5JSOA

Structures of dddq from ruegeria lac. reveal key residues for metal binding and catalysis - tris bound
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
MTLENVLEAARHLHQTLPALSEFGNWPTDLTATGLQPRAIPATPLVQALDQPGSPRTTGLVQAIRSAAHLAHWKRTYTEAEVGADFRNRYGYFELFGPTGHFHSTQLRGYVAYWGAGLDYDWHSHQAEELYLTLAGGAVFKVDGERAFVGAEGTRLHASWQSHAMSTGDQPILTFVLWRGEGLNALPRMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Dimethlysulfonioproprionate lyase DddQ
publication title New Mechanistic Insight from Substrate- and Product-Bound Structures of the Metal-Dependent Dimethylsulfoniopropionate Lyase DddQ.
pubmed doi rcsb
source organism Ruegeria lacuscaerulensis (strain dsm 11314 / kctc 2953 / iti-1157)
total genus 60
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 4.4.1.3: Dimethylpropiothetin dethiomethylase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16867 DMSP_lyase Dimethlysulfonioproprionate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jsoA00
3RYPA 3D0JA 2B9UA 2IXKA 3NW4A 5I8TA 4FAHA 4MUVA 1CAXB 1NZCA 3GYDA 4IEPA 4X6RB 1J3QA 3LAGA 4FT8A 1FT9A 2GC0A 4WBBA 3H3ZA 5CVRA 2BEOA 1O5LA 1O3TA 3KMHA 2GC2A 3E5UA 3H3UA 1FXZA 2D93A 1ZZ8A 3FZ3A 4OFGA 4YNIA 4CYDA 4HZFA 3H1MA 2IXJA 4LTAA 4XF3A 1I5ZA 4IETA 4LEJA 3SCGA 4GULA 3BALA 4KU8A 1YFWA 2UY8A 5EZWA 4LLOA 3UKTA 3H7JA 2DCTA 1VJ2A 3M3IA 4AVAA 2KXLA 3LOIA 2ATFA 3IIAA 4Z82A 2XLFA 4IEYA 4KU7A 1DGWA 3RNSA 1WLTA 3USSA 4E2GA 1O3QA 4EWEA 5FQ0A 1EPZA 1VP6A 3RYKA 4XFFA 1PM7A 4H7LA 2HJIA 1J58A 4I3PA 3NJZA 4HMZA 3NVCA 5LEJA 1X7NA 2K0GA 4PIXA 4HBNA 5AVPA 4Q0VA 4MGZE 3FHIB 3FX3A 1XE8A 3ES1A 1QY4A 4PJYA 4YRDA 2QVSB 2ETEA 1J3RA 3LA2A 4Q0UA 4YYOA 3RDIA 2F4PA 3I54A 4QGMA 3BPZA 4ZU4A 3CJXA 4XFCA 1CAVB 2BYVE 2GAUA 3GBFA 1UIJA 5FLIA 4D7TA 4YSFA 2PQQA 3NSTA 4AQ6A 5I93A 4HLTA 4I0BA 1YFUA 4UXAA 4EROA 4ZU5A 1LRHA 1YUDA 3RYRA 3FFQA 3CO2A 3OGJA 2GZWA 2H6BA 4Z07A 1SQ4A 3EBRA 4F8AA 2Q30A 4LA3A 4WZCA 3EQEA 2OA2A 1O3SA 3TNPB 1J1LA 2HKXA 4XFAA 1JUHA 2UY9A 4KL1A 4A2UA 3KGZA 5LEKA 2Y0OA 3DV8A 1YLLA 4I2OA 2IXCA 4KWJA 3MPBA 2GU9A 4HVQA 1SEFA 1LB2A 1CAXA 4ORFA 2OPKA 2WFPA 1Y3TA 2D5HA 1UW8A 3JZVA 1FI2A 5C8WA 4IEQA 1ZZ6A 4IEZA 5I0SA 2UYBA 3D82A 1Q5OA 1PMIA 4HVRA 1VR3A 5JAXA 5FDBA 3R6SA 1ZRFA 3CEWA 5J7MA 2OYZA 5I8SA 5I91A 3FJSA 3H50A 1ZX5A 3KGLA 1H1IA 2VECA 1IPKA 5FLJA 4FAGA 4JTNA 2PAMA 3E6DA 1H1MA 1SFNA 5JSPA 1EYBA 3FWEA 2ET7A 4I09A 5EFUA 4RD7A 4R52A 1UD1A 5J3UA 2Q4SA 2CGPA 5HI0A 2CV6A 4AVBA 5I8YA 2XLAA 2PYTA 5D1IA 3E5QA 1RUNA 4XF4A 1ZRDA 2E9QA 3OF1A 3BU7A 3HT2A 5CU1A 3VHRA 2ZCWA 4OLLA 3IDBB 3NL1A 3PVBB 4N9IA 2N7GA 3UKNA 4IEVA 2XGXA 1OMIA 4AXOA 4AQ2A 4NVPA 5I0UA 3OTFA 1X8EA 4UBHA 5BY5A 2PHLA 2EA7A 2K9ZA 1O5UA 1ZREA 2C0ZA 1YFXA 5KHGA 1RC6A 2CAVA 2ZKLA 1CAVA 5BPXA 4IEOA 1I6XA 1OD5A 4K8FA 4MH0E 5JR7B 4QGNA 3H9AA 3ST7A 4N9HA 3BB6A 3RZZA 4PIYA 3WW4A 1ZVFA 4ZU7A 3LA3A 4XFGA 2UYAA 1OFNA 4R8HA 1J3PA 5T3NA 4LULA 1YFYA 3TNQA 4QXKA 5C6CA 1O4TA 4X6QB 2O1QA 4BHPA 2FQPA 4AVCA 3UKVA 4BIFA 1WA4A 3MZHA 5CADA 2BGCA 1ZZ7A 4Q0QA 5JSRA 2XL7A 3ES4A 2ET1A 3HIFA 3PNAA 3S7EA 4E2QA 1ZRCA 2PAKA 1ZRRA 4QM8A 3O14A 4WVZA 4PIZA 5BUVA 5KHKA 2MNGA 1XE7A 4Q0SA 1YHFA 3DL3A 3E6BA 4MGIE 2BNNA 4XF1A 1V70A 1ZZBA 3H1YA 4I0AA 3WW2A 5KHJA 3H1WA 3ELNA 2D40A 4YARA 3E6CC 4Q0PA 3IDCB 1WGPA 1DZRA 3I59B 1NE4A 5F1RA 5KHIA 3M70A 2GC1A 4UBGA 2PFWA 4O9GA 3CL1A 2P17A 1RGSA 1QXJA 4JVAA 1IPJA 2Z2SB 2D5FA 1O7FA 1DGRA 4IEUA 1ZZ9A 1CAWB 3I7DA 2VQAA 4META 3S0MA 3L2HA 3DKWA 1CGPA 2Z69A 4L2NA 4XETA 5FLHA 4FBFA 3EO6A 4TLFA 4BYYA 4KWLA 4IEXA 1CAUB 1GQHA 3PLQA 3S7IA 1X82A 1UIKA 4E2SA 4HN0A 1LR5A 4XF9A 4BH9A 4J1XA 5BXXA 2PAEA 3ZDSA 5JSOA 5LRSA 1O3RA 3DN7A 3ETQA 3NKTA 2EVXA 3D0SA 4HSLA 4MX3A 1X8MA 1ZZCA 1RTVA 3N4MA 1Q43A 1U12A 4IESA 1EP0A 3ROUA 2B5HA 2CAUA 3BCWA 3IWZA 4MZUA 3KSCA 1RUOA 1XRUA 2IXHA 4O9EA 3ACLA 1QXRA 2OZ6A 4J1WA 2Q0AA 2XKPA 1Y9QA 2O8QA 1L3JA 3OD0A 5E16A 5KBFA 5FPZA 1QWRA 1YWKA 3C3VA 3E5XA 2IXLA 2IXIA 3H7YA 4ONUA 1LKNA 1GQGA 4DINB 1NYWA 3LA7A 5I0TA 5FPXA 4HVOA 5KHHA 4QM9A 1NE6A 4QX5A 4XFHA 2XL9A 2Q1ZB 2EAAA 4MV2A 5I0RA 4QMAA 1J59A 2PA7A 4XF0A 2H6CA 1HW5A 3KCCA 1TQ5A 3HQXA 3WW3A 4XEZA 2OZJA 2MHFA 5FQ0B 1UCXA 4MGYE 3H8UA 4I01A 1G6NA 2IC1A 3SCFA 2QNKA 3SCHA 5J48A 3RPQA 5E1RA 4IERA 3IBMA 2XHKA 3CF6E 1DZTA 3G7DA 3MYXA 4LUMA 4D7SA 3QOPA 3FE5A 4QGLA 3U0ZA 5JCTA 2H0VA 3OCPA 5BV6A 4JTOA 2PTMA 2XLGA 4HN1A 5K8SA 4L11A 2QDRA 3I59A 2MPFA 4MGKE 1ZNPA 4Q29A 2XKOA 2PHDA 1NXMA 3EHKA 2WC2A 4EWDA 3SHRA 2B8MA 2QCSB 4F7ZA 3QACA 4EV0A 4I02A 3SXWA 3U10A 2FMYA 3CLPA 3LWCA 4B29A 3B02A 4HSJA 2GH2A 1CX4A 1OI6A 4XFIA 1CAWA 2VPVA 1EY2A 3U11A 3WW1A 2BNOA 2V09A 4KWKA 3E97A 2QJVA 3EJKA 4JV4A 4EWAA 4IEWA 1CAUA 4XFBA 3SMHA 4LA2A 1UPIA 5FCCA 2I45A 2GC3A 3HT1A 1RL3A 4P9GA 1Q3EA 5LRRA 4LUKA 2BNMA 3MDPA 3LZZA
chains in the Genus database with same CATH superfamily
