4QDSA

Physical basis for nrp2 ligand binding
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
182
structure length
182
Chain Sequence
SHMFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for VEGF-C Binding to Neuropilin-2 and Sequestration by a Soluble Splice Form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Neuropilin-2
total genus 48
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdsA00
3OGRA 3I3DA 4W4ZA 4KI5M 3OB8A 1W8OA 5C71A 3NJVA 2ZEYA 4DEQA 5IJRA 2RV9A 5IFPA 3C7EA 3WF3A 3FN9A 3NNGA 4JKLA 4JKMA 1UYYA 4ZZ8A 2JE8A 3OGSA 2QQLA 2PQSA 4A45A 2L9LA 2YB7A 4GWIA 1W9WA 1NKGA 2BERA 4BDVB 4PF1A 3WSOA 3CQOA 1CX1A 4M4PA 3C7FA 4DUXA 2Y6HA 1UY0A 3HNBM 1JU3A 2DDUA 4A3ZA 4CU7A 2W91A 3OBAA 2XOMA 4P08A 1K45A 2WO3A 1US3A 2JDAA 1OF3A 4OZOA 1H6XA 2WN3A 2VZ3A 4IUGA 4CUBA 3IAQA 3E1F1 2E26A 2YG0A 3T08A 1F4AA 4DXSA 2ORXA 2J1UA 2VTFA 2VMFA 3SEPA 3WEZA 1GQPA 3T0BA 2BGPA 1JHJA 3VD5A 3C7OA 3I2FA 2VZVA 2WN2A 3P6BA 4RYDA 3MUZ1 5IFTA 1UYXA 2E32A 2WYSA 3MV01 1UY2A 1I5PA 3T0DA 4CVUA 3HJRA 3BN6A 1K12A 3J7HA 1EUUA 1PX3A 3WF2A 2WQ8A 3CZJA 2W94A 1SG3A 3D3AA 1DLCA 3LE0A 5G04L 5DQ0A 1PMJX 3LPGA 3I2HA 3LEKA 1CZTA 3K46A 2DCKA 3I2KA 2VMDA 3EYPA 1CZVA 4JKKA 5LCWL 4BK5A 4A4AA 4MO3M 2WBKA 1O59A 4E8CA 2WABA 4UI9L 2Y6KA 3HNMA 3HOBA 4OUEA 4DUVA 1OD3A 1J83A 3IIIA 2VZSA 3P1IA 4XVHA 1IQDC 3THDA 1H6YA 1DP0A 2WDBA 3BGAA 3I97A 3MBWA 1O8SA 3WF0A 3WNPA 4UOJA 4LKSA 2VR4A 3ZM8A 2VJXA 1PMHX 1J84A 2Y6GA 3PUHA 4XUTA 1JZ8A 3LEGA 4W8JA 1KGYA 3VD7A 4PT6A 1BHGA 1WKYA 3C7GA 3T0AA 1OH4A 4E8DA 1W0NA 2YC4A 3UESA 2QQJA 1GOFA 3UETA 3UNPA 2WAOA 2B9VA 2W46A 5HPOA 2X09A 4UAPA 2QBXA 1WCQA 5CYYA 1F4HA 2VMEA 1JYWA 1UZ0A 2KD7A 2VZ1A 2BGOA 5IYYA 2Y6JA 5CZKA 2W47A 2ZEXA 1L7RA 3HPNA 3CDZB 4LPLA 4ZY9A 2VZTA 2CDOA 2WAAA 2BZDA 3I2JA 3T2OA 4P00B 1JZ7A 2V4VA 1ULPA 2X10A 3ACFA 1LNSA 1JZ2A 3A7QA 1JI6A 3K77A 3DECA 5FUIA 2VMCA 2C9KA 3I2IA 2Y8KA 2ZXQA 5JXGA 3CMGA 4MOAA 4QX0A 1JYXA 3CZUA 1UMHA 2VL4A 1JU4A 2W1QA 1OT5A 4AG4A 3SKJE 2R7EB 4A6OA 2VZQA 1JZ3A 1W8NA 3W5MA 1P8JA 4ARXA 4QB1A 2VZOA 1UMIA 4LHSA 1K3IA 3OEBA 4P5YA 4CU6A 1CZSA 1W99A 5DPNA 5JUVA 1UWWA 1W9TA 1CIYA 2C26A 3WNMA 2WZ8A 1UYZA 4DUWA 4XURA 2Z4FA 3ETPA 2VCAA 3DYMA 1EUTA 1UX7A 2CDPA 3VDCA 3WNOA 1JZ6A 4W50A 3GM8A 4L0PA 5LA1A 2V72A 3T09A 1GMMA 2QQNA 2QQOA 1ULOA 3WNNA 5JR2A 2VQTA 4JHZA 1SHWB 4JX0A 3WNLA 2Y6LA 2QQIA 5A1AA 1O8PA 4ZXEA 4ARYA 2J7MA 4RN5A 1NAEA 4BK4A 4CU9A 4CU8A 2W1SA 5LA2A 3LEIA 3VD9A 3DYPA 5J1XA 2J1RA 4ET7A 2HLEA 2V5DA 5DMYA 5HXMA 3IAPA 3K4AA 1R64A 3A21A 2QQMA 4HG6B 3I2GA 2J22A 1TG7A 1TVGA 5JXJA 3OG2A 3GDBA 1NUKA 1UY4A 4XUQA 3FL7A 3HNYM 2HYXA 2XONA 1L7QA 3VD3A 5I0DA 4GZ9A 2JD9A 2VQUA 4KWUA 4BJ0A 3VDBA 1GUIA 4QDRA 5JXIA 1W9SA 2VCBA 3ECQA 5B4NA 1UY3A 4DXRA 2VO5A 2ID4A 4A42A 2W9XA 2BBAA 2VOTA 3AC0A 3DYOA 4A44A 3SKVA 1K42A 4QX3A 4XUOA 3VD4A 1GNYA 1MPXA 3ACHA 3SEEA 3PUIA 3IDAA 3K4DA 3WF4A 5JMOA 4QAWA 1GOHA 1UY1A 2J1TA 2X05A 4M4RA 5EIYB 2W1UA 4TXWA 3NJXA 2W3JA 1HN1A 3MO4A 4XUNA 3C7HA 1DYOA 4AAXA 3FHQA 3FHAA 4KMQA 3IB3A 3MV11 2RJ2A 3GGLA 3I3EA 4OMCA 2YFZA 1SDDB 2VM9A 3A23A 3K75B 2XQXA 2VC9A 2YFUA 4XUPA 4A41A 4CUAA 3ACGA 2RVAA 2VZRA 3U37A 5F7UA 4QDQA 2OKXA 3T2PA 4Z2AA 4LQRA 2ZEZA 3I3BA 4MGQA 5C70A 2W1WA 1OF4A 1JYVA 4OMDA 1UXXX 3MUY1 1US2A 2ORZA 4QB6A 3EB7A 2Y64A 2B4KA 4MGSA 4ZZ5A 2J1VA 4PQQA 4QDSA 2LW8A 3A22A 2C4XA 1T2XA 3ABZA 4D0QA 2E31A 3OEAA 3JXSA 4BXSV 4GWJA 2EICA 2WO2A 2XHNA 4DEVA 3CIHA 1KEXA 3CKHA 2W87A 5B4XA 1XPWA 4YPJA 3WF1A 1JYNA 3F2ZA 2LS6A 2QQKA 5JXHA 3NRUA 2EIBA 1GU3A 2W95A 2W92A 3LPFA 5EJ1B 3NQHA 1RYYA 4DXTA 2EIDA 1XC6A 2WUHA 2J1SA 3W5NA 3THCA 3HEIA 3OGVA 1UXZA 1XNTA 2JKXA 5G05L 4TTGA 2W5FA 4QPWA 2J1EA 3VDAA 1PX4A 5C7GA 2WO1A 2E33A 3ACIA 2WZEA 2DCJA 1D7PM 4MADA 4XZUG 4QX2A 4OYUA 4QB2A 5EJZB 3LQCA 1NX9A 3C8XA 3WNKA 2J1AA 3HN3A 3GXUA 1GOGA 4CUCA 4P02B 3WQBA 4FI9A 1YQ2A 2EIEA 4D8MA 5IHRA 5DN2A 2VCCA 2VZPA 5LA0A 2VZUA 1JZ4A 1JZ5A 1XNAA 3K4ZA 4QX1A 3T2QA 2YC2A 2ZEWA
chains in the Genus database with same CATH superfamily
2D6PA 1RHI1 2DUQA 2ZX4A 3HBKA 4KI5M 1V6OA 4W4ZA 3IDEA 1ZRDA 4DEQA 3ST7A 2YPJA 3BTAA 1HRV3 1ODMA 1X7NA 1W6NB 3TNPB 4YVSC 3C7EA 3FN9A 1IKQA 1R083 1VBC1 4YVSA 3VBUA 3AXDA 4XFGA 3ETQA 1WLDA 4Y5Z0 4N9HA 2GDFA 1NXD1 2PN5A 4LBQD 3O1SA 5KBFA 2JXAA 4FOYA 2QQLA 3NSTA 1GP4A 1LEDA 1LOBA 1JYCA 2YB7A 1LR5A 4GWIA 1GWLA 1VJ2A 4S2DA 1X33A 3FWEA 4JQRA 4Y3OA 5A3PA 3EBRA 1C3HA 2IFWA 3WHUA 1GZCA 5FZFA 4QU1A 1E5SA 2HWF1 1DZRA 4YGDA 1GWKA 3UT0A 2PFWA 3KZ4C 4CP9B 3N4MA 1H8TA 2ZPXA 4COZA 4YVWC 2ZA9A 3WQ1A 3ZX7A 2D3SA 4XAAA 4AI2A 4L8QA 1S2EA 2Q8DA 1DF0A 1AUYA 3OBAA 4CCLA 1NOVA 4XJAA 4YG3A 2JIJA 1PGL1 1RUH3 1ZM1A 4JDMA 3TB0A 1RUF2 1WW7A 1GZWA 3B7MA 1OF3A 1H6XA 1BZWA 4AHYA 1RUG2 2HBTA 1Y9QA 2VZ3A 2WIIB 3LIGA 4PIYA 3VHNA 3OGGA 4IE0A 4UXAA 4YVWB 1RUC1 5EYYA 4AFAA 1CAXB 5L36A 4OQ8A 3WDVA 2YG0A 4XJZA 4V2WA 4I09A 1UIJA 5JR7B 1RTVA 5FUPA 3MICA 4Q4W1 4CEYA 1B35A 3FMGA 1LOGA 2XVKA 1GQPA 5DUXA 3T0BA 4Q4V1 3ILRA 4GQ7A 1W8TA 5LB6A 2ARCA 3BALA 4L99A 2WN2A 4MG2A 5F1RA 1UL9A 5H9SA 4BE3A 5FPUA 5IFTA 2NP0A 2FQPA 2RS53 2D5FA 4EN8B 1GR3A 3MV01 3POWA 3ELNA 4JAAA 4FAHA 3ACLA 2XKOA 4BQ5A 4PHZA 1YJKA 3ASIA 3DEMA 3J8F1 2RJKA 3OYWB 4Q0UA 4QQLA 4BXFA 5FFOC 3T4VA 2FBEA 5A1FA 1MZFA 2NZ9A 3HBZA 1PK6C 4KG8A 4B8EA 2DTWA 4Y1UA 1PX3A 3WF2A 1RUNA 3RZHA 2W94A 4XFAA 4CCJA 4OVEA 1FV2A 1RHI3 5F2WA 5A3NA 4GMP1 3RG0A 3MF6A 1MQTA 1H4GA 2QUOA 5DQ0A 5DZGA 3O1OA 4I0AA 1RUD1 4AEKA 1PMIA 2RS52 1VMFA 4A7ZA 3I2HA 1FOD3 2BYVE 1RUOA 2RG4A 2XLGA 3ZFGA 2GSYA 4XF9A 5EWSA 4YZ2A 1RUE3 1IS4A 1KFXL 3TEWA 4OI2A 1MVEA 4R4XA 3WLUA 5BNQA 1KS5A 4IE4A 2WBKA 2XPJA 4OUSA 1O59A 1W9FA 1WBFA 4BIOA 4Z8BA 2Y6KA 3HNMA 3S7IA 2ZGTA 2RS11 3ZKUA 2ZHLA 4OUEA 4ZS2A 3G7DA 4FTSA 2P5BA 1ZRCA 3M2MA 3VDDB 4D6SA 3IIIA 1DYKA 2VZSA 4XBQA 2A3YA 2IVIB 4A3XA 3THDA 2QZ3A 3WF0A 3ZYIB 3I97A 3WNPA 1RUF3 2PTMA 4LKSA 2VR4A 4YM1A 4FPOB 3K48A 3ZYBA 1ND2C 2VG9A 2VJXA 3EO6A 1PMHX 4AEJA 1LHOA 4NHYA 3ZMOA 2Y6GA 5GZCA 3RZZA 4RHV2 5A32A 4KNCA 3ZYFA 3J7MA 4C0BA 1IS6A 1X36A 1BHGA 2YC0A 4YZ1A 3T0AA 1GBGA 4ZKTB 2Z2SB 4TWTA 3SISA 1CAUB 3POGA 3U78A 4AF9A 1OH4A 1V6JA 4L92A 1S1AA 4PIXA 4RGAA 4PDWC 5DAXA 5FPVA 3VKOA 4QPGA 3RMXA 1W6PA 3UESA 5ISLA 1EAH1 3POBA 1W2AX 4M0NA 1GOFA 4SBVA 3UETA 1QH7A 4BA6A 4AQSA 3WD5A 3UNPA 4PCRA 4FBFA 5JIUA 4BCUA 1OXCA 1XNBA 1WCQA 3U4SA 2HWE3 3KS7A 5LRRA 3H1YA 2BQPA 5CYYA 2VMEA 3OY8B 2RDSA 4KH9A 3V0AA 2HWB1 3KV9A 5KHGA 2VVFA 3VZMA 1HB1A 3UK9A 4N53B 3TOJA 2DVAA 3RWNA 5ABJA 4HVRA 1Y4WA 1UPSA 2W47A 4L11A 2O8QA 4QPIB 4YGBA 3VBHA 3SNMA 1XNKA 3ES4A 5J36A 1L7RA 1APNA 4XPVA 3DL3A 3WV6A 1X82A 4ZY9A 1VPHA 2P6HA 1UKRA 4XC9A 2XJQA 3VV1A 2I45A 4B1LA 1WCKA 1QJX2 5GZDA 4IV3A 2HBUA 1BEV3 1JZ7A 2V4VA 4R9AA 4XMAA 5C5TA 1MVQA 4RS5B 4CCOA 3WG3A 1BKZA 1GQGA 4BH9A 4YZ3A 3Q8AA 3ZMNA 2P2KA 3RI9A 1IOAA 2K2SA 3DECA 4NMIA 3QH7A 1ULEA 3TN93 1ZBA1 2P34A 2PELA 1WW4A 2A7AA 1WZXA 2C9KA 5E16A 4E4HA 5JXGA 5CVRA 3VL9A 5KHIA 1JOBA 4HKLA 1NCQC 2HWD3 2VW1A 3TN91 4BQ4A 2QJVA 2NN8A 3CZUA 1UMHA 1VBD2 1JU4A 1W6MA 5I0UA 4DIQA 4AXOA 3QCWA 1N3PA 5I0RA 4AEMA 4AG4A 3LA2A 1N1YA 3SKJE 1FMD2 2VZQA 3ZYPA 2OPWA 3FUQA 5KC6A 2BRTA 2WNEA 1YEWA 3NV1A 2VOXA 1MEC1 2PHFA 1UZZA 4PI2A 5FZMA 1SFPA 1V9U3 2WRAA 2Y33A 4LHSA 4HN1A 3ZXEA 4Q4X3 2AEZA 1UWWA 5F3IA 1S0EA 2HWD2 1M4WA 2R042 1KFUL 1G8WA 2ETEA 2RMU3 3QOPA 3GYDA 1PGW2 5T55A 2CWSA 2A71A 2ATFA 4OHXA 5IVCA 1WLWA 2XBO2 1VMHA 3ITQA 1UX7A 3VDCA 1LOCA 4JGZB 2Y26A 2AACA 1KXGA 3AZYA 3VKFC 3WDUA 4YFZA 5J48A 1O3SA 3O1RA 1UZVA 2BNNA 3AYDA 2B8MA 3RMYA 4BLJA 4DZGA 2ZGOA 5LA1A 1W0OA 3POIA 1UOBA 4KL1A 1T6GC 3ORJA 3SCFA 4META 4CDWA 5IAXA 3SLIA 1BEV2 3VBOA 1DQ5A 3VBOC 2MHFA 2PHUA 5IATA 2FCVA 5CISA 3VHOA 4QKNA 5L9RA 3HR9A 2P3JA 3LF7A 5FY9A 2HWE1 4CPBD 2GC1A 4ARYA 5FZEA 3WP3A 4Q4Y1 4BK4A 1QHDA 3ATGA 4CU8A 1G86A 1MR5A 1NE6A 3U0ZA 3KHCA 5LA2A 2WJSA 3WR0A 1S0CA 2C0ZA 2D98A 3PVNA 3DYPA 5F9TA 4ZU5A 4BOWA 2V09A 4ET7A 2G9GA 3CHXA 2A6ZA 4FQ4A 5DMYA 1AR62 4Z2WA 3IAPA 1YQ5A 1WD4A 3ZXDA 4Y20B 2KXLA 4B3NA 1CJPA 2GC3A 4Z82A 4W6XA 4MGZE 4RGGA 1URXA 1YJLA 2QQMA 4MX3A 4FCAA 4HPKB 2P1BA 4WVMA 4OI1A 3JD71 1VAMA 4LO8A 1Y43B 2J22A 1LTEA 5FP9A 1QQP1 1SLTA 1TG7A 3ZFEC 4Q0QA 5F8PA 1SMVA 1WA6X 1NUKA 2CL2A 1VE0A 3HQXA 5DUVA 3DKWA 2IXCA 2V73A 1NCRC 1XJAA 3KV4A 4NIHA 1C4RA 3GZTB 4LTAA 1NCRA 1QDOA 2VQUA 3ZSEA 3WDXA 3VDBA 2LALA 4FPGA 2IWGB 5FZLA 3AJZA 4Y4RA 2O14A 1IG3A 4QXBA 5FY1A 3T1MA 3ECQA 4N7UA 4TLGA 2A5ZA 5FPZA 1F9KA 2ZJCA 5KXCA 2D7FA 2BBAA 2VOTA 2ZMLA 5D8AA 1YYNA 3HQRA 2OUHA 1S0DA 2V4AA 1RGSA 4EZHA 1QXRA 4NHMA 4QPIA 1M06G 4FOQA 1UOGA 2VNGA 2YZ4A 1CAWA 3RSJA 1HV0A 1Q56A 1GICA 1C1LA 1XNCA 2E9QA 2E6VA 1QJU2 2EF6A 3AP9A 4YG0A 3DGTA 3SCHA 2J1TA 2D6OX 2JJ6A 1W8HA 5ABJB 4Z92B 4NIIA 3WX5A 5DABA 1YFYA 2F17A 2IFRA 4K40A 4E4SA 4YWAA 2W3JA 3S7EA 4CCCA 3SH3A 1HN0A 1QOSA 3TRSB 1PIV1 3C7HA 3AZXA 1DYOA 1Z7S2 2RE9A 4XFIA 4PLNA 