5JSOA

Structures of dddq from ruegeria lac. reveal key residues for metal binding and catalysis - tris bound
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
190
structure length
190
Chain Sequence
MTLENVLEAARHLHQTLPALSEFGNWPTDLTATGLQPRAIPATPLVQALDQPGSPRTTGLVQAIRSAAHLAHWKRTYTEAEVGADFRNRYGYFELFGPTGHFHSTQLRGYVAYWGAGLDYDWHSHQAEELYLTLAGGAVFKVDGERAFVGAEGTRLHASWQSHAMSTGDQPILTFVLWRGEGLNALPRMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimethlysulfonioproprionate lyase DddQ
publication title New Mechanistic Insight from Substrate- and Product-Bound Structures of the Metal-Dependent Dimethylsulfoniopropionate Lyase DddQ.
pubmed doi rcsb
source organism Ruegeria lacuscaerulensis (strain dsm 11314 / kctc 2953 / iti-1157)
molecule tags Lyase
total genus 60
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 4.4.1.3: Dimethylpropiothetin dethiomethylase.
pdb deposition date 2016-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16867 DMSP_lyase Dimethlysulfonioproprionate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5jsoA00
4KWJA 3NVCA 4IEVA 1RUOA 4QX5A 3NJZA 5FPXA 1RTVA 3LZZA 3S0MA 3D82A 1HW5A 4AQ6A 2PAKA 2IXLA 4MH0E 4BH9A 3NKTA 3RPQA 4BIFA 3H8UA 2O1QA 4LA2A 2OZ6A 4ZU4A 3M3IA 2ET7A 1ZVFA 2CV6A 1ZZ7A 2KXLA 2XL7A 3I59B 5EFUA 3ROUA 4X6QB 4PJYA 3SCHA 2QCSB 3IIAA 4XFBA 4Q0VA 2OYZA 4O9GA 4H7LA 1J3PA 3KGLA 4Q0QA 3PVBB 1VJ2A 2VQAA 4XEZA 1UD1A 3H3UA 2GC1A 1SQ4A 1IPKA 3GBFA 2EAAA 5AVPA 4XFAA 5FPZA 3RNSA 1YLLA 5BV6A 1CAWA 4IEQA 3E6DA 5KBFA 1ZZ6A 2FMYA 1ZREA 3SCGA 3H1WA 2D5HA 1O5UA 4XETA 5FLHA 1RGSA 1EY2A 2K9ZA 1Q3EA 1DZRA 1YWKA 4P9GA 2MPFA 4ORFA 3HT2A 3OD0A 1H1MA 1O3TA 4GULA 1CAVB 5J7MA 2IXCA 3C3VA 3H3ZA 1LRHA 3FWEA 3SMHA 4AQ2A 2OA2A 3ES1A 1OD5A 3RYKA 2K0GA 5KHKA 5K8SA 2QJVA 2IXKA 1LR5A 4O9EA 3I59A 3VHRA 4EWEA 3I7DA 4QM9A 1YUDA 2ATFA 5J3UA 4J1XA 4XFCA 3OF1A 1XRUA 1ZX5A 3U10A 1QWRA 1O4TA 3QACA 5FCCA 4AXOA 2XLAA 5BUVA 4MX3A 4EWAA 4N9IA 4OFGA 4IESA 2XGXA 2B8MA 3LAGA 3MYXA 5E16A 1O3QA 4E2QA 3GYDA 4FAHA 1EP0A 1ZZ9A 4WZCA 3IWZA 4KL1A 3FX3A 3H1YA 1X8MA 5FDBA 2H6CA 4D7TA 3R6SA 1ZRDA 1Y3TA 5FLIA 4EWDA 3WW2A 4META 2B9UA 4XF4A 4AVCA 1J58A 1CAVA 1ZRCA 4I0AA 1CAWB 2MNGA 2PQQA 1RC6A 1DZTA 5C6CA 4FT8A 2EA7A 2PHLA 1Q43A 1ZNPA 3LOIA 4WVZA 3BALA 4EROA 3DN7A 2PAMA 2Y0OA 5LRRA 5JSPA 2C0ZA 1SFNA 4PIYA 2XHKA 1UW8A 1Q5OA 4HVRA 1OMIA 2EVXA 3OCPA 3FE5A 2ET1A 5T3NA 3WW4A 3RZZA 3EBRA 1EYBA 4LULA 4A2UA 3TNQA 3ES4A 2PYTA 3DV8A 2ZCWA 3LWCA 3OTFA 1O3SA 2IXIA 4TLFA 5CADA 4IEUA 3FZ3A 5E1RA 2QNKA 2FQPA 4L2NA 2E9QA 4IEYA 4I01A 3HQXA 4QMAA 5BXXA 1O7FA 2Q30A 1GQGA 1I6XA 4QGLA 4IEOA 3E5UA 3ZDSA 5BPXA 1WGPA 3LA2A 1TQ5A 3KMHA 1UPIA 4IERA 1WA4A 3LA3A 4ZU7A 3D0SA 1NE4A 2H0VA 4MGIE 1DGWA 4LA3A 3E6BA 3ETQA 4OLLA 2P17A 4XFIA 2WFPA 4JTNA 3G7DA 4I3PA 4I09A 5D1IA 2XKOA 4L11A 4CYDA 3RYPA 5FQ0A 3RYRA 1DGRA 4XFFA 2XL9A 3UKTA 2ETEA 4LUMA 4B29A 1XE8A 1NZCA 1YFWA 3ST7A 4Q0SA 2VECA 4PIXA 5CVRA 2UYAA 3NSTA 1JUHA 2CAUA 3O14A 1YFYA 2IXHA 4XF0A 3SXWA 4HLTA 1FI2A 3EJKA 4UBGA 5C8WA 5F1RA 5I0SA 1OI6A 1J59A 1CAUA 2IC1A 3HT1A 3PNAA 4QM8A 1X7NA 4XFGA 1UCXA 2PA7A 3USSA 2GC0A 2GC3A 4HN0A 3CL1A 1J1LA 4IEPA 3NL1A 4JTOA 1ZRFA 5KHIA 4AVBA 5I0RA 5LEKA 3CF6E 2F4PA 2Z2SB 3B02A 3KSCA 2CGPA 3KCCA 2XLFA 4DINB 1NXMA 3SHRA 5FLJA 1RUNA 5JCTA 1RL3A 4MGKE 1J3QA 3MPBA 4Q0UA 2CAVA 2VPVA 1NYWA 3U11A 1YFUA 1SEFA 1G6NA 2UYBA 4LUKA 4LTAA 5KHHA 3H1MA 4KWKA 1ZRRA 1QXRA 2GU9A 4ZU5A 4E2GA 3CO2A 4E2SA 1OFNA 4LEJA 4WBBA 2PHDA 3EO6A 4YRDA 4YARA 5I8YA 1PMIA 3TNPB 2I45A 3N4MA 4HN1A 3NW4A 3IDCB 4FAGA 1YFXA 5KHGA 3FFQA 3H7YA 4FBFA 4XF1A 5I8SA 5FQ0B 2D40A 3KGZA 3WW1A 4I2OA 1CAXB 3ACLA 3H9AA 4BYYA 3BPZA 1PM7A 3L2HA 4UBHA 4X6RB 3RDIA 2GC2A 3SCFA 4QGNA 4ONUA 4I02A 1V70A 1CGPA 5LRSA 2BGCA 4HZFA 3FHIB 4YYOA 4PIZA 4IETA 2D93A 4JV4A 4Z07A 2QVSB 1GQHA 5J48A 4Q0PA 4I0BA 3M70A 4MUVA 5I93A 4XF9A 2UY9A 4HSLA 3S7IA 1CX4A 3I54A 3H50A 5JSOA 1XE7A 1CAUB 1YHFA 1VR3A 2D5FA 2IXJA 3MDPA 4XFHA 4F8AA 2GAUA 5I0UA 1ZZ8A 4Q29A 2MHFA 4HSJA 4KU7A 5JAXA 2ZKLA 2PAEA 3D0JA 3UKNA 3WW3A 4BHPA 2GZWA 3E5XA 2BNOA 1FXZA 3CEWA 1H1IA 3FJSA 4R8HA 3ELNA 2Q0AA 4Z82A 4D7SA 3S7EA 5I0TA 4IEWA 1CAXA 4YSFA 3DL3A 5EZWA 2QDRA 4EV0A 5I8TA 2B5HA 2XLGA 4HVQA 3LA7A 4HMZA 2Q4SA 3PLQA 2V09A 2BEOA 1X8EA 1EPZA 1FT9A 1LB2A 1QY4A 2UY8A 3BB6A 3CJXA 2BNNA 3QOPA 3H7JA 2DCTA 1ZZBA 1O3RA 4IEXA 4J1WA 3E6CC 3IBMA 2PTMA 4R52A 2PFWA 1IPJA 3OGJA 3DKWA 2WC2A 4MGZE 5HI0A 1ZZCA 3HIFA 3E97A 4NVPA 1U12A 4AVAA 4MZUA 4N9HA 2BYVE 2BNMA 4UXAA 1LKNA 4HBNA 4JVAA 4MGYE 5JR7B 2XKPA 2HKXA 2OPKA 1UIKA 2OZJA 3MZHA 1VP6A 4QGMA 4YNIA 1I5ZA 3EHKA 3BU7A 3CLPA 3U0ZA 4IEZA 2HJIA 4HVOA 4KU8A 5LEJA 1X82A 2Q1ZB 3E5QA 4F7ZA 1Y9QA 1UIJA 2N7GA 4LLOA 5KHJA 1QXJA 2Z69A 4RD7A 2H6BA 3UKVA 5I91A 3IDBB 4MV2A 5BY5A 5JSRA 2O8QA 3BCWA 5CU1A 3JZVA 4K8FA 1NE6A 1O5LA 3EQEA 1L3JA 4QXKA 1J3RA 4KWLA 1WLTA 2GH2A 4XF3A
chains in the Genus database with same CATH superfamily
