1OVPA

Lecb (pa-lii) in complex with fructose
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein LecB
publication title Structural Basis of Carbohydrate Recognition by the Lectin LecB from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2003-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 1ovpA00
1GZTA 1OXCA 2WR9A 2BP6A 1UZVA 2BOJA 1OVSA 5A6ZA 2JDKA 2BV4A 2JDUA 2JDYA 2XR4A 4UT5A 4CE8A 2JDMA 1OUXA 5A6YA 5A3OA 1W8FA 3DCQA 1UQXA 2BOIA 2JDPA 1OURA 5HCHA 3ZDVA 1W8HA 1OVPA 5A70A 2JDNA 2VUDA 2VNVA 2JDHA 2WRAA 5D2AA 5A6QA 1OUSA 2VUCA 4AOCA 2CHHA 5A6XA
chains in the Genus database with same CATH superfamily
1PVC2 5DAQA 5A7QA 1HB1A 4FOYA 1I5PA 1NA1B 3KGZA 4QDSA 2BFUS 1LTEA 3KCCA 3RMXA 1AL0G 3Q9OA 4DIQA 2WNEA 4DEQA 4QQHA 2A3WA 2WL1A 3HBZA 1CN1A 4XQWA 2C9AA 1ZNPA 2Q30A 1CAUA 3ZPOA 3C2UA 3MLJA 5LA2A 1O59A 3NL1A 1KDMA 1OPOA 3UV9A 4MHUA 4XMIA 2VZRA 4YVSC 4WVMA 3ASIA 4AG4A 1N3PA 1LOFA 1T6GC 4XFAA 3EB7A 2RM21 4AEJA 5D8AB 5FYYA 1STMA 3AZWA 4Q4V3 3SNMA 5C8CA 1URXA 1TME3 1UOBA 2W87A 5FJHA 5FP8A 5F5IA 1BYHA 2OQ7A 3DF0A 2A5ZA 4GMP1 2P37A 5FMBA 4D7TA 1AR82 3T08A 4ZU5A 3KQ4B 3GZTB 4YSFA 4CP1A 1GWKA 2O0OA 1ASJ1 1JUHA 1GP4A 3WQBA 1GQPA 1GWLA 3ZXFA 4Q4Y2 1K42A 5A3UA 3T1MA 3BUCA 2R6QA 5E88A 3HPNA 5GKAC 3I3QA 1V6KA 4BMBA 2HWB2 3LFIA 5F9TA 2WLPA 4CEYB 1ULEA 4E2GA 4FVVA 4LO4B 1SMVA 1OF3A 1Q8SA 4QXKA 4XOGA 5KHJA 4DUVA 4MH0E 1KFUL 3O0XA 4NR1A 2VE1A 3H8XA 2ZS6B 4TN7A 1YRZA 5FLJA 5JZGA 3BTYA 1PO11 4LITA 5FWEA 1IZ3A 4GWNA 3OGVA 1XNDA 3AYDA 4P9WA 3ZDSA 4QU2A 1TE1B 1F9KA 1GQGA 5BNQA 2VVFA 2JWPA 4OVEA 2XJPA 4ARYA 4C0HA 4JGZA 4CXWA 4D7YA 3VDCA 1PHMA 1OSGA 2Q1MA 4PLMA 2XBO3 3N7JA 4XXPA 5FPLA 5T54A 2ADDA 5F32A 2OUJA 5GLTA 2ID4A 1B09A 2NLRA 4BZ4A 1TVGA 2B46X 4GH4B 3TYJA 3N9NA 1AVBA 1ENQA 3P1IA 4N7UA 1VALA 5FTTC 4MZUA 4I2OA 4OUMA 3E5QA 4HANA 1YQ8A 4DEVA 2BNMA 4OFGA 4YVWC 1ZZBA 2BP6A 4AEMA 2YV8A 2VQ0A 5FJKA 3WF4A 1BXHA 3DPRA 1S0CA 4ZS3A 1Y3TA 2HWE2 3OGSA 5F2WA 3N7KA 4UW6A 1PVC3 2EXHA 2A6WA 4LOSA 1V6MA 1VJ2A 2DTYA 5FY4A 1AR62 3W58A 2WYFA 4K6BA 4FAGA 3HEIA 2R49A 3OB8A 4WM8A 4AGVA 4MO3M 4XF9A 1UKGA 2OKXA 3RG0A 4QPIC 5HCAA 3BTAA 1XJAA 1SDWA 2W68A 2OS2A 2RDSA 1PNGA 2RS32 4XIKA 4EV0A 5JOWA 1H9PA 2GDFA 1S1AA 1JU3A 3UGFA 4S2FA 3ZPYA 4AEDC 4JHZA 2ZX3A 5FXVA 1TMF1 3ILFA 3WNPA 3J4UH 5C9AB 3ZFEC 2W95A 1S0FA 4CXYA 1N3QA 3OSDA 4NRMA 1VBD3 3J7LA 3I2FA 5LBFA 4CDQB 3ZXGA 2VZQA 4JKMA 5EFUA 2J1SA 1OBNA 4Y26A 3N4MA 2VQTA 1CQ9A 2XQXA 4GA9A 1XSQA 2VNOA 1VBB2 4JQTA 3FN9A 1AR83 1XOYA 1H4HA 2GMMA 2HWF2 4YW1A 1NZCA 4NMIA 1WUVA 1UMIA 2VPVA 3LFMA 2E7AA 3CZJA 3AKQA 3WNNA 2B9VA 3VBHA 3WDUA 2XLGA 4LOTA 2KD7A 5FFOC 1X7NA 3T2QA 2VCBA 1ZA7A 3WUDA 1JHNA 3NJZA 3PUQA 4XEZA 3VBSA 5A6XA 3IIAA 2Q1ZB 2E31A 3LF7A 2HWB3 4XUTA 3WZ1A 4PLOA 3ZFGC 3LEKA 4LBQB 1DYKA 3CF6E 2HYXA 4H7LA 2XGXA 4PCRA 5DQ0A 5DZGA 3ZXLA 2VW1A 4EN7B 2NYYA 5F7UA 4QPGC 4LHNA 5IVBA 2P3IA 1RUG3 3DCQA 2WSVA 1UKRA 4EN9B 3VZOA 3LZZA 3MPPG 1LKNA 2YROA 4TLFA 1YUDA 1EV12 2VZUA 5I0DA 3THDA 4LO8A 2A3XA 4ZY9A 3OGGA 3AL5A 1POV0 2XDVA 4XUOA 1NUKA 1ND2A 3ZSLA 1SLLA 4B4RA 1ZBA2 3RYRA 2ZHNA 3GF6A 1JZ4A 2ARBA 3THPA 1G7YA 2XHNA 3THTA 4FPJA 1VRBA 4W4ZA 2F4LA 3NMBA 2XJQA 5FZDA 3ZIXA 4QX8A 1BZWA 5BNPA 1BEV2 3I8TA 4XJZA 3CBNA 3BTZA 5C33A 1Q5OA 1DGLA 1HIXA 5L9RA 1RUI2 4MV2A 2UURA 1HLCA 4NIAA 5SV8A 3ZFFA 5KC5A 5IVFA 4F83A 3NAPC 2YBSA 2JX9A 3VHOA 4CZSA 2PYTA 1ZYBA 4XUPA 4CXXA 3DEMA 4XW3A 3DYMA 3LOIA 1JYIA 2HWE3 2A6VA 4CDWB 3FLRA 3E1F1 4G4FA 2VQAA 4M3CB 3TN92 5F37A 4XHXA 2VOVA 4Q4X3 4XCAA 2WT2A 2X5IC 3AFKA 3V65A 3WP5A 2XLFA 4KGGA 5CADA 4S2GA 1FOD1 4V1PA 1ALYA 1H8TB 2DV9A 3K4AA 3RSJA 3RI8A 2WNUA 4META 5KHKA 5CG9A 2JDMA 1VBE2 1QOTA 2FBEA 3VD3A 4BLJA 4BJ0A 5C3PA 3WG2A 3B94A 5BNOB 4RS5A 4GKXA 1GP5A 4NRPA 4W6WA 3V0AA 4LXLA 4DY3A 2JE9A 1LHUA 3LQCA 5FOBB 4COWA 3Q8CA 3Q8FA 3W9AA 2JE8A 3KMHA 5LZ6A 3W20A 2G9GA 5FP3A 4PLNA 4X6RB 1KRIA 1GSLA 4IE4A 4UYBA 1VBB3 3S30A 2RVAA 2BGOA 1OFSA 4UFMA 3P6BA 3FC0A 2K9ZA 1IS6A 3MUZ1 3ABZA 4LBMA 3VD5A 2PHTA 3CNAA 2HWC2 5FBZA 2V5YA 2D7FA 1X82A 2JEMA 4JRLA 4INDA 1O5LA 3KD4A 3HNYM 3IAQA 3E6CC 1JN2P 4YGCA 4CU6A 1LODA 5L7OA 4KGQA 5HCBA 1XB9A 3P3PA 4HPKA 1FMD1 5HXVA 1OT5A 1D0HA 4IDZA 4N53A 4RGKA 5FLHA 3WY6A 4DRVA 3IDAA 3H8RA 2EICA 3EXUA 1QQP2 3U4SA 1AYM3 1H30A 3NVCA 4CDUB 1EV13 4EN6B 1C8NA 4AFCA 3LA7A 1OA2A 4YGBA 2H0VA 2RE9A 3ALQA 4NHXA 4XVHA 2VUJA 1NCRA 3MDPA 5FZOB 4PDWB 5HV4A 5IVVA 1BQPA 2NZ9A 5LY2A 4YZ5A 1GR3A 4DUXA 4MGYE 4S2DA 4B29A 4LLFA 1PO22 2RDQA 3JU9A 4H2AA 4Q4W2 3T0DA 1J59A 4W6XA 2HWD2 3QD6A 4M4PA 1Z78A 3ZSMA 4WM7C 2ILMA 1QJZA 4HOOA 3I3MA 1BEV3 1GWMA 5JR2A 4Y3OA 1JZ5A 4URTA 1GUIA 1X33A 1X8MA 1COV1 1RUI3 5CKQA 1NG0A 4CEWA 2DWRA 3M1HA 3MW3A 4IV3C 3CDZB 4LBOA 5T55A 2WAOA 2D40A 2FDHA 1VMHA 2WRAA 2W94A 4RQPA 4G9SB 3PMSA 4RR3B 1EPWA 1OUSA 4WVWA 3U14A 4KQ7A 3WW1A 3PTYA 4CA9A 1ZZ9A 4IETA 1VAKA 1OXCA 2JDZA 2WT0A 4FFHA 3C7FA 4X6QB 1O6UA 1AF9A 3VBFB 5C5UA 2BEOA 2WABA 1PK6A 3INAA 4LUMA 3ZX7A 1KS4A 1UZYA 2ZA9A 4JDOA 4K20A 3TN93 5JVVA 2YY1A 4LULA 5G05L 4B4PA 3DXUA 4LLOA 4GALA 2MNGA 4ZXEA 5A6YA 1R1A2 4PT6A 1UOGA 2RJKA 2EIGA 1MS9A 3ETPA 4GZ9A 2Z69A 4Q4Y1 1AR72 1VBC1 2FDKA 4YG3A 1GNHA 2RDRA 1D2SA 1JTZX 1ZRDA 1G9CA 2HBTA 4AQTA 3UJQA 1MQTB 5D2AA 5D8AC 5FRAA 1RXGA 1XSRA 3NJVA 1XC6A 4L9BA 1GQHA 1JYWA 5DG2A 2CYFA 4L2NA 2PHRA 4XJWA 5AFBA 1CAVA 1W05A 4CCNA 2QCSB 2X09A 1RUE1 4UW5A 3AFGA 1SQ4A 4XF3A 4DY5A 1QJX2 2QJVA 3KLSA 1OOPA 2WKKA 2W46A 4RHV2 2JDPA 4OMCA 3B01A 5ACA3 2HWC3 1BBT2 4GKYA 4NJ4A 3RMYA 4E4SA 5FPXA 1LU2A 2RMU1 4XABA 3DECA 1C4RA 3O1VA 4GULA 2FCUA 2XJRA 1KDKA 2VNRA 4HG6B 2HKXA 5GZCA 1WD4A 5L36A 3GGLA 4M0HA 2YC4A 4YVSB 5IVJA 3ZSKA 2Y6JA 3ATGA 1AL22 5FY0A 2Q8CA 3VB9A 5A1AA 2CAVA 2OPWA 2VOKA 2D3RA 4TLGA 1EAH3 2VMHA 5EIYB 1NYWA 2WINB 3JBG3 3M4FA 4ISQA 4XQDA 1HB4A 2VXRA 4P9YA 3L2YA 1OD3A 1KXGA 2ZX0A 3ROUA 2FD8A 1AR61 1F35A 1ULPA 2ZACA 4LJHA 1VAMA 2YGLA 3WG3A 1UPIA 4NAOA 1JZ7A 1QU0A 4LBQD 1R093 1UMHA 4Q4W3 1SBEA 3NV1A 1BK0A 1W6NB 2FDJA 4HKWA 3N9QA 1MEC2 2RS31 3RJRA 3SKJE 2W3JA 2D43A 4PBOA 4W65A 5IAVA 3N36A 4NVPA 4IUGA 4K1YA 2HEVF 1W9SA 3G6JB 3LCPA 1CIYA 2CU5A 3CJIA 4CCDA 3GNEA 2ZGUA 3OCPA 2EIBA 3H1WA 4GJZA 1XYNA 4J25A 5IFPA 5CFDC 5EHDA 2C4XA 1RVF3 3VL9A 1H0BA 4RGAA 5CFCC 1FPN3 4AW7A 3HT2A 1XYPA 4PHZA 2WFF2 5DUWA 4BXSV 4LBKA 4YWAA 1I9RA 3ACLA 3MUY1 5GLUA 4TSVA 3LDKA 2HWF1 2VULA 1E5IA 4YM2A 5JXGA 4NUBA 4NHMA 3LDRA 5A3LA 1REEA 2YC2A 4L11A 4BQ4A 4FTSA 5IYYA 1UL9A 1OH3A 1HRI3 1QJY3 1AR73 3AP5A 1DLCA 3LA2A 4Q0UA 4UXAA 4YLZA 2VCCA 3E5UA 3NV3A 1O4ZA 3RDIA 4DXRA 4CDXC 3JUUA 2K2SA 1POV3 1SLBA 2YG0A 1WW4A 4YVWB 2YPDA 2VU9A 4LKFA 2TNFA 1CONA 2VZOA 4KU7A 1HXS2 3K3NA 4MGQA 1PZ7A 3AZYA 1ZX5A 3OOXA 4AGRA 3T30A 1DZRA 1QWRA 2CGOA 5FY9A 1QJX3 2XXZA 5FYMA 1DIWA 1W9TA 5HV0A 2GC3A 1V0AA 4HK9A 1N1SA 3D0SA 2P4EA 1ZBA1 4IV1C 4RHV3 1W9YA 4JHTA 3IPVB 1CD3G 1NZIA 4QPIB 3EO6A 2XH6A 4CCJA 3VD9A 3B00A 1RIRA 4WZFA 3D5OA 4FOWA 3FFQA 4IGPA 1WCSA 1SDDB 1JBCA 1LEDA 2VCAA 1W8UA 2VBDA 3LDBA 4ZZ5A 1ULDA 4J6GA 3KGLA 5DN2A 4AEDB 3BU0A 4YM0A 1CVNA 1WCQA 3VKOA 2ES3A 4QX5A 1US2A 3ZFEB 2PLV1 4BQ1A 4BPZA 2BBVA 4XFHA 2G4IA 1VIWB 5DDJ2 2MEV2 2YBPA 1E5HA 4PI0A 5IATA 5JXIA 1KGYA 1O8PA 4KNCA 4Q27A 5DG1A 2WT1A 3M70A 3RNSA 3WW3A 3POIA 4AVCA 2VUDA 1HKDA 4Q1PA 5IK7A 4PIYA 2GH2A 4UW3A 4Q26A 4A3ZA 4ASMB 2AR6A 1UYXA 5I0UA 3SHRA 1U5YA 5A3MA 2A6ZA 3K3OA 1H8VA 1YWKA 4YW3A 5LBBA 1Z7S1 4C0BA 1AR93 2R7EB 3I2GA 1I6XA 4E8CA 5FBJA 3HVDA 2B9UA 1EUTA 4OQ9A 1CX1A 1FV2A 4XC9A 3QH6A 3WR0A 4ET7A 1VBE1 1XE8A 4P00B 3ZFGB 4ARXA 5CKNA 2HEWF 2IXLA 5F3GA 4BLIA 3O1UA 1AJKA 2Y6LA 3EJKA 1CZTA 3LEMA 3SEPA 4QPGB 4BDVB 4YG6A 4BHPA 4NN0A 4BISA 3USUA 1WA6X 2TUNA 1QJEA 1K5MB 2DU0A 2UWAA 4P9IA 5FO9B 3POEA 1L3JA 1UOFA 3CZUA 1JS9A 1UY0A 3I97A 3J8F3 2I2SA 1VE0A 2RV9A 3RYPA 2BV4A 1QY4A 1UAIA 4J1XA 5FY8A 3HNBM 1VPHA 3MBWA 5KHIA 5LY1A 2Y6KA 5BNOC 4C1WA 4FTEA 2GNMA 2PQQA 1SHWB 3BCWA 1NCQA 4HN1A 3QH7A 1LB2A 3S5QA 1QQP1 3ZN6A 3NAPB 1UX6A 4YW5A 5EJ1B 5EP9A 1XE7A 2AUYA 2YB7A 1UYZA 1RHI1 2PHDA 1R081 2GALA 5FK7A 1NQDA 5FPAA 4XF1A 1RMU3 3MIHA 2Y26A 4MOAA 1GZWB 4GWMA 4JAAA 2B39A 4LKSA 4QPWA 3WLUA 3ZXJA 2R041 1ZRRA 4AYUA 3G7DA 4XUQA 4XFGA 2ZZJA 2X5IB 5LBEA 1EP0A 2KA3A 2OQ6A 3AJYA 3BYWA 1PO21 1LOBA 3MYXA 2HWD1 4EWAA 4TXWA 2C24A 3LPFA 4JDNA 4XBNA 3L2HA 1DGWX 4IE7A 4AQ2A 5A70A 1W6OA 3MF6A 2AH2A 3WW4A 1ENXA 2WC2A 1BVP1 2MEV3 3LIGA 1CAXB 3VDDA 2OIIA 3O1RA 2RS12 4LA2A 2Y60A 4Y20B 2ZGMA 3VBUA 4WBBA 2W47A 3M7AA 1IG0A 3E97A 1IKQA 1EUUA 3MW2A 4CTEA 3WG1A 1A8MA 3VHPA 3ZKYA 