3AKSA 5FYVA 5E1RA 1ULDA 1Q3EA 5SV8A 1RUI2 1PO21 3GGLA 2A6WA 2XXZA 2E53A 1W90A 3BTYA 1YQ8A 2E63A 4OMCA 3SH5A 2G19A 1SDDB 2VM9A 2WZR2 3MHZA 3K75B 4MXVA 3QH6A 5HXVA 1POV3 2XHKA 2XQXA 2VC9A 3TBDA 5JOXA 1AR82 4S2FA 1UNBA 5EP9A 4NRMA 4RFT0 4XUPA 3BTZA 4A41A 2JX9A 1GP6A 2HKXA 3ACGA 3OCPA 1AR91 2A6VA 4FFFA 2VZRA 2CTVA 1RMU2 3U37A 5F7UA 5CADA 1PM7A 2JDNA 2C6SA 3N9LA 2AZ5A 3MIHA 2UURA 1O7FA 3M7AA 1NY71 4LJHA 1RJ7A 4NR1A 1UU5A 1N1VA 4Q1RA 3MW2A 2WNUB 5F3GA 4A6SA 3MLJA 4CZSA 4F8AA 1JYVA 4OMDA 3MUY1 1US2A 4ES9A 3CJIB 4LBMA 4QB6A 3WY6A 4F83A 5F5AA 2K9ZA 2A70A 3LFIA 3NMBA 3MLLA 3O5SA 4R4ZA 4COYA 2J1VA 4UFIA 5LBBA 5LK5A 1C8M2 2F4PA 1T2XA 4QXKA 2E31A 4D7TA 2P3IA 5A3UA 1ENRA 3AFGA 4BXSV 1XB9A 2AUYA 4B7KA 2Q4SA 1S0IA 5C33A 5IK4A 2WO2A 2XHNA 3TEXA 4AI0A 2BP6A 1OH3A 2WFPA 2XL9A 4LIUA 5FIXA 1JN2P 1LHVA 3MPBA 4Y5SA 1BXHA 4OI0A 1TNRA 3C3VA 1AR83 5FZIA 2RS32 3BPSA 5FZHA 1UO9A 3T1LA 2ERFA 3M70A 4OLLA 2OA2A 3OOXA 3OUJA 4NPRA 1W2NA 4YPJA 1OURA 2GMPA 1JYNA 3O1PA 2LS6A 1PIV3 2QQKA 2VTXA 3DF0A 4LBKA 1OLQA 4X6RB 1UX6A 3U10A 5A3TA 2D6NA 3VDDA 5FMOS 3OTFA 4Y1ZA 1GFF2 4P9LA 5HBAA 3IDCB 4G4FA 1QXJA 1DIWA 1VIWB 3TN92 4DXTA 1ENSA 1YFUA 3ZSJA 1SLBA 5FXXA 1DHKB 4WBBA 2R0HA 3W5NA 1WW5A 3MIEA 5K7PA 2W39A 2JWPA 5LEKA 4UFKA 1HJFA 1FOD2 1UAIA 4XJUA 4IEPA 5GZFA 1F5JA 3VBOB 3WVJA 5A33B 2JE7A 1RMU1 2G1MA 2WO1A 3OPTA 2ENRA 1YRZA 4P9YA 3ACIA 1LHNA 2WZEA 2DCJA 1AL22 1AYM2 1REFA 1D7PM 1QJX1 1KDKA 4MADA 4QX2A 5E8AA 4D6RA 2RS13 4JRLA 2P17A 5D1IA 3HN3A 4H7LA 2R073 3CNAA 1VBE2 5C4WC 1I6XA 3CU7A 3LOIA 2JENA 2FHRA 4NRPA 3LDKA 3V0AB 2VU9A 4P02B 5KXEA 5K8SA 5K9YA 1PO12 4C0HA 1W04A 1H8VA 3C2UA 4BQWA 5BV6A 1QXPA 4GWMA 3RZJA 2AR6A 2ZS6B 1YC61 1RUE2 3JBG1 4TN7A 1EPWA 1YI9A 5JVVA 2UY9A 2FCTA 2VZUA 1JZ5A 4QX1A 3VKLA 3KM5A 3BIEA 5JOWA 3I3DA 3UGFA 3ZO0B 2ILMA 5HV4A 1W8OA 3MIBA 2B9UA 1RUJ1 3ZSMA 2EAKA 4QQPA 3R6SA 2A3WA 3PDQA 1OQEA 1E5IA 1Q8VA 1ZZBA 1V6MA 2YU1A 4IE7A 2PAKA 2JIGA 1GYKA 4PBOA 5BXXA 2XB6C 1VBB3 2Y0IA 5GLVA 4CDQC 4EV0A 1W2TA 4XDPA 2OPKA 3OGSA 4FP3A 2JG9B 2VAUA 1ACCA 2L9LA 3PMSA 1QJZA 1DZTA 5KXDA 1UF2C 4LIVA 4FFIA 5T54A 5KWRA 2DUPA 4NVPA 3B94A 3CJXA 4LLOA 5AVAA 3ZSLA 4M3CB 2RDRA 4BDVB 4JZRA 2JDKA 2CSGA 4BQ3A 4Y1XA 4QMAA 1NLRA 3CQOA 1XU1A 3I54A 1QIQA 3TYJA 4CCNA 1QQP2 2WWJA 3BUCA 3HNBM 5EPAA 4IGOA 1POQA 3H3LA 2DDUA 5FMBA 2BUKA 4A3ZA 5BUVA 1AYN1 4FOWA 3M8LA 4DINB 4M3CA 4P9IA 2O8OA 2KA3A 1A3KA 2IXLA 3KQ4B 2VCMA 1CAVA 1NA1C 4XHXA 2WO3A 3RZKA 2H0BA 2WFF3 1LU1A 3PUQA 1PK6A 2XVLA 3OYWA 3FE5A 3GHMA 1OKOA 3GJBA 1PO11 1Q5OA 1VBA1 3MFAA 3MYXA 5FYIA 3ZN6A 2WN3A 3ZR6A 5JSOA 1CGPA 3OUHA 4ATEA 4K20A 3AMQA 4QQHA 4CA9A 4EROA 1SBFA 3PJQA 2RR12 4FPKA 4CUBA 2WKKA 3E1F1 3E6BA 5ABJC 2E7AA 3T08A 2BBVA 2CU5A 1TMF1 1S0GA 4WM8A 2VTFA 3I59A 4AI3A 1MS0A 5FZ4A 1J1TA 1POV1 3U1XA 1RUJ3 2HYKA 1H9PA 1R1A2 1R1A1 3VD5A 3C7OA 3I2FA 5KXBA 2CHHA 1SLAA 3ZFEA 5H9PA 3RGBA 5CBLA 2NQYA 3VBRC 3MUZ1 5I8SA 1UYXA 5EQUA 2OT7A 2OZ6A 3I49A 2E32A 4XYXA 3R4UA 1HRI3 2Q0AA 2QQVA 4BMEA 5I0TA 1LULA 1PNGA 2BV4A 1SZBA 2GU9A 4XIOA 3T0DA 4IV1A 1LOAA 1GSLA 1GNHA 2LROA 4ASKA 4YYOA 4GH4A 5KHJA 3HJRA 1OFSA 4RSUA 2XBO1 4LR4A 3CEWA 1XE0A 3J7HA 3JZVA 3LOBA 1V70A 2XVGA 1RB8G 2WQ8A 1CVNA 1RUG1 2JDPA 1J58A 4PLOA 3ZN4A 3D3AA 3BYWA 4DNYA 5L9VA 4DMIA 1WUVA 4H55A 3O7OA 4NRQA 1BLZA 4RFRB 4TLFA 5G04L 3RS6A 4COWA 4EN9B 5A3LA 1YCIA 1MS4A 4J1XA 3AP4A 4XFFA 4PDWA 5ANNA 1KRIA 2DCKA 1OUXA 4WVMB 4FFHA 3T30A 1IPJA 4KWLA 1QJEA 1R1A3 2Q1FA 3EYPA 2YXSA 2BU9A 1HB3A 4DFSA 3WCRA 1LJ7A 2B5HA 4ISRA 3TAYA 1VBD3 3SCGA 1JH5A 4L2NA 3BCWA 4C1XA 3Q8CA 1I3HA 3MF9A 2GN7A 4AFCA 4R52A 3HOBA 3SMHA 4RR3C 4RQPC 2WT2A 2JECA 1CN1A 4FPEA 4XVHA 5EXOA 5JSPA 5FJKA 3W20A 1IQDC 1H6YA 2D44A 2WDBA 4GJYA 3MBWA 1OUSA 1UPIA 2XLAA 3INAA 4UOJA 3NNFA 3VLBB 5DXDA 3AXEA 1HW5A 2XJRA 1OFNA 3PUHA 4CDXB 3H8RA 3A0KA 1V6LA 4W8JA 1FNYA 1QNWA 4XQ4A 3VD7A 5T5OA 3RFRA 2I07B 1WGPA 3C7GA 1CAWB 1LKNA 2WNOA 1V6NA 4LE3A 4UBHA 3AMNA 4AVVA 1Z0HA 5IK7A 2ADDA 3BB6A 1RUJ2 4KGQA 3RNSA 5KC5A 1RC6A 4H2AA 4XE9A 1H8TB 3D8CA 3ZVXA 3D5OA 4JCKA 2WLQA 2VUDA 2WZR1 2YHJA 4UAPA 2QBXA 2YGMA 5FLJA 5ACA2 4CDUC 1A8MA 1LODA 1F4HA 5AFBA 1UCXA 3DUIA 1BCXA 5BNOB 2KD7A 4LOTA 4AHXA 2UWBA 2VZ1A 4AVAA 4KWKA 2BGOA 3POFA 4GMP0 5IYYA 2H6CA 3CL1A 2RMU1 2GNDA 5FYMA 3H3UA 2DVFA 4KWJA 3ME2A 5FYCA 1VBE1 4LKFA 3HAGA 1U0AA 2VW2A 3HPNA 5A7WA 5A7WB 1BBT2 3ES1A 3CDZB 5GLZA 3HQUA 4BISA 1N47A 2VW0A 2ZAAA 3DPRC 4RHV3 2WAAA 2BZDA 1WCUA 3T2OA 4Q4Y3 5HCFA 2FDKA 3LGRA 1OOPB 2X10A 3ACFA 2RM21 4EWAA 1QH6A 1OA3A 3K77A 3N9PA 3F95A 2WNUA 4LHNA 5A6YA 3LCPA 2G9ZA 3GBFA 2WNUC 4N8MA 3I2IA 2GH8A 2JB8A 3GF6A 5FO8B 4LULA 4AVCA 5LATA 2MEV3 1Q8PA 2P4EA 2BWCA 2A1XA 1AYM3 2XKPA 4E4ZA 4FO9A 2VL4A 4QQOA 2WWUA 2PLV1 4RS5C 2C24A 1UQXA 3L2HA 4K6BA 5FY8A 4EN7B 4LHLA 4YW5A 2RS12 4XCBA 1OT5A 4NIGA 1W03A 5C3OA 2G9FA 2R7EB 1CAVB 2D6KA 2VXRA 2JE9A 2YBSA 5IW0A 3WUDA 3IBMA 1UD1A 5IT6A 1JZ3A 4FTEA 2TNFA 1UKGA 1P8JA 2QKDA 4QB1A 3RVHA 4H7MA 1LECA 1AVBA 4JGYA 4NO4A 4AWDA 1W9TA 5FZ1A 2CGNA 3JBG2 5FYUA 2BVVA 1VB2A 2QQUA 2EVXA 4HVQA 4CE8A 4ZS3A 2C26A 4XDQA 3H1MA 1RUG3 4YW7A 1UYZA 2NPIA 5FUNA 2OYZA 3WP4A 1ZRFA 5ACA3 3ETPA 1JZ6A 1EUTA 2CDPA 3ZSKA 4IV3B 5JZGA 1XYNA 2AEYA 5K4LA 4BM8A 1RUC3 3M4FA 4W50A 2VTXJ 4Q4Y2 1F8VA 2E7QA 4TZDA 3KT4A 1X8MA 3VZJA 5E88A 2V72A 4PDWB 1GMMA 1UYPA 2QQNA 4XF1A 3N3HA 3RZLA 1ULOA 5FBZA 1DDLA 2VQTA 1JMUB 2BJSA 4JHZA 1RVF3 1W28A 2X5IC 2FDJA 3Q8EA 4JX0A 2Y6LA 2X5IA 5JZGB 2QQIA 2X5IB 3PVEA 3M3OA 4Y20A 4ES8A 4I30A 5KR7A 4XAEA 5BY5A 3PL0A 3H3ZA 2A6YA 4LKDA 3LKJA 3AMMA 4CU9A 5HCHA 5GJ6A 4FFGA 2BPA2 2BW8A 1QJY1 1VAVA 1FI2A 2W1SA 5BNNA 5BNNB 3VD9A 5J1XA 1H2NA 3OF1A 1YQ6A 4E2QA 2Z5WA 3H9AA 3MGUA 5D21A 1TEIA 5JI9A 3RJRA 1SBEA 4V1PA 1X9TA 5JPNB 4GJZA 3K4AA 5FMOL 1W9YA 2ZX0A 3H7YA 3KD4A 1G6NA 1X8EA 2GNTA 5FP4A 1A6CA 2R043 3KMHA 3VUOA 3A21A 1L7LA 3B02A 3L9JT 4NHKA 2FDIA 2XR4A 4X8NA 5BPXA 1PZ7A 3W59A 4AR2A 4D94A 5JOZA 1QJFA 2ZGLA 1ND3B 4CSWA 4D3WA 1ENXA 2VH9A 3PVBB 1MS9A 2Y60A 3PJYA 5JOYA 2RDNA 5JXJA 3OG2A 1QU0A 2C5DA 4J6GA 3VBHB 5DG2A 2WC2A 5K0UB 4NAMA 3RJ2X 4AGRA 1GANA 4DB5A 1NA1A 4Q8KA 1SCRA 1BVVA 3PURA 1SLIA 2WSVA 4ONUA 1YHFA 5I0DA 2JD9A 3B9CA 1QJY2 4OZXA 4IETA 5FZ7A 5KHHA 2WT0A 2AH2A 1R082 1ST8A 4LBJA 4EJRA 1YIPA 3JBG3 4PF5A 1FXZA 2HEVF 5FY5A 3ZFGB 4U36A 4FQZA 5LBCA 1AL21 3UL2A 5FCCA 1COV3 2CYFA 3DYOA 4AOCA 5LZ6A 1JS9A 2QE3A 1AR92 3RRDA 4OHZA 3RPQA 3N35A 3AB0A 3O12A 3VD4A 1BBT1 3GHNA 1CR7A 5JSRA 2DUOA 4XF3A 3ZYJB 4Q4W3 2QDRA 4XTMA 3IDAA 3K4DA 4WVVA 4QAWA 4FXGB 3B9IA 1GOHA 3VBSB 2X05A 1LHUA 2E51A 5EIYB 4N90A 2W1UA 3TWIA 2VNVA 1STMA 1RUE1 3S5AA 4BU2A 5FYHA 2RS51 2TUNA 2ZGMA 4NIAA 1RUI3 3NNLA 1Z7S1 3URFA 2EXKA 5FV3A 4QHBA 1XOYA 1S0BA 4KMQA 4XMIA 4YM2A 4AFBA 1A78A 1PGSA 3CJIA 5BNOC 1WCSA 3I3EA 5J98B 3AVSA 2ZGUA 3FFQA 4M00A 1TQ5A 2A6XA 4CRQA 2UY8A 1R1ZA 1LHWA 5C5UA 4QGLA 3ZPOA 3AYEA 4YGCA 1EYBA 2H0VA 1BBT3 3J9SA 5C3QA 1H4HA 1NQDA 1QJX3 2BWAA 3EXUA 5FK7A 5A7QA 1H8TC 4AQ2A 4C8DA 1G9FA 3VB9A 4XACA 1ZNPA 4IE5A 3AZZA 4HSJA 2FD8A 3AKPA 3KWVA 1ASJ2 2WSUA 2DFCA 2PLV2 3AKQA 4FP2A 5CA6A 1LOEA 4LT5A 2ZEZA 3I3BA 4FVVA 3NV2A 4MGQA 1JTZX 3IMMA 5JAXA 2WFF1 2WFF2 5J09A 1OF4A 1FAYA 2ZHNA 2ORZA 4IEZA 2BGCA 5DUWA 1C57A 1OQDA 3BPZA 5A70A 2VMIA 2Y64A 2B4KA 4MGSA 2RM22 1ASJ1 3OSDA 5FO7B 3UJOA 4GWNA 4YVSB 2BNOA 4PQQA 1NY72 2LW8A 3A22A 2C4XA 3M3CA 3UGGA 5FQ0A 3WQ0A 3VKNA 3VZNA 3OEAA 3WQ7A 3QACA 3ZXAC 3WG4A 4HANA 1B35C 1VMJA 3H50A 4MGIE 4EN0A 4JGYC 2XUMA 4CP1A 4DEVA 5A7PA 2RHPA 3NAPA 1KEXA 3AKRA 4QPIC 1WWYA 2O1QA 1AR81 1WMXA 3CKHA 3D6EA 2WINB 4NN0A 2W52A 5FXVA 1DGRN 2BNMA 2C9AA 3WP5A 3H8XA 4N53C 2XH6A 2LTNA 4C91A 1CQ9A 4MLOA 1C5HA 5DUUA 5ERLA 2G4IA 5CU1A 5JXHA 2Z79A 2VVDA 4OI4A 3AFKA 2W92A 1A8DA 2ZKLA 4YNIA 4AYUA 2EAAA 3NQHA 1I9RA 1RYYA 2EIDA 4U2AA 1UN1A 1XC6A 2WUHA 1MACA 2PHLA 4Q26A 4XXPA 1VRH3 4Y5TA 2D43A 4P9XA 2B42B 5FMDA 2HEYF 5CG9A 2WNVB 3OGVA 4WV8A 4XHBA 4CP9A 2JKXA 5G05L 4TTGA 3VBRB 4QPWA 5H9RA 2WNVC 3VHRA 1PX4A 4I2OA 3E6CC 4K3UA 4E27A 2B7YA 1GZTA 3GCWA 3ZYGA 3JQXA 4IXLA 1R081 1VBC3 1XE7A 3RQ0A 4CXWA 1GV9A 2DTYA 2CWMA 5FREA 4HL0A 1NX9A 4NAOA 3LD8A 4QX7A 1RHI2 2J1AA 2W0XA 3ZDVA 1XU2A 3MFCA 2ZKNA 2P6CA 3D82A 4Z07A 4CUCA 2FDFA 1SLCA 4KGGA 3VZKA 1GWMA 1GQHA 1HJGA 2GMMA 3USUA 1POV0 4LBNA 5IHRA 2YBPA 4JHTA 1IPSA 1ND2A 4R9CA 4UFHA 3B69A 3VBUB 1QOOA 5C9AA 1VBE3 1HDKA 2RDQA 1XNAA 5FJHA 1YXWA 2YC2A 2ZEWA 3EQEA 4XFCA 1G9DA 2WS92 4ISQA 4NWWA 1AR71 2CNAA 5FZ8A 3OGRA 4MV2A 3OB8A 1IZ3A 2SLIA 2DVGA 1B35B 1W8WA 5C71A 5LEJA 1DGWX 2ZEYA 4YGEA 1AZDA 3RYRA 4LXLA 3ROUA 5IJRA 2YYOA 5DDJ3 2NMOA 2RV9A 2WL1A 5C8WA 3AK0A 2X8KA 3L2YA 1CAXA 3N7MA 5FKCA 1AR61 3NNGA 3WF3A 1ZVFA 4UFJA 1JW6A 3ZYRA 1W39A 2X53S 5A7OA 2VUJA 3V64A 3BIWE 2BFUS 3O0WA 3KCXA 1PZ8A 3OGJA 1ZRIA 2BTVC 4S2HA 1D4M1 1KQRA 3JU9A 1K5MC 1WMEA 3A4UA 1AF9A 4N43A 4QKDA 5T50A 2JG9C 3SHRA 4UW4A 3ZIWA 2RJLA 2SBAA 2HWE2 3O1UA 