The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
60
|
sequence length |
190
|
structure length |
190
|
Chain Sequence |
MTLENVLEAARHLHQTLPALSEFGNWPTDLTATGLQPRAIPATPLVQALDQPGSPRTTGLVQAIRSAAHLAHWKRTYTEAEVGADFRNRYGYFELFGPTGHFHSTQLRGYVAYWGAGLDYDWHSHQAEELYLTLAGGAVFKVDGERAFVGAEGTRLHASWQSHAMSTGDQPILTFVLWRGEGLNALPRMD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
New Mechanistic Insight from Substrate- and Product-Bound Structures of the Metal-Dependent Dimethylsulfoniopropionate Lyase DddQ.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| source organism |
Ruegeria lacuscaerulensis (strain dsm 11314 / kctc 2953 / iti-1157)
|
| molecule keywords |
Dimethlysulfonioproprionate lyase DddQ
|
| total genus |
60
|
| structure length |
190
|
| sequence length |
190
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
4.4.1.3: Dimethylpropiothetin dethiomethylase. |
| pdb deposition date | 2016-05-09 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF16867 | DMSP_lyase | Dimethlysulfonioproprionate lyase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Jelly Rolls | Jelly Rolls |