4B7KA 3VDAA 1VMFA 4AVVA 5CEHA 3N9PA 2BDRA 2ZCWA 4BQ5A 2VL4A 4ASLA 1R1A1 3KM5A 4QMAA 2D3SA 2QZ3A 2WZ8A 4HVOA 4NHYA 2JG8C 3M3IA 3OY8A 4QHBA 5GLVA 4ORFA 3U75A 3VLBB 4NIHA 1BCXA 2VGDA 3NV4A 3M3CA 3PTRB 4AI8A 5C4WC 3UNPA 3WX5A 1JMUB 5KC6A 1DQ1A 4RR3C 5FZ7A 3T4HB 5JLVA 2R072 1PGW2 2R1DA 4YARA 4K9SA 1OD5A 3UETA 1EY2A 1LESA 3I59A 5L73A 2XPJA 3MHZA 5A3WA 3VBRA 2ZAAA 1JOPA 5FUIA 4E4ZA 1NLRA 1J3QA 2BZDA 4M01A 2ZEZA 2I07B 1RUF3 2XBO2 3JD73 3ZM8A 5BXXA 3OYWA 3A7QA 1H1IA 1VRH1 2KM2A 4LO7A 1H9WA 2Z79A 1OC1A 1CR7A 2XJUA 2JD9A 1Y7BA 2DCYA 3SISA 1UO9A 2DYCA 5FMCA 1BJQA 1CIWA 1W2TA 2GN3A 1BBT1 1UZWA 3EHKA 5J48A 3ACIA 2XG3A 5FPBA 4JKKA 4IEQA 4WM7B 3GCXA 4COUA 2GC1A 3POWA 2WN2A 4MXWA 3ORJA 3WW2A 5JSOA 1F2NA 1Q43A 3M8LA 5FZGA 4YRDA 4OHYA 4K40A 3USSA 1AL21 3GZAA 4DB5A 1VBA2 2JDKA 1MS1A 1SACA 5BPXA 3UGGA 4AE2A 3J7NA 3JCIA 2D5FA 5F6KA 2R0FA 2BWAA 1V9U2 1LOCA 1OMIA 3JB4C 1W03A 2JECA 3ZOIA 4FPKA 4BQXA 3X29B 2ZKLA 4N43A 1SPPA 3T1LA 5FOJB 1F5FA 1W6QB 2BFUL 4DINB 3GDBA 4R4ZA 4MVTA 2AZ5A 1YQ5A 1YNAA 3OPZA 1JW6A 4XMAA 1VLNA 1GFF2 2ZEYA 3C7OA 4QKBA 1MEC1 1UY2A 1UY1A 4EWEA 1VBD2 1JXNA 1MS8A 2JD4A 3BALA 4YW6A 3RZJA 3D0JA 4GB31 2A75A 4GWJA 2E53A 3VBOC 2ARAA 1MS0A 1Q56A 1YEWA 2HLEA 3MV01 1C8M3 1W06A 2XVLA 2ZZQA 4XDOA 3HJRA 3OGJA 3R05A 4XYXA 2X8KA 3PURA 2C9KA 2Q5TA 4SLIA 3LPGA 1MS5A 2RS13 3PU8A 2XONA 1E57A 1WCKA 1WLCA 3NNGA 4YPJA 4FPOB 4M4RA 2IXKA 2IXJA 1QGLA 1QH6A 2VOXA 2WFF1 3ECQA 4N9IA 4NOTA 5IVYA 2WLQA 2XHKA 3NKTA 4ZU7A 3OBRA 3ACHA 4XBQA 2WAAA 4CUCA 1H2LA 3LEIA 4ZXKA 4UF0B 5KHGA 3D82A 1OLMA 2W52A 3M2MA 4MGIE 4XF4A 3KCXA 4AVBA 5FXWA 3HBKA 4NHLA 4AOCA 2RJ2A 4XFBA 3JXSA 4H3WA 2E26A 4CP2A 2YYOA 1LHWA 1RUG2 2P6HA 5FCCA 2CY6A 1QNWA 2R073 2QQOA 3AZZA 4FO9A 1H6XA 4QX1A 5T3NA 1RUJ3 2JDYA 1UCXA 3SC7X 3KHCA 1NE6A 3C3VA 3WP4A 5AC92 2KXLA 2VNGA 1HXS1 2XQRA 4IE6A 3AMMA 3NAPA 3U10A 5A32B 4AVTA 2GNTA 1UX7A 2NP0A 2W2IA 4QU1A 1IS4A 4XF0A 4OHVA 4AI3A 1FNZA 1SLAA 4NO4A 4EROA 1HB2A 4I09A 4IL7A 5BY5A 2ORZA 3OEAA 4UFLA 2X53S 1QEXA 2YZ4A 5IK5A 5FZ9A 3HMYA 5A1LA 3IMMA 4LHSA 2HBUA 4CCKA 2WNVA 1W8NA 5IHRA 5L7OB 2FDGA 3H42B 4AI0A 4ATEA 1QJU3 2BERA 4E2QA 1ULGA 2WZR3 1XNKA 2LW8A 4B1MA 5IVCA 3VD4A 3MFCA 5A7PA 2VMGA 5JXHA 5A3OA 4QB1A 3ST7A 2FCTA 5KR7A 1OLME 4LA3A 4KBBA 1B35B 3DKWA 4XTMA 3VKMA 1Y4WA 5DDJ1 4D7SA 2A6YA 1VBA3 1DQ0A 5CFDB 1T2XA 2E51A 4FQ4A 4QM8A 3RJ2X 4Z92B 1BK1A 4BQ3A 4Q4X2 2LTNA 5CFCB 5T5LA 1V9U3 3HD8B 4MGKE 4CP9A 2WJSA 4HLTA 4A4AA 3ZMOA 4XILA 4C91A 3T09A 3TAYA 2VMFA 5ABJC 1ZRCA 4K7JA 1XNAA 3PJQA 3VN4A 4GXLA 3BOWA 3IDEA 2I45A 3OBTA 2G9ZA 5FZMA 4YZ4A 2DF7A 2VM9A 3AKTA 4QGLA 1GMMA 4QB6A 4FI9A 5C70A 3M3QA 2NMNA 4Q29A 5KHHA 4EN0A 4OUSA 2ZMKA 1POQA 1GOGA 1AJOA 3SEEA 3WUCA 3SLIA 1DHKB 5FZKA 2W5FA 2WS92 4CDXB 3FX3A 4QHZA 3RVHA 2PHLA 4B1LA 2D6KA 3GJAA 2XL7A 3H3LA 1VAVA 4W6YA 1RB8G 3RWKX 4CVUA 3W5MA 2VVDA 1M4WA 2JG9C 1RUH2 2Z42A 4Y4RA 1J83A 1UOJA 4FQZA 4XCBA 2D6LX 1W8TA 4IV1B 3AKRA 3JQWA 3RZLA 1HRV3 1O91A 3ZXDA 2OW4A 5J98B 3WNLA 4EZHA 2R061 4B4QA 4UI9L 4MUVA 3VHRA 5E1RA 1UNBA 4BK5A 1DZQA 3B9IA 4LHKA 1S0GA 2A73B 4YGEA 1AYM2 4AI2A 4H7MA 3TB0A 1K5MC 3PDQA 3WV6A 2DURA 5CU1A 4CYDA 4IV3A 2XUEA 5AC93 4LE4A 1AX0A 1M06G 3U4XA 1CAWB 1PNFA 1CJPA 4ZHNA 3IZOA 1NA1A 4Y5Z0 3N3HA 1RXFA 3MFAA 5HCFA 4GQ7A 4LBJA 1SEFA 2PHXA 1L7LA 3RRDA 1TQ5A 4HZFA 3V0BB 3WG4A 5F2SA 4A2UA 2VZTA 1UXXX 3GJBA 3IAPA 1REFA 2ET7A 1QDCA 2JJ6A 5DABA 1FATA 1GZ9A 2EF6A 2J22A 2WQZC 2F6BA 3PVOA 2BGPA 2WNOA 1UF2C 5E16A 3BU7A 4JGYB 3LSEA 4I0WB 3WF1A 1PGL1 2QE3A 1Y9GA 1O3RA 3O1MA 2VOTA 4NPMA 5LBCA 4GWIA 3MIGA 4XJ9A 5K0UC 2VY0A 4Q4V1 5D8AA 2OYZA 3S5AA 1TME1 1UZZA 3GZEA 2QKDA 1PMHX 3GM8A 3UK9A 2VQUA 5FO8B 5I93A 5FYUA 2QFEA 3IIIA 2QTWB 3O7OA 1CX4A 4HXCA 5JZGC 2YFUA 1HDKA 5A7SA 1ZBE2 2ARXA 3F2ZA 3KQRA 2IXCA 2DCTA 1S2KA 2CV6A 5BNNB 3BPZA 3OUHA 2DBNA 1LGCA 4JDMA 2VR4A 4KG0A 4JGZC 3Q8AA 4TYSA 2VMDA 4Q8KA 5DZFA 1D0GA 1QMJA 4CEYA 1JUIA 1G9AA 2V4VA 4NIDA 4AR2A 4CSWA 2XWJB 3HQXA 1YXWA 3S57A 1PGW1 2WS93 3HWJA 5J09A 4XIOA 2G19A 2B5HA 2XKPA 4BU2A 1G6NA 5A7WB 2ENRA 4IEOA 2D5HA 5I0RA 3RZGA 2C6SA 2Y38A 2HJIA 2OXBA 2CWMA 3MPBA 4Y24A 4FAHA 1C28A 2XBO1 1ZZCA 4UOJA 1DGWA 2Q8OA 3FLTA 5ACA2 1N47A 1RUH3 3POBA 2Q8EA 4P14A 4NWVA 4BM8A 2UYAA 1VB4A 1W8ZA 1YHFA 3BIWE 4L8QA 3KF3A 3AJZA 3ME2A 4GH4A 4LBNA 1AXZA 5IFTA 1Q3EA 4O7XA 4Z82A 3RZKA 2ZGRA 3ZKUA 4AQSA 1QXJA 2VBBA 4WM8C 4COVA 4LO5B 3U07A 5EPAA 4BYYA 4CRQA 1SFYA 2D6OX 5ERLA 2QDRA 4C8DA 1KJLA 1EAH2 2DDUA 2DFBA 4RD7A 4GMP0 3JBG2 1US3A 2WO1A 4LEJA 3I49A 2EAAA 1ZVFA 1PVC1 2ZAHA 2E6VA 5APAA 4R52A 5KXEA 1H4GA 4YYOA 1H2KA 1WCUA 5DAPA 1WW6A 1F5JA 1RUD3 4QQPA 1S55A 4OHXA 3U78A 4QD2A 1R092 1H2MA 4HVQA 5K7PA 4KG8A 1DQ4A 4D6SA 2IFWA 5JIUA 4ZKTB 3AZVA 1A8DA 1PIV3 4QHOA 2JG8B 2JDNA 4BA6A 1V6JA 1QDOA 1J1TA 3UKNA 2D93A 5C4WB 2WA3A 4N7IA 3FWEA 4MG2A 3O12A 1KITA 1FT9A 1VBD1 2BU9A 2EAKA 4HL0A 5FUNA 3VBHC 4RN5A 5C9AA 1SLCA 4YZ3A 4AXOA 4CDQA 1KEXA 3VBSC 4QAWA 2GNDA 1N3OA 1RVF2 2VECA 2ATFA 3NRUA 2W91A 3MV11 2Q8DA 1FPN2 2P1BA 4LKEA 1IS3A 3K77A 2PQSA 2LALA 3WQ1A 1AR81 4DXTA 5F39A 1W8FA 5DAXA 3DN7A 2GNBA 3PUAA 5JWPA 1ZBE3 3HIFA 4IGOA 1HRI2 1QJY2 2PHWA 2VW2A 4P9JA 3WDXA 5A33B 2EIEA 4M00A 1ZZ6A 4QXHA 3A0KA 2HWB1 4XFCA 5A1FA 2ZEXA 4LBQA 2VZ1A 3AXEA 1C1LA 1L7RA 1MS3A 2W08A 3FBYA 5FR3A 4IEUA 5C3SA 5C3QA 2DCZA 2WR9A 1RUG1 4Z2WA 2D97A 1CPMA 4AI9A 2ZMLA 1RITA 3MEPA 1OHFA 2EXJA 1ULCA 2P34A 1WLDA 2PAMA 3LEGA 3R0RA 3KT7A 1W6MB 3OPWA 2WWSA 5LASA 4CUGA 4AFBA 3ZFFC 1UU5A 3TWIA 2NPIA 2DVAA 5F1RA 1QIQA 5JI9A 4R9BA 2RJLA 3WOGA 4XHBA 3N7MA 4LIUA 5ANNA 1Y9QA 1YQ6A 4LTAA 4ITCA 1S2BA 4WVZA 4FBFA 2F17A 2VZVA 3EBRA 4TTGA 2XUMA 1YI9A 2A6XA 1YIFA 4IQPA 4DXSA 1T6BX 1GZTA 4ASKA 3T0AA 1QF3A 3T3YA 2BQPA 2ZGOA 2ZGKA 5L9VA 1D4M2 1DQ6A 1SFPA 3WDVA 3CEWA 5A3TA 2WNUC 3M3EA 1APNA 3T4VA 1OH4A 3VBOB 3K4ZA 5A80A 2HWE1 1DQ5A 4FOQA 1MZFA 2P2KA 4K3UA 3PU3A 4CDWA 3MGUA 2WIIB 2EA7A 2DUPA 2VJXA 4M3CA 2BBAA 4QXCA 2NN8A 1LGNA 4Q4X1 2E7TA 4P08A 2PHFA 1IPJA 1AR92 1MVQA 1I3HA 3QLQA 2D44A 3CL1A 4D3WA 4D6QA 1A34A 1H8TA 4Q1RA 3PUIA 4H14A 4L99A 1WBLA 2D6NA 1W39A 3JQXA 3LE0A 4FTBA 1GBGA 1SLIA 1OLQA 2AYHA 5I0TA 1DYPA 3NKGA 4WZCA 5BNOA 1B35C 3B69A 3AM2A 3OUJA 5LA0A 4QXBA 4QX7A 2X10A 4CCLA 3O0VA 3IN9A 1JYNA 1XE0A 3MIEA 5L7OC 5KBFA 1SZBA 1AYN3 1VR3A 4N53C 3VD7A 1VBB1 4DFSA 3T2OA 3UKVA 4FCAA 5D1IA 2BRTA 4XAEA 2YUEA 1UXZA 3KHBA 3J8F2 4OHWA 4OLLA 5FO7B 4QKFA 2RM22 3A22A 1UN1A 2RR13 2VAUA 5JDBA 2Q0AA 4Y22B 4OULA 3B93A 1G9DA 1Q8QA 1DGRA 3SCGA 3DYPA 1NCRC 2DTWA 2ZMNA 1O3QA 5EQUA 4KWLA 3T2PA 5IUQA 3WNOA 2J7MA 2WUHA 3F95A 1ASJ2 1W90A 1ENSA 3CJXA 4EJRA 2QQKA 1NY72 1W04A 2V09A 1AYM1 1JOBA 4IE5A 2ZGNA 1BKZA 1EV11 1CZVA 1WMDA 1X9PA 4CDUA 3RZZA 2GMEA 2SLIA 4Y5TA 1RMU2 4CEWC 4A42A 4F7ZA 4RQPC 3FUQA 3K46A 3MIFA 4PDWA 5FZOA 5FUPA 4EN8B 1GYKA 5TSWA 1Q8OA 5ABJB 5FMDA 5EJZB 3GBWA 1UPSA 2R30A 4D94A 1PK6C 2QQNA 1DU3D 2WWJA 4EZ4A 4IEYA 5E89A 3SH3A 5I0SA 1BEV1 3DKQA 5FZEA 3AX4A 5KXDA 2RDNA 1S0BA 3NWKA 4G3YC 4GAZA 5B4XA 4I0AA 2ZHMA 1ZM1A 1RUI1 4YNIA 2CDPA 1SG3A 2VBPA 3HNMA 1ZRIA 3QACA 5BYNA 1DLLA 1GV9A 1D4M3 1RYYA 1WGPA 1F31A 1W6PB 2CNAA 3ON7A 3POJA 2R16A 4PF1A 4RL7A 4RR3A 4UFJA 5EZWA 3NO8A 3TEXA 3K75B 5KXCA 4FFFA 4MGTA 3VBFA 4E4DX 1W2OA 3AZXA 1NLQA 2J1AA 2VUCA 1JYCA 5K4LA 3ZXKA 3TN91 1WCDJ 5FQ0B 4WVVA 4JZRA 1RUC3 2JG9B 2V72A 3CMGA 3N9MA 5FYZA 3MIDA 4FXGB 2AC1A 1DG6A 3S0MA 4A7ZA 3ES1A 4JGYC 5E8AA 2OT7A 4ATFA 2RS53 4AHXA 1OOPC 1F15A 1UY4A 3IDBB 5FZ6A 1K12A 5LEKA 1Z0HA 2BNOA 1U12A 3BGAA 3KV6A 2DUQA 5FPZA 1MQTA 3OD4A 5IK8A 2LM3A 1HQWA 1RUNA 5I8TA 2E9QA 3MIBA 3O1OA 5FZHA 1HV1A 2ZKNA 1CAUB 4Y1YA 1FYUA 1CWPA 1ND3C 4OCTA 1RUF2 1U5IA 2NQYA 3JD72 4JX0A 5BV6A 2BTVC 5DMYA 2XOMA 3P3NA 1U5XA 4WVMB 3I7DA 4K21A 5BNNC 4R8HA 2P5BA 4AEKA 4UFIA 3RS6A 4HMZA 3GCWA 2YGMA 5ACA1 1UU4A 2HWC1 2AEYA 2RM23 1V70A 5HXMA 5C8CB 5FZFA 4CCEA 4Q0PA 4L97A 2ZHKA 5FPVA 3CLPA 3HR9A 2UU8A 4V2VA 4GMP3 3WINE 2V4AA 5GLZA 2X05A 3UL2A 3WD5A 4XQ4A 3D4KA 3NSTA 2PA7A 2WQ4A 1J58A 1N1YA 4DXZA 5FDBA 1ASJ3 4YVSA 2JICA 3ZMNA 5K0UB 4OHZA 1X9TA 1EAH1 3JBG1 3AKPA 2AGSA 4LK7A 1PX4A 3CJIC 2BOJA 2P17A 2P3YA 1YIPA 2R32A 3ZYJB 4AL9A 3GZUC 1OI6A 4R9AA 3RPQA 2QQUA 4Z2AA 4ES9A 1OUXA 3AK0A 3LSDA 2VW0A 4ZU4A 2XJVA 5JZGB 1R091 2C0ZA 4Q4W1 3MI8A 4R9DA 5FYCA 1PO13 3SCHA 3ZYRA 5JPNB 4Q8LA 2E7QA 1W6NA 1WZXA 2BVBA 3AP6A 1JU4A 4L92A 4LO6B 4D8MA 1D4VB 4JGZB 4KL1A 2DCJA 1JHJA 4FPEA 4PQQA 3UGHA 4XUNA 1NXMA 3OBZA 1C8M2 3H1YA 1AX2A 3A0NA 3BIEA 2BVVA 3ZYBA 2NMOA 1N1VA 2FMDA 3J7HA 4XJ8A 1J3RA 1RVF1 2ZX1A 