1HRI3 3RYPA 1YQ2A 2RR13 1QXPA 2DYCA 2W94A 4NOTA 4D69A 3NW4A 4NHYA 4FOYA 4WM7A 5I8TA 4KBZA 1UNBA 3MF6A 3GYDA 2YXSA 4OI0A 2MEV2 1DYPA 3NNGA 1EUUA 2TEPA 4GWIA 2XBO1 4FFHA 3AZWA 1L7RA 1W6MB 4FT8A 3U75A 1WD3A 3AJZA 4WBBA 3OD4A 2QE3A 1DDLA 3GJBA 1MEC3 3H3ZA 4PBPA 3ZSEA 5K9YA 1UQXA 2BEOA 1SDWA 3PUHA 3WDWA 1O3TA 3FLRA 2LROA 2GALA 1UWWA 3E5UA 3LCPA 2ZPXA 1QF3A 3AP5A 3CJIC 4RGKA 1JUIA 4YG6A 3FZ3A 1ZZ8A 4L99A 4YNIA 4FCAA 3SEEA 1AR81 1JMUB 2Y26A 5L9VA 4HZFA 3KCYA 5F3EA 1C8NA 1ND2B 3ACIA 4LTAA 2E7TA 1I5ZA 1J1TA 2R1BA 2R1DA 3TN92 3PIGA 5A7PA 2KM2A 1VBB1 1IS6A 3BALA 3MICA 2ZKNA 3RVHA 4KU8A 3VN4A 1JYWA 2UY8A 2V72A 1OD3A 1UXZA 4LLOA 5DDJ3 1Z0HA 4FQZA 1SBFA 3WSOA 3N7LA 1KJRA 1RVF3 2UWAA 3BTYA 1N3OA 3ILFA 4KNCA 3VBRB 3K51A 3ZSMA 3U4XA 3LEMA 3IIAA 3CHXA 1S2KA 3TYJA 1V9U2 3ZYJB 3CJIA 1DGWA 4KU7A 4XZUG 3RNSA 4AI2A 4PI0A 3B7MA 4EWEA 2D3PA 4AVTA 4HFSA 4HPKA 5FJHA 1UZWA 1Z78A 2RJLA 3N9NA 4FO9A 2PHRA 3RYKA 5A1LA 1JXNA 2HJIA 1J58A 2E7AA 4I3PA 2YROA 1OOPC 4JGYC 4LBJA 4HMZA 4UFHA 1EPWA 3BOWA 2P3YA 5CEHA 3T08A 5D21A 5AVPA 4JDNA 2BVVA 4RN5A 4Q0VA 1HIXA 1OA2A 4MGZE 3CMGA 3P6BA 3FX3A 3HJRA 5FZEA 3I2GA 5ACA3 1RXFA 5FPUA 2Y60A 3LA2A 2AREA 4IE4A 3WNMA 4YYOA 5FZDA 5IAVA 4QPGC 3RDIA 3TRSB 5A3NA 4ITCA 1LHVA 4XW3A 1AUYA 1W6NA 3JD73 3RS6A 2WSUA 3CJXA 3LDRA 1RUG1 1OSGA 2BYVE 2OVUA 2RS13 2GAUA 3GBFA 4QX1A 1OOPA 4JGYA 3H0OA 3WT3A 1SPPB 5FLIA 2HH9A 4D7TA 3PVOA 4P9YA 2IZWA 1CD3G 3H42B 2QFEA 1ENSA 5C8CB 4I3GA 3OGGA 1RUF3 3O1RA 4Q4V3 2OIIA 1O4ZA 4EROA 1AX0A 1ZBE2 3KS7A 1NCQC 3NJXA 5IVCA 1FMD2 1YUDA 4N90A 4NHXA 1AF9A 3VBOB 1RHI2 3AVSA 4Q2FA 3FFQA 4QU2A 3CO2A 2GZWA 2E31A 1RUE1 1W0PA 1BXHA 3VBFB 5FFOC 4ATEA 3EBRA 4QPGA 4NO4A 2Q30A 4QAWA 1V6LA 4Y24A 5HPOA 1V6NA 1Q56A 1O3SA 1W9WA 1VMFA 3M3QA 3WY6A 3UK9A 2BERA 2MEV1 4RS5B 2W0XA 1CZTA 1CJPA 1CJDA 1HN0A 1AR71 2HWC3 2UY9A 3P3PA 4Q27A 1OLME 4KH9A 5IJRA 1IOAA 5LEKA 1AYM3 2C9AA 1YLLA 3DV8A 3ZO0B 4FFGA 3POGA 4U36A 4OQ9A 4CEYC 1H0BA 1W2OA 1W6QA 1NCQA 4LO5B 3MO4A 1D4VB 3ZN4A 2RS33 1LB2A 2VMIA 1C5HA 3LIHA 2EIEA 1Q8QA 3LFMA 4ORFA 1HRV3 4UF0B 2HWE1 1UN1A 5DPNA 3VBUB 1Y3TA 1NQDA 3WXPA 3JZVA 1FI2A 1OVSA 2BOIA 1ZZ6A 2NPIA 2RDRA 4YZ4A 4M3CB 4PLMA 1KXGA 1JZ3A 1Q5OA 2DWRA 2HWD2 2QQJA 1PMIA 2Y6HA 2VMCA 4LO4B 2XMLA 4NRQA 2R7EB 2LW8A 1PZ8A 4RQPC 3ZPOA 3WQ7A 4E4SA 3CEWA 2D6LX 4CEYA 1GYKA 2VXRA 4DQAA 5CB7A 4IGPA 1AR61 3AZYA 1GZWA 1V9U1 3KGLA 1H1IA 2JE9A 1IPKA 4MADA 3NV4A 5FLJA 1LENA 2WNUC 4FPJA 5D2AA 4GIQA 1VBD2 3UETA 1I9RA 2VBDA 3V0BA 4I09A 1OXCA 3B3QE 4Y5Z0 1S0BA 1A78A 3WF3A 1I3HA 3PHMA 2XLAA 4LNVA 1KQRA 3E5QA 2QQIA 4RQPA 4QX0A 3KV9A 3PMEA 4YFZA 4LOSA 2E9QA 4EJRA 1CX1A 2YGLA 4QWNA 2WFF3 1QIQA 3HT2A 3VHRA 2WNUA 3NL1A 3NNJA 3Q9OA 3AP9A 4N9IA 2NYYA 3UKNA 1TMF2 2JDUA 5FZFA 2XUMA 2XGXA 4P9WA 4XQWA 4YGDA 1NLSA 5JXJA 3ZXAC 5FZOA 3T2OA 1IKQA 5I0UA 3OTFA 4CEWC 1VBE3 1X8EA 2A3XA 1LAJA 2XQRA 3I8TA 5BY5A 4C90A 2EA7A 2TUNA 5FJKA 1ZYBA 4BK5A 1W9SA 2BRTA 1ZBE1 1QGLA 3I3DA 1OHFA 3ILRA 2DURA 3KVAA 1RHI1 2X8KA 1YFXA 5LCWL 5KHGA 1ST8A 4K40A 4E8DA 2CAVA 1LECA 2OQ7A 5FZAA 1ONAA 2DUQA 4IEOA 1W8NA 4OMDA 1PZ9A 3AJYA 1GNYA 5JR7B 2VVEA 5FY4A 3ZMNA 3NV3A 3VBSC 3W21A 2R30A 4WZFA 5E6HA 1H2MA 3JBG3 1BEV3 2W46A 1AR93 2J1EA 5EHDA 4PIYA 4TN7A 5L9RA 4UFJA 5FZ0A 2Z79A 4YGBA 3VDBA 2UYAA 4XJ8A 2ORXA 1OFNA 3ZXGA 4CEWA 4URAA 4NIHA 4W8JA 3WG2A 1XJAA 4CUCA 1O91A 5T3NA 2Y6KA 3GNEA 1PO13 1OC1A 4JHZA 3UESA 1SLIA 3NV1A 1C8M3 3MPPG 4HK8A 4LULA 3TNQA 1IG0A 4WM8C 5BNOC 3PJQA 1PIV2 1O4TA 2OKXA 1W8UA 1TNRA 2O1QA 4BHPA 3B5LB 4HG6B 4AVCA 5CBLA 1B35B 2JWPA 5DQ0A 2QQLA 4FI9A 3VBSA 3TBDA 4ZONA 1FATA 1ZZ7A 2QQNA 1VBA2 5C5TA 4Q0QA 5JSRA 1WWYA 2HBUA 2Q8OA 4PCRA 3ES4A 1YQ6A 3WF2A 3O1SA 3O1VA 1JOBA 2DCJA 2VC9A 3PIJA 1N3PA 1QJY2 4JDMA 4NN0A 4XDPA 3PMSA 5GJ6A 5GLWA 5CAZA 3O1TA 1ZRRA 4Q4Y3 3ACHA 4WVZA 3RWNA 3C7EA 4XXPA 5BUVA 5KHKA 3VKMA 2HEYF 3WHUA 2VVFA 3T4HB 3KM5A 4WM8A 1H8VA 5BNOA 4MXVA 2G1MA 5FZ3A 4Y26A 5BNPC 5JPMB 5IK8A 3E6BA 4Y3OA 1WCUA 2ZAAA 1VBD1 4XF1A 2BNNA 1BMV1 1RUC3 4XAAA 3OJBA 2OXBA 3N7MA 3SH5A 1ZZBA 4XUQA 2XVLA 4I0AA 3IPVA 3JU9A 1JZ4A 5KHJA 1NUKA 1IHMA 4KWUA 5FP7A 4CDXB 4Z1VA 2YG0A 3NNFA 2FDJA 4NIIA 4CDUB 1HKDA 3DPRC 2ZGKA 4N7IA 4ASMB 3O1PA 2B7YA 1W6PA 2VCCA 1KFXL 4LBKA 1H8TB 4MOAA 3ETPA 5BNNB 3AB0A 3IMMA 4P02B 1NE4A 5DAQA 1DFQA 5F1RA 1K5MB 1FYUA 1W3XA 1UMIA 1YXWA 3MLLA 4K7JA 5BNPA 1XSQA 1O8SA 4XTMA 1DZQA 1RMU3 4XQ4A 3K77A 1E5IA 1TMF1 2YBKA 5GZEA 1SMVA 2VMDA 1U5IA 2JKXA 1VRBA 4CCCA 2ZBJA 3KD4A 2D6MA 2HLEA 1DGRA 1W9FA 3VL8A 1JZ6A 3B01A 4NIDA 1BVVA 1ZZ9A 3UGGA 1CAWB 1GZCA 4RA0A 4Y33A 4CCMA 4ZZ5A 2Y64A 2CWMA 2WWUA 4HXCA 4LBQB 4CCJA 3DPRA 1UO9A 1VPHA 4IV3B 3JB8A 4XETA 3MUY1 2WS92 2OT7A 4ZKTB 4IV1B 4AYUA 2RM21 5GALA 3X29B 5C3SA 3HEIA 5C71A 4P14A 1STMA 3RMXA 4EZHA 3MEPA 4UFMA 5FBJA 1G9CA 1CAUB 3JB4C 3S7IA 2WABA 4YWAA 1X82A 2PHWA 5A1FA 4MO3M 2LTNA 5FY0A 2DTYA 3WP4A 4E2SA 2VZUA 5HXVA 3PURA 4FQ4A 2BOJA 2ZHNA 3GXUA 2YV8A 1JBCA 4NHLA 4NPMA 5J1XA 1XYPA 1W8OA 3R05A 3NKTA 2EVXA 3D0SA 1C5IA 2JDKA 2FZ2A 4MX3A 2W92A 1C28A 5H9RA 3WDXA 2IUWA 1RTVA 1R092 5FYHA 1Q43A 4BXSV 1U12A 3ROUA 3M7AA 4FTEA 2B5HA 1GOHA 3ZIWA 3IWZA 1YO8A 1IQDC 2VM9A 2ID4A 3AX4A 1Q8OA 1ZBA2 4MZUA 4CSWA 1QEXA 3RZHA 4CCNA 3T0BA 2ZX3A 3VKFC 1WLDA 4FFIA 4BQ5A 2DVBA 1IZ3A 4Y5TA 4QPIB 4R9CA 3VBHB 1JU3A 1Y4WA 5LATA 1TME2 4DRVA 3MUZ1 1QJZA 1UXXX 4XJAA 3WNNA 1OFSA 3OD0A 3ZXLA 2RMU3 4P9XA 1QWRA 1LHOA 5FP4A 1UY4A 2VTFA 1QJY1 1UYPA 2IXLA 3GZEA 5FTTC 2IXIA 3JQWA 3A4UA 5FZIA 1DBNA 2W1WA 1BYHA 1LKNA 5LA9A 5T50A 5I0TA 5LA2A 