1OVPA

Lecb (pa-lii) in complex with fructose
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords hypothetical protein LecB
publication title Structural Basis of Carbohydrate Recognition by the Lectin LecB from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2003-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1ovpA00
5D2AA 2JDNA 2JDUA 2CHHA 2VUDA 2BP6A 1W8HA 2JDKA 2VUCA 1OUSA 2JDHA 5A6YA 2BOIA 2JDPA 5A6ZA 2BOJA 2BV4A 1OXCA 1UQXA 4AOCA 2JDMA 5A6XA 5A3OA 1W8FA 1OVPA 3ZDVA 2WRAA 1OURA 1UZVA 3DCQA 5HCHA 1GZTA 4UT5A 4CE8A 2VNVA 2XR4A 1OUXA 1OVSA 2JDYA 2WR9A 5A70A 5A6QA
chains in the Genus database with same CATH superfamily
4GMP0 4A7ZA 2Y6GA 1QDCA 1MZ5A 4QGMA 2XOMA 2VMIA 2JG8B 1VPHA 4D7SA 2RV9A 4QPYA 1HB2A 2X09A 1REFA 4MADA 3ZYGA 5FBJA 4WVMA 2WS92 4URTA 3SH4A 1RHI1 2HYKA 4AW7A 3L2YA 1OH3A 2X5IC 3RNSA 1FOD2 2GNTA 2JB8A 5LRRA 2ZX3A 5DUVA 3VKOA 3OGGA 1RUG1 2I2SA 2LROA 1F5FA 2EF6A 2VGDA 4AQSA 3AFKA 2J1RA 2XHNA 3VKMA 1HQWA 2PLV3 2EICA 4GH4A 4AVAA 1SCSA 5FFOC 4HETA 3WDYA 4PIYA 2D5FA 4OYUA 1JBCA 4XDPA 3OYWA 1ZZ9A 3PVOA 4Y1ZA 5T3NA 1IPJA 5DABA 3NVCA 3HQXA 3P1IA 5APAA 4XABA 3MFAA 3WLUA 4BPZA 4LBQB 1PO11 3Q8EA 1O7FA 4GWNA 5HPOA 3ZSEA 1RUF3 4PDWC 3I49A 1H1MA 5DAQA 2OPWA 2GDFA 1VBC1 4KGGA 4M3CB 4CDWB 1DFQA 4D8MA 4BWOA 2YU1A 4NRMA 3WW4A 2CDPA 1ZX5A 3VDDC 2W0XA 4ET7A 1RVF3 1OD3A 4BB3A 3M7AA 5JR7B 4NMIA 4Q0QA 1ZBE3 4NWWA 4Y3OA 4YVSC 1POV1 1WWYA 2ZKNA 5DDJ3 1NXD1 4B3NA 4B1LA 2V72A 1XXNA 3GBFA 1C8NA 3UKVA 2DURA 1ND3B 3KV5A 1B09A 1W2NA 3JB4C 1G9CA 4F3JA 2RM23 1JW6A 4V1PA 3OUHA 1ASJ2 4CU7A 4XMAA 3VN4A 3QOPA 5JVVA 2IVJA 5L19A 1QHDA 4YFZA 3FFZA 1AZDA 2VOKA 1MS3A 3VZMA 2DTWA 3HBZA 5JZGA 1IQDC 2DBNA 5A3UA 4LBKA 1LKNA 4Q4V1 1X8EA 3FLRA 1C1FA 3VHPA 3WF0A 4XZPA 1LB2A 2Q30A 3VD3A 5F32A 1QJX1 2P6CA 5E8AA 2C26A 3C7OA 1IS4A 4NO4A 1EY2A 4SBVA 4ASKA 1HXS2 2BGOA 5LBBA 3U75A 4Q0VA 1HRV3 4HANA 1ULEA 2GN3A 4EYUA 3BTYA 2YPJA 1W6MB 2XKOA 1VBD3 4HONA 3J7NA 3TN91 2VUAA 1R1A1 5LY2A 1GBGA 3TAYA 1E5HA 1TME2 3CLPA 3K46A 1UPSA 4Z1VA 1LJ7A 3ZKYA 5FYYA 4TLFA 4QKDA 5FP8A 3DPRA 1VB2A 3MIDA 3C7GA 1UO9A 2AC1A 2DCZA 2VM9A 3B9CA 4HMZA 4Q8LA 4YM2A 1R093 3ES1A 1RJ7A 1HB1A 4XF1A 5CKMA 1UYPA 1RUH1 1KJLA 2VZ3A 3M3QA 3ZFFB 4B7KA 4DY3A 1AYM2 4PF5A 5F5CA 1V9U3 4AQ6A 1TME1 1OA2A 2BPA2 4W50A 5JXIA 2YU2A 2JDNA 4QKNA 4AEKA 5IATA 1LOCA 1YNAA 4LA3A 3OF1A 3VKNA 5C9AC 1OLQA 2HWC2 1OPOA 2LS6A 4QX7A 1STMA 2KR2A 3PURA 4OI2A 1CD3G 2WO3A 4GKXA 1KXGA 4Y22B 4Y24A 4ARXA 1W9TA 1S0FA 1S0IA 4YARA 1NQJA 2IXIA 1Z78A 2VMHA 2BNMA 3POIA 4JC1A 1SACA 3I3QA 2FHRA 3PLQA 3I2HA 4IUGA 3MF9A 4E2QA 2A3YA 5GLWA 3A23A 4UFKA 3ATGA 4CUCA 1NCQC 2QJVA 2PQQA 4XUTA 4EZ4A 1JZ7A 4FXGB 4Y26A 1H9WA 3VBHC 1RUE2 3J8F2 3FX3A 3SLIA 5AVPA 3AMHA 2A3WA 4K1YA 1J1TA 1POQA 3OBAA 2D40A 3UK9A 4QHOA 3K77A 3ZFEC 3VZJA 2PAKA 2DYCA 4QPGC 1AR83 4P9IA 1UPIA 4LIVA 2VXJA 3ZDSA 2DVFA 2R043 5GLUA 3WQ0A 1PVC3 5I8TA 2NYYA 5J09A 2P37A 4UW3A 5FZGA 5E89A 1RUE1 3T30A 2W1SA 2RJLA 3W5MA 2VZUA 2XONA 3B9IA 5C6CA 2VJXA 1SLAA 2ORZA 1W28A 3WG2A 1DQ5A 4FPJA 5HCHA 2IXJA 3NKTA 4DIQA 1NCRC 3J7LA 3NJYA 4NWVA 3LAGA 2YC0A 2HLEA 3C3VA 3HJRA 4MGTA 3H3ZA 5CYYA 5EIYB 5JR2A 4JQTA 1QJU1 2YROA 4I3GA 4Q4Y3 4CEYB 2Q5TA 3A0KA 2J42A 5F3IA 2RS32 4GULA 1XYPA 1RL3A 2WLPA 4N53C 4OHVA 2VBDA 4NN0A 3SITA 1RITA 1H0BA 1QU0A 2HKXA 1SDWA 3GCWA 3WDUA 5C4WC 4RR3B 4HPKB 3ZDVA 1BEV1 4R8HA 1Q3EA 1PK6A 3I54A 1HLCA 2X5IB 3I59A 2C24A 3VZLA 2RDRA 1EAH2 5LCWL 1AR62 3L9JT 2RS31 2SBAA 2VG9A 3DUIA 5H9SA 1G7YA 5HXVA 1NT0A 2W9XA 3GXUA 1V6LA 1LHOA 3G7DA 1YFXA 3KB5A 2PA7A 3I2FA 5JLVA 1DIWA 3E6DA 5HV4A 1FV2A 4QQPA 4BQ1A 5AFEA 2HBTA 4NRPA 3RRDA 3FMGA 3DYPA 3CJIC 5J1XA 1W6NA 4QKBA 4QGNA 5FPXA 4YRDA 3O1TA 1AR92 1EP0A 1PNGA 2QQOA 1ODMA 3LEMA 5A7WA 5A6ZA 2VCBA 1VE0A 4MXVA 4CDQA 2W47A 2PELA 5L7OC 2LTNA 2JE7A 4G3YC 4OMCA 1DQ0A 1UIJA 4PDWB 1H1IA 5ANNA 4PIXA 3K3NA 2ATFA 1BCXA 3RZMA 2X53S 2XQRA 4D7TA 3BOWA 1CAXB 3H7YA 2P5BA 2YG0A 3AP4A 4FPLA 4MGSA 5FQ0A 4UF0B 1UWWA 1X33A 1VBE1 3AC0A 4XFGA 2C9AA 1CAUA 4YVSB 5FMOL 2A75A 5C3OA 3RZJA 1OLRA 3DKQA 5IW0A 3M70A 5A32B 3WNLA 3N7KA 1PIV1 2WNVA 3O1MA 2R063 1Z7S2 2QQIA 1HQNA 3DECA 4AVTA 3KVBA 1A3KA 1PO21 3N9OA 3ROUA 3PIJA 3WD5A 3RI9A 3ZYRA 4BLJA 2UURA 3E97A 4I30A 5FK8A 4AFCA 4EN6B 3ASIA 3RZKA 3T1LA 1GNYA 5CFDB 1S2EA 3I2JA 3UJOA 3IBMA 5FYTA 2JECA 3Q8AA 1Y3TA 3WNKA 1VLNA 4L0PA 2FD8A 4JGZA 4FQ4A 4QDRA 1XOYA 3ZXDA 3ZSMA 3WUCA 3WNOA 1M4WA 4KNCA 1D2SA 4E4HA 1CIWA 1NOVA 4CTEA 4NIHA 1G6NA 1J3QA 4LORA 4AFAA 4OHWA 4FOQA 1P8JA 1SPPB 3ZXKA 5KXEA 2JG9A 4SLIA 2PMWB 4NIAA 1UZZA 1HN0A 1GQHA 4ARYA 2WAOA 4WVVA 1A78A 3TB0A 4KQ7A 4DUXA 2G1MA 2ZAAA 1R1ZA 1GZWB 1OH4A 1DGLA 3FLPA 4NAMA 5D8AB 4BQ3A 4OLLA 1LHWA 2JD4A 3ACGA 2VC9A 1YXWA 4OZOA 2A1XA 1DQ6A 1WW4A 4Q0SA 4GB31 3THCA 1RUD3 2D6NA 2PLV1 4LJHA 1O3SA 2EAAA 2VOXA 1RUF2 2OPKA 3U10A 1QOTA 4LULA 1VJ2A 4M3CE 4YFWA 3NV1A 1R082 2ERFA 2AENA 4BIOA 2VMFA 2ZX2A 2GMPA 3WW2A 5FZ4A 3KGLA 3I3DA 1TMF1 1GFF2 1RVF2 5T5LA 1ALYA 1VB4A 4WZCA 5FYBA 3FC0A 4KWLA 1ZBE2 4AHXA 3VHRA 4K1ZA 3MLKA 3ZFGC 2OYZA 4XF4A 3ALQA 5DDJ2 3UESA 1U12A 3M1HA 2RS13 3FBYA 1RUF1 4NJ4A 3DEMA 2PTMA 3HOBA 3VBSA 2UYBA 4RHV1 3S57A 1F8VA 1ZZ8A 4RN5A 2XLGA 4MUVA 3BIWE 1NCQB 2RM22 5TSWA 3KQ4B 3VBHB 4KBZA 4NUBA 1N1YA 5F1RA 1V70A 1C57A 4LTAA 1ZBE1 2BGPA 3MUZ1 4NE9A 4PI2A 5FP9A 4CVUA 2C6SA 4YZ1A 4B4RA 1XC6A 2GP5A 4QQLA 4XW3A 3QH7A 5EXOA 4UFLA 2P34A 1UN1A 1WZXA 1X9TA 4CEWA 2Z2SB 1KJRA 4FAGA 3POEA 1OVPA 4JGYA 3ZSKA 3P6BA 1HRI1 3VZOA 3JBG3 1QXJA 2B7YA 2ZMLA 3NSTA 1JI6A 1LOFA 1HRV2 1O91A 3AZZA 4Z07A 1HX6A 1LR5A 1MS5A 5FLHA 2WZEA 1NCRB 1VBD2 4XUPA 1S0CA 2OQ7A 2YBKA 3KCCA 1IS3A 4CP9B 1FYUA 4IEYA 3AKPA 5CISA 5F9TA 5HBAA 1BXHA 3B01A 1WW6A 1ZVFA 4JRLA 4BISA 3TWIA 5LA0A 1UZYA 1GZ9A 2ET1A 2FDFA 5A33B 4LQRA 2VTXJ 4XBLA 1LOBA 1PVXA 1G8WA 1R092 3Q8BA 3GZTB 4YW5A 4YW6A 5AFBA 3A0NA 5A6YA 4N53B 2VPVA 1RHI3 3OPZA 2A5ZA 4J25A 1W04A 5C4WB 3KVAA 1V9U2 1MR5A 5L9BA 5A3PA 5EP9A 1RUG3 4D6QA 4BQYA 2GC3A 1CESA 5FLJA 3MPBA 4K20A 2Y0IA 2Y64A 3T2QA 5B2GB 2WZ8A 2B4KA 4XACA 1HW5A 4XJWA 2A73B 4W6WA 2E6VA 2QDNA 3JU9A 3I4IA 2R7EB 1XNKA 4KH9A 5FZFA 5C3QA 2GMMA 2JD9A 1D7PM 4LBLA 5T5JA 1HJFA 1LHVA 2VBBA 5A3MA 5F3GA 1RJ8A 4LO8A 4K8RB 1PMIA 3NAPB 1XU2A 1PO13 3M3CA 4IEOA 1U5ZA 1X8MA 3HNMA 2H6BA 2VCAA 5IVCA 1VBC3 5GZDA 4CDXB 2BBAA 2DUQA 5L7OB 3LDRA 1ZRIA 1RC6A 4M0NA 2GNDA 3EYPA 4KBBA 4B1MA 2OQ6A 3MI8A 3TRSB 4FPCA 3O1PA 2WA4A 2R042 1PVC2 1LGBA 1NLQA 4AI2A 4QPIC 5F3CA 4K21A 2NQYA 2BRTA 3J26N 3O0VA 2B39A 2VNGA 1XJAA 2J1SA 1UYZA 4CDUB 3NNLA 4XDOA 1H8VA 3KT1A 1MS8A 4PF1A 2BP6A 3VBRC 3VBFB 4GD4A 1DZQA 1AR81 4WM8B 3G6JB 4P9WA 5KBFA 2BWCA 3NRUA 2QQVA 1YQ6A 2HWB1 3HMYA 4AAXA 1W6QA 4Q4Y2 2R6QA 4YGEA 3RMXA 3ACFA 2B8MA 3GALA 3AMMA 4Q4V3 4XE9A 2XR4A 1BVP1 2GH2A 2R0FA 1WD3A 2R0HA 3PDQA 4IV1B 1QJX3 4K6BA 4PLMA 3DYOA 4FOWA 1AJKA 2HWF1 5I0UA 1OHFA 4QXBA 5KHKA 3V0BB 3LWCA 3NNJA 3LDKA 4YGBA 3MEPA 4IGOA 3WVJA 4AEMA 1W0OA 4R9CA 3VBOA 1QXRA 2QZ2A 1BQPA 1QH6A 3UV9A 5FOBB 2D44A 3USSA 3AP7A 3TN93 4FSJA 4QX3A 5DZFA 1N3QA 1R1A3 4IEQA 4A42A 4B7EA 4QX0A 2OT7A 1Q5OA 2RR11 3WP4A 1ZZ7A 3AMQA 1L3JA 2A6ZA 4BMBA 3CL1A 4HXCA 1CQ9A 4M3CF 5CIRA 1YJLA 2QDRA 1O4TA 3D6EA 3ZXFA 1RUH3 1QEXA 4YG6A 3WW1A 2Q8DA 5FZKA 2UYAA 4INDA 4Y1UA 1G86A 1WLCA 3OSDA 5C70A 5DN2A 5CADA 3MW4A 4ATEA 5HCBA 5I8SA 1W9WA 2VUDA 3WG3A 1KQRA 2VQ0A 3VB9A 4XF3A 5BNNB 3SXWA 3N9LA 2JEMA 2BOIA 3O1UA 2GN7A 2GU9A 1YFWA 1OOPC 1W8FA 1CPMA 2ZHKA 5DQ0A 5CB7A 2D43A 4XCBA 3CZUA 4QU1A 3ZFGB 1SEFA 2ZZQA 1DHKB 3PNAA 4FXKB 1A8DA 4CYDA 4IEWA 2RMU1 2ENRA 2ADDA 5CG8A 4GMP3 4JDMA 2HWD2 3OUIA 3T4HB 2R062 4Z8BA 4COVA 3POSA 4M4RA 1MZFA 3BYWA 5JSRA 3RZGA 4LMFA 1CAVB 4AI0A 4ZU7A 2ZPXA 5FZOA 4XILA 4IGQA 1OKQA 5IK7A 4DNYA 3LDBA 3LEGA 2PHFA 2YC2A 4V2VA 3OPTA 3ELNA 1YHFA 4CDQC 2DV9A 4MZUA 1UX7A 2R061 2VAUA 4IL7A 2E9QA 3N9NA 4DINB 5BYNA 2WRAA 1O3TA 2VMCA 3FZ3A 2ZX1A 4ZU5A 2KD7A 2ZGLA 3H8XA 3I97A 1WBLA 4MGIE 2HH9A 4XOGA 5FY8A 1NY72 3H3LA 2XUMA 1JZ3A 2JWPA 4RGKA 2WSVA 5JMCA 1WCSA 3MPPG 4RSUA 1H1AA 4ONUA 1QJU3 2Z5WA 3HT1A 2Y60A 1YIPA 3ZPYA 4C0BA 5ABJB 2VBPA 3T0BA 4FFFA 1NQDA 2WN3A 2PHRA 3EO6A 3BIEA 1PM7A 4AGRA 1VMJA 1W8HA 2WNVC 5JXHA 4W6YA 5E6HA 2WZR3 4BQWA 3T08A 3T2OA 1DGWA 4QT6A 3RPQA 1VMFA 2AREA 3TOJA 3X29B 1LNSA 4LO4B 4RS5B 4XMIA 1OC1A 5HCFA 1RUD2 3N7MA 4QKFA 3I2OA 2AEYA 1O4ZA 5HI0A 1OI6A 2YUEA 2CY6A 2WYFA 4AGVA 4LBQD 1PX4A 4XIKA 1OSGA 1NZIA 3O0XA 2LM3A 5A3NA 3ZIWA 5FCCA 4HG6B 4N90A 4QXHA 1CGPA 5FR3A 4EROA 2QQWA 1RUD1 2ZX0A 4JQRA 4YWAA 3AYDA 1JU4A 3FL7A 