2Y33A 2Y0OA 1ENRA 1FPN1 1W2AX 1IOAA 2W1QA 1Y43B 1YLLA 2ZTNA 4NE9A 4XJUA 4CE8A 2IXHA 1ZRFA 4LPLA 2IXIA 5FXZA 5FP9A 3POYA 5FK8A 5FPUA 1W2NA 3DPRB 5CG8A 3MLKA 4NIGA 4NHKA 3OF1A 2F4PA 4A7KA 2IVJA 5DAVA 5I91A 3AYEA 1HRI1 1QJY1 1AR71 4JCKA 1OQDA 2W0XA 2DVDA 1BHGA 3NNMA 3ZO0B 4AHYA 1NXD1 4CP0A 2UY9A 3N35A 1YI7A 2B45X 2VMEA 1O4YA 1RUJ2 3CU7A 4WM8B 3ZN4A 3PL0A 1POV1 1XU2A 2R1BA 3PVBB 5IT6A 1OA4A 1IPKA 1FOD2 1X8EA 2ZPXA 4YVWA 4BCUA 3KF5A 1AX1A 3WHUA 4A7YA 2WYSA 2GP3A 2JE7A 3J26N 5LEJA 2PAEA 5F5CA 5FMOL 2H6BA 4YGDA 1RJ7A 1WBFA 3KCYA 1QJX1 2QNKA 5CA6A 3UT0A 2VZ3A 4U2AA 1TMF3 3EMRA 4YW4A 3ZYIB 1YFUA 2J1TA 3ILNA 1RL3A 3MF9A 3IKWA 4A6SA 3AYCA 4RHV1 5J36A 3W59A 1JZ2A 5FZ8A 2GH8A 4QPIA 2MPFA 3IPVA 1WD3A 3SH5A 3T2TA 1PZ8A 3FJSA 3EQEA 2BUKA 1QJU2 1WWYA 2XB6C 2MHFA 1LOAA 1LNSA 2WZR2 2PN5A 3H50A 4LK6A 5IAXA 2G1MA 3TEYA 3GBGA 5CYYA 4AF9A 4AEDA 1SBFA 3OG2A 5FYTA 2YMZA 3ZFEA 3VBHB 4FPHA 3KV5A 3I2IA 4HONA 1RGSA 3VBSB 3GXUA 2ZXQA 4PIXA 2PTMA 1Q8VA 1RTVA 2WDBA 4FFGA 3NNFA 4UW4A 5FKCA 5CB7A 2O1QA 1FMD2 1LOEA 1G86A 1HQNA 3R4DB 2GSYA 3M3OA 4PQ9A 5CZKA 5CISA 5C7GA 3FZ3A 1AR91 4URAA 3PVEA 4UFHA 1DYOA 1QXPA 2VNVA 5EJ3A 3WSOA 4MGSA 2EXKA 5BUVA 4Q0QA 4AZZA 1ND2B 4QGNA 3KVAA 4QWNA 1LOGA 2EVXA 3ZFGA 3WNMA 5I8SA 2DVFA 2V73A 2ET1A 4N9HA 3BI3A 2JDUA 2FZ1A 1BMV2 5F6LB 4QPGA 1LHVA 3IT8A 2DU1A 1SBDA 4NWWA 1C1FA 3HOBA 5DAWA 1ZZ7A 1OF4A 3PUHA 5DZEA 2WWUA 4XAAA 3O14A 1LJ7A 2ZBJA 4BQYA 5BNPB 5FY7A 1K5MA 1LHNA 1AXYA 1OFNA 1UIKA 1WMFA 1NCQC 4NROA 1S0JA 1COV2 2WQ8A 3D8CA 4C90A 3ZFFB 2VUAA 3CHXA 1NT0A 2CSGA 3ELNA 3J8F1 4Z8BA 1RJ8A 1HRV2 2GP5A 1VB2A 3UYJA 1NAEA 1PZ9A 4NRQA 4D69A 3QOPA 3EYPA 4I01A 2BWCA 2WSUA 4E8DA 3OPTA 3KT1A 1OVSA 1MZ5A 3HN1A 4HFSA 4IE0A 4A6OA 5FP7A 1IHMA 5AFEA 4BIOA 4N90A 3KV9A 2PFWA 2Z4FA 2CDOA 4AAPA 5GZGA 1FOD3 1WW7A 1BVVA 2WNUB 3SXWA 5JUVA 5K0UA 1MACA 1NY71 3S6PA 1VBC2 5IK4A 4AK3A 1C3HA 1OA3A 2EIDA 1XPWA 4MYEA 4PJYA 3KT4A 2C26A 1RMU1 3J9SA 3QBQA 4DQAA 2UWBA 4YFZA 4RS5B 4XZUG 1J84A 1GZWA 3V0AB 4UAPA 3FHQA 4CCMA 4LUKA 3VDDC 1GP6A 1S2EA 2X5IA 3VBUC 4KI5M 2AREA 3NNLA 1JZ6A 3LKJA 3AKSA 1RUE2 4LORA 1RINA 1HV0A 1FX5A 4W8JA 3BODA 4K8RB 4P5YA 4COZA 4FPGA 2XLAA 3WCRA 2LRPA 5LRRA 3WT3A 1UZ0A 4XACA 2IC1A 1WMEA 4B7EA 3PMEA 1HW5A 4IESA 3LB9A 1IS5A 2O8QA 2J1VA 2VD7A 2VO5A 2YHJA 4FPCA 2MEV1 1REDA 1DP0A 3R4UA 1H2NA 1XRUA 1YCIA 5FZBA 1CAXA 1TZOA 5M0TA 1DBNA 2RMU2 2WZPP 4Y20A 5T50A 1QNYA 3I2HA 5E6HA 2D3PA 4O9EA 1XNCA 3H3ZA 4HPKB 2E32A 2QBXA 4N53B 4Z1VA 3H1MA 1FMD3 4YM3A 4I30A 4NAMA 1LRHA 3K4DA 3VBRC 2Y6HA 2TBVA 1MVEA 1R64A 1UMZA 2P3KA 1U5ZA 3E6BA 4CPBA 4QDQA 4Y1ZA 5FYIA 3VZKA 3R6SA 2YU1A 3SCFA 4XFIA 1YFWA 2LS6A 3NQHA 2YU2A 2YPJA 3OGRA 4K8FA 1LCLA 1NCRB 4DS0A 4ZZ8A 1FV3A 1YQ2A 5GM0A 2YFZA 1N1TA 3N7LA 2W39A 1TG7A 2QQLA 4MX3A 3WHTA 1QHDA 4RYDA 2SBAA 4OQ8A 1OKQA 4HVRA 4XDQA 3LGRA 4XDPA 1RUF1 2XWBB 1GNZA 2NM1A 1S0EA 3JD71 3IMNA 2K46A 3O0WA 1J1LA 2P6CA 2D98A 4CEWB 5CBLA 1COV3 2DFCA 2D6PA 1DF0A 1YJLA 4AAXA 4RQPB 1S0IA 5B4NA 1NE4A 5FV3A 3P5BA 4QGMA 1O3TA 4UT5A 2YDEA 1JOJA 1ODMA 2PAKA 2FZ2A 2Z2SB 3Q8BA 1PVXA 5F3CA 1PK6B 2VTXJ 2ZGLA 4XPVA 4WM7A 1XBFA 4COYA 1UYPA 4LR4A 4AI1A 5L19A 2GN7A 4N43C 1IPSA 4MLOA 3VKNA 1FI2A 1UU6A 2OPKA 1SCRA 1WMXA 4QM9A 3W5NA 3APBA 2LUWA 2PMWB 4JTNA 4YM1A 1GU3A 4Q4Y3 4AGGA 2DVBA 2JDAA 1VBC3 2HH9A 1LOFC 3NJXA 1BLZA 1RUD2 4CPBD 3MLLA 4OUEA 3CQOA 2ZGTA 1KS5A 5C8CC 3ACGA 5EV7A 1F4AA 2GC0A 4YZ2A 3PVNA 4S2HA 5F8PA 3LA3A 3IB3A 1W6QA 1PIV2 2PXJA 1CAVB 4IEVA 1XU1A 4GJYA 3CKHA 3ZR6A 5LCWL 4AWDA 1GOFA 1RUE3 3ENRA 1LHOA 5K9YA 4HKOA 4V2WA 1OOPB 2QDNA 4E27A 1W2UA 3RFRA 3VZJA 1UWWA 4M0NA 2A1XA 5FY1A 3K48A 1S0DA 1C8M1 4B3NA 2VMCA 2YBKA 2RS11 3AVRA 3SQOA 2RMU3 4JTOA 2JB4A 1ND3B 5GLWA 3OBAA 3PJYA 1WKYA 2A3YA 2VTFA 5CAZA 2XR4A 4XXAA 2BNNA 4H55A 4OYUA 4Y33A 2PLV2 1DFQA 3AP7A 3HN3A 2D6MA 3B5LB 4AVSA 2FDIA 3RWNA 1W8OA 2H6CA 1QKQA 4UF0A 3GYDA 3SKVA 3TOJA 5HBAA 2WZEA 3BPSA 4KBZA 2OZ6A 4ES8A 1A6CA 4FP3A 4DMIA 4FOVA 3NV2A 3ZLIA 4DRRA 1QJFA 3C7EA 1L7QA 4DNYA 5F3IA 1FAYA 1W8WA 1AR63 2R071 1WLWA 2JIGA 2VOWA 3KS7A 3POSA 5JPMB 1RUJ1 5D21A 4BE3A 2OX0A 4LIVA 3KSCA 4XFFA 1Z7S2 3I2DA 4I3PA 4OI4A 4XTPA 3AVSA 2KR2A 4K1ZA 3TRSB 2A70A 2WNVC 5FZAA 5H9QA 4FP2A 4O9GA 1O5UA 2RS33 2ZEWA 4A44A 2FDFA 4M3CF 2RHPA 4R4XA 3VGIA 5A32A 2WN3A 2FHRA 4FFIA 3CJIB 3DPRC 3ZXEA 4D6RA 4UBHA 1X50A 3PLQA 2JKXA 4LMFA 2XJTA 4JKLA 2YC0A 3W21A 3FHIB 3WF2A 4LHLA 1CPNA 1K5JA 3VZNA 1JZ3A 4XETA 3OEBA 3ZR5A 2GU9A 4LE3A 1PM7A 1LR5A 2ZGPA 5JOZA 2JDHA 3WQ7A 4UWDA 1QJU1 3U0ZA 1W9WA 2WZR1 2VH9A 4YFWA 1O7FA 3AP4A 3D3AA 2HWF3 1U0AA 2PELA 2CHHA 3WDYA 3AC0A 3VL8A 5C6CA 5JAXA 2Z5WA 2ZX2A 2BJSA 2ETEA 1HN0A 3SMHA 1H1AA 1MS4A 4IGQA 2IZWA 1B35A 2ZABA 1VBA1 3N9OA 3H8UA 4KMQA 5FYHA 5FZCA 3BKZA 3AL6A 1WA4A 3FHAA 5CFDA 5GZDA 3CO2A 3K2OA 2UY8A 4Z07A 5FREA 1EPZA 5FZ4A 1V9U1 4NPLA 5CFCA 4AFMA 3B7MA 4P02B 2O8OA 1LULA 3I3EA 2Y64A 3R4SA 2RG4A 1NOVA 2XVKA 4A41A 3A4UA 5CIRA 2UWCA 1XXNA 2XKOA 3B9CA 3BB6A 2C5DA 2IUWA 3WP6A 2QVSB 4OZOA 5IJRA 3TNPB 1W28A 1RHI2 2J42A 3KB5A 3WNXA 1R082 3VUOA 4AHWA 4QX3A 1HB3A 4FSJA 5JI7A 3ZVXA 1YJKA 5FKBA 4BWOA 2R042 5LWBA 3U11A 2GC2A 4QDRA 2ORXA 1XNBA 1ZBA3 4R9CA 3KVBA 3I54A 1KD7A 4CDXA 5FIXA 4EE2A 1AYN2 1ZREA 1BMV1 3N9LA 1JODA 3FE5A 2H0BA 4ZONA 4Q2FA 4BIFA 4QQ2A 4DPNA 2BW8A 4HSLA 1XYOA 4HETA 1GZCA 4ZPIA 3KZ4C 4MADA 2RR12 5J96B 1G9BA 2PLV3 1JZ8A 3K51A 1ND2C 5FZIA 1HRV1 4IV1A 1NA1C 4E2SA 5DXDA 3GHMA 4CCCA 4JV4A 2XJSA 1QH7A 1Q8PA 2DVGA 3A23A 3KV4A 4I3GA 5J37A 5A3PA 2DUOA 2GZWA 2FQPA 4IEPA 3ZSEA 2ZOEB 5BNPC 1WLTA 3B02A 4BXFA 1Z7S3 1A3KA 2WO3A 3ZXAC 5AC91 4HBNA 4PBPA 5L9BA 5LK5A 4LT5A 4MXVA 4FPFA 5JOYA 1GKBA 1CAWA 1VBE3 4QQOA 4P9LA 1UYYA 1E5RA 4CU8A 3UKTA 1TNRA 4KU8A 4WV8A 3S7IA 3H9AA 5FYBA 5IWFA 4QX0A 3FFZA 2W1WA 1CESA 3DV8A 3BOPA 3IBMA 3V0BA 1VMJA 4QB2A 4NIIA 5FWJA 3MICA 4FT8A 3PIJA 3USUB 1IQAA 1JH5A 2WO2A 1HX6A 3E5XA 4JGYA 1O3SA 4P9XA 1VRH2 3POGA 5LK7B 5ANQA 5FZLA 1JYXA 1G9FA 4A45A 3PHMA 4AQ6A 4AVAA 2CGPA 5EWSA 4I02A 5GALA 5T5JA 4AHZA 3FLPA 1XNTA 3ZIWA 4CEYC 3FL7A 3ACFA 4RS5C 1NQJA 5J3UA 2VG9A 3AP9A 3ETQA 3PIGA 1RUC2 1ND3A 1GANA 2CL2A 4Q5OA 1NCQB 2W9XA 2AENA 4Y1VA 2FMYA 5A7OA 5DUXA 2JKBA 5CNAA 1C5IA 2J1RA 2ZJCA 2RS52 2DCKA 3ZN6B 1QQP3 1TEIA 2XVGA 5BNNA 4BK4A 3UJOA 1RHI3 5H9SA 2OA2A 1R083 1ONAA 3RYKA 1D2QA 3VKLA 3MO4A 4BH9A 5JSRA 1IQDC 3ES4A 2B4KA 2BYVE 2R043 2WS91 4QKDA 4DOUA 1C57A 4XJAA 4GH4C 2WFPA 3JZVA 5C5TA 2G9FA 1J3PA 1PO23 4PIZA 5A7WA 3VKFC 3I3BA 4JQRA 4UBGA 1KJRA 2HWD3 2QQMA 5LA9A 3IDCB 4BB3A 3DGTA 1PMJX 1WW5A 3JB8A 3RQ0A 1W6OB 3H7YA 4GB32 4LBLA 1RUH1 3J7MA 2AACA 4IEXA 5FY5A 1FXZA 3CIHA 4HSJA 4XURA 1K45A 3U37A 3ZN5A 1O4TA 1A78A 5DUUA 3RGBA 3VDDB 1MR5A 3FMGA 4KH9A 1NLSA 4M3CE 1CZSA 3VBUB 3HQUA 4KWUA 5EXOA 1AHSA 1ULFA 1YC61 3NJYA 1CJDA 1OLRA 4QQLA 1I5ZA 3GBFA 5JCTA 4QX2A 4LNVA 5IW0A 5JR7B 3NNJA 2BPA2 2L9LA 3NW4A 3VHNA 2K0GA 1W8HA 3ZDVA 2YXSA 1R1A3 4IXLA 3A21A 1LENA 3OY8B 4O61A 1E5SA 2XL9A 5T5OA 1YO8A 4IERA 1V6OA 4YG0A 2I74A 3I4IA 2ERFA 3QCWA 2CGNA 5G04L 3TNQA 3VV1A 3ZYGA 5JOXA 4E9KA 4HN0A 2E63A 5C9AC 5GZFA 1NKGA 5DUVA 1RUD1 4CDQC 4SBVA 3HQRA 1PO12 4TZDA 3I59B 5A3NA 4DO0A 3DL3A 5GJ6A 4Y5SA 4TWTA 3VBRB 5C3RA 2VCMA 1PIV1 3RZMA 3DYOA 3TEWA 1GICA 1QOOA 4F8AA 2JG8A 3WF0A 3AB0A 3OYWB 1IKPA 1PM4A 4F3JA 1W99A 1ACCA 5C4WA 1VRH3 5LB6A 3WVJA 2PHUA 4RFT0 4OI0A 1P8JA 3C8XA 5FZ3A 5F5AA 4XBLA 3ZSJA 2ADEA 4W50A 1MZ6A 3VDBA 5JXJA 4XE9A 1BBT3 1HN1A 2JENA 1K3IA 5LW9A 1G8WA 2UYBA 3C7HA 1F4HA 3D6EA 1MPXA 1LEMA 4FXKB 4MXWB 3WDWA 3OD0A 1F8VA 4RA0A 2FCVA 5A6ZA 3I3DA 4D0QA 1D7PM 3WP3A 1ZBE1 4E4HA 3WF3A 4AFAA 4N8MA 2QZ2A 4J1WA 1H6YA 5A33A 3WNKA 5I8YA 2R0HA 2Y34A 1AXKA 1AL23 4GD4A 3LWCA 4EWDA 5J1XA 5FZ0A 4DZGA 3LAGA 5IVEA 4I0BA 3H0OA 1DZTA 4PF5A 5F5QA 2QQVA 4BQWA 4U36A 4JRAA 5FLIA 1ULOA 2C1FA 3H3UA 1GNYA 3RZHA 4N43B 1SPPB 2HEYF 3MZHA 5H9PA 3KWVA 2ZX4A 5FZ1A 5FYVA 3ZYHA 4X8NA 3UESA 2O14A 3B3QE 4JVAA 3H8OA 4Q0VA 1QXRA 2XMLA 5A7NA 1W0OA 1PX3A 3IM0A 5CVRA 3V64A 1W6MA 1HJFA 4NPRA 1TMF2 4OMDA 1V6NA 1MEC3 4YZ1A 2BGCA 4CUAA 4XZPA 3RI9A 1KFXL 1ZA4A 3AYAA 4AFDA 2IWGB 4GB33 2W1UA 2AEZA 3DXTA 2J1UA 4CUBA 5HPOA 1SFNA 1V6IA 3AMPA 1V00A 1DGRN 1UQXA 3AXDA 2BOIA 4RGGA 1I1EA 1JI6A 4EYUA 1W3XA 2WO7A 4Y4YA 3LD8A 2ZHLA 1PMIA 4CDWC 2QQWA 5SV5A 1QOSA 5B2GB 4L0PA 5C3OA 2VC9A 4CU7A 2DBIA 2P3JA 4QKNA 4EQVA 2VMIA 1Y9MA 1UY3A 5DPNA 5C71A 2WFF3 4CU9A 1H8TC 1LGBA 2N7GA 1AZDA 3H7JA 4LQRA 3VBOA 1ODNA 3AMNA 4QT6A 1R1ZA 5FP4A 4OI2A 1UZVA 2Q4SA 3WQ0A 4RSUA 5JMOA 4MHRA 2B8MA 2R062 2J1EA 4FPYA 3ZYPA 