1E5S A;  2OW4 A;  2R06 1;  3QAC A;  3JB8 A;  2WNU A;  3KF5 A;  4P9L A;  2QQO A;  3ZFF A;  1VB4 A;  3QH7 A;  1E57 A;  1VBB 2;  4RHV 1;  4XCB A;  4AZZ A;  3AP9 A;  4KBZ A;  5JXH A;  4YVW C;  1PZ9 A;  2P3K A;  5DAW A;  3FE5 A;  3PVB B;  4OHX A;  4XF4 A;  4XUR A;  3N4M A;  3OPT A;  3RDI A;  1ACC A;  2I2S A;  4XQW A;  3NL1 A;  5TSW A;  4E4Z A;  2W94 A;  2HBU A;  3WNX A;  4GB3 1;  2HWE 3;  5FLI A;  5FYY A;  4UXA A;  4LMF A;  1O3R A;  1OPO A;  4KMQ A;  2JIG A;  2RS5 3;  1Y9G A;  1O8P A;  3VHR A;  4XHX A;  1YIF A;  1YJK A;  2OQ7 A;  3B9I A;  4IV3 B;  4K3U A;  4YZ3 A;  5KC5 A;  1MZ5 A;  1YEW A;  4D6R A;  1WWY A;  3WX5 A;  4IE4 A;  2ENR A;  1AR8 2;  4XF9 A;  3VDD C;  2DCT A;  1MS9 A;  4PLM A;  2WC2 A;  3AXD A;  4R9D A;  1JYI A;  2C9K A;  3K77 A;  5C4W B;  3IAP A;  3RZM A;  4JX0 A;  1SAC A;  4N9H A;  1GNZ A;  2FDG A;  3HQX A;  1F4A A;  1HB4 A;  1BBT 3;  2A6V A;  1OD3 A;  3ZO0 B;  1TG7 A;  1WD4 A;  2D5F A;  3LPG A;  5IJR A;  4OI1 A;  4I01 A;  1LOG A;  5CIS A;  3HMY A;  3UET A;  4ZKT B;  2A6Z A;  5DAQ A;  4LBJ A;  5FYT A;  2C0Z A;  2MHF A;  1T6B X;  3ZXL A;  1AYM 2;  2FDJ A;  1Q5O A;  1WW6 A;  2YBS A;  1OFS A;  2VUL A;  2K9Z A;  1RUE 2;  2VG9 A;  5IAV A;  4YM1 A;  4YYO A;  2ZPX A;  2B46 X;  3N9O A;  1MEC 2;  3FN9 A;  2TNF A;  3AYD A;  4YWA A;  5LEK A;  2ZGL A;  2NYY A;  3RQ0 A;  4Q29 A;  1NLR A;  2RR1 2;  2ZAA A;  3NQH A;  4Q8L A;  2BTV C;  3HNY M;  1EAH 1;  2WO7 A;  2YFZ A;  1A34 A;  1RVF 2;  1XE7 A;  3PUI A;  3T1M A;  4AR2 A;  4JDN A;  2GMP A;  3VV1 A;  1CX1 A;  4BQ4 A;  2JG9 B;  3VBS A;  4A7K A;  1JYW A;  2GN3 A;  4NUB A;  1H8V A;  1MQT C;  2HWD 2;  2XBO 3;  4BDV B;  4DPN A;  2WZE A;  3I2G A;  1DBN A;  2YC4 A;  3P6B A;  2BRT A;  1R09 1;  1WA6 X;  4JCK A;  4XUP A;  2JX9 A;  3KVA A;  4FPJ A;  3OGR A;  1RUI 3;  5T54 A;  4X6R B;  1VPH A;  3MPP G;  2IXI A;  3WF0 A;  2NM1 A;  1IKQ A;  3KLS A;  1XU1 A;  3ZN4 A;  3OUJ A;  4JKL A;  3V65 A;  4AHW A;  2CSG A;  1U5Z A;  2ZMK A;  3LE0 A;  3NRU A;  4SLI A;  4XFA A;  4ES9 A;  5CFC B;  4UF0 A;  4P02 B;  3CIH A;  4EWD A;  1NT0 A;  2JG9 A;  2VMI A;  5FP3 A;  4PQ9 A;  3AM2 A;  3DEC A;  1JZ3 A;  2VNR A;  1EPW A;  1Y4W A;  2XLA A;  5JOW A;  