3OCPA 4FP3A 1ND2A 4Y20B 5FREA 5A3WA 3JD72 2JDKA 4EWAA 2YZ4A 4D69A 2BW8A 3BGAA 1REEA 4W6XA 2XHKA 5A7QA 3BI3A 2DUOA 1W0NA 1DQ2A 5KHHA 5G05L 3WP3A 2FCUA 5A1AA 3TBDA 4YSFA 1DP0A 2AUYA 5EYYA 2YBPA 3GJAA 1S0BA 5SV5A 1GWMA 1KFUL 1GYKA 3H1WA 2RS11 1TEIA 3K51A 4XJUA 1ZREA 1WBFA 4H7LA 1H2LA 2W95A 4XUQA 5T5PA 2HJIA 4IETA 5FWEA 3S6PA 1VBE3 4NHYA 4QPIB 2FMYA 2DFBA 3IM0A 4N43B 4CPBD 1JU3A 4JZRA 3B00A 4N9HA 3OB8A 3JBG2 4ZU4A 1MQTC 1PIV3 2VH9A 5DZEA 3IPVB 4YZ2A 4LO7A 3VBRB 3CO2A 4AHYA 3OD4A 1AHSA 1PO23 3PU8A 5CU1A 2QUOA 4NIGA 2BVBA 2W39A 4JRAA 4XURA 5EQUA 1H8TB 1ULDA 3VBSC 1Q56A 3VD7A 5FO9B 2AEZA 3ZXAC 1WD4A 4IXLA 5FMDA 1IG0A 2XJVA 4U2AA 1V6NA 4YGCA 4J1WA 1NG0A 2VW0A 3LQCA 2QQJA 4BXSV 2X8KA 4I0WB 1VMHA 1RHI2 2ORXA 5LK5A 1XPWA 1I5PA 1GR3A 4Z2WA 1JZ4A 3ON7A 3PTRB 5GLZA 4H55A 4A3XA 5BNPC 1UU6A 1QJZA 1RUG2 3BALA 3NJVA 4COYA 1UX6A 2Y8KA 2ZMKA 3AL6A 3ILFA 1H2MA 4CEWC 2OVUA 3APBA 3VZNA 5LA1A 1YI9A 2ZEZA 1WA6X 4S2GA 4JGYC 4AK3A 1XNTA 3GZUC 2W92A 4GKYA 2YGLA 1GKBA 2VVDA 1LOFC 3TNPB 3UGGA 4RQPB 3HBKA 2VQAA 4DXRA 3WNPA 2YFUA 4FTSA 1RXGA 2XVLA 2D3PA 2VZ1A 4HZFA 4E2SA 4GB33 4BQXA 2CDOA 4IE6A 1PO12 1TG7A 1OFNA 3IWZA 3T09A 2QZ3A 2ET7A 2UWCA 1VBC2 4Q0PA 5FUIA 3SEEA 3MW2A 1AYN1 2WNUB 4UOJA 4XF9A 3DGTA 2YC4A 4PQ9A 3KV9A 3CKHA 2ZGTA 1TMF3 2NMNA 2WN2A 3PL0A 1JZ6A 3O1OA 4A41A 2Q1FA 3IDEA 4K7JA 3EB7A 5D21A 1CN1A 5BNOA 2RE9A 3WY6A 5A7SA 3PMSA 3V64A 3VD4A 2BGCA 1OOPB 3D0JA 4LO6B 2XL9A 2W08A 4HN1A 1YRZA 4RHV3 5FZIA 2Q8OA 2OX0A 2PHXA 3VBUA 3HAGA 3WEZA 3RJ2X 1H4GA 4NOTA 5F6KA 5L36A 3KQRA 1VRH3 1W9FA 3K3OA 3C7HA 4W8JA 5JOZA 4Q4W1 2R073 2DCYA 2VZPA 3PIGA 1MS0A 5JPMB 2IXKA 1VBA1 2VU9A 4YG0A 1OLME 5GM0A 1KITA 1J58A 2MNGA 2TNFA 4H7MA 3ENRA 4NPRA 4YPJA 3AYCA 2ZEYA 2W46A 1IKQA 4KU8A 4E4ZA 4AVSA 1SLLA 5K0UC 5DAXA 4Q4V2 1MZEA 4COZA 5K9YA 4XXPA 3KGZA 3RFRA 3TEYA 1HKDA 1HDKA 1QJX2 4D0QA 3MHZA 1HRI3 1UOFA 1IQAA 2PAEA 2R1BA 2E7AA 4Z2AA 1E5SA 1BLZA 2ZABA 5DAVA 2XJTA 5FZMA 2DWRA 1HB3A 1ULFA 2DVAA 1V6KA 1KEXA 3TN92 1OQ1A 1R1A2 3OY8A 4HT1T 3THDA 2J1UA 3WQ1A 2W1QA 3QBQA 4XFAA 1S55A 1D0GA 4QB6A 3KF3A 3PJQA 3ZSLA 1XNCA 3FFQA 2KXLA 3LPGA 2CNAA 3MICA 3F95A 4KGQA 1OUSA 1RUH2 1CAWA 4YZ4A 4DB5A 1XU1A 1JODA 2BU9A 3MZHA 2EALA 4HVOA 4L9BA 1PGW1 3FHIB 3JZVA 4YW3A 4ES9A 3ZLIA 4CCEA 5JOXA 2FQPA 3RGBA 1F2NA 3LFMA 4XF0A 4HSLA 4YVWA 3WDTA 1JYTA 3ETQA 3KM5A 1UNBA 3AXDA 5I8YA 1AX1A 5JSPA 1IHMA 4CCOA 1YC61 4KG8A 3VZKA 4RFRB 1TZOA 4LHLA 2WAAA 4XQ4A 4R9AA 4WVZA 4FVVA 5EYXA 2Z4FA 5C8CB 2VVEA 4X8PA 4AHZA 5F2SA 5KHIA 5FLIA 4H3WA 2BTVC 4XJZA 2VZOA 5FYUA 4XJ9A 3GBWA 1B35A 4PIZA 1DG6A 4XPVA 1UYXA 1GZCA 2JIJA 3CJXA 4NAOA 3THTA 4FCAA 1SHWB 1OA3A 1H6XA 1UU4A 2WQ8A 4PBPA 4Y5Z0 3C2UA 1OURA 4XVHA 4A7YA 1CVNA 1AX0A 2E31A 1I3HA 1YEWA 2KA3A 3ZN6A 1KDMA 1J1LA 2B46X 2JXAA 1ULGA 4S2DA 1WMXA 2WQZC 2GC1A 1JUIA 2IFRA 3D82A 3V56A 4HKLA 5EJ1B 3UT0A 4KWKA 4C91A 4GJZA 4NVPA 2WYSA 4HL0A 1W8TA 4GMP1 3RYPA 3WDWA 1K5MA 3WF2A 3CHXA 4P08A 5KHGA 2XWJB 3WCRA 3I2DA 2AYHA 4MHUA 5DAWA 3ZYBA 3UKNA 4MYEA 5A80A 1MQTB 2WINB 2TBVA 4EWEA 2O14A 1W6PA 3VGIA 4OFGA 4HVQA 2VW2A 3PVBB 2HWB3 4IV3A 5KC5A 5LEJA 2FZ2A 3BTAA 4WM7A 1QJU2 3EXUA 1S0EA 4JV4A 4M01A 4IEZA 2ZHLA 3SCGA 2DBIA 2A6WA 4UT5A 2BNOA 2O8OA 5FZBA 5FOJB 1W3VA 2ZKLA 1XNAA 1U0AA 4NHKA 3I3BA 2HWF3 5H9RA 2WZR2 2XB6C 5J98B 4BK4A 5LASA 3I2KA 2JG8A 4PJYA 1BEV2 3POJA 1NA1B 3J7MA 1RMU1 4JX0A 3ZX7A 3FUOA 1XYNA 4AZZA 2PHDA 2R16A 4FT8A 5BNPB 5JWPA 4NHLA 2GC2A 5IVVA 1NLSA 3GHMA 5T55A 2RS51 2RR13 5FYVA 4CZSA 5C3PA 1H2KA 5GKAC 1O3QA 2WZR1 2ZGQA 3O0WA 5K0UB 5HCAA 1ZM1A 1XBFA 4CCNA 4DS0A 1O8PA 2P4EA 2Y6FA 2J1VA 4PBOA 3GBGA 3OGSA 3W21A 1VIWB 3D0SA 3ZR6A 1HV1A 3NJZA 4D7YA 3VDBA 4BMEA 4GJYA 2C1FA 2VR4A 1A34A 1YQ5A 1F15A 1W2OA 1XE7A 4QXCA 4MSVA 4COWA 1H9PA 3HQUA 3W5NA 1ZA4A 1IPSA 3WXPA 2D3RA 4LNVA 3GF6A 4ORFA 1HIXA 1QJFA 1R64A 1LU1A 1IKPA 3M2MA 1JHNA 3BU0A 1W6OB 3NNFA 4COUA 3FWEA 1W03A 1SBEA 5FP7A 4YYOA 2YHJA 4LBQA 1QNWA 1JZ2A 3B69A 4JCKA 3LSEA 1C1LA 5JI9A 4M3CA 2BYVE 5A6XA 2CAVA 2JDZA 2P2KA 1VBE2 4CDWA 2YPDA 1OBNA 3WINE 5LW9A 3KHBA 5DUWA 1W39A 5KXDA 4W65A 2RMU3 1PIV2 2B9VA 4JKMA 4IEPA 1LGCA 1C5IA 1JHJA 1VR3A 2D97A 1DLCA 2N7GA 2NN8A 3VDDB 4D94A 1SBDA 4ZY9A 5E1RA 1PO22 2ZGSA 3ILRA 1RIRA 2IXLA 3RG0A 1SLTA 1L7LA 1ND3A 2BDRA 3UGFA 1LOEA 1XSRA 1KDKA 1PM4A 4LE4A 5JIUA 1FNZA 3M3IA 4DPNA 1PZ8A 1PMJX 1UIKA 2V09A 1UD1A 2K9ZA 3MUY1 4QHZA 1REDA 1S2BA 5LB6A 2J22A 4DXTA 3BTXA 1FPN1 1WCUA 4UAPA 4S2HA 1UKRA 1Y9MA 2VXRA 3FUQA 4HKOA 4I0BA 3MIGA 5CFCC 2BBVA 1GQGA 1DCSA 4C8DA 4L11A 4OHZA 4CPBA 4AEDC 2H0VA 2Z42A 2ZGRA 3SC7X 5M0TA 2B45X 3ZO0B 5LZ6A 1ENRA 2GSYA 3MF6A 4H2AA 2CWSA 4L8QA 4XDQA 5EZWA 1HQLA 1NZCA 2R32A 3KS7A 3VDCA 5DG2A 3LOIA 4C1WA 4E8CA 2P3KA 2W1UA 1IS5A 3K4ZA 5T54A 5IHRA 1W6MA 3ES4A 1LECA 2WO2A 3KT7A 3GZEA 3WSOA 1JYVA 1JH5A 2A71A 2XJRA 2AR6A 3KF5A 4GB32 3U14A 2XJPA 2PLV2 3AKRA 1N3OA 2FZ1A 1L7RA 4H14A 2X05A 4B8EA 5FZ1A 4KG0A 4U36A 3MV01 3W20A 3IZOA 1UY4A 1IZ3A 3ZFFA 1TMF2 1OQDA 3FE5A 5FPAA 5JXJA 1OT5A 3AJZA 1W05A 5FMCA 5DXDA 4XBNA 3T0DA 5A1FA 1GV9A 5F37A 4XHBA 1QGLA 4DMIA 3E1F1 4LEJA 4IQPA 4QQ2A 3W9AA 1A8MA 1ZBA3 2W2IA 4PI0A 4GIQA 4RHV2 5FPZA 5FRAA 2D6PA 2ILMA 3K4AA 4FOVA 3SKVA 1VRH2 4WVWA 4W4ZA 4CU6A 3E5QA 4YZ5A 2J7MA 4Y22A 4BCUA 4DEVA 1OXCA 4XETA 3S7EA 4XYXA 1RUJ3 3GGLA 5C9AB 2EVXA 1H2NA 2X29A 3IT8A 1QOOA 5JCTA 1FAYA 2Y6KA 2Y6HA 4FP2A 5F7UA 2WJSA 1EUUA 2DU0A 1PMHX 3NNMA 1QF3A 3U78A 5A3TA 5HV0A 4XFIA 1VRH1 4LBJA 4GH4C 4X6QB 1F4AA 2JB4A 2R071 2RVAA 2QVSB 2VUJA 1YUDA 1HRI2 4PLOA 4ITCA 4P9LA 3L2HA 2P3YA 2CL2A 2EXKA 3FHQA 4CXWA 3ACIA 1XB9A 3ZFEB 3S30A 4MX3A 4QPGB 3LA2A 4EWDA 3CDZB 4LBOA 4RGAA 2JDMA 4FO9A 2C5DA 3A7QA 1ODNA 4GAZA 4RD7A 3BODA 4AFBA 1RB8G 5FZ8A 3POWA 2MHFA 4CP2A 4CCJA 4XC9A 4TTGA 3M3OA 2QQUA 3SQOA 3R4DB 1NX9A 2XXZA 3OEAA 5CKNA 3MLLA 2G19A 2F4PA 4ATFA 4Z92B 1VRBA 3C7EA 4IEUA 2EIEA 4O9EA 5A7PA 4CEYA 4CCMA 1JN2P 4RA0A 4N7IA 4DUVA 1OPMA 3IDCB 3OTFA 4XTMA 5LWBA 1UMIA 4HBNA 4Q29A 1KD7A 5EFUA 4YW2A 4G9SB 2Y6JA 4GA9A 3ZN4A 2FMDA 1YJKA 3AZXA 4RR3A 4HPKA 2HBUA 3AKSA 1NUKA 5K7PA 4NIDA 1Y9QA 2PAMA 2VCMA 2X5IA 2CAUA 2WNEA 3BCWA 5FZ6A 3RQ0A 4ZXEA 1UY1A 3LF7A 4LLOA 3ZYHA 5J7MA 5JZGC 3LPFA 3NNGA 2XLAA 3J9SA 2XKPA 1FMD1 2ZZJA 4BXFA 2E33A 1RUC1 4N8MA 4Y33A 3WHUA 5JOWA 4LKDA 4QX8A 2Y26A 4XJ8A 1AYN3 1E5IA 1U5YA 5KXBA 2CU5A 1ONAA 1JYCA 4L97A 3ACLA 3ZOIA 4YG3A 3VL9A 1O8SA 3B3QE 3B93A 1C8M1 3ZPOA 2BJSA 4YGDA 3CJIB 4AWDA 4EE2A 4F7ZA 3RDIA 5FKCA 4OQ9A 2XJUA 4CP0A 3V0AB 1IS6A 2ZS6B 4PDWA 3RJRA 4XIOA 2GNBA 2IXCA 3LD8A 4FFIA 1GOFA 5C8WA 1X9PA 3DPRC 1WLTA 4JAAA 3JB8A 1V0AA 5FYHA 4Q4W3 3T4VA 1CAXA 1AR82 3USUB 2OW4A 1VBA3 3NL1A 3CNAA 4LIUA 2OA2A 1COV1 3UNPA 1UW8A 3PMEA 1CJDA 2XUEA 4M0HA 4UF0A 1VBB1 2VZRA 4KWJA 5IVYA 4ASLA 2J1AA 4YVSA 5CZKA 2HWB2 2ZGOA 3B7MA 2DVBA 2HWE3 1WLWA 4XFBA 4OI1A 2WBKA 2XBO1 5A32A 5KR7A 3AXEA 3GZAA 1M06G 4HKWA 4LR4A 3CEWA 1B35C 4HK8A 2GP3A 3OOXA 5EV7A 3DKWA 4XEZA 1MS4A 3SCFA 1URXA 2HWF2 1IPKA 4HK9A 4MOAA 4V2WA 2WT2A 4CUBA 4UI9L 1J83A 1WUVA 2NPIA 3AKQA 4QM9A 4BOWA 4DXSA 5CFCB 2ZMNA 3M3EA 2ES3A 5CFDA 4FAHA 4AEDB 1UL9A 2PXJA 3WG4A 4EZHA 3EQEA 5KHJA 1V6IA 5FV3A 4ZKTB 2RR12 1OA4A 1K5MC 2ZACA 1QJY1 1MPXA 3E5UA 3KZ4C 4J6GA 3ZYFA 1CIYA 1QQP1 5FUPA 4AL9A 5F8PA 4AR2A 4Y1YA 2JKXA 5J48A 3O5SA 4O9GA 1W3XA 1SPPA 4DXZA 4KU7A 3RYRA 2P3IA 2XLFA 3UYJA 5FPBA 2CGNA 1N1TA 1WCKA 2Y33A 3B94A 1ZYBA 3H3UA 4IV3C 2LALA 1PGL1 3P3NA 4Q4X1 4WM7C 4AFMA 2EIDA 1ENSA 3D5OA 4MXWB 5L9RA 2QCSB 2BQPA 1GNHA 4QB2A 1GZWA 5DUXA 3VL8A 5D8AA 2RJ2A 4LPLA 3KT4A 4BQ2A 5B4NA 2WUHA 5J36A 3BN6A 1CX1A 3EBRA 1OD5A 1W9YA 2VZVA 2XWBB 1JOJA 2JICA 1H30A 2UWAA 2LW8A 5FYIA 4AXOA 4YM3A 2WC2A 1Q8OA 1W9SA 2DDUA 3ETPA 2BUKA 2RMU2 3OD0A 4FFHA 3O7OA 2R30A 3JQXA 1UU5A 4LXLA 3LIHA 2ZGKA 3INAA 4UW6A 4WVMB 3SCHA 4E4SA 1K42A 3U0ZA 5FP3A 3I3MA 2C9KA 1IOAA 4AQTA 1PK6C 2D93A 3SHRA 1W0PA 2G9FA 4BQ4A 2NZ9A 5FXZA 1IGOA 1NCQA 5CVRA 3VBHA 3FHAA 3IN9A 4LUMA 5LBFA 5AC91 5FO7B 5I93A 4GH4B 2WWJA 4YZ3A 2RJKA 2TUNA 2AZ5A 4AI1A 1W8WA 5IK5A 3ACHA 1N47A 2I07B 3HNYM 2QE3A 4IESA 3OYWB 4PCRA 5BNQA 1PZ9A 2W5FA 3AYAA 4GZ9A 1CWPA 1AYM3 1S2KA 2VOWA 2FBEA 1RUI1 2E53A 2IUWA 4UFIA 4CDWC 5BY5A 2WFF3 4K40A 5FZHA 4BE3A 5C3RA 1J59A 1RUOA 3O1VA 5FPUA 5T52A 3IMMA 2XG3A 4R4ZA 1NCRA 5G04L 4OUMA 2DTYA 4Y5SA 5LBCA 3TEZA 2WO1A 4CP9A 4AF9A 4C90A 3KLSA 1W90A 5L9VA 4YW1A 2RHPA 1JYNA 3K48A 3HT2A 1RMU3 3C7FA 5A33A 3D4KA 2E63A 2YYOA 1WGPA 1I6XA 2C4XA 3KCXA 2EXIA 4N53A 1PHMA 1UY2A 2RS53 2W52A 4IE0A 4B4PA 5C4WA 4IDZA 3GNEA 3K4DA 4BK5A 1ULPA 1UQXA 