1GSLA 2WO7A 4DO0A 3PVEA 2W1SA 4ARXA 5FZ6A 1JYIA 3H8OA 1LJ7A 1NE6A 4QX5A 1UL9A 3O1OA 2QBXA 4ZXKA 4IE7A 5A33B 4HT1T 2VUCA 2IWGB 2YYOA 3S30A 4CCOA 3KCCA 3M8LA 4RHV1 5IHRA 4RL7A 2OZJA 4XEZA 3AKRA 1T2XA 5FQ0B 1UCXA 4MGYE 1DIWA 5IVVA 3B9IA 2P34A 2IC1A 4LHLA 5IK7A 3W20A 4GJYA 2JIGA 1OQDA 3GJAA 4CP2A 3VGIA 3CF6E 1GBGA 3G7DA 1SCRA 2DCYA 5FZ1A 3T30A 4Z8BA 4QPYA 2ZGOA 3R4UA 2PMWB 4LO7A 5FYMA 3ZSKA 4BE3A 3MIEA 1NA1B 4KQ7A 4C0HA 5A3OA 5F9TA 2WBKA 5K8SA 2XLGA 3U07A 5FY9A 1OT5A 2EXKA 5FYSA 2WLPA 3FLTA 2C26A 2NP0A 4FPLA 3ZFEB 2DF7A 2WZR3 5FZHA 5SV5A 3VDDB 1R082 1RJ8A 5ERLA 4B1LA 1KGYA 4D7YA 2WS91 4XBQA 3WG4A 4LE3A 1EV13 3QACA 4YGCA 1BLZA 3U10A 4DNYA 4WVMB 3ZN6A 4B29A 2ZAHA 1VRH3 1QJX2 4HSJA 4UW6A 5FR3A 2GH2A 1CX4A 1RUD1 1DGLA 3NJYA 2D6NA 4AI3A 3QH6A 2E33A 4FP3A 3BU0A 2P4EA 5FP9A 3ZKYA 4A3XA 2F4LA 5FY1A 3VKOA 1QU0A 4OCTA 3O0WA 5JXGA 3RI8A 3ZXJA 2XQXA 1D0GA 4AVVA 4INDA 2QJVA 2DUOA 1YQCA 3EJKA 1KD7A 3LB9A 5AVAA 5FV3A 2VNOA 4LHNA 2NM1A 2BWAA 4ET7A 3SMHA 4Y1UA 4EWAA 1R1A3 3POIA 3ZPYA 5ANNA 1Y9GA 2GC3A 2SLIA 3ZYPA 1R091 4F83A 5B2GB 5LW9A 2DCZA 2PXJA 5LA0A 1Q3EA 4AHZA 1MVQA 4HK9A 1ACCA 1AYN3 1U5XA 5FY5A 1ZBA1 2B4KA 5LB6A 3NJVA 4DEQA 1KITA 1QOOA 2VBBA 5GZCA 1D4M2 1W9YA 1GP4A 1US2A 2VBPA 5T5PA 4AFDA 4XUPA 4FAHA 5D8AC 5B4NA 1CAXB 1NZCA 1GR3A 1W2UA 4GKYA 4YM2A 1CN1A 1PX4A 1BBT3 3WP3A 1FT9A 2PLV3 4BDVB 2VZOA 2W52A 5A6ZA 2VD7A 1PGSA 1X9PA 1N1TA 1PO21 2VOTA 3AM2A 3RWKX 1POV0 2WO3A 1YI9A 2C4XA 3KMHA 4XMIA 1PGW2 2JD9A 2B42B 1GFF2 3HMYA 4IGQA 4Q4W2 1HJGA 2RVAA 1OLRA 4N43B 2ILMA 5FP8A 4QDRA 3HOBA 2Q8EA 3TAYA 2AYHA 1APNA 1S55A 3IMNA 3H1MA 1NXD1 4IE5A 2DU1A 1ND3B 2VG9A 4LEJA 3SCGA 4JGZC 2LALA 4GULA 5EP9A 3DKQA 2EAKA 2PHXA 2WZEA 4N53B 4NPRA 4LKFA 4A6SA 1N1YA 5D8AA 1FOD1 2C5DA 1HRI2 2RG4A 2SBAA 3H7JA 2DFCA 2RR12 2Y0IA 2QQPA 3M3IA 2VO5A 1YQ8A 5I0DA 3USUB 4NHMA 3WP5A 4LE4A 4QDQA 3LOIA 5DZGA 5SV8A 4XHBA 3HBKA 1F15A 1QHDA 5GZDA 1WW5A 1T6BX 1WW6A 2XBO2 1H6XA 2XLFA 2P1BA 2BBVA 4AFCA 4YZ1A 5JPNB 1MEC2 2Y38A 1O3QA 4LT5A 1PK6C 4LMFA 1YCIA 4DRRA 5B4XA 3AMQA 1JOPA 4BQ2A 2X53S 5FK8A 3W59A 4CVUA 4XFFA 1PM7A 5GKAC 3MF9A 4XZPA 4OHYA 2RS51 4JGZA 5C3PA 3NJZA 1GKBA 3U37A 5IVYA 4RR3C 3AVRA 3WF0A 5LEJA 5JUVA 2VCAA 1C1LA 3FC0A 2K0GA 4UW3A 5CNAA 1WW7A 1W6OA 2Y6LA 1VBB2 2CU5A 4AW7A 5HCHA 2GSYA 5FKCA 5C9AC 3AP7A 5FYBA 1YRZA 1C4RA 1PVC1 5DDJ2 1XE8A 3ES1A 2Z42A 1H4HA 2JXAA 5C4WC 4XXAA 2P3IA 2XB6C 2P3KA 4CPBA 2ZXQA 1QJX1 1LOCA 2HYKA 1PK6A 2BJSA 3BPZA 3ZFGB 5JOXA 4XVHA 1S0FA 2QZ2A 3Q8AA 1UIJA 4YG0A 4YSFA 3KLSA 4RR3A 5FYCA 3NSTA 1MR5A 5JDBA 1RUI1 3I3BA 2ZGQA 2CL2A 2DU0A 4I0BA 5A3LA 3GF6A 4QHZA 5C9AA 4XBLA 5GLVA 1RIRA 4RGAA 2AGSA 2Y6FA 4RFT0 3C7GA 4Y22A 3RYRA 2BGPA 3KT4A 5C4WA 5T52A 3BIWE 1F35A 1LGBA 1WBLA 3N36A 5KXBA 4Z07A 5FYVA 2G19A 3ZYIB 1SQ4A 5FPVA 2GN7A 1D4M1 4BLIA 1MACA 2WO2A 4LA3A 3EQEA 1OLMA 3TNPB 1J1LA 5AC93 1Z7S3 3AFGA 4AI8A 3JD72 3WZ1A 4KL1A 4ARYA 5C5UA 2V5DA 3KGZA 2Y0OA 4XIKA 1ND2C 2J1AA 4I2OA 2IXCA 1QQP3 4KWJA 1DGWX 1PNFA 1ENQA 2CTVA 1NY71 1SEFA 5LASA 3POFA 4FPFA 1QJU3 4Y1VA 1WBFA 4Q4V2 3D8CA 3PDQA 2WFPA 1W6MA 2VZPA 2D5HA 1UW8A 2BGOA 2W1QA 3URFA 3ZR5A 3AC0A 5LK5A 3VBRC 5C8WA 1RUE2 2JG8C 4Q4X3 2R0HA 1HRI1 4Y5SA 1XPWA 4GALA 5EJ1B 3D82A 3U4SA 2RR11 4EYUA 1X33A 3T2PA 1JYNA 3LGRA 2Y33A 5DAPA 3UGFA 2F6BA 2ENRA 1SFYA 4R4XA 1WLWA 2GN3A 1ULFA 3J8F3 1HB4A 1RUJ3 1ND2A 3A0KA 3QCWA 3R6SA 3WCSA 1ZRFA 4XURA 3TOJA 2JIJA 1XNDA 1HXS3 1KDKA 1E5RA 3FJSA 3I2HA 4NIAA 1AR72 1FPN3 1AYM2 1UOJA 1Q8SA 1HLCA 1MEC1 4FAGA 2VECA 1S4CA 4YG3A 4Y1XA 4JTNA 2PAMA 3FMGA 1H1MA 1SFNA 2RS32 5TSWA 3F95A 3J7NA 1EYBA 2EXHA 2DV9A 4XIOA 3ZSJA 4D6SA 3VBRA 1AL23 1W8WA 2VCMA 1HRV2 2PELA 2JG8A 4FPEA 4R52A 3VZOA 5J3UA 4KGGA 1LODA 2HWE2 2Q4SA 4JKKA 2CGPA 5EV7A 4AEDB 3N9QA 3PJYA 4B8EA 5I8YA 2ERFA 1DP0A 5DDJ1 1J84A 1RUH3 3WCRA 4L8QA 2VTXA 5JI7A 1AX1A 1QJEA 1RUNA 2J1RA 4LK7A 1RVF1 5F39A 3RJRA 3SC7X 3LDKA 5LBFA 5FZBA 5CKQA 2OUJA 4P9LA 5CU1A 3CNAA 5L73A 4W6YA 3ZX7A 3BIEA 5C8CC 3WQ1A 4UW4A 3PVBB 4DXSA 1LGCA 2VH9A 4CP9B 2YUEA 4FVVA 3M2MA 4IEVA 5EJ3A 1AR62 4IQPA 4BQ4A 1WKYA 3ZYRA 1COV3 3VBOC 2XDVA 4GB33 4BISA 3ABZA 1GNZA 1ALYA 3AP4A 5BNQA 2PHLA 5H9PA 5HCBA 3VBFC 3NNMA 3ZXEA 2EALA 1RJ7A 1OF3A 3KV4A 3Q8EA 3EB7A 1A8DA 3KHBA 1O5UA 2A3YA 4NE9A 1ZREA 5T54A 3NWKA 3GCWA 5T5OA 1RC6A 2VNRA 4RS5C 2ZKLA 3TB0A 2WT1A 2NN8A 5JOZA 1SPPA 4MH0E 2HWB3 2JE7A 3O7OA 4ASLA 5ACA1 2CDOA 1W3VA 5F3IA 5C33A 5C8CA 3CIHA 3M4FA 2WFF2 2K2SA 2ZA9A 1WMXA 3VBOA 1JZ2A 1BJQA 2CSGA 3JD71 3PUAA 4B7KA 1X36A 3EXUA 1J3PA 1WLCA 2RS11 3VBFA 3VBUC 2D97A 2BPA2 4C1WA 1REEA 1YFYA 5DMYA 5FMOS 4OULA 5F2WA 2VZQA 5C6CA 2WA4A 1RUF1 3R0RA 4Q4V1 5DAXA 3VD5A 4SLIA 4TYSA 4RS5A 2BZDA 1GZ9A 2FQPA 4BIFA 5FZ7A 3AL6A 2FDKA 1H9PA 2VMEA 3BUCA 1F4AA 2BGCA 2FDIA 1CVNA 5F32A 1A6CA 5F3GA 5FZMA 1H9WA 2EIDA 5CA6A 2VXJA 3IAQA 4QB1A 4AFMA 2ET1A 1OUXA 1BEV2 5FUPA 2NQYA 3WHTA 2NMOA 1XQNA 4UF0A 2WN3A 3O14A 3VBUA 4Z2WA 2HWC1 4S2HA 3L9JT 4L9BA 4A41A 2WKKA 2XUEA 3DEMA 4MXWA 1OQ1A 1AYM1 2ADDA 3HNMA 2XJPA 1YHFA 3DL3A 4DFSA 3N7KA 4FPYA 1I5PA 1NOVA 4MGIE 3WEZA 5FREA 3T1LA 2RS31 4HETA 1E5SA 4AWDA 1V70A 4LKDA 2JECA 3OPWA 4EN0A 3ZYGA 4DS0A 2YHJA 1HRV1 1VAKA 3ELNA 3F2ZA 2FHRA 