2R041 3OYWA 3OPTA 3O7OA 4IEVA 4XVHA 4Y22A 2AEYA 2VTFA 2W9XA 2EALA 5FZ7A 1UAIA 5BNPC 2HYXA 1TMF1 1VBD2 4Z2AA 3KT1A 2FD8A 4F3JA 5FZFA 4GWJA 2PAKA 2GMEA 1U5XA 3NKTA 1APNA 3RPQA 2D3RA 3H8UA 4LA2A 3Q8FA 4ZU4A 3ZOIA 3ILRA 5FXXA 4OZOA 3LEMA 1W8HA 1WMXA 5ANQA 2XL7A 2LTNA 2VVEA 4MGSA 3OBZA 1WCQA 3QLQA 4PF1A 4BA6A 5JR2A 1W3VA 1WW5A 2DVGA 4PI2A 3ILFA 3ZYFA 1VBA1 4A7KA 4X6QB 1JU3A 4CRQA 4L9BA 4LK7A 4PJYA 5JOWA 1VALA 1BMV2 2XR4A 2QZ3A 3SCHA 4JKLA 2BQPA 4OCTA 3WDVA 2HLEA 1HRI2 1RUJ1 1YQ8A 2Y64A 1A8MA 4XFBA 2QE3A 3FN9A 2ZHNA 5JOXA 4RGGA 4XZUG 4H7LA 3KGLA 4YGDA 1VJ2A 3RFRA 1GP6A 5DZEA 4Y26A 5A7QA 3WF3A 1JYIA 2WSVA 2EAAA 3GBFA 5AVPA 3LDBA 4Y20B 5FXWA 1YLLA 4AHWA 4OHVA 4CVUA 4OZXA 1ZZ6A 5FZAA 4CUAA 1ND3B 3KV6A 3H1WA 3P5BA 1UQXA 3ZSMA 1YXWA 3H8OA 4QX1A 1WLDA 1EY2A 2C1FA 2RG4A 1MS5A 5FP8A 3VDCA 2JE7A 2KD7A 2WO2A 4LKFA 1CR7A 1E5HA 4Z8BA 4ORFA 4YW2A 2YPJA 3WHTA 5CISA 2WNVB 4OUMA 3HT2A 4MSVA 2B4KA 2OXBA 5J7MA 4ZXKA 3ZR6A 3TB0A 2VNGA 3AP4A 4AVTA 2ZZQA 5IVVA 1R092 1LRHA 3FWEA 2WAAA 5A32A 5BNNA 1GWKA 1UKRA 2OA2A 3ES1A 3Q8CA 2D97A 4PQ9A 1ND2A 2P37A 4L99A 4LKEA 4XXAA 2VULA 4LOSA 1RUH2 2ARBA 1AL22 1H9WA 1RMU3 5EYXA 3I7DA 5T54A 1W6PB 1GICA 1RHI1 1GZTA 1KFXL 1XSRA 4FTEA 4RA0A 1IS3A 5C5UA 2JWPA 5L9VA 4DEVA 4J1XA 4XFCA 3OF1A 5C33A 1LGBA 2GNBA 4HL0A 2UWCA 4RQPB 3U1XA 3ZXFA 4BXSV 5LCWL 3LOBA 1NX9A 2GSYA 4RFRB 4BISA 2XLAA 5BUVA 4MX3A 2JIGA 4RR3B 1H9PA 4HONA 4N9IA 4OFGA 2ZOEB 4IESA 4AFDA 2B8MA 2B9VA 1PK6B 3WNLA 4HT1T 4UFMA 3GBWA 3KHBA 3U37A 3ZFGB 4N43C 5HV4A 1WCKA 4E2QA 4NO4A 5FZIA 5FO7B 3J26N 5HCAA 2XVGA 3C8XA 1KDKA 1ZZ9A 3Q8BA 3JQWA 2Z79A 3M4FA 3QCWA 3IWZA 2C26A 2WNOA 4KL1A 5A6YA 1CIWA 1X8MA 5FDBA 1US2A 4D7TA 3R6SA 1ZRDA 5FLIA 1PZ9A 5EP9A 1M4WA 4FP2A 3WINE 4AQTA 5A1AA 4Q2FA 4AVCA 4U2AA 1SPPB 1CAVA 4P08A 2RS32 5EHDA 2P34A 3GDBA 5A7PA 4CDUA 4QHBA 1JS9A 2P3KA 3ZSJA 1XYOA 1W0OA 4FT8A 1W6NB 5F8PA 5FY4A 4CP0A 5E6HA 4I30A 4XQ4A 5F7UA 1XNBA 4Z2WA 2KM2A 2FDKA 3LQCA 4CDQB 2BOJA 1ZNPA 4JGZC 1A3KA 1K5MC 3HMYA 5CG9A 1YJKA 1BK1A 1T6BX 2YU1A 3ASIA 3PVNA 4YM2A 3HPNA 1BCXA 1J84A 5KXCA 2OS2A 4K8RB 2KA3A 2VO5A 4JQRA 4V2WA 3CJIB 3NMBA 3HD8B 3I2OA 3BI3A 1VPHA 4DNYA 2C0ZA 1Q8VA 4IQPA 4PIYA 3OD4A 4IV1C 3I3MA 1UW8A 3TN92 1Q5OA 4P14A 3MIFA 2E26A 1VMJA 1WD3A 3O0VA 3OCPA 1W2TA 1GNZA 3OGVA 1DLCA 5G05L 4DMIA 4D3WA 1G9FA 3EBRA 3ZYJB 3RMXA 1LOFA 1NG0A 2RS13 4LBOA 2DDUA 4LHNA 3ES4A 1QXPA 2PYTA 2NN8A 2ZCWA 3EYPA 3SISA 4AI8A 2IXIA 1O3SA 1BHGA 2BRTA 3ACGA 4JGYC 3VKOA 1JOBA 4FQ4A 5CADA 3FZ3A 2QNKA 2PHUA 4IUGA 2FQPA 2VNVA 1I1EA 1F4AA 2VCBA 4L2NA 1AR62 3UGGA 3WLUA 4QMAA 2DCJA 2Y6FA 1W9SA 1YNAA 1GWMA 2AC1A 3O0WA 1HB1A 3JBG2 4UFLA 1O7FA 2Q30A 1GQGA 1I6XA 4ARXA 1AXZA 1JBCA 3C7HA 4QB1A 3UYJA 1VE0A 1LOAA 4NWVA 4DUVA 3ZDSA 1UN1A 5F5QA 5C8CA 2YGLA 1RVF1 2WRAA 1RUD1 3JU9A 1XYNA 4CXYA 2A3XA 5FMCA 3N7KA 4MGIE 1GP5A 1NE4A 4B8EA 5IVJA 1RUI2 2JG9C 3O1RA 1CESA 4P9IA 4QKNA 1AYN2 5L9RA 2C9KA 5FP3A 1O4ZA 4M3CB 4OLLA 2TBVA 2P17A 3WX5A 1W6MA 4DRVA 1SLBA 1CZVA 5D8AB 1Z7S2 3TBDA 2JDYA 1VIWB 3D4KA 3A0NA 3AP6A 3G7DA 1QJY3 1ZBA3 3ON7A 4I3PA 3VDDA 3VBSB 4DQAA 1FMD2 1MQTB 1QNWA 5FY1A 2ORZA 4L11A 1OH4A 3CQOA 4BLIA 5FQ0A 1AVBA 1DGRA 2AZ5A 2V5YA 4H7MA 1GUIA 1GV9A 4FFFA 2O8OA 4RGAA 5HPOA 5IVCA 1MEC1 3UKTA 3KVAA 1F35A 1XE8A 2EIDA 4Q1PA 4BZ4A 3H3LA 2HYKA 2RR12 1SBFA 2J7MA 4E9KA 5ANNA 1CN1A 3VZKA 5K0UA 3CHXA 3C2UA 1RUG3 2CAUA 1US3A 1Q8OA 2NPIA 5E89A 2FDHA 1BBT3 2IXHA 4FXGB 1YQCA 4A45A 4ATEA 3MFAA 2DBNA 1YIFA 3NV2A 5FBZA 3NNMA 5C3SA 5C8WA 1S0EA 5F39A 1H4GA 5I0SA 1J59A 4E4HA 1D4M2 1SLCA 5H9RA 5HBAA 4Y4RA 4XFGA 4AVVA 4FP3A 1UCXA 4Q4X3 1V9U3 3AC0A 5GKAC 2ZS6B 2PA7A 4WVVA 2DWRA 4AGRA 2Z5WA 3USSA 3J7LA 5FAXA 1H6YA 4ZS3A 1W8FA 3WUCA 5GZDA 4EN8B 1I5PA 1EAH1 1QOSA 3NL1A 1W0PA 4UOJA 5L9BA 4QQHA 2OVUA 5LEKA 4AEDB 1QHDA 3N7MA 3NNGA 4N7UA 4UFJA 3RRDA 3MGUA 3AZWA 2P4EA 2AR6A 2ZEZA 3KCCA 4OI1A 3LGRA 1PO22 3AJZA 4DINB 2A73B 1YJLA 3AP9A 3DXTA 3SHRA 3ZFEB 1FAYA 4MGKE 1T2XA 3LPFA 3BODA 1F2NA 1FPN1 3QH7A 3ZN4A 2VBPA 1COV3 3ATGA 1NYWA 3SH4A 1GFF2 4OMDA 2VL4A 1YFUA 5ERLA 4CE8A 4LITA 4LUKA 4OUSA 4CCNA 4LHKA 3W21A 5KHHA 4E4DX 5A7SA 1GLHA 2CTVA 1ZRRA 4LMFA 1S0IA 2WA3A 2R042 5GM0A 1TME3 5FV3A 2C4XA 3GCXA 4E2GA 4AVSA 3AL5A 2LW8A 4LIUA 4NAOA 4E2SA 1WA6X 4LEJA 1DP0A 3EO6A 4P9JA 3ZR5A 4DY5A 3GGLA 4AI0A 3GALA 4HN1A 4CEWA 1W9WA 5DG1A 1TMF2 2XDVA 3F95A 3UT0A 3H7YA 2DFCA 2JD9A 3K3OA 4Q4Y3 4LE4A 3ZFFB 5I8SA 3WW1A 3WD5A 4WM8C 1BQPA 3H9AA 1WCSA 5C3OA 2SBAA 2BFUL 4M3CF 2ZGOA 2ZGTA 4YG3A 4YG0A 4S2HA 4BQYA 4QGNA 3W5MA 5JIAA 4E8DA 3ME2A 4IV3B 5LRSA 2BGCA 4E4ZA 3Q8EA 3FHIB 5CFCA 4JHTA 2FCTA 5F2SA 4A7ZA 4PIZA 5C5TA 1LCLA 1N47A 4MLOA 2JD4A 4N53C 1POV3 1IZ3A 3OBAA 4CUBA 1V00A 2Q8OA 1QJFA 1V6NA 4NRQA 3BU0A 1RUJ2 1CZTA 3IMNA 2GMPA 3S7IA 3KT7A 1XE7A 3NNLA 5FFOC 5FZBA 3RG0A 1VR3A 4QX0A 4CEYC 3DPRA 3NAPB 1XJAA 1MR5A 2ZMNA 1DYKA 1XOYA 2GAUA 3DEMA 4URTA 4HPKB 4J6GA 4GB33 5I0UA 1MS4A 4Y33A 3DF0A 3FBYA 5LBCA 4BCUA 1HQNA 4Q29A 3R05A 1W0NA 4JRLA 3D0JA 1TE1B 2JG8C 2PHTA 5DAQA 1CONA 1NCQB 2L9LA 2P1BA 3UKNA 3VL8A 3WW3A 1WWYA 4XCBA 3MIBA 4PT6A 1FXZA 4YZ3A 1Y9MA 3AX4A 3K77A 5C4WA 4YVSB 1DU3D 2VUAA 2AGSA 5A33A 1UY3A 3ELNA 5FPUA 5FO9B 4QX8A 1Y9GA 2Q0AA 3BPSA 2GDFA 2VZQA 3SEPA 2D6LX 1JH5A 2AREA 2CSGA 3AP7A 1GQPA 3IB3A 1S0DA 3IAPA 3NWKA 1C1LA 3OJBA 4IDZA 4QD2A 4Z82A 3B9CA 3GZUC 2HBUA 4LO6B 4DZGA 1OURA 3ZYRA 4MYEA 3ZO0B 3P3NA 2WFF3 2XJPA 2WT1A 1STMA 1U5YA 2QDRA 1HDKA 4CP9B 2X5IA 1KFUL 2YY1A 