4QMAA 2QQNA 1E57A 1D4M1 4QWNA 1YYNA 1UZWA 3O14A 3ZN5A 4OHXA 1KFXL 1MEC1 2WLQA 3MV11 5BUVA 1AJOA 2HEYF 1IG3A 1XQNA 1YQ2A 5JZGB 2ZXQA 3T0AA 5CEHA 1DBNA 1QDOA 3WNMA 3VLBB 3WHTA 1E5RA 4K8FA 4RL7A 4JGZC 4CA9A 1J3RA 1GOHA 2Q4SA 1POV0 5IVEA 1JUHA 3N9PA 1UF2C 5FKBA 1FV3A 1JMUB 4XTPA 1SLBA 3HPNA 3ZXGA 1S0DA 2VZSA 1JTZX 1I9RA 4I01A 2RS12 3CU7A 3NAPA 1ZBA1 2IZWA 2PFWA 4QXKA 2YFZA 2JDAA 1LU2A 2JG9C 3AZYA 1DYOA 2H6CA 4RGGA 1SZBA 2IC1A 5C71A 4CDXA 1J84A 1LGNA 5L7OA 4Q26A 1T6BX 1LESA 3KHCA 1X50A 3IIIA 3BUCA 1RUJ1 3MW3A 5LEKA 1TVGA 1H6YA 2F6BA 1S4CA 3DPRB 4LUKA 3ZFFC 5I0RA 3ZMOA 1K3IA 4META 4QX1A 5IAVA 1X7NA 4EN8B 1K12A 5C7GA 2E7QA 2IFWA 3NKGA 2MEV1 4CDUA 1AVBA 3UKTA 1YLLA 5I0TA 3VBFA 2ID4A 3D8CA 3AP9A 4MLOA 3HQRA 1JZ8A 4WM8A 4URAA 1NLRA 1OLMA 1YIFA 5CKQA 1MZ6A 1FPN3 3CQOA 2XJSA 1F9KA 1LAJA 4EJRA 3HIFA 5D1IA 2VNRA 1W2AX 5IT6A 4QDSA 5BXXA 1DYPA 4UFJA 5ERLA 4P02B 1GP4A 3CMGA 5ANQA 4BJ0A 2D98A 4XCAA 3RSJA 1ZNPA 3CIHA 3DL3A 1Q8SA 3IB3A 4IV1A 2PHUA 4FPOB 4P14A 3W59A 1JOPA 3V0BA 2VZQA 3NW4A 4IEVA 4FPFA 1AL21 4IE5A 5IAXA 3PUIA 1UOBA 5FMBA 4ISQA 1UOGA 2ZTNA 1LENA 1DLLA 3CBNA 2YGMA 3PUHA 5GZFA 1YI7A 4GQ7A 5LRSA 4PHZA 3R05A 1F35A 2VUCA 1RINA 4JHTA 2VD7A 5EJ3A 3WF1A 4Q2FA 1CZTA 3S0MA 3NV4A 4FTEA 1NKGA 2V4AA 1JYIA 3NWKA 2FDJA 1AXYA 5GLTA 4GALA 3POFA 2V5YA 1ZZ6A 1AYN2 3ZIXA 1WW7A 2VMDA 3N7JA 1DGRN 2GAUA 4P9JA 4XHXA 4DQAA 4LA2A 4P9YA 5DAPA 5KC6A 4JDOA 2QQKA 1EV11 5FBZA 5IVFA 1AXKA 2ARCA 2HEVF 3WR0A 1I1EA 1F5JA 1CZSA 4CU9A 3WT3A 4QPWA 4EV0A 1Z0HA 2JDUA 3MLJA 2RG4A 3AB0A 3IIAA 2ZGPA 1QY4A 4LHNA 5BNNA 1KS4A 1RXFA 4NHMA 2LRPA 4Q4W2 3N35A 4OULA 4RR3C 1VBA2 3I7DA 1S1AA 2WT1A 3LEKA 3J7HA 1US3A 5FZ3A 4Q0UA 3DN7A 3OGVA 5FK7A 3ZFGA 3U1XA 3PVEA 1TNRA 3BPZA 2A6VA 1V6JA 2B5HA 2HWE2 1V00A 1YO8A 3R6SA 1PK6B 4BZ4A 3T3YA 3I59B 1WMFA 1W8ZA 4A7KA 2YXSA 2OS2A 1KRIA 1Q8QA 5I0DA 3VV1A 5J3UA 2WS91 5JMOA 2QBXA 3QD6A 4NIIA 1CAVA 3ZXJA 1DZRA 2FDKA 1SLCA 3KD4A 1FOD1 4PQQA 4OUSA 4FBFA 1WW5A 2HWE1 4TXWA 2YMZA 5J37A 2CGPA 1W6NB 3WDVA 4OUEA 3K2OA 4HVRA 2WNOA 1GMMA 5A7WB 2IXHA 3LA7A 5F3EA 4CDQB 2ZGNA 3H1YA 1R083 2BWAA 4KL1A 4F8AA 1LEMA 4P5YA 3H0OA 5CNAA 4R4XA 4P5HA 1ACCA 1W8OA 1YCIA 4OHYA 1GU3A 1SMVA 2H0BA 4MH0E 4MGYE 4UYBA 2WR9A 5ABJA 5FZ9A 4F83A 1BBT3 3A21A 1PGW2 4FOYA 4BM8A 3H50A 4Q1RA 5FQ0B 3D3AA 3RYKA 4BU2A 1ULCA 1BMV2 1CAUB 4HFSA 5IFPA 5FZ7A 4AQ2A 5A1LA 2P6HA 1EUTA 3LEIA 4RS5A 3ST7A 2WNVB 5FTTC 4E9KA 3IKWA 1OF3A 1Y4WA 4OZXA 3A4UA 1K5JA 5FZAA 4DY5A 2BNNA 5GZCA 1XNBA 2VQTA 2ZAHA 1C3HA 1JYWA 4TLGA 5CFDC 4I02A 4AYUA 1FMD3 3W58A 2C0ZA 1RUC3 4KMQA 5FY9A 2W87A 1N1SA 4L99A 5IVBA 1BMV1 3NO8A 1DU3D 4ISRA 3RS6A 5GZGA 3PTYA 3JQWA 1ASJ1 4TWTA 4CCDA 4XQDA 3S5QA 1LODA 2A6XA 4XBQA 4JGZB 4Y20A 4N9IA 2I74A 3LFIA 3VD5A 2ZJCA 4Z82A 1C8M3 4P00B 4YW4A 3VBOC 4IEXA 1N3PA 1UY3A 5FMOS 3NQHA 3OBTA 3I2GA 1XE0A 4JTOA 5FY0A 2ETEA 3RZZA 1LOAA 2QFEA 4Q1PA 1ZRDA 5FYCA 1FT9A 4QU2A 4CUAA 2JG9B 3UJQA 1UAIA 5GLVA 5A3OA 3SH5A 4FQZA 1D2QA 1GQPA 5D8AC 2V5DA 5FZDA 1HXS1 4NR1A 1QMJA 3U4SA 2WQ4A 1COV3 3ZXLA 4MGKE 5JDBA 3QCWA 2YB7A 1VBB3 2XMLA 1QKQA 3H42B 1GOGA 4QPIA 5T50A 2J1TA 1ZZCA 2XL7A 4N43A 4RFT0 3R4UA 2WFF2 5C33A 2XBO3 2B42B 3KWVA 3LIGA 1AF9A 2Q0AA 3IPVA 3WUDA 2ZGUA 3QH6A 1EPZA 4NROA 3VBRA 4JKLA 5JI7A 1S0JA 4L92A 5FY4A 3WQBA 4XUNA 1GUIA 5K8SA 1AYM1 3TEXA 1DF0A 1H8TA 2K0GA 2AACA 5LBEA 4ZZ8A 5IK8A 1NAEA 4MV2A 4PT6A 4JKKA 1RMU2 2WFF1 4IW3A 4QQHA 4N7UA 5F6LB 4B29A 1G9BA 3LB9A 4NPLA 1CX4A 1WCDJ 3I3EA 3VBSB 2B9UA 2RS52 2HWC1 2QTWB 5J96B 1QJY3 3HNBM 2YBSA 1QQP3 4JHZA 5DZGA 1UZ0A 3PVNA 1XYOA 5LA9A 4C0HA 2Q1MA 4EN0A 1QJEA 1UXZA 1AX2A 3POGA 1SDDB 2WA3A 1GWKA 3IAQA 1G9FA 1GICA 3PUQA 3GYDA 1I5ZA 2WWUA 4Q4X3 3J8F1 1TNFA 5F5AA 3BOPA 1BK0A 4AOCA 2JJ6A 4Q8KA 5IWFA 2LUWA 1ENQA 5GJ6A 4CEWB 1EYBA 4UFMA 4RQPA 1LTEA 3WP6A 4TYSA 4JGYB 4EQVA 4QD2A 2WL1A 3J4UH 4GWMA 1FX5A 5FUNA 2O0OA 1W8UA 3PU3A 1ST8A 4ZS3A 2OUHA 1HJGA 3AK0A 4CU8A 3S5AA 3UL2A 3AKTA 2EIBA 4NHXA 4AI3A 3HVDA 2WNUA 5F2WA 1JYXA 1AR73 5JIAA 4LBNA 2ZHMA 4HLTA 5JAXA 4AE2A 4J1XA 3DXTA 2WDBA 4KI5M 1DQ4A 3R4SA 1QH7A 2WSUA 2A7AA 1JS9A 5FZCA 1UOJA 3WF3A 2BV4A 2A70A 2ZBJA 1OOPA 3QACA 3ITQA 1HB4A 1QWRA 5EPAA 5BV6A 5LATA 4ZONA 3Q8FA 1JZ5A 1VAMA 2ZEXA 1MS9A 2VCCA 1UKGA 4BH9A 4ZZ5A 5FO8B 5FZLA 5FPLA 1C4RA 4IGPA 4D6RA 5AC93 3WZ1A 1DDLA 1FPN2 3ZVXA 2ZHNA 4FI9A 1QXPA 2XPJA 4FPEA 5K4LA 4O61A 3LOBA 4FPGA 2AH2A 5LY1A 2W1WA 3HEIA 3NAPC 3H8RA 5ISLA 1ND2C 2XH6A 1AR61 1EAH1 3AMPA 4FPKA 1RUI3 3WG1A 1XE8A 3MIBA 3AMNA 4CDXC 3RMYA 1O3RA 1APNA 4A44A 2E51A 4QAWA 1GLHA 2ZGMA 2MPFA 3FJSA 4MG2A 4M4PA 1W2TA 4OCTA 3RVHA 5H9QA 3GJBA 3OGJA 1RUNA 2E7TA 3AVSA 1AR91 4AVBA 2JDYA 4TSVA 4PLNA 4BDVB 4DRRA 4I09A 1VAVA 2ARAA 4BYYA 4CCLA 1UMHA 4UXAA 1GANA 2PQSA 5FIXA 4CDUC 1GWLA 2AGSA 3VBFC 4MGQA 5A7NA 3OPWA 3ZSJA 5FDBA 4DUWA 4WM8C 1SLIA 2WO7A 1MACA 2IVIB 1FXZA 2HWD3 2VOTA 3LE0A 2BVVA 2XGXA 3FLTA 2VW1A 3N4MA 5L73A 2DCJA 1PNFA 2FCTA 1D4M3 1TQ5A 2D6OX 1BHGA 1ULOA 3IDBB 5A3LA 5I91A 5JOYA 1MEC3 2GZWA 3QLQA 1Y7BA 4L2NA 2JE9A 5H9PA 2Z69A 3NJXA 2WABA 3AP6A 1O4YA 1W6QB 1XRUA 4IV1C 4JVAA 5E16A 4MGZE 3E5XA 1Z7S1 4AEJA 5FY1A 2V4VA 3T2PA 1U5IA 3LA3A 5C8CA 3N3HA 3DYMA 5D2AA 5FAXA 1LCLA 2F17A 1VP6A 2DUPA 3OBRA 1UMZA 4UW4A 5FYSA 3VBOB 2XVGA 3KMHA 2OKXA 4CUGA 2DVGA 1G9DA 5ACA3 3LCPA 2R072 3OG2A 5FXVA 2PHLA 3ZM8A 4XFFA 1O5UA 4Q5OA 4LKEA 3EJKA 5CBLA 3OJBA 2D6LX 1YFUA 3ECQA 1T2XA 2I45A 3MYXA 4M00A 1O6UA 4RYDA 2PN5A 3S7IA 3H1MA 2NP0A 4YM1A 2MEV3 3ZYPA 4ES8A 5DG1A 3AL5A 4DO0A 1MQTA 5BNNC 4K9SA 4A45A 4QX5A 3B02A 4A3ZA 4DFSA 2ADEA 3K75B 5C3SA 4Q27A 2OXBA 2D7FA 2BOJA 2EIGA 4Y1XA 5FXXA 1T6GC 5FY7A 5BNOC 3MIHA 4BQ5A 3POBA 3T2TA 1BBT2 1F4HA 3JD73 3IAPA 2OZJA 3FBMA 4LE3A 3VBUC 1R081 2VE1A 3BKZA 5FYZA 3SKJE 2QKDA 4DZGA 1F31A 3U11A 5JXGA 1AL23 1GNZA 4QGLA 5KXCA 1RVF1 5GZEA 4Y4RA 1O5LA 5FPVA 1NA1A 2WWSA 3ZMNA 2QQPA 5DDJ1 1D0HA 1JXNA 1OQEA 1WMDA 5EJZB 5BNPA 1BBT1 3KV6A 5CAZA 1N1VA 2XDVA 3TNQA 3HWJA 4LK7A 3R0RA 4CP1A 5FZOB 1FMD2 5SV8A 1RUC2 2P3JA 4E8DA 1Y9GA 4D6SA 5T5OA 1ZRCA 1CJPA 2RM21 1WLDA 5CA6A 3WV6A 1VAKA 5EHDA 1PZ7A 2GH8A 2Q8EA 3DCQA 1CPNA 1C8M2 4FPHA 4UBHA 4K3UA 4Y5TA 1EV13 1MVEA 2BEOA 2PHTA 1YWKA 4QHBA 3ZR5A 3SH3A 5ABJC 2Y0OA 1J3PA 1LHUA 4LOSA 3LSDA 1BKZA 2IWGB 3ZXEA 5FWJA 3F2ZA 3B5LB 2QNKA 1W6OA 4CCCA 4XQWA 3AJYA 3AZVA 3AP5A 3CF6E 2JENA 1HRV1 3LGRA 4LITA 4RS5C 3HN3A 1COV2 4QX2A 2JDHA 5B4XA 1QOSA 1VBB2 1VBD1 2VNOA 3CZJA 4MHRA 2VECA 4ZS2A 1W99A 2FDHA 4FTBA 2G4IA 3I8TA 2O8QA 1LOGA 3LZZA 2XBO2 1WA4A 4AAPA 3SMHA 4CSWA 3WDXA 4YVWC 4E4DX 1ZRRA 1OF4A 1R091 1Y43B 3VDDA 3RI8A 2UY9A 2WS93 5HXMA 2BFUS 4I0AA 5LA2A 5A6QA 2NM1A 1AL0G 3AYEA 1ZRFA 1FOD3 2SLIA 1V9U1 3NMBA 4QM8A 1H4HA 1LRHA 2CYFA 2O1QA 2V73A 3TYJA 3VUOA 1DYKA 2ARXA 4S2FA 2XQXA 5K0UA 1SFYA 3U07A 1CR7A 4AFDA 1ND2B 1ENXA 2EXHA 2VL4A 3OBZA 4GWJA 3DF0A 4IE7A 1UY0A 4XFCA 4C1XA 2D5HA 3PJYA 3T1MA 1C28A 1QJY2 3BVCA 4CXYA 1EPWA 1QQP2 1L7QA 2YDEA 2BERA 2PHWA 1U5XA 3GCXA 1GZTA 4AI8A 1YQCA 2W68A 1PGSA 2VNVA 2UU8A 4LO5B 4BIFA 3MO4A 3U4XA 2JKBA 3FN9A 2JE8A 1POV3 1SCRA 2D6MA 3A22A 4HN0A 3ZKUA 4N43C 2XJQA 3KV4A 4Q4X2 1PGL2 3VKFC 5A70A 2EAKA 4OQ8A 2CTVA 2DCTA 4R9BA 4LT5A 3THPA 4CRQA 3ZYJB 2E32A 3MDPA 1AXZA 1RTVA 1SFPA 2PYTA 2WT0A 4LBMA 2R041 3AFGA 4FFGA 2ZX4A 2CV6A 1PVC1 3PHMA 3UGHA 3JUUA 3P3PA 3GDBA 1H8TC 3KSCA 3O1SA 1YQ8A 1NXMA 1AR72 3KCYA 1UZVA 2WZPP 4CXXA 3UETA 4QDQA 3RWKX 4YNIA 1ZA7A 5IK4A 1DGRA 1SBFA 4LK6A 1OUXA 4TN7A 1G9AA 2FDGA 1CONA 3Q9OA 4DEQA 2E26A 3H8UA 3ILNA 4MVTA 1ASJ3 5DPNA 1FI2A 3O1RA 2W91A 2R49A 4XJAA 3URFA 5FXWA 4A2UA 2P1BA 3N9MA 3WW3A 2JG8C 4G4FA 2R1DA 3I2IA 4MO3M 1AR71 1SQ4A 3JXSA 2VTXA 3OGRA 4Q4Y1 1WMEA 3V65A 4LKFA 4QQOA 2ZEWA 2VULA 1O59A 1BJQA 2W3JA 1BVVA 4AG4A 1OKOA 2VVFA 4XAEA 5C9AA 1K45A 1GP6A 1UYYA 1RGSA 2ZA9A 4XAAA 5AC92 4I2OA 2QQMA 1HN1A 2ARBA 3EHKA 3NV3A 4RQPC 4XXAA 3M8LA 1LULA 1HXS3 3ZYIB 4DRVA 2Y38A 2NMOA 3SNMA 4P9XA 2DU1A 1WCQA 1V6MA 2RDQA 3H9AA 5IJRA 4JTNA 1ZZBA 2G9GA 3WQ7A 1CZVA 3MIEA 5JPNB 1AUYA 1RUI2 2Q1ZB 1TME3 2OUJA 4ZHNA 5F5QA 2WNUC 4O7XA 1Q43A 3WCSA 3WOGA 5EWSA 1MVQA 2Z79A 1FATA 4LKSA 4EN7B 5C5UA 3ZFEA 4R52A 4ZXKA 4FPYA 5LK7B 2HEWF 4QPGA 2XVKA 4KWUA 3HD8B 4AI9A 1W2UA 1YFYA 2GNMA 2FDIA 2WFPA 5I0SA 2VQUA 2WIIB 5KWRA 2A3XA 2QQLA 4ASMB 1BYHA 5BNOB 3BU7A 4HOOA 4D3WA 1X36A 2K2SA 4LLFA 4WV8A 1MS1A 3WNNA 4B4QA 3VBUB 4CE8A 2HWC3 3AVRA 5JUVA 3GM8A 1SG3A 5IUQA 4AVCA 2GALA 2VOVA 3VD9A 1D4M2 2VZTA 3VHNA 4UBGA 4XUOA 3N9QA 3VHOA 2DFCA 1MEC2 2YV8A 1ND3C 5FJKA 5E88A 3N36A 4OI4A 5IVJA 4Y1VA 3BB6A 4IERA 3OUJA 