4B3NA 4CXXA 4V1PA 2R073 4P9IA 4LKEA 1VBC3 3SH4A 3E6CC 4QXBA 1GP5A 4DOUA 2VNVA 2EIBA 1WGPA 2CGNA 2CDPA 5LA1A 3RZLA 1QJFA 3VDAA 3ZN5A 2WNOA 2GC1A 2DUPA 2RV9A 1H2KA 1QDOA 2J7MA 3I49A 1MZFA 4UFKA 5EQUA 4XBNA 1QXJA 5DXDA 2ZX1A 2C1FA 1UY1A 5FUIA 4M0HA 1IPJA 3UV9A 1WA6X 3K4AA 2CWSA 2R062 3KCXA 4IE6A 4LBMA 1O7FA 5E8AA 3TN93 4IEUA 3K48A 3WF1A 1BMV2 2VQAA 1GOFA 1K5JA 4CCKA 2ZX4A 4CUAA 3DKWA 1CGPA 2Z69A 1PMJX 3JXSA 4L2NA 2YGMA 1KS5A 5FLHA 1NCQB 1LESA 3MW3A 4NR1A 1ULOA 1PX3A 1W9TA 4CP0A 3FLPA 4TLFA 3RRDA 4XC9A 2AENA 4IEXA 2R32A 4JRLA 4D94A 5LBCA 4FPGA 3RSJA 1UIKA 5CZKA 5FY8A 2WFF1 2R043 4YW4A 1HX6A 4IW3A 2VW2A 4LBLA 2NLRA 4HN0A 5FMDA 1LR5A 1QMJA 2BFUL 4XF9A 1W8HA 1WMDA 4J1XA 3RMYA 1O3RA 3ZDSA 5EYXA 4BA6A 3DN7A 1S2EA 1GV9A 4AEJA 1BCXA 2EIGA 4HSLA 3HAGA 1B35C 1VBE1 3M3CA 4PQQA 3BTZA 5CISA 2VMHA 1LU1A 2WQ4A 3I97A 1EP0A 2ZZQA 3WDUA 2CAUA 3BCWA 2V4AA 3AKSA 4NWVA 4M00A 1RUOA 1XRUA 2R16A 2WO1A 3ACLA 1QXRA 2W08A 2Q5TA 3I2FA 3NAPB 4GKXA 4K20A 5IUQA 4H55A 2OZ6A 3LSDA 2DCKA 4J1WA 2JG9B 2RM22 1S0JA 4MVTA 1Y9QA 4AFBA 4E9KA 3KQRA 4X8NA 3ECQA 2X5IB 4TWTA 5KBFA 2WL1A 3FBYA 5K4LA 4GMP3 3JBG1 1X9TA 3MFAA 1BEV1 4XUTA 1AR91 3GDBA 4LITA 3KV5A 3MLKA 3INAA 3LPFA 4BU2A 1B35A 5K0UB 1WW4A 2GNMA 4QU1A 1H4GA 1PO11 4QM9A 4AI1A 2XL9A 1ASJ3 2EAAA 1FMD3 2Q1ZB 3OB8A 1C8M1 1SLCA 5I0RA 5A3PA 4DUVA 4CDUC 4QMAA 5KXDA 1J59A 4QQLA 4PLNA 1HV1A 2GMEA 2FD8A 3WQ0A 3LKJA 4WVWA 5BNNC 1U5YA 4GJZA 1UY3A 2MHFA 4UI9L 5GLUA 3AXEA 1K5MC 4LR4A 3PUSA 3H8UA 2DDUA 4I01A 1DQ6A 2D6PA 3UJQA 1G6NA 1IKPA 3FUOA 3SCHA 2PHFA 5T55A 4ZPIA 5J48A 5GZGA 4LBOA 1SLAA 2O14A 3MV11 2WT0A 3IBMA 4M01A 2XHKA 1DQ1A 2ZGLA 1DU3D 2Y6JA 3GM8A 3J7MA 4Q4Y1 4D7SA 1F5FA 4A4AA 4CDXA 2H0VA 3A22A 1TEIA 4HN1A 4CDUA 2GNTA 4IV3C 5JLVA 4Q1PA 3J7HA 2R061 1CONA 4IV1C 4LO8A 5BNNA 1REDA 1OPMA 3DCQA 4LIVA 4DEVA 5HXMA 4XAEA 2AEYA 2MPFA 4MGKE 2A70A 4Q29A 3KHCA 1K5MA 1RUC1 1UKRA 4BCUA 5GZFA 4SBVA 3WQBA 4M3CE 2BUKA 4BQ1A 1OA4A 2V5YA 4RHV2 3SHRA 4AGRA 3MIDA 2J1VA 2HWD3 3N3HA 4QD2A 2GP5A 1UYXA 4OZXA 2VZSA 2E32A 2VAUA 2E26A 4A45A 5JZGB 2FMYA 2WYSA 2VNGA 5APAA 3LWCA 3RQ0A 1TZOA 3WINE 5A70A 4COVA 1CAWA 3KWVA 4RGGA 1UKGA 4LBQA 4BMEA 4LHSA 4IV3A 4PQ9A 3OUHA 5CYYA 4XQDA 4N7UA 2W47A 3AP6A 1RMU1 4IV1A 4C8DA 1F2NA 4CP1A 1XE0A 2A1XA 1ULDA 3FHQA 3RG0A 1JYXA 1DYKA 1KRIA 1CAUA 4COZA 2XJTA 4M4PA 4LA2A 5JOYA 2VOWA 4B4RA 2WQ8A 5JMCA 3E1F1 3GZUC 4KMQA 4QPIC 1G7YA 3VBHC 2AC1A 4AAPA 3OEAA 2W5FA 2XWBB 4LUKA 3ACFA 2BNMA 2EICA 5F6KA 3LZZA 2VL4A 4XJUA 2ZGTA 4Z2AA 5FO8B 2EF6A 1DG6A 4A7KA 3D0JA 1WCQA 2B9UA 2ZOEB 1XU2A 2G9GA 3MGUA 4MUVA 4QX8A 5EPAA 3UGHA 4CDWB 4GXLA 1AXYA 4X6RB 3AMNA 5DZEA 1J83A 1NCRB 2E63A 2RDSA 1RUD2 3LAGA 5BYNA 5L19A 4JKMA 1SLTA 4BPZA 5CVRA 1PNGA 1O5LA 1SLBA 2LUWA 2OPWA 3AYEA 3IKWA 5HCFA 2K46A 1G9DA 2D93A 2OQ6A 2UURA 4QPIA 3VBHA 1IS3A 2A3WA 5DZFA 2IXJA 4J6GA 4KG0A 4E4HA 2A6ZA 1AZDA 4IETA 2OS2A 2GDFA 2BFUS 3LE0A 1H2NA 4D8MA 4LOTA 5EZWA 2VQUA 3MHZA 3PTRB 3P3NA 3UKTA 1ENXA 3WDTA 2FCVA 4MYEA 5J09A 2OW4A 4AVAA 1S0DA 2E6VA 3DGTA 5FZCA 1UZYA 2JDNA 4FSJA 2KXLA 1NA1C 1VMJA 3A23A 1QNYA 4QQ2A 1Q8PA 5KWRA 2ATFA 1YIPA 2JDAA 2RMU1 5FWEA 5A33A 3WNLA 2EXIA 4IEYA 5IAXA 3FHAA 3J9SA 5A7NA 3NQHA 4QX3A 4E2GA 3VHPA 1PO22 3R4SA 4URTA 3ZFEC 5FQ0A 4IXLA 1EPZA 1XSRA 4XDQA 3VD3A 4AEMA 4A7YA 1PIV3 4LXLA 5ABJB 3ZXKA 4YVWB 4QB6A 2G9ZA 3NVCA 4M0NA 5FIXA 3ZVXA 1OBNA 4ATFA 5FO7B 1JHJA 1X7NA 5IYYA 2BWCA 3M3OA 4PDWB 2CY6A 3O0XA 3AXDA 4PIXA 5FXWA 2AH2A 3LQCA 4W4ZA 4EN7B 5C3RA 3O5SA 1VBA3 3OG2A 4FFFA 4AHYA 4WVVA 3WUCA 5G05L 3UYJA 1F8VA 1Q8VA 1NA1A 1FOD2 2V73A 2WZ8A 3IZOA 4PJYA 4OHVA 2R49A 1QJY3 3ZXDA 3JCIA 4Q0UA 3W5NA 4U2AA 2F4PA 3W9AA 4NUBA 2IFWA 3I54A 1IG3A 4K3UA 1V00A 1W2NA 2XJSA 4QGMA 3ZFEA 2IFRA 3T0DA 1UAIA 4XFCA 2GMMA 4PF5A 1CAVB 2FZ1A 1OVPA 3ZYFA 2PQQA 3GZTB 4CXYA 1DCSA 4Y4YA 1POQA 2XJQA 1NZIA 3AKQA 4BM8A 1JHNA 1UX6A 4WVMA 3GGLA 4UXAA 1CR7A 2RS52 1YJLA 2JJ6A 4ZU5A 3O1UA 5F5CA 5GM0A 1G9FA 4NAMA 5EJZB 3B94A 1Y9MA 4C91A 2WZR1 2ES3A 1R1ZA 4NHKA 4UWDA 4GQ7A 5DAVA 4OUSA 1PVC2 4YLZA 4AI0A 4F8AA 4WZCA 1EV11 5A7WB 2OA2A 4HL0A 1HB3A 2A6YA 1AJKA 3J7LA 3OBZA 2HKXA 4BB3A 1JUHA 4P08A 1MS9A 2VTXJ 2X05A 3SEPA 5M0TA 1VRH1 2VOXA 1UU4A 2WNEA 3S6PA 2ZJCA 4N43C 4XYXA 3LSEA 5FXXA 5ISLA 3OEBA 4BQXA 5A3MA 3LF7A 1O8PA 1CWPA 3OYWB 4YVSB 3LEIA 1LCLA 4OHWA 1F5JA 3MPBA 4UOJA 2GU9A 4EN6B 4HVQA 2D7FA 1SFPA 4IL7A 4N53C 3ZFFB 3ZLIA 1D2SA 1PZ7A 1CAXA 1RUI2 1M4WA 1LOEA 3K46A 3MIGA 1R1A1 1VB2A 1ULEA 1DHKB 4Y20A 3HWJA 2HWF3 2OX0A 2RDNA 1XOYA 3B9CA 1AYN1 4V2VA 3VKNA 2ARBA 4IEQA 5I0SA 5DAWA 2J1UA 2J42A 1MQTB 4UFIA 4B7EA 2Q1FA 4JDOA 4N43A 1PHMA 3H3LA 3T1MA 3POSA 4EE2A 1XNAA 1VR3A 5JAXA 1GUIA 5FZKA 2RE9A 3AZXA 1Z7S2 3H8RA 1BBT1 2I74A 2YDEA 3N9OA 5CG9A 4QKBA 1UPSA 2LS6A 3WP6A 2PLV1 3HQRA 1SACA 3H50A 4DUWA 1EAH3 1ZX5A 4N53A 3NNLA 1NLRA 1UOBA 4DZGA 2DVAA 2C6SA 2ZEXA 4RFRB 3C7FA 4W6WA 4EN9B 5FBZA 3USUA 1JI6A 1NY72 5CFCB 1AJOA 1N3QA 5EFUA 4RD7A 2ZGRA 4AQSA 4CDQB 3HNYM 3K3OA 3OY8B 5HI0A 2RDQA 4P00B 1IQAA 1SLLA 4AVBA 1LGNA 3ZFGC 1TME3 1NLQA 3ZDVA 3TEWA 4Q4X2 5D1IA 2YU2A 3PVNA 2GP3A 4XF4A 5F5IA 1RB8G 1ZRDA 3AYDA 2XR4A 3C2UA 2OUHA 3LEKA 4BZ4A 3VD9A 2ZMNA 3ZSLA 3OF1A 3OUJA 4O61A 