4BK4A 1AX2A 1SACA 1BXHA 3NV1A 1QEXA 3VBOC 4EZHA 4NMIA 4HMZA 4YVWA 2PLV2 2HWC1 3BN6A 5DAVA 5FIXA 2FDFA 3GNEA 3PLQA 1GZ9A 3VBUB 5IVBA 1EPZA 1RHI2 2BERA 3MIGA 5IVFA 1ZRIA 3APBA 4PBPA 2XJRA 5FMOS 3S57A 4QX2A 1QNYA 1QJU3 1SLIA 4DRRA 2VUJA 3H7JA 1OLME 2AENA 1LTEA 4P9XA 3ZPYA 2DVAA 3VZJA 3V0BA 2PFWA 1IPJA 1ODNA 2A71A 1MS0A 1VRH3 3DKWA 5F6KA 4UFHA 4A42A 1KDMA 2WC2A 2QFEA 1QOTA 2WAOA 3BOWA 5LASA 5LA1A 1ZZCA 2HWE3 5JVVA 4Y22B 3VBSA 3ZXAC 3O12A 1Q56A 4INDA 4JKMA 4COVA 5CKMA 1XU2A 4DIQA 3NO8A 1ND3C 4LR4A 1ZBE2 4NHKA 1QIQA 2BWAA 4GJYA 4ASMB 4PDWA 5EJZB 4AVAA 4N9HA 4UXAA 4CEWC 2WNUB 5A1FA 4HBNA 2LUWA 1GYKA 5A70A 1IOAA 1NY71 1QQP1 2WNVC 5G04L 5F3GA 5AC93 1VP6A 1WCUA 1W90A 4JCKA 4YNIA 3AP5A 5LB6A 4XUQA 4BQ3A 2FDGA 3CLPA 4IEZA 3OEBA 4K6BA 5GALA 1X82A 2VCAA 4LBJA 1W6OA 4QDRA 3E5QA 4KG0A 4D69A 3RZKA 1UIJA 2YC2A 3FUOA 2G9FA 3USUB 4LLOA 2VZOA 5CYYA 4WM7C 1RUF1 1QXJA 1A78A 3SKJE 4LBLA 2Y6LA 3ZMOA 1G7YA 5CFDA 1BEV1 2RM23 3BCWA 1AR91 4A3XA 2W94A 5CU1A 2JX9A 4L92A 3NV3A 4W4ZA 1SBEA 3JZVA 4RHV2 1NE6A 5FMOL 2XOMA 1OUXA 4QX7A 2DUOA 3IMMA 2QQWA 3MLJA 4P9YA 1L3JA 4Q27A 4QXBA 1MS1A 1DZQA 2VR4A 4AHXA 4YW6A 1J3RA 4L97A 3JB4C 1WLTA 3O14A 4JRAA 5FP9A 4CDWC 4FAGA 4I3GA 2VZSA 5BYNA 4XC9A 1VBD3 3GZEA 5FZMA 1WZXA 3ZYPA 2ARAA 1K45A 2Y6JA 3WP6A 3POSA 3PMEA 4RN5A 3UETA 3AL6A 5A3OA 1CIYA 1REDA 2CL2A 1N1YA 2W2IA 4QU1A 4ZKTB 3AMNA 4AQ6A 2IXLA 4LOTA 3DECA 1KEXA 2XMLA 3WF1A 2BJSA 4BH9A 4BIFA 1SMVA 1JI6A 2O1QA 1IPSA 5FWEA 4K20A 3WF4A 3KM5A 3NNJA 5JMOA 3M3IA 1RVF2 3I2FA 2ZGRA 2ZZJA 1RUD2 3N35A 4L0PA 4XTPA 1ND2B 4X8PA 2WABA 1HJFA 1DYPA 3KCXA 5FY0A 2A3YA 1SCSA 2OUJA 3K2OA 1LHVA 4Z1VA 5DXDA 1KS4A 1AJOA 3AJYA 3NV4A 1HRI3 5EFUA 2X5IC 3T2QA 4QHZA 5F3IA 3VBRC 1W8ZA 4NHYA 5JLVA 2ZXQA 1BLZA 3PUAA 2A1XA 5BNPA 4W6WA 3X29B 3AXEA 3J7MA 1V6LA 3PU3A 4Q0VA 3WP3A 3VHPA 1J3PA 1YO8A 4ZZ5A 1UOGA 3OUIA 3K48A 5FWJA 3D3AA 3HQRA 4XEZA 2P5BA 4GAZA 4MGQA 2GC1A 2I2SA 4UW5A 3DYPA 1AF9A 1MEC2 2VC9A 2YU2A 4BMBA 2WS91 4BLJA 3W59A 2VZ3A 2OUHA 5BV6A 1BKZA 2HWD1 3BVCA 4M01A 4HXCA 4IEQA 4FPKA 3WQ1A 1W8UA 2ZAHA 2XPJA 4XTMA 2D5HA 5B2GB 4XBNA 1KGYA 1ZM1A 3PTYA 2TUNA 4FTBA 1P8JA 1RGSA 3KF5A 2K9ZA 2XWBB 2LRPA 2KR2A 3AKQA 4YLZA 4B4PA 5A7WA 1UYZA 3FLTA 4P9GA 2OKXA 4CCJA 2ZGSA 1R093 3WF0A 4PDWC 1NCRC 1O3TA 3ETPA 5JOYA 3H42B 4GWIA 1CAVB 3OSDA 2V73A 1VBB1 1O8SA 2EXKA 4R9AA 5GZGA 1IKPA 3H3ZA 1JHNA 4Q5OA 2Q8EA 2VG9A 1AL23 1GWLA 1POQA 1MVEA 2Y0IA 3BYWA 5H9PA 2RMU1 4YZ4A 5L7OC 2WA4A 4AQ2A 1Q8PA 2NP0A 1K42A 2EIEA 2QQLA 2K0GA 3KD4A 2VNOA 1HIXA 1EAH2 5K8SA 2QJVA 1VBE1 3UJQA 3I59A 2MEV1 2X10A 4EWEA 5K7PA 2W87A 5IJRA 3PUQA 2BZDA 2ATFA 1UY4A 4FOVA 3RWNA 1IS5A 1LGCA 5FZOB 4H14A 3WR0A 5J3UA 2HBTA 1DF0A 3RSJA 4TZDA 4AAPA 1UMHA 4CUCA 1JZ2A 1FPN2 1PO11 3DUIA 3RGBA 5K4LA 4RS5C 4G3YC 5DAWA 2WZ8A 3VBSC 1F31A 2NYYA 1W04A 2NQYA 5FOBB 5E16A 2R0FA 5F32A 4FPYA 3MICA 4CCMA 3RZHA 4CPBA 3GYDA 1UKGA 3I2HA 5IW0A 1ASJ1 4YGCA 1R1A1 4BE3A 4FAHA 5FOJB 1Z78A 3VD5A 1EP0A 1G9CA 4WZCA 2QQOA 4AE2A 5LW9A 2WDBA 4YGBA 1VBC1 3OY8B 4DXSA 4BU2A 5HCBA 3N3HA 2RS33 4ZXEA 3KQ4B 4DO0A 1SDDB 2QQUA 3I8TA 3POFA 4MOAA 5FZ3A 3WW2A 2BWCA 2A3WA 3I2GA 1M06G 3AMHA 1IG0A 5J96B 3L9JT 2R1DA 3MV01 2LS6A 5E8AA 4I0AA 3ZSLA 1CAWB 3AKTA 3POEA 4QPYA 1HRV1 1VB4A 1RIRA 1VB2A 3C7EA 4NRMA 4UWDA 2ZHKA 1LEDA 1YQ6A 2D6PA 4C90A 4YFZA 1DGRN 3N9LA 1W6MB 1KQRA 1D0HA 1F9KA 1OLMA 1Y4WA 1GNYA 4EROA 1OVSA 1XYPA 1OXCA 1S2BA 3TN93 2Y0OA 4ASLA 4AEDC 2F6BA 4XUPA 3VDDB 5JSPA 2XJVA 3UJOA 3A4UA 4K3UA 2D6OX 5J37A 4EYUA 1SFNA 2W46A 3EMRA 3ILNA 5GZCA 3TAYA 1LHUA 1E5SA 2R0HA 3NQHA 1OMIA 1T6GC 3OPZA 1H8TB 1W05A 3FE5A 5FZEA 3AYEA 3WZ1A 2D6MA 2VU9A 1EYBA 4LULA 1F5FA 5AFBA 1MZ5A 3DV8A 3AZYA 3LWCA 3ZYIB 4AG4A 3TYJA 1AR63 4HKWA 4JGZA 4TLFA 1K5MA 4QPIC 5IUQA 4QT6A 2R7EB 3SQOA 5E1RA 3JBG3 3QH6A 2VJXA 1OD3A 1OOPB 4L8QA 4URAA 3GJAA 5CKNA 1OBNA 1C8M1 2E9QA 4EQVA 5FYSA 5BNQA 1V6JA 4YW5A 3P3PA 1B35C 3D6EA 1UZVA 3FMGA 4IV1A 1XQNA 3ZDVA 1BK0A 3J9SA 5A3WA 2Q8DA 5EIYB 4MVTA 3BTAA 4QGLA 2JE9A 4IEOA 5C6CA 1DLLA 2ZX1A 1S4CA 1YRZA 1GBGA 1FOD2 2ES3A 1PZ8A 1UNBA 2RJ2A 2UWAA 3E1F1 4Y5SA 4W50A 3K75B 2RS51 4OYUA 5LATA 3O1SA 4JGYA 4H3WA 1ENRA 1W2NA 2H0VA 4AHZA 1Z7S3 3I2IA 4NIAA 3E6BA 2D43A 2HWC2 4QPGA 1R1ZA 3CU7A 2RS11 4C1WA 1LOEA 1AR71 2CDOA 4IV3C 3WT3A 1EV11 3UL2A 4ES9A 4FPFA 1FMD3 2CNAA 4YZ5A 2YBSA 1XBFA 5F5AA 3VZOA 2WFPA 4AR2A 5HCHA 1AUYA 2W5FA 2EIGA 5DQ0A 3WCSA 3ENRA 2BU9A 3J8F2 4CU7A 3M8LA 5FMDA 3MW2A 1GZWA 2DFBA 2DVBA 3C7GA 2XKOA 2BDRA 3T4HB 3RYPA 4Y24A 1MZ6A 5TSWA 3VZLA 2OQ7A 2RR13 2ETEA 2WLQA 3WG1A 1AYM1 2JG9A 1QGLA 3CKHA 3N9NA 5IK7A 2WWJA 4OUEA 2R061 3I3BA 4G4FA 1UZZA 4N7IA 5CB7A 2Y33A 3UNPA 2VZVA 1FATA 1KJLA 4M00A 1QH7A 3OBTA 4IE5A 4XF0A 1DG6A 1D4M3 2ZA9A 1LEMA 3EJKA 2VMGA 4LBMA 3A21A 3AMQA 5GLUA 4MGTA 2ZX2A 3OUJA 1I9RA 1QQP2 2AEZA 2BBAA 4QDSA 3U4XA 1QJY1 3HOBA 5J1XA 4B4QA 2YFZA 3LE0A 2UU8A 5CKQA 3WDYA 3BTYA 5CFCB 2VXRA 2EXIA 5ISLA 4GH4C 1SLTA 1KJRA 4HN0A 2FZ2A 1PO23 1R081 1ZRFA 4AVBA 1JOPA 2E31A 4Q4V1 3ZXEA 2VMHA 2F4PA 3CF6E 3MFCA 5FUNA 1J83A 4NHXA 5ABJC 3B02A 1RUF2 5DDJ2 5J36A 2R30A 3WP4A 1NXMA 1PX4A 2W68A 1H6XA 2VMFA 3INAA 1BEV2 4B1LA 4NPMA 3DPRB 2J1EA 4XHBA 3ZXLA 3WQBA 5JPNB 3WG2A 3MPBA 