4JVAA 4OCTA 1OBNA 4XFBA 2VMHA 1AX1A 4IEXA 3S0MA 5FLHA 5FQ0B 1U5YA 1DBNA 1JUIA 4KQ7A 1CX1A 5BNPB 4M4PA 5FYTA 3C7FA 4XDOA 2Y6HA 5L19A 1JU3A 1EP0A 2DBIA 2WZR3 4IE6A 5FKBA 1TE1B 4QT6A 4XBLA 2DU0A 4UF0B 2RR11 3B3QE 4AL9A 4QX8A 3BODA 2HWB2 3AZVA 3ZFFC 2W68A 5FZDA 2RR13 4FT8A 3V56A 1XYOA 2GNBA 2JDAA 3WP6A 4QU2A 3KVAA 1O4TA 4OZOA 5FXZA 3U14A 4BQ2A 1LOFC 2DVDA 2VECA 2RS31 4OHVA 4IUGA 1GNZA 4GALA 1V6IA 2YMZA 2WA4A 1AYN2 1SPPA 2E26A 3N36A 2XLFA 1F4AA 1DLLA 4G9SB 2Q30A 1ZRRA 4DXSA 2ORXA 4HLTA 2J1UA 4DY3A 2ZX1A 4EN6B 3UKTA 3SEPA 2BGPA 1JHJA 4FXKB 5HCAA 4Q4V2 4FTBA 2VZVA 1HX6A 2NYYA 3P6BA 3OUIA 4RYDA 3ZFGC 5T5LA 4CUGA 2ZOEB 2JG8A 2YY1A 4JDNA 5DZEA 3O1VA 2ZAHA 1UY2A 2QQPA 2VY0A 3BTXA 4CTEA 1W2UA 4XW3A 2WT1A 4YM0A 4CDQA 5JCTA 3SITA 1N1SA 4NUBA 2GMEA 2DV9A 3B5LB 1CPMA 2R071 1ZZ7A 1K12A 2XL7A 3LSEA 4WZFA 4OFGA 1EUUA 4W65A 3J8F3 2ZMNA 1RL3A 5IUQA 3EMRA 3FHIB 3G6JB 5K0UC 1QWRA 2HWD1 2F6BA 2IXJA 3BOWA 4AAPA 2FCUA 5FZGA 1PMJX 4IEWA 1ENQA 3NVCA 3K46A 2VE1A 3I2KA 1OVSA 1W8UA 4E2GA 1J3PA 1MEC2 1XE8A 1LGCA 1Y9GA 5GM0A 2VMDA 2ZX2A 4MSVA 4Q4V3 4JKKA 1C8M1 1W6QA 3QLQA 4O9EA 3RDIA 1PO22 4MO3M 4BK5A 3T3YA 4Q2FA 4XJ9A 2WABA 1WA4A 3K3OA 3P3PA 3D4KA 1H2MA 1H1MA 4UI9L 5E89A 4HFSA 3H42B 4AGVA 4LO6B 1AYN3 1EV12 1EY2A 3VGIA 4DUVA 1OD3A 1SFYA 2ARAA 5FPXA 4IEYA 1F15A 1GKBA 3N7LA 3P1IA 5FY4A 2FZ2A 3ON7A 1DP0A 2OXBA 1O8SA 1QJU1 2EA7A 2RS33 5FTTC 1S4CA 4AI1A 5CKNA 1EAH2 3ZYHA 1J84A 5FZOA 1SFNA 2WNVA 4XUTA 4EWEA 3ILNA 3LEGA 1MZ6A 4ZXKA 3N9OA 1UMZA 3O0VA 3VBFB 2D6MA 3NV4A 4L9BA 4WM8C 1QDCA 3E6DA 4LHKA 1BEV1 4BIFA 1TMF3 1W0NA 1WMDA 4KG0A 1UU6A 3WF4A 5CAZA 2YDEA 2YC4A 4CYDA 1T6BX 4C1WA 4IV3C 2IUWA 1WMFA 4LLFA 2AGSA 2ZZQA 4XIKA 1CESA 3FUOA 4XZPA 3OJBA 3WW4A 1JYWA 1PIV2 4IGPA 1UZ0A 1W3XA 2WWSA 1NXMA 3VHPA 1BMV2 2B39A 5C9AC 2UYBA 1SQ4A 4LBQA 2AC1A 4B4PA 4FOVA 1NA1B 5D8AC 3APBA 3AP6A 4IEQA 5L7OA 5I8TA 5I8YA 2ZEXA 2R0FA 4LBOA 1O5UA 4NOTA 1RUD3 4AQ6A 1NLQA 5JMCA 4B29A 4CCEA 1EPZA 1ZA4A 1PVC2 2HWC2 4IGQA 2VZTA 3HN1A 5EHDA 3DCQA 4MXWB 2ZHMA 4P00B 3USSA 2R30A 3JUUA 1ULPA 3HWJA 4N53A 3FJSA 1WLCA 1UOFA 2YBKA 4K7JA 1W05A 1JZ2A 3I2DA 5C3PA 4DRVA 5IK5A 4M01A 3AVRA 2ES3A 3M1HA 4JC1A 4XABA 2VUAA 1Z7S3 2VMCA 1K5MA 4N43C 4A7YA 3KGLA 4HKWA 2Y8KA 1XSRA 3CMGA 3POJA 5FOJB 4URTA 4MOAA 4QPGB 1Q8SA 1VBC2 4QD2A 3FZ3A 5JWPA 2W1QA 3GNEA 4HMZA 1O4YA 2EIGA 3I3QA 2PYTA 4GMP3 1MS3A 4JTOA 1NCRB 1OA2A 3I4IA 4EWDA 1MS5A 4XOGA 4A6OA 4I3PA 1AXZA 5BYNA 3MZHA 3MI8A 3CLPA 2J42A 4QM8A 3W5MA 4CDWB 3N9MA 4JTNA 4Q4W2 4ARXA 4DS0A 5F5IA 3T4HB 3PNAA 1RMU3 1UMIA 2GNMA 1K3IA 1ALYA 4P5YA 4QGMA 1JODA 1S2KA 4UW3A 4WVZA 1LENA 1YUDA 1WD3A 3IWZA 3AM2A 5DPNA 5FLIA 5A33A 5JUVA 1VB4A 3ZFFA 2DBNA 3AP7A 4HN0A 1RUI1 2EALA 5FPLA 2A75A 4Y22B 2IXKA 4GB33 1W3VA 1ZBA3 2BOJA 2W08A 3KB5A 5L73A 3FBYA 1XQNA 2WZ8A 3WNMA 3IIAA 4DUWA 2JDUA 4Z1VA 4DO0A 4XURA 2PHXA 3E97A 2VCAA 4HXCA 3Q8FA 4QPYA 3NJZA 4ASMB 3WNOA 5LY1A 3BU0A 3KLSA 2IVJA 4MHUA 2KR2A 3POSA 3IZOA 1UU4A 4OULA 5LASA 3GZUC 4DQAA 3GM8A 1RVF2 4RA0A 1LRHA 3T09A 4MH0E 4WM7A 5JDBA 4WM7B 2QQOA 3WNNA 2PA7A 1SLLA 4PI0A 1OLRA 1SHWB 1QKQA 2DWRA 4QKFA 3WNLA 3U07A 1PVC3 2HWC3 2Y34A 3E5QA 2Q1MA 2QZ2A 3KHBA 4PLMA 4UBGA 4XBNA 2UYAA 1NG0A 5FYYA 5A1AA 3W21A 5JLVA 4XETA 1TME3 1G9CA 2J7MA 2YGLA 4RN5A 1NAEA 5IVBA 2YPDA 4M0HA 4QKBA 1H2LA 1GP5A 1OVPA 3I3MA 3ZKYA 1WCDJ 5HI0A 4RQPB 1LCLA 4P5HA 1O3RA 1F35A 4DXZA 3IDBB 2PAEA 3AX4A 4LO5B 2WQZC 4JGZA 1UW8A 2XWBB 2J1RA 2HLEA 1VAKA 3KSCA 5LY2A 1ASJ3 5C3SA 3VL8A 1IGOA 1BK1A 4RS5A 2VOVA 3GALA 4CEYB 1R64A 3JQWA 4CXXA 3ILFA 4OQ9A 1F31A 1LB2A 1KD7A 1FNZA 3V65A 3AYCA 4HG6B 1W6MB 5IK8A 2MNGA 2D5HA 3I2GA 5DAWA 4P9GA 4Y24A 2JKBA 3J4UH 1TVGA 3IPVB 3Q8BA 4YZ5A 4YSFA 1UY4A 1D0HA 4XUQA 1VLNA 3D0SA 3O1TA 2DCTA 3D0JA 4BLIA 4F7ZA 1L7QA 2DCYA 3GZAA 5ACA1 4WZCA 4GZ9A 2IC1A 4L97A 1TME1 3SC7X 2D97A 1ZBA2 2DU1A 4AFMA 2BOIA 4QDRA 3CJIC 5BNOA 5J96B 5JXIA 1ULFA 5A1LA 5FK8A 4MXWA 4YZ4A 3FFZA 3V0BA 1J59A 1AYM1 1PO23 1H9WA 2MEV1 5JZGC 1COV1 1UY3A 2ZGSA 2JDYA 1LEMA 2PQQA 2ID4A 2QTWB 2VVEA 3S6PA 2W9XA 4A42A 5LWBA 2XDVA 4A2UA 3AC0A 4LORA 3SKVA 1MEC3 1K42A 1TME2 1FOD1 1OLME 3LB9A 1AR93 1G7YA 4JDOA 5FZCA 2GH2A 3N7KA 1O6UA 3O0XA 4XUOA 1YNAA 5FXWA 5L7OB 1MPXA 2C1FA 2CGOA 3SEEA 4HK8A 3PUIA 3I59B 4X8PA 4EQVA 4D69A 1LU2A 5IVFA 1QF3A 3R0RA 1UY1A 3B93A 4M4RA 3O14A 4KBBA 4Q29A 5B4NA 3NJXA 3CO2A 5J7MA 1HB2A 4AVSA 3MO4A 5LBFA 2D3RA 1E5RA 3A0NA 2WLPA 5D8AB 4AAXA 3FHQA 1RUH2 5H9QA 5DAPA 5F32A 2CY6A 3FHAA 4CP0A 3IB3A 4ZONA 4YW2A 3MV11 2RJ2A 2R041 2BFUL 1BJQA 2A3XA 3AMPA 1J1LA 1MZEA 1V9U2 3DN7A 3KGZA 1BK0A 5EJ3A 2YFZA 3OBZA 3H0OA 3NAPC 5A7NA 1LGBA 4Q0VA 2YFUA 1FMD3 4COUA 3KCCA 1RUD2 4N9IA 4CUAA 4D7SA 5E6HA 5CFCB 2RVAA 2QCSB 3HMYA 4Q0SA 3PUSA 4NWVA 1IPKA 3ZXJA 3NO8A 2OKXA 1MQTB 3T2PA 3ZXLA 1H0BA 1N3OA 2ADEA 2PXJA 5ANQA 5LA9A 2LUWA 2OUJA 1ULCA 4GA9A 2XJPA 3IKWA 3KCYA 5FDBA 2W1WA 1D4M3 1D2SA 4AEDC 3H8OA 1CX4A 1UXXX 4NIDA 1ZZ6A 3GBGA 4CDQB 1OOPC 2VOKA 3WW2A 1HXS1 2R063 4O9GA 4OHWA 4D7YA 3KF5A 1DYPA 4E2SA 4ZZ5A 4MGKE 1NZCA 2FMYA 4NPMA 2DCZA 5F3CA 3OBTA 3ABZA 1HQLA 1TMF2 4HBNA 4JV4A 4PQ9A 3M3IA 4D0QA 2VGDA 4P14A 4MVTA 4GWJA 2HWF3 3AMHA 4LUMA 4LKEA 1CAUA 4P9WA 4ZHNA 5C6CA 4IESA 1ZA7A 2JB4A 1ZBE1 2PHTA 4GKXA 5CG8A 1W6QB 4IEOA 1CPNA 2N7GA 1RUC2 1C8M3 1VBA2 2ZX3A 5L9BA 2HEWF 5A32B 1XPWA 2ZACA 5A3OA 1DZQA 4NE9A 1DGWA 4LO4B 3AL6A 4LEJA 3F2ZA 5FMCA 1C1FA 1JXNA 2D93A 1XBFA 4CPBA 3M3QA 4YW6A 3NRUA 1PGL2 4BWOA 2XJVA 1GU3A 2W95A 4IL7A 3FLRA 5DZFA 3ZXKA 5C4WB 1PK6B 3K2OA 5LBEA 4ATFA 2VPVA 3LPFA 1FPN1 4V2VA 4FPYA 5EJ1B 4BYYA 5IVVA 2VXJA 2Y6FA 2QNKA 4P9JA 3WHTA 4AHWA 5AVPA 2FDGA 1UIKA 1OKQA 4AW7A 4TYSA 2J1SA 5F6LB 1DQ1A 4J25A 2R32A 3THCA 3KV6A 4PBPA 3RZMA 1U12A 1DGRA 4CDXC 1KJRA 2W5FA 2J1EA 2ZZJA 4YW1A 1FT9A 2ZTNA 4MHRA 1A34A 1NT0A 4RGKA 1ND3A 4DRRA 1R093 4BZ4A 4O7XA 4XZUG 4OYUA 4QB2A 1OI6A 2D6LX 2WS93 5FYBA 3C8XA 1OD5A 2YV8A 3ZPYA 3KT1A 4ZPIA 2ZGKA 1GOGA 2VULA 4JGZC 3OD4A 5T5PA 5T52A 3WQBA 2DF7A 2JG9A 4Q5OA 1XXNA 1YQ2A 3I8TA 2ZHKA 1CWPA 4D8MA 3H1WA 2VCCA 4BQ1A 1CONA 5CNAA 3WOGA 1V6KA 2VZPA 3HD8B 1ONAA 3N7JA 3ZFFB 3B01A 4PIZA 1W6PB 1JZ4A 1VRH1 5IAVA 2VMGA 1SCSA 2OS2A 1U5ZA 2BDRA 3NV3A 4FPCA 4JRAA 3S30A 3UKNA 3WW1A 1YFXA 4YLZA 3MIFA 2O0OA 2W2IA 3NJVA 1V0AA 1WW6A 2A73B 1W8FA 2D40A 5A3MA 5LRSA 5A6QA 3NNJA 5IFPA 4SLIA 5BNPC 5JIAA 3UYJA 2WR9A 4JKLA 5FY0A 4JKMA 1R091 2R1BA 1UYYA 1EAH3 4AI8A 1HB4A 2DFBA 1PO13 3ZXGA 1HRI1 3LEMA 4ZZ8A 1LOFA 2HJIA 2JE8A 3JB4C 1HXS3 3J8F2 4MYEA 4AEDB 4YW3A 2H6BA 2QVSB 2PQSA 1ODNA 1K5MB 3H7JA 2JDHA 4J1WA 4A45A 4N43B 4HONA 1C28A 1W9WA 1FX5A 1R092 1NKGA 2P37A 5IWFA 2BERA 1W6OB 5FZBA 4RHV1 1J3RA 5GLWA 1IS3A 1SEFA 4PF1A 3WSOA 5CFCC 1OSGA 5FBJA 4S2GA 3WDYA 5CFCA 1N3QA 2AYHA 4DUXA 3BKZA 4IW3A 1QQP3 1UY0A 3MLKA 4Q8LA 4DY5A 3R05A 2BEOA 4CU7A 2JG8C 5DDJ1 1LAJA 2Z42A 2NLRA 2OVUA 4NHLA 1O3QA 2W91A 3LAGA 1IQAA 1Y3TA 3WZ1A 1YO8A 3HIFA 2Y0OA 4FPHA 4LBLA 2VNOA 5JI7A 2XOMA 4P08A 1PGW1 3MDPA 3WG1A 2VBPA 4FPJA 1K45A 1PM4A 4GB31 4LNVA 4CCMA 2HWB3 1US3A 3ZIXA 1RUF1 1I1EA 4I3GA 3OY8A 1O5LA 3TEYA 3KV5A 5K0UA 2VUCA 3U11A 4HVOA 4IV1C 1RIRA 2JG8B 1HXS2 4H3WA 3ZN5A 2OQ6A 3KF3A 5F37A 3EJKA 3AKTA 3IAQA 1S55A 2IXIA 1W6NA 3WT3A 3MIGA 2XJUA 4LA2A 2XG3A 4LITA 5C8CB 1FMD1 1Y9MA 5F6KA 3K3NA 5FR3A 5L7OC 3IM0A 2VMFA 3WEZA 4ITCA 1BYHA 5JPMB 1VBD1 3AZWA 3E5UA 3BVCA 5IVJA 4GKYA 2IXHA 2X29A 5FZOB 3MPPG 5M0TA 2WYSA 1KDMA 5IVYA 4YVWA 2OZJA 1YFWA 3RI8A 1DGLA 3LZZA 4R9BA 1I5PA 1OLMA 2TEPA 2KM2A 4XQWA 1SBDA 1AJOA 1PHMA 4UT5A 1DQ6A 2Q8OA 3VDDC 3BN6A 4CVUA 1RJ8A 4WVWA 3AP5A 3J7LA 1KITA 1W2OA 3QBQA 3CZJA 2UWCA 4AHZA 1SG3A 1HQNA 1DLCA 3LE0A 4I01A 5F2SA 1AX0A 2WQ4A 1S2BA 3J26N 3PTRB 3LPGA 3LEKA 1CZTA 2B45X 2EXHA 3DV8A 3VN4A 4LO7A 5A6ZA 1G9AA 1HRV2 1XNDA 3VBRA 4W6YA 4Q4X1 4LUKA 1CZVA 3FBMA 2JEMA 2TBVA 4BQXA 3JCIA 5C3RA 5LCWL 1V00A 3RZGA 2NMNA 5F3EA 1OQ1A 2LM3A 4A4AA 2VQAA 1O4ZA 1UOJA 3ZXFA 4E8CA 3NNMA 5FY7A 4IERA 1H1AA 1J83A 4I02A 5GALA 5C4WA 5AC93 5FO9B 1OA4A 4RL7A 1REEA 2R062 3LDRA 5EYXA 5I91A 4I0WB 3H8UA 3BGAA 2PAMA 5D2AA 1Y7BA 3GJAA 3IN9A 5LK7B 1D4M2 3NL1A 1SACA 3ZM8A 5KHKA 1H1IA 1HRI2 4KBZA 1AJKA 1HV1A 1Q8OA 3CF6E 3WW3A 2I2SA 1JZ8A 1S0FA 4I0BA 3RWKX 3BU7A 1KGYA 3KQRA 4PT6A 3TEZA 4W6WA 1XYPA 1WKYA 3ZDSA 5J3UA 3ENRA 1XSQA 4YW4A 4YRDA 4WM7C 4E8DA 2K0GA 3OBRA 2GP5A 1VBB1 3T2TA 4XTPA 1W06A 3R4DB 2R6QA 5FP7A 2QQJA 1SPPB 4RR3A 5DG1A 2WAOA 2B9VA 2W46A 5HPOA 3FLPA 4ZU4A 1IKPA 1VRH2 1JUHA 2EXJA 2X09A 5LW9A 2P3YA 3FC0A 5GZGA 1AR72 2ARBA 1HLCA 4IEVA 3QD6A 2E7TA 1MS8A 1RUH1 3THTA 1IG0A 5FRAA 4EE2A 2CGPA 3JD72 2Y6JA 1YIFA 2OW4A 4QX5A 5DAVA 1QJU3 5CZKA 1UZWA 1QGLA 3I2OA 2VBBA 4Q1PA 5HCBA 1RINA 2R16A 1AXKA 1LESA 3LA7A 1JYTA 4CEWC 3M3EA 1OPOA 4LPLA 4BHPA 1HRV1 3B00A 1FYUA 2VOWA 1BVP1 2OQ7A 3LSDA 1ZBE2 4AVTA 5BNPA 2ET7A 2OIIA 2CDOA 3I2JA 5FPBA 2JICA 2ZBJA 4B4QA 4FAGA 1AL0G 4HZFA 1F2NA 4CDUA 3MIDA 2GC0A 1W0PA 1NLSA 1LNSA 