3HR9A 3Q8CA 4BLIA 1RUE3 1GP5A 3J8F3 3HN1A 4XFHA 5FYMA 2VMGA 2HWD1 2Q8CA 2NLRA 4JDNA 1D4VB 2DCKA 4Y4YA 3RWNA 1W06A 4IE4A 3U37A 1FNYA 2HYXA 3WF4A 1OMIA 4AHWA 2BFUL 4UW5A 4I3PA 3ORJA 2D3SA 3PUAA 1ZBA2 1C5HA 1PX3A 3LKJA 3VDAA 5A7OA 4E2GA 1S0GA 4CCKA 3TEWA 5CG9A 3MGUA 5ACA2 3RZLA 1X82A 3N7LA 3OY8B 4X8NA 2DF7A 2GC0A 2X10A 5F5IA 1GSLA 1RUJ2 4A6SA 3SEPA 2CGOA 2GMEA 5FJHA 2CHHA 5FZ0A 4XZUG 4YLZA 2DVDA 3CJIA 4R9DA 1NY71 3WP5A 5FP4A 3POYA 4LOTA 2FCVA 3VKLA 2Y6LA 4UWDA 4X6RB 3V0AA 2VO5A 1CAWB 1BEV3 2CSGA 2KM2A 3EMRA 5C5TA 5ACA1 2MEV2 1WKYA 1DZTA 1A6CA 3P5BA 3GHNA 3O12A 1QIQA 2EXJA 2P17A 2RS33 1BZWA 1QNYA 1W8NA 3MIFA 2J1EA 3MFCA 3USUA 4AVVA 3AZWA 3JCIA 1KGYA 4OVEA 2TEPA 4YVWB 1RYYA 2Y34A 4OI0A 2OIIA 2VTFA 5C8CC 4LHSA 3IMNA 1SFNA 1V6OA 4QB1A 4TZDA 2JIGA 5FY5A 1NYWA 5IFTA 3WNXA 4DOUA 5IYYA 2ZCWA 1AR63 1EAH3 1LEDA 2JDPA 1DGWX 1AL22 1Q8VA 2UWBA 2UY8A 3C8XA 5GALA 1B35B 2G9ZA 4A4AA 1KS5A 5CFCA 3WX5A 1US2A 1UXXX 2YY1A 2K46A 2ZOEB 4UFHA 4AEDA 3BTZA 2VY0A 1AR93 3ZN6B 4P9GA 3DV8A 3JD71 2BZDA 1TE1B 1XSQA 3AM2A 2L9LA 5JSOA 1OFSA 4WZFA 1NE4A 3OEBA 2EA7A 5AVAA 4A6OA 1LHNA 1K5MB 4HSJA 1DQ1A 1XNDA 4O65A 4GWIA 4YM0A 4ZPIA 4NRQA 1UCXA 2RDNA 1HV0A 1VALA 1JOBA 2W94A 4NPMA 4WBBA 1EV12 2OZ6A 3MBWA 5DUUA 4OMDA 3AX4A 5F39A 4MXWA 3IDAA 3SISA 1BK1A 2A6YA 3DXUA 4BA6A 1W6PB 4EN9B 3E6CC 2CWMA 2D6KA 2WKKA 4AGGA 3E6BA 4IV3B 4YW7A 4GXLA 5BPXA 2VMEA 3RZHA 4WM7B 3BPSA 3ABZA 3JBG1 4E27A 3PUSA 2JX9A 3H7JA 3ME2A 5FZEA 1NE6A 4LHKA 1OVSA 1Z7S3 4BHPA 3H8OA 3M4FA 1Q8PA 2F4LA 1NA1C 3NV2A 5DMYA 4CEYC 2RDSA
chains in the Genus database with same CATH topology
5D2AA 2JDNA 2JDUA 2CHHA 2VUDA 2BP6A 1W8HA 2JDKA 2VUCA 1OUSA 2JDHA 5A6YA 2BOIA 2JDPA 5A6ZA 2BOJA 2BV4A 1OXCA 1UQXA 4AOCA 2JDMA 5A6XA 5A3OA 1W8FA 1OVPA 3ZDVA 2WRAA 1OURA 1UZVA 3DCQA 5HCHA 1GZTA 4UT5A 4CE8A 2VNVA 2XR4A 1OUXA 1OVSA 2JDYA 2WR9A 5A70A 5A6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D2A A;  2JDN A;  2JDU A;  2CHH A;  2VUD A;  2BP6 A;  1W8H A;  2JDK A;  2VUC A;  1OUS A;  2JDH A;  5A6Y A;  2BOI A;  2JDP A;  5A6Z A;  2BOJ A;  2BV4 A;  1OXC A;  1UQX A;  4AOC A;  2JDM A;  5A6X A;  5A3O A;  1W8F A;  1OVP A;  3ZDV A;  2WRA A;  1OUR A;  1UZV A;  3DCQ A;  5HCH A;  1GZT A;  4UT5 A;  4CE8 A;  2VNV A;  2XR4 A;  1OUX A;  1OVS A;  2JDY A;  2WR9 A;  5A70 A;  5A6Q A; 
#chains in the Genus database with same CATH topology
 4GMP 0;  4A7Z A;  2Y6G A;  1QDC A;  1MZ5 A;  4QGM A;  2XOM A;  2VMI A;  2JG8 B;  1VPH A;  4D7S A;  2RV9 A;  4QPY A;  1HB2 A;  2X09 A;  1REF A;  4MAD A;  3ZYG A;  5FBJ A;  4WVM A;  2WS9 2;  4URT A;  3SH4 A;  1RHI 1;  2HYK A;  4AW7 A;  3L2Y A;  1OH3 A;  2X5I C;  3RNS A;  1FOD 2;  2GNT A;  2JB8 A;  5LRR A;  2ZX3 A;  5DUV A;  3VKO A;  3OGG A;  1RUG 1;  2I2S A;  2LRO A;  1F5F A;  2EF6 A;  2VGD A;  4AQS A;  3AFK A;  2J1R A;  2XHN A;  3VKM A;  1HQW A;  2PLV 3;  2EIC A;  4GH4 A;  4AVA A;  1SCS A;  5FFO C;  4HET A;  3WDY A;  4PIY A;  2D5F A;  4OYU A;  1JBC A;  4XDP A;  3OYW A;  1ZZ9 A;  3PVO A;  4Y1Z A;  5T3N A;  1IPJ A;  5DAB A;  3NVC A;  3HQX A;  3P1I A;  5APA A;  4XAB A;  3MFA A;  3WLU A;  4BPZ A;  4LBQ B;  1PO1 1;  3Q8E A;  1O7F A;  4GWN A;  5HPO A;  3ZSE A;  1RUF 3;  4PDW C;  3I49 A;  1H1M A;  5DAQ A;  2OPW A;  2GDF A;  1VBC 1;  4KGG A;  4M3C B;  4CDW B;  1DFQ A;  4D8M A;  4BWO A;  2YU1 A;  4NRM A;  3WW4 A;  2CDP A;  1ZX5 A;  3VDD C;  2W0X A;  4ET7 A;  1RVF 3;  1OD3 A;  4BB3 A;  3M7A A;  5JR7 B;  4NMI A;  4Q0Q A;  1ZBE 3;  4NWW A;  4Y3O A;  4YVS C;  1POV 1;  1WWY A;  2ZKN A;  5DDJ 3;  1NXD 1;  4B3N A;  4B1L A;  2V72 A;  1XXN A;  3GBF A;  1C8N A;  3UKV A;  2DUR A;  1ND3 B;  3KV5 A;  1B09 A;  1W2N A;  3JB4 C;  1G9C A;  4F3J A;  2RM2 3;  1JW6 A;  4V1P A;  3OUH A;  1ASJ 2;  4CU7 A;  4XMA A;  3VN4 A;  3QOP A;  5JVV A;  2IVJ A;  5L19 A;  1QHD A;  4YFZ A;  3FFZ A;  1AZD A;  2VOK A;  1MS3 A;  3VZM A;  2DTW A;  3HBZ A;  5JZG A;  1IQD C;  2DBN A;  5A3U A;  4LBK A;  1LKN A;  4Q4V 1;  1X8E A;  3FLR A;  1C1F A;  3VHP A;  3WF0 A;  4XZP A;  1LB2 A;  2Q30 A;  3VD3 A;  5F32 A;  1QJX 1;  2P6C A;  5E8A A;  2C26 A;  3C7O A;  1IS4 A;  4NO4 A;  1EY2 A;  4SBV A;  4ASK A;  1HXS 2;  2BGO A;  5LBB A;  3U75 A;  4Q0V A;  1HRV 3;  4HAN A;  1ULE A;  2GN3 A;  4EYU A;  3BTY A;  2YPJ A;  1W6M B;  2XKO A;  1VBD 3;  4HON A;  3J7N A;  3TN9 1;  2VUA A;  1R1A 1;  5LY2 A;  1GBG A;  3TAY A;  1E5H A;  1TME 2;  3CLP A;  3K46 A;  1UPS A;  4Z1V A;  1LJ7 A;  3ZKY A;  5FYY A;  4TLF A;  4QKD A;  5FP8 A;  3DPR A;  1VB2 A;  3MID A;  3C7G A;  1UO9 A;  2AC1 A;  2DCZ A;  2VM9 A;  3B9C A;  4HMZ A;  4Q8L A;  4YM2 A;  1R09 3;  3ES1 A;  1RJ7 A;  1HB1 A;  4XF1 A;  5CKM A;  1UYP A;  1RUH 1;  1KJL A;  2VZ3 A;  3M3Q A;  3ZFF B;  4B7K A;  4DY3 A;  1AYM 2;  4PF5 A;  5F5C A;  1V9U 3;  4AQ6 A;  1TME 1;  1OA2 A;  2BPA 2;  4W50 A;  5JXI A;  2YU2 A;  2JDN A;  4QKN A;  4AEK A;  5IAT A;  1LOC A;  1YNA A;  4LA3 A;  3OF1 A;  3VKN A;  5C9A C;  1OLQ A;  2HWC 2;  1OPO A;  2LS6 A;  4QX7 A;  1STM A;  2KR2 A;  3PUR A;  4OI2 A;  1CD3 G;  2WO3 A;  4GKX A;  1KXG A;  4Y22 B;  4Y24 A;  4ARX A;  1W9T A;  1S0F A;  1S0I A;  4YAR A;  1NQJ A;  2IXI A;  1Z78 A;  2VMH A;  2BNM A;  3POI A;  4JC1 A;  1SAC A;  3I3Q A;  2FHR A;  3PLQ A;  3I2H A;  4IUG A;  3MF9 A;  4E2Q A;  2A3Y A;  5GLW A;  3A23 A;  4UFK A;  3ATG A;  4CUC A;  1NCQ C;  2QJV A;  2PQQ A;  4XUT A;  4EZ4 A;  1JZ7 A;  4FXG B;  4Y26 A;  1H9W A;  3VBH C;  1RUE 2;  3J8F 2;  3FX3 A;  3SLI A;  5AVP A;  3AMH A;  2A3W A;  4K1Y A;  1J1T A;  1POQ A;  3OBA A;  2D40 A;  3UK9 A;  4QHO A;  3K77 A;  3ZFE C;  3VZJ A;  2PAK A;  2DYC A;  4QPG C;  1AR8 3;  4P9I A;  1UPI A;  4LIV A;  2VXJ A;  3ZDS A;  2DVF A;  2R04 3;  5GLU A;  3WQ0 A;  1PVC 3;  5I8T A;  2NYY A;  5J09 A;  2P37 A;  4UW3 A;  5FZG A;  5E89 A;  1RUE 1;  3T30 A;  2W1S A;  2RJL A;  3W5M A;  2VZU A;  2XON A;  3B9I A;  5C6C A;  2VJX A;  1SLA A;  2ORZ A;  1W28 A;  3WG2 A;  1DQ5 A;  4FPJ A;  5HCH A;  2IXJ A;  3NKT A;  4DIQ A;  1NCR C;  3J7L A;  3NJY A;  4NWV A;  3LAG A;  2YC0 A;  2HLE A;  3C3V A;  3HJR A;  4MGT A;  3H3Z A;  5CYY A;  5EIY B;  5JR2 A;  4JQT A;  1QJU 1;  2YRO A;  4I3G A;  4Q4Y 3;  4CEY B;  2Q5T A;  3A0K A;  2J42 A;  5F3I A;  2RS3 2;  4GUL A;  1XYP A;  1RL3 A;  2WLP A;  4N53 C;  4OHV A;  2VBD A;  4NN0 A;  3SIT A;  1RIT A;  1H0B A;  1QU0 A;  2HKX A;  1SDW A;  3GCW A;  3WDU A;  5C4W C;  4RR3 B;  4HPK B;  3ZDV A;  1BEV 1;  4R8H A;  1Q3E A;  1PK6 A;  3I54 A;  1HLC A;  2X5I B;  3I59 A;  2C24 A;  3VZL A;  2RDR A;  1EAH 2;  5LCW L;  1AR6 2;  3L9J T;  2RS3 1;  2SBA A;  2VG9 A;  3DUI A;  5H9S A;  1G7Y A;  5HXV A;  1NT0 A;  2W9X A;  3GXU A;  1V6L A;  1LHO A;  3G7D A;  1YFX A;  3KB5 A;  2PA7 A;  3I2F A;  5JLV A;  1DIW A;  3E6D A;  5HV4 A;  1FV2 A;  4QQP A;  4BQ1 A;  5AFE A;  2HBT A;  4NRP A;  3RRD A;  3FMG A;  3DYP A;  3CJI C;  5J1X A;  1W6N A;  4QKB A;  4QGN A;  5FPX A;  4YRD A;  3O1T A;  1AR9 2;  1EP0 A;  1PNG A;  2QQO A;  1ODM A;  3LEM A;  5A7W A;  5A6Z A;  2VCB A;  1VE0 A;  4MXV A;  4CDQ A;  2W47 A;  2PEL A;  5L7O C;  2LTN A;  2JE7 A;  4G3Y C;  4OMC A;  1DQ0 A;  1UIJ A;  4PDW B;  1H1I A;  5ANN A;  4PIX A;  3K3N A;  2ATF A;  1BCX A;  3RZM A;  2X53 S;  2XQR A;  4D7T A;  3BOW A;  1CAX B;  3H7Y A;  2P5B A;  2YG0 A;  3AP4 A;  4FPL A;  4MGS A;  5FQ0 A;  4UF0 B;  1UWW A;  1X33 A;  1VBE 1;  3AC0 A;  4XFG A;  2C9A A;  1CAU A;  4YVS B;  5FMO L;  2A75 A;  5C3O A;  3RZJ A;  1OLR A;  3DKQ A;  5IW0 A;  3M70 A;  5A32 B;  3WNL A;  3N7K A;  1PIV 1;  2WNV A;  3O1M A;  2R06 3;  1Z7S 2;  2QQI A;  1HQN A;  3DEC A;  4AVT A;  3KVB A;  1A3K A;  1PO2 1;  3N9O A;  3ROU A;  3PIJ A;  3WD5 A;  3RI9 A;  3ZYR A;  4BLJ A;  2UUR A;  3E97 A;  4I30 A;  5FK8 A;  4AFC A;  4EN6 B;  3ASI A;  3RZK A;  3T1L A;  1GNY A;  5CFD B;  1S2E A;  3I2J A;  3UJO A;  3IBM A;  5FYT A;  2JEC A;  3Q8A A;  1Y3T A;  3WNK A;  1VLN A;  4L0P A;  2FD8 A;  4JGZ A;  4FQ4 A;  4QDR A;  1XOY A;  3ZXD A;  3ZSM A;  3WUC A;  3WNO A;  1M4W A;  4KNC A;  1D2S A;  4E4H A;  1CIW A;  1NOV A;  4CTE A;  4NIH A;  1G6N A;  1J3Q A;  4LOR A;  4AFA A;  4OHW A;  4FOQ A;  1P8J A;  1SPP B;  3ZXK A;  5KXE A;  2JG9 A;  4SLI A;  2PMW B;  4NIA A;  1UZZ A;  1HN0 A;  1GQH A;  4ARY A;  2WAO A;  4WVV A;  1A78 A;  3TB0 A;  4KQ7 A;  4DUX A;  2G1M A;  2ZAA A;  1R1Z A;  1GZW B;  1OH4 A;  1DGL A;  3FLP A;  4NAM A;  5D8A B;  4BQ3 A;  4OLL A;  1LHW A;  2JD4 A;  3ACG A;  2VC9 A;  1YXW A;  4OZO A;  2A1X A;  1DQ6 