2SLIA 1AR92 3B7MA 5FY5A 2AACA 1YI9A 2ORXA 3K4DA 4XURA 2CYFA 5DZGA 2R49A 1CZSA 3FC0A 2WN3A 2R043 2WQ8A 1BJQA 3QD6A 4D94A 4LTAA 2DU0A 2P3IA 3TWIA 1QXRA 4LJHA 4BQXA 3TOJA 1ST8A 2GU9A 2ZTNA 2QBXA 2XJSA 1TMF3 4Q4X1 1FX5A 5IFTA 4ZU5A 5FRAA 4A6SA 3CO2A 5C4WB 4LBQA 2PHDA 3MIDA 4YRDA 3KZ4C 2JDAA 2I45A 4Q4W1 2R6QA 3NW4A 1YFXA 3GZTB 3MF6A 2GH8A 3PVOA 5T5JA 1DQ4A 2GNDA 3SH5A 4FBFA 1RXGA 1A6CA 2D40A 4LK6A 2VVDA 3PVEA 4MO3M 3PURA 2X05A 2VCMA 2WNUC 4DUXA 3HVDA 1TEIA 5FZDA 1ACCA 2XJTA 1RUE1 2HWF1 1NUKA 5ACA1 1C8NA 1LENA 4KH9A 2ZGPA 4LO5B 4NRPA 1YEWA 1CGPA 1RUC2 2P6HA 5LA2A 5F37A 1C1FA 3QBQA 5DAPA 3J4UH 2D93A 2QZ2A 4HG6B 2LM3A 3IN9A 3ACFA 1UOJA 3GJBA 4LBQD 4Z07A 4QPGC 5FZ9A 4GALA 4Q0PA 4JQTA 4EZ4A 4I0BA 4GD4A 3ZIWA 3M70A 5I93A 4XMAA 3PJQA 1HXS1 3V0AA 4FFIA 4CDXC 3L2YA 3GHMA 2W08A 1CAUB 4DUWA 4WM8A 2ZABA 2RDSA 1OF4A 1UMZA 2D5FA 3V0BB 2ZAAA 3B3QE 2IXJA 3MDPA 4XFHA 1KD7A 5EQUA 4CU8A 5JZGA 1IS4A 5A80A 1UU6A 2WS92 4UF0A 5FZHA 2HWB1 3HN1A 3IIIA 4YWAA 1JXNA 2HWD2 4QQPA 4KGGA 1HN1A 4Y5TA 1Y43B 2IFWA 4HSJA 4PI0A 3ZLIA 3LF7A 2PAEA 4N53A 4WZFA 3VHNA 2VMEA 5JMCA 4YZ1A 4PCRA 4FQZA 2BNOA 4A6OA 1S1AA 3T2TA 1W9TA 2FHRA 2WT0A 3CEWA 4QU2A 2E7QA 4XBLA 5JXIA 4CTEA 3VUOA 5A3UA 1UY2A 2JDPA 2OX0A 3AYCA 5FYVA 1QDCA 3KWVA 3RWKX 1AR81 2ZJCA 3SLIA 3HWJA 3VBFC 4CEYA 4KWUA 1VBB2 5A7OA 3ZYBA 4D7SA 4M3CE 4CXWA 4BQ1A 5DUXA 1W8TA 4ET7A 2PLV3 2RMU2 2OPWA 3POIA 3VKNA 4OMCA 1RHI3 2IVIB 2XVLA 4M0HA 3WG3A 4EV0A 1W6OB 3KB5A 2B42B 2JG8A 1BVVA 1VAVA 2XBO1 5F6LB 1VBE2 3RMYA 2MEV2 4GB31 1LHOA 1ONAA 3BIWE 2Q4SA 3M3OA 2V09A 4Q26A 4Z92B 1X8EA 2PHFA 3S5QA 4YGEA 1F5JA 2AYHA 4M0NA 1LB2A 3ZKYA 2UY8A 3AYAA 4WVMA 3BB6A 4QB6A 1PO12 4XJWA 2DCTA 4IEXA 2EAKA 3THPA 2DCKA 2VOXA 5BNOB 4R52A 3ACHA 5KXBA 5FJKA 5FUIA 4IGPA 2HEVF 1REFA 3T1MA 1GR3A 4UFKA 3VBOA 5A3MA 1ZBE3 4FPHA 5FR3A 5C9AC 1ASJ2 1EUUA 1R1A2 1LJ7A 3E97A 4UW3A 3KHCA 2A6ZA 3AZZA 5EJ1B 1NA1B 3KT4A 2G4IA 2Y34A 4JDNA 3UV9A 3IAQA 2Q5TA 3U07A 4BQ2A 2YZ4A 2VCCA 2GN3A 1VBC2 1D7PM 5APAA 3VBHC 3UGFA 2BYVE 1E57A 1U5ZA 1SBDA 4IE7A 1QJX1 4FTSA 5SV5A 3VD4A 4MGYE 5JR7B 3CMGA 1OKOA 3KCYA 2B46X 2OPKA 4QPWA 4W8JA 1BVP1 1YQ5A 4XJAA 1DDLA 2B39A 4ZZ8A 4S2GA 2RDNA 4LE3A 1ULFA 2OZJA 3MZHA 3AVSA 4UT5A 1I5ZA 4XAAA 2CY6A 1HRV2 3B94A 3CBNA 2VOTA 3VL9A 4Y20A 3N9OA 1PVC2 3W9AA 2E7TA 2HJIA 2X53S 3SEEA 4HVOA 3AKSA 5FZCA 5IT6A 3T1LA 5BNPB 1VRH1 3M2MA 3RJRA 4F7ZA 1ND3A 2D98A 2N7GA 3THTA 5JI7A 3LFIA 4FPCA 1W06A 2WN2A 2Z69A 1QU0A 3UKVA 4LORA 3MIHA 1W03A 1HKDA 3JD71 4RHV3 2V5DA 3IDBB 4GJZA 5DPNA 1RJ8A 4R9BA 4YW1A 2ID4A 2WNVA 3N7LA 1WKYA 4YW7A 2QUOA 5J09A 5GJ6A 3MI8A 2R071 3EQEA 3AK0A 1H8VA 1POV0 4JHZA 4QQLA 1JYWA 3AZXA 5JZGC 4QXKA 1FYUA 3S6PA 3ZPOA 1QMJA 1G86A 1YCIA 3POWA 2GH2A 4OQ9A 4K21A 5AC91 4KWJA 3OPWA 3ZM8A 4WM7A 1O4YA 2J1UA 3NVCA 4OHWA 1VBA2 5T5PA 1RUOA 2DU1A 3NJZA 4DOUA 1YIPA 1VRBA 2W91A 3HEIA 1C8M2 3I2DA 3HNMA 1W6PA 1ULPA 3AYDA 1ZYBA 3LZZA 2WLPA 1RVF3 3D82A 3OGGA 2W1WA 1RUD3 4FVVA 4IXLA 1W2OA 4M4PA 5FP4A 3V56A 4UW6A 3VKFC 4AFAA 3VD7A 3WCRA 1XC6A 3CIHA 2V4AA 3T0AA 4MADA 1GNHA 1JTZX 4UI9L 4K9SA 3SITA 4TYSA 3DCQA 3PTRB 1JZ3A 2ET7A 1ZVFA 2CV6A 2KXLA 5F3CA 2XUEA 2RS52 1PK6A 2YDEA 1UU5A 2ILMA 3I59B 4GQ7A 3POGA 4HKOA 2Y60A 4CDWA 5JXHA 5LA0A 1GMMA 5EWSA 1W8WA 4ATFA 2RS12 1YC61 4DXTA 1AR72 3WDUA 2EXHA 2XXZA 1EV12 1WBLA 3OGRA 2NLRA 4AI1A 3O5SA 4AHYA 5LWBA 2QCSB 4QQOA 1JN2P 5DUWA 5IAXA 5FYTA 4YW3A 1JYNA 1MEC3 2J42A 4O9GA 4XAEA 4Q0QA 5A1LA 3LSDA 4R4XA 2VQAA 1MZFA 4TN7A 4AF9A 1LGNA 1UD1A 4AQSA 3JCIA 1IPKA 2EICA 1OA3A 1QJEA 2JICA 4XFAA 5FPZA 4AI9A 3NJVA 4QX3A 4COUA 4IGOA 2J1SA 1AYM2 5LBEA 2YG0A 3VZMA 1UX7A 2FDIA 2WINB 2R062 1CPMA 3E6DA 3F2ZA 2E32A 3THDA 5KBFA 4CUGA 4OULA 1PIV1 2JKXA 4HETA 1UWWA 3VBRA 1BZWA 1W6NA 1WUVA 3TRSB 3W20A 1O5UA 4XETA 1NLSA 1W28A 1FNZA 3B69A 3T2PA 3DYMA 1YWKA 2CDPA 1WMFA 1W39A 4NUBA 4XDOA 4BB3A 1PVXA 5GLWA 4B4RA 3OD0A 1H1MA 4GULA 3ITQA 5FZ1A 1Q8QA 3LEKA 2ZEWA 3C3VA 4N43B 1LAJA 1EAH3 3A22A 1GP4A 1PZ7A 1QJY2 4D6SA 1N3QA 3AKPA 1OD5A 3RYKA 5KR7A 3OBRA 3OYWB 4UW4A 1R082 1LR5A 2IXKA 2UWBA 3T0BA 4BOWA 2JDMA 2GALA 4Q4V2 3WUDA 4CCLA 1DYOA 5FREA 4TTGA 3O1OA 2J1AA 4NN0A 4QM9A 5CIRA 3AFKA 1FPN3 2Q1MA 3RZLA 1U5IA 1WCDJ 4YFWA 5JWPA 2R16A 1NCRA 1ZX5A 5FZ6A 3U10A 2K46A 1QWRA 1O4TA 2DCZA 1OLRA 3PUIA 2W47A 2IUWA 2FBEA 3BKZA 2XQXA 3POBA 5FCCA 4NIIA 4AXOA 3GCWA 5L7OA 3K4ZA 4EWAA 2DURA 2RJLA 4S2DA 2EXJA 2XGXA 2JKBA 1EUTA 3MYXA 1UO9A 1GU3A 4IE0A 2RV9A 2VZPA 3KV5A 1K5MB 4XJZA 1O3QA 1OUSA 3B01A 5KWRA 2WZR1 2VOKA 4LO7A 4Q4X2 1WLWA 1AL21 2YHJA 4K40A 4NAMA 4QAWA 1WMDA 2A5ZA 5JI9A 1IGOA 4IV1B 3PMSA 3H1YA 4Q4W2 5B4XA 1N1VA 1NZIA 1XE0A 1EPWA 1JOJA 2A6WA 1XNCA 2H6CA 5LY2A 5D8AA 5HXVA 1SLLA 5FYHA 3T2OA 1KRIA 2ZHLA 4IE6A 3PJYA 1DQ2A 4RS5A 4NPRA 4DPNA 1UYPA 1V0AA 2RDRA 2BVBA 4META 2YROA 1XB9A 1YQ2A 4RQPC 1MQTA 1CVNA 1S0GA 1XNAA 2B9UA 4XF4A 2V72A 5CEHA 2ZEXA 1J58A 4JGYB 3T3YA 1RUE2 2HWF2 3MLLA 4BPZA 5ACA2 1ULDA 2VZRA 1DZTA 3I3DA 3O1PA 4RR3C 3POJA 3WDXA 2EA7A 4FFGA 2PHLA 1Q43A 4B3NA 1PK6C 5FYYA 1F8VA 3ZFGC 3FHQA 3LOIA 1QJZA 4Y1XA 3BALA 3EB7A 1OHFA 2WWUA 1MVQA 3RVHA 2WQZC 3SC7X 1GZWB 1HXS2 1LOGA 3WNKA 1Z0HA 5DMYA 2XHKA 4V1PA 2BTVC 4NE9A 1UZWA 1NKGA 3IDEA 1HQWA 