4AK3A 2O8OA 3BU7A 3WR0A 2JKBA 2VZTA 1JH5A 3IDBB 4OLLA 3DYOA 4A7ZA 5IK5A 1BKZA 2J1SA 2QQWA 3AK0A 3UL2A 2Q1MA 4IE0A 2ZZJA 1OMIA 4AXOA 2W95A 3AZVA 3WDVA 4L97A 5F8PA 5A6QA 4L0PA 3DUIA 3RGBA 3WNKA 2QQKA 3V65A 1AL22 2EXJA 3VD7A 1K45A 3ZFGA 2XXZA 4JX0A 4XUOA 1VIWB 2JDHA 4C1XA 2C0ZA 4A6OA 1GANA 4MHUA 2JX9A 1OPOA 1GLHA 1WZXA 5JIAA 2BDRA 1FX5A 1OD5A 3ASIA 4AHXA 2ZHKA 3I2DA 4A3ZA 2YPDA 4N9HA 4BQWA 4FOQA 4D0QA 1RVF2 3BB6A 1E5HA 5A6YA 1UMZA 3WW4A 1PVXA 1ZVFA 3N9LA 2QKDA 4FPCA 4YZ3A 4K9SA 4XFGA 3VLBB 4ZU7A 2LRPA 4Y1ZA 5FMOL 5L7OB 4ASKA 1A34A 3NMBA 5DUXA 5T5LA 2P37A 4NMIA 4CCEA 3GCXA 1OQEA 3N35A 1W04A 1LHWA 3D6EA 3SITA 4QQOA 4GB32 4CU8A 5DG2A 2YZ4A 5FOBB 1DYOA 4LJHA 1VB4A 4QXKA 3U1XA 3OGVA 1R083 1DF0A 5LZ6A 2ZHLA 3CQOA 4X6QB 4DB5A 3V0AB 3AL5A 3ME2A 4YW2A 3UKVA 1WA4A 4BK4A 3MZHA 1N47A 3LIGA 4I30A 1LOAA 2DVGA 4DMIA 1I1EA 1BHGA 4XMAA 4Q5OA 4GH4B 5A32B 4CA9A 2VQ0A 1NX9A 4H7MA 4GAZA 2ZGSA 1AXKA 1CIWA 4UYBA 3GHMA 2XL7A 4OHXA 3IM0A 3HNBM 3WNOA 5ACA2 3HIFA 4GZ9A 1W05A 3PNAA 3S7EA 3LFIA 4E2QA 1ZRCA 2PAKA 4QM8A 2LM3A 4YM1A 1WCSA 1Z7S1 2IVIB 2FMDA 4B4QA 5AC91 1UY2A 3SH3A 5F2SA 5CFDB 2MNGA 1UOGA 3VD4A 2NMNA 1MS4A 1XXNA 3I3EA 5AFEA 1DQ0A 4EZ4A 1QQP1 2YFUA 2RS12 2VUJA 1C57A 2VZ3A 1LHUA 4IGOA 3SQOA 5JWPA 1XNCA 4AEDC 3EMRA 4COUA 2VOVA 1F4HA 1QJU1 2WSVA 1O59A 5EXOA 3WOGA 3WF4A 3O12A 4S2DA 3H1YA 1RUF2 3VZNA 5JXHA 1JOJA 2BW8A 3WW2A 4Q26A 1V6JA 3CKHA 2D40A 4RR3B 3DYPA 4YARA 1SBEA 1SHWB 5A1AA 1ODNA 5FOJB 2IVJA 2XWJB 2A75A 2JE8A 4Q4X1 1DLLA 4QX2A 5FYTA 4AOCA 3IDCB 3S57A 3I59B 2XONA 2JB8A 1XYOA 1FNZA 3J8F1 4CXWA 3CU7A 1G8WA 1RUJ1 3OGRA 4UBGA 4BWOA 2AR6A 1G9BA 4O9GA 1HXS1 4Q4W3 5AFBA 2HWC2 2W87A 3CL1A 2P17A 1FPN1 4PT6A 2ZMKA 4XABA 4AEDA 5DUWA 4JVAA 4OMCA 4XCAA 1AHSA 3LD8A 2ZX2A 2WRAA 3HR9A 4ZHNA 3I2KA 2XVKA 3WX5A 4BQYA 3I7DA 4Q1RA 4YGEA 2QQVA 1POV3 1YJKA 1CZVA 1MS5A 2WNVB 3L2HA 3S0MA 3I2OA 4ZY9A 1AL21 1OURA 3P1IA 4K1ZA 4CZSA 3J4UH 3MW2A 3VZMA 4BOWA 4CP9A 1F9KA 2R072 4UW5A 1VBC2 1NKGA 5JIUA 5FZ8A 5IVFA 1RUH1 3I2JA 2HEWF 3DXTA 5FZ4A 2XBO3 5FYIA 3SISA 4FOVA 1BZWA 3LEGA 4M3CF 1VLNA 1SBDA 1W0NA 1S0IA 2A71A 3AYCA 5FP3A 1S0CA 1YC61 1O4YA 1A3KA 1R64A 2AEZA 3HPNA 2FCUA 4BH9A 3PU8A 5BXXA 3B00A 3SKJE 4AGVA 4WM7B 4RSUA 4D3WA 5GLTA 5J98B 1D0HA 3GALA 1COV1 2ZS6B 1AR83 1H30A 1W8FA 4PHZA 4GB31 4UAPA 3IIIA 1ZZCA 4YW6A 2RJKA 1RITA 2AZ5A 3N4MA 1UZ0A 4IESA 1N1VA 1VBB3 4D6QA 3FN9A 4V2WA 1HDKA 2IXHA 4O9EA 4NRPA 2WIIB 3N9PA 5IVEA 5HV0A 2VUDA 2ZHMA 5A7OA 3RZMA 1SG3A 1UU6A 2JDMA 3OOXA 3D3AA 4CTEA 1DQ5A 2HWB1 1FNYA 3U78A 2JG8B 3PL0A 5FY7A 5E16A 5FPZA 1HB1A 5A7QA 5F7UA 3IAPA 1YI7A 4YM0A 2Y34A 1JU4A 2R042 2BTVC 5L9BA 4YW7A 1G86A 1GQGA 2RJ2A 5FMBA 5JXIA 3LA7A 4DXRA 2VMFA 1V6MA 3PU3A 3AZZA 1UOFA 4XPVA 1PMHX 2D3RA 2ORZA 2JDZA 4PF1A 5KHHA 3BN6A 4XFHA 1W2AX 1MZ6A 4ZS2A 1VALA 1VBE2 3AMHA 5A3WA 4LO6B 1IPSA 4CU6A 4LHKA 3VHNA 4AGGA 3NRUA 2H6CA 4R9DA 4GMP0 3CJIB 3HQXA 1GNHA 3DXUA 1YYNA 3VV1A 3DF0A 3BODA 4HPKB 1PM4A 3SCFA 4CCDA 1GOGA 3W58A 3ON7A 4TZDA 1LU2A 1X50A 1MS3A 4IERA 4LIUA 2JICA 5K7PA 4BJ0A 1URXA 1L7QA 3JBG2 3T2TA 4XE9A 5FPLA 1RUG3 1AR92 2XH6A 4CE8A 5IATA 1ZM1A 2YB7A 1HV0A 3AYAA 2ZGUA 3FE5A 3MW4A 1W8TA 4G3YC 3U0ZA 4HANA 2QTWB 4IUGA 4JTOA 1AX2A 5H9SA 2WINB 5FZ9A 5BV6A 5FRAA 5FKBA 4GA9A 2XJVA 1ASJ2 1PO12 4M3CA 2QDRA 5H9QA 2VUAA 1DLCA 4PLOA 4DXZA 1C8M2 1WCKA 1ZNPA 2XKOA 2ARAA 1W6NB 3MIFA 4D6RA 2PHDA 2W2IA 1E57A 1U0AA 1NG0A 4BXFA 2DBIA 3EHKA 5HBAA 1RUE3 1W39A 2WC2A 5IVBA 2PHUA 2VQTA 2WZPP 3S5QA 5FWJA 1OOPB 4JGYB 4C0BA 4K6BA 4CPBD 3IT8A 4FTSA 4PBOA 1OKOA 2R071 2UWCA 4EV0A 1VBC1 2Z4FA 4I02A 2A6WA 5J36A 1LULA 2GMPA 3CLPA 2MEV3 3B02A 4B4PA 1ZRIA 2VZVA 3R4DB 2ZGPA 2ZGMA 1AR73 4XFIA 3WDYA 1US3A 2VPVA 1HQNA 5CKMA 2JDPA 3ZR6A 1S0EA 2DFBA 1EY2A 1EUTA 1L7LA 1OLQA 4LBNA 4Q4Y2 2BNOA 3U11A 4QPGB 1H6YA 3Q8BA 2CGOA 3THPA 3T3YA 4YM3A 1UYYA 3NAPC 5DABA 2HYXA 4XFBA 1OH3A 1CPMA 3AMMA 2JG9C 2HWE3 5FCCA 5FYUA 1QKQA 1RL3A 3HT1A 3OPZA 4MXWB 4P5HA 1RUC2 4P9GA 5KC5A 5LK7B 5LRRA 2WWJA 2X5IC 3BGAA 5F5AA 3G6JB 5I93A 4P5YA 3K75B 1W6QB 1F31A 2IXKA 4AI9A 1IGOA 2ZGNA 5K0UC 4IEPA 1S2BA 2WT2A 4ISQA 3O1MA 1J3QA 1VMHA 1K3IA 1NT0A 1AL0G 1AR63 2GC0A 2W3JA 4PI2A 1V9U3 1K42A 2VMGA 5FMCA 5LBBA 2R041 3BKZA 5FUNA 4B1MA 3NAPA 5CKNA 4NROA 1FV2A 2GC2A 4YW3A 1RMU2 2JG9A 3H3UA 5KR7A 1FXZA 1LOBA 1Y43B 4OFGA 2W68A 4W50A 1W28A 1UMHA 4AF9A 5G04L 1HN1A 3SKVA 4FPOB 4CYDA 2X5IA 1CZSA 4IDZA 4XF3A 2YC0A 4CEYB 1WCDJ 3V56A 3KVBA 3D4KA 3VHOA 1UF2C 1YQ5A 1ZA4A 1GZWB 2TNFA 3OGSA 4YZ5A 1YFWA 2YY1A 3UJOA 3BOPA 5ANQA 2VR4A 1XNKA 5K0UA 2DCTA 5JMOA 1VJ2A 2QQMA 4OYUA 3ZOIA 3POBA 2B45X 3POWA 1S0GA 5FZGA 3V0BB 3JQXA 3L2YA 2KA3A 4Z82A 4GMP1 4FXKB 1DQ4A 1NQJA 2QQUA 1WD4A 5LY1A 2YPJA 3USSA 1WLTA 4P9JA 4HONA 4G9SB 4OUMA 1NAEA 4TXWA 4RQPB 4XJWA 2P3JA 1VP6A 2KD7A 1WMFA 1S1AA 4H7LA 2VVDA 4HOOA 1W2TA 3WNPA 2NZ9A 3MV01 5FO9B 2VW0A 1ASJ1 1ZBE3 1FMD1 4CDXC 4FOWA 2WNUB 3ORJA 5JZGC 1RHI3 4HBNA 2DBNA 1JTZX 3T2QA 1H8TC 2W1UA 1UYZA 5FZOB 1W8ZA 3FHIB 4GWNA 1QY4A 4MGQA 2C9KA 2VCBA 2XHNA 4QKNA 2QVSB 4YRDA 4ZS3A 2ETEA 1J3RA 1JODA 4R9AA 4R9BA 3RFRA 3OBTA 3MFCA 3OUIA 4FP2A 3ZYHA 4ZU4A 2RMU2 4KI5M 3OPTA 2B46X 2A7AA 2D44A 3BPSA 1LTEA 4WV8A 1GMMA 2WN2A 