A;  1WW4 A;  4Q0S A;  4GB3 1;  3THC A;  1RUD 3;  2D6N A;  2PLV 1;  4LJH A;  1O3S A;  2EAA A;  2VOX A;  1RUF 2;  2OPK A;  3U10 A;  1QOT A;  4LUL A;  1VJ2 A;  4M3C E;  4YFW A;  3NV1 A;  1R08 2;  2ERF A;  2AEN A;  4BIO A;  2VMF A;  2ZX2 A;  2GMP A;  3WW2 A;  5FZ4 A;  3KGL A;  3I3D A;  1TMF 1;  1GFF 2;  1RVF 2;  5T5L A;  1ALY A;  1VB4 A;  4WZC A;  5FYB A;  3FC0 A;  4KWL A;  1ZBE 2;  4AHX A;  3VHR A;  4K1Z A;  3MLK A;  3ZFG C;  2OYZ A;  4XF4 A;  3ALQ A;  5DDJ 2;  3UES A;  1U12 A;  3M1H A;  2RS1 3;  3FBY A;  1RUF 1;  4NJ4 A;  3DEM A;  2PTM A;  3HOB A;  3VBS A;  2UYB A;  4RHV 1;  3S57 A;  1F8V A;  1ZZ8 A;  4RN5 A;  2XLG A;  4MUV A;  3BIW E;  1NCQ B;  2RM2 2;  5TSW A;  3KQ4 B;  3VBH B;  4KBZ A;  4NUB A;  1N1Y A;  5F1R A;  1V70 A;  1C57 A;  4LTA A;  1ZBE 1;  2BGP A;  3MUZ 1;  4NE9 A;  4PI2 A;  5FP9 A;  4CVU A;  2C6S A;  4YZ1 A;  4B4R A;  1XC6 A;  2GP5 A;  4QQL A;  4XW3 A;  3QH7 A;  5EXO A;  4UFL A;  2P34 A;  1UN1 A;  1WZX A;  1X9T A;  4CEW A;  2Z2S B;  1KJR A;  4FAG A;  3POE A;  1OVP A;  4JGY A;  3ZSK A;  3P6B A;  1HRI 1;  3VZO A;  3JBG 3;  1QXJ A;  2B7Y A;  2ZML A;  3NST A;  1JI6 A;  1LOF A;  1HRV 2;  1O91 A;  3AZZ A;  4Z07 A;  1HX6 A;  1LR5 A;  1MS5 A;  5FLH A;  2WZE A;  1NCR B;  1VBD 2;  4XUP A;  1S0C A;  2OQ7 A;  2YBK A;  3KCC A;  1IS3 A;  4CP9 B;  1FYU A;  4IEY A;  3AKP A;  5CIS A;  5F9T A;  5HBA A;  1BXH A;  3B01 A;  1WW6 A;  1ZVF A;  4JRL A;  4BIS A;  3TWI A;  5LA0 A;  1UZY A;  1GZ9 A;  2ET1 A;  2FDF A;  5A33 B;  4LQR A;  2VTX J;  4XBL A;  1LOB A;  1PVX A;  1G8W A;  1R09 2;  3Q8B A;  3GZT B;  4YW5 A;  4YW6 A;  5AFB A;  3A0N A;  5A6Y A;  4N53 B;  2VPV A;  1RHI 3;  3OPZ A;  2A5Z A;  4J25 A;  1W04 A;  5C4W B;  3KVA A;  1V9U 2;  1MR5 A;  5L9B A;  5A3P A;  5EP9 A;  1RUG 3;  4D6Q A;  4BQY A;  2GC3 A;  1CES A;  5FLJ A;  3MPB A;  4K20 A;  2Y0I A;  2Y64 A;  3T2Q A;  5B2G B;  2WZ8 A;  2B4K A;  4XAC A;  1HW5 A;  4XJW A;  2A73 B;  4W6W A;  2E6V A;  2QDN A;  3JU9 A;  3I4I A;  2R7E B;  1XNK A;  4KH9 A;  5FZF A;  5C3Q A;  2GMM A;  2JD9 A;  1D7P M;  4LBL A;  5T5J A;  1HJF A;  1LHV A;  2VBB A;  5A3M A;  5F3G A;  1RJ8 A;  4LO8 A;  4K8R B;  1PMI A;  3NAP B;  1XU2 A;  1PO1 3;  3M3C A;  4IEO A;  1U5Z A;  1X8M A;  3HNM A;  2H6B A;  2VCA A;  5IVC A;  1VBC 3;  5GZD A;  4CDX B;  2BBA A;  2DUQ A;  5L7O B;  3LDR A;  1ZRI A;  1RC6 A;  4M0N A;  2GND A;  3EYP A;  4KBB A;  4B1M A;  2OQ6 A;  3MI8 A;  3TRS B;  4FPC A;  3O1P A;  2WA4 A;  2R04 2;  1PVC 2;  1LGB A;  1NLQ A;  4AI2 A;  4QPI C;  5F3C A;  4K21 A;  2NQY A;  2BRT A;  3J26 N;  3O0V A;  2B39 A;  2VNG A;  1XJA A;  2J1S A;  1UYZ A;  4CDU B;  3NNL A;  4XDO A;  1H8V A;  3KT1 A;  1MS8 A;  4PF1 A;  2BP6 A;  3VBR C;  3VBF B;  4GD4 A;  1DZQ A;  1AR8 1;  4WM8 B;  3G6J B;  4P9W A;  5KBF A;  2BWC A;  3NRU A;  2QQV A;  1YQ6 A;  2HWB 1;  3HMY A;  4AAX A;  1W6Q A;  4Q4Y 2;  2R6Q A;  4YGE A;  3RMX A;  3ACF A;  2B8M A;  3GAL A;  3AMM A;  4Q4V 3;  4XE9 A;  2XR4 A;  1BVP 1;  2GH2 A;  2R0F A;  1WD3 A;  2R0H A;  3PDQ A;  4IV1 B;  1QJX 3;  4K6B A;  4PLM A;  3DYO A;  4FOW A;  1AJK A;  2HWF 1;  5I0U A;  1OHF A;  4QXB A;  5KHK A;  3V0B B;  3LWC A;  3NNJ A;  3LDK A;  4YGB A;  3MEP A;  4IGO A;  3WVJ A;  4AEM A;  1W0O A;  4R9C A;  3VBO A;  1QXR A;  2QZ2 A;  1BQP A;  1QH6 A;  3UV9 A;  5FOB B;  2D44 A;  3USS A;  3AP7 A;  3TN9 3;  4FSJ A;  4QX3 A;  5DZF A;  1N3Q A;  1R1A 3;  4IEQ A;  4A42 A;  4B7E A;  4QX0 A;  2OT7 A;  1Q5O A;  2RR1 1;  3WP4 A;  1ZZ7 A;  3AMQ A;  1L3J A;  2A6Z A;  4BMB A;  3CL1 A;  4HXC A;  1CQ9 A;  4M3C F;  5CIR A;  1YJL A;  2QDR A;  1O4T A;  3D6E A;  3ZXF A;  1RUH 3;  1QEX A;  4YG6 A;  3WW1 A;  2Q8D A;  5FZK A;  2UYA A;  4IND A;  4Y1U A;  1G86 A;  1WLC A;  3OSD A;  5C70 A;  5DN2 A;  5CAD A;  3MW4 A;  4ATE A;  5HCB A;  5I8S A;  1W9W A;  2VUD A;  3WG3 A;  1KQR A;  2VQ0 A;  3VB9 A;  4XF3 A;  5BNN B;  3SXW A;  3N9L A;  2JEM A;  2BOI A;  3O1U A;  2GN7 A;  2GU9 A;  1YFW A;  1OOP C;  1W8F A;  1CPM A;  2ZHK A;  5DQ0 A;  5CB7 A;  2D43 A;  4XCB A;  3CZU A;  4QU1 A;  3ZFG B;  1SEF A;  2ZZQ A;  1DHK B;  3PNA A;  4FXK B;  1A8D A;  4CYD A;  4IEW A;  2RMU 1;  2ENR A;  2ADD A;  5CG8 A;  4GMP 3;  4JDM A;  2HWD 2;  3OUI A;  3T4H B;  2R06 2;  4Z8B A;  4COV A;  3POS A;  4M4R A;  1MZF A;  3BYW A;  5JSR A;  3RZG A;  4LMF A;  1CAV B;  4AI0 A;  4ZU7 A;  2ZPX A;  5FZO A;  4XIL A;  4IGQ A;  1OKQ A;  5IK7 A;  4DNY A;  3LDB A;  3LEG A;  2PHF A;  2YC2 A;  4V2V A;  3OPT A;  3ELN A;  1YHF A;  4CDQ C;  2DV9 A;  4MZU A;  1UX7 A;  2R06 1;  2VAU A;  4IL7 A;  2E9Q A;  3N9N A;  4DIN B;  5BYN A;  2WRA A;  1O3T A;  2VMC A;  3FZ3 A;  2ZX1 A;  4ZU5 A;  2KD7 A;  2ZGL A;  3H8X A;  3I97 A;  1WBL A;  4MGI E;  2HH9 A;  4XOG A;  5FY8 A;  1NY7 2;  3H3L A;  2XUM A;  1JZ3 A;  2JWP A;  4RGK A;  2WSV A;  5JMC A;  1WCS A;  3MPP G;  4RSU A;  1H1A A;  4ONU A;  1QJU 3;  2Z5W A;  3HT1 A;  2Y60 A;  1YIP A;  3ZPY A;  4C0B A;  5ABJ B;  2VBP A;  3T0B A;  4FFF A;  1NQD A;  2WN3 A;  2PHR A;  3EO6 A;  3BIE A;  1PM7 A;  4AGR A;  1VMJ A;  1W8H A;  2WNV C;  5JXH A;  4W6Y A;  5E6H A;  2WZR 3;  4BQW A;  3T08 A;  3T2O A;  1DGW A;  4QT6 A;  3RPQ A;  1VMF A;  2ARE A;  3TOJ A;  3X29 B;  1LNS A;  4LO4 B;  4RS5 B;  4XMI A;  1OC1 A;  5HCF A;  1RUD 2;  3N7M A;  4QKF A;  3I2O A;  2AEY A;  1O4Z A;  5HI0 A;  1OI6 A;  2YUE A;  2CY6 A;  2WYF A;  4AGV A;  4LBQ D;  1PX4 A;  4XIK A;  1OSG A;  1NZI A;  3O0X A;  2LM3 A;  5A3N A;  3ZIW A;  5FCC A;  4HG6 B;  4N90 A;  4QXH A;  1CGP A;  5FR3 A;  4ERO A;  2QQW A;  1RUD 1;  2ZX0 A;  4JQR A;  4YWA A;  3AYD A;  1JU4 A;  3FL7 A;  3OCP A;  4FP3 A;  1ND2 A;  4Y20 B;  5FRE A;  5A3W A;  3JD7 2;  2JDK A;  4EWA A;  2YZ4 A;  4D69 A;  2BW8 A;  3BGA A;  1REE A;  4W6X A;  2XHK A;  5A7Q A;  3BI3 A;  2DUO A;  1W0N A;  1DQ2 A;  5KHH A;  5G05 L;  3WP3 A;  2FCU A;  5A1A A;  3TBD A;  4YSF A;  1DP0 A;  2AUY A;  5EYY A;  2YBP A;  3GJA A;  1S0B A;  5SV5 A;  1GWM A;  1KFU L;  1GYK A;  3H1W A;  2RS1 1;  1TEI A;  3K51 A;  4XJU A;  1ZRE A;  1WBF A;  4H7L A;  1H2L A;  2W95 A;  4XUQ A;  5T5P A;  2HJI A;  4IET A;  5FWE A;  3S6P A;  1VBE 3;  4NHY A;  4QPI B;  2FMY A;  2DFB A;  3IM0 A;  4N43 B;  4CPB D;  1JU3 A;  4JZR A;  3B00 A;  4N9H A;  3OB8 A;  3JBG 2;  4ZU4 A;  1MQT C;  1PIV 3;  2VH9 A;  5DZE A;  3IPV B;  4YZ2 A;  4LO7 A;  3VBR B;  3CO2 A;  4AHY A;  3OD4 A;  1AHS A;  1PO2 3;  3PU8 A;  5CU1 A;  2QUO A;  4NIG A;  2BVB A;  2W39 A;  4JRA A;  4XUR A;  5EQU A;  1H8T B;  1ULD A;  3VBS C;  1Q56 A;  3VD7 A;  5FO9 B;  2AEZ A;  3ZXA C;  1WD4 A;  4IXL A;  5FMD A;  1IG0 A;  2XJV A;  4U2A A;  1V6N A;  4YGC A;  4J1W A;  1NG0 A;  2VW0 A;  3LQC A;  2QQJ A;  4BXS V;  2X8K A;  4I0W B;  1VMH A;  1RHI 2;  2ORX A;  5LK5 A;  1XPW A;  1I5P A;  1GR3 A;  4Z2W A;  1JZ4 A;  3ON7 A;  3PTR B;  5GLZ A;  4H55 A;  4A3X A;  5BNP C;  1UU6 A;  1QJZ A;  1RUG 2;  3BAL A;  3NJV A;  4COY A;  1UX6 A;  2Y8K A;  2ZMK A;  3AL6 A;  3ILF A;  1H2M A;  4CEW C;  2OVU A;  3APB A;  3VZN A;  5LA1 A;  1YI9 A;  2ZEZ A;  1WA6 X;  4S2G A;  4JGY C;  4AK3 A;  1XNT A;  3GZU C;  2W92 A;  4GKY A;  2YGL A;  1GKB A;  2VVD A;  1LOF C;  3TNP B;  3UGG A;  4RQP B;  3HBK A;  2VQA A;  4DXR A;  3WNP A;  2YFU A;  4FTS A;  1RXG A;  2XVL A;  2D3P A;  2VZ1 A;  4HZF A;  4E2S A;  4GB3 3;  4BQX A;  2CDO A;  4IE6 A;  1PO1 2;  1TG7 A;  1OFN A;  3IWZ A;  3T09 A;  2QZ3 A;  2ET7 A;  2UWC A;  1VBC 2;  4Q0P A;  5FUI A;  3SEE A;  3MW2 A;  1AYN 1;  2WNU B;  4UOJ A;  4XF9 A;  3DGT A;  2YC4 A;  4PQ9 A;  3KV9 A;  3CKH A;  2ZGT A;  1TMF 3;  2NMN A;  2WN2 A;  3PL0 A;  1JZ6 A;  3O1O A;  4A41 A;  2Q1F A;  3IDE A;  4K7J A;  3EB7 A;  5D21 A;  1CN1 A;  5BNO A;  2RE9 A;  3WY6 A;  5A7S A;  3PMS A;  3V64 A;  3VD4 A;  2BGC A;  1OOP B;  3D0J A;  4LO6 B;  2XL9 A;  2W08 A;  4HN1 A;  1YRZ A;  4RHV 3;  5FZI A;  2Q8O A;  2OX0 A;  2PHX A;  3VBU A;  3HAG A;  3WEZ A;  3RJ2 X;  1H4G A;  4NOT A;  5F6K A;  5L36 A;  3KQR A;  1VRH 3;  1W9F A;  3K3O A;  3C7H A;  4W8J A;  5JOZ A;  4Q4W 1;  2R07 3;  2DCY A;  2VZP A;  3PIG A;  1MS0 A;  5JPM B;  2IXK A;  1VBA 1;  2VU9 A;  4YG0 A;  1OLM E;  5GM0 A;  1KIT A;  1J58 A;  2MNG A;  2TNF A;  4H7M A;  3ENR A;  4NPR A;  4YPJ A;  3AYC A;  2ZEY A;  2W46 A;  1IKQ A;  4KU8 A;  4E4Z A;  4AVS A;  1SLL A;  5K0U C;  5DAX A;  4Q4V 2;  1MZE A;  4COZ A;  5K9Y A;  4XXP A;  3KGZ A;  3RFR A;  3TEY A;  1HKD A;  1HDK A;  1QJX 2;  4D0Q A;  3MHZ A;  1HRI 3;  1UOF A;  1IQA A;  2PAE A;  2R1B