1OMIA 3A7QA 4LA3A 4QPGC 2Q8EA 5C8CA 5FZKA 1JI6A 5FZAA 3WCSA 4Y22A 5FUIA 4Y4YA 2P3KA 2VD7A 3PHMA 1REDA 4IEUA 2ZXQA 2ZGNA 1B09A 1FPN2 2UU8A 3GCXA 4QX0A 4NHXA 3USUB 2DURA 1MQTC 1F5FA 1JYXA 4K8FA 5F5CA 1AXYA 5IVEA 2D3PA 4IQPA 1EV11 5SV5A 4AK3A 3NW4A 4RD7A 4HETA 2ZGRA 5CIRA 4FSJA 2PLV3 1W8NA 4CDXA 1C8NA 1VR3A 3NAPB 1JOPA 1YQCA 2VZOA 4K8RB 1ND3C 3OEBA 4XJWA 4UW6A 2LRPA 3MEPA 2I74A 1CZSA 1W99A 4XQDA 4CU6A 3RYPA 2QFEA 4B4RA 4A7KA 1CIYA 4GULA 3VBUC 4ORFA 2GC2A 1OPMA 5I0SA 5FPAA 1H30A 2Z4FA 2OX0A 4GH4C 4UYBA 3DYMA 2Q8CA 5BNNC 2CV6A 5F39A 2YU2A 4LOSA 5CKQA 5FZ9A 4XILA 5GLUA 3UKVA 1NCQA 4E4DX 2ARXA 4L0PA 5J37A 4YG6A 2R1DA 5CFDB 2HWF2 3NKGA 2AENA 1AL23 4QQ2A 3OPWA 3JB8A 5JR2A 3HT1A 4ZU7A 3VBFA 3PIGA 2ZGQA 4NROA 1ZBE3 3FX3A 2XQRA 3V0BB 3N9NA 4BPZA 3DKQA 1RXFA 1O8PA 1Q8QA 4ZXEA 3SXWA 1RVF1 4YARA 4HOOA 5CFDC 5HV0A 3ALQA 4NPLA 5CFDA 1IHMA 4X6QB 5EFUA 4RQPA 5T5JA 4E9KA 2R061 3LEIA 4AZZA 5CEHA 2ZMKA 4AQTA 1MS1A 3SH4A 3ZFEB 4AVBA 1QJY3 2VNRA 2V5DA 3MW3A 5FAXA 4K1YA 5GZEA 1D2QA 5HXMA 2WA3A 1OOPA 4HSLA 3R4SA 4M3CE 3DXUA 4MGYE 4XCAA 3WG2A 1YLLA 1CJDA 1GZ9A 1PZ9A 5A6XA 2XWJB 4QM9A 1I5ZA 4GIQA 2K46A 4K21A 1QOTA 4CEYC 4Q4X2 5CB7A 4UW5A 3PLQA 2YUEA 3IPVA 4GXLA 4NJ4A 4XEZA 3VKMA 4JGYB 4B1MA 4CCKA 1FV3A 4XF4A 3AYAA 3P3NA 2WZPP 4N7IA 3GDBA 4C90A 2Q5TA 3FL7A 2HYXA 2XONA 3HNYM 3WXPA 1DFQA 3VD3A 1KS4A 5AC91 4KWUA 2WO7A 4BJ0A 4B7EA 1GUIA 4EZ4A 1WLTA 4INDA 4F3JA 1JBCA 1FATA 4AGGA 1W9SA 1QY4A 4UFMA 4Y1YA 1Q43A 2GAUA 2VCBA 3S5QA 2CAUA 1QMJA 1N1TA 4CCDA 3S57A 1DQ4A 3IMNA 3UV9A 4QXCA 4DXRA 1DQ0A 2VO5A 5FP8A 2ZABA 4BMBA 4QXHA 1TNFA 3FLTA 2V5YA 2YROA 4FPFA 4HKOA 4A44A 2EXIA 2GP3A 1ZZCA 1W6OA 3HT2A 4QX3A 5FWJA 1GNYA 3ACHA 5A7SA 3WUCA 1D0GA 3KVBA 1KJLA 4LE4A 4DOUA 2UWAA 1ZZ8A 3DPRA 2GN3A 3DXTA 5FWEA 3DPRB 1U5IA 5JMOA 1JOJA 1NYWA 2B46X 1YWKA 3ZLIA 3MW4A 4XFHA 2PHWA 1O3TA 1E57A 4CEWB 1OC1A 4TXWA 4AEDA 2WS91 2F4LA 1HN1A 1OHFA 4XJ8A 4IDZA 1UZYA 4XUNA 4MUVA 5FP3A 1QNYA 2FDHA 1DU3D 1GZWB 3VZOA 1J3QA 1C5IA 1Z78A 4KU8A 3PVOA 3THPA 2FZ1A 1NE4A 1VP6A 3AL5A 3J7NA 3LA3A 4MZUA 4CEWA 5FZ6A 3VZLA 1MZ5A 1E5HA 3GZEA 4UWDA 4CDUB 3A23A 4CDWC 5GKAC 2GZWA 3VBSA 4CXYA 4LK6A 3VBSC 1HQWA 3E5XA 1S0JA 2Z69A 5FZ0A 3RYKA 4O61A 1PVXA 1ZZ9A 1ZX5A 3ZR5A 2Y38A 2BVBA 5FOBB 4QDQA 3LFMA 1NCQB 3AJYA 3GBWA 3K51A 1AHSA 3NKTA 3WINE 1WBLA 2MEV2 2Q1ZB 4TSVA 5F5QA 3JD73 4LQRA 4H14A 5EV7A 3POEA 5A80A 4AFDA 4Z2AA 2JDZA 3LIHA 1D4VB 1CIWA 3U4XA 3X29B 5C70A 2RM23 3W58A 4JQTA 3LWCA 5FYZA 3P5BA 2IZWA 3EB7A 3Q9OA 1FPN3 5EZWA 4XXAA 3O1MA 4AE2A 2QQWA 3PUAA 4QDSA 2QDNA 4RR3B 1RITA 2FMDA 2PHDA 3VBHC 4OHYA 3NJYA 4OUMA 3JXSA 3CBNA 3BI3A 3POYA 4K9SA 2JD4A 2EICA 4GD4A 4QGNA 3CIHA 5T3NA 1JHNA 2HWC1 1PVC1 1ZYBA 2WYFA 4R8HA 2W87A 1LGNA 4KU7A 3EHKA 1IS5A 3PMEA 5GLTA 5B4XA 2DVBA 1BQPA 1VRBA 1XRUA 4LBQB 4MGTA 4GAZA 4LMFA 5C9AB 4XF0A 1L3JA 3NWKA 2XGXA 3OPZA 3WF1A 1GLHA 1TZOA 3LDBA 1DQ2A 1AR63 4PJYA 1NQJA 3TNQA 3ZOIA 4D6QA 1SDWA 2VQ0A 2EIBA 4GB32 4HK9A 3ZN6B 4FPLA 3WDWA 2CAVA 4Y33A 2R072 4M3CF 1O91A 1CD3G 3UJQA 4G3YC 4BB3A 3UGHA 1JYIA 4K1ZA 4Q27A 1EV13 2VBDA 1AR73 4URAA 2DYCA 1VBB2 4UF0A 1G9BA 1DCSA 1VALA 4WM8B 1W8ZA 3SQOA 3VBFC 3I7DA 3W9AA 4BQYA 5TSWA 3HEIA 3N9QA 1ZREA 1UXZA 1XNTA 2MPFA 3PU8A 3VDAA 4QHOA 4Y26A 1U5XA 2HH9A 4ASLA 5DAQA 1ND2B 5C7GA 3KT7A 4R9DA 5AFEA 1DG6A 2E33A 3WDTA 5FYSA 3WNXA 4EYUA 2PHRA 2AREA 3PTYA 4HPKA 4DPNA 2ZGPA 1AX2A 1COV2 2XJSA 1V9U1 4Y1VA 5EJZB 3LQCA 5APAA 5C8CC 3PU3A 3WNKA 2ZCWA 4CP2A 2XJTA 3OD0A 1HIXA 3GXUA 3PIJA 1K5JA 1RXGA 2XMLA 4O65A 1X9PA 5AC92 5CKMA 3BOPA 4GH4B 1NZIA 1ULGA 1PNFA 2XBO3 4FI9A 4HT1T 4QWNA 2JDMA 4IV1B 2ET1A 4LK7A 1H2KA 4QHZA 4Q0PA 4UFLA 5FZ3A 2EIEA 4COVA 2R49A 2NM1A 1BMV1 5DN2A 1YI7A 3U75A 1HKDA 2RMU2 2XUEA 4AI9A 3IT8A 4YM3A 5I93A 5LA0A 1VBA3 3HVDA 5DDJ2 5A3WA 3K4ZA 1QEXA 5B2GB 3T2QA 4YFWA 2GALA 2PMWB 1X50A
chains in the Genus database with same CATH topology
3OGRA 3I3DA 4W4ZA 4KI5M 3OB8A 1W8OA 5C71A 3NJVA 2ZEYA 4DEQA 5IJRA 2RV9A 5IFPA 3C7EA 3WF3A 3FN9A 3NNGA 4JKLA 4JKMA 1UYYA 4ZZ8A 2JE8A 3OGSA 2QQLA 2PQSA 4A45A 2L9LA 2YB7A 4GWIA 1W9WA 1NKGA 2BERA 4BDVB 4PF1A 3WSOA 3CQOA 1CX1A 4M4PA 3C7FA 4DUXA 2Y6HA 1UY0A 3HNBM 1JU3A 2DDUA 4A3ZA 4CU7A 2W91A 3OBAA 2XOMA 4P08A 1K45A 2WO3A 1US3A 2JDAA 1OF3A 4OZOA 1H6XA 2WN3A 2VZ3A 4IUGA 4CUBA 3IAQA 3E1F1 2E26A 2YG0A 3T08A 1F4AA 4DXSA 2ORXA 2J1UA 2VTFA 2VMFA 3SEPA 3WEZA 1GQPA 3T0BA 2BGPA 1JHJA 3VD5A 3C7OA 3I2FA 2VZVA 2WN2A 3P6BA 4RYDA 3MUZ1 5IFTA 1UYXA 2E32A 2WYSA 3MV01 1UY2A 1I5PA 3T0DA 4CVUA 3HJRA 3BN6A 1K12A 3J7HA 1EUUA 1PX3A 3WF2A 2WQ8A 3CZJA 2W94A 1SG3A 3D3AA 1DLCA 3LE0A 5G04L 5DQ0A 1PMJX 3LPGA 3I2HA 3LEKA 1CZTA 3K46A 2DCKA 3I2KA 2VMDA 3EYPA 1CZVA 4JKKA 5LCWL 4BK5A 4A4AA 4MO3M 2WBKA 1O59A 4E8CA 2WABA 4UI9L 2Y6KA 3HNMA 3HOBA 4OUEA 4DUVA 1OD3A 1J83A 3IIIA 2VZSA 3P1IA 4XVHA 1IQDC 3THDA 1H6YA 1DP0A 2WDBA 3BGAA 3I97A 3MBWA 1O8SA 3WF0A 3WNPA 4UOJA 4LKSA 2VR4A 3ZM8A 2VJXA 1PMHX 1J84A 2Y6GA 3PUHA 4XUTA 1JZ8A 3LEGA 4W8JA 1KGYA 3VD7A 4PT6A 1BHGA 1WKYA 3C7GA 3T0AA 1OH4A 4E8DA 1W0NA 2YC4A 3UESA 2QQJA 1GOFA 3UETA 3UNPA 2WAOA 2B9VA 2W46A 5HPOA 2X09A 4UAPA 2QBXA 1WCQA 5CYYA 1F4HA 2VMEA 1JYWA 1UZ0A 2KD7A 2VZ1A 2BGOA 5IYYA 2Y6JA 5CZKA 2W47A 2ZEXA 1L7RA 3HPNA 3CDZB 4LPLA 4ZY9A 2VZTA 2CDOA 2WAAA 2BZDA 3I2JA 3T2OA 4P00B 1JZ7A 2V4VA 1ULPA 2X10A 3ACFA 1LNSA 1JZ2A 3A7QA 1JI6A 3K77A 3DECA 5FUIA 2VMCA 2C9KA 3I2IA 2Y8KA 2ZXQA 5JXGA 3CMGA 4MOAA 4QX0A 1JYXA 3CZUA 1UMHA 2VL4A 1JU4A 2W1QA 1OT5A 4AG4A 3SKJE 2R7EB 4A6OA 2VZQA 1JZ3A 1W8NA 3W5MA 1P8JA 4ARXA 4QB1A 2VZOA 1UMIA 4LHSA 1K3IA 3OEBA 4P5YA 4CU6A 1CZSA 1W99A 5DPNA 5JUVA 1UWWA 1W9TA 1CIYA 2C26A 3WNMA 2WZ8A 1UYZA 4DUWA 4XURA 2Z4FA 3ETPA 2VCAA 3DYMA 1EUTA 1UX7A 2CDPA 3VDCA 3WNOA 1JZ6A 4W50A 3GM8A 4L0PA 5LA1A 2V72A 3T09A 1GMMA 2QQNA 2QQOA 1ULOA 3WNNA 5JR2A 2VQTA 4JHZA 1SHWB 4JX0A 3WNLA 2Y6LA 2QQIA 5A1AA 1O8PA 4ZXEA 4ARYA 2J7MA 4RN5A 1NAEA 4BK4A 4CU9A 4CU8A 2W1SA 5LA2A 3LEIA 3VD9A 3DYPA 5J1XA 2J1RA 4ET7A 2HLEA 2V5DA 5DMYA 5HXMA 3IAPA 3K4AA 1R64A 3A21A 2QQMA 4HG6B 3I2GA 2J22A 1TG7A 1TVGA 5JXJA 3OG2A 3GDBA 1NUKA 1UY4A 4XUQA 3FL7A 3HNYM 2HYXA 2XONA 1L7QA 3VD3A 5I0DA 4GZ9A 2JD9A 2VQUA 4KWUA 4BJ0A 3VDBA 1GUIA 4QDRA 5JXIA 1W9SA 2VCBA 3ECQA 5B4NA 1UY3A 4DXRA 2VO5A 2ID4A 4A42A 2W9XA 2BBAA 2VOTA 3AC0A 3DYOA 4A44A 3SKVA 1K42A 4QX3A 4XUOA 3VD4A 1GNYA 1MPXA 3ACHA 3SEEA 3PUIA 3IDAA 3K4DA 3WF4A 5JMOA 4QAWA 1GOHA 1UY1A 2J1TA 2X05A 4M4RA 5EIYB 2W1UA 4TXWA 3NJXA 2W3JA 1HN1A 3MO4A 4XUNA 3C7HA 1DYOA 4AAXA 3FHQA 3FHAA 4KMQA 3IB3A 3MV11 2RJ2A 3GGLA 3I3EA 4OMCA 2YFZA 1SDDB 2VM9A 3A23A 3K75B 2XQXA 2VC9A 2YFUA 4XUPA 4A41A 4CUAA 3ACGA 2RVAA 2VZRA 3U37A 5F7UA 4QDQA 2OKXA 3T2PA 4Z2AA 4LQRA 2ZEZA 3I3BA 4MGQA 5C70A 2W1WA 1OF4A 1JYVA 4OMDA 1UXXX 3MUY1 1US2A 2ORZA 4QB6A 3EB7A 2Y64A 2B4KA 4MGSA 4ZZ5A 2J1VA 4PQQA 4QDSA 2LW8A 3A22A 2C4XA 1T2XA 3ABZA 4D0QA 2E31A 3OEAA 3JXSA 4BXSV 4GWJA 2EICA 2WO2A 2XHNA 4DEVA 3CIHA 1KEXA 3CKHA 2W87A 5B4XA 1XPWA 4YPJA 3WF1A 1JYNA 3F2ZA 2LS6A 2QQKA 5JXHA 3NRUA 2EIBA 1GU3A 2W95A 2W92A 3LPFA 5EJ1B 3NQHA 1RYYA 4DXTA 2EIDA 1XC6A 2WUHA 2J1SA 3W5NA 3THCA 3HEIA 3OGVA 1UXZA 1XNTA 2JKXA 5G05L 4TTGA 2W5FA 4QPWA 2J1EA 3VDAA 1PX4A 5C7GA 2WO1A 2E33A 3ACIA 2WZEA 2DCJA 1D7PM 4MADA 4XZUG 4QX2A 4OYUA 4QB2A 5EJZB 3LQCA 1NX9A 3C8XA 3WNKA 2J1AA 3HN3A 3GXUA 1GOGA 4CUCA 4P02B 3WQBA 4FI9A 1YQ2A 2EIEA 4D8MA 5IHRA 5DN2A 2VCCA 2VZPA 5LA0A 2VZUA 1JZ4A 1JZ5A 1XNAA 3K4ZA 4QX1A 3T2QA 2YC2A 2ZEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGR A;  3I3D A;  4W4Z A;  4KI5 M;  3OB8 A;  1W8O A;  5C71 A;  3NJV A;  2ZEY A;  4DEQ A;  5IJR A;  2RV9 A;  5IFP A;  3C7E A;  3WF3 A;  3FN9 A;  3NNG A;  4JKL A;  4JKM A;  1UYY A;  4ZZ8 A;  2JE8 A;  3OGS A;  2QQL A;  2PQS A;  4A45 A;  2L9L A;  2YB7 A;  4GWI A;  1W9W A;  1NKG A;  2BER A;  4BDV B;  4PF1 A;  3WSO A;  3CQO A;  1CX1 A;  4M4P A;  3C7F A;  4DUX A;  2Y6H A;  1UY0 A;  3HNB M;  1JU3 A;  2DDU A;  4A3Z A;  4CU7 A;  2W91 A;  3OBA A;  2XOM A;  4P08 A;  1K45 A;  2WO3 A;  1US3 A;  2JDA A;  1OF3 A;  4OZO A;  1H6X A;  2WN3 A;  2VZ3 A;  4IUG A;  4CUB A;  3IAQ A;  3E1F 1;  2E26 A;  2YG0 A;  3T08 A;  1F4A A;  4DXS A;  2ORX A;  2J1U A;  2VTF A;  2VMF A;  3SEP A;  3WEZ A;  1GQP A;  3T0B A;  2BGP A;  1JHJ A;  3VD5 A;  3C7O A;  3I2F A;  2VZV A;  2WN2 A;  3P6B A;  4RYD A;  3MUZ 1;  5IFT A;  1UYX A;  2E32 A;  2WYS A;  3MV0 1;  1UY2 A;  1I5P A;  3T0D A;  4CVU A;  3HJR A;  3BN6 A;  1K12 A;  3J7H A;  1EUU A;  1PX3 A;  3WF2 A;  2WQ8 A;  3CZJ A;  2W94 A;  1SG3 A;  3D3A A;  1DLC A;  3LE0 A;  5G04 L;  5DQ0 A;  1PMJ X;  3LPG A;  3I2H A;  3LEK A;  1CZT A;  3K46 A;  2DCK A;  3I2K A;  2VMD A;  3EYP A;  1CZV A;  4JKK A;  5LCW L;  4BK5 A;  4A4A A;  4MO3 M;  2WBK A;  1O59 A;  4E8C A;  2WAB A;  4UI9 L;  2Y6K A;  3HNM A;  3HOB A;  4OUE A;  4DUV A;  1OD3 A;  1J83 A;  3III A;  2VZS A;  3P1I A;  4XVH A;  1IQD C;  3THD A;  1H6Y A;  1DP0 A;  2WDB A;  3BGA A;  3I97 A;  3MBW A;  1O8S A;  3WF0 A;  3WNP A;  4UOJ A;  4LKS A;  2VR4 A;  3ZM8 A;  2VJX A;  1PMH X;  1J84 A;  2Y6G A;  3PUH A;  4XUT A;  1JZ8 A;  3LEG A;  4W8J A;  1KGY A;  3VD7 A;  4PT6 A;  1BHG A;  1WKY A;  3C7G A;  3T0A A;  1OH4 A;  4E8D A;  1W0N A;  2YC4 A;  3UES A;  2QQJ A;  1GOF A;  3UET A;  3UNP A;  2WAO A;  2B9V A;  2W46 A;  5HPO A;  2X09 A;  4UAP A;  2QBX A;  1WCQ A;  5CYY A;  1F4H A;  2VME A;  1JYW A;  1UZ0 A;  2KD7 A;  2VZ1 A;  2BGO A;  5IYY A;  2Y6J A;  5CZK A;  2W47 A;  2ZEX A;  1L7R A;  3HPN A;  3CDZ B;  4LPL A;  4ZY9 A;  2VZT A;  2CDO A;  2WAA A;  2BZD A;  3I2J A;  3T2O A;  4P00 B;  1JZ7 A;  2V4V A;  1ULP A;  2X10 A;  3ACF A;  1LNS A;  1JZ2 A;  3A7Q A;  1JI6 A;  3K77 A;  3DEC A;  5FUI A;  2VMC A;  2C9K A;  3I2I A;  2Y8K A;  2ZXQ A;  5JXG A;  3CMG A;  4MOA A;  4QX0 A;  1JYX A;  3CZU A;  1UMH A;  2VL4 A;  1JU4 A;  2W1Q A;  1OT5 A;  4AG4 A;  3SKJ E;  2R7E B;  4A6O A;  2VZQ A;  1JZ3 A;  1W8N A;  3W5M A;  1P8J A;  4ARX A;  4QB1 A;  2VZO A;  1UMI A;  4LHS A;  1K3I A;  3OEB A;  4P5Y A;  4CU6 A;  1CZS A;  1W99 A;  5DPN A;  5JUV A;  1UWW A;  1W9T A;  1CIY A;  2C26 A;  3WNM A;  2WZ8 A;  1UYZ A;  4DUW A;  4XUR A;  2Z4F A;  3ETP A;  2VCA A;  3DYM A;  1EUT A;  1UX7 A;  2CDP A;  3VDC A;  3WNO A;  1JZ6 A;  4W50 A;  3GM8 A;  4L0P A;  5LA1 A;  2V72 A;  3T09 A;  1GMM A;  2QQN A;  2QQO A;  1ULO A;  3WNN A;  5JR2 A;  2VQT A;  4JHZ A;  1SHW B;  4JX0 A;  3WNL A;  2Y6L A;  2QQI A;  5A1A A;  1O8P A;  4ZXE A;  4ARY A;  2J7M A;  4RN5 A;  1NAE A;  4BK4 A;  4CU9 A;  4CU8 A;  2W1S A;  5LA2 A;  3LEI A;  3VD9 A;  3DYP A;  5J1X A;  2J1R A;  4ET7 A;  2HLE A;  2V5D A;  5DMY A;  5HXM A;  3IAP A;  3K4A A;  1R64 A;  3A21 A;  2QQM A;  4HG6 B;  3I2G A;  2J22 A;  1TG7 A;  1TVG A;  5JXJ A;  3OG2 A;  3GDB A;  1NUK A;  1UY4 A;  4XUQ A;  3FL7 A;  3HNY M;  2HYX A;  2XON A;  1L7Q A;  3VD3 A;  5I0D A;  4GZ9 A;  2JD9 A;  2VQU A;  4KWU A;  4BJ0 A;  3VDB A;  1GUI A;  4QDR A;  5JXI A;  1W9S A;  2VCB A;  3ECQ A;  5B4N A;  1UY3 A;  4DXR A;  2VO5 A;  2ID4 A;  4A42 A;  2W9X A;  2BBA A;  2VOT A;  3AC0 A;  3DYO A;  4A44 A;  3SKV A;  1K42 A;  4QX3 A;  4XUO A;  3VD4 A;  1GNY A;  1MPX A;  3ACH A;  3SEE A;  3PUI A;  3IDA A;  3K4D A;  3WF4 A;  5JMO A;  4QAW A;  1GOH A;  1UY1 A;  2J1T A;  2X05 A;  4M4R A;  5EIY B;  2W1U A;  4TXW A;  3NJX A;  2W3J A;  1HN1 A;  3MO4 A;  4XUN A;  3C7H A;  1DYO A;  4AAX A;  3FHQ A;  3FHA A;  4KMQ A;  3IB3 A;  3MV1 1;  2RJ2 A;  3GGL A;  3I3E A;  4OMC A;  2YFZ A;  1SDD B;  2VM9 A;  3A23 A;  3K75 B;  2XQX A;  2VC9 A;  2YFU A;  4XUP A;  4A41 A;  4CUA A;  3ACG A;  2RVA A;  2VZR A;  3U37 A;  5F7U A;  4QDQ A;  2OKX A;  3T2P A;  4Z2A A;  4LQR A;  2ZEZ A;  3I3B A;  4MGQ A;  5C70 A;  2W1W A;  1OF4 A;  1JYV A;  4OMD A;  1UXX X;  3MUY 1;  1US2 A;  2ORZ A;  4QB6 A;  3EB7 A;  2Y64 A;  2B4K A;  4MGS A;  4ZZ5 A;  2J1V A;  4PQQ A;  4QDS A;  2LW8 A;  3A22 A;  2C4X A;  1T2X A;  3ABZ A;  4D0Q A;  2E31 A;  3OEA A;  3JXS A;  4BXS V;  4GWJ A;  2EIC A;  2WO2 A;  2XHN A;  4DEV A;  3CIH A;  1KEX A;  3CKH A;  2W87 A;  5B4X A;  1XPW A;  4YPJ A;  3WF1 A;  1JYN A;  3F2Z A;  2LS6 A;  2QQK A;  5JXH A;  3NRU A;  2EIB A;  1GU3 A;  2W95 A;  2W92 A;  3LPF A;  5EJ1 B;  3NQH A;  1RYY A;  4DXT A;  2EID A;  1XC6 A;  2WUH A;  2J1S A;  3W5N A;  3THC A;  3HEI A;  3OGV A;  1UXZ A;  1XNT A;  2JKX A;  5G05 L;  4TTG A;  2W5F A;  4QPW A;  2J1E A;  3VDA A;  1PX4 A;  5C7G A;  2WO1 A;  2E33 A;  3ACI A;  2WZE A;  2DCJ A;  1D7P M;  4MAD A;  4XZU G;  4QX2 A;  4OYU A;  4QB2 A;  5EJZ B;  3LQC A;  1NX9 A;  3C8X A;  3WNK A;  2J1A A;  3HN3 A;  3GXU A;  1GOG A;  4CUC A;  4P02 B;  3WQB A;  4FI9 A;  1YQ2 A;  2EIE A;  4D8M A;  5IHR A;  5DN2 A;  2VCC A;  2VZP A;  5LA0 A;  2VZU A;  1JZ4 A;  1JZ5 A;  1XNA A;  3K4Z A;  4QX1 A;  3T2Q A;  2YC2 A;  2ZEW A; 
#chains in the Genus database with same CATH topology
 2D6P A;  1RHI 1;  2DUQ A;  2ZX4 A;  3HBK A;  4KI5 M;  1V6O A;  4W4Z A;  3IDE A;  1ZRD A;  4DEQ A;  3ST7 A;  2YPJ A;  3BTA A;  1HRV 3;  1ODM A;  1X7N A;  1W6N B;  3TNP B;  4YVS C;  3C7E A;  3FN9 A;  1IKQ A;  1R08 3;  1VBC 1;  4YVS A;  3VBU A;  3AXD A;  4XFG A;  3ETQ A;  1WLD A;  4Y5Z 0;  4N9H A;  2GDF A;  1NXD 1;  2PN5 A;  4LBQ D;  3O1S A;  5KBF A;  2JXA A;  4FOY A;  2QQL A;  3NST A;  1GP4 A;  1LED A;  1LOB A;  1JYC A;  2YB7 A;  1LR5 A;  4GWI A;  1GWL A;  1VJ2 A;  4S2D A;  1X33 A;  3FWE A;  4JQR A;  4Y3O A;  5A3P A;  3EBR A;  1C3H A;  2IFW A;  3WHU A;  1GZC A;  5FZF A;  4QU1 A;  1E5S A;  2HWF 1;  1DZR A;  4YGD A;  1GWK A;  3UT0 A;  2PFW A;  3KZ4 C;  4CP9 B;  3N4M A;  1H8T A;  2ZPX A;  4COZ A;  4YVW C;  2ZA9 A;  3WQ1 A;  3ZX7 A;  2D3S A;  4XAA A;  4AI2 A;  4L8Q A;  1S2E A;  2Q8D A;  1DF0 A;  1AUY A;  3OBA A;  4CCL A;  1NOV A;  4XJA A;  4YG3 A;  2JIJ A;  1PGL 1;  1RUH 3;  1ZM1 A;  4JDM A;  3TB0 A;  1RUF 2;  1WW7 A;  1GZW A;  3B7M A;  1OF3 A;  1H6X A;  1BZW A;  4AHY A;  1RUG 2;  2HBT A;  1Y9Q A;  2VZ3 A;  2WII B;  3LIG A;  4PIY A;  3VHN A;  3OGG A;  4IE0 A;  4UXA A;  4YVW B;  1RUC 1;  5EYY A;  4AFA A;  1CAX B;  5L36 A;  4OQ8 A;  3WDV A;  2YG0 A;  4XJZ A;  4V2W A;  4I09 A;  1UIJ A;  5JR7 B;  1RTV A;  5FUP A;  3MIC A;  4Q4W 1;  4CEY A;  1B35 A;  3FMG A;  1LOG A;  2XVK A;  1GQP A;  5DUX A;  3T0B A;  4Q4V 1;  3ILR A;  4GQ7 A;  1W8T A;  5LB6 A;  2ARC A;  3BAL A;  4L99 A;  2WN2 A;  4MG2 A;  5F1R A;  1UL9 A;  5H9S A;  4BE3 A;  5FPU A;  5IFT A;  2NP0 A;  2FQP A;  2RS5 3;  2D5F A;  4EN8 B;  1GR3 A;  3MV0 1;  3POW A;  3ELN A;  4JAA A;  4FAH A;  3ACL A;  2XKO A;  4BQ5 A;  4PHZ A;  1YJK A;  3ASI A;  3DEM A;  3J8F 1;  2RJK A;  3OYW B;  4Q0U A;  4QQL A;  4BXF A;  5FFO C;  3T4V A;  2FBE A;  5A1F A;  1MZF A;  2NZ9 A;  3HBZ A;  1PK6 C;  4KG8 A;  4B8E A;  2DTW A;  4Y1U A;  1PX3 A;  3WF2 A;  1RUN A;  3RZH A;  2W94 A;  4XFA A;  4CCJ A;  4OVE A;  1FV2 A;  1RHI 3;  5F2W A;  5A3N A;  4GMP 1;  3RG0 A;  3MF6 A;  1MQT A;  1H4G A;  2QUO A;  5DQ0 A;  5DZG A;  3O1O A;  4I0A A;  1RUD 1;  4AEK A;  1PMI A;  2RS5 2;  1VMF A;  4A7Z A;  3I2H A;  1FOD 3;  2BYV E;  1RUO A;  2RG4 A;  2XLG A;  3ZFG A;  2GSY A;  4XF9 A;  5EWS A;  4YZ2 A;  1RUE 3;  1IS4 A;  1KFX L;  3TEW A;  4OI2 A;  1MVE A;  4R4X A;  3WLU A;  5BNQ A;  1KS5 A;  4IE4 A;  2WBK A;  2XPJ A;  4OUS A;  1O59 A;  1W9F A;  1WBF A;  4BIO A;  4Z8B A;  2Y6K A;  3HNM A;  3S7I A;  2ZGT A;  2RS1 1;  3ZKU A;  2ZHL A;  4OUE A;  4ZS2 A;  3G7D A;  4FTS A;  2P5B A;  1ZRC A;  3M2M A;  3VDD B;  4D6S A;  3III A;  1DYK A;  2VZS A;  4XBQ A;  2A3Y A;  2IVI B;  4A3X A;  3THD A;  2QZ3 A;  3WF0 A;  3ZYI B;  3I97 A;  3WNP A;  1RUF 3;  2PTM A;  4LKS A;  2VR4 A;  4YM1 A;  4FPO B;  3K48 A;  3ZYB A;  1ND2 C;  2VG9 A;  2VJX A;  3EO6 A;  1PMH X;  4AEJ A;  1LHO A;  4NHY A;  3ZMO A;  2Y6G A;  5GZC A;  3RZZ A;  4RHV 2;  5A32 A;  4KNC A;  3ZYF A;  3J7M A;  4C0B A;  1IS6 A;  1X36 A;  1BHG A;  2YC0 A;  4YZ1 A;  3T0A A;  1GBG A;  4ZKT B;  2Z2S B;  4TWT A;  3SIS A;  1CAU B;  3POG A;  3U78 A;  4AF9 A;  1OH4 A;  1V6J A;  4L92 A;  1S1A A;  4PIX A;  4RGA A;  4PDW C;  5DAX A;  5FPV A;  3VKO A;  4QPG A;  3RMX A;  1W6P A;  3UES A;  5ISL A;  1EAH 1;  3POB A;  1W2A X;  4M0N A;  1GOF A;  4SBV A;  3UET A;  1QH7 A;  4BA6 A;  4AQS A;  3WD5 A;  3UNP A;  4PCR A;  4FBF A;  5JIU A;  4BCU A;  1OXC A;  1XNB A;  1WCQ A;  3U4S A;  2HWE 3;  3KS7 A;  5LRR A;  3H1Y A;  2BQP A;  5CYY A;  2VME A;  3OY8 B;  2RDS A;  4KH9 A;  3V0A A;  2HWB 1;  3KV9 A;  5KHG A;  2VVF A;  3VZM A;  1HB1 A;  3UK9 A;  4N53 B;  3TOJ A;  2DVA A;  3RWN A;  5ABJ A;  4HVR A;  1Y4W A;  1UPS A;  2W47 A;  4L11 A;  2O8Q A;  4QPI B;  4YGB A;  3VBH A;  3SNM A;  1XNK A;  3ES4 A;  5J36 A;  1L7R A;  1APN A;  4XPV A;  3DL3 A;  3WV6 A;  1X82 A;  4ZY9 A;  1VPH A;  2P6H A;  1UKR A;  4XC9 A;  2XJQ A;  3VV1 A;  2I45 A;  4B1L A;  1WCK A;  1QJX 2;  5GZD A;  4IV3 A;  2HBU A;  1BEV 3;  1JZ7 A;  2V4V A;  4R9A A;  4XMA A;  5C5T A;  1MVQ A;  4RS5 B;  4CCO A;  3WG3 A;  1BKZ A;  1GQG A;  4BH9 A;  4YZ3 A;  3Q8A A;  3ZMN A;  2P2K A;  3RI9 A;  1IOA A;  2K2S A;  3DEC A;  4NMI A;  3QH7 A;  1ULE A;  3TN9 3;  1ZBA 1;  2P34 A;  2PEL A;  1WW4 A;  2A7A A;  1WZX A;  2C9K A;  5E16 A;  4E4H A;  5JXG A;  5CVR A;  3VL9 A;  5KHI A;  1JOB A;  4HKL A;  1NCQ C;  2HWD 3;  2VW1 A;  3TN9 1;  4BQ4 A;  2QJV A;  2NN8 A;  3CZU A;  1UMH A;  1VBD 2;  1JU4 A;  1W6M A;  5I0U A;  4DIQ A;  4AXO A;  3QCW A;  1N3P A;  5I0R A;  4AEM A;  4AG4 A;  3LA2 A;  1N1Y A;  3SKJ E;  1FMD 2;  2VZQ A;  3ZYP A;  2OPW A;  3FUQ A;  5KC6 A;  2BRT A;  2WNE A;  1YEW A;  3NV1 A;  2VOX A;  1MEC 1;  2PHF A;  1UZZ A;  4PI2 A;  5FZM A;  1SFP A;  1V9U 3;  2WRA A;  2Y33 A;  4LHS A;  4HN1 A;  3ZXE A;  4Q4X 3;  2AEZ A;  1UWW A;  5F3I A;  1S0E A;  2HWD 2;  