2VU9A 4ISRA 4AQ6A 2B9VA 1V0AA 4HLTA 5JZGA 1YFUA 3T09A 4AVSA 4BIOA 1LRHA 4NWWA 1H8TA 2E7QA 3BI3A 4QKDA 4CDWC 2ADEA 2GNDA 4CEWB 1UY0A 4QPWA 4DIQA 4L92A 3ZYBA 4A44A 1GWKA 1BQPA 1MVEA 2H6BA 1SCSA 3OGJA 2WAAA 3VB9A 5CG8A 1NCRC 2HWD1 2WDBA 3WLUA 3VKLA 2FCTA 4E4DX 3OBAA 2ZACA 4MG2A 4OHZA 5IFPA 5J96B 4XFAA 3TEXA 5FZLA 3K4ZA 4BMBA 1C1FA 3AMPA 3EYPA 3U14A 2AACA 4A2UA 2VZRA 3Q8CA 4Q8LA 1CIYA 3VBSB 2FDHA 1IS4A 1IS5A 1JZ7A 2R063 5FXZA 2D43A 1OF4A 1GU3A 3MBWA 2ZEYA 1VBD3 2RHPA 2YC2A 3VL9A 4CDWA 1TE1B 1JYCA 2WWSA 1YIFA 3HQUA 5CIRA 4JKLA 2D6OX 4MLOA 2OPKA 4RYDA 4QDSA 1NCRA 4OI1A 4BLJA 4JRAA 3C7HA 4H2AA 2WZR2 4XUNA 4WM8B 3MLJA 5BNOB 4IEZA 1CESA 2UYBA 4LQRA 2PHTA 4HVRA 4QXHA 1EV12 3KZ4C 3ALQA 5FDBA 1QOTA 2D6KA 3IPVB 1KS4A 4HKOA 1VRH2 1W99A 4GWMA 2OYZA 5J7MA 5I8SA 5ABJC 5I91A 3RZJA 1REFA 4YVWC 3PTYA 1TMF3 1JN2P 2W9XA 1AVBA 1FV3A 3HD8B 3SNMA 5F3CA 1MZEA 4PDWC 4FPHA 1W6PB 3VZLA 4GWJA 4XACA 5A3UA 2G4IA 2QUOA 3E6DA 5C7GA 2PN5A 5JSPA 4XDOA 1GWMA 4KGQA 3FWEA 4MGTA 2ET7A 3IDEA 5IT6A 3LOBA 3GBWA 3WG3A 3CZUA 4QHOA 3DYMA 1R1A2 1UD1A 1V6IA 1VE0A 5BNPB 2HWF2 4MGSA 3RJ2X 2I07B 2XPJA 2RM23 2CV6A 2JD4A 1MS8A 1AYN2 3HN1A 4QQHA 1RINA 2PYTA 5J37A 1U5ZA 1C3HA 2BQPA 5JI9A 5KC6A 2UWBA 4CCLA 1LOGA 2XG3A 5ABJA 4YVWA 3ZKUA 1CQ9A 1D7PM 3M1HA 4QB2A 4S2FA 1FAYA 3DPRB 4JC1A 1ULCA 1XNTA 1BBT2 2A6XA 2ZCWA 4PDWA 4QQPA 1GWLA 2N7GA 2PLV2 1EAH2 5C3QA 5IVJA 4KBBA 4AQ2A 2JENA 4NVPA 2YBSA 1HQWA 4UBHA 3QH7A 1GZTA 3I3QA 1PIV1 3VDDC 4MSVA 3N9MA 2K9ZA 4QHBA 3THDA 1BK1A 1HJFA 3ENRA 1O6UA 1WMEA 2BV4A 4N8MA 5DG1A 5A80A 1VAMA 4ES9A 3N7JA 3K2OA 2VW1A 4DY3A 1GICA 3S5AA 4I0WB 1CAVA 1VBA1 3KV6A 5BPXA 3RZGA 5EWSA 1B09A 5LWBA 3BVCA 3POYA 4TTGA 1I6XA 3Q8FA 2WQZC 4H14A 4K8FA 5FAXA 4QGNA 3H9AA 3ST7A 2J22A 3VZJA 2FDFA 4UT5A 1XNBA 4COWA 2PQSA 3NV2A 3RZZA 4YVSC 4DXTA 1M06G 4AHWA 1H1AA 4OI4A 1W06A 2W91A 3LA3A 4W65A 4XTPA 4J25A 3IB3A 3ZFFC 4Z92B 1ODMA 3BYWA 4R8HA 3C8XA 4YPJA 3TN91 3VDDA 4CUGA 4E4ZA 3UNPA 4GD4A 2XJRA 5GLZA 2I2SA 3D5OA 1JZ8A 1OUSA 5A7WA 4H3WA 4CU9A 1AXZA 5A6XA 2J1TA 4AR2A 1MQTC 4LPLA 4RHV3 3MIBA 2ZTNA 1UX7A 2R0FA 1VAVA 4BQ3A 4NRMA 4AAXA 5CADA 3THTA 4JCKA 2YFZA 4LORA 4DPNA 3OYWA 1P8JA 4YVSA 4EN8B 2YC4A 4OQ8A 3C7OA 3QBQA 1DQ2A 3WNXA 4F3JA 3OBRA 5IW0A 3ZFFA 3I3MA 3KF3A 1XBFA 3IDAA 3FFZA 5E89A 4LK6A 5DUVA 2P2KA 2V4VA 4PIZA 5F6LB 2WA3A 4HKWA 2UU8A 5CFCC 3I2IA 2A73B 4LKSA 3WUDA 1ULGA 3KT1A 4AE2A 4CRQA 2A6VA 2JB4A 1XE7A 1XC6A 2FBEA 4Q0SA 4CDQC 1ND3C 1MQTA 3FUQA 3RZKA 4Q8KA 3FL7A 3KT7A 4NPLA 1D2QA 1LNSA 2XOMA 2TBVA 3H1WA 1QH7A 2HWF1 2WS93 3ITQA 3W5MA 2CHHA 2FDGA 4FXGB 3THCA 4AQTA 5KXCA 5IK4A 3JUUA 3PUQA 4Q0PA 4X8PA 3SLIA 1LEDA 1Y7BA 2P5BA 1MPXA 2X29A 1DZRA 1RUD3 3ATGA 1W90A 2VJXA 5CFCA 5KHIA 2HEVF 3I4IA 3IN9A 3M70A 3B69A 2VGDA 1TVGA 4OUEA 5AC92 4CDQA 5JOWA 2JDYA 1V6KA 2PFWA 4R4ZA 1ND3A 5FPAA 2GNBA 3OY8A 2QQOA 1RGSA 2Y6GA 1EAH1 3ZXFA 5L36A 4JAAA 2YMZA 4MHRA 5JR2A 1QQP2 3TEZA 2Z2SB 3ZN6B 2D5FA 3NKGA 3ZM8A 2E51A 1R093 2ZMLA 4QXCA 2F17A 1LEMA 1QJU2 2QDNA 1OA3A 2X10A 3ACGA 4FPKA 4META 5FK7A 1MS0A 1ZBA3 2DVFA 4XJ9A 4S2GA 5C70A 3AFKA 1T6GC 3UT0A 1RYYA 4FBFA 5LY2A 3J26N 3OSDA 3EO6A 2CNAA 1BK0A 1ENRA 4BYYA 1TME1 4XJZA 4LLFA 2VY0A 4KWLA 1V6OA 3PUIA 3GZAA 3QLQA 4LBQD 1GQHA 5L7OC 3WG1A 3PLQA 4Y20B 4YW5A 3WV6A 4FTBA 1YEWA 5IFTA 1YNAA 2GH8A 2X09A 1QDCA 1ULPA 2DVDA 3A0NA 2D98A 5EIYB 2B39A 2O0OA 3J8F2 4TLGA 1TG7A 1PO23 1RUJ2 1K12A 5JVVA 4A42A 4EQVA 1HXS2 2Q8DA 2ZABA 1FPN2 1GP6A 2PAEA 3POJA 4W6XA 3CBNA 3ETQA 5JSOA 5LRSA 2YU1A 2VE1A 2BBAA 1X8MA 3B93A 2Q8CA 3VUOA 2WR9A 4GH4C 2WAOA 1N1SA 4QT6A 3RI9A 2ARCA 4YW1A 1UU5A 5T5JA 1QOSA 2VULA 3WD5A 2ZEZA 5A7SA 3KSCA 3AKPA 4M4RA 4QKFA 1PGL2 3LDBA 1FOD3 4K1YA 4JZRA 5FYZA 3HBZA 5L7OA 4AG4A 1ZA7A 2Q0AA 2A5ZA 5E88A 5HV4A 2XKPA 1XU1A 4O7XA 4XCBA 1KJLA 5CFDC 2O8QA 4XHXA 2HBTA 1BVP1 1L3JA 1RUH2 5F5QA 2WJSA 2G9FA 5F37A 1YWKA 2W39A 5EYYA 3BTXA 3C3VA 3E5XA 3H7YA 3V0AA 4ONUA 3LPGA 5D8AB 4DINB 1NYWA 3WVJA 1UZVA 4YZ2A 5FPXA 4HVOA 2Z5WA 4OVEA 3VDCA 3AKTA 2BP6A 4GH4A 3TWIA 5A32A 2ZEWA 2P6HA 2RS53 3VZKA 1AR82 2KR2A 4JQTA 1COV2 3BTAA 4K8RB 5KXEA 3M3EA 1LOFC 4MV2A 1SZBA 5LBEA 2H0BA 1G9AA 2PA7A 4YFWA 2AUYA 1R081 4NJ4A 2C24A 3GHNA 4XF0A 4AEKA 1HW5A 3A21A 1TQ5A 3WW3A 2DTWA 1RXGA 3HN3A 1PVC3 5CFDA 1QNWA 2WYFA 3KQ4B 1JW6A 3DECA 5FXVA 2QNKA 3P5BA 4NIGA 1DGRN 3RPQA 4JGZB 5DN2A 5E1RA 1JZ5A 2BU9A 2JEMA 1W03A 4HKLA 1JYVA 2HWB2 1QJX3 2VOKA 4JHTA 2XVGA 4CUBA 2VZ1A 1DZTA 1W6OB 2Y8KA 3MYXA 4OI2A 4G4FA 4LUMA 3A7QA 1UZZA 3MI8A 4E8CA 2YBPA 3K3NA 3KB5A 2BVBA 3QOPA 2D3SA 4QGLA 4K21A 2WNVC 3T4VA 5JCTA 1LOFA 3OCPA 2PTMA 1RUI3 3T0AA 2P6CA 2ZX0A 4XILA 4CU7A 2L9LA 1TNFA 2E53A 1HQLA 2CYFA 3V64A 4L11A 3ZMOA 2WLQA 1LHNA 3CZJA 4KG8A 4Y1YA 3I59A 1PK6B 2QZ3A 4ZXEA 1XYNA 1HB2A 1XB9A 4QX7A 4XOGA 1NXMA 3FBMA 3HVDA 1KFUL 5IWFA 4EWDA 1KEXA 1OKQA 3K4DA 2B8MA 2QCSB 2XJUA 4F7ZA 1D4M3 3NO8A 4JQRA 3O0VA 4OZOA 1KDMA 3TEYA 1JYTA 4O65A 3SXWA 1SDDB 3ILNA 1H2LA 5C9AB 4TSVA 1OI6A 4WM7C 4Y22B 1A8MA 2WNVA 3KF5A 5FYYA 1W0OA 1QH6A 1RUG2 2WUHA 3CDZB 3APBA 5C4WB 3ZIXA 5DUUA 3WW1A 1PGW1 4Q4W1 2V09A 1WUVA 1JS9A 3E97A 1OH4A 4KWKA 3QD6A 4NAOA 4AZZA 4AFAA 1CPNA 3H8XA 3GBGA 4DY5A 4JV4A 2ARXA 4IEWA 4UFLA 5FPBA 4DUXA 1MS1A 4ZZ8A 3MIHA 5HCAA 1UPIA 3POEA 2I45A 5C3OA 4Y4RA 4COYA 1POV1 4AL9A 4E27A 2R6QA 1MZ5A 4ES8A 1PGL1 1GQPA 5A3TA 3MDPA