3S0M A;  2ARB A;  2ZA9 A;  2WNV A;  3DV8 A;  5IHR A;  1F31 A;  1AXK A;  4QKF A;  4WVZ A;  5GLW A;  3GZU C;  3FBM A;  2V72 A;  1ZZC A;  4OI2 A;  4QX5 A;  3NV1 A;  3T4V A;  4XFC A;  3L2Y A;  5BV6 A;  3TEY A;  2QJV A;  3GZT B;  1HQL A;  5A6Q A;  1TQ5 A;  3JXS A;  2XHN A;  3RGB A;  5CFC A;  3KMH A;  4YW7 A;  2HWF 3;  3I2K A;  3ACG A;  4QM8 A;  5FYC A;  3OEA A;  3WD5 A;  5JPN B;  4IET A;  4QKB A;  3FWE A;  5DXD A;  1NQJ A;  4LA3 A;  2BFU L;  4MGY E;  3C7F A;  2ZMN A;  4PQQ A;  2ZGP A;  2OX0 A;  1ONA A;  3M8L A;  5E6H A;  4E8C A;  1C1L A;  1GQP A;  4M01 A;  3O1O A;  5FP8 A;  1ZZ8 A;  5FV3 A;  3AX4 A;  4LBQ B;  1GZC A;  5C4W C;  1VRH 2;  4ASL A;  3NNJ A;  5FQ0 B;  5FPZ A;  4MLO A;  5J37 A;  2VXR A;  4GAL A;  1W2A X;  4YW2 A;  4AI0 A;  4QX0 A;  4NPR A;  1JZ4 A;  5C7G A;  5IVF A;  1PO2 1;  5GZF A;  2WYS A;  4P9J A;  1QJY 1;  1VP6 A;  5I0T A;  1CN1 A;  4O61 A;  4XDO A;  1K5M A;  1LHV A;  2Y0I A;  1PIV 1;  3C3V A;  3R4D B;  3POJ A;  4LBL A;  3AMQ A;  4EWE A;  2CY6 A;  4E4S A;  1VBE 2;  1VMJ A;  2PHU A;  2Y0O A;  3VUO A;  1XU2 A;  5FAX A;  1NA1 B;  5FQ0 A;  3SQO A;  1HRI 2;  4UW6 A;  2FCV A;  1O4T A;  2D6N A;  3PL0 A;  2JDY A;  3KB5 A;  3I2D A;  3BU7 A;  3AFK A;  4K7J A;  5F39 A;  1W9T A;  1QDO A;  5LWB A;  4G9S B;  1UYY A;  4RN5 A;  2WFP A;  3H7J A;  1L7L A;  3SCH A;  4Q8K A;  1ULF A;  3C7E A;  2ORZ A;  4L92 A;  2E31 A;  5E8A A;  1NA1 A;  3K46 A;  3MIG A;  4CU6 A;  1C8M 1;  3B02 A;  4A42 A;  1OI6 A;  1UN1 A;  5LZ6 A;  3U4X A;  3V0B A;  3S57 A;  5J48 A;  2WT1 A;  5JMO A;  2L9L A;  5ABJ B;  2IWG B;  2RS1 1;  2W91 A;  1QU0 A;  3MGU A;  3H8U A;  4FP3 A;  5FZ6 A;  1RUF 3;  2IZW A;  3PU8 A;  1X50 A;  1YQ2 A;  3N9Q A;  3Q9O A;  4UW5 A;  1Q3E A;  3SIT A;  4YFZ A;  2Q0A A;  4XOG A;  1OA3 A;  5BUV A;  1JUH A;  4MGI E;  1DIW A;  3MLL A;  3VL8 A;  2XB6 C;  3ASI A;  2W1Q A;  4Q0Q A;  4QPG B;  4E2G A;  5CKM A;  2VL4 A;  4K6B A;  4IEP A;  4QKD A;  3ILR A;  4CDX B;  3BOP A;  2YYO A;  1US3 A;  3CLP A;  4KU7 A;  5AC9 2;  4XUO A;  4LT5 A;  1IG0 A;  5K0U B;  4WBB A;  1ODM A;  1H8T C;  2CNA A;  2JB8 A;  4OHW A;  4GMP 0;  1W28 A;  1CZS A;  3EBR A;  4PDW B;  3RWK X;  3T2O A;  4AFM A;  3S7E