1M4W A;  2R04 2;  1KFU L;  1G8W A;  2ETE A;  2RMU 3;  3QOP A;  3GYD A;  1PGW 2;  5T55 A;  2CWS A;  2A71 A;  2ATF A;  4OHX A;  5IVC A;  1WLW A;  2XBO 2;  1VMH A;  3ITQ A;  1UX7 A;  3VDC A;  1LOC A;  4JGZ B;  2Y26 A;  2AAC A;  1KXG A;  3AZY A;  3VKF C;  3WDU A;  4YFZ A;  5J48 A;  1O3S A;  3O1R A;  1UZV A;  2BNN A;  3AYD A;  2B8M A;  3RMY A;  4BLJ A;  4DZG A;  2ZGO A;  5LA1 A;  1W0O A;  3POI A;  1UOB A;  4KL1 A;  1T6G C;  3ORJ A;  3SCF A;  4MET A;  4CDW A;  5IAX A;  3SLI A;  1BEV 2;  3VBO A;  1DQ5 A;  3VBO C;  2MHF A;  2PHU A;  5IAT A;  2FCV A;  5CIS A;  3VHO A;  4QKN A;  5L9R A;  3HR9 A;  2P3J A;  3LF7 A;  5FY9 A;  2HWE 1;  4CPB D;  2GC1 A;  4ARY A;  5FZE A;  3WP3 A;  4Q4Y 1;  4BK4 A;  1QHD A;  3ATG A;  4CU8 A;  1G86 A;  1MR5 A;  1NE6 A;  3U0Z A;  3KHC A;  5LA2 A;  2WJS A;  3WR0 A;  1S0C A;  2C0Z A;  2D98 A;  3PVN A;  3DYP A;  5F9T A;  4ZU5 A;  4BOW A;  2V09 A;  4ET7 A;  2G9G A;  3CHX A;  2A6Z A;  4FQ4 A;  5DMY A;  1AR6 2;  4Z2W A;  3IAP A;  1YQ5 A;  1WD4 A;  3ZXD A;  4Y20 B;  2KXL A;  4B3N A;  1CJP A;  2GC3 A;  4Z82 A;  4W6X A;  4MGZ E;  4RGG A;  1URX A;  1YJL A;  2QQM A;  4MX3 A;  4FCA A;  4HPK B;  2P1B A;  4WVM A;  4OI1 A;  3JD7 1;  1VAM A;  4LO8 A;  1Y43 B;  2J22 A;  1LTE A;  5FP9 A;  1QQP 1;  1SLT A;  1TG7 A;  3ZFE C;  4Q0Q A;  5F8P A;  1SMV A;  1WA6 X;  1NUK A;  2CL2 A;  1VE0 A;  3HQX A;  5DUV A;  3DKW A;  2IXC A;  2V73 A;  1NCR C;  1XJA A;  3KV4 A;  4NIH A;  1C4R A;  3GZT B;  4LTA A;  1NCR A;  1QDO A;  2VQU A;  3ZSE A;  3WDX A;  3VDB A;  2LAL A;  4FPG A;  2IWG B;  5FZL A;  3AJZ A;  4Y4R A;  2O14 A;  1IG3 A;  4QXB A;  5FY1 A;  3T1M A;  3ECQ A;  4N7U A;  4TLG A;  2A5Z A;  5FPZ A;  1F9K A;  2ZJC A;  5KXC A;  2D7F A;  2BBA A;  2VOT A;  2ZML A;  5D8A A;  1YYN A;  3HQR A;  2OUH A;  1S0D A;  2V4A A;  1RGS A;  4EZH A;  1QXR A;  4NHM A;  4QPI A;  1M06 G;  4FOQ A;  1UOG A;  2VNG A;  2YZ4 A;  1CAW A;  3RSJ A;  1HV0 A;  1Q56 A;  1GIC A;  1C1L A;  1XNC A;  2E9Q A;  2E6V A;  1QJU 2;  2EF6 A;  3AP9 A;  4YG0 A;  3DGT A;  3SCH A;  2J1T A;  2D6O X;  2JJ6 A;  1W8H A;  5ABJ B;  4Z92 B;  4NII A;  3WX5 A;  5DAB A;  1YFY A;  2F17 A;  2IFR A;  4K40 A;  4E4S A;  4YWA A;  2W3J A;  3S7E A;  4CCC A;  3SH3 A;  1HN0 A;  1QOS A;  3TRS B;  1PIV 1;  3C7H A;  3AZX A;  1DYO A;  1Z7S 2;  2RE9 A;  4XFI A;  4PLN A;  3AKS A;  5FYV A;  5E1R A;  1ULD A;  1Q3E A;  5SV8 A;  1RUI 2;  1PO2 1;  3GGL A;  2A6W A;  2XXZ A;  2E53 A;  1W90 A;  3BTY A;  1YQ8 A;  2E63 A;  4OMC A;  3SH5 A;  2G19 A;  1SDD B;  2VM9 A;  2WZR 2;  3MHZ A;  3K75 B;  4MXV A;  3QH6 A;  5HXV A;  1POV 3;  2XHK A;  2XQX A;  2VC9 A;  3TBD A;  5JOX A;  1AR8 2;  4S2F A;  1UNB A;  5EP9 A;  4NRM A;  4RFT 0;  4XUP A;  3BTZ A;  4A41 A;  2JX9 A;  1GP6 A;  2HKX A;  3ACG A;  3OCP A;  1AR9 1;  2A6V A;  4FFF A;  2VZR A;  2CTV A;  1RMU 2;  3U37 A;  5F7U A;  5CAD A;  1PM7 A;  2JDN A;  2C6S A;  3N9L A;  2AZ5 A;  3MIH A;  2UUR A;  1O7F A;  3M7A A;  1NY7 1;  4LJH A;  1RJ7 A;  4NR1 A;  1UU5 A;  1N1V A;  4Q1R A;  3MW2 A;  2WNU B;  5F3G A;  4A6S A;  3MLJ A;  4CZS A;  4F8A A;  1JYV A;  4OMD A;  3MUY 1;  1US2 A;  4ES9 A;  3CJI B;  4LBM A;  4QB6 A;  3WY6 A;  4F83 A;  5F5A A;  2K9Z A;  2A70 A;  3LFI A;  3NMB A;  3MLL A;  3O5S A;  4R4Z A;  4COY A;  2J1V A;  4UFI A;  5LBB A;  5LK5 A;  1C8M 2;  2F4P A;  1T2X A;  4QXK A;  2E31 A;  4D7T A;  2P3I A;  5A3U A;  1ENR A;  3AFG A;  4BXS V;  1XB9 A;  2AUY A;  4B7K A;  2Q4S A;  1S0I A;  5C33 A;  5IK4 A;  2WO2 A;  2XHN A;  3TEX A;  4AI0 A;  2BP6 A;  1OH3 A;  2WFP A;  2XL9 A;  4LIU A;  5FIX A;  1JN2 P;  1LHV A;  3MPB A;  4Y5S A;  1BXH A;  4OI0 A;  1TNR A;  3C3V A;  1AR8 3;  5FZI A;  2RS3 2;  3BPS A;  5FZH A;  1UO9 A;  3T1L A;  2ERF A;  3M70 A;  4OLL A;  2OA2 A;  3OOX A;  3OUJ A;  4NPR A;  1W2N A;  4YPJ A;  1OUR A;  2GMP A;  1JYN A;  3O1P A;  2LS6 A;  1PIV 3;  2QQK A;  2VTX A;  3DF0 A;  4LBK A;  1OLQ A;  4X6R B;  1UX6 A;  3U10 A;  5A3T A;  2D6N A;  3VDD A;  5FMO S;  3OTF A;  4Y1Z A;  1GFF 2;  4P9L A;  5HBA A;  3IDC B;  4G4F A;  1QXJ A;  1DIW A;  1VIW B;  3TN9 2;  4DXT A;  1ENS A;  1YFU A;  3ZSJ A;  1SLB A;  5FXX A;  1DHK B;  4WBB A;  2R0H A;  3W5N A;  1WW5 A;  3MIE A;  5K7P A;  2W39 A;  2JWP A;  5LEK A;  4UFK A;  1HJF A;  1FOD 2;  1UAI A;  4XJU A;  4IEP A;  5GZF A;  1F5J A;  3VBO B;  3WVJ A;  5A33 B;  2JE7 A;  1RMU 1;  2G1M A;  2WO1 A;  3OPT A;  2ENR A;  1YRZ A;  4P9Y A;  3ACI A;  1LHN A;  2WZE A;  2DCJ A;  1AL2 2;  1AYM 2;  1REF A;  1D7P M;  1QJX 1;  1KDK A;  4MAD A;  4QX2 A;  5E8A A;  4D6R A;  2RS1 3;  4JRL A;  2P17 A;  5D1I A;  3HN3 A;  4H7L A;  2R07 3;  3CNA A;  1VBE 2;  5C4W C;  1I6X A;  3CU7 A;  3LOI A;  2JEN A;  2FHR A;  4NRP A;  3LDK A;  3V0A B;  2VU9 A;  4P02 B;  5KXE A;  5K8S A;  5K9Y A;  1PO1 2;  4C0H A;  1W04 A;  1H8V A;  3C2U A;  4BQW A;  5BV6 A;  1QXP A;  4GWM A;  3RZJ A;  2AR6 A;  2ZS6 B;  1YC6 1;  1RUE 2;  3JBG 1;  4TN7 A;  1EPW A;  1YI9 A;  5JVV A;  2UY9 A;  2FCT A;  2VZU A;  1JZ5 A;  4QX1 A;  3VKL A;  3KM5 A;  3BIE A;  5JOW A;  3I3D A;  3UGF A;  3ZO0 B;  2ILM A;  5HV4 A;  1W8O A;  3MIB A;  2B9U A;  1RUJ 1;  3ZSM A;  2EAK A;  4QQP A;  3R6S A;  2A3W A;  3PDQ A;  1OQE A;  1E5I A;  1Q8V A;  1ZZB A;  1V6M A;  2YU1 A;  4IE7 A;  2PAK A;  2JIG A;  1GYK A;  4PBO A;  5BXX A;  2XB6 C;  1VBB 3;  2Y0I A;  5GLV A;  4CDQ C;  4EV0 A;  1W2T A;  4XDP A;  2OPK A;  3OGS A;  4FP3 A;  2JG9 B;  2VAU A;  1ACC A;  2L9L A;  3PMS A;  1QJZ A;  1DZT A;  5KXD A;  1UF2 C;  4LIV A;  4FFI A;  5T54 A;  5KWR A;  2DUP A;  4NVP A;  3B94 A;  3CJX A;  4LLO A;  5AVA A;  3ZSL A;  4M3C B;  2RDR A;  4BDV B;  4JZR A;  2JDK A;  2CSG A;  4BQ3 A;  4Y1X A;  4QMA A;  1NLR A;  3CQO A;  1XU1 A;  3I54 A;  1QIQ A;  3TYJ A;  4CCN A;  1QQP 2;  2WWJ A;  3BUC A;  3HNB M;  5EPA A;  4IGO A;  1POQ A;  3H3L A;  2DDU A;  5FMB A;  2BUK A;  4A3Z A;  5BUV A;  1AYN 1;  4FOW A;  3M8L A;  4DIN B;  4M3C A;  4P9I A;  2O8O A;  2KA3 A;  1A3K A;  2IXL A;  3KQ4 B;  2VCM A;  1CAV A;  1NA1 C;  4XHX A;  2WO3 A;  3RZK A;  2H0B A;  2WFF 3;  1LU1 A;  3PUQ A;  1PK6 A;  2XVL A;  3OYW A;  3FE5 A;  3GHM A;  1OKO A;  3GJB A;  1PO1 1;  1Q5O A;  1VBA 1;  3MFA A;  3MYX A;  5FYI A;  3ZN6 A;  2WN3 A;  3ZR6 A;  5JSO A;  1CGP A;  3OUH A;  4ATE A;  4K20 A;  3AMQ A;  4QQH A;  4CA9 A;  4ERO A;  1SBF A;  3PJQ A;  2RR1 2;  4FPK A;  4CUB A;  2WKK A;  3E1F 1;  3E6B A;  5ABJ C;  2E7A A;  3T08 A;  2BBV A;  2CU5 A;  1TMF 1;  1S0G A;  4WM8 A;  2VTF A;  3I59 A;  4AI3 A;  1MS0 A;  5FZ4 A;  1J1T A;  1POV 1;  3U1X A;  1RUJ 3;  2HYK A;  1H9P A;  1R1A 2;  1R1A 1;  3VD5 A;  3C7O A;  3I2F A;  5KXB A;  2CHH A;  1SLA A;  3ZFE A;  5H9P A;  3RGB A;  5CBL A;  2NQY A;  3VBR C;  3MUZ 1;  5I8S A;  1UYX A;  5EQU A;  2OT7 A;  2OZ6 A;  3I49 A;  2E32 A;  4XYX A;  3R4U A;  1HRI 3;  2Q0A A;  2QQV A;  4BME A;  5I0T A;  1LUL A;  1PNG A;  2BV4 A;  1SZB A;  2GU9 A;  4XIO A;  3T0D A;  4IV1 A;  1LOA A;  1GSL A;  1GNH A;  2LRO A;  4ASK A;  4YYO A;  4GH4 A;  5KHJ A;  3HJR A;  1OFS A;  4RSU A;  2XBO 1;  4LR4 A;  3CEW A;  1XE0 A;  3J7H A;  3JZV A;  3LOB A;  1V70 A;  2XVG A;  1RB8 G;  2WQ8 A;  1CVN A;  1RUG 1;  2JDP A;  1J58 A;  4PLO A;  3ZN4 A;  3D3A A;  3BYW A;  4DNY A;  5L9V A;  4DMI A;  1WUV A;  4H55 A;  3O7O A;  4NRQ A;  1BLZ A;  4RFR B;  4TLF A;  5G04 L;  3RS6 A;  4COW A;  4EN9 B;  5A3L A;  1YCI A;  1MS4 A;  4J1X A;  3AP4 A;  4XFF A;  4PDW A;  5ANN A;  1KRI A;  2DCK A;  1OUX A;  4WVM B;  4FFH A;  3T30 A;  1IPJ A;  4KWL A;  1QJE A;  1R1A 3;  2Q1F A;  3EYP A;  2YXS A;  2BU9 A;  1HB3 A;  4DFS A;  3WCR A;  1LJ7 A;  2B5H A;  4ISR A;  3TAY A;  1VBD 3;  3SCG A;  1JH5 A;  4L2N A;  3BCW A;  4C1X A;  3Q8C A;  1I3H A;  3MF9 A;  2GN7 A;  4AFC A;  4R52 A;  3HOB A;  3SMH A;  4RR3 C;  4RQP C;  2WT2 A;  2JEC A;  1CN1 A;  4FPE A;  4XVH A;  5EXO A;  5JSP A;  5FJK A;  3W20 A;  1IQD C;  1H6Y A;  2D44 A;  2WDB A;  4GJY A;  3MBW A;  1OUS A;  1UPI A;  2XLA A;  3INA A;  4UOJ A;  3NNF A;  3VLB B;  5DXD A;  3AXE A;  1HW5 A;  2XJR A;  1OFN A;  3PUH A;  4CDX B;  3H8R A;  3A0K A;  1V6L A;  4W8J A;  1FNY A;  1QNW A;  4XQ4 A;  3VD7 A;  5T5O A;  3RFR A;  2I07 B;  1WGP A;  3C7G A;  1CAW B;  1LKN A;  2WNO A;  1V6N A;  4LE3 A;  4UBH A;  3AMN A;  4AVV A;  1Z0H A;  5IK7 A;  2ADD A;  3BB6 A;  1RUJ 2;  4KGQ A;  3RNS A;  5KC5 A;  1RC6 A;  4H2A A;  4XE9 A;  1H8T B;  3D8C A;  3ZVX A;  3D5O A;  4JCK A;  2WLQ A;  2VUD A;  2WZR 1;  2YHJ A;  4UAP A;  2QBX A;  2YGM A;  5FLJ A;  5ACA 2;  4CDU C;  1A8M A;  1LOD A;  1F4H A;  5AFB A;  1UCX A;  3DUI A;  1BCX A;  5BNO B;  2KD7 A;  4LOT A;  4AHX A;  2UWB A;  2VZ1 A;  4AVA A;  4KWK A;  2BGO A;  3POF A;  4GMP 0;  5IYY A;  2H6C A;  3CL1 A;  2RMU 1;  2GND A;  5FYM A;  3H3U A;  2DVF A;  4KWJ A;  3ME2 A;  5FYC A;  1VBE 1;  4LKF A;  3HAG A;  1U0A A;  2VW2 