A;  2E7A A;  4Z2A A;  1E5S A;  1BLZ A;  2ZAB A;  5DAV A;  2XJT A;  5FZM A;  2DWR A;  1HB3 A;  1ULF A;  2DVA A;  1V6K A;  1KEX A;  3TN9 2;  1OQ1 A;  1R1A 2;  3OY8 A;  4HT1 T;  3THD A;  2J1U A;  3WQ1 A;  2W1Q A;  3QBQ A;  4XFA A;  1S55 A;  1D0G A;  4QB6 A;  3KF3 A;  3PJQ A;  3ZSL A;  1XNC A;  3FFQ A;  2KXL A;  3LPG A;  2CNA A;  3MIC A;  3F95 A;  4KGQ A;  1OUS A;  1RUH 2;  1CAW A;  4YZ4 A;  4DB5 A;  1XU1 A;  1JOD A;  2BU9 A;  3MZH A;  2EAL A;  4HVO A;  4L9B A;  1PGW 1;  3FHI B;  3JZV A;  4YW3 A;  4ES9 A;  3ZLI A;  4CCE A;  5JOX A;  2FQP A;  3RGB A;  1F2N A;  3LFM A;  4XF0 A;  4HSL A;  4YVW A;  3WDT A;  1JYT A;  3ETQ A;  3KM5 A;  1UNB A;  3AXD A;  5I8Y A;  1AX1 A;  5JSP A;  1IHM A;  4CCO A;  1YC6 1;  4KG8 A;  3VZK A;  4RFR B;  1TZO A;  4LHL A;  2WAA A;  4XQ4 A;  4R9A A;  4WVZ A;  4FVV A;  5EYX A;  2Z4F A;  5C8C B;  2VVE A;  4X8P A;  4AHZ A;  5F2S A;  5KHI A;  5FLI A;  4H3W A;  2BTV C;  4XJZ A;  2VZO A;  5FYU A;  4XJ9 A;  3GBW A;  1B35 A;  4PIZ A;  1DG6 A;  4XPV A;  1UYX A;  1GZC A;  2JIJ A;  3CJX A;  4NAO A;  3THT A;  4FCA A;  1SHW B;  1OA3 A;  1H6X A;  1UU4 A;  2WQ8 A;  4PBP A;  4Y5Z 0;  3C2U A;  1OUR A;  4XVH A;  4A7Y A;  1CVN A;  1AX0 A;  2E31 A;  1I3H A;  1YEW A;  2KA3 A;  3ZN6 A;  1KDM A;  1J1L A;  2B46 X;  2JXA A;  1ULG A;  4S2D A;  1WMX A;  2WQZ C;  2GC1 A;  1JUI A;  2IFR A;  3D82 A;  3V56 A;  4HKL A;  5EJ1 B;  3UT0 A;  4KWK A;  4C91 A;  4GJZ A;  4NVP A;  2WYS A;  4HL0 A;  1W8T A;  4GMP 1;  3RYP A;  3WDW A;  1K5M A;  3WF2 A;  3CHX A;  4P08 A;  5KHG A;  2XWJ B;  3WCR A;  3I2D A;  2AYH A;  4MHU A;  5DAW A;  3ZYB A;  3UKN A;  4MYE A;  5A80 A;  1MQT B;  2WIN B;  2TBV A;  4EWE A;  2O14 A;  1W6P A;  3VGI A;  4OFG A;  4HVQ A;  2VW2 A;  3PVB B;  2HWB 3;  4IV3 A;  5KC5 A;  5LEJ A;  2FZ2 A;  3BTA A;  4WM7 A;  1QJU 2;  3EXU A;  1S0E A;  4JV4 A;  4M01 A;  4IEZ A;  2ZHL A;  3SCG A;  2DBI A;  2A6W A;  4UT5 A;  2BNO A;  2O8O A;  5FZB A;  5FOJ B;  1W3V A;  2ZKL A;  1XNA A;  1U0A A;  4NHK A;  3I3B A;  2HWF 3;  5H9R A;  2WZR 2;  2XB6 C;  5J98 B;  4BK4 A;  5LAS A;  3I2K A;  2JG8 A;  4PJY A;  1BEV 2;  3POJ A;  1NA1 B;  3J7M A;  1RMU 1;  4JX0 A;  3ZX7 A;  3FUO A;  1XYN A;  4AZZ A;  2PHD A;  2R16 A;  4FT8 A;  5BNP B;  5JWP A;  4NHL A;  2GC2 A;  5IVV A;  1NLS A;  3GHM A;  5T55 A;  2RS5 1;  2RR1 3;  5FYV A;  4CZS A;  5C3P A;  1H2K A;  5GKA C;  1O3Q A;  2WZR 1;  2ZGQ A;  3O0W A;  5K0U B;  5HCA A;  1ZM1 A;  1XBF A;  4CCN A;  4DS0 A;  1O8P A;  2P4E A;  2Y6F A;  2J1V A;  4PBO A;  3GBG A;  3OGS A;  3W21 A;  1VIW B;  3D0S A;  3ZR6 A;  1HV1 A;  3NJZ A;  4D7Y A;  3VDB A;  4BME A;  4GJY A;  2C1F A;  2VR4 A;  1A34 A;  1YQ5 A;  1F15 A;  1W2O A;  1XE7 A;  4QXC A;  4MSV A;  4COW A;  1H9P A;  3HQU A;  3W5N A;  1ZA4 A;  1IPS A;  3WXP A;  2D3R A;  4LNV A;  3GF6 A;  4ORF A;  1HIX A;  1QJF A;  1R64 A;  1LU1 A;  1IKP A;  3M2M A;  1JHN A;  3BU0 A;  1W6O B;  3NNF A;  4COU A;  3FWE A;  1W03 A;  1SBE A;  5FP7 A;  4YYO A;  2YHJ A;  4LBQ A;  1QNW A;  1JZ2 A;  3B69 A;  4JCK A;  3LSE A;  1C1L A;  5JI9 A;  4M3C A;  2BYV E;  5A6X A;  2CAV A;  2JDZ A;  2P2K A;  1VBE 2;  4CDW A;  2YPD A;  1OBN A;  3WIN E;  5LW9 A;  3KHB A;  5DUW A;  1W39 A;  5KXD A;  4W65 A;  2RMU 3;  1PIV 2;  2B9V A;  4JKM A;  4IEP A;  1LGC A;  1C5I A;  1JHJ A;  1VR3 A;  2D97 A;  1DLC A;  2N7G A;  2NN8 A;  3VDD B;  4D94 A;  1SBD A;  4ZY9 A;  5E1R A;  1PO2 2;  2ZGS A;  3ILR A;  1RIR A;  2IXL A;  3RG0 A;  1SLT A;  1L7L A;  1ND3 A;  2BDR A;  3UGF A;  1LOE A;  1XSR A;  1KDK A;  1PM4 A;  4LE4 A;  5JIU A;  1FNZ A;  3M3I A;  4DPN A;  1PZ8 A;  1PMJ X;  1UIK A;  2V09 A;  1UD1 A;  2K9Z A;  3MUY 1;  4QHZ A;  1RED A;  1S2B A;  5LB6 A;  2J22 A;  4DXT A;  3BTX A;  1FPN 1;  1WCU A;  4UAP A;  4S2H A;  1UKR A;  1Y9M A;  2VXR A;  3FUQ A;  4HKO A;  4I0B A;  3MIG A;  5CFC C;  2BBV A;  1GQG A;  1DCS A;  4C8D A;  4L11 A;  4OHZ A;  4CPB A;  4AED C;  2H0V A;  2Z42 A;  2ZGR A;  3SC7 X;  5M0T A;  2B45 X;  3ZO0 B;  5LZ6 A;  1ENR A;  2GSY A;  3MF6 A;  4H2A A;  2CWS A;  4L8Q A;  4XDQ A;  5EZW A;  1HQL A;  1NZC A;  2R32 A;  3KS7 A;  3VDC A;  5DG2 A;  3LOI A;  4C1W A;  4E8C A;  2P3K A;  2W1U A;  1IS5 A;  3K4Z A;  5T54 A;  5IHR A;  1W6M A;  3ES4 A;  1LEC A;  2WO2 A;  3KT7 A;  3GZE A;  3WSO A;  1JYV A;  1JH5 A;  2A71 A;  2XJR A;  2AR6 A;  3KF5 A;  4GB3 2;  3U14 A;  2XJP A;  2PLV 2;  3AKR A;  1N3O A;  2FZ1 A;  1L7R A;  4H14 A;  2X05 A;  4B8E A;  5FZ1 A;  4KG0 A;  4U36 A;  3MV0 1;  3W20 A;  3IZO A;  1UY4 A;  1IZ3 A;  3ZFF A;  1TMF 2;  1OQD A;  3FE5 A;  5FPA A;  5JXJ A;  1OT5 A;  3AJZ A;  1W05 A;  5FMC A;  5DXD A;  4XBN A;  3T0D A;  5A1F A;  1GV9 A;  5F37 A;  4XHB A;  1QGL A;  4DMI A;  3E1F 1;  4LEJ A;  4IQP A;  4QQ2 A;  3W9A A;  1A8M A;  1ZBA 3;  2W2I A;  4PI0 A;  4GIQ A;  4RHV 2;  5FPZ A;  5FRA A;  2D6P A;  2ILM A;  3K4A A;  4FOV A;  3SKV A;  1VRH 2;  4WVW A;  4W4Z A;  4CU6 A;  3E5Q A;  4YZ5 A;  2J7M A;  4Y22 A;  4BCU A;  4DEV A;  1OXC A;  4XET A;  3S7E A;  4XYX A;  1RUJ 3;  3GGL A;  5C9A B;  2EVX A;  1H2N A;  2X29 A;  3IT8 A;  1QOO A;  5JCT A;  1FAY A;  2Y6K A;  2Y6H A;  4FP2 A;  5F7U A;  2WJS A;  1EUU A;  2DU0 A;  1PMH X;  3NNM A;  1QF3 A;  3U78 A;  5A3T A;  5HV0 A;  4XFI A;  1VRH 1;  4LBJ A;  4GH4 C;  4X6Q B;  1F4A A;  2JB4 A;  2R07 1;  2RVA A;  2QVS B;  2VUJ A;  1YUD A;  1HRI 2;  4PLO A;  4ITC A;  4P9L A;  3L2H A;  2P3Y A;  2CL2 A;  2EXK A;  3FHQ A;  4CXW A;  3ACI A;  1XB9 A;  3ZFE B;  3S30 A;  4MX3 A;  4QPG B;  3LA2 A;  4EWD A;  3CDZ B;  4LBO A;  4RGA A;  2JDM A;  4FO9 A;  2C5D A;  3A7Q A;  1ODN A;  4GAZ A;  4RD7 A;  3BOD A;  4AFB A;  1RB8 G;  5FZ8 A;  3POW A;  2MHF A;  4CP2 A;  4CCJ A;  4XC9 A;  4TTG A;  3M3O A;  2QQU A;  3SQO A;  3R4D B;  1NX9 A;  2XXZ A;  3OEA A;  5CKN A;  3MLL A;  2G19 A;  2F4P A;  4ATF A;  4Z92 B;  1VRB A;  3C7E A;  4IEU A;  2EIE A;  4O9E A;  5A7P A;  4CEY A;  4CCM A;  1JN2 P;  4RA0 A;  4N7I A;  4DUV A;  1OPM A;  3IDC B;  3OTF A;  4XTM A;  5LWB A;  1UMI A;  4HBN A;  4Q29 A;  1KD7 A;  5EFU A;  4YW2 A;  4G9S B;  2Y6J A;  4GA9 A;  3ZN4 A;  2FMD A;  1YJK A;  3AZX A;  4RR3 A;  4HPK A;  2HBU A;  3AKS A;  1NUK A;  5K7P A;  4NID A;  1Y9Q A;  2PAM A;  2VCM A;  2X5I A;  2CAU A;  2WNE A;  3BCW A;  5FZ6 A;  3RQ0 A;  4ZXE A;  1UY1 A;  3LF7 A;  4LLO A;  3ZYH A;  5J7M A;  5JZG C;  3LPF A;  3NNG A;  2XLA A;  3J9S A;  2XKP A;  1FMD 1;  2ZZJ A;  4BXF A;  2E33 A;  1RUC 1;  4N8M A;  4Y33 A;  3WHU A;  5JOW A;  4LKD A;  4QX8 A;  2Y26 A;  4XJ8 A;  1AYN 3;  1E5I A;  1U5Y A;  5KXB A;  2CU5 A;  1ONA A;  1JYC A;  4L97 A;  3ACL A;  3ZOI A;  4YG3 A;  3VL9 A;  1O8S A;  3B3Q E;  3B93 A;  1C8M 1;  3ZPO A;  2BJS A;  4YGD A;  3CJI B;  4AWD A;  4EE2 A;  4F7Z A;  3RDI A;  5FKC A;  4OQ9 A;  2XJU A;  4CP0 A;  3V0A B;  1IS6 A;  2ZS6 B;  4PDW A;  3RJR A;  4XIO A;  2GNB A;  2IXC A;  3LD8 A;  4FFI A;  1GOF A;  5C8W A;  1X9P A;  3DPR C;  1WLT A;  4JAA A;  3JB8 A;  1V0A A;  5FYH A;  4Q4W 3;  3T4V A;  1CAX A;  1AR8 2;  3USU B;  2OW4 A;  1VBA 3;  3NL1 A;  3CNA A;  4LIU A;  2OA2 A;  1COV 1;  3UNP A;  1UW8 A;  3PME A;  1CJD A;  2XUE A;  4M0H A;  4UF0 A;  1VBB 1;  2VZR A;  4KWJ A;  5IVY A;  4ASL A;  2J1A A;  4YVS A;  5CZK A;  2HWB 2;  2ZGO A;  3B7M A;  2DVB A;  2HWE 3;  1WLW A;  4XFB A;  4OI1 A;  2WBK A;  2XBO 1;  5A32 A;  5KR7 A;  3AXE A;  3GZA A;  1M06 G;  4HKW A;  4LR4 A;  3CEW A;  1B35 C;  4HK8 A;  2GP3 A;  3OOX A;  5EV7 A;  3DKW A;  4XEZ A;  1MS4 A;  3SCF A;  1URX A;  2HWF 2;  1IPK A;  4HK9 A;  4MOA A;  4V2W A;  2WT2 A;  4CUB A;  4UI9 L;  1J83 A;  1WUV A;  2NPI A;  3AKQ A;  4QM9 A;  4BOW A;  4DXS A;  5CFC B;  2ZMN A;  3M3E A;  2ES3 A;  5CFD A;  4FAH A;  4AED B;  1UL9 A;  2PXJ A;  3WG4 A;  4EZH A;  3EQE A;  5KHJ A;  1V6I A;  5FV3 A;  4ZKT B;  2RR1 2;  1OA4 A;  1K5M C;  2ZAC A;  1QJY 1;  1MPX A;  3E5U A;  3KZ4 C;  4J6G A;  3ZYF A;  1CIY A;  1QQP 1;  5FUP A;  4AL9 A;  5F8P A;  4AR2 A;  4Y1Y A;  2JKX A;  5J48 A;  3O5S A;  4O9G A;  1W3X A;  1SPP A;  4DXZ A;  4KU7 A;  3RYR A;  2P3I A;  2XLF A;  3UYJ A;  5FPB A;  2CGN A;  1N1T A;  1WCK A;  2Y33 A;  3B94 A;  1ZYB A;  3H3U A;  4IV3 C;  2LAL A;  1PGL 1;  3P3N A;  4Q4X 1;  4WM7 C;  4AFM A;  2EID A;  1ENS A;  3D5O A;  4MXW B;  5L9R A;  2QCS B;  2BQP A;  1GNH A;  4QB2 A;  1GZW A;  5DUX A;  3VL8 A;  5D8A A;  2RJ2 A;  4LPL A;  3KT4 A;  4BQ2 A;  5B4N A;  2WUH A;  5J36 A;  3BN6 A;  1CX1 A;  3EBR A;  1OD5 A;  1W9Y A;  2VZV A;  2XWB B;  1JOJ A;  2JIC A;  1H30 A;  2UWA A;  2LW8 A;  5FYI A;  4AXO A;  4YM3 A;  2WC2 A;  1Q8O A;  1W9S A;  2DDU A;  3ETP A;  2BUK A;  2RMU 2;  3OD0 A;  4FFH A;  3O7O A;  2R30 A;  3JQX A;  1UU5 A;  4LXL A;  3LIH A;  2ZGK A;  3INA A;  4UW6 A;  4WVM B;  3SCH A;  4E4S A;  1K42 A;  3U0Z A;  5FP3 A;  3I3M A;  2C9K A;  1IOA A;  4AQT A;  1PK6 C;  2D93 A;  3SHR A;  1W0P A;  2G9F A;  4BQ4 A;  2NZ9 A;  5FXZ A;  1IGO A;  1NCQ A;  5CVR A;  3VBH A;  3FHA A;  3IN9 A;  4LUM A;  5LBF A;  5AC9 1;  5FO7 B;  5I93 A;  4GH4 B;  2WWJ A;  4YZ3 A;  2RJK A;  2TUN A;  2AZ5 A;  4AI1 A;  1W8W A;  5IK5 A;  3ACH A;  1N47 A;  2I07 B;  3HNY M;  2QE3 A;  4IES A;  3OYW B;  4PCR A;  5BNQ A;  1PZ9 A;  2W5F A;  3AYA A;  4GZ9 A;  1CWP A;  1AYM 3;  1S2K A;  2VOW A;  2FBE A;  1RUI 1;  2E53 A;  2IUW A;  4UFI A;  4CDW C;  5BY5 A;  2WFF 3;  4K40 A;  5FZH A;  4BE3 A;  5C3R A;  1J59 A;  1RUO A;  3O1V A;  5FPU A;  5T52 A;  3IMM A;  2XG3 A;  4R4Z A;  1NCR A;  5G04 L;  4OUM A;  2DTY A;  4Y5S A;  5LBC A;  3TEZ A;  2WO1 A;  4CP9 A;  4AF9 A;  4C90 A;  3KLS A;  1W90 A;  5L9V A;  4YW1 A;  2RHP A;  1JYN A;  3K48 A;  3HT2 A;  1RMU 3;  3C7F A;  5A33 A;  3D4K A;  2E63 A;  2YYO A;  1WGP A;  1I6X A;  2C4X A;  3KCX A;  2EXI A;  4N53 A;  1PHM A;  1UY2 A;  2RS5 3;  2W52 A;  4IE0 A;  4B4P A;  5C4W A;  4IDZ A;  3GNE A;  3K4D A;  4BK5 A;  1ULP A;  1UQX A;  4QMA A;  2QQN A;  1E57 A;  1D4M 1;  4QWN A;  1YYN A;  1UZW A;  3O14 A;  3ZN5 A;  4OHX A;  1KFX L;  1MEC 1;  2WLQ A;  3MV1 1;  5BUV A;  1AJO A;  2HEY F;  1IG3 A;  1XQN A;  1YQ2 A;  5JZG B;  2ZXQ A;  3T0A A;  5CEH A;  1DBN A;  1QDO A;  3WNM A;  3VLB B;  3WHT A;  1E5R A;  4K8F A;  4RL7 A;  4JGZ C;  4CA9 A;  1J3R A;  1GOH A;  2Q4S A;  1POV 0;  5IVE A;  1JUH A;  3N9P A;  1UF2 C;  5FKB A;  1FV3 A;  1JMU B;  4XTP A;  1SLB A;  3HPN A;  3ZXG A;  1S0D A;  2VZS A;  1JTZ X;  1I9R A;  4I01 A;  2RS1 2;  3CU7 A;  3NAP A;  1ZBA 1;  2IZW A;  2PFW A;  4QXK A;  2YFZ A;  2JDA A;  1LU2 A;  2JG9 C;  3AZY A;  1DYO A;  2H6C A;  4RGG A;  1SZB A;  2IC1 A;  5C71 A;  4CDX A;  1J84 A;  1LGN A;  5L7O A;  4Q26 A;  1T6B X;  1LES A;  3KHC A;  1X50 A;  3III A;  3BUC A;  1RUJ 1;  3MW3 A;  5LEK A;  1TVG A;  1H6Y A;  2F6B A;  1S4C A;  3DPR B;  4LUK A;  3ZFF C;  5I0R A;  3ZMO A;  1K3I A;  4MET A;  4QX1 A;  5IAV A;  1X7N A;  4EN8 B;  1K12 A;  5C7G A;  2E7Q A;  2IFW A;  3NKG A;  2MEV 1;  4CDU A;  1AVB A;  3UKT A;  1YLL A;  5I0T A;  3VBF A;  2ID4 A;  3D8C A;  3AP9 A;  4MLO A;  3HQR A;  1JZ8 A;  4WM8 A;  4URA A;  1NLR A;  1OLM A;  1YIF A;  5CKQ A;  1MZ6 A;  1FPN 3;  3CQO A;  2XJS A;  1F9K A;  1LAJ A;  4EJR A;  3HIF A;  5D1I A;  2VNR A;  1W2A X;  5IT6 A;  4QDS A;  5BXX A;  1DYP A;  4UFJ A;  5ERL A;  4P02 B;  1GP4 A;  3CMG A;  5ANQ A;  4BJ0 A;  2D98 A;  4XCA A;  3RSJ A;  1ZNP A;  3CIH A;  3DL3 A;  1Q8S A;  3IB3 A;  4IV1 A;  2PHU A;  4FPO B;  4P14 A;  3W59 A;  1JOP A;  3V0B A;  2VZQ A;  3NW4 A;  4IEV A;  4FPF A;  1AL2 1;  4IE5 A;  5IAX A;  3PUI A;  1UOB A;  5FMB A;  4ISQ A;  1UOG A;  2ZTN A;  1LEN A;  1DLL A;  3CBN A;  2YGM A;  3PUH A;  5GZF A;  1YI7 A;  4GQ7 A;  5LRS A;  4PHZ A;  3R05 A;  1F35 A;  2VUC A;  1RIN A;  4JHT A;  2VD7 A;  5EJ3 A;  3WF1 A;  4Q2F A;  1CZT A;  3S0M A;  3NV4 A;  4FTE A;  1NKG A;  2V4A A;  1JYI A;  3NWK A;  2FDJ A;  1AXY A;  5GLT A;  4GAL A;  3POF A;  2V5Y A;  1ZZ6 A;  1AYN 2;  3ZIX A;  1WW7 A;  2VMD A;  3N7J A;  1DGR N;  2GAU A;  4P9J A;  4XHX A;  4DQA A;  4LA2 A;  4P9Y A;  5DAP A;  5KC6 A;  4JDO A;  2QQK A;  1EV1 1;  5FBZ A;  5IVF A;  1AXK A;  2ARC A;  2HEV F;  3WR0 A;  1I1E A;  1F5J A;  1CZS A;  4CU9 A;  3WT3 A;  4QPW A;  4EV0 A;  1Z0H A;  2JDU A;  3MLJ A;  2RG4 A;  3AB0 A;  3IIA A;  2ZGP A;  1QY4 A;  4LHN A;  5BNN A;  1KS4 A;  1RXF A;  4NHM A;  2LRP A;  4Q4W 2;  3N35 A;  4OUL A;  4RR3 C;  1VBA 2;  3I7D A;  1S1A A;  2WT1 A;  3LEK A;  3J7H A;  1US3 A;  5FZ3 A;  4Q0U A;  3DN7 A;  3OGV A;  5FK7 A;  3ZFG A;  3U1X A;  3PVE A;  1TNR A;  3BPZ A;  2A6V A;  1V6J A;  2B5H A;  2HWE 2;  1V00 A;  1YO8 A;  3R6S A;  1PK6 B;  4BZ4 A;  3T3Y A;  3I59 B;  1WMF A;  1W8Z A;  4A7K A;  2YXS A;  2OS2 A;  1KRI A;  1Q8Q A;  5I0D A;  3VV1 A;  5J3U A;  2WS9 1;  5JMO A;  2QBX A;  3QD6 A;  4NII A;  1CAV A;  3ZXJ A;  1DZR A;  2FDK A;  1SLC A;  3KD4 A;  1FOD 1;  4PQQ A;  4OUS A;  4FBF A;  1WW5 A;  2HWE 1;  4TXW A;  2YMZ A;  5J37 A;  2CGP A;  1W6N B;  3WDV A;  4OUE A;  3K2O A;  4HVR A;  2WNO A;  1GMM A;  5A7W B;  2IXH A;  3LA7 A;  5F3E A;  4CDQ B;  2ZGN A;  3H1Y A;  1R08 3;  2BWA A;  4KL1 A;  4F8A A;  1LEM A;  4P5Y A;  3H0O A;  5CNA A;  4R4X A;  4P5H A;  1ACC A;  1W8O A;  1YCI A;  4OHY A;  1GU3 A;  1SMV A;  2H0B A;  4MH0 E;  4MGY E;  4UYB A;  2WR9 A;  5ABJ A;  5FZ9 A;  4F83 A;  1BBT 3;  3A21 A;  1PGW 2;  4FOY A;  4BM8 A;  3H50 A;  4Q1R A;  5FQ0 B;  3D3A A;  3RYK A;  4BU2 A;  1ULC A;  1BMV 2;  1CAU B;  4HFS A;  5IFP A;  5FZ7 A;  4AQ2 A;  5A1L A;  2P6H A;  1EUT A;  3LEI A;  4RS5 A;  3ST7 A;  2WNV B;  5FTT C;  4E9K A;  3IKW A;  1OF3 A;  1Y4W A;  4OZX A;  3A4U A;  1K5J A;  5FZA A;  4DY5 A;  2BNN A;  5GZC A;  1XNB A;  2VQT A;  2ZAH A;  1C3H A;  1JYW A;  4TLG A;  5CFD C;  4I02 A;  4AYU A;  1FMD 3;  3W58 A;  2C0Z A;  1RUC 3;  4KMQ A;  5FY9 A;  2W87 A;  1N1S A;  4L99 A;  5IVB A;  1BMV 1;  3NO8 A;  1DU3 D;  4ISR A;  3RS6 A;  5GZG A;  3PTY A;  3JQW A;  1ASJ 1;  4TWT A;  4CCD A;  4XQD A;  3S5Q A;  1LOD A;  2A6X A;  4XBQ A;  4JGZ B;  4Y20 A;  4N9I A;  2I74 A;  3LFI A;  3VD5 A;  2ZJC A;  4Z82 A;  1C8M 3;  4P00 B;  4YW4 A;  3VBO C;  4IEX A;  1N3P A;  1UY3 A;  5FMO S;  3NQH A;  3OBT A;  3I2G A;  1XE0 A;  4JTO A;  5FY0 A;  2ETE A;  3RZZ A;  1LOA A;  2QFE A;  4Q1P A;  1ZRD A;  5FYC A;  1FT9 A;  4QU2 A;  4CUA A;  2JG9 B;  3UJQ A;  1UAI A;  5GLV A;  5A3O A;  3SH5 A;  4FQZ A;  1D2Q A;  1GQP A;  5D8A C;  2V5D A;  5FZD A;  1HXS 1;  4NR1 A;  1QMJ A;  3U4S A;  2WQ4 A;  1COV 3;  3ZXL A;  4MGK E;  5JDB A;  3QCW A;  2YB7 A;  1VBB 3;  2XML A;  1QKQ A;  3H42 B;  1GOG A;  4QPI A;  5T50 A;  2J1T A;  1ZZC A;  2XL7 A;  4N43 A;  4RFT 0;  3R4U A;  2WFF 2;  5C33 A;  2XBO 3;  2B42 B;  3KWV A;  3LIG A;  1AF9 A;  2Q0A A;  3IPV A;  3WUD A;  2ZGU A;  3QH6 A;  1EPZ A;  4NRO A;  3VBR A;  4JKL A;  5JI7 A;  1S0J A;  4L92 A;  5FY4 A;  3WQB A;  4XUN A;  1GUI A;  5K8S A;  1AYM 1;  3TEX A;  1DF0 A;  1H8T A;  2K0G A;  2AAC A;  5LBE A;  4ZZ8 A;  5IK8 A;  1NAE A;  4MV2 A;  4PT6 A;  4JKK A;  1RMU 2;  2WFF 1;  4IW3 A;  4QQH A;  4N7U A;  5F6L B;  4B29 A;  1G9B A;  3LB9 A;  4NPL A;  1CX4 A;  1WCD J;  3I3E A;  3VBS B;  2B9U A;  2RS5 2;  2HWC 1;  2QTW B;  5J96 B;  1QJY 3;  3HNB M;  2YBS A;  1QQP 3;  4JHZ A;  5DZG A;  1UZ0 A;  3PVN A;  1XYO A;  5LA9 A;  4C0H A;  2Q1M A;  4EN0 A;  1QJE A;  1UXZ A;  1AX2 A;  3POG A;  1SDD B;  2WA3 A;  1GWK A;  3IAQ A;  1G9F A;  1GIC A;  3PUQ A;  3GYD A;  1I5Z A;  2WWU A;  4Q4X 3;  3J8F 1;  1TNF A;  5F5A A;  3BOP A;  1BK0 A;  4AOC A;  2JJ6 A;  4Q8K A;  5IWF A;  2LUW A;  1ENQ A;  5GJ6 A;  4CEW B;  1EYB A;  4UFM A;  4RQP A;  1LTE A;  3WP6 A;  4TYS A;  4JGY B;  4EQV A;  4QD2 A;  2WL1 A;  3J4U H;  4GWM A;  1FX5 A;  5FUN A;  2O0O A;  1W8U A;  3PU3 A;  1ST8 A;  4ZS3 A;  2OUH A;  1HJG A;  3AK0 A;  4CU8 A;  3S5A A;  3UL2 A;  3AKT A;  2EIB A;  4NHX A;  4AI3 A;  3HVD A;  2WNU A;  5F2W A;  1JYX A;  1AR7 3;  5JIA A;  4LBN A;  2ZHM A;  4HLT A;  5JAX A;  4AE2 A;  4J1X A;  3DXT A;  2WDB A;  4KI5 M;  1DQ4 A;  3R4S A;  1QH7 A;  2WSU A;  2A7A A;  1JS9 A;  5FZC A;  1UOJ A;  3WF3 A;  2BV4 A;  2A70 A;  2ZBJ A;  1OOP A;  3QAC A;  3ITQ A;  1HB4 A;  1QWR A;  5EPA A;  5BV6 A;  5LAT A;  4ZON A;  3Q8F A;  1JZ5 A;  1VAM A;  2ZEX A;  1MS9 A;  2VCC A;  1UKG A;  4BH9 A;  4ZZ5 A;  5FO8 B;  5FZL A;  5FPL A;  1C4R A;  4IGP A;  4D6R A;  5AC9 3;  3WZ1 A;  1DDL A;  1FPN 2;  3ZVX A;  2ZHN A;  4FI9 A;  1QXP A;  2XPJ A;  4FPE A;  5K4L A;  4O61 A;  3LOB A;  4FPG A;  2AH2 A;  5LY1 A;  2W1W A;  3HEI A;  3NAP C;  3H8R A;  5ISL A;  1ND2 C;  2XH6 A;  1AR6 1;  1EAH 1;  3AMP A;  4FPK A;  1RUI 3;  3WG1 A;  1XE8 A;  3MIB A;  3AMN A;  4CDX C;  3RMY A;  1O3R A;  1APN A;  4A44 A;  2E51 A;  4QAW A;  1GLH A;  2ZGM A;  2MPF A;  3FJS A;  4MG2 A;  4M4P A;  1W2T A;  4OCT A;  3RVH A;  5H9Q A;  3GJB A;  3OGJ A;  1RUN A;  2E7T A;  3AVS A;  1AR9 1;  4AVB A;  2JDY A;  4TSV A;  4PLN A;  4BDV B;  4DRR A;  4I09 A;  1VAV A;  2ARA A;  4BYY A;  4CCL A;  1UMH A;  4UXA A;  1GAN A;  2PQS A;  5FIX A;  4CDU C;  1GWL