A;  1JU3 A;  2VQT A;  5L9B A;  5IWF A;  5FXW A;  1OF3 A;  5C9A A;  3JD7 3;  2RMU 2;  4QHB A;  3AXE A;  2RG4 A;  4AF9 A;  1IQD C;  2VZR A;  4QPG A;  2GC2 A;  4DUX A;  1FOD 3;  4AAP A;  4CDX A;  1JOP A;  4IGO A;  3WDY A;  3NJX A;  2Q1F A;  4CU8 A;  3CEW A;  3NNG A;  3NW4 A;  2D6O X;  1BK0 A;  4R52 A;  5EFU A;  5K0U A;  1HXS 1;  3PUR A;  1LOF A;  2YG0 A;  1COV 1;  4QXK A;  4PDW A;  1YIP A;  2GND A;  2ZGQ A;  3B3Q E;  2VZV A;  3HQU A;  1AX2 A;  4JTN A;  5D21 A;  1VAM A;  4HON A;  3ZYI B;  4ZXK A;  1BEV 2;  1UYZ A;  4TLG A;  1LEC A;  5BNN C;  2ZHN A;  2XKP A;  2YGM A;  4YM0 A;  3VKN A;  2X29 A;  2VZU A;  4QXB A;  3ZFG A;  1Z7S 3;  4JGZ C;  3WNO A;  4COV A;  3UES A;  4F3J A;  4AFC A;  5APA A;  2VCB A;  2VJX A;  3S6P A;  4HPK A;  4Q5O A;  1BLZ A;  1IZ3 A;  2VCM A;  2NZ9 A;  5C33 A;  3RI8 A;  3CU7 A;  4NRQ A;  4HG6 B;  1PZ8 A;  4HZF A;  3VBF A;  3U0Z A;  1AYN 3;  2R32 A;  5KBF A;  4PT6 A;  2XJV A;  4K8F A;  3K75 B;  5LBE A;  3MDP A;  4FPF A;  1LUL A;  1SLA A;  3NJY A;  4MXV A;  4FXK B;  2BZD A;  3UT0 A;  1S4C A;  2PQS A;  3NAP B;  5A7Q A;  4FVV A;  4SBV A;  3PNA A;  1JI6 A;  5FYI A;  3VZJ A;  2ZGU A;  3TN9 2;  3OUH A;  3LAG A;  1UX6 A;  4AI2 A;  3ZM8 A;  5ABJ C;  1YO8 A;  5C3P A;  4YW6 A;  1OLQ A;  3R6S A;  5B4N A;  3SEE A;  3RZL A;  1SQ4 A;  2PLV 1;  2WZ8 A;  2VUD A;  4RR3 B;  5FXX A;  1V6N A;  4COW A;  1Z0H A;  1O4Z A;  2XML A;  1F8V A;  3KV5 A;  2GZW A;  1POV 3;  4IQP A;  3K4A A;  3GCW A;  4AI1 A;  4BQ2 A;  1D4M 1;  4X8N A;  1RHI 2;  5GLU A;  4HKW A;  1WCQ A;  2VZS A;  4LR4 A;  3OTF A;  4JKM A;  4KWL A;  1ASJ 1;  4QX2 A;  3WW4 A;  3IZO A;  4CCC A;  4EN8 B;  1JZ8 A;  4XPV A;  1V9U 1;  2DBI A;  3AZY A;  2XJU A;  4XBN A;  4I0A A;  5HPO A;  5KHJ A;  1DFQ A;  1O6U A;  4DUV A;  1QEX A;  1RED A;  3ACF A;  3D0J A;  4H7L A;  5FFO C;  4ZZ5 A;  3NJV A;  3WQ7 A;  2UY9 A;  1ZBA 2;  4QT6 A;  2OA2 A;  1S0C A;  4K9S A;  5BPX A;  3UJO A;  2AH2 A;  4CEW C;  2Q8C A;  4YNI A;  1H1M A;  4JQT A;  2AR6 A;  3ZXD A;  4BZ4 A;  1WW5 A;  4P5H A;  2EAL A;  2YGL A;  4FAH A;  1PO1 1;  3PU3 A;  1JOB A;  4ORF A;  1ULE A;  1NCR B;  4HSJ A;  5FYV A;  3WDV A;  4DXZ A;  2VC9 A;  2Q30 A;  4CUG A;  1SLI