2ET1A 5A32B 3WW4A 2H0BA 2JG9B 3RZZA 5BNNB 1C5IA 1H2NA 2Q8CA 2HWB2 2R1BA 2VH9A 4AEMA 3OTFA 4MHRA 5T52A 3N9PA 5KC5A 2YUEA 2X8KA 2YC4A 4IEUA 1NLRA 4TWTA 1SCRA 5JIUA 4AEDA 1C28A 2JECA 4CDQC 3HNBM 5CAZA 1XNKA 2GNTA 2YMZA 2D3SA 1AR82 1FOD3 5EXOA 2A7AA 3ZFEA 3P6BA 3WNMA 1IKQA 3CJIC 3IM0A 4W6YA 2Y38A 4RYDA 5IK4A 4DEQA 1H2KA 4RL7A 3LA2A 1TQ5A 2HWC3 3KMHA 1UPIA 1OPMA 4IERA 1I3HA 1WA4A 2P6CA 3K3NA 3LA3A 4BQ5A 4QPIA 4ZU7A 1L7LA 2XBO2 4UAPA 5FK7A 4ISQA 1MS3A 2ARXA 3ETQA 1PGSA 1GOHA 3J8F3 4K7JA 2VBDA 3MLKA 4OQ8A 1B35A 3OUHA 4LPLA 3ZN6A 3O1TA 2VTXJ 2VXJA 3O0XA 2ENRA 4A3ZA 1PHMA 1RJ7A 3SKVA 5FYUA 2VUCA 1F15A 1CJPA 4FOWA 1W6QA 4LBKA 4CYDA 4NHLA 4ITCA 1UXXX 2DTWA 1CWPA 1KXGA 4YM3A 2XL9A 2W92A 4CDUB 3TEYA 2WWSA 1RUH3 1LHNA 1ENQA 4LUMA 3IPVA 1LHWA 4LQRA 1PGL1 3VN4A 1TNFA 1N3OA 4LKDA 4P02B 3S5AA 4LBQB 1YFWA 2BVVA 2OIIA 3ST7A 2VECA 2YPDA 2JB4A 4IV3A 1UMIA 3ALQA 1JZ4A 1JUHA 5L19A 3HR9A 1OQ1A 1YFYA 2VZTA 2WZEA 1QQP3 4ZPIA 5FYMA 1QJX2 3ABZA 3OB8A 4FPGA 2OT7A 5F1RA 1OI6A 3I2JA 5D8AC 2CGOA 2IC1A 5JUVA 4QM8A 1G9AA 1X7NA 1W9FA 1VAMA 2C9AA 4XJ9A 3BTXA 3H8XA 3WV6A 1MQTC 5FXVA 2GC0A 1KITA 3I97A 2ADDA 1AL0G 1RUF3 4XXPA 5DDJ3 1J1LA 1O8PA 1BEV3 1VRH2 2DYCA 2JIJA 2VOWA 2W3JA 3AKRA 3PUHA 4JDOA 4RGKA 3Q9OA 2Z2SB 4CXXA 5L73A 1AR93 2CGPA 4FPLA 2XLFA 3W58A 3V0AB 2HH9A 3R0RA 3JD72 4WM8B 4SBVA 2BBVA 5JCTA 4CCKA 1RMU1 1OQDA 1YYNA 1XNTA 3B00A 1VMFA 5FPLA 4Q0UA 2CAVA 3VGIA 4AOCA 5C8CB 4GMP3 4UF0B 4XPVA 2R072 1G6NA 3LDKA 1SZBA 3WHUA 4GH4A 5A3PA 3H1MA 5FY8A 4N53B 5BNOC 4OHYA 2DCYA 4MXWA 5FZ8A 3UGHA 3CNAA 4CP9A 4CPBD 2WZPP 2WO1A 3AXDA 5ABJA 4MG2A 1OFNA 1OQEA 4BK5A 4CCCA 4YARA 1PMIA 4HK8A 3VBUA 1UZYA 2VMDA 4CEYB 3VD9A 3JB8A 4HANA 2CU5A 4P9LA 3U78A 1N1SA 1J1TA 4LO4B 4PHZA 4GKXA 5FQ0B 3IZOA 2XH6A 4I2OA 2GMMA 2XJUA 3ACLA 4BYYA 3KS7A 3ZFEC 2NMNA 1RUC3 4CP1A 1AXYA 1HV0A 1LODA 4X6RB 2JG8B 4IE4A 3RDIA 3SCFA 3LKJA 1GANA 3VV1A 4KNCA 4ONUA 4I02A 1JYCA 4HZFA 5GLVA 2DVDA 4FFHA 5K0UB 1AXKA 4IETA 4NOTA 1GOGA 3K4AA 3N9QA 4XYXA 1K3IA 4JV4A 3ZSEA 4YZ2A 5IVEA 3DYOA 2HEWF 2J22A 3OGSA 1GQHA 4QXHA 3LD8A 3BOPA 5J48A 4WVMB 3ZKUA 3VDBA 4LLFA 4XF9A 4FO9A 5LBFA 1CX4A 5CBLA 4GWNA 4YM1A 2WYFA 2WS93 1YHFA 2ZGLA 2ZACA 4BDVB 2WNUA 4M4RA 2HWD3 2E6VA 1PMJX 2ZGMA 2D44A 4JZRA 3KVBA 1RUI3 3VBOB 3ZFFC 1ZZ8A 1AYN3 1GKBA 1FNYA 2DV9A 1UYYA 1GZCA 4PLOA 3RI9A 2GP5A 2MHFA 1O59A 1PIV2 4PQQA 5FZKA 5F5IA 3WQ0A 2GZWA 5HXMA 4XILA 4NIDA 4P00B 5FBJA 2PHWA 3LCPA 5A3NA 3USUA 2JB8A 3FJSA 3POYA 1VBB3 4R8HA 2PHRA 4CDXA 2YBKA 1H2MA 3GXUA 2VMIA 3PHMA 2VM9A 2ZGQA 3AMPA 2RMU3 4IGQA 5CNAA 1ENSA 4AGGA 1S0BA 2PHXA 3LB9A 3S7EA 5FZ4A 1VBE3 1CAXA 4NHMA 2MEV3 3U14A 1JYVA 2YC0A 1DCSA 4YSFA 3DL3A 3NAPC 2F4LA 4XW3A 3ACIA 5EZWA 1OF3A 2BW8A 1MACA 2RVAA 5I8TA 1X33A 2B5HA 4F83A 1S0CA 4HVQA 3LA7A 5K9YA 2BPA2 4CEWB 2BEOA 3MPPG 5AFEA 1PO13 2IFRA 4LO8A 2O14A 2ZGUA 4TLGA 4XQWA 3NRUA 4TXWA 2ZPXA 4XBQA 1NCQC 3VBFA 3BTZA 1AX0A 2E33A 3NKGA 1LOCA 4AI3A 4XZPA 4YVSC 3QOPA 1O3RA 3IDAA 4DXRA 1NY72 1ASJ3 3D5OA 1R1A3 3IBMA 3WEZA 3E6CC 1WW6A 2QQIA 1ZBA1 2ZMKA 3NJYA 3ZVXA 2JE8A 4MGZE 2WZR2 5HI0A 4WM7B 1VBC3 2TNFA 3HIFA 2PLV1 5LZ6A 2B7YA 4NVPA 4RSUA 4C91A 5FY9A 3NJXA 4O65A 4Y4YA 3V65A 2W0XA 1W99A 5GZEA 2XG3A 4ASKA 5GLTA 3IKWA 4MZUA 1R64A 1FV2A 2BNMA 4EN6B 3VBUC 2VZ1A 4H55A 4Q1RA 4JVAA 1ODMA 1RUG1 4FXKB 4WVWA 2XKPA 4A44A 1HRV3 2PXJA 1BBT1 5FMBA 1PVC3 3FLRA 4P9WA 4N8MA 2BUKA 1UIKA 2DUPA 1MZEA 4QHOA 3AVRA 3JUUA 1DFQA 5H9QA 3VDAA 3WDTA 4CDWB 3FFZA 4BM8A 5C3QA 5C9AA 4DB5A 3UK9A 2AUYA 4E27A 3U0ZA 3P1IA 4KU8A 5LEJA 2VQUA 1V9U1 2Q1ZB 1DBNA 1Y9QA 1WW7A 2TEPA 3LIGA 3C7FA 3HBKA 4XMIA 1ZBE1 4Y1VA 1G9BA 3VBHA 1X9TA 4LXLA 1TZOA 4PBOA 3VKLA 5A33B 3D8CA 4EN9B 5I91A 2JDKA 1A34A 2VGDA 5IK5A 2VW2A 3CZUA 2O8QA 3I3EA 4H2AA 2DUQA 2ZX0A 1JZ7A 5A6QA 1JHJA 1IQAA 4AFBA 5C7GA 4A41A 4AFMA 1ULGA 1H4HA 2ZGNA 1DQ6A 2X5IB 2XJQA 2Z42A 3U75A 3R4SA 1VBA3 4ISRA 1C5HA 3VBRB 1COV1 4NWWA 4XABA 2WO3A 5IFPA 2RDQA 4YVWB 1C8M3 1D0GA 5KXEA 1RUJ3 5IHRA 4Q8LA 4QXCA 1MPXA 4QX5A 4E8CA 5FPXA 2ZKNA 1RTVA 4COZA 1LOBA 1PGW1 1TME1 2C24A 3BUCA 5LY1A 4FPEA 2JDNA 5FZOA 1HQLA 1HW5A 2ARCA 2RJKA 3ECQA 3R4UA 4MH0E 4AEKA 2VVFA 2RS53 2XWJB 3ZXKA 1JYXA 1NAEA 2OZ6A 4GZ9A 4RHV1 4LT5A 1C57A 1JZ5A 3MEPA 2CWSA 1A8DA 3JQXA 4Q4Y1 4ZHNA 1ZZ7A 1AR73 5CA6A 3KV4A 1EV13 2WSUA 3RZJA 1F4HA 1SFYA 2J1TA 4Y1UA 1E5RA 1N1TA 3ROUA 4CU6A 1HX6A 1V6KA 2P2KA 1PNFA 4SLIA 4E4SA 4AW7A 2Y26A 3FL7A 4RFT0 4PDWB 2E63A 1NCRB 2D3PA 3WNOA 3IIAA 3OY8A 2OYZA 2YYOA 4EE2A 1B09A 1POV1 3OOXA 5L7OB 3PVBB 1AYM3 4FOYA 2OQ6A 2R063 3H3UA 1SQ4A 1VAKA 5JOZA 1KS5A 2ZEYA 2GP3A 4Q8KA 3RNSA 3T08A 3K46A 1JUIA 1PGL2 5BNNC 1CAWA 2O0OA 1ULOA 3T4VA 2FMYA 2NM1A 1ZREA 3MUZ1 3SCGA 1ND2C 3AFGA 5FLHA 4HPKA 1CQ9A 3G6JB 3M1HA 1Q3EA 1DZRA 5A3LA 5CFDB 2JDHA 2ZGKA 3LFMA 3DGTA 2P3YA 2WL1A 3A7QA 3A0KA 3WNPA 4RS5B 2MPFA 1OSGA 2OW4A 1OC1A 1QKQA 3I4IA 5T5LA 2VTXA 3VHOA 2IXCA 1UOFA 4FI9A 1REEA 1VLNA 3B93A 1R083 4R9CA 3DKQA 4NROA 5DN2A 4Q4V3 1LU2A 1NOVA 1H8TA 4NPLA 3SMHA 4WV8A 4ZS2A 5FPAA 4B1MA 2Y8KA 2ZMLA 4QB2A 3LEGA 3ZN5A 5KHKA 1IQDC 5DUUA 4O9EA 3ZXJA 4G9SB 2Q1FA 3M3CA 4IW3A 3T0DA 4KBBA 3VHRA 2WFF1 5EYYA 5H9SA 3VB9A 5FPBA 4D0QA 4PLMA 4Y5Z0 3WQ7A 5JPMB 2PMWB 4XIOA 