5ISLA 4CCOA 5KXBA 3SITA 3O1PA 1UW8A 3O5SA 1X36A 2QQJA 5K8SA 4HKLA 1OPMA 3C7GA 4MGZE 2W92A 2Y8KA 3T0BA 2IVIB 2ZGSA 4QPYA 4YW7A 2VZSA 1UIJA 2QUOA 3THCA 4YW2A 4A3XA 4Y1UA 2IFRA 3E6DA 1OURA 3FUOA 1O8SA 2ARCA 1MZEA 4Y1XA 5F3EA 4FPLA 4IEZA 5C8WA 1OVPA 5J7MA 3OJBA 3I2KA 1JYVA 1HXS3 5LRSA 1RUOA 5FYSA 4OI1A 5A6QA 2VXJA 3WEZA 1H1MA 1YFYA 1XQNA 3HAGA 5GZEA 4KWJA 3WCSA 1YFXA 3HT1A 4JC1A 5AVAA 5CKMA 3O1SA 5JMCA 2Y6FA 3ZYFA 4ZS2A 2EALA 3LIHA 3V56A 1AYN1 4P9GA 3U1XA 5KWRA 1LECA 2WNVB 1IG3A 5AVPA 1UD1A 4P5HA 1TNFA 3OUIA 1PGL2 1OQEA 3AMHA 2WA4A 2HYKA 3VZMA 1SCSA 2Q1FA 5EYXA 1RC6A 2RR11 5HCHA 4B8EA 2ZGQA 1IGOA 3MW4A 4CDUC 4IW3A 3GALA 4Q4V2 1NX9A 1TME2 3PNAA 3AMQA 4Y22A 2JB8A 1FNYA 5T5PA 3TEZA 5DDJ3 1VP6A 1W3VA 1GOHA 4BOWA 2VVEA 1OQ1A 1AUYA 3FBMA 4PDWC 3ITQA 2X29A 1W9FA 3SH4A 3VZLA 2OVUA 4CP9B 2VZPA 3ILRA 3OTFA 3Q8EA 5H9RA 1S4CA 2TEPA 2B42B 2JXAA 1OKOA 1JYTA 4HT1T 2QQPA 4BMEA 1DCSA 1GLHA 2GMPA 4KWKA 4OZXA 1HJGA 2CAUA 1ST8A 2B7YA 5T52A 1C5HA 4O65A 1YQCA 1W0PA 4X8PA 1CGPA 1LU1A 1ZZ8A 4ONUA 2GAUA 3L9JT 2EXIA 4Q0SA 5FMOS 3TBDA 3VBFC 5ABJA 4BQ2A 1HQLA 4IEWA 3LOBA 5EYYA 1EYBA 3POFA 2CWSA 2Y6GA 4PI2A 5LA1A 2V5DA 5HI0A 1W0NA 2JIJA 2OUHA 1DDLA 3BVCA 3I2JA 4MSVA 3I2OA 3DUIA 3S7EA 1D4M1 1YYNA 2VTXA 5JSPA 3URFA 4DUWA 1SLTA 1W6PA 3BN6A 2WBKA 1V6LA 5FXXA 3WDTA 1LAJA 2OZJA 3GHNA 4C1XA 4LKDA 5LATA 1MQTC 2R063 2A7AA 5JIAA 2A71A 3PUSA 2E33A 2W1SA 4GIQA 4ISRA 5FQ0A 1RUC1 1DQ2A 2LROA 2JG9A 1KQRA 4HK8A 3O1TA 3BTXA 4UFKA 1PGSA 5FAXA 4IV3B 2CTVA 3WXPA 2Y0IA 2QQIA 2RS51 3IWZA 4RFRB
chains in the Genus database with same CATH topology
1GZTA 1OXCA 2WR9A 2BP6A 1UZVA 2BOJA 1OVSA 5A6ZA 2JDKA 2BV4A 2JDUA 2JDYA 2XR4A 4UT5A 4CE8A 2JDMA 1OUXA 5A6YA 5A3OA 1W8FA 3DCQA 1UQXA 2BOIA 2JDPA 1OURA 5HCHA 3ZDVA 1W8HA 1OVPA 5A70A 2JDNA 2VUDA 2VNVA 2JDHA 2WRAA 5D2AA 5A6QA 1OUSA 2VUCA 4AOCA 2CHHA 5A6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZT A;  1OXC A;  2WR9 A;  2BP6 A;  1UZV A;  2BOJ A;  1OVS A;  5A6Z A;  2JDK A;  2BV4 A;  2JDU A;  2JDY A;  2XR4 A;  4UT5 A;  4CE8 A;  2JDM A;  1OUX A;  5A6Y A;  5A3O A;  1W8F A;  3DCQ A;  1UQX A;  2BOI A;  2JDP A;  1OUR A;  5HCH A;  3ZDV A;  1W8H A;  1OVP A;  5A70 A;  2JDN A;  2VUD A;  2VNV A;  2JDH A;  2WRA A;  5D2A A;  5A6Q A;  1OUS A;  2VUC A;  4AOC A;  2CHH A;  5A6X A; 
#chains in the Genus database with same CATH topology
 1PVC 2;  5DAQ A;  5A7Q A;  1HB1 A;  4FOY A;  1I5P A;  1NA1 B;  3KGZ A;  4QDS A;  2BFU S;  1LTE A;  3KCC A;  3RMX A;  1AL0 G;  3Q9O A;  4DIQ A;  2WNE A;  4DEQ A;  4QQH A;  2A3W A;  2WL1 A;  3HBZ A;  1CN1 A;  4XQW A;  2C9A A;  1ZNP A;  2Q30 A;  1CAU A;  3ZPO A;  3C2U A;  3MLJ A;  5LA2 A;  1O59 A;  3NL1 A;  1KDM A;  1OPO A;  3UV9 A;  4MHU A;  4XMI A;  2VZR A;  4YVS C;  4WVM A;  3ASI A;  4AG4 A;  1N3P A;  1LOF A;  1T6G C;  4XFA A;  3EB7 A;  2RM2 1;  4AEJ A;  5D8A B;  5FYY A;  1STM A;  3AZW A;  4Q4V 3;  3SNM A;  5C8C A;  1URX A;  1TME 3;  1UOB A;  2W87 A;  5FJH A;  5FP8 A;  5F5I A;  1BYH A;  2OQ7 A;  3DF0 A;  2A5Z A;  4GMP 1;  2P37 A;  5FMB A;  4D7T A;  1AR8 2;  3T08 A;  4ZU5 A;  3KQ4 B;  3GZT B;  4YSF A;  4CP1 A;  1GWK A;  2O0O A;  1ASJ 1;  1JUH A;  1GP4 A;  3WQB A;  1GQP A;  1GWL A;  3ZXF A;  4Q4Y 2;  1K42 A;  5A3U A;  3T1M A;  3BUC A;  2R6Q A;  5E88 A;  3HPN A;  5GKA C;  3I3Q A;  1V6K A;  4BMB A;  2HWB 2;  3LFI A;  5F9T A;  2WLP A;  4CEY B;  1ULE A;  4E2G A;  4FVV A;  4LO4 B;  1SMV A;  1OF3 A;  1Q8S A;  4QXK A;  4XOG A;  5KHJ A;  4DUV A;  4MH0 E;  1KFU L;  3O0X A;  4NR1 A;  2VE1 A;  3H8X A;  2ZS6 B;  4TN7 A;  1YRZ A;  5FLJ A;  5JZG A;  3BTY A;  1PO1 1;  4LIT A;  5FWE A;  1IZ3 A;  4GWN A;  3OGV A;  1XND A;  3AYD A;  4P9W A;  3ZDS A;  4QU2 A;  1TE1 B;  1F9K A;  1GQG A;  5BNQ A;  2VVF A;  2JWP A;  4OVE A;  2XJP A;  4ARY A;  4C0H A;  4JGZ A;  4CXW A;  4D7Y A;  3VDC A;  1PHM A;  1OSG A;  2Q1M A;  4PLM A;  2XBO 3;  3N7J A;  4XXP A;  5FPL A;  5T54 A;  2ADD A;  5F32 A;  2OUJ A;  5GLT A;  2ID4 A;  1B09 A;  2NLR A;  4BZ4 A;  1TVG A;  2B46 X;  4GH4 B;  3TYJ A;  3N9N A;  1AVB A;  1ENQ A;  3P1I A;  4N7U A;  1VAL A;  5FTT C;  4MZU A;  4I2O A;  4OUM A;  3E5Q A;  4HAN A;  1YQ8 A;  4DEV A;  2BNM A;  4OFG A;  4YVW C;  1ZZB A;  2BP6 A;  4AEM A;  2YV8 A;  2VQ0 A;  5FJK A;  3WF4 A;  1BXH A;  3DPR A;  1S0C A;  4ZS3 A;  1Y3T A;  2HWE 2;  3OGS A;  5F2W A;  3N7K A;  4UW6 A;  1PVC 3;  2EXH A;  2A6W A;  4LOS A;  1V6M A;  1VJ2 A;  2DTY A;  5FY4 A;  1AR6 2;  3W58 A;  2WYF A;  4K6B A;  4FAG A;  3HEI A;  2R49 A;  3OB8 A;  4WM8 A;  4AGV A;  4MO3 M;  4XF9 A;  1UKG A;  2OKX A;  3RG0 A;  4QPI C;  5HCA A;  3BTA A;  1XJA A;  1SDW A;  2W68 A;  2OS2 A;  2RDS A;  1PNG A;  2RS3 2;  4XIK A;  4EV0 A;  5JOW A;  1H9P A;  2GDF A;  1S1A A;  1JU3 A;  3UGF A;  4S2F A;  3ZPY A;  4AED C;  4JHZ A;  2ZX3 A;  5FXV A;  1TMF 1;  3ILF A;  3WNP A;  3J4U H;  5C9A B;  3ZFE C;  2W95 A;  1S0F A;  4CXY A;  1N3Q A;  3OSD A;  4NRM A;  1VBD 3;  3J7L A;  3I2F A;  5LBF A;  4CDQ B;  3ZXG A;  2VZQ A;  4JKM A;  5EFU A;  2J1S A;  1OBN A;  4Y26 A;  3N4M A;  2VQT A;  1CQ9 A;  2XQX A;  4GA9 A;  1XSQ A;  2VNO A;  1VBB 2;  4JQT A;  3FN9 A;  1AR8 3;  1XOY A;  1H4H A;  2GMM A;  2HWF 2;  4YW1 A;  1NZC A;  4NMI A;  1WUV A;  1UMI A;  2VPV A;  3LFM A;  2E7A A;  3CZJ A;  3AKQ A;  3WNN A;  2B9V A;  3VBH A;  3WDU A;  2XLG A;  4LOT A;  2KD7 A;  5FFO C;  1X7N A;  3T2Q A;  2VCB A;  1ZA7 A;  3WUD A;  1JHN A;  3NJZ A;  3PUQ A;  4XEZ A;  3VBS A;  5A6X A;  3IIA A;  2Q1Z B;  2E31 A;  3LF7 A;  2HWB 3;  4XUT A;  3WZ1 A;  4PLO A;  3ZFG C;  3LEK A;  4LBQ B;  1DYK A;  3CF6 E;  2HYX A;  4H7L A;  2XGX A;  4PCR A;  5DQ0 A;  5DZG A;  3ZXL A;  2VW1 A;  4EN7 B;  2NYY A;  5F7U A;  4QPG C;  4LHN A;  5IVB A;  2P3I A;  1RUG 3;  3DCQ A;  2WSV A;  1UKR A;  4EN9 B;  3VZO A;  3LZZ A;  3MPP G;  1LKN A;  2YRO A;  4TLF A;  1YUD A;  1EV1 2;  2VZU A;  5I0D A;  3THD A;  4LO8 A;  2A3X A;  4ZY9 A;  3OGG A;  3AL5 A;  1POV 0;  2XDV A;  4XUO A;  1NUK A;  1ND2 A;  3ZSL A;  1SLL A;  4B4R A;  1ZBA 2;  3RYR A;  2ZHN A;  3GF6 A;  1JZ4 A;  2ARB A;  3THP A;  1G7Y A;  2XHN A;  3THT A;  4FPJ A;  1VRB A;  4W4Z A;  2F4L A;  3NMB A;  2XJQ A;  5FZD A;  3ZIX A;  4QX8 A;  1BZW A;  5BNP A;  1BEV 2;  3I8T A;  4XJZ A;  3CBN A;  3BTZ A;  5C33 A;  1Q5O A;  1DGL A;  1HIX A;  5L9R A;  1RUI 2;  4MV2 A;  2UUR A;  1HLC A;  4NIA A;  5SV8 A;  3ZFF A;  5KC5 A;  5IVF A;  4F83 A;  3NAP C;  2YBS A;  2JX9 A;  3VHO A;  4CZS A;  2PYT A;  1ZYB A;  4XUP A;  4CXX A;  3DEM A;  4XW3 A;  3DYM A;  3LOI A;  1JYI A;  2HWE 3;  2A6V A;  4CDW B;  3FLR A;  3E1F 1;  4G4F A;  2VQA A;  4M3C B;  3TN9 2;  5F37 A;  4XHX A;  2VOV A;  4Q4X 3;  4XCA A;  2WT2 A;  2X5I C;  3AFK A;  3V65 A;  3WP5 A;  2XLF A;  4KGG A;  5CAD A;  4S2G A;  1FOD 1;  4V1P A;  1ALY A;  1H8T B;  2DV9 A;  3K4A A;  3RSJ A;  3RI8 A;  2WNU A;  4MET A;  5KHK A;  5CG9 A;  2JDM A;  1VBE 2;  1QOT A;  2FBE A;  3VD3 A;  4BLJ A;  4BJ0 A;  5C3P A;  3WG2 A;  3B94 A;  5BNO B;  4RS5 A;  4GKX A;  1GP5 A;  4NRP A;  4W6W A;  3V0A A;  4LXL A;  4DY3 A;  2JE9 A;  1LHU A;  3LQC A;  5FOB B;  4COW A;  3Q8C A;  3Q8F A;  3W9A A;  2JE8 A;  3KMH A;  5LZ6 A;  3W20 A;  2G9G A;  5FP3 A;  4PLN A;  4X6R B;  1KRI A;  1GSL A;  4IE4 A;  4UYB A;  1VBB 3;  3S30 A;  2RVA A;  2BGO A;  1OFS A;  4UFM A;  3P6B A;  3FC0 A;  2K9Z A;  1IS6 A;  3MUZ 1;  3ABZ A;  4LBM A;  3VD5 A;  2PHT A;  3CNA A;  2HWC 2;  5FBZ A;  2V5Y A;  2D7F A;  1X82 A;  2JEM A;  4JRL A;  4IND A;  1O5L A;  3KD4 A;  3HNY M;  3IAQ A;  3E6C C;  1JN2 P;  4YGC A;  4CU6 A;  1LOD A;  5L7O A;  4KGQ A;  5HCB A;  1XB9 A;  3P3P A;  4HPK A;  1FMD 1;  5HXV A;  1OT5 A;  1D0H A;  4IDZ A;  4N53 A;  4RGK A;  5FLH A;  3WY6 A;  4DRV A;  3IDA A;  3H8R A;  2EIC A;  3EXU A;  1QQP 2;  3U4S A;  1AYM 3;  1H30 A;  3NVC A;  4CDU B;  1EV1 3;  4EN6 B;  1C8N A;  4AFC A;  3LA7 A;  1OA2 A;  4YGB A;  2H0V A;  2RE9 A;  3ALQ A;  4NHX A;  4XVH A;  2VUJ A;  1NCR A;  3MDP A;  5FZO B;  4PDW B;  5HV4 A;  5IVV A;  1BQP A;  2NZ9 A;  5LY2 A;  4YZ5 A;  1GR3 A;  4DUX A;  4MGY E;  4S2D A;  4B29 A;  4LLF A;  1PO2 2;  2RDQ A;  3JU9 A;  4H2A A;  4Q4W 2;  3T0D A;  1J59 A;  4W6X A;  2HWD 2;  3QD6 A;  4M4P A;  1Z78 A;  3ZSM A;  4WM7 C;  2ILM A;  1QJZ A;  4HOO A;  3I3M A;  1BEV 3;  1GWM A;  5JR2 A;  4Y3O A;  1JZ5 A;  4URT A;  1GUI A;  1X33 A;  1X8M A;  1COV 1;  1RUI 3;  5CKQ A;  1NG0 A;  4CEW A;  2DWR A;  3M1H A;  3MW3 A;  4IV3 C;  3CDZ B;  4LBO A;  5T55 A;  2WAO