A;  2AGS A;  3VBF C;  4MGQ A;  5A7N A;  3OPW A;  3ZSJ A;  5FDB A;  4DUW A;  4WM8 C;  1SLI A;  2WO7 A;  1MAC A;  2IVI B;  1FXZ A;  2HWD 3;  2VOT A;  3LE0 A;  2BVV A;  2XGX A;  3FLT A;  2VW1 A;  3N4M A;  5L73 A;  2DCJ A;  1PNF A;  2FCT A;  1D4M 3;  1TQ5 A;  2D6O X;  1BHG A;  1ULO A;  3IDB B;  5A3L A;  5I91 A;  5JOY A;  1MEC 3;  2GZW A;  3QLQ A;  1Y7B A;  4L2N A;  2JE9 A;  5H9P A;  2Z69 A;  3NJX A;  2WAB A;  3AP6 A;  1O4Y A;  1W6Q B;  1XRU A;  4IV1 C;  4JVA A;  5E16 A;  4MGZ E;  3E5X A;  1Z7S 1;  4AEJ A;  5FY1 A;  2V4V A;  3T2P A;  1U5I A;  3LA3 A;  5C8C A;  3N3H A;  3DYM A;  5D2A A;  5FAX A;  1LCL A;  2F17 A;  1VP6 A;  2DUP A;  3OBR A;  1UMZ A;  4UW4 A;  5FYS A;  3VBO B;  2XVG A;  3KMH A;  2OKX A;  4CUG A;  2DVG A;  1G9D A;  5ACA 3;  3LCP A;  2R07 2;  3OG2 A;  5FXV A;  2PHL A;  3ZM8 A;  4XFF A;  1O5U A;  4Q5O A;  4LKE A;  3EJK A;  5CBL A;  3OJB A;  2D6L X;  1YFU A;  3ECQ A;  1T2X A;  2I45 A;  3MYX A;  4M00 A;  1O6U A;  4RYD A;  2PN5 A;  3S7I A;  3H1M A;  2NP0 A;  4YM1 A;  2MEV 3;  3ZYP A;  4ES8 A;  5DG1 A;  3AL5 A;  4DO0 A;  1MQT A;  5BNN C;  4K9S A;  4A45 A;  4QX5 A;  3B02 A;  4A3Z A;  4DFS A;  2ADE A;  3K75 B;  5C3S A;  4Q27 A;  2OXB A;  2D7F A;  2BOJ A;  2EIG A;  4Y1X A;  5FXX A;  1T6G C;  5FY7 A;  5BNO C;  3MIH A;  4BQ5 A;  3POB A;  3T2T A;  1BBT 2;  1F4H A;  3JD7 3;  3IAP A;  2OZJ A;  3FBM A;  4LE3 A;  3VBU C;  1R08 1;  2VE1 A;  3BKZ A;  5FYZ A;  3SKJ E;  2QKD A;  4DZG A;  1F31 A;  3U11 A;  5JXG A;  1AL2 3;  1GNZ A;  4QGL A;  5KXC A;  1RVF 1;  5GZE A;  4Y4R A;  1O5L A;  5FPV A;  1NA1 A;  2WWS A;  3ZMN A;  2QQP A;  5DDJ 1;  1D0H A;  1JXN A;  1OQE A;  1WMD A;  5EJZ B;  5BNP A;  1BBT 1;  3KV6 A;  5CAZ A;  1N1V A;  2XDV A;  3TNQ A;  3HWJ A;  4LK7 A;  3R0R A;  4CP1 A;  5FZO B;  1FMD 2;  5SV8 A;  1RUC 2;  2P3J A;  4E8D A;  1Y9G A;  4D6S A;  5T5O A;  1ZRC A;  1CJP A;  2RM2 1;  1WLD A;  5CA6 A;  3WV6 A;  1VAK A;  5EHD A;  1PZ7 A;  2GH8 A;  2Q8E A;  3DCQ A;  1CPN A;  1C8M 2;  4FPH A;  4UBH A;  4K3U A;  4Y5T A;  1EV1 3;  1MVE A;  2BEO A;  2PHT A;  1YWK A;  4QHB A;  3ZR5 A;  3SH3 A;  5ABJ C;  2Y0O A;  1J3P A;  1LHU A;  4LOS A;  3LSD A;  1BKZ A;  2IWG B;  3ZXE A;  5FWJ A;  3F2Z A;  3B5L B;  2QNK A;  1W6O A;  4CCC A;  4XQW A;  3AJY A;  3AZV A;  3AP5 A;  3CF6 E;  2JEN A;  1HRV 1;  3LGR A;  4LIT A;  4RS5 C;  3HN3 A;  1COV 2;  4QX2 A;  2JDH A;  5B4X A;  1QOS A;  1VBB 2;  1VBD 1;  2VNO A;  3CZJ A;  4MHR A;  2VEC A;  4ZS2 A;  1W99 A;  2FDH A;  4FTB A;  2G4I A;  3I8T A;  2O8Q A;  1LOG A;  3LZZ A;  2XBO 2;  1WA4 A;  4AAP A;  3SMH A;  4CSW A;  3WDX A;  4YVW C;  4E4D X;  1ZRR A;  1OF4 A;  1R09 1;  1Y43 B;  3VDD A;  3RI8 A;  2UY9 A;  2WS9 3;  5HXM A;  2BFU S;  4I0A A;  5LA2 A;  5A6Q A;  2NM1 A;  1AL0 G;  3AYE A;  1ZRF A;  1FOD 3;  2SLI A;  1V9U 1;  3NMB A;  4QM8 A;  1H4H A;  1LRH A;  2CYF A;  2O1Q A;  2V73 A;  3TYJ A;  3VUO A;  1DYK A;  2ARX A;  4S2F A;  2XQX A;  5K0U A;  1SFY A;  3U07 A;  1CR7 A;  4AFD A;  1ND2 B;  1ENX A;  2EXH A;  2VL4 A;  3OBZ A;  4GWJ A;  3DF0 A;  4IE7 A;  1UY0 A;  4XFC A;  4C1X A;  2D5H A;  3PJY A;  3T1M A;  1C28 A;  1QJY 2;  3BVC A;  4CXY A;  1EPW A;  1QQP 2;  1L7Q A;  2YDE A;  2BER A;  2PHW A;  1U5X A;  3GCX A;  1GZT A;  4AI8 A;  1YQC A;  2W68 A;  1PGS A;  2VNV A;  2UU8 A;  4LO5 B;  4BIF A;  3MO4 A;  3U4X A;  2JKB A;  3FN9 A;  2JE8 A;  1POV 3;  1SCR A;  2D6M A;  3A22 A;  4HN0 A;  3ZKU A;  4N43 C;  2XJQ A;  3KV4 A;  4Q4X 2;  1PGL 2;  3VKF C;  5A70 A;  2EAK A;  4OQ8 A;  2CTV A;  2DCT A;  4R9B A;  4LT5 A;  3THP A;  4CRQ A;  3ZYJ B;  2E32 A;  3MDP A;  1AXZ A;  1RTV A;  1SFP A;  2PYT A;  2WT0 A;  4LBM A;  2R04 1;  3AFG A;  4FFG A;  2ZX4 A;  2CV6 A;  1PVC 1;  3PHM A;  3UGH A;  3JUU A;  3P3P A;  3GDB A;  1H8T C;  3KSC A;  3O1S A;  1YQ8 A;  1NXM A;  1AR7 2;  3KCY A;  1UZV A;  2WZP P;  4CXX A;  3UET A;  4QDQ A;  3RWK X;  4YNI A;  1ZA7 A;  5IK4 A;  1DGR A;  1SBF A;  4LK6 A;  1OUX A;  4TN7 A;  1G9A A;  2FDG A;  1CON A;  3Q9O A;  4DEQ A;  2E26 A;  3H8U A;  3ILN A;  4MVT A;  1ASJ 3;  5DPN A;  1FI2 A;  3O1R A;  2W91 A;  2R49 A;  4XJA A;  3URF A;  5FXW A;  4A2U A;  2P1B A;  3N9M A;  3WW3 A;  2JG8 C;  4G4F A;  2R1D A;  3I2I A;  4MO3 M;  1AR7 1;  1SQ4 A;  3JXS A;  2VTX A;  3OGR A;  4Q4Y 1;  1WME A;  3V65 A;  4LKF A;  4QQO A;  2ZEW A;  2VUL A;  1O59 A;  1BJQ A;  2W3J A;  1BVV A;  4AG4 A;  1OKO A;  2VVF A;  4XAE A;  5C9A A;  1K45 A;  1GP6 A;  1UYY A;  1RGS A;  2ZA9 A;  4XAA A;  5AC9 2;  4I2O A;  2QQM A;  1HN1 A;  2ARB A;  3EHK A;  3NV3 A;  4RQP C;  4XXA A;  3M8L A;  1LUL A;  1HXS 3;  3ZYI B;  4DRV A;  2Y38 A;  2NMO A;  3SNM A;  4P9X A;  2DU1 A;  1WCQ A;  1V6M A;  2RDQ A;  3H9A A;  5IJR A;  4JTN A;  1ZZB A;  2G9G A;  3WQ7 A;  1CZV A;  3MIE A;  5JPN B;  1AUY A;  1RUI 2;  2Q1Z B;  1TME 3;  2OUJ A;  4ZHN A;  5F5Q A;  2WNU C;  4O7X A;  1Q43 A;  3WCS A;  3WOG A;  5EWS A;  1MVQ A;  2Z79 A;  1FAT A;  4LKS A;  4EN7 B;  5C5U A;  3ZFE A;  4R52 A;  4ZXK A;  4FPY A;  5LK7 B;  2HEW F;  4QPG A;  2XVK A;  4KWU A;  3HD8 B;  4AI9 A;  1W2U A;  1YFY A;  2GNM A;  2FDI A;  2WFP A;  5I0S A;  2VQU A;  2WII B;  5KWR A;  2A3X A;  2QQL A;  4ASM B;  1BYH A;  5BNO B;  3BU7 A;  4HOO A;  4D3W A;  1X36 A;  2K2S A;  4LLF A;  4WV8 A;  1MS1 A;  3WNN A;  4B4Q A;  3VBU B;  4CE8 A;  2HWC 3;  3AVR A;  5JUV A;  3GM8 A;  1SG3 A;  5IUQ A;  4AVC A;  2GAL A;  2VOV A;  3VD9 A;  1D4M 2;  2VZT A;  3VHN A;  4UBG A;  4XUO A;  3N9Q A;  3VHO A;  2DFC A;  1MEC 2;  2YV8 A;  1ND3 C;  5FJK A;  5E88 A;  3N36 A;  4OI4 A;  5IVJ A;  4Y1V A;  3BB6 A;  4IER A;  3OUJ A;  3HR9 A;  3Q8C A;  4BLI A;  1RUE 3;  1GP5 A;  3J8F 3;  3HN1 A;  4XFH A;  5FYM A;  2VMG A;  2HWD 1;  2Q8C A;  2NLR A;  4JDN A;  1D4V B;  2DCK A;  4Y4Y A;  3RWN A;  1W06 A;  4IE4 A;  3U37 A;  1FNY A;  2HYX A;  3WF4 A;  1OMI A;  4AHW A;  2BFU L;  4UW5 A;  4I3P A;  3ORJ A;  2D3S A;  3PUA A;  1ZBA 2;  1C5H A;  1PX3 A;  3LKJ A;  3VDA A;  5A7O A;  4E2G A;  1S0G A;  4CCK A;  3TEW A;  5CG9 A;  3MGU A;  5ACA 2;  3RZL A;  1X82 A;  3N7L A;  3OY8 B;  4X8N A;  2DF7 A;  2GC0 A;  2X10 A;  5F5I A;  1GSL A;  1RUJ 2;  4A6S A;  3SEP A;  2CGO A;  2GME A;  5FJH A;  2CHH A;  5FZ0 A;  4XZU G;  4YLZ A;  2DVD A;  3CJI A;  4R9D A;  1NY7 1;  3WP5 A;  5FP4 A;  3POY A;  4LOT A;  2FCV A;  3VKL A;  2Y6L A;  4UWD A;  4X6R B;  3V0A A;  2VO5 A;  1CAW B;  1BEV 3;  2CSG A;  2KM2 A;  3EMR A;  5C5T A;  5ACA 1;  2MEV 2;  1WKY A;  1DZT A;  1A6C A;  3P5B A;  3GHN A;  3O12 A;  1QIQ A;  2EXJ A;  2P17 A;  2RS3 3;  1BZW A;  1QNY A;  1W8N A;  3MIF A;  2J1E A;  3MFC A;  3USU A;  4AVV A;  3AZW A;  3JCI A;  1KGY A;  4OVE A;  2TEP A;  4YVW B;  1RYY A;  2Y34 A;  4OI0 A;  2OII A;  2VTF A;  5C8C C;  4LHS A;  3IMN A;  1SFN A;  1V6O A;  4QB1 A;  4TZD A;  2JIG A;  5FY5 A;  1NYW A;  5IFT A;  3WNX A;  4DOU A;  5IYY A;  2ZCW A;  1AR6 3;  1EAH 3;  1LED A;  2JDP A;  1DGW X;  1AL2 2;  1Q8V A;  2UWB A;  2UY8 A;  3C8X A;  5GAL A;  1B35 B;  2G9Z A;  4A4A A;  1KS5 A;  5CFC A;  3WX5 A;  1US2 A;  1UXX X;  2YY1 A;  2K46 A;  2ZOE B;  4UFH A;  4AED A;  3BTZ A;  2VY0 A;  1AR9 3;  3ZN6 B;  4P9G A;  3DV8 A;  3JD7 1;  2BZD A;  1TE1 B;  1XSQ A;  3AM2 A;  2L9L A;  5JSO A;  1OFS A;  4WZF A;  1NE4 A;  3OEB A;  2EA7 A;  5AVA A;  4A6O A;  1LHN A;  1K5M B;  4HSJ A;  1DQ1 A;  1XND A;  4O65 A;  4GWI A;  4YM0 A;  4ZPI A;  4NRQ A;  1UCX A;  2RDN A;  1HV0 A;  1VAL A;  1JOB A;  2W94 A;  4NPM A;  4WBB A;  1EV1 2;  2OZ6 A;  3MBW A;  5DUU A;  4OMD A;  3AX4 A;  5F39 A;  4MXW A;  3IDA A;  3SIS A;  1BK1 A;  2A6Y A;  3DXU A;  4BA6 A;  1W6P B;  4EN9 B;  3E6C C;  2CWM A;  2D6K A;  2WKK A;  4AGG A;  3E6B A;  4IV3 B;  4YW7 A;  4GXL A;  5BPX A;  2VME A;  3RZH A;  4WM7 B;  3BPS A;  3ABZ A;  3JBG 1;  4E27 A;  3PUS A;  2JX9 A;  3H7J A;  3ME2 A;  5FZE A;  1NE6 A;  4LHK A;  1OVS A;  1Z7S 3;  4BHP A;  3H8O A;  3M4F A;  1Q8P A;  2F4L A;  1NA1 C;  3NV2 A;  5DMY A;  4CEY C;  2RDS A; 
#chains in the Genus database with same CATH homology
 5D2A A;  2JDN A;  2JDU A;  2CHH A;  2VUD A;  2BP6 A;  1W8H A;  2JDK A;  2VUC A;  1OUS A;  2JDH A;  5A6Y A;  2BOI A;  2JDP A;  5A6Z A;  2BOJ A;  2BV4 A;  1OXC A;  1UQX A;  4AOC A;  2JDM A;  5A6X A;  5A3O A;  1W8F A;  1OVP A;  3ZDV A;  2WRA A;  1OUR A;  1UZV A;  3DCQ A;  5HCH A;  1GZT A;  4UT5 A;  4CE8 A;  2VNV A;  2XR4 A;  1OUX A;  1OVS A;  2JDY A;  2WR9 A;  5A70 A;  5A6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...