1YUDA 2D7FA 5FKCA 1D2QA 1OOPA 4B7EA 3HAGA 2BFUS 1XRUA 2W1SA 3PIJA 1RMU2 3PIGA 3GHNA 3QACA 4KGQA 3PUSA 4AEJA 2ZX3A 3MW4A 4KG8A 1UOBA 4Y3OA 5C3RA 5FKBA 2E51A 1C3HA 3KLSA 5LBBA 5D2AA 4AK3A 3T09A 3LAGA 1UY0A 4NIGA 3RS6A 1QJU1 2NMOA 4Q4W3 4CDUC 1S55A 1OLQA 4BIOA 3O1VA 2PN5A 4LIVA 4HFSA 4UFIA 3FX3A 3RJ2X 2A6VA 5B4NA 2JXAA 4CCOA 3ZMNA 2HWE1 1RITA 5M0TA 3TEWA 1PNGA 1Y3TA 1L7QA 5JDBA 1RUE3 2HWF3 5ACA3 4EWDA 5F3EA 1BYHA 4XJUA 5FJHA 2W39A 3THCA 2JDUA 1VMHA 4QPIB 1HJGA 1ZRCA 4UYBA 4XDQA 2MNGA 2PQQA 1RC6A 4O7XA 3U4SA 1LOFC 1S0JA 3AB0A 1NQDA 5F2WA 1UZ0A 4GWMA 1HXS3 1B35B 3PL0A 3ZN6B 2F17A 2VW1A 4WVZA 5A7WB 3M3EA 2ADEA 2BV4A 4JX0A 3DN7A 2PAMA 2A6XA 3N9MA 3RZMA 5LRRA 4JC1A 1QF3A 1W9YA 2K2SA 2D6KA 1W6QB 3ZYGA 3MIEA 2HWB3 2JDZA 1CX1A 4RQPA 5HV0A 3GF6A 4HVRA 2VBBA 2EVXA 2W52A 4YG6A 4BJ0A 4OHZA 5T3NA 2VOVA 3IPVB 1LULA 1SDWA 1UU4A 2WT2A 1ZA4A 4W65A 5EPAA 2RM21 5C8CC 1UL9A 4A2UA 4RR3A 3TNQA 2ZHMA 2G9ZA 3O1UA 3J7HA 4QDQA 1WBFA 4CZSA 1LU1A 3ZFGA 2YXSA 1O6UA 3B9IA 1AR83 1OKQA 1IS6A 2QQNA 4KI5M 3KF3A 3ZX7A 1XNDA 1S2KA 5JXJA 1JZ6A 4YM0A 4IEYA 4I01A 4COWA 1UPSA 3HQXA 5T50A 5T5OA 4DFSA 1VBD1 1NT0A 5BXXA 3GBGA 4JAAA 1JU4A 2JENA 3K51A 4XUTA 3VDDC 4C8DA 3E5UA 2ZX4A 4BXFA 2W1QA 1HLCA 2XBO3 3GZAA 5BPXA 3I3QA 4MHUA 1WGPA 4YW4A 3WVJA 5GLZA 4IL7A 1V6MA 2A75A 2NZ9A 2W95A 4KMQA 4CCEA 1SPPA 4XIKA 1H8TC 3D0SA 4D6QA 4P5YA 1DGWA 2DF7A 5FY7A 4LA3A 5C3PA 5IATA 1RB8G 1X50A 4R4ZA 4V2VA 2QQMA 2G19A 2BGPA 2IZWA 3ZIXA 1D4VB 2X09A 4CDQA 2A6YA 4XFIA 5FYCA 2XONA 1X9PA 4CU9A 5K0UC 1BMV1 4C0HA 1HRI1 4DXZA 4JTNA 5CG8A 5FTTC 5KXDA 1OA4A 2VUDA 4LKSA 1OOPC 3MO4A 3CJIA 4GIQA 4I09A 1DIWA 4OI2A 4AAXA 5D1IA 3OEAA 1XSQA 3RYRA 1CPNA 4GH4B 4XFFA 1H0BA 1HB4A 1FOD1 3MHZA 2I07B 1ZBA2 3WXPA 4MXWB 1RINA 2ERFA 3ZXGA 5DG2A 4B29A 2J1RA 1HB3A 2PQSA 1OA2A 5ABJB 2G9GA 1NZCA 1K5JA 1SFPA 4XE9A 2Y6KA 3URFA 4Q0SA 5CVRA 4PIXA 2CGNA 4AGVA 5HCFA 4HK9A 3HBZA 4XACA 2UYAA 4XOGA 1N3PA 1QJX3 2FCUA 3NSTA 3R4DB 4LBNA 4XDPA 2D6NA 4A4AA 3WNXA 4D8MA 4OVEA 1CD3G 3SXWA 3H8RA 4HLTA 4X8NA 1FI2A 4EN7B 2J1VA 3FBMA 3J8F1 4UBGA 3WOGA 2VMCA 3J7NA 5CZKA 1RUG2 5LA9A 2W1UA 1PX3A 1BBT2 1CAUA 2QQVA 3HT1A 3PNAA 4XQDA 5C70A 4ZONA 1WLCA 2VE1A 1R091 2WKKA 4QWNA 4EJRA 5T55A 4HKLA 2GC3A 1XU1A 1OPOA 2X29A 1OFSA 4JGZB 3N36A 3CL1A 5EJ3A 4NIHA 4IEPA 4ARYA 5IVYA 3JD73 4JTOA 1RUH1 1ZA7A 1V9U2 5I0RA 1GOFA 1TG7A 5KHIA 3O1MA 4BQWA 4C0BA 2DBIA 4FPOB 5FYIA 3KSCA 5LK7B 4QKFA 1WW4A 2WYSA 2A70A 2P3JA 4ZY9A 1K12A 1OT5A 3WF2A 4M3CA 2C5DA 5FLJA 4FCAA 2R073 2V4VA 3HQUA 4TSVA 5D21A 1RUNA 1RL3A 3LIHA 1SLAA 1J3QA 1OH3A 1PMHX 1W2AX 1ALYA 1DQ0A 3C7OA 2VPVA 5FXZA 2LROA 3U11A 4O61A 4J25A 3ZYHA 1X36A 2YB7A 1SEFA 2WIIB 2UYBA 5EV7A 2RE9A 3B5LB 4BQ4A 1UXZA 4JKKA 3RI8A 1IG3A 1SG3A 4KWKA 1COV2 2WJSA 4XUOA 2YV8A 5FP7A 4I0WB 5E88A 4AZZA 1UY1A 4QPGB 2VNRA 5C71A 1JYTA 4W6XA 1PM4A 3LEIA 4AI2A 4KBZA 5CFCC 2GN7A 4WBBA 1QOOA 4CDXB 4P5HA 5DDJ1 5I8YA 3AMMA 2E7AA 1ENXA 3TNPB 3N4MA 1QDOA 2JEMA 3MW3A 3IDCB 3EXUA 1PGW2 1TME2 3FFQA 2RHPA 4A7YA 5KHGA 5DABA 4XF1A 2UURA 3WY6A 2QDNA 3KGZA 4QKDA 1CAXB 1RYYA 4FOQA 2WNEA 4EN0A 3FHAA 4XHXA 4XUNA 5F5CA 4CCDA 3DPRC 3AZVA 3BPZA 2C6SA 1PM7A 2XQRA 3L2HA 4OI4A 4UBHA 4Q4Y2 2RS31 2GC2A 4U36A 3T30A 1NQJA 5BNOA 5FZLA 4D6RA 5IK8A 4GMP1 3LPGA 3ZSKA 1V70A 3FLPA 1UF2C 2EIBA 4YYOA 1UX6A 3WSOA 3VD3A 2CHHA 1NA1A 2QVSB 3VBFB 5FK8A 2VZUA 1GSLA 2B45X 3LDRA 4MUVA 4AFCA 5C4WC 1W8NA 1AZDA 2UY9A 3M3QA 4HSLA 3I54A 3H50A 5DZFA 3WP5A 5JSOA 1W8OA 1DGLA 5FZ0A 4PF5A 1G9DA 4K1ZA 4XJ8A 3TN91 2YFUA 3OG2A 3MV11 1PIV3 1XPWA 1L7RA 4COYA 3TEXA 4F8AA 1QH6A 4MXVA 2BGOA 3MUY1 3TEZA 4XCAA 1RUC1 4KU7A 5JAXA 1MS9A 1C4RA 2ZKLA 1RXFA 4LHLA 2VQ0A 3V64A 5FPVA 3VLBB 4BHPA 1ULEA 2Y6GA 3E5XA 1ULCA 3KQRA 4GB32 4YVWC 3RQ0A 3ZXDA 1LNSA 3BIEA 1H1IA 1HV1A 1AR61 1WD4A 2IWGB 2VAUA 3MF9A 5FUPA 1H30A 2QQKA 3JXSA 5DAXA 4OI0A 2WO7A 1S2EA 2DTYA 2VD7A 3JBG1 3GM8A 1TVGA 1AX1A 3WDWA 1IHMA 3N7JA 3VZNA 4AWDA 4CSWA 2BOIA 3W5NA 2BP6A 3ZFFA 2EF6A 5C9AB 1MS8A 5I0TA 2QTWB 4IEWA 1UYXA 3LSEA 2YGMA 2FDJA 5IYYA 4FSJA 2FMDA 2QQJA 1V6OA 4GA9A 2PELA 2G1MA 3AM2A 2AH2A 5LK5A 4CP2A 1RUI1 2XLGA 3I49A 4PLNA 3HNYM 3VBHB 1AYN1 2WFF2 4DS0A 1E5IA 3SH3A 5IAVA 5J98B 1FT9A 1H1AA 2YBPA 5JXGA 3CZJA 3HN3A 1Z7S1 1QY4A 3BGAA 1JW6A 5A6XA 5I0DA 1TNRA 3CJXA 4BMEA 2BNNA 4QQ2A 1FMD1 1JODA 3Q8AA 4NR1A 3MBWA 1ZZBA 2VY0A 2WZR3 3UESA 1Q8SA 4J1WA 4AL9A 2WR9A 1URXA 2PTMA 4C1XA 3NAPA 4FPJA 3OGJA 4K1YA 5A6ZA 4N90A 1QJU2 5IWFA 1D2SA 2VQTA 2LALA 4HOOA 5FZGA 2Z4FA 4Y1ZA 3KV9A 2RR11 4KQ7A 5FO8B 1DQ5A 2E53A 1DGWX 1LECA 1HN0A 4LHSA 4OHXA 2CWMA 2XHNA 4QKBA 4JDMA 3WNNA 4R9DA 1DQ1A 1NCQA 1U12A 2FZ1A 4GMP0 4D7YA 2QQPA 2HWE2 2WUHA 2I74A 1HB2A 3VKMA 1LESA 4YVSA 5CFDC 3FUQA 1LKNA 4Y1YA 2R32A 1V6IA 2XUMA 3NNFA 1CJDA 2HKXA 5F9TA 5JZGB 1D4M1 1O91A 4BWOA 5FYBA 1FV3A 2QKDA 2VW0A 3WG4A 1DHKB 1U0AA 3ORJA 2IVJA 2WBKA 4QGMA 3S0MA 2GNMA 3EHKA 3BU7A 1WMEA 4LNVA 2WQ4A 5AVAA 5GZFA 1XXNA 5AC92 4S2FA 2FCVA 3PU8A 4GXLA 3M7AA 1H2LA 4ES8A 2ZBJA 4YPJA 2HEYF 1NLQA 1JMUB 5KC6A 5SV8A 5KHJA 4RD7A 2H6BA 1PO21 3PDQA 4CA9A 4GKYA 5FYZA 5A3TA 3S30A 1NA1C 3DXUA 4MV2A 5BY5A 5JSRA 2XVKA 5L36A 2Y6HA 3CDZB 1JZ8A 5DUVA 2DVFA 2JJ6A 1OVPA 4AYUA 3I2KA 4K8FA 3RZGA 3A23A 1SHWB 1AHSA 1YI7A 4N43A 1O5LA 1Y7BA 4DY3A 2RM22 3HJRA 3H0OA 4NJ4A 1W2UA 1PVC1 4B7KA 5A7NA 1AJKA 2XB6C 1S0FA 3IT8A 1NXD1 1W3XA 4KWLA 1G8WA 3SNMA 4XF3A