A;  1AR6 1;  1VIW B;  4ZXE A;  4I09 A;  1MPX A;  2ARA A;  5C3S A;  3GBG A;  4LK7 A;  3P1I A;  1FNY A;  2RVA A;  2FHR A;  2Y26 A;  4XHB A;  1W9F A;  2VBB A;  1CJD A;  2VOT A;  4IL7 A;  5CKQ A;  1RUN A;  4MO3 M;  1AYN 2;  1WLT A;  2GC0 A;  2ZML A;  4GXL A;  4IEW A;  3KV9 A;  4KWU A;  2BGC A;  1O5U A;  5FP9 A;  4B4P A;  4B8E A;  4NMI A;  1UY0 A;  2HYK A;  2ZZJ A;  3AKQ A;  3FLR A;  3OGS A;  4H3W A;  1ZBE 3;  4PI0 A;  1F4H A;  3WNM A;  1QJX 1;  2WNO A;  4CP0 A;  4FTB A;  4PLN A;  1BHG A;  4Y22 A;  2JG8 B;  3E1F 1;  3GJA A;  5IK7 A;  1CGP A;  3GNE A;  4IE5 A;  3IN9 A;  1QJU 3;  5FZ9 A;  2EAK A;  1FNZ A;  1LTE A;  2RDR A;  4ET7 A;  1GZT A;  2J1U A;  3BTZ A;  3J8F 1;  5CFD A;  2E32 A;  1WGP A;  3DKQ A;  3HEI A;  1IOA A;  4R8H A;  3SCG A;  1CON A;  1H4H A;  2XHK A;  3CKH A;  4CZS A;  5HXV A;  2XGX A;  3KT1 A;  3LB9 A;  2JXA A;  4RFR B;  2JG8 A;  4RR3 C;  3UKN A;  1VMF A;  2ZX1 A;  1VRB A;  4NHM A;  2WQ4 A;  5IAX A;  3U07 A;  4Y5S A;  1GZW B;  1SLC A;  3POI A;  1QNW A;  1VBC 2;  3GXU A;  4XZU G;  1HB1 A;  2DBN A;  4EJR A;  4MHR A;  2A7A A;  5FZO B;  5SV5 A;  1PM4 A;  1W8W A;  5K7P A;  1XYO A;  3OBZ A;  5JI9 A;  2V5Y A;  5CZK A;  3RJR A;  3THC A;  4AQT A;  1RUO A;  1RXG A;  3B9C A;  5FWE A;  4BMB A;  3JBG 1;  4EQV A;  5FOB B;  1AF9 A;  1QJF A;  4F83 A;  4HMZ A;  1QNY A;  4NOT A;  2YHJ A;  1W0P A;  5DUU A;  1C1F A;  1CES A;  1GZW A;  1K45 A;  1UW8 A;  2R04 2;  2YY1 A;  3HBK A;  3KT7 A;  5F5Q A;  1M4W A;  2DCJ A;  2HKX A;  1W8O A;  2ZEZ A;  1RUG 3;  2A71 A;  2ZEX A;  3PTY A;  4JRL A;  4GH4 B;  5FO7 B;  1UZZ A;  3KQ4 B;  4IGP A;  4WM8 B;  3C2U A;  1AR9 2;  1HN1 A;  1VAV A;  2OII A;  3GHM A;  1RB8 G;  3K4Z A;  4XFF A;  1A6C A;  1RJ8 A;  4GJZ A;  3I49 A;  1W8Z A;  3WLU A;  4HN1 A;  5LA9 A;  4Q4Y 1;  2SBA A;  2EXH A;  1YYN A;  3LD8 A;  1DQ0 A;  5E16 A;  2WAB A;  3VB9 A;  5I0D A;  4M3C B;  5DZF A;  3LIG A;  2V09 A;  4QDR A;  3KM5 A;  2XQX A;  4AQ6 A;  1XXN A;  1CAU B;  4MOA A;  4WM8 A;  1DGW A;  2XG3 A;  2GNT A;  5EZW A;  5H9Q A;  2ET1 A;  5LK5 A;  4GWN A;  3APB A;  1YWK A;  4WVM B;  4AED B;  2P37 A;  3N7K A;  4OQ9 A;  4XFH A;  4BJ0 A;  4AXO A;  4C0B A;  2GNB A;  2VOW A;  