A;  2D40 A;  2FDH A;  1VMH A;  2WRA A;  2W94 A;  4RQP A;  4G9S B;  3PMS A;  4RR3 B;  1EPW A;  1OUS A;  4WVW A;  3U14 A;  4KQ7 A;  3WW1 A;  3PTY A;  4CA9 A;  1ZZ9 A;  4IET A;  1VAK A;  1OXC A;  2JDZ A;  2WT0 A;  4FFH A;  3C7F A;  4X6Q B;  1O6U A;  1AF9 A;  3VBF B;  5C5U A;  2BEO A;  2WAB A;  1PK6 A;  3INA A;  4LUM A;  3ZX7 A;  1KS4 A;  1UZY A;  2ZA9 A;  4JDO A;  4K20 A;  3TN9 3;  5JVV A;  2YY1 A;  4LUL A;  5G05 L;  4B4P A;  3DXU A;  4LLO A;  4GAL A;  2MNG A;  4ZXE A;  5A6Y A;  1R1A 2;  4PT6 A;  1UOG A;  2RJK A;  2EIG A;  1MS9 A;  3ETP A;  4GZ9 A;  2Z69 A;  4Q4Y 1;  1AR7 2;  1VBC 1;  2FDK A;  4YG3 A;  1GNH A;  2RDR A;  1D2S A;  1JTZ X;  1ZRD A;  1G9C A;  2HBT A;  4AQT A;  3UJQ A;  1MQT B;  5D2A A;  5D8A C;  5FRA A;  1RXG A;  1XSR A;  3NJV A;  1XC6 A;  4L9B A;  1GQH A;  1JYW A;  5DG2 A;  2CYF A;  4L2N A;  2PHR A;  4XJW A;  5AFB A;  1CAV A;  1W05 A;  4CCN A;  2QCS B;  2X09 A;  1RUE 1;  4UW5 A;  3AFG A;  1SQ4 A;  4XF3 A;  4DY5 A;  1QJX 2;  2QJV A;  3KLS A;  1OOP A;  2WKK A;  2W46 A;  4RHV 2;  2JDP A;  4OMC A;  3B01 A;  5ACA 3;  2HWC 3;  1BBT 2;  4GKY A;  4NJ4 A;  3RMY A;  4E4S A;  5FPX A;  1LU2 A;  2RMU 1;  4XAB A;  3DEC A;  1C4R A;  3O1V A;  4GUL A;  2FCU A;  2XJR A;  1KDK A;  2VNR A;  4HG6 B;  2HKX A;  5GZC A;  1WD4 A;  5L36 A;  3GGL A;  4M0H A;  2YC4 A;  4YVS B;  5IVJ A;  3ZSK A;  2Y6J A;  3ATG A;  1AL2 2;  5FY0 A;  2Q8C A;  3VB9 A;  5A1A A;  2CAV A;  2OPW A;  2VOK A;  2D3R A;  4TLG A;  1EAH 3;  2VMH A;  5EIY B;  1NYW A;  2WIN B;  3JBG 3;  3M4F A;  4ISQ A;  4XQD A;  1HB4 A;  2VXR A;  4P9Y A;  3L2Y A;  1OD3 A;  1KXG A;  2ZX0 A;  3ROU A;  2FD8 A;  1AR6 1;  1F35 A;  1ULP A;  2ZAC A;  4LJH A;  1VAM A;  2YGL A;  3WG3 A;  1UPI A;  4NAO A;  1JZ7 A;  1QU0 A;  4LBQ D;  1R09 3;  1UMH A;  4Q4W 3;  1SBE A;  3NV1 A;  1BK0 A;  1W6N B;  2FDJ A;  4HKW A;  3N9Q A;  1MEC 2;  2RS3 1;  3RJR A;  3SKJ E;  2W3J A;  2D43 A;  4PBO A;  4W65 A;  5IAV A;  3N36 A;  4NVP A;  4IUG A;  4K1Y A;  2HEV F;  1W9S A;  3G6J B;  3LCP A;  1CIY A;  2CU5 A;  3CJI A;  4CCD A;  3GNE A;  2ZGU A;  3OCP A;  2EIB A;  3H1W A;  4GJZ A;  1XYN A;  4J25 A;  5IFP A;  5CFD C;  5EHD A;  2C4X A;  1RVF 3;  3VL9 A;  1H0B A;  4RGA A;  5CFC C;  1FPN 3;  4AW7 A;  3HT2 A;  1XYP A;  4PHZ A;  2WFF 2;  5DUW A;  4BXS V;  4LBK A;  4YWA A;  1I9R A;  3ACL A;  3MUY 1;  5GLU A;  4TSV A;  3LDK A;  2HWF 1;  2VUL A;  1E5I A;  4YM2 A;  5JXG A;  4NUB A;  4NHM A;  3LDR A;  5A3L A;  1REE A;  2YC2 A;  4L11 A;  4BQ4 A;  4FTS A;  5IYY A;  1UL9 A;  1OH3 A;  1HRI 3;  1QJY 3;  1AR7 3;  3AP5 A;  1DLC A;  3LA2 A;  4Q0U A;  4UXA A;  4YLZ A;  2VCC A;  3E5U A;  3NV3 A;  1O4Z A;  3RDI A;  4DXR A;  4CDX C;  3JUU A;  2K2S A;  1POV 3;  1SLB A;  2YG0 A;  1WW4 A;  4YVW B;  2YPD A;  2VU9 A;  4LKF A;  2TNF A;  1CON A;  2VZO A;  4KU7 A;  1HXS 2;  3K3N A;  4MGQ A;  1PZ7 A;  3AZY A;  1ZX5 A;  3OOX A;  4AGR A;  3T30 A;  1DZR A;  1QWR A;  2CGO A;  5FY9 A;  1QJX 3;  2XXZ A;  5FYM A;  1DIW A;  1W9T A;  5HV0 A;  2GC3 A;  1V0A A;  4HK9 A;  1N1S A;  3D0S A;  2P4E A;  1ZBA 1;  4IV1 C;  4RHV 3;  1W9Y A;  4JHT A;  3IPV B;  1CD3 G;  1NZI A;  4QPI B;  3EO6 A;  2XH6 A;  4CCJ A;  3VD9 A;  3B00 A;  1RIR A;  4WZF A;  3D5O A;  4FOW A;  3FFQ A;  4IGP A;  1WCS A;  1SDD B;  1JBC A;  1LED A;  2VCA A;  1W8U A;  2VBD A;  3LDB A;  4ZZ5 A;  1ULD A;  4J6G A;  3KGL A;  5DN2 A;  4AED B;  3BU0 A;  4YM0 A;  1CVN A;  1WCQ A;  3VKO A;  2ES3 A;  4QX5 A;  1US2 A;  3ZFE B;  2PLV 1;  4BQ1 A;  4BPZ A;  2BBV A;  4XFH A;  2G4I A;  1VIW B;  5DDJ 2;  2MEV 2;  2YBP A;  1E5H A;  4PI0 A;  5IAT A;  5JXI A;  1KGY A;  1O8P A;  4KNC A;  4Q27 A;  5DG1 A;  2WT1 A;  3M70 A;  3RNS A;  3WW3 A;  3POI A;  4AVC A;  2VUD A;  1HKD A;  4Q1P A;  5IK7 A;  4PIY A;  2GH2 A;  4UW3 A;  4Q26 A;  4A3Z A;  4ASM B;  2AR6 A;  1UYX A;  5I0U A;  3SHR A;  1U5Y A;  5A3M A;  2A6Z A;  3K3O A;  1H8V A;  1YWK A;  4YW3 A;  5LBB A;  1Z7S 1;  4C0B A;  1AR9 3;  2R7E B;  3I2G A;  1I6X A;  4E8C A;  5FBJ A;  3HVD A;  2B9U A;  1EUT A;  4OQ9 A;  1CX1 A;  1FV2 A;  4XC9 A;  3QH6 A;  3WR0 A;  4ET7 A;  1VBE 1;  1XE8 A;  4P00 B;  3ZFG B;  4ARX A;  5CKN A;  2HEW F;  2IXL A;  5F3G A;  4BLI A;  3O1U A;  1AJK A;  2Y6L A;  3EJK A;  1CZT A;  3LEM A;  3SEP A;  4QPG B;  4BDV B;  4YG6 A;  4BHP A;  4NN0 A;  4BIS A;  3USU A;  1WA6 X;  2TUN A;  1QJE A;  1K5M B;  2DU0 A;  2UWA A;  4P9I A;  5FO9 B;  3POE A;  1L3J A;  1UOF A;  3CZU A;  1JS9 A;  1UY0 A;  3I97 A;  3J8F 3;  2I2S A;  1VE0 A;  2RV9 A;  3RYP A;  2BV4 A;  1QY4 A;  1UAI A;  4J1X A;  5FY8 A;  3HNB M;  1VPH A;  3MBW A;  5KHI A;  5LY1 A;  2Y6K A;  5BNO C;  4C1W A;  4FTE A;  2GNM A;  2PQQ A;  1SHW B;  3BCW A;  1NCQ A;  4HN1 A;  3QH7 A;  1LB2 A;  3S5Q A;  1QQP 1;  3ZN6 A;  3NAP B;  1UX6 A;  4YW5 A;  5EJ1 B;  5EP9 A;  1XE7 A;  2AUY A;  2YB7 A;  1UYZ A;  1RHI 1;  2PHD A;  1R08 1;  2GAL A;  5FK7 A;  1NQD A;  5FPA A;  4XF1 A;  1RMU 3;  3MIH A;  2Y26 A;  4MOA A;  1GZW B;  4GWM A;  4JAA A;  2B39 A;  4LKS A;  4QPW A;  3WLU A;  3ZXJ A;  2R04 1;  1ZRR A;  4AYU A;  3G7D A;  4XUQ A;  4XFG A;  2ZZJ A;  2X5I B;  5LBE A;  1EP0 A;  2KA3 A;  2OQ6 A;  3AJY A;  3BYW A;  1PO2 1;  1LOB A;  3MYX A;  2HWD 1;  4EWA A;  4TXW A;  2C24 A;  3LPF A;  4JDN A;  4XBN A;  3L2H A;  1DGW X;  4IE7 A;  4AQ2 A;  5A70 A;  1W6O A;  3MF6 A;  2AH2 A;  3WW4 A;  1ENX A;  2WC2 A;  1BVP 1;  2MEV 3;  3LIG A;  1CAX B;  3VDD A;  2OII A;  3O1R A;  2RS1 2;  4LA2 A;  2Y60 A;  4Y20 B;  2ZGM A;  3VBU A;  4WBB A;  2W47 A;  3M7A A;  1IG0 A;  3E97 A;  1IKQ A;  1EUU A;  3MW2 A;  4CTE A;  3WG1 A;  1A8M A;  3VHP A;  3ZKY A;  4B7K A;  3VDA A;  1VMF A;  4AVV A;  5CEH A;  3N9P A;  2BDR A;  2ZCW A;  4BQ5 A;  2VL4 A;  4ASL A;  1R1A 1;  3KM5 A;  4QMA A;  2D3S A;  2QZ3 A;  2WZ8 A;  4HVO A;  4NHY A;  2JG8 C;  3M3I A;  3OY8 A;  4QHB A;  5GLV A;  4ORF A;  3U75 A;  3VLB B;  4NIH A;  1BCX A;  2VGD A;  3NV4 A;  3M3C A;  3PTR B;  4AI8 A;  5C4W C;  3UNP A;  3WX5 A;  1JMU B;  5KC6 A;  1DQ1 A;  4RR3 C;  5FZ7 A;  3T4H B;  5JLV A;  2R07 2;  1PGW 2;  2R1D A;  4YAR A;  4K9S A;  1OD5 A;  3UET A;  1EY2 A;  1LES A;  3I59 A;  5L73 A;  2XPJ A;  3MHZ A;  5A3W A;  3VBR A;  2ZAA A;  1JOP A;  5FUI A;  4E4Z A;  1NLR A;  1J3Q A;  2BZD A;  4M01 A;  2ZEZ A;  2I07 B;  1RUF 3;  2XBO 2;  3JD7 3;  3ZM8 A;  5BXX A;  3OYW A;  3A7Q A;  1H1I A;  1VRH 1;  2KM2 A;  4LO7 A;  1H9W A;  2Z79 A;  1OC1 A;  1CR7 A;  2XJU A;  2JD9 A;  1Y7B A;  2DCY A;  3SIS A;  1UO9 A;  2DYC A;  5FMC A;  1BJQ A;  1CIW A;  1W2T A;  2GN3 A;  1BBT 1;  1UZW A;  3EHK A;  5J48 A;  3ACI A;  2XG3 A;  5FPB A;  4JKK A;  4IEQ A;  4WM7 B;  3GCX A;  4COU A;  2GC1 A;  3POW A;  2WN2 A;  4MXW A;  3ORJ A;  3WW2 A;  5JSO A;  1F2N A;  1Q43 A;  3M8L A;  5FZG A;  4YRD A;  4OHY A;  4K40 A;  3USS A;  1AL2 1;  3GZA A;  4DB5 A;  1VBA 2;  2JDK A;  1MS1 A;  1SAC A;  5BPX A;  3UGG A;  4AE2 A;  3J7N A;  3JCI A;  2D5F A;  5F6K A;  2R0F A;  2BWA A;  1V9U 2;  1LOC A;  1OMI A;  3JB4 C;  1W03 A;  2JEC A;  3ZOI A;  4FPK A;  4BQX A;  3X29 B;  2ZKL A;  4N43 A;  1SPP A;  3T1L A;  5FOJ B;  1F5F A;  1W6Q B;  2BFU L;  4DIN B;  3GDB A;  4R4Z A;  4MVT A;  2AZ5 A;  1YQ5 A;  1YNA A;  3OPZ A;  1JW6 A;  4XMA A;  1VLN A;  1GFF 2;  2ZEY A;  3C7O A;  4QKB A;  1MEC 1;  1UY2 A;  1UY1 A;  4EWE A;  1VBD 2;  1JXN A;  1MS8 A;  2JD4 A;  3BAL A;  4YW6 A;  3RZJ A;  3D0J A;  4GB3 1;  2A75 A;  4GWJ A;  2E53 A;  3VBO C;  2ARA A;  1MS0 A;  1Q56 A;  1YEW A;  2HLE A;  3MV0 1;  1C8M 3;  1W06 A;  2XVL A;  2ZZQ A;  4XDO A;  3HJR A;  3OGJ A;  3R05 A;  4XYX A;  2X8K A;  3PUR A;  2C9K A;  2Q5T A;  4SLI A;  3LPG A;  1MS5 A;  2RS1 3;  3PU8 A;  2XON A;  1E57 A;  1WCK A;  1WLC A;  3NNG A;  4YPJ A;  4FPO B;  4M4R A;  2IXK A;  2IXJ A;  1QGL A;  1QH6 A;  2VOX A;  2WFF 1;  3ECQ A;  4N9I A;  4NOT A;  5IVY A;  2WLQ A;  2XHK A;  3NKT A;  4ZU7 A;  3OBR A;  3ACH A;  4XBQ A;  2WAA A;  4CUC A;  1H2L A;  3LEI A;  4ZXK A;  4UF0 B;  5KHG A;  3D82 A;  1OLM A;  2W52 A;  3M2M A;  4MGI E;  4XF4 A;  3KCX A;  4AVB A;  5FXW A;  3HBK A;  4NHL A;  4AOC A;  2RJ2 A;  4XFB A;  3JXS A;  4H3W A;  2E26 A;  4CP2 A;  2YYO A;  1LHW A;  1RUG 2;  2P6H A;  5FCC A;  2CY6 A;  1QNW A;  2R07 3;  2QQO A;  3AZZ A;  4FO9 A;  1H6X A;  4QX1 A;  5T3N A;  1RUJ 3;  2JDY A;  1UCX A;  3SC7 X;  3KHC A;  1NE6 A;  3C3V A;  3WP4 A;  5AC9 2;  2KXL A;  2VNG A;  1HXS 1;  2XQR A;  4IE6 A;  3AMM A;  3NAP A;  3U10 A;  5A32 B;  4AVT A;  2GNT A;  1UX7 