chains in the Genus database with same CATH topology
1HRI3 3RYPA 2RR13 1QXPA 2DYCA 4NOTA 4D69A 3NW4A 5I8TA 4FOYA 4WM7A 3MF6A 3GYDA 2YXSA 4OI0A 2MEV2 1DYPA 2TEPA 2XBO1 3AZWA 1W6MB 4FT8A 1WD3A 3AJZA 4WBBA 3OD4A 2QE3A 1DDLA 3H3ZA 1MEC3 4PBPA 3ZSEA 5K9YA 2BEOA 1SDWA 3WDWA 1O3TA 3FLRA 2GALA 3E5UA 3LCPA 2ZPXA 1QF3A 3AP5A 3CJIC 1JUIA 4YG6A 3FZ3A 1ZZ8A 4L99A 4YNIA 4FCAA 1AR81 2Y26A 4HZFA 3KCYA 1I1EA 1C8NA 1ND2B 4LTAA 2E7TA 1I5ZA 1J1TA 2R1BA 2R1DA 3TN92 2KM2A 1VBB1 1IS6A 3BALA 3MICA 2ZKNA 4KU8A 3VN4A 2UY8A 4LLOA 5DDJ3 1Z0HA 4FQZA 1SBFA 3N7LA 1KJRA 1RVF3 2UWAA 1N3OA 3ILFA 4KNCA 3VBRB 3K51A 3ZSMA 3U4XA 3IIAA 1S2KA 3TYJA 1V9U2 3ZYJB 3CJIA 1DGWA 4KU7A 3RNSA 4AI2A 3B7MA 4EWEA 2D3PA 4AVTA 4HFSA 4HPKA 1Z78A 2RJLA 3RYKA 4FO9A 2PHRA 1JXNA 2HJIA 1J58A 2E7AA 4I3PA 2YROA 1OOPC 4JGYC 4LBJA 4HMZA 1EPWA 3BOWA 5AVPA 4JDNA 2BVVA 4Q0VA 1HIXA 1OA2A 4MGZE 3FX3A 5ACA3 3LA2A 2AREA 4YYOA 4QPGC 3RDIA 3TRSB 4ITCA 1LHVA 4XW3A 1AUYA 1W6NA 3JD73 3RS6A 2WSUA 3CJXA 1RUG1 1OSGA 2BYVE 2OVUA 2RS13 2GAUA 3GBFA 3WT3A 1OOPA 4JGYA 3H0OA 5FLIA 4D7TA 3PVOA 4P9YA 2IZWA 1CD3G 2QFEA 1ENSA 5C8CB 4I3GA 3OGGA 1RUF3 4Q4V3 2OIIA 1O4ZA 4EROA 1AX0A 1ZBE2 3KS7A 1NCQC 1FMD2 1YUDA 4N90A 3VBOB 1AF9A 1RHI2 4Q2FA 3FFQA 4QU2A 3CO2A 2GZWA 1RUE1 1W0PA 1BXHA 3VBFB 5FFOC 4ATEA 3EBRA 4QPGA 4NO4A 2Q30A 1V6LA 4Y24A 1V6NA 1Q56A 1O3SA 3M3QA 3UK9A 2MEV1 4RS5B 2W0XA 1CJPA 1CJDA 2HWC3 1AR71 2UY9A 3P3PA 4Q27A 4KH9A 1IOAA 5LEKA 1AYM3 2C9AA 1YLLA 3DV8A 3ZO0B 4CEYC 4U36A 1H0BA 1W6QA 1NCQA 4LO5B 1D4VB 3ZN4A 2RS33 1LB2A 2VMIA 1C5HA 1Q8QA 4ORFA 1HRV3 2HWE1 1UN1A 3VBUB 1Y3TA 1NQDA 3WXPA 3JZVA 1FI2A 1ZZ6A 2NPIA 4YZ4A 4M3CB 4PLMA 1KXGA 1Q5OA 2DWRA 2HWD2 1PMIA 4LO4B 1PZ8A 4RQPC 3WQ7A 4E4SA 3CEWA 2D6LX 4CEYA 1GYKA 2VXRA 4DQAA 5CB7A 1AR61 3AZYA 1GZWA 1V9U1 3KGLA 1H1IA 2JE9A 1IPKA 5FLJA 3NV4A 1LENA 2WNUC 4FPJA 4GIQA 1VBD2 1I9RA 3V0BA 4I09A 3B3QE 4Y5Z0 1S0BA 1A78A 1I3HA 3PHMA 2XLAA 4LNVA 1KQRA 3E5QA 4RQPA 3PMEA 4YFZA 2E9QA 4EJRA 2YGLA 2WFF3 3HT2A 3VHRA 2WNUA 3NL1A 3Q9OA 3AP9A 4N9IA 2NYYA 3UKNA 1TMF2 2XUMA 2XGXA 4P9WA 4XQWA 4YGDA 1NLSA 3ZXAC 1IKQA 5I0UA 3OTFA 4CEWC 1VBE3 1X8EA 2A3XA 3I8TA 5BY5A 4C90A 2EA7A 2TUNA 1ZYBA 1ZBE1 1QGLA 1OHFA 3ILRA 2DURA 1RHI1 2X8KA 1YFXA 5KHGA 4K40A 2CAVA 1LECA 1ONAA 2DUQA 4IEOA 1PZ9A 3AJYA 5JR7B 2VVEA 3ZMNA 3NV3A 3VBSC 2R30A 4WZFA 1H2MA 3JBG3 1BEV3 1AR93 4PIYA 2Z79A 4YGBA 2UYAA 4XJ8A 4CEWA 1OFNA 3ZXGA 3WG2A 1O91A 5T3NA 3GNEA 1PO13 1SLIA 3NV1A 1C8M3 3MPPG 4HK8A 4LULA 3TNQA 4WM8C 5BNOC 3PJQA 1PIV2 1O4TA 1TNRA 2O1QA 4BHPA 3B5LB 4AVCA 5CBLA 1B35B 3VBSA 3TBDA 1FATA 1ZZ7A 1VBA2 4Q0QA 5JSRA 2Q8OA 4PCRA 3ES4A 2DCJA 4JDMA 1N3PA 1QJY2 4NN0A 5CAZA 3PMSA 5GJ6A 5GLWA 1ZRRA 4Q4Y3 4WVZA 3RWNA 4XXPA 5BUVA 5KHKA 3VKMA 2HEYF 3WHUA 2VVFA 3KM5A 4WM8A 1H8VA 5BNOA 4MXVA 5BNPC 4Y26A 5JPMB 5IK8A 3E6BA 2ZAAA 1BMV1 1VBD1 4XF1A 2BNNA 1RUC3 3OJBA 3SH5A 3N7MA 1ZZBA 2XVLA 4I0AA 3IPVA 3JU9A 5KHJA 1IHMA 4CDXB 4Z1VA 4CDUB 1HKDA 3DPRC 2ZGKA 4N7IA 4ASMB 2B7YA 1W6PA 1KFXL 4LBKA 1H8TB 5BNNB 3AB0A 1NE4A 1DFQA 5F1RA 1K5MB 1FYUA 1YXWA 3MLLA 4K7JA 5BNPA 4XTMA 1DZQA 1RMU3 4XQ4A 1TMF1 5GZEA 1SMVA 1U5IA 2ZBJA 3KD4A 2D6MA 1DGRA 3VL8A 3B01A 1BVVA 1ZZ9A 5A3MA 1CAWB 1GZCA 4RA0A 2CWMA 4LBQB 3DPRA 4IV3B 3JB8A 4XETA 2WS92 4ZKTB 4IV1B 4AYUA 2RM21 5GALA 3X29B 4P14A 3RMXA 3MEPA 1G9CA 1CAUB 3JB4C 3S7IA 1X82A 2PHWA 2LTNA 2DTYA 3WP4A 4E2SA 5HXVA 4FQ4A 2ZHNA 2YV8A 1JBCA 4NHLA 1XYPA 3R05A 3NKTA 2EVXA 3D0SA 1C5IA 2FZ2A 4MX3A 1C28A 5H9RA 3WDXA 1RTVA 1R092 1Q43A 1U12A 3ROUA 3M7AA 4FTEA 2B5HA 3ZIWA 3IWZA 1YO8A 3AX4A 4MZUA 1Q8OA 1ZBA2 2ZX3A 3VKFC 1WLDA 2DVBA 1IZ3A 4QPIB 4R9CA 3VBHB 4DRVA 1TME2 1QJZA 4XJAA 1OFSA 3OD0A 3ZXLA 2RMU3 4P9XA 1QWRA 1LHOA 1QJY1 5FTTC 2IXLA 2IXIA 3JQWA 3A4UA 1DBNA 1BYHA 1LKNA 5T50A 5I0TA 1GSLA 3PVEA 1JYIA 1LJ7A 1NE6A 4QX5A 1UL9A 4ZXKA 5A33B 4HT1T 2IWGB 2YYOA 3S30A 3KCCA 3M8LA 4RHV1 4RL7A 2OZJA 4XEZA 3AKRA 5FQ0B 1UCXA 4MGYE 1DIWA 3B9IA 2P34A 2IC1A 4LHLA 5IK7A 1OQDA 4CP2A 3VGIA 3CF6E 1GBGA 3G7DA 1SCRA 2DCYA 4Z8BA 4QPYA 2ZGOA 3R4UA 3ZSKA 4LO7A 4BE3A 3MIEA 1NA1B 4KQ7A 4C0HA 5F9TA 5K8SA 2XLGA 3U07A 2EXKA 2WLPA 3FLTA 2NP0A 4FPLA 3ZFEB 2DF7A 2WZR3 5SV5A 3VDDB 1R082 1RJ8A 4D7YA 2WS91 4XBQA 3WG4A 4LE3A 1EV13 3QACA 4YGCA 3U10A 4DNYA 4WVMB 3ZN6A 4B29A 2ZAHA 1VRH3 1QJX2 4HSJA 4UW6A 2GH2A 1CX4A 1RUD1 1DGLA 2D6NA 4AI3A 3QH6A 4FP3A 4A3XA 3VKOA 1QU0A 3O0WA 3RI8A 3ZXJA 1D0GA 4AVVA 4INDA 2QJVA 2DUOA 3EJKA 5AVAA 1KD7A 3LB9A 2VNOA 4LHNA 2NM1A 2BWAA 4EWAA 3SMHA 4Y1UA 1R1A3 3ZPYA 3ZYPA 2GC3A 2SLIA 4F83A 1R091 5B2GB 2DCZA 1Q3EA 4AHZA 1MVQA 4HK9A 1U5XA 1AYN3 1ZBA1 1KITA 1QOOA 5GZCA 1D4M2 4AFDA 5T5PA 4FAHA 5D8AC 1CAXB 1NZCA 1GR3A 1W2UA 4GKYA 4YM2A 1CN1A 1BBT3 3WP3A 1FT9A 2PLV3 2W52A 1PGSA 1N1TA 1PO21 3AM2A 1POV0 1YI9A 3KMHA 4XMIA 1PGW2 3HMYA 2B42B 1GFF2 4Q4W2 3SH4A 3WY6A 1OLRA 4N43B 2ILMA 3TAYA 2AYHA 1APNA 1S55A 3IMNA 3H1MA 1NXD1 2DU1A 1ND3B 2VG9A 4LEJA 3SCGA 4JGZC 2LALA 4GULA 2EAKA 2PHXA 4NPRA 4N53B 1N1YA 5D8AA 1FOD1 2C5DA 1HRI2 2SBAA 3H7JA 2DFCA 2RR12 2Y0IA 2QQPA 3M3IA 3USUB 