4LBM A;  1M06 G;  1S0I A;  2RHP A;  4N53 C;  4PBO A;  4GWJ A;  3IPV B;  2OXB A;  2D7F A;  4MGQ A;  3NKT A;  2R49 A;  3EO6 A;  3ORJ A;  3DXT A;  3KF3 A;  5EYY A;  5JOY A;  1W6Q A;  3D0S A;  4IW3 A;  2BBA A;  1WCU A;  1KFX L;  5B4X A;  1CAV B;  2EXJ A;  4I30 A;  3HJR A;  3LWC A;  3W59 A;  2ZKN A;  2XL9 A;  2WO3 A;  2CYF A;  5K4L A;  5KXD A;  1JUI A;  3PLQ A;  3MW2 A;  2VH9 A;  4R9A A;  3ST7 A;  4AVT A;  4GZ9 A;  4FFH A;  2HWE 1;  1O59 A;  1B09 A;  1UOB A;  1W2T A;  2C9A A;  3W58 A;  1GBG A;  3BI3 A;  1J84 A;  4LBQ D;  2B5H A;  2W1S A;  1ZRC A;  4W50 A;  1B35 A;  1ZZ7 A;  3BPS A;  3SLI A;  2QQV A;  3DN7 A;  2CGP A;  3E6D A;  5BNQ A;  4DY3 A;  2RS5 1;  5FMO L;  3EQE A;  4KH9 A;  1PGL 2;  1KDM A;  4BU2 A;  3VBH C;  2NLR A;  5LAS A;  5JXG A;  3KV4 A;  2UY8 A;  4NRO A;  2JD9 A;  4BCU A;  4CCO A;  1YCI A;  2DUP A;  4Y5T A;  5FK7 A;  1AXY A;  2W46 A;  4CDW B;  1BBT 1;  2CHH A;  4FBF A;  3T0A A;  4CCK A;  2YU2 A;  2BGP A;  2HWB 1;  1SG3 A;  2VCC A;  4M4P A;  4NRM A;  3WF4 A;  2WT2 A;  2DTY A;  5FZD A;  1ZRR A;  3DKW A;  3RYR A;  2BBV A;  2UUR A;  1GFF 2;  2X53 S;  4AI8 A;  3LA2 A;  2XJT A;  3BUC A;  2LRO A;  4JHT A;  5FBZ A;  1Q8O A;  5IFP A;  4ZU7 A;  1TMF 1;  3LZZ A;  5DUW A;  3WP6 A;  2QQM A;  2ZOE B;  1W8T A;  4A7Y A;  4YM2 A;  1PMH X;  1ULG A;  2C5D A;  4MX3 A;  2E63 A;  3MHZ A;  4G4F A;  5KHG A;  3GBW A;  1G9F A;  3BYW A;  3LF7 A;  1N1T A;  5F5C A;  1CR7 A;  1NXM A;  4HLT A;  5G05 L;  4AED C;  5IK5 A;  2PYT A;  2XBO 1;  1PMJ X;  2XJS A;  4YLZ A;  5FZ3 A;  1RL3 A;  1XNT A;  3USU B;  4DUW A;  4XMI A;  3WP3 A;  4EN6 B;  1UKG A;  3ZOI A;  5F6K A;  4XJ8 A;  3M3I A;  5A80 A;  4OHY A;  1RUI 1;  1IHM A;  2G9F A;  3V56 A;  1PZ7 A;  2JEN A;  2ZHL A;  3NV4 A;  1OOP C;  3DF0 A;  1DLC A;  2P5B A;  2XWB B;  2XVK A;  1ZZ9 A;  1V6J A;  4XDP A;  3MF9 A;  5F1R A;  1TNR A;  1W6N B;  3GCX A;  1AL2 3;  3S5A A;  2V4V A;  3BAL A;  3Q8C A;  3RZJ A;  3D4K A;  2DVA A;  3USU A;  2SLI A;  2I45 A;  1UYX A;  3WF2 A;  1XBF A;  2XH6 A;  4RSU A;  4XMA A;  1BVP 1;  4PLO A;  1UO9 A;  5LA2 A;  1Z78 A;  5FY9 A;  4PHZ A;  2VR4 A;  4L2N A;  4XBL A;  3VDA A;  4E27 A;  1NYW A;  5IT6 A;  1RUJ 2;  3GJB A;  