A;  2NP0 A;  2W2I A;  4QU1 A;  1IS4 A;  4XF0 A;  4OHV A;  4AI3 A;  1FNZ A;  1SLA A;  4NO4 A;  4ERO A;  1HB2 A;  4I09 A;  4IL7 A;  5BY5 A;  2ORZ A;  3OEA A;  4UFL A;  2X53 S;  1QEX A;  2YZ4 A;  5IK5 A;  5FZ9 A;  3HMY A;  5A1L A;  3IMM A;  4LHS A;  2HBU A;  4CCK A;  2WNV A;  1W8N A;  5IHR A;  5L7O B;  2FDG A;  3H42 B;  4AI0 A;  4ATE A;  1QJU 3;  2BER A;  4E2Q A;  1ULG A;  2WZR 3;  1XNK A;  2LW8 A;  4B1M A;  5IVC A;  3VD4 A;  3MFC A;  5A7P A;  2VMG A;  5JXH A;  5A3O A;  4QB1 A;  3ST7 A;  2FCT A;  5KR7 A;  1OLM E;  4LA3 A;  4KBB A;  1B35 B;  3DKW A;  4XTM A;  3VKM A;  1Y4W A;  5DDJ 1;  4D7S A;  2A6Y A;  1VBA 3;  1DQ0 A;  5CFD B;  1T2X A;  2E51 A;  4FQ4 A;  4QM8 A;  3RJ2 X;  4Z92 B;  1BK1 A;  4BQ3 A;  4Q4X 2;  2LTN A;  5CFC B;  5T5L A;  1V9U 3;  3HD8 B;  4MGK E;  4CP9 A;  2WJS A;  4HLT A;  4A4A A;  3ZMO A;  4XIL A;  4C91 A;  3T09 A;  3TAY A;  2VMF A;  5ABJ C;  1ZRC A;  4K7J A;  1XNA A;  3PJQ A;  3VN4 A;  4GXL A;  3BOW A;  3IDE A;  2I45 A;  3OBT A;  2G9Z A;  5FZM A;  4YZ4 A;  2DF7 A;  2VM9 A;  3AKT A;  4QGL A;  1GMM A;  4QB6 A;  4FI9 A;  5C70 A;  3M3Q A;  2NMN A;  4Q29 A;  5KHH A;  4EN0 A;  4OUS A;  2ZMK A;  1POQ A;  1GOG A;  1AJO A;  3SEE A;  3WUC A;  3SLI A;  1DHK B;  5FZK A;  2W5F A;  2WS9 2;  4CDX B;  3FX3 A;  4QHZ A;  3RVH A;  2PHL A;  4B1L A;  2D6K A;  3GJA A;  2XL7 A;  3H3L A;  1VAV A;  4W6Y A;  1RB8 G;  3RWK X;  4CVU A;  3W5M A;  2VVD A;  1M4W A;  2JG9 C;  1RUH 2;  2Z42 A;  4Y4R A;  1J83 A;  1UOJ A;  4FQZ A;  4XCB A;  2D6L X;  1W8T A;  4IV1 B;  3AKR A;  3JQW A;  3RZL A;  1HRV 3;  1O91 A;  3ZXD A;  2OW4 A;  5J98 B;  3WNL A;  4EZH A;  2R06 1;  4B4Q A;  4UI9 L;  4MUV A;  3VHR A;  5E1R A;  1UNB A;  4BK5 A;  1DZQ A;  3B9I A;  4LHK A;  1S0G A;  2A73 B;  4YGE A;  1AYM 2;  4AI2 A;  4H7M A;  3TB0 A;  1K5M C;  3PDQ A;  3WV6 A;  2DUR A;  5CU1 A;  4CYD A;  4IV3 A;  2XUE A;  5AC9 3;  4LE4 A;  1AX0 A;  1M06 G;  3U4X A;  1CAW B;  1PNF A;  1CJP A;  4ZHN A;  3IZO A;  1NA1 A;  4Y5Z 0;  3N3H A;  1RXF A;  3MFA A;  5HCF A;  4GQ7 A;  4LBJ A;  1SEF A;  2PHX A;  1L7L A;  3RRD A;  1TQ5 A;  4HZF A;  3V0B B;  3WG4 A;  5F2S A;  4A2U A;  2VZT A;  1UXX X;  3GJB A;  3IAP A;  1REF A;  2ET7 A;  1QDC A;  2JJ6 A;  5DAB A;  1FAT A;  1GZ9 A;  2EF6 A;  2J22 A;  2WQZ C;  2F6B A;  3PVO A;  2BGP A;  2WNO A;  1UF2 C;  5E16 A;  3BU7 A;  4JGY B;  3LSE A;  4I0W B;  3WF1 A;  1PGL 1;  2QE3 A;  1Y9G A;  1O3R A;  3O1M A;  2VOT A;  4NPM A;  5LBC A;  4GWI A;  3MIG A;  4XJ9 A;  5K0U C;  2VY0 A;  4Q4V 1;  5D8A A;  2OYZ A;  3S5A A;  1TME 1;  1UZZ A;  3GZE A;  2QKD A;  1PMH X;  3GM8 A;  3UK9 A;  2VQU A;  5FO8 B;  5I93 A;  5FYU A;  2QFE A;  3III A;  2QTW B;  3O7O A;  1CX4 A;  4HXC A;  5JZG C;  2YFU A;  1HDK A;  5A7S A;  1ZBE 2;  2ARX A;  3F2Z A;  3KQR A;  2IXC A;  2DCT A;  1S2K A;  2CV6 A;  5BNN B;  3BPZ A;  3OUH A;  2DBN A;  1LGC A;  4JDM A;  2VR4 A;  4KG0 A;  4JGZ C;  3Q8A A;  4TYS A;  2VMD A;  4Q8K A;  5DZF A;  1D0G A;  1QMJ A;  4CEY A;  1JUI A;  1G9A A;  2V4V A;  4NID A;  4AR2 A;  4CSW A;  2XWJ B;  3HQX A;  1YXW A;  3S57 A;  1PGW 1;  2WS9 3;  3HWJ A;  5J09 A;  4XIO A;  2G19 A;  2B5H A;  2XKP A;  4BU2 A;  1G6N A;  5A7W B;  2ENR A;  4IEO A;  2D5H A;  5I0R A;  3RZG A;  2C6S A;  2Y38 A;  2HJI A;  2OXB A;  2CWM A;  3MPB A;  4Y24 A;  4FAH A;  1C28 A;  2XBO 1;  1ZZC A;  4UOJ A;  1DGW A;  2Q8O A;  3FLT A;  5ACA 2;  1N47 A;  1RUH 3;  3POB A;  2Q8E A;  4P14 A;  4NWV A;  4BM8 A;  2UYA A;  1VB4 A;  1W8Z A;  1YHF A;  3BIW E;  4L8Q A;  3KF3 A;  3AJZ A;  3ME2 A;  4GH4 A;  4LBN A;  1AXZ A;  5IFT A;  1Q3E A;  4O7X A;  4Z82 A;  3RZK A;  2ZGR A;  3ZKU A;  4AQS A;  1QXJ A;  2VBB A;  4WM8 C;  4COV A;  4LO5 B;  3U07 A;  5EPA A;  4BYY A;  4CRQ A;  1SFY A;  2D6O X;  5ERL A;  2QDR A;  4C8D A;  1KJL A;  1EAH 2;  2DDU A;  2DFB A;  4RD7 A;  4GMP 0;  3JBG 2;  1US3 A;  2WO1 A;  4LEJ A;  3I49 A;  2EAA A;  1ZVF A;  1PVC 1;  2ZAH A;  2E6V A;  5APA A;  4R52 A;  5KXE A;  1H4G A;  4YYO A;  1H2K A;  1WCU A;  5DAP A;  1WW6 A;  1F5J A;  1RUD 3;  4QQP A;  1S55 A;  4OHX A;  3U78 A;  4QD2 A;  1R09 2;  1H2M A;  4HVQ A;  5K7P A;  4KG8 A;  1DQ4 A;  4D6S A;  2IFW A;  5JIU A;  4ZKT B;  3AZV A;  1A8D A;  1PIV 3;  4QHO A;  2JG8 B;  2JDN A;  4BA6 A;  1V6J A;  1QDO A;  1J1T A;  3UKN A;  2D93 A;  5C4W B;  2WA3 A;  4N7I A;  3FWE A;  4MG2 A;  3O12 A;  1KIT A;  1FT9 A;  1VBD 1;  2BU9 A;  2EAK A;  4HL0 A;  5FUN A;  3VBH C;  4RN5 A;  5C9A A;  1SLC A;  4YZ3 A;  4AXO A;  4CDQ A;  1KEX A;  3VBS C;  4QAW A;  2GND A;  1N3O A;  1RVF 2;  2VEC A;  2ATF A;  3NRU A;  2W91 A;  3MV1 1;  2Q8D A;  1FPN 2;  2P1B A;  4LKE A;  1IS3 A;  3K77 A;  2PQS A;  2LAL A;  3WQ1 A;  1AR8 1;  4DXT A;  5F39 A;  1W8F A;  5DAX A;  3DN7 A;  2GNB A;  3PUA A;  5JWP A;  1ZBE 3;  3HIF A;  4IGO A;  1HRI 2;  1QJY 2;  2PHW A;  2VW2 A;  4P9J A;  3WDX A;  5A33 B;  2EIE A;  4M00 A;  1ZZ6 A;  4QXH A;  3A0K A;  2HWB 1;  4XFC A;  5A1F A;  2ZEX A;  4LBQ A;  2VZ1 A;  3AXE A;  1C1L A;  1L7R A;  1MS3 A;  2W08 A;  3FBY A;  5FR3 A;  4IEU A;  5C3S A;  5C3Q A;  2DCZ A;  2WR9 A;  1RUG 1;  4Z2W A;  2D97 A;  1CPM A;  4AI9 A;  2ZML A;  1RIT A;  3MEP A;  1OHF A;  2EXJ A;  1ULC A;  2P34 A;  1WLD A;  2PAM A;  3LEG A;  3R0R A;  3KT7 A;  1W6M B;  3OPW A;  2WWS A;  5LAS A;  4CUG A;  4AFB A;  3ZFF C;  1UU5 A;  3TWI A;  2NPI A;  2DVA A;  5F1R A;  1QIQ A;  5JI9 A;  4R9B A;  2RJL A;  3WOG A;  4XHB A;  3N7M A;  4LIU A;  5ANN A;  1Y9Q A;  1YQ6 A;  4LTA A;  4ITC A;  1S2B A;  4WVZ A;  4FBF A;  2F17 A;  2VZV A;  3EBR A;  4TTG A;  2XUM A;  1YI9 A;  2A6X A;  1YIF A;  4IQP A;  4DXS A;  1T6B X;  1GZT A;  4ASK A;  3T0A A;  1QF3 A;  3T3Y A;  2BQP A;  2ZGO A;  2ZGK A;  5L9V A;  1D4M 2;  1DQ6 A;  1SFP A;  3WDV A;  3CEW A;  5A3T A;  2WNU C;  3M3E A;  1APN A;  3T4V A;  1OH4 A;  3VBO B;  3K4Z A;  5A80 A;  2HWE 1;  1DQ5 A;  4FOQ A;  1MZF A;  2P2K A;  4K3U A;  3PU3 A;  4CDW A;  3MGU A;  2WII B;  2EA7 A;  2DUP A;  2VJX A;  4M3C A;  2BBA A;  4QXC A;  2NN8 A;  1LGN A;  4Q4X 1;  2E7T A;  4P08 A;  2PHF A;  1IPJ A;  1AR9 2;  1MVQ A;  1I3H A;  3QLQ A;  2D44 A;  3CL1 A;  4D3W A;  4D6Q A;  1A34 A;  1H8T A;  4Q1R A;  3PUI A;  4H14 A;  4L99 A;  1WBL A;  2D6N A;  1W39 A;  3JQX A;  3LE0 A;  4FTB A;  1GBG A;  1SLI A;  1OLQ A;  2AYH A;  5I0T A;  1DYP A;  3NKG A;  4WZC A;  5BNO A;  1B35 C;  3B69 A;  3AM2 A;  3OUJ A;  5LA0 A;  4QXB A;  4QX7 A;  2X10 A;  4CCL A;  3O0V A;  3IN9 A;  1JYN A;  1XE0 A;  3MIE A;  5L7O C;  5KBF A;  1SZB A;  1AYN 3;  1VR3 A;  4N53 C;  3VD7 A;  1VBB 1;  4DFS A;  3T2O A;  3UKV A;  4FCA A;  5D1I A;  2BRT A;  4XAE A;  2YUE A;  1UXZ A;  3KHB A;  3J8F 2;  4OHW A;  4OLL A;  5FO7 B;  4QKF A;  2RM2 2;  3A22 A;  1UN1 A;  2RR1 3;  2VAU A;  5JDB A;  2Q0A A;  4Y22 B;  4OUL A;  3B93 A;  1G9D A;  1Q8Q A;  1DGR A;  3SCG A;  3DYP A;  1NCR C;  2DTW A;  2ZMN A;  1O3Q A;  5EQU A;  4KWL A;  3T2P A;  5IUQ A;  3WNO A;  2J7M A;  2WUH A;  3F95 A;  1ASJ 2;  1W90 A;  1ENS A;  3CJX A;  4EJR A;  2QQK A;  1NY7 2;  1W04 A;  2V09 A;  1AYM 1;  1JOB A;  4IE5 A;  2ZGN A;  1BKZ A;  1EV1 1;  1CZV A;  1WMD A;  1X9P A;  4CDU A;  3RZZ A;  2GME A;  2SLI A;  4Y5T A;  1RMU 2;  4CEW C;  4A42 A;  4F7Z A;  4RQP C;  3FUQ A;  3K46 A;  3MIF A;  4PDW A;  5FZO A;  5FUP A;  4EN8 B;  1GYK A;  5TSW A;  1Q8O A;  5ABJ B;  5FMD A;  5EJZ B;  3GBW A;  1UPS A;  2R30 A;  4D94 A;  1PK6 C;  2QQN A;  1DU3 D;  2WWJ A;  4EZ4 A;  4IEY A;  5E89 A;  3SH3 A;  5I0S A;  1BEV 1;  3DKQ A;  5FZE A;  3AX4 A;  5KXD A;  2RDN A;  1S0B A;  3NWK A;  4G3Y C;  4GAZ A;  5B4X A;  4I0A A;  2ZHM A;  1ZM1 A;  1RUI 1;  4YNI A;  2CDP A;  1SG3 A;  2VBP A;  3HNM A;  1ZRI A;  3QAC A;  5BYN A;  1DLL A;  1GV9 A;  1D4M 3;  1RYY A;  1WGP A;  1F31 A;  1W6P B;  2CNA A;  3ON7 A;  3POJ A;  2R16 A;  4PF1 A;  4RL7 A;  4RR3 A;  4UFJ A;  5EZW A;  3NO8 A;  3TEX A;  3K75 B;  5KXC A;  4FFF A;  4MGT A;  3VBF A;  4E4D X;  1W2O A;  3AZX A;  1NLQ A;  2J1A A;  2VUC A;  1JYC A;  5K4L A;  3ZXK A;  3TN9 1;  1WCD J;  5FQ0 B;  4WVV A;  4JZR A;  1RUC 3;  2JG9 B;  2V72 A;  3CMG A;  3N9M A;  5FYZ A;  3MID A;  4FXG B;  2AC1 A;  1DG6 A;  3S0M A;  4A7Z A;  3ES1 A;  4JGY C;  5E8A A;  2OT7 A;  4ATF A;  2RS5 3;  4AHX A;  1OOP C;  1F15 A;  1UY4 A;  3IDB B;  5FZ6 A;  1K12 A;  5LEK A;  1Z0H A;  2BNO A;  1U12 A;  3BGA A;  3KV6 A;  2DUQ A;  5FPZ A;  1MQT A;  3OD4 A;  5IK8 A;  2LM3 A;  1HQW A;  1RUN A;  5I8T A;  2E9Q A;  3MIB A;  3O1O A;  5FZH A;  