chains in the Genus database with same CATH topology
2R041 3OYWA 3O7OA 4IEVA 4Y22A 2EALA 1UAIA 5BNPC 1TMF1 1VBD2 3KT1A 4F3JA 2PAKA 2GMEA 1U5XA 3NKTA 1APNA 3RPQA 2D3RA 3H8UA 4LA2A 4ZU4A 3ILRA 2XL7A 2LTNA 2VVEA 4BA6A 3QLQA 1WW5A 2DVGA 3ILFA 1VBA1 4A7KA 4X6QB 5JOWA 4L9BA 1BMV2 4PJYA 1VALA 2QZ3A 3SCHA 2BQPA 3WDVA 1HRI2 1RUJ1 5JOXA 1A8MA 4XFBA 2QE3A 2ZHNA 4RGGA 4H7LA 3KGLA 4YGDA 1VJ2A 5DZEA 4Y26A 1JYIA 2WSVA 2EAAA 3GBFA 5AVPA 4Y20B 1YLLA 4AHWA 4OHVA 4OZXA 1ZZ6A 1ND3B 3ZSMA 3H1WA 1YXWA 1WLDA 1EY2A 2C1FA 1MS5A 2JE7A 1CR7A 4Z8BA 4ORFA 4YW2A 2YPJA 3WHTA 2WNVB 4OUMA 3HT2A 4MSVA 5J7MA 4ZXKA 3TB0A 2VNGA 3AP4A 4AVTA 2ZZQA 1R092 1LRHA 3FWEA 5A32A 5BNNA 1UKRA 2OA2A 3ES1A 2D97A 4PQ9A 1ND2A 2P37A 4L99A 4XXAA 2VULA 1RUH2 2ARBA 1AL22 1H9WA 1RMU3 5EYXA 3I7DA 5T54A 1W6PB 1GICA 1RHI1 1KFXL 4FTEA 4RA0A 1IS3A 4J1XA 4XFCA 3OF1A 5C33A 1LGBA 2GNBA 4HL0A 2UWCA 4RQPB 3LOBA 3ZXFA 2GSYA 2XLAA 5BUVA 4MX3A 4RR3B 1H9PA 4N9IA 4OFGA 2ZOEB 4IESA 4AFDA 2B8MA 1PK6B 4HT1T 3GBWA 3ZFGB 4N43C 1WCKA 4E2QA 4NO4A 5FO7B 3J26N 5HCAA 2XVGA 1KDKA 1ZZ9A 3JQWA 2Z79A 3M4FA 3QCWA 3IWZA 4KL1A 1CIWA 1X8MA 5FDBA 4D7TA 3R6SA 1ZRDA 5FLIA 1PZ9A 1M4WA 4FP2A 3WINE 4AQTA 4Q2FA 4AVCA 4U2AA 1CAVA 2RS32 2P34A 4CDUA 4QHBA 2P3KA 3ZSJA 1XYOA 1W0OA 4FT8A 1W6NB 4CP0A 5C6CA 4I30A 4XQ4A 1XNBA 4Z2WA 2KM2A 4CDQB 1ZNPA 4JGZC 1A3KA 1K5MC 3HMYA 5CG9A 1YJKA 1BK1A 3PVNA 3ASIA 4YM2A 1BCXA 5KXCA 2KA3A 4JQRA 3CJIB 3HD8B 4DNYA 2C0ZA 1Q8VA 4IQPA 4PIYA 3OD4A 4IV1C 1UW8A 3TN92 1Q5OA 4P14A 3MIFA 3O0VA 3OCPA 1WD3A 1GNZA 4DMIA 4D3WA 1G9FA 3EBRA 3ZYJB 3RMXA 1LOFA 1NG0A 2RS13 4LBOA 4LHNA 3ES4A 1QXPA 2PYTA 2NN8A 2ZCWA 3SISA 4AI8A 1O3SA 2IXIA 4JGYC 3VKOA 4FQ4A 5CADA 3FZ3A 2QNKA 2PHUA 2FQPA 1I1EA 4L2NA 1AR62 3WLUA 4QMAA 2DCJA 1YNAA 3O0WA 3JBG2 1O7FA 2Q30A 1GQGA 1I6XA 1AXZA 1JBCA 1LOAA 4NWVA 3ZDSA 1UN1A 5F5QA 5C8CA 2YGLA 1RVF1 1RUD1 3JU9A 1XYNA 2A3XA 3N7KA 4MGIE 1NE4A 4B8EA 1RUI2 2JG9C 1CESA 4P9IA 1AYN2 1O4ZA 4M3CB 4OLLA 2TBVA 2P17A 3WX5A 1W6MA 4DRVA 1SLBA 5D8AB 1Z7S2 3TBDA 1VIWB 3D4KA 3A0NA 3AP6A 3G7DA 1QJY3 1ZBA3 4I3PA 3VDDA 3VBSB 4DQAA 1FMD2 1MQTB 1QNWA 4BLIA 4L11A 5FQ0A 2V5YA 1AVBA 1DGRA 2AZ5A 4H7MA 1GV9A 4RGAA 2O8OA 1MEC1 3UKTA 1XE8A 4Q1PA 4BZ4A 2HYKA 2RR12 1SBFA 4E9KA 1CN1A 3VZKA 5K0UA 3C2UA 1RUG3 2CAUA 1Q8OA 2NPIA 5E89A 1BBT3 2IXHA 4FXGB 4ATEA 3MFAA 3NV2A 1YIFA 5FBZA 5C8WA 5I0SA 1S0EA 1H4GA 1J59A 5HBAA 1D4M2 1SLCA 5H9RA 4AVVA 4XFGA 4FP3A 1UCXA 4Q4X3 1V9U3 5GKAC 2ZS6B 2PA7A 4WVVA 2DWRA 4AGRA 2Z5WA 3USSA 5FAXA 3WUCA 5GZDA 4EN8B 1EAH1 1QOSA 3NL1A 1W0PA 4QQHA 2OVUA 5LEKA 4AEDB 1QHDA 3N7MA 4N7UA 3RRDA 3MGUA 3AZWA 2AR6A 3KCCA 4OI1A 3LGRA 1PO22 3AJZA 4DINB 2A73B 1YJLA 3AP9A 3SHRA 3ZFEB 1FAYA 4MGKE 3BODA 1F2NA 1FPN1 3QH7A 3ZN4A 3ATGA 1COV3 1NYWA 3SH4A 1GFF2 1YFUA 4LUKA 4OUSA 4LHKA 5KHHA 4E4DX 1GLHA 2CTVA 1ZRRA 1S0IA 2WA3A 2R042 5GM0A 1TME3 4E2GA 4AVSA 4E2SA 4LEJA 3EO6A 4P9JA 4DY5A 4AI0A 3GALA 4HN1A 4CEWA 5DG1A 1TMF2 3H7YA 2DFCA 4Q4Y3 4LE4A 3ZFFB 5I8SA 3WW1A 3WD5A 4WM8C 1BQPA 3H9AA 1WCSA 2SBAA 2BFUL 4M3CF 2ZGOA 2ZGTA 4YG3A 4YG0A 4S2HA 4QGNA 5JIAA 3ME2A 4IV3B 5LRSA 2BGCA 4E4ZA 3FHIB 5CFCA 4A7ZA 4PIZA 1LCLA 1N47A 4MLOA 2JD4A 4N53C 1POV3 1IZ3A 1V00A 2Q8OA 1V6NA 1RUJ2 3IMNA 2GMPA 3S7IA 3KT7A 1XE7A 5FFOC 3RG0A 1VR3A 4CEYC 3DPRA 3NAPB 1MR5A 2ZMNA 1DYKA 2GAUA 4URTA 4HPKB 4J6GA 4GB33 5I0UA 1MS4A 3DF0A 3FBYA 4BCUA 1HQNA 4Q29A 3R05A 4JRLA 3D0JA 1TE1B 2JG8C 2PHTA 3UKNA 1CONA 1NCQB 3VL8A 3WW3A 3MIBA 1FXZA 4YZ3A 5C4WA 3AX4A 4YVSB 1DU3D 2VUAA 2AGSA 5A33A 3ELNA 5FO9B 2Q0AA 2GDFA 1JH5A 2AREA 2D6LX 3AP7A 3NWKA 4CRQA 1S0DA 4Z82A 3OJBA 1C1LA 4QD2A 3B9CA 3GZUC 4LO6B 4DZGA 3ZYRA 4MYEA 3ZO0B 3P3NA 2WFF3 2XJPA 2WT1A 1U5YA 2QDRA 1HDKA 2X5IA 2YY1A 1KFUL 1AX2A 1SACA 1BXHA 3NV1A 3VBOC 4HMZA 4YVWA 2PLV2 2HWC1 3GNEA 3PLQA 1GZ9A 3VBUB 1EPZA 1RHI2 3MIGA 3APBA 4PBPA 2XJRA 5FMOS 1QNYA 1QJU3 1SLIA 4DRRA 2VUJA 3H7JA 2AENA 1LTEA 4P9XA 3ZPYA 2DVAA 3VZJA 3V0BA 2PFWA 1IPJA 2A71A 1MS0A 1VRH3 3DKWA 5F6KA 1KDMA 2WC2A 2QFEA 1QOTA 3BOWA 1ZZCA 2HWE3 5JVVA 4Y22B 3ZXAC 3O12A 1Q56A 4INDA 4COVA 1XU2A 3NO8A 1ND3C 4LR4A 1ZBE2 4NHKA 2BWAA 4ASMB 4AVAA 4PDWA 4N9HA 4UXAA 4CEWC 2WNUB 4HBNA 2LUWA 1GYKA 1IOAA 1NY71 1QQP1 2WNVC 5AC93 1VP6A 4YNIA 4JCKA 3AP5A 3CLPA 4IEZA 4K6BA 5GALA 1X82A 4LBJA 4D69A 1W6OA 3E5QA 4KG0A 1UIJA 3FUOA 3USUB 2G9FA 4LLOA 4WM7C 1RUF1 1QXJA 1A78A 4LBLA 3ZMOA 1G7YA 5CFDA 1BEV1 2RM23 3BCWA 1AR91 4A3XA 5CU1A 2JX9A 4L92A 3NV3A 1SBEA 3JZVA 4RHV2 1NE6A 5FMOL 2DUOA 4P9YA 3MLJA 1L3JA 4Q27A 1MS1A 1DZQA 4AHXA 1J3RA 4L97A 3JB4C 1WLTA 3O14A 4JRAA 4CDWC 4FAGA 5BYNA 4I3GA 1VBD3 3ZYPA 3WP6A 3POSA 3PMEA 2CL2A 1REDA 1N1YA 4ZKTB 3AMNA 4AQ6A 2IXLA 4BH9A 4BIFA 1SMVA 2O1QA 4K20A 3KM5A 3M3IA 1RVF2 2ZGRA 2ZZJA 1RUD2 3N35A 4XTPA 1ND2B 4X8PA 1DYPA 3KCXA 2A3YA 1SCSA 2OUJA 1LHVA 4Z1VA 5DXDA 1KS4A 1AJOA 3AJYA 3NV4A 1HRI3 5EFUA 2X5IC 3VBRC 5JLVA 5BNPA 4W6WA 3X29B 3AXEA 3WP3A 1V6LA 4Q0VA 3VHPA 1J3PA 1YO8A 3K48A 4XEZA 2GC1A 2I2SA 4UW5A 4BMBA 1AF9A 1MEC2 2WS91 4BLJA 3W59A 2OUHA 5BV6A 1BKZA 2HWD1 4M01A 4IEQA 