4BLI A;  1PHM A;  3G7D A;  2QKD A;  1NY7 2;  4NHX A;  1QJE A;  4Q4W 2;  5A3T A;  3WQ0 A;  1G6N A;  1W9W A;  5GLZ A;  1QKQ A;  4A4A A;  2HWF 1;  4Y4Y A;  1LES A;  4YW3 A;  1W6N A;  1WUV A;  5CG8 A;  2GC3 A;  2W47 A;  2K2S A;  1FMD 3;  2VMF A;  2YV8 A;  1JXN A;  2PHL A;  4HVO A;  2R0H A;  3J7L A;  1HV0 A;  1T2X A;  4E2S A;  1GU3 A;  2JDU A;  4CDU B;  3VBR C;  3W9A A;  1WW7 A;  3BCW A;  2VOV A;  3FX3 A;  3OOX A;  2DCZ A;  4FPL A;  4XJA A;  2B42 B;  1UL9 A;  3SKV A;  4OHV A;  3VBU B;  1CPN A;  4C91 A;  2JDN A;  3FHA A;  4L8Q A;  3WDU A;  1NX9 A;  2WO2 A;  3GHN A;  5T3N A;  1H9W A;  2OZ6 A;  2Z42 A;  4CXX A;  4XTM A;  3IWZ A;  2JKX A;  3JZV A;  4XUT A;  1MS8 A;  3G6J B;  3KCC A;  4CCD A;  2A6Y A;  4QM9 A;  4WVW A;  3R4S A;  1BMV 1;  1RGS A;  4TZD A;  3ZN6 A;  2BVV A;  1DHK B;  1VBB 3;  1GNH A;  4Y5Z 0;  3N35 A;  4XVH A;  4CDU A;  4PF5 A;  4MZU A;  4FFF A;  4E4D X;  1K42 A;  2P17 A;  4GIQ A;  4MVT A;  5J09 A;  1UMH A;  1JN2 P;  3VBU A;  4CXW A;  2WQ8 A;  5C71 A;  4RS5 B;  2OT7 A;  3IDE A;  3POS A;  4M3C E;  1US2 A;  5JZG B;  4YW5 A;  3Q8E A;  1LB2 A;  3LDR A;  2LM3 A;  5F3G A;  3BOW A;  4CEY C;  1Y9Q A;  2AGS A;  2IXC A;  3V64 A;  1LEN A;  2FMD A;  5HCF A;  2DFB A;  1O3T A;  5H9S A;  4DS0 A;  2ZXQ A;  5FZF A;  4H2A A;  4D7S A;  1SDW A;  4IES A;  4CCL A;  4K8R B;  1W6O A;  4QPY A;  2XVG A;  2W08 A;  1ND2 C;  3K3O A;  1AL2 2;  4DY5 A;  2GAU A;  4RS5 A;  1AR8 3;  5AFB A;  1ULP A;  1DYP A;  4TLF A;  2D40 A;  2IXK A;  2R07 2;  2WBK A;  3DXU A;  5JZG A;  3W5N A;  2VCA A;  4OMD A;  2ZGK A;  1PK6 B;  2J42 A;  4CCM A;  5EWS A;  4CXY A;  5I8T A;  4BXF A;  1KIT A;  2CV6 A;  2Q5T A;  1RUF 1;  3GGL A;  2F4L A;  4IER A;  4UW4 A;  4BM8 A;  5BNP B;  2AEY A;  1TVG A;  2Z79 A;  1G9A A;  1KJR A;  5FY0 A;  1QMJ A;  3SXW A;  3AMP A;  3O0W A;  3W5M A;  3WNP A;  4B3N A;  1RUE 3;  1W9Y A;  3RYP A;  1BVV A;  5KXB A;  3AMH A;  2R1D A;  2BYV E;  4XZP A;  1MEC 3;  1RUC 1;  3WP4 A;  3C7O A;  4HFS A;  2XKO A;  1PGW 2;  1PK6 A;  2RR1 3;  2YC0 A;  3I3B A;  4TXW A;  3OY8 A;  1PX4 A;  2LTN A;  3N9M A;  5LA1 A;  1RVF 3;  1SZB A;  1KD7 A;  3SNM A;  5LBC A;  5ANN A;  1IPK A;  2ZJC A;  4NIG A;  1UMI A;  