1HV1 A;  2ZKN A;  1CAU B;  4Y1Y A;  1FYU A;  1CWP A;  1ND3 C;  4OCT A;  1RUF 2;  1U5I A;  2NQY A;  3JD7 2;  4JX0 A;  5BV6 A;  2BTV C;  5DMY A;  2XOM A;  3P3N A;  1U5X A;  4WVM B;  3I7D A;  4K21 A;  5BNN C;  4R8H A;  2P5B A;  4AEK A;  4UFI A;  3RS6 A;  4HMZ A;  3GCW A;  2YGM A;  5ACA 1;  1UU4 A;  2HWC 1;  2AEY A;  2RM2 3;  1V70 A;  5HXM A;  5C8C B;  5FZF A;  4CCE A;  4Q0P A;  4L97 A;  2ZHK A;  5FPV A;  3CLP A;  3HR9 A;  2UU8 A;  4V2V A;  4GMP 3;  3WIN E;  2V4A A;  5GLZ A;  2X05 A;  3UL2 A;  3WD5 A;  4XQ4 A;  3D4K A;  3NST A;  2PA7 A;  2WQ4 A;  1J58 A;  1N1Y A;  4DXZ A;  5FDB A;  1ASJ 3;  4YVS A;  2JIC A;  3ZMN A;  5K0U B;  4OHZ A;  1X9T A;  1EAH 1;  3JBG 1;  3AKP A;  2AGS A;  4LK7 A;  1PX4 A;  3CJI C;  2BOJ A;  2P17 A;  2P3Y A;  1YIP A;  2R32 A;  3ZYJ B;  4AL9 A;  3GZU C;  1OI6 A;  4R9A A;  3RPQ A;  2QQU A;  4Z2A A;  4ES9 A;  1OUX A;  3AK0 A;  3LSD A;  2VW0 A;  4ZU4 A;  2XJV A;  5JZG B;  1R09 1;  2C0Z A;  4Q4W 1;  3MI8 A;  4R9D A;  5FYC A;  1PO1 3;  3SCH A;  3ZYR A;  5JPN B;  4Q8L A;  2E7Q A;  1W6N A;  1WZX A;  2BVB A;  3AP6 A;  1JU4 A;  4L92 A;  4LO6 B;  4D8M A;  1D4V B;  4JGZ B;  4KL1 A;  2DCJ A;  1JHJ A;  4FPE A;  4PQQ A;  3UGH A;  4XUN A;  1NXM A;  3OBZ A;  1C8M 2;  3H1Y A;  1AX2 A;  3A0N A;  3BIE A;  2BVV A;  3ZYB A;  2NMO A;  1N1V A;  2FMD A;  3J7H A;  4XJ8 A;  1J3R A;  1RVF 1;  2ZX1 A;  2Y33 A;  2Y0O A;  1ENR A;  1FPN 1;  1W2A X;  1IOA A;  2W1Q A;  1Y43 B;  1YLL A;  2ZTN A;  4NE9 A;  4XJU A;  4CE8 A;  2IXH A;  1ZRF A;  4LPL A;  2IXI A;  5FXZ A;  5FP9 A;  3POY A;  5FK8 A;  5FPU A;  1W2N A;  3DPR B;  5CG8 A;  3MLK A;  4NIG A;  4NHK A;  3OF1 A;  2F4P A;  4A7K A;  2IVJ A;  5DAV A;  5I91 A;  3AYE A;  1HRI 1;  1QJY 1;  1AR7 1;  4JCK A;  1OQD A;  2W0X A;  2DVD A;  1BHG A;  3NNM A;  3ZO0 B;  4AHY A;  1NXD 1;  4CP0 A;  2UY9 A;  3N35 A;  1YI7 A;  2B45 X;  2VME A;  1O4Y A;  1RUJ 2;  3CU7 A;  4WM8 B;  3ZN4 A;  3PL0 A;  1POV 1;  1XU2 A;  2R1B A;  3PVB B;  5IT6 A;  1OA4 A;  1IPK A;  1FOD 2;  1X8E A;  2ZPX A;  4YVW A;  4BCU A;  3KF5 A;  1AX1 A;  3WHU A;  4A7Y A;  2WYS A;  2GP3 A;  2JE7 A;  3J26 N;  5LEJ A;  2PAE A;  5F5C A;  5FMO L;  2H6B A;  4YGD A;  1RJ7 A;  1WBF A;  3KCY A;  1QJX 1;  2QNK A;  5CA6 A;  3UT0 A;  2VZ3 A;  4U2A A;  1TMF 3;  3EMR A;  4YW4 A;  3ZYI B;  1YFU A;  2J1T A;  3ILN A;  1RL3 A;  3MF9 A;  3IKW A;  4A6S A;  3AYC A;  4RHV 1;  5J36 A;  3W59 A;  1JZ2 A;  5FZ8 A;  2GH8 A;  4QPI A;  2MPF A;  3IPV A;  1WD3 A;  3SH5 A;  3T2T A;  1PZ8 A;  3FJS A;  3EQE A;  2BUK A;  1QJU 2;  1WWY A;  2XB6 C;  2MHF A;  1LOA A;  1LNS A;  2WZR 2;  2PN5 A;  3H50 A;  4LK6 A;  5IAX A;  2G1M A;  3TEY A;  3GBG A;  5CYY A;  4AF9 A;  4AED A;  1SBF A;  3OG2 A;  5FYT A;  2YMZ A;  3ZFE A;  3VBH B;  4FPH A;  3KV5 A;  3I2I A;  4HON A;  1RGS A;  3VBS B;  3GXU A;  2ZXQ A;  4PIX A;  2PTM A;  1Q8V A;  1RTV A;  2WDB A;  4FFG A;  3NNF A;  4UW4 A;  5FKC A;  5CB7 A;  2O1Q A;  1FMD 2;  1LOE A;  1G86 A;  1HQN A;  3R4D B;  2GSY A;  3M3O A;  4PQ9 A;  5CZK A;  5CIS A;  5C7G A;  3FZ3 A;  1AR9 1;  4URA A;  3PVE A;  4UFH A;  1DYO A;  1QXP A;  2VNV A;  5EJ3 A;  3WSO A;  4MGS A;  2EXK A;  5BUV A;  4Q0Q A;  4AZZ A;  1ND2 B;  4QGN A;  3KVA A;  4QWN A;  1LOG A;  2EVX A;  3ZFG A;  3WNM A;  5I8S A;  2DVF A;  2V73 A;  2ET1 A;  4N9H A;  3BI3 A;  2JDU A;  2FZ1 A;  1BMV 2;  5F6L B;  4QPG A;  1LHV A;  3IT8 A;  2DU1 A;  1SBD A;  4NWW A;  1C1F A;  3HOB A;  5DAW A;  1ZZ7 A;  1OF4 A;  3PUH A;  5DZE A;  2WWU A;  4XAA A;  3O14 A;  1LJ7 A;  2ZBJ A;  4BQY A;  5BNP B;  5FY7 A;  1K5M A;  1LHN A;  1AXY A;  1OFN A;  1UIK A;  1WMF A;  1NCQ C;  4NRO A;  1S0J A;  1COV 2;  2WQ8 A;  3D8C A;  4C90 A;  3ZFF B;  2VUA A;  3CHX A;  1NT0 A;  2CSG A;  3ELN A;  3J8F 1;  4Z8B A;  1RJ8 A;  1HRV 2;  2GP5 A;  1VB2 A;  3UYJ A;  1NAE A;  1PZ9 A;  4NRQ A;  4D69 A;  3QOP A;  3EYP A;  4I01 A;  2BWC A;  2WSU A;  4E8D A;  3OPT A;  3KT1 A;  1OVS A;  1MZ5 A;  3HN1 A;  4HFS A;  4IE0 A;  4A6O A;  5FP7 A;  1IHM A;  5AFE A;  4BIO A;  4N90 A;  3KV9 A;  2PFW A;  2Z4F A;  2CDO A;  4AAP A;  5GZG A;  1FOD 3;  1WW7 A;  1BVV A;  2WNU B;  3SXW A;  5JUV A;  5K0U A;  1MAC A;  1NY7 1;  3S6P A;  1VBC 2;  5IK4 A;  4AK3 A;  1C3H A;  1OA3 A;  2EID A;  1XPW A;  4MYE A;  4PJY A;  3KT4 A;  2C26 A;  1RMU 1;  3J9S A;  3QBQ A;  4DQA A;  2UWB A;  4YFZ A;  4RS5 B;  4XZU G;  1J84 A;  1GZW A;  3V0A B;  4UAP A;  3FHQ A;  4CCM A;  4LUK A;  3VDD C;  1GP6 A;  1S2E A;  2X5I A;  3VBU C;  4KI5 M;  2ARE A;  3NNL A;  1JZ6 A;  3LKJ A;  3AKS A;  1RUE 2;  4LOR A;  1RIN A;  1HV0 A;  1FX5 A;  4W8J A;  3BOD A;  4K8R B;  4P5Y A;  4COZ A;  4FPG A;  2XLA A;  3WCR A;  2LRP A;  5LRR A;  3WT3 A;  1UZ0 A;  4XAC A;  2IC1 A;  1WME A;  4B7E A;  3PME A;  1HW5 A;  4IES A;  3LB9 A;  1IS5 A;  2O8Q A;  2J1V A;  2VD7 A;  2VO5 A;  2YHJ A;  4FPC A;  2MEV 1;  1RED A;  1DP0 A;  3R4U A;  1H2N A;  1XRU A;  1YCI A;  5FZB A;  1CAX A;  1TZO A;  5M0T A;  1DBN A;  2RMU 2;  2WZP P;  4Y20 A;  5T50 A;  1QNY A;  3I2H A;  5E6H A;  2D3P A;  4O9E A;  1XNC A;  3H3Z A;  4HPK B;  2E32 A;  2QBX A;  4N53 B;  4Z1V A;  3H1M A;  1FMD 3;  4YM3 A;  4I30 A;  4NAM A;  1LRH A;  3K4D A;  3VBR C;  2Y6H A;  2TBV A;  1MVE A;  1R64 A;  1UMZ A;  2P3K A;  1U5Z A;  3E6B A;  4CPB A;  4QDQ A;  4Y1Z A;  5FYI A;  3VZK A;  3R6S A;  2YU1 A;  3SCF A;  4XFI A;  1YFW A;  2LS6 A;  3NQH A;  2YU2 A;  2YPJ A;  3OGR A;  4K8F A;  1LCL A;  1NCR B;  4DS0 A;  4ZZ8 A;  1FV3 A;  1YQ2 A;  5GM0 A;  2YFZ A;  1N1T A;  3N7L A;  2W39 A;  1TG7 A;  2QQL A;  4MX3 A;  3WHT A;  1QHD A;  4RYD A;  2SBA A;  4OQ8 A;  1OKQ A;  4HVR A;  4XDQ A;  3LGR A;  4XDP A;  1RUF 1;  2XWB B;  1GNZ A;  2NM1 A;  1S0E A;  3JD7 1;  3IMN A;  2K46 A;  3O0W A;  1J1L A;  2P6C A;  2D98 A;  4CEW B;  5CBL A;  1COV 3;  2DFC A;  2D6P A;  1DF0 A;  1YJL A;  4AAX A;  4RQP B;  1S0I A;  5B4N A;  1NE4 A;  5FV3 A;  3P5B A;  4QGM A;  1O3T A;  4UT5 A;  2YDE A;  1JOJ A;  1ODM A;  2PAK A;  2FZ2 A;  2Z2S B;  3Q8B A;  1PVX A;  5F3C A;  1PK6 B;  2VTX J;  2ZGL A;  4XPV A;  4WM7 A;  1XBF A;  4COY A;  1UYP A;  4LR4 A;  4AI1 A;  5L19 A;  2GN7 A;  4N43 C;  1IPS A;  4MLO A;  3VKN A;  1FI2 A;  1UU6 A;  2OPK A;  1SCR A;  1WMX A;  4QM9 A;  3W5N A;  3APB A;  2LUW A;  2PMW B;  4JTN A;  4YM1 A;  1GU3 A;  4Q4Y 3;  4AGG A;  2DVB A;  2JDA A;  1VBC 3;  2HH9 A;  1LOF C;  3NJX A;  1BLZ A;  1RUD 2;  4CPB D;  3MLL A;  4OUE A;  3CQO A;  2ZGT A;  1KS5 A;  5C8C C;  3ACG A;  5EV7 A;  1F4A A;  2GC0 A;  4YZ2 A;  3PVN A;  4S2H A;  5F8P A;  3LA3 A;  3IB3 A;  1W6Q A;  1PIV 2;  2PXJ A;  1CAV B;  4IEV A;  1XU1 A;  4GJY A;  3CKH A;  3ZR6 A;  5LCW L;  4AWD A;  1GOF A;  1RUE 3;  3ENR A;  1LHO A;  5K9Y A;  4HKO A;  4V2W A;  1OOP B;  2QDN A;  4E27 A;  1W2U A;  3RFR A;  3VZJ A;  1UWW A;  4M0N A;  2A1X A;  5FY1 A;  3K48 A;  1S0D A;  1C8M 1;  4B3N A;  2VMC A;  2YBK A;  2RS1 1;  3AVR A;  3SQO A;  2RMU 3;  4JTO A;  2JB4 A;  1ND3 B;  5GLW A;  3OBA A;  3PJY A;  1WKY A;  2A3Y A;  2VTF A;  5CAZ A;  2XR4 A;  4XXA A;  2BNN A;  4H55 A;  4OYU A;  4Y33 A;  2PLV 2;  1DFQ A;  3AP7 A;  3HN3 A;  2D6M A;  3B5L B;  4AVS A;  2FDI A;  3RWN A;  1W8O A;  2H6C A;  1QKQ A;  4UF0 A;  3GYD A;  3SKV A;  3TOJ A;  5HBA A;  2WZE A;  3BPS A;  4KBZ A;  2OZ6 A;  4ES8 A;  1A6C A;  4FP3 A;  4DMI A;  4FOV A;  3NV2 A;  3ZLI A;  4DRR A;  1QJF A;  3C7E A;  1L7Q A;  4DNY A;  5F3I A;  1FAY A;  1W8W A;  1AR6 3;  2R07 1;  1WLW A;  2JIG A;  2VOW A;  3KS7 A;  3POS A;  5JPM B;  1RUJ 1;  5D21 A;  4BE3 A;  2OX0 A;  4LIV A;  3KSC A;  4XFF A;  1Z7S 2;  3I2D A;  4I3P A;  4OI4 A;  4XTP A;  3AVS A;  2KR2 A;  4K1Z A;  3TRS B;  2A70 A;  2WNV C;  5FZA A;  5H9Q A;  4FP2 A;  4O9G A;  1O5U A;  2RS3 3;  2ZEW A;  4A44 A;  2FDF A;  4M3C F;  2RHP A;  4R4X A;  3VGI A;  5A32 A;  2WN3 A;  2FHR A;  4FFI A;  3CJI B;  3DPR C;  3ZXE A;  4D6R A;  4UBH A;  1X50 A;  3PLQ A;  2JKX A;  4LMF A;  2XJT A;  4JKL A;  2YC0 A;  3W21 A;  3FHI B;  3WF2 A;  4LHL A;  1CPN A;  1K5J A;  3VZN A;  1JZ3 A;  4XET A;  3OEB A;  3ZR5 A;  2GU9 A;  4LE3 A;  1PM7 A;  1LR5 A;  2ZGP A;  5JOZ A;  2JDH A;  3WQ7 A;  4UWD A;  1QJU 1;  3U0Z A;  1W9W A;  2WZR 1;  2VH9 A;  4YFW A;  1O7F A;  3AP4 A;  3D3A A;  2HWF 3;  1U0A A;  2PEL A;  2CHH A;  3WDY A;  3AC0 A;  3VL8 A;  5C6C A;  5JAX A;  2Z5W A;  2ZX2 A;  2BJS A;  2ETE A;  1HN0 A;  3SMH A;  1H1A A;  1MS4 A;  4IGQ A;  2IZW A;  1B35 A;  2ZAB A;  1VBA 1;  3N9O A;  3H8U A;  4KMQ A;  5FYH A;  5FZC A;  