4FPKA 3WQ1A 2ZAHA 2XPJA 4XTMA 2D5HA 5B2GB 4XBNA 1ZM1A 3PTYA 2TUNA 4FTBA 1RGSA 2K9ZA 2XWBB 3AKQA 4YLZA 4B4PA 3FLTA 4P9GA 2ZGSA 1R093 4PDWC 1NCRC 1O3TA 5JOYA 1CAVB 2V73A 1VBB1 4R9AA 2EXKA 5GZGA 1IKPA 3H3ZA 1JHNA 2VG9A 1AL23 5L7OC 2Y0IA 1MVEA 5H9PA 2RMU1 4YZ4A 2WA4A 4AQ2A 1Q8PA 2NP0A 2K0GA 3KD4A 2VNOA 1HIXA 1EAH2 5K8SA 2QJVA 1VBE1 3UJQA 3I59A 2MEV1 4EWEA 5K7PA 4E27A 2ATFA 4FOVA 3RWNA 3WR0A 1IS5A 1LGCA 5J3UA 4H14A 1DF0A 3RSJA 4TZDA 1FPN2 1PO11 3DUIA 4RS5C 4G3YC 3VBSC 1F31A 2NYYA 2NQYA 5FOBB 5E16A 2R0FA 4FPYA 3MICA 3GYDA 1UKGA 4BE3A 4FAHA 1ASJ1 4YGCA 1R1A1 5FOJB 1Z78A 1EP0A 1G9CA 4WZCA 4AE2A 4YGBA 1VBC1 3OY8B 5HCBA 3N3HA 2RS33 3I8TA 3WW2A 2BWCA 2A3WA 1M06G 3AMHA 5J96B 3L9JT 2R1DA 5E8AA 3ZSLA 4I0AA 1CAWB 3AKTA 4QPYA 1HRV1 1VB4A 1RIRA 1VB2A 2ZHKA 1LEDA 2D6PA 4C90A 4YFZA 1DGRN 1W6MB 1KQRA 1D0HA 1F9KA 4EROA 1XYPA 1S2BA 3TN93 2Y0OA 4ASLA 4AEDC 2F6BA 3VDDB 5JSPA 2XJVA 3UJOA 3A4UA 4K3UA 2D6OX 5J37A 1SFNA 3ILNA 5GZCA 3TAYA 1LHUA 2R0HA 1OMIA 1T6GC 3OPZA 1H8TB 3FE5A 3AYEA 3WZ1A 2D6MA 2VU9A 1EYBA 4LULA 1F5FA 5AFBA 1MZ5A 3DV8A 3AZYA 3LWCA 3ZYIB 4AG4A 3TYJA 1AR63 4HKWA 4JGZA 4TLFA 1K5MA 4QPIC 5IUQA 4QT6A 5E1RA 3JBG3 3QH6A 4L8QA 1OOPB 1C8M1 2E9QA 5BNQA 1V6JA 4YW5A 3P3PA 1B35C 3D6EA 3FMGA 4IV1A 1XQNA 3J9SA 4MVTA 3BTAA 4QGLA 2JE9A 4IEOA 1DLLA 2ZX1A 1YRZA 1GBGA 1FOD2 2UWAA 1PZ8A 2ES3A 2RS51 4JGYA 4H3WA 1ENRA 2H0VA 4AHZA 1Z7S3 3E6BA 2D43A 2HWC2 4QPGA 1R1ZA 3CU7A 2RS11 4C1WA 1LOEA 1AR71 4IV3C 3WT3A 1EV11 3UL2A 4ES9A 4FPFA 1FMD3 2CNAA 4YZ5A 3VZOA 2WFPA 1AUYA 2EIGA 3WCSA 3ENRA 3J8F2 3M8LA 3MW2A 1GZWA 2DFBA 2DVBA 2XKOA 3RYPA 4Y24A 1MZ6A 5TSWA 3VZLA 2RR13 2ETEA 2WLQA 3WG1A 1AYM1 2JG9A 1QGLA 5IK7A 2R061 4G4FA 1UZZA 4N7IA 5CB7A 1FATA 1KJLA 4M00A 1QH7A 3OBTA 4XF0A 1DG6A 1D4M3 2ZA9A 1LEMA 3EJKA 2VMGA 4LBMA 3AMQA 5GLUA 2ZX2A 1I9RA 1QQP2 3U4XA 1QJY1 4B4QA 3WDYA 2UU8A 5CFCB 2VXRA 2EXIA 4GH4C 1SLTA 1KJRA 4HN0A 2FZ2A 1PO23 1R081 1ZRFA 4AVBA 4Q4V1 3ZXEA 2VMHA 2F4PA 3CF6E 3MFCA 5ABJC 3B02A 1RUF2 5DDJ2 5J36A 2R30A 3WP4A 1NXMA 2W68A 3INAA 1BEV2 3DPRB 4XHBA 3ZXLA 5JPNB 3WG2A 3MPBA 2SLIA 1AR92 3B7MA 1YI9A 2CYFA 5DZGA 2R49A 3FC0A 2R043 4D94A 1BJQA 3QD6A 4LTAA 2DU0A 2P3IA 3TWIA 1QXRA 3TOJA 2GU9A 2ZTNA 4Q4X1 2XJSA 1TMF3 1FX5A 4ZU5A 5FRAA 5C4WB 3CO2A 4LBQA 2PHDA 3MIDA 4YRDA 3KZ4C 2I45A 4Q4W1 2R6QA 3NW4A 1YFXA 3GZTB 3MF6A 2GH8A 3PVOA 5T5JA 1DQ4A 2GNDA 3SH5A 4FBFA 1A6CA 2D40A 2VVDA 3PVEA 2WNUC 1TEIA 2XJTA 1RUE1 2HWF1 5ACA1 1C8NA 1LENA 4KH9A 2ZGPA 4LO5B 1CGPA 1RUC2 1C1FA 3QBQA 3J4UH 2D93A 2QZ2A 2LM3A 3IN9A 4Z07A 4LBQD 4QPGC 4GALA 4Q0PA 4I0BA 3ZIWA 3M70A 5I93A 4XMAA 3PJQA 1HXS1 3V0AA 4CDXC 3L2YA 3GHMA 2W08A 1CAUB 4WM8A 2ZABA 2D5FA 1UMZA 3V0BB 2ZAAA 3B3QE 2IXJA 3MDPA 4XFHA 1KD7A 5JZGA 1IS4A 1UU6A 2WS92 2HWB1 3HN1A 1JXNA 2HWD2 4QQPA 4KGGA 1Y43B 2IFWA 4HSJA 2PAEA 4N53A 4WZFA 3VHNA 5JMCA 4YZ1A 4PCRA 4FQZA 2BNOA 1S1AA 2FHRA 2WT0A 3CEWA 4QU2A 2E7QA 4XBLA 4CTEA 3VUOA 3AYCA 3SLIA 1QDCA 1AR81 2ZJCA 4CEYA 3HWJA 3VBFC 1VBB2 4D7SA 4M3CE 4BQ1A 5DUXA 2PLV3 2RMU2 3VKNA 1RHI3 2XVLA 4M0HA 3WG3A 4EV0A 1W6OB 3KB5A 2JG8A 2B42B 1BVVA 1VAVA 2XBO1 5F6LB 1VBE2 3RMYA 2MEV2 4GB31 1LHOA 1ONAA 3BIWE 2Q4SA 3M3OA 2V09A 4Q26A 4Z92B 1X8EA 2PHFA 4YGEA 1F5JA 2AYHA 4M0NA 1LB2A 2UY8A 3AYAA 4WVMA 3BB6A 1PO12 4XJWA 2DCTA 4IEXA 2EAKA 3THPA 2DCKA 2VOXA 5BNOB 4R52A 5KXBA 2HEVF 1REFA 3T1MA 1GR3A 3VBOA 5A3MA 1ZBE3 4FPHA 5C9AC 1ASJ2 1R1A2 1LJ7A 3E97A 4UW3A 2A6ZA 3AZZA 1NA1B 3KT4A 2G4IA 3UV9A 4JDNA 2Q5TA 3U07A 2YZ4A 2GN3A 1VBC2 3VBHC 2BYVE 1E57A 1U5ZA 1SBDA 1QJX1 4FTSA 5SV5A 4MGYE 5JR7B 3KCYA 2B46X 2OPKA 1BVP1 4XJAA 1DDLA 2B39A 4S2GA 4LE3A 1ULFA 2OZJA 3MZHA 1I5ZA 2CY6A 1HRV2 3B94A 3VL9A 4Y20A 1PVC2 3W9AA 2E7TA 2HJIA 2X53S 4HVOA 3AKSA 5IT6A 3T1LA 5BNPB 1VRH1 3M2MA 3RJRA 4F7ZA 1ND3A 2D98A 2N7GA 3THTA 5JI7A 4FPCA 2Z69A 1QU0A 3UKVA 3MIHA 3JD71 1HKDA 4RHV3 3IDBB 1RJ8A 4R9BA 4YW1A 2WNVA 3N7LA 2QUOA 5J09A 5GJ6A 3MI8A 2R071 3EQEA 3AK0A 1H8VA 1POV0 4QQLA 3AZXA 5JZGC 4QXKA 1FYUA 3S6PA 1QMJA 1G86A 1YCIA 3POWA 2GH2A 4K21A 5AC91 4KWJA 4WM7A 1O4YA 4OHWA 3NVCA 5T5PA 1VBA2 1RUOA 2DU1A 3NJZA 4DOUA 1YIPA 1C8M2 3I2DA 1W6PA 3AYDA 4FVVA 1ZYBA 3LZZA 2WLPA 1RVF3 3D82A 3OGGA 4IXLA 1RUD3 3V56A 3VKFC 3S0MA 4AFAA 4UW6A 3WCRA 3SITA 1GNHA 1JTZX 4K9SA 4TYSA 2ET7A 1ZVFA 2CV6A 2KXLA 2RS52 1PK6A 2YDEA 1UU5A 2ILMA 3I59B 4GQ7A 4HKOA 4CDWA 5EWSA 4ATFA 2RS12 1AR72 3WDUA 2EXHA 1EV12 1WBLA 2NLRA 4AI1A 3O5SA 4AHYA 2QCSB 4QQOA 1JN2P 5DUWA 4YW3A 1MEC3 4O9GA 4Q0QA 3LSDA 4R4XA 2VQAA 1MZFA 4AF9A 1LGNA 1UD1A 4AQSA 3JCIA 1IPKA 1OA3A 2JICA 4XFAA 5FPZA 4COUA 1AYM2 3VZMA 2WINB 2R062 1CPMA 3E6DA 5KBFA 4OULA 1PIV1 4HETA 3VBRA 1BZWA 1W6NA 1WUVA 3TRSB 1O5UA 4XETA 1NLSA 1FNZA 3B69A 1YWKA 1WMFA 1W39A 1PVXA 5GLWA 4B4RA 3OD0A 1H1MA 4GULA 1Q8QA 4N43B 3C3VA 1EAH3 1PZ7A 1QJY2 1N3QA 3AKPA 1OD5A 3RYKA 3OBRA 3OYWB 4UW4A 1R082 1LR5A 2IXKA 2UWBA 4BOWA 2GALA 4Q4V2 3WUDA 5FREA 4NN0A 4QM9A 5CIRA 3AFKA 1FPN3 2Q1MA 1U5IA 1WCDJ 4YFWA 5JWPA 2R16A 1NCRA 1ZX5A 3U10A 1QWRA 1O4TA 2DCZA 1OLRA 2FBEA 5FCCA 4AXOA 5L7OA 4EWAA 2DURA 2RJLA 4S2DA 2EXJA 2XGXA 2JKBA 3MYXA 4XJZA 1O3QA 1K5MB 3B01A 5KWRA 2WZR1 2VOKA 4LO7A 4Q4X2 1WLWA 1AL21 2YHJA 4K40A 1WMDA 2A5ZA 5JI9A 1IGOA