2D3S A;  1LOD A;  4UFI A;  4AYU A;  4CPB A;  3I3M A;  3SEP A;  2HWD 3;  4NWV A;  3SH3 A;  2PMW B;  3O5S A;  1U5Y A;  4Q26 A;  1FOD 1;  2D6L X;  5CAD A;  4QX8 A;  1I5Z A;  2E26 A;  3ILN A;  4IE7 A;  4YGE A;  2B4K A;  1W06 A;  1MS4 A;  1FV3 A;  1SFN A;  4Q0S A;  1NZI A;  3KD4 A;  4UAP A;  4BQ3 A;  2N7G A;  4DEV A;  4LHL A;  1W9S A;  3H0O A;  2WRA A;  1QQP 2;  1MVQ A;  1DYO A;  1VBD 2;  5GLV A;  3DPR A;  1XNK A;  4ASK A;  1WMX A;  1I9R A;  3ZIW A;  5FO9 B;  4EN0 A;  4BWO A;  1Z7S 1;  3JUU A;  1AXZ A;  1GWM A;  1HJG A;  2JEC A;  2WDB A;  2VY0 A;  4OZO A;  4OHZ A;  4AEJ A;  5A1F A;  2WFF 2;  1UY2 A;  1GP4 A;  2P2K A;  4KI5 M;  4QD2 A;  1DGR A;  4J25 A;  1UCX A;  1ZM1 A;  1V6L A;  5JR7 B;  1CZT A;  4V1P A;  4EV0 A;  2P3Y A;  3OGJ A;  2XWJ B;  1YI9 A;  3UV9 A;  4BQ5 A;  2P6C A;  2XJR A;  1C5H A;  1BYH A;  4CCJ A;  1SLB A;  5FKC A;  3A7Q A;  4E4H A;  4K40 A;  3AMM A;  4QHZ A;  2CL2 A;  2ZAC A;  4UYB A;  3TNQ A;  1Y43 B;  1CD3 G;  1LU1 A;  1NE6 A;  3PTR B;  4KWK A;  4ZU4 A;  1BCX A;  1MS3 A;  2QQW A;  5LB6 A;  5FYS A;  3VBS B;  2BUK A;  2D97 A;  4FPO B;  1VRH 3;  2YBK A;  4GKX A;  4LUL A;  2E7Q A;  3ZYF A;  4ASM B;  3WCR A;  4HET A;  2V73 A;  2HWC 2;  4P9I A;  2GNM A;  3MF6 A;  3RZG A;  3KSC A;  1UIJ A;  4LKD A;  1S0G A;  3WW2 A;  1DU3 D;  1N47 A;  1S0D A;  3ETQ A;  2VNG A;  5C3R A;  1POV 1;  3WDW A;  4D69 A;  2OS2 A;  2WNU C;  3IBM A;  4RQP A;  1CZV A;  3ZFF C;  1VBE 3;  2AEZ A;  2GP5 A;  1H2N A;  3H1Y A;  1F5J A;  5DZG A;  2W1U A;  4UF0 B;  3OG2 A;  4D6S A;  5JMC A;  4WM7 A;  3WF1 A;  2EIE A;  4JDM A;  2DVB A;  1HRI 3;  2OYZ A;  1C4R A;  2RM2 1;  1W2U A;  3MIH A;  2WNV B;  1NLQ A;  4IEU A; 
#chains in the Genus database with same CATH homology
 2VUC A;  1UQX A;  5HCH A;  2BV4 A;  5A6X A;  1OVS A;  2VUD A;  1OVP A;  4UT5 A;  4CE8 A;  2VNV A;  1W8F A;  5A6Z A;  2BOI A;  5A70 A;  3DCQ A;  2JDY A;  1W8H A;  2JDU A;  2JDH A;  2BOJ A;  1OUX A;  3ZDV A;  2JDK A;  1GZT A;  2JDN A;  1UZV A;  1OUR A;  5D2A A;  5A3O A;  5A6Q A;  1OUS A;  1OXC A;  2JDP A;  4AOC A;  2BP6 A;  2CHH A;  5A6Y A;  2WRA A;  2WR9 A;  2XR4 A;  2JDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...