A;  3HPN A;  5A7W A;  5A7W B;  1BBT 2;  3ES1 A;  3CDZ B;  5GLZ A;  3HQU A;  4BIS A;  1N47 A;  2VW0 A;  2ZAA A;  3DPR C;  4RHV 3;  2WAA A;  2BZD A;  1WCU A;  3T2O A;  4Q4Y 3;  5HCF A;  2FDK A;  3LGR A;  1OOP B;  2X10 A;  3ACF A;  2RM2 1;  4EWA A;  1QH6 A;  1OA3 A;  3K77 A;  3N9P A;  3F95 A;  2WNU A;  4LHN A;  5A6Y A;  3LCP A;  2G9Z A;  3GBF A;  2WNU C;  4N8M A;  3I2I A;  2GH8 A;  2JB8 A;  3GF6 A;  5FO8 B;  4LUL A;  4AVC A;  5LAT A;  2MEV 3;  1Q8P A;  2P4E A;  2BWC A;  2A1X A;  1AYM 3;  2XKP A;  4E4Z A;  4FO9 A;  2VL4 A;  4QQO A;  2WWU A;  2PLV 1;  4RS5 C;  2C24 A;  1UQX A;  3L2H A;  4K6B A;  5FY8 A;  4EN7 B;  4LHL A;  4YW5 A;  2RS1 2;  4XCB A;  1OT5 A;  4NIG A;  1W03 A;  5C3O A;  2G9F A;  2R7E B;  1CAV B;  2D6K A;  2VXR A;  2JE9 A;  2YBS A;  5IW0 A;  3WUD A;  3IBM A;  1UD1 A;  5IT6 A;  1JZ3 A;  4FTE A;  2TNF A;  1UKG A;  1P8J A;  2QKD A;  4QB1 A;  3RVH A;  4H7M A;  1LEC A;  1AVB A;  4JGY A;  4NO4 A;  4AWD A;  1W9T A;  5FZ1 A;  2CGN A;  3JBG 2;  5FYU A;  2BVV A;  1VB2 A;  2QQU A;  2EVX A;  4HVQ A;  4CE8 A;  4ZS3 A;  2C26 A;  4XDQ A;  3H1M A;  1RUG 3;  4YW7 A;  1UYZ A;  2NPI A;  5FUN A;  2OYZ A;  3WP4 A;  1ZRF A;  5ACA 3;  3ETP A;  1JZ6 A;  1EUT A;  2CDP A;  3ZSK A;  4IV3 B;  5JZG A;  1XYN A;  2AEY A;  5K4L A;  4BM8 A;  1RUC 3;  3M4F A;  4W50 A;  2VTX J;  4Q4Y 2;  1F8V A;  2E7Q A;  4TZD A;  3KT4 A;  1X8M A;  3VZJ A;  5E88 A;  2V72 A;  4PDW B;  1GMM A;  1UYP A;  2QQN A;  4XF1 A;  3N3H A;  3RZL A;  1ULO A;  5FBZ A;  1DDL A;  2VQT A;  1JMU B;  2BJS A;  4JHZ A;  1RVF 3;  1W28 A;  2X5I C;  2FDJ A;  3Q8E A;  4JX0 A;  2Y6L A;  2X5I A;  5JZG B;  2QQI A;  2X5I B;  3PVE A;  3M3O A;  4Y20 A;  4ES8 A;  4I30 A;  5KR7 A;  4XAE A;  5BY5 A;  3PL0 A;  3H3Z A;  2A6Y A;  4LKD A;  3LKJ A;  3AMM A;  4CU9 A;  5HCH A;  5GJ6 A;  4FFG A;  2BPA 2;  2BW8 A;  1QJY 1;  1VAV A;  1FI2 A;  2W1S A;  5BNN A;  5BNN B;  3VD9 A;  5J1X A;  1H2N A;  3OF1 A;  1YQ6 A;  4E2Q A;  2Z5W A;  3H9A A;  3MGU A;  5D21 A;  1TEI A;  5JI9 A;  3RJR A;  1SBE A;  4V1P A;  1X9T A;  5JPN B;  4GJZ A;  3K4A A;  5FMO L;  1W9Y A;  2ZX0 A;  3H7Y A;  3KD4 A;  1G6N A;  1X8E A;  2GNT A;  5FP4 A;  1A6C A;  2R04 3;  3KMH A;  3VUO A;  3A21 A;  1L7L A;  3B02 A;  3L9J T;  4NHK A;  2FDI A;  2XR4 A;  4X8N A;  5BPX A;  1PZ7 A;  3W59 A;  4AR2 A;  4D94 A;  5JOZ A;  1QJF A;  2ZGL A;  1ND3 B;  4CSW A;  4D3W A;  1ENX A;  2VH9 A;  3PVB B;  1MS9 A;  2Y60 A;  3PJY A;  5JOY A;  2RDN A;  5JXJ A;  3OG2 A;  1QU0 A;  2C5D A;  4J6G A;  3VBH B;  5DG2 A;  2WC2 A;  5K0U B;  4NAM A;  3RJ2 X;  4AGR A;  1GAN A;  4DB5 A;  1NA1 A;  4Q8K A;  1SCR A;  1BVV A;  3PUR A;  1SLI A;  2WSV A;  4ONU A;  1YHF A;  5I0D A;  2JD9 A;  3B9C A;  1QJY 2;  4OZX A;  4IET A;  5FZ7 A;  5KHH A;  2WT0 A;  2AH2 A;  1R08 2;  1ST8 A;  4LBJ A;  4EJR A;  1YIP A;  3JBG 3;  4PF5 A;  1FXZ A;  2HEV F;  5FY5 A;  3ZFG B;  4U36 A;  4FQZ A;  5LBC A;  1AL2 1;  3UL2 A;  5FCC A;  1COV 3;  2CYF A;  3DYO A;  4AOC A;  5LZ6 A;  1JS9 A;  2QE3 A;  1AR9 2;  3RRD A;  4OHZ A;  3RPQ A;  3N35 A;  3AB0 A;  3O12 A;  3VD4 A;  1BBT 1;  3GHN A;  1CR7 A;  5JSR A;  2DUO A;  4XF3 A;  3ZYJ B;  4Q4W 3;  2QDR A;  4XTM A;  3IDA A;  3K4D A;  4WVV A;  4QAW A;  4FXG B;  3B9I A;  1GOH A;  3VBS B;  2X05 A;  1LHU A;  2E51 A;  5EIY B;  4N90 A;  2W1U A;  3TWI A;  2VNV A;  1STM A;  1RUE 1;  3S5A A;  4BU2 A;  5FYH A;  2RS5 1;  2TUN A;  2ZGM A;  4NIA A;  1RUI 3;  3NNL A;  1Z7S 1;  3URF A;  2EXK A;  5FV3 A;  4QHB A;  1XOY A;  1S0B A;  4KMQ A;  4XMI A;  4YM2 A;  4AFB A;  1A78 A;  1PGS A;  3CJI A;  5BNO C;  1WCS A;  3I3E A;  5J98 B;  3AVS A;  2ZGU A;  3FFQ A;  4M00 A;  1TQ5 A;  2A6X A;  4CRQ A;  2UY8 A;  1R1Z A;  1LHW A;  5C5U A;  4QGL A;  3ZPO A;  3AYE A;  4YGC A;  1EYB A;  2H0V A;  1BBT 3;  3J9S A;  5C3Q A;  1H4H A;  1NQD A;  1QJX 3;  2BWA A;  3EXU A;  5FK7 A;  5A7Q A;  1H8T C;  4AQ2 A;  4C8D A;  1G9F A;  3VB9 A;  4XAC A;  1ZNP A;  4IE5 A;  3AZZ A;  4HSJ A;  2FD8 A;  3AKP A;  3KWV A;  1ASJ 2;  2WSU A;  2DFC A;  2PLV 2;  3AKQ A;  4FP2 A;  5CA6 A;  1LOE A;  4LT5 A;  2ZEZ A;  3I3B A;  4FVV A;  3NV2 A;  4MGQ A;  1JTZ X;  3IMM A;  5JAX A;  2WFF 1;  2WFF 2;  5J09 A;  1OF4 A;  1FAY A;  2ZHN A;  2ORZ A;  4IEZ A;  2BGC A;  5DUW A;  1C57 A;  1OQD A;  3BPZ A;  5A70 A;  2VMI A;  2Y64 A;  2B4K A;  4MGS A;  2RM2 2;  1ASJ 1;  3OSD A;  5FO7 B;  3UJO A;  4GWN A;  4YVS B;  2BNO A;  4PQQ A;  1NY7 2;  2LW8 A;  3A22 A;  2C4X A;  3M3C A;  3UGG A;  5FQ0 A;  3WQ0 A;  3VKN A;  3VZN A;  3OEA A;  3WQ7 A;  3QAC A;  3ZXA C;  3WG4 A;  4HAN A;  1B35 C;  1VMJ A;  3H50 A;  4MGI E;  4EN0 A;  4JGY C;  2XUM A;  4CP1 A;  4DEV A;  5A7P A;  2RHP A;  3NAP A;  1KEX A;  3AKR A;  4QPI C;  1WWY A;  2O1Q A;  1AR8 1;  1WMX A;  3CKH A;  3D6E A;  2WIN B;  4NN0 A;  2W52 A;  5FXV A;  1DGR N;  2BNM A;  2C9A A;  3WP5 A;  3H8X A;  4N53 C;  2XH6 A;  2LTN A;  4C91 A;  1CQ9 A;  4MLO A;  1C5H A;  5DUU A;  5ERL A;  2G4I A;  5CU1 A;  5JXH A;  2Z79 A;  2VVD A;  4OI4 A;  3AFK A;  2W92 A;  1A8D A;  2ZKL A;  4YNI A;  4AYU A;  2EAA A;  3NQH A;  1I9R A;  1RYY A;  2EID A;  4U2A A;  1UN1 A;  1XC6 A;  2WUH A;  1MAC A;  2PHL A;  4Q26 A;  4XXP A;  1VRH 3;  4Y5T A;  2D43 A;  4P9X A;  2B42 B;  5FMD A;  2HEY F;  5CG9 A;  2WNV B;  3OGV A;  4WV8 A;  4XHB A;  4CP9 A;  2JKX A;  5G05 L;  4TTG A;  3VBR B;  4QPW A;  5H9R A;  2WNV C;  3VHR A;  1PX4 A;  4I2O A;  3E6C C;  4K3U A;  4E27 A;  2B7Y A;  1GZT A;  3GCW A;  3ZYG A;  3JQX A;  4IXL A;  1R08 1;  1VBC 3;  1XE7 A;  3RQ0 A;  4CXW A;  1GV9 A;  2DTY A;  2CWM A;  5FRE A;  4HL0 A;  1NX9 A;  4NAO A;  3LD8 A;  4QX7 A;  1RHI 2;  2J1A A;  2W0X A;  3ZDV A;  1XU2 A;  3MFC A;  2ZKN A;  2P6C A;  3D82 A;  4Z07 A;  4CUC A;  2FDF A;  1SLC A;  4KGG A;  3VZK A;  1GWM A;  1GQH A;  1HJG A;  2GMM A;  3USU A;  1POV 0;  4LBN A;  5IHR A;  2YBP A;  4JHT A;  1IPS A;  1ND2 A;  4R9C A;  4UFH A;  3B69 A;  3VBU B;  1QOO A;  5C9A A;  1VBE 3;  1HDK A;  2RDQ A;  1XNA A;  5FJH A;  1YXW A;  2YC2 A;  2ZEW A;  3EQE A;  4XFC A;  1G9D A;  2WS9 2;  4ISQ A;  4NWW A;  1AR7 1;  2CNA A;  5FZ8 A;  3OGR A;  4MV2 A;  3OB8 A;  1IZ3 A;  2SLI A;  2DVG A;  1B35 B;  1W8W A;  5C71 A;  5LEJ A;  1DGW X;  2ZEY A;  4YGE A;  1AZD A;  3RYR A;  4LXL A;  3ROU A;  5IJR A;  2YYO A;  5DDJ 3;  2NMO A;  2RV9 A;  2WL1 A;  5C8W A;  3AK0 A;  2X8K A;  3L2Y A;  1CAX A;  3N7M A;  5FKC A;  1AR6 1;  3NNG A;  3WF3 A;  1ZVF A;  4UFJ A;  1JW6 A;  3ZYR A;  1W39 A;  2X53 S;  5A7O A;  2VUJ A;  3V64 A;  3BIW E;  2BFU S;  3O0W A;  3KCX A;  1PZ8 A;  3OGJ A;  1ZRI A;  2BTV C;  4S2H A;  1D4M 1;  1KQR A;  3JU9 A;  1K5M C;  1WME A;  3A4U A;  1AF9 A;  4N43 A;  4QKD A;  5T50 A;  2JG9 C;  3SHR A;  4UW4 A;  3ZIW A;  2RJL A;  2SBA A;  2HWE 2;  3O1U A;  4JVA A;  4OCT A;  1OBN A;  4XFB A;  2VMH A;  1AX1 A;  4IEX A;  3S0M A;  5FLH A;  5FQ0 B;  1U5Y A;  1DBN A;  1JUI A;  4KQ7 A;  1CX1 A;  5BNP B;  4M4P A;  5FYT A;  3C7F A;  4XDO A;  2Y6H A;  5L19 A;  1JU3 A;  1EP0 A;  2DBI A;  2WZR 3;  4IE6 A;  5FKB A;  1TE1 B;  4QT6 A;  4XBL A;  2DU0 A;  4UF0 B;  2RR1 1;  3B3Q E;  4AL9 A;  4QX8 A;  3BOD A;  2HWB 2;  3AZV A;  3ZFF C;  2W68 A;  5FZD A;  2RR1 3;  4FT8 A;  3V56 A;  1XYO A;  2GNB A;  2JDA A;  3WP6 A;  4QU2 A;  3KVA A;  1O4T A;  4OZO A;  5FXZ A;  3U14 A;  4BQ2 A;  1LOF C;  2DVD A;  2VEC A;  2RS3 1;  4OHV A;  4IUG A;  1GNZ A;  4GAL A;  1V6I A;  2YMZ A;  2WA4 A;  1AYN 2;  1SPP A;  2E26 A;  3N36 A;  2XLF A;  1F4A A;  1DLL A;  4G9S B;  2Q30 A;  1ZRR A;  4DXS A;  2ORX A;  4HLT A;  2J1U A;  4DY3 A;  2ZX1 A;  4EN6 B;  3UKT A;  3SEP A;  2BGP A;  1JHJ A;  4FXK B;  5HCA A;  4Q4V 2;  4FTB A;  2VZV A;  1HX6 A;  2NYY A;  3P6B A;  3OUI A;  4RYD A;  3ZFG C;  5T5L A;  4CUG A;  2ZOE B;  2JG8 A;  2YY1 A;  4JDN A;  5DZE A;  3O1V A;  2ZAH A;  1UY2 A;  2QQP A;  2VY0 A;  3BTX A;  4CTE A;  1W2U A;  4XW3 A;  2WT1 A;  4YM0 A;  4CDQ A;  5JCT A;  3SIT A;  1N1S A;  4NUB A;  2GME A;  2DV9 A;  3B5L B;  1CPM A;  2R07 1;  1ZZ7 A;  1K12 A;  2XL7 A;  3LSE A;  4WZF A;  4OFG A;  1EUU A;  4W65 A;  3J8F 3;  2ZMN A;  1RL3 A;  5IUQ A;  3EMR A;  3FHI B;  3G6J B;  5K0U C;  1QWR A;  2HWD 1;  2F6B A;  2IXJ A;  3BOW A;  4AAP A;  2FCU A;  5FZG A;  1PMJ X;  4IEW A;  1ENQ A;  3NVC A;  3K46 A;  2VE1 A;  3I2K A;  1OVS A;  1W8U A;  4E2G A;  1J3P A;  1MEC 2;  1XE8 A;  1LGC A;  1Y9G A;  5GM0 A;  2VMD A;  2ZX2 A;  4MSV A;  4Q4V 3;  4JKK A;  1C8M 1;  1W6Q A;  3QLQ A;  4O9E A;  3RDI A;  1PO2 2;  4MO3 M;  4BK5 A;  3T3Y A;  4Q2F A;  4XJ9 A;  2WAB A;  1WA4 A;  3K3O A;  3P3P A;  3D4K A;  1H2M A;  1H1M A;  4UI9 L;  5E89 A;  4HFS A;  3H42 B;  4AGV A;  4LO6 B;  1AYN 3;  1EV1 2;  1EY2 A;  3VGI A;  4DUV A;  1OD3 A;  1SFY A;  2ARA A;  5FPX A;  4IEY A;  1F15 A;  1GKB A;  3N7L A;  3P1I A;  5FY4 A;  2FZ2 A;  3ON7 A;  1DP0 A;  2OXB A;  