3BKZ A;  3AL6 A;  1WA4 A;  3FHA A;  5CFD A;  5GZD A;  3CO2 A;  3K2O A;  2UY8 A;  4Z07 A;  5FRE A;  1EPZ A;  5FZ4 A;  1V9U 1;  4NPL A;  5CFC A;  4AFM A;  3B7M A;  4P02 B;  2O8O A;  1LUL A;  3I3E A;  2Y64 A;  3R4S A;  2RG4 A;  1NOV A;  2XVK A;  4A41 A;  3A4U A;  5CIR A;  2UWC A;  1XXN A;  2XKO A;  3B9C A;  3BB6 A;  2C5D A;  2IUW A;  3WP6 A;  2QVS B;  4OZO A;  5IJR A;  3TNP B;  1W28 A;  1RHI 2;  2J42 A;  3KB5 A;  3WNX A;  1R08 2;  3VUO A;  4AHW A;  4QX3 A;  1HB3 A;  4FSJ A;  5JI7 A;  3ZVX A;  1YJK A;  5FKB A;  4BWO A;  2R04 2;  5LWB A;  3U11 A;  2GC2 A;  4QDR A;  2ORX A;  1XNB A;  1ZBA 3;  4R9C A;  3KVB A;  3I54 A;  1KD7 A;  4CDX A;  5FIX A;  4EE2 A;  1AYN 2;  1ZRE A;  1BMV 1;  3N9L A;  1JOD A;  3FE5 A;  2H0B A;  4ZON A;  4Q2F A;  4BIF A;  4QQ2 A;  4DPN A;  2BW8 A;  4HSL A;  1XYO A;  4HET A;  1GZC A;  4ZPI A;  3KZ4 C;  4MAD A;  2RR1 2;  5J96 B;  1G9B A;  2PLV 3;  1JZ8 A;  3K51 A;  1ND2 C;  5FZI A;  1HRV 1;  4IV1 A;  1NA1 C;  4E2S A;  5DXD A;  3GHM A;  4CCC A;  4JV4 A;  2XJS A;  1QH7 A;  1Q8P A;  2DVG A;  3A23 A;  3KV4 A;  4I3G A;  5J37 A;  5A3P A;  2DUO A;  2GZW A;  2FQP A;  4IEP A;  3ZSE A;  2ZOE B;  5BNP C;  1WLT A;  3B02 A;  4BXF A;  1Z7S 3;  1A3K A;  2WO3 A;  3ZXA C;  5AC9 1;  4HBN A;  4PBP A;  5L9B A;  5LK5 A;  4LT5 A;  4MXV A;  4FPF A;  5JOY A;  1GKB A;  1CAW A;  1VBE 3;  4QQO A;  4P9L A;  1UYY A;  1E5R A;  4CU8 A;  3UKT A;  1TNR A;  4KU8 A;  4WV8 A;  3S7I A;  3H9A A;  5FYB A;  5IWF A;  4QX0 A;  3FFZ A;  2W1W A;  1CES A;  3DV8 A;  3BOP A;  3IBM A;  3V0B A;  1VMJ A;  4QB2 A;  4NII A;  5FWJ A;  3MIC A;  4FT8 A;  3PIJ A;  3USU B;  1IQA A;  1JH5 A;  2WO2 A;  1HX6 A;  3E5X A;  4JGY A;  1O3S A;  4P9X A;  1VRH 2;  3POG A;  5LK7 B;  5ANQ A;  5FZL A;  1JYX A;  1G9F A;  4A45 A;  3PHM A;  4AQ6 A;  4AVA A;  2CGP A;  5EWS A;  4I02 A;  5GAL A;  5T5J A;  4AHZ A;  3FLP A;  1XNT A;  3ZIW A;  4CEY C;  3FL7 A;  3ACF A;  4RS5 C;  1NQJ A;  5J3U A;  2VG9 A;  3AP9 A;  3ETQ A;  3PIG A;  1RUC 2;  1ND3 A;  1GAN A;  2CL2 A;  4Q5O A;  1NCQ B;  2W9X A;  2AEN A;  4Y1V A;  2FMY A;  5A7O A;  5DUX A;  2JKB A;  5CNA A;  1C5I A;  2J1R A;  2ZJC A;  2RS5 2;  2DCK A;  3ZN6 B;  1QQP 3;  1TEI A;  2XVG A;  5BNN A;  4BK4 A;  3UJO A;  1RHI 3;  5H9S A;  2OA2 A;  1R08 3;  1ONA A;  3RYK A;  1D2Q A;  3VKL A;  3MO4 A;  4BH9 A;  5JSR A;  1IQD C;  3ES4 A;  2B4K A;  2BYV E;  2R04 3;  2WS9 1;  4QKD A;  4DOU A;  1C57 A;  4XJA A;  4GH4 C;  2WFP A;  3JZV A;  5C5T A;  2G9F A;  1J3P A;  1PO2 3;  4PIZ A;  5A7W A;  3VKF C;  3I3B A;  4JQR A;  4UBG A;  1KJR A;  2HWD 3;  2QQM A;  5LA9 A;  3IDC B;  4BB3 A;  3DGT A;  1PMJ X;  1WW5 A;  3JB8 A;  3RQ0 A;  1W6O B;  3H7Y A;  4GB3 2;  4LBL A;  1RUH 1;  3J7M A;  2AAC A;  4IEX A;  5FY5 A;  1FXZ A;  3CIH A;  4HSJ A;  4XUR A;  1K45 A;  3U37 A;  3ZN5 A;  1O4T A;  1A78 A;  5DUU A;  3RGB A;  3VDD B;  1MR5 A;  3FMG A;  4KH9 A;  1NLS A;  4M3C E;  1CZS A;  3VBU B;  3HQU A;  4KWU A;  5EXO A;  1AHS A;  1ULF A;  1YC6 1;  3NJY A;  1CJD A;  1OLR A;  4QQL A;  1I5Z A;  3GBF A;  5JCT A;  4QX2 A;  4LNV A;  5IW0 A;  5JR7 B;  3NNJ A;  2BPA 2;  2L9L A;  3NW4 A;  3VHN A;  2K0G A;  1W8H A;  3ZDV A;  2YXS A;  1R1A 3;  4IXL A;  3A21 A;  1LEN A;  3OY8 B;  4O61 A;  1E5S A;  2XL9 A;  5T5O A;  1YO8 A;  4IER A;  1V6O A;  4YG0 A;  2I74 A;  3I4I A;  2ERF A;  3QCW A;  2CGN A;  5G04 L;  3TNQ A;  3VV1 A;  3ZYG A;  5JOX A;  4E9K A;  4HN0 A;  2E63 A;  5C9A C;  5GZF A;  1NKG A;  5DUV A;  1RUD 1;  4CDQ C;  4SBV A;  3HQR A;  1PO1 2;  4TZD A;  3I59 B;  5A3N A;  4DO0 A;  3DL3 A;  5GJ6 A;  4Y5S A;  4TWT A;  3VBR B;  5C3R A;  2VCM A;  1PIV 1;  3RZM A;  3DYO A;  3TEW A;  1GIC A;  1QOO A;  4F8A A;  2JG8 A;  3WF0 A;  3AB0 A;  3OYW B;  1IKP A;  1PM4 A;  4F3J A;  1W99 A;  1ACC A;  5C4W A;  1VRH 3;  5LB6 A;  3WVJ A;  2PHU A;  4RFT 0;  4OI0 A;  1P8J A;  3C8X A;  5FZ3 A;  5F5A A;  4XBL A;  3ZSJ A;  2ADE A;  4W50 A;  1MZ6 A;  3VDB A;  5JXJ A;  4XE9 A;  1BBT 3;  1HN1 A;  2JEN A;  1K3I A;  5LW9 A;  1G8W A;  2UYB A;  3C7H A;  1F4H A;  3D6E A;  1MPX A;  1LEM A;  4FXK B;  4MXW B;  3WDW A;  3OD0 A;  1F8V A;  4RA0 A;  2FCV A;  5A6Z A;  3I3D A;  4D0Q A;  1D7P M;  3WP3 A;  1ZBE 1;  4E4H A;  3WF3 A;  4AFA A;  4N8M A;  2QZ2 A;  4J1W A;  1H6Y A;  5A33 A;  3WNK A;  5I8Y A;  2R0H A;  2Y34 A;  1AXK A;  1AL2 3;  4GD4 A;  3LWC A;  4EWD A;  5J1X A;  5FZ0 A;  4DZG A;  3LAG A;  5IVE A;  4I0B A;  3H0O A;  1DZT A;  4PF5 A;  5F5Q A;  2QQV A;  4BQW A;  4U36 A;  4JRA A;  5FLI A;  1ULO A;  2C1F A;  3H3U A;  1GNY A;  3RZH A;  4N43 B;  1SPP B;  2HEY F;  3MZH A;  5H9P A;  3KWV A;  2ZX4 A;  5FZ1 A;  5FYV A;  3ZYH A;  4X8N A;  3UES A;  2O14 A;  3B3Q E;  4JVA A;  3H8O A;  4Q0V A;  1QXR A;  2XML A;  5A7N A;  1W0O A;  1PX3 A;  3IM0 A;  5CVR A;  3V64 A;  1W6M A;  1HJF A;  4NPR A;  1TMF 2;  4OMD A;  1V6N A;  1MEC 3;  4YZ1 A;  2BGC A;  4CUA A;  4XZP A;  3RI9 A;  1KFX L;  1ZA4 A;  3AYA A;  4AFD A;  2IWG B;  4GB3 3;  2W1U A;  2AEZ A;  3DXT A;  2J1U A;  4CUB A;  5HPO A;  1SFN A;  1V6I A;  3AMP A;  1V00 A;  1DGR N;  1UQX A;  3AXD A;  2BOI A;  4RGG A;  1I1E A;  1JI6 A;  4EYU A;  1W3X A;  2WO7 A;  4Y4Y A;  3LD8 A;  2ZHL A;  1PMI A;  4CDW C;  2QQW A;  5SV5 A;  1QOS A;  5B2G B;  4L0P A;  5C3O A;  2VC9 A;  4CU7 A;  2DBI A;  2P3J A;  4QKN A;  4EQV A;  2VMI A;  1Y9M A;  1UY3 A;  5DPN A;  5C71 A;  2WFF 3;  4CU9 A;  1H8T C;  1LGB A;  2N7G A;  1AZD A;  3H7J A;  4LQR A;  3VBO A;  1ODN A;  3AMN A;  4QT6 A;  1R1Z A;  5FP4 A;  4OI2 A;  1UZV A;  2Q4S A;  3WQ0 A;  4RSU A;  5JMO A;  4MHR A;  2B8M A;  2R06 2;  2J1E A;  4FPY A;  3ZYP A;  5ISL A;  4CCO A;  5KXB A;  3SIT A;  3O1P A;  1UW8 A;  3O5S A;  1X36 A;  2QQJ A;  5K8S A;  4HKL A;  1OPM A;  3C7G A;  4MGZ E;  2W92 A;  2Y8K A;  3T0B A;  2IVI B;  2ZGS A;  4QPY A;  4YW7 A;  2VZS A;  1UIJ A;  2QUO A;  3THC A;  4YW2 A;  4A3X A;  4Y1U A;  2IFR A;  3E6D A;  1OUR A;  3FUO A;  1O8S A;  2ARC A;  1MZE A;  4Y1X A;  5F3E A;  4FPL A;  4IEZ A;  5C8W A;  1OVP A;  5J7M A;  3OJB A;  3I2K A;  1JYV A;  1HXS 3;  5LRS A;  1RUO A;  5FYS A;  4OI1 A;  5A6Q A;  2VXJ A;  3WEZ A;  1H1M A;  1YFY A;  1XQN A;  3HAG A;  5GZE A;  4KWJ A;  3WCS A;  1YFX A;  3HT1 A;  4JC1 A;  5AVA A;  5CKM A;  3O1S A;  5JMC A;  2Y6F A;  3ZYF A;  4ZS2 A;  2EAL A;  3LIH A;  3V56 A;  1AYN 1;  4P9G A;  3U1X A;  5KWR A;  1LEC A;  2WNV B;  1IG3 A;  5AVP A;  1UD1 A;  4P5H A;  1TNF A;  3OUI A;  1PGL 2;  1OQE A;  3AMH A;  2WA4 A;  2HYK A;  3VZM A;  1SCS A;  2Q1F A;  5EYX A;  1RC6 A;  2RR1 1;  5HCH A;  4B8E A;  2ZGQ A;  1IGO A;  3MW4 A;  4CDU C;  4IW3 A;  3GAL A;  4Q4V 2;  1NX9 A;  1TME 2;  3PNA A;  3AMQ A;  4Y22 A;  2JB8 A;  1FNY A;  5T5P A;  3TEZ A;  5DDJ 3;  1VP6 A;  1W3V A;  1GOH A;  4BOW A;  2VVE A;  1OQ1 A;  1AUY A;  3FBM A;  4PDW C;  3ITQ A;  2X29 A;  1W9F A;  3SH4 A;  3VZL A;  2OVU A;  4CP9 B;  2VZP A;  3ILR A;  3OTF A;  3Q8E A;  5H9R A;  1S4C A;  2TEP A;  2B42 B;  2JXA A;  1OKO A;  1JYT A;  4HT1 T;  2QQP A;  4BME A;  1DCS A;  1GLH A;  2GMP A;  4KWK A;  4OZX A;  1HJG A;  2CAU A;  1ST8 A;  2B7Y A;  5T52 A;  1C5H A;  4O65 A;  1YQC A;  1W0P A;  4X8P A;  1CGP A;  1LU1 A;  1ZZ8 A;  4ONU A;  2GAU A;  3L9J T;  2EXI A;  4Q0S A;  5FMO S;  3TBD A;  3VBF C;  5ABJ A;  4BQ2 A;  1HQL A;  4IEW A;  3LOB A;  5EYY A;  1EYB A;  3POF A;  2CWS A;  2Y6G A;  4PI2 A;  5LA1 A;  2V5D A;  5HI0 A;  1W0N A;  2JIJ A;  2OUH A;  1DDL A;  3BVC A;  3I2J A;  4MSV A;  3I2O A;  3DUI A;  3S7E A;  1D4M 1;  1YYN A;  2VTX A;  5JSP A;  3URF A;  4DUW A;  1SLT A;  1W6P A;  3BN6 A;  2WBK A;  1V6L A;  5FXX A;  3WDT A;  1LAJ A;  2OZJ A;  3GHN A;  4C1X A;  4LKD A;  5LAT A;  1MQT C;  2R06 3;  2A7A A;  5JIA A;  2A71 A;  3PUS A;  2E33 A;  2W1S A;  4GIQ A;  4ISR A;  5FQ0 A;  1RUC 1;  1DQ2 A;  2LRO A;  2JG9 A;  1KQR A;  4HK8 A;  3O1T A;  3BTX A;  4UFK A;  1PGS A;  5FAX A;  4IV3 B;  2CTV A;  3WXP A;  2Y0I A;  2QQI A;  2RS5 1;  3IWZ A;  4RFR B; 
#chains in the Genus database with same CATH homology
 1GZT A;  1OXC A;  2WR9 A;  2BP6 A;  1UZV A;  2BOJ A;  1OVS A;  5A6Z A;  2JDK A;  2BV4 A;  2JDU A;  2JDY A;  2XR4 A;  4UT5 A;  4CE8 A;  2JDM A;  1OUX A;  5A6Y A;  5A3O A;  1W8F A;  3DCQ A;  1UQX A;  2BOI A;  2JDP A;  1OUR A;  5HCH A;  3ZDV A;  1W8H A;  1OVP A;  5A70 A;  2JDN A;  2VUD A;  2VNV A;  2JDH A;  2WRA A;  5D2A A;  5A6Q A;  1OUS A;  2VUC A;  4AOC A;  2CHH A;  5A6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...