4NHMA 3WP5A 4LE4A 3LOIA 5DZGA 5SV8A 4XHBA 1QHDA 5GZDA 1WW5A 1WW6A 2XBO2 2XLFA 2BBVA 4AFCA 4YZ1A 5JPNB 1MEC2 2Y38A 1O3QA 4LT5A 1PK6C 1YCIA 4DRRA 3AMQA 2X53S 3W59A 4XFFA 1PM7A 5GKAC 3MF9A 4XZPA 4OHYA 2RS51 4JGZA 3NJZA 1GKBA 4RR3C 5LEJA 1C1LA 3FC0A 2K0GA 4UW3A 5CNAA 1WW7A 1W6OA 1VBB2 4AW7A 2GSYA 5C9AC 3AP7A 1YRZA 1C4RA 1PVC1 5DDJ2 1XE8A 3ES1A 2Z42A 1H4HA 2JXAA 5C4WC 4XXAA 2P3IA 2XB6C 2P3KA 1QJX1 1LOCA 2HYKA 1PK6A 3ZFGB 3BPZA 5JOXA 1S0FA 2QZ2A 1UIJA 4YG0A 4YSFA 3KLSA 4RR3A 3NSTA 1MR5A 5JDBA 1RUI1 2ZGQA 2CL2A 2DU0A 4I0BA 5A3LA 3GF6A 5C9AA 4XBLA 5GLVA 1RIRA 4RGAA 2AGSA 4RFT0 3RYRA 4Y22A 3KT4A 5C4WA 5T52A 3BIWE 1LGBA 1WBLA 3N36A 5KXBA 4Z07A 3ZYIB 1SQ4A 2GN7A 1D4M1 4BLIA 1MACA 4LA3A 3EQEA 3TNPB 1J1LA 5AC93 1Z7S3 3AFGA 4AI8A 3JD72 3WZ1A 4KL1A 3KGZA 2Y0OA 4XIKA 1ND2C 4I2OA 2IXCA 1QQP3 4KWJA 1DGWX 1PNFA 1ENQA 2CTVA 1NY71 1SEFA 4FPFA 1QJU3 4Y1VA 1WBFA 4Q4V2 3D8CA 2WFPA 1W6MA 2D5HA 1UW8A 3URFA 5LK5A 3VBRC 5C8WA 1RUE2 2JG8C 4Q4X3 2R0HA 1HRI1 4GALA 3D82A 2RR11 1X33A 3LGRA 2F6BA 2ENRA 1SFYA 4R4XA 1WLWA 2GN3A 1ULFA 3J8F3 3QCWA 1RUJ3 1ND2A 3A0KA 3R6SA 3WCSA 1ZRFA 3TOJA 1XNDA 1HXS3 1KDKA 3FJSA 1AR72 1FPN3 1AYM2 1Q8SA 1HLCA 1MEC1 4FAGA 2VECA 4YG3A 4Y1XA 4JTNA 2PAMA 3FMGA 1H1MA 1SFNA 2RS32 5TSWA 3ZSJA 4XIOA 1EYBA 2EXHA 2DV9A 3VBRA 1AL23 4FPEA 1HRV2 2PELA 2JG8A 4R52A 3VZOA 5J3UA 4KGGA 1LODA 2HWE2 2Q4SA 2CGPA 5EV7A 4AEDB 3PJYA 4B8EA 5I8YA 2ERFA 5DDJ1 3WCRA 1RUH3 1RUNA 4L8QA 5JI7A 1AX1A 1RVF1 3RJRA 2OUJA 4P9LA 5CU1A 3CNAA 5L73A 4W6YA 3ZX7A 5C8CC 3WQ1A 4UW4A 3PVBB 1LGCA 2VH9A 2YUEA 4FVVA 3M2MA 4IEVA 5EJ3A 1AR62 4IQPA 3ZYRA 1COV3 3VBOC 4GB33 1GNZA 1ALYA 3AP4A 5BNQA 2PHLA 5H9PA 5HCBA 3VBFC 3ZXEA 2EALA 1RJ7A 1A8DA 1O5UA 2A3YA 1ZREA 5T54A 3NWKA 5T5OA 1RC6A 2VNRA 4RS5C 2ZKLA 3TB0A 2WT1A 2NN8A 5JOZA 4MH0E 2HWB3 2JE7A 3O7OA 4ASLA 5ACA1 5C33A 5C8CA 3M4FA 2WFF2 2K2SA 2ZA9A 3VBOA 1BJQA 3JD71 4B7KA 1X36A 3EXUA 1J3PA 1WLCA 2RS11 3VBFA 3VBUC 2D97A 2BPA2 4C1WA 1REEA 1YFYA 5FMOS 4OULA 5JLVA 5C6CA 2WA4A 1RUF1 3R0RA 4Q4V1 4SLIA 4TYSA 4RS5A 1GZ9A 2FQPA 4BIFA 1H9PA 2BGCA 1CVNA 1A6CA 1H9WA 5CA6A 4AFMA 2ET1A 1BEV2 2NQYA 3WHTA 2NMOA 1XQNA 3VBUA 3O14A 4Z2WA 2HWC1 4S2HA 3L9JT 4L9BA 2WKKA 4MXWA 1OQ1A 1AYM1 2XJPA 1YHFA 3DL3A 4DFSA 3N7KA 4FPYA 1NOVA 4MGIE 5FREA 3T1LA 2RS31 4HETA 4AWDA 1V70A 2JECA 4EN0A 3ZYGA 4DS0A 2YHJA 1HRV1 1VAKA 3ELNA 2FHRA 4B3NA 4V1PA 2R073 4P9IA 1VBC3 3E6CC 4DOUA 1WGPA 2CGNA 3ZN5A 2GC1A 2DUPA 1H2KA 1QDOA 1MZFA 4XBNA 1QXJA 5DXDA 2ZX1A 2C1FA 3UV9A 4M0HA 1IPJA 2CWSA 2R062 3KCXA 4LBMA 1O7FA 5E8AA 3TN93 4IEUA 3K48A 1BMV2 2VQAA 2ZX4A 3DKWA 1CGPA 2Z69A 4L2NA 2YGMA 1KS5A 5FLHA 1NCQB 1LESA 3MW3A 4NR1A 4CP0A 3FLPA 4TLFA 3RRDA 2AENA 4IEXA 2R32A 4JRLA 4D94A 4FPGA 3RSJA 1UIKA 2WFF1 2R043 4YW4A 1HX6A 2VW2A 4LBLA 2NLRA 4HN0A 1LR5A 1QMJA 2BFUL 4XF9A 1WMDA 4J1XA 3RMYA 1O3RA 3ZDSA 5EYXA 4BA6A 3DN7A 4AEJA 1GV9A 1BCXA 2EIGA 4HSLA 3HAGA 1B35C 1VBE1 3M3CA 2VMHA 1LU1A 2WQ4A 1EP0A 2ZZQA 3WDUA 2CAUA 3BCWA 4NWVA 3AKSA 4M00A 1RUOA 1XRUA 2R16A 3ACLA 1QXRA 2W08A 2Q5TA 3NAPB 4GKXA 4K20A 5IUQA 4H55A 2OZ6A 3LSDA 2DCKA 4J1WA 2JG9B 2RM22 1S0JA 4MVTA 1Y9QA 4AFBA 4E9KA 3KQRA 4X8NA 3ECQA 2X5IB 4TWTA 5KBFA 2WL1A 3FBYA 4GMP3 3JBG1 3MFAA 1BEV1 1AR91 3MLKA 3INAA 1B35A 5K0UB 1WW4A 2GNMA 1H4GA 1PO11 4QM9A 4AI1A 2XL9A 1ASJ3 2EAAA 1FMD3 2Q1ZB 5KXDA 1C8M1 1SLCA 5I0RA 4CDUC 4QMAA 1J59A 4QQLA 4PLNA 1HV1A 2GMEA 3WQ0A 3LKJA 4WVWA 5BNNC 1U5YA 2MHFA 5GLUA 3AXEA 1K5MC 4LR4A 3H8UA 4I01A 1DQ6A 2D6PA 3UJQA 1G6NA 1IKPA 3FUOA 3SCHA 2PHFA 5T55A 5J48A 5GZGA 4LBOA 1SLAA 2WT0A 3IBMA 4M01A 2XHKA 1DQ1A 2ZGLA 1DU3D 4Q4Y1 4D7SA 1F5FA 4CDXA 2H0VA 1TEIA 4HN1A 4CDUA 2GNTA 4IV3C 4Q1PA 2R061 1CONA 4IV1C 4LO8A 5BNNA 1REDA 1OPMA 2MPFA 4MGKE 2A70A 4Q29A 1K5MA 1RUC1 1UKRA 4BCUA 5GZFA 4SBVA 4M3CE 2BUKA 4BQ1A 1OA4A 2V5YA 4RHV2 3SHRA 4AGRA 3MIDA 2HWD3 3N3HA 4QD2A 4OZXA 5JZGB 2FMYA 2VNGA 3LWCA 3RQ0A 3WINE 4COVA 1CAWA 4RGGA 1UKGA 4LBQA 4BMEA 4IV3A 4PQ9A 4XQDA 4N7UA 3AP6A 1RMU1 4IV1A 1F2NA 4CP1A 1ULDA 3RG0A 1KRIA 1DYKA 1CAUA 4COZA 2XJTA 4LA2A 5JOYA 2VOWA 4B4RA 5JMCA 3GZUC 4QPIC 3VBHC 1G7YA 2XWBB 4LUKA 2BNMA 5F6KA 3LZZA 4XJUA 2ZGTA 5FO8B 2EF6A 1DG6A 4A7KA 3D0JA 2B9UA 2ZOEB 1XU2A 2G9GA 3MGUA 4MUVA 4CDWB 4GXLA 1AXYA 4X6RB 3AMNA 5DZEA 1NCRB 3LAGA 2E63A 5L19A 1RUD2 5BYNA 1SLTA 4BPZA 5CVRA 1PNGA 1O5LA 1SLBA 2LUWA 3AYEA 5HCFA 3IKWA 1G9DA 2D93A 2UURA 4QPIA 3VBHA 1IS3A 2A3WA 5DZFA 2IXJA 4J6GA 4KG0A 2A6ZA 1AZDA 4IETA 2GDFA 2BFUS 1H2NA 5EZWA 3WDTA 3P3NA 3UKTA 1ENXA 4MYEA 5J09A 2OW4A 4AVAA 1S0DA 2E6VA 3DGTA 1UZYA 4FSJA 2KXLA 1NA1C 1QNYA 4QQ2A 1Q8PA 5KWRA 2ATFA 1YIPA 2RMU1 5A33A 2EXIA 4IEYA 3J9SA 4E2GA 3VHPA 1PO22 3R4SA 4URTA 3ZFEC 5FQ0A 4IXLA 1EPZA 4XDQA 4AEMA 4A7YA 1PIV3 5ABJB 3ZXKA 4YVWB 3NVCA 4M0NA 3ZVXA 4ATFA 5FO7B 1X7NA 2BWCA 3M3OA 4PDWB 2CY6A 3O0XA 3AXDA 4PIXA 2AH2A 4EN7B 3O5SA 1VBA3 4AHYA 4WVVA 3WUCA 1F8VA 1Q8VA 1NA1A 1FOD2 2V73A 4PJYA 4OHVA 2R49A 1QJY3 3ZXDA 3JCIA 4Q0UA 4U2AA 2F4PA 3W9AA 2IFWA 3I54A 4QGMA 4K3UA 1V00A 2XJSA 3ZFEA 2IFRA 1UAIA 4XFCA 2GMMA 4PF5A 1CAVB 2FZ1A 2PQQA 3GZTB 4Y4YA 2XJQA 3AKQA 4BM8A 1JHNA 1UX6A 4WVMA 4UXAA 1CR7A 2RS52 1YJLA 2JJ6A 4ZU5A 5GM0A 1G9FA 3B94A 4C91A 2WZR1 2ES3A 1R1ZA