1O8S A;  1QJU 1;  2EA7 A;  2RS3 3;  5FTT C;  1S4C A;  4AI1 A;  5CKN A;  1EAH 2;  3ZYH A;  1J84 A;  5FZO A;  1SFN A;  2WNV A;  4XUT A;  4EWE A;  3ILN A;  3LEG A;  1MZ6 A;  4ZXK A;  3N9O A;  1UMZ A;  3O0V A;  3VBF B;  2D6M A;  3NV4 A;  4L9B A;  4WM8 C;  1QDC A;  3E6D A;  4LHK A;  1BEV 1;  4BIF A;  1TMF 3;  1W0N A;  1WMD A;  4KG0 A;  1UU6 A;  3WF4 A;  5CAZ A;  2YDE A;  2YC4 A;  4CYD A;  1T6B X;  4C1W A;  4IV3 C;  2IUW A;  1WMF A;  4LLF A;  2AGS A;  2ZZQ A;  4XIK A;  1CES A;  3FUO A;  4XZP A;  3OJB A;  3WW4 A;  1JYW A;  1PIV 2;  4IGP A;  1UZ0 A;  1W3X A;  2WWS A;  1NXM A;  3VHP A;  1BMV 2;  2B39 A;  5C9A C;  2UYB A;  1SQ4 A;  4LBQ A;  2AC1 A;  4B4P A;  4FOV A;  1NA1 B;  5D8A C;  3APB A;  3AP6 A;  4IEQ A;  5L7O A;  5I8T A;  5I8Y A;  2ZEX A;  2R0F A;  4LBO A;  1O5U A;  4NOT A;  1RUD 3;  4AQ6 A;  1NLQ A;  5JMC A;  4B29 A;  4CCE A;  1EPZ A;  1ZA4 A;  1PVC 2;  2HWC 2;  4IGQ A;  2VZT A;  3HN1 A;  5EHD A;  3DCQ A;  4MXW B;  2ZHM A;  4P00 B;  3USS A;  2R30 A;  3JUU A;  1ULP A;  3HWJ A;  4N53 A;  3FJS A;  1WLC A;  1UOF A;  2YBK A;  4K7J A;  1W05 A;  1JZ2 A;  3I2D A;  5C3P A;  4DRV A;  5IK5 A;  4M01 A;  3AVR A;  2ES3 A;  3M1H A;  4JC1 A;  4XAB A;  2VUA A;  1Z7S 3;  2VMC A;  1K5M A;  4N43 C;  4A7Y A;  3KGL A;  4HKW A;  2Y8K A;  1XSR A;  3CMG A;  3POJ A;  5FOJ B;  4URT A;  4MOA A;  4QPG B;  1Q8S A;  1VBC 2;  4QD2 A;  3FZ3 A;  5JWP A;  2W1Q A;  3GNE A;  4HMZ A;  1O4Y A;  2EIG A;  3I3Q A;  2PYT A;  4GMP 3;  1MS3 A;  4JTO A;  1NCR B;  1OA2 A;  3I4I A;  4EWD A;  1MS5 A;  4XOG A;  4A6O A;  4I3P A;  1AXZ A;  5BYN A;  3MZH A;  3MI8 A;  3CLP A;  2J42 A;  4QM8 A;  3W5M A;  4CDW B;  3N9M A;  4JTN A;  4Q4W 2;  4ARX A;  4DS0 A;  5F5I A;  3T4H B;  3PNA A;  1RMU 3;  1UMI A;  2GNM A;  1K3I A;  1ALY A;  4P5Y A;  4QGM A;  1JOD A;  1S2K A;  4UW3 A;  4WVZ A;  1LEN A;  1YUD A;  1WD3 A;  3IWZ A;  3AM2 A;  5DPN A;  5FLI A;  5A33 A;  5JUV A;  1VB4 A;  3ZFF A;  2DBN A;  3AP7 A;  4HN0 A;  1RUI 1;  2EAL A;  5FPL A;  2A75 A;  4Y22 B;  2IXK A;  4GB3 3;  1W3V A;  1ZBA 3;  2BOJ A;  2W08 A;  3KB5 A;  5L73 A;  3FBY A;  1XQN A;  2WZ8 A;  3WNM A;  3IIA A;  4DUW A;  2JDU A;  4Z1V A;  4DO0 A;  4XUR A;  2PHX A;  3E97 A;  2VCA A;  4HXC A;  3Q8F A;  4QPY A;  3NJZ A;  4ASM B;  3WNO A;  5LY1 A;  3BU0 A;  3KLS A;  2IVJ A;  4MHU A;  2KR2 A;  3POS A;  3IZO A;  1UU4 A;  4OUL A;  5LAS A;  3GZU C;  4DQA A;  3GM8 A;  1RVF 2;  4RA0 A;  1LRH A;  3T09 A;  4MH0 E;  4WM7 A;  5JDB A;  4WM7 B;  2QQO A;  3WNN A;  2PA7 A;  1SLL A;  4PI0 A;  1OLR A;  1SHW B;  1QKQ A;  2DWR A;  4QKF A;  3WNL A;  3U07 A;  1PVC 3;  2HWC 3;  2Y34 A;  3E5Q A;  2Q1M A;  2QZ2 A;  3KHB A;  4PLM A;  4UBG A;  4XBN A;  2UYA A;  1NG0 A;  5FYY A;  5A1A A;  3W21 A;  5JLV A;  4XET A;  1TME 3;  1G9C A;  2J7M A;  2YGL A;  4RN5 A;  1NAE A;  5IVB A;  2YPD A;  4M0H A;  4QKB A;  1H2L A;  1GP5 A;  1OVP A;  3I3M A;  3ZKY A;  1WCD J;  5HI0 A;  4RQP B;  1LCL A;  4P5H A;  1O3R A;  1F35 A;  4DXZ A;  3IDB B;  2PAE A;  3AX4 A;  4LO5 B;  2WQZ C;  4JGZ A;  1UW8 A;  2XWB B;  2J1R A;  2HLE A;  1VAK A;  3KSC A;  5LY2 A;  1ASJ 3;  5C3S A;  3VL8 A;  1IGO A;  1BK1 A;  4RS5 A;  2VOV A;  3GAL A;  4CEY B;  1R64 A;  3JQW A;  4CXX A;  3ILF A;  4OQ9 A;  1F31 A;  1LB2 A;  1KD7 A;  1FNZ A;  3V65 A;  3AYC A;  4HG6 B;  1W6M B;  5IK8 A;  2MNG A;  2D5H A;  3I2G A;  5DAW A;  4P9G A;  4Y24 A;  2JKB A;  3J4U H;  1TVG A;  3IPV B;  3Q8B A;  4YZ5 A;  4YSF A;  1UY4 A;  1D0H A;  4XUQ A;  1VLN A;  3D0S A;  3O1T A;  2DCT A;  3D0J A;  4BLI A;  4F7Z A;  1L7Q A;  2DCY A;  3GZA A;  5ACA 1;  4WZC A;  4GZ9 A;  2IC1 A;  4L97 A;  1TME 1;  3SC7 X;  2D97 A;  1ZBA 2;  2DU1 A;  4AFM A;  2BOI A;  4QDR A;  3CJI C;  5BNO A;  5J96 B;  5JXI A;  1ULF A;  5A1L A;  5FK8 A;  4MXW A;  4YZ4 A;  3FFZ A;  3V0B A;  1J59 A;  1AYM 1;  1PO2 3;  1H9W A;  2MEV 1;  5JZG C;  1COV 1;  1UY3 A;  2ZGS A;  2JDY A;  1LEM A;  2PQQ A;  2ID4 A;  2QTW B;  2VVE A;  3S6P A;  2W9X A;  4A42 A;  5LWB A;  2XDV A;  4A2U A;  3AC0 A;  4LOR A;  3SKV A;  1MEC 3;  1K42 A;  1TME 2;  1FOD 1;  1OLM E;  3LB9 A;  1AR9 3;  1G7Y A;  4JDO A;  5FZC A;  2GH2 A;  3N7K A;  1O6U A;  3O0X A;  4XUO A;  1YNA A;  5FXW A;  5L7O B;  1MPX A;  2C1F A;  2CGO A;  3SEE A;  4HK8 A;  3PUI A;  3I59 B;  4X8P A;  4EQV A;  4D69 A;  1LU2 A;  5IVF A;  1QF3 A;  3R0R A;  1UY1 A;  3B93 A;  4M4R A;  3O14 A;  4KBB A;  4Q29 A;  5B4N A;  3NJX A;  3CO2 A;  5J7M A;  1HB2 A;  4AVS A;  3MO4 A;  5LBF A;  2D3R A;  1E5R A;  3A0N A;  2WLP A;  5D8A B;  4AAX A;  3FHQ A;  1RUH 2;  5H9Q A;  5DAP A;  5F32 A;  2CY6 A;  3FHA A;  4CP0 A;  3IB3 A;  4ZON A;  4YW2 A;  3MV1 1;  2RJ2 A;  2R04 1;  2BFU L;  1BJQ A;  2A3X A;  3AMP A;  1J1L A;  1MZE A;  1V9U 2;  3DN7 A;  3KGZ A;  1BK0 A;  5EJ3 A;  2YFZ A;  3OBZ A;  3H0O A;  3NAP C;  5A7N A;  1LGB A;  4Q0V A;  2YFU A;  1FMD 3;  4COU A;  3KCC A;  1RUD 2;  4N9I A;  4CUA A;  4D7S A;  5E6H A;  5CFC B;  2RVA A;  2QCS B;  3HMY A;  4Q0S A;  3PUS A;  4NWV A;  1IPK A;  3ZXJ A;  3NO8 A;  2OKX A;  1MQT B;  3T2P A;  3ZXL A;  1H0B A;  1N3O A;  2ADE A;  2PXJ A;  5ANQ A;  5LA9 A;  2LUW A;  2OUJ A;  1ULC A;  4GA9 A;  2XJP A;  3IKW A;  3KCY A;  5FDB A;  2W1W A;  1D4M 3;  1D2S A;  4AED C;  3H8O A;  1CX4 A;  1UXX X;  4NID A;  1ZZ6 A;  3GBG A;  4CDQ B;  1OOP C;  2VOK A;  3WW2 A;  1HXS 1;  2R06 3;  4O9G A;  4OHW A;  4D7Y A;  3KF5 A;  1DYP A;  4E2S A;  4ZZ5 A;  4MGK E;  1NZC A;  2FMY A;  4NPM A;  2DCZ A;  5F3C A;  3OBT A;  3ABZ A;  1HQL A;  1TMF 2;  4HBN A;  4JV4 A;  4PQ9 A;  3M3I A;  4D0Q A;  2VGD A;  4P14 A;  4MVT A;  4GWJ A;  2HWF 3;  3AMH A;  4LUM A;  4LKE A;  1CAU A;  4P9W A;  4ZHN A;  5C6C A;  4IES A;  1ZA7 A;  2JB4 A;  1ZBE 1;  2PHT A;  4GKX A;  5CG8 A;  1W6Q B;  4IEO A;  1CPN A;  2N7G A;  1RUC 2;  1C8M 3;  1VBA 2;  2ZX3 A;  5L9B A;  2HEW F;  5A32 B;  1XPW A;  2ZAC A;  5A3O A;  1DZQ A;  4NE9 A;  1DGW A;  4LO4 B;  3AL6 A;  4LEJ A;  3F2Z A;  5FMC A;  1C1F A;  1JXN A;  2D93 A;  1XBF A;  4CPB A;  3M3Q A;  4YW6 A;  3NRU A;  1PGL 2;  4BWO A;  2XJV A;  1GU3 A;  2W95 A;  4IL7 A;  3FLR A;  5DZF A;  3ZXK A;  5C4W B;  1PK6 B;  3K2O A;  5LBE A;  4ATF A;  2VPV A;  3LPF A;  1FPN 1;  4V2V A;  4FPY A;  5EJ1 B;  4BYY A;  5IVV A;  2VXJ A;  2Y6F A;  2QNK A;  4P9J A;  3WHT A;  4AHW A;  5AVP A;  2FDG A;  1UIK A;  1OKQ A;  4AW7 A;  4TYS A;  2J1S A;  5F6L B;  1DQ1 A;  4J25 A;  2R32 A;  3THC A;  3KV6 A;  4PBP A;  3RZM A;  1U12 A;  1DGR A;  4CDX C;  1KJR A;  2W5F A;  2J1E A;  2ZZJ A;  4YW1 A;  1FT9 A;  2ZTN A;  4MHR A;  1A34 A;  1NT0 A;  4RGK A;  1ND3 A;  4DRR A;  1R09 3;  4BZ4 A;  4O7X A;  4XZU G;  4OYU A;  4QB2 A;  1OI6 A;  2D6L X;  2WS9 3;  5FYB A;  3C8X A;  1OD5 A;  2YV8 A;  3ZPY A;  3KT1 A;  4ZPI A;  2ZGK A;  1GOG A;  2VUL A;  4JGZ C;  3OD4 A;  5T5P A;  5T52 A;  3WQB A;  2DF7 A;  2JG9 A;  4Q5O A;  1XXN A;  1YQ2 A;  3I8T A;  2ZHK A;  1CWP A;  4D8M A;  3H1W A;  2VCC A;  4BQ1 A;  1CON A;  5CNA A;  3WOG A;  1V6K A;  2VZP A;  3HD8 B;  1ONA A;  3N7J A;  3ZFF B;  3B01 A;  4PIZ A;  1W6P B;  1JZ4 A;  1VRH 1;  5IAV A;  2VMG A;  1SCS A;  2OS2 A;  1U5Z A;  2BDR A;  3NV3 A;  4FPC A;  4JRA A;  3S30 A;  3UKN A;  3WW1 A;  1YFX A;  4YLZ A;  3MIF A;  2O0O A;  2W2I A;  3NJV A;  1V0A A;  1WW6 A;  2A73 B;  1W8F A;  2D40 A;  5A3M A;  5LRS A;  5A6Q A;  3NNJ A;  5IFP A;  4SLI A;  5BNP C;  5JIA A;  3UYJ A;  2WR9 A;  4JKL A;  5FY0 A;  4JKM A;  1R09 1;  2R1B A;  1UYY A;  1EAH 3;  4AI8 A;  1HB4 A;  2DFB A;  1PO1 3;  3ZXG A;  1HRI 1;  3LEM A;  4ZZ8 A;  1LOF A;  2HJI A;  2JE8 A;  3JB4 C;  1HXS 3;  3J8F 2;  4MYE A;  4AED B;  4YW3 A;  2H6B A;  2QVS B;  2PQS A;  1ODN A;  1K5M B;  3H7J A;  2JDH A;  4J1W A;  4A45 A;  4N43 B;  4HON A;  1C28 A;  1W9W A;  1FX5 A;  1R09 2;  1NKG A;  2P37 A;  5IWF A;  2BER A;  1W6O B;  5FZB A;  4RHV 1;  1J3R A;  5GLW A;  1IS3 A;  1SEF A;  4PF1 A;  3WSO A;  5CFC C;  1OSG A;  5FBJ A;  4S2G A;  3WDY A;  5CFC A;  1N3Q A;  2AYH A;  4DUX A;  3BKZ A;  4IW3 A;  1QQP 3;  1UY0 A;  3MLK A;  4Q8L A;  4DY5 A;  3R05 A;  2BEO A;  4CU7 A;  2JG8 C;  5DDJ 1;  1LAJ A;  2Z42 A;  2NLR A;  2OVU A;  4NHL A;  1O3Q A;  2W91 A;  3LAG A;  1IQA A;  1Y3T A;  3WZ1 A;  1YO8 A;  3HIF A;  2Y0O A;  4FPH A;  4LBL A;  2VNO A;  5JI7 A;  2XOM A;  4P08 A;  1PGW 1;  3MDP A;  3WG1 A;  2VBP A;  4FPJ A;  1K45 A;  1PM4 A;  4GB3 1;  4LNV A;  4CCM A;  2HWB 3;  1US3 A;  3ZIX A;  1RUF 1;  1I1E A;  4I3G A;  3OY8 A;  1O5L A;  3TEY A;  3KV5 A;  5K0U A;  2VUC A;  3U11 A;  4HVO A;  4IV1 C;  1RIR A;  2JG8 B;  1HXS 2;  4H3W A;  3ZN5 A;  2OQ6 A;  3KF3 A;  5F37 A;  3EJK A;  3AKT A;  3IAQ A;  1S55 A;  2IXI A;  1W6N A;  3WT3 A;  3MIG A;  2XJU A;  4LA2 A;  2XG3 A;  4LIT A;  5C8C B;  1FMD 1;  1Y9M A;  5F6K A;  3K3N A;  5FR3 A;  5L7O C;  3IM0 A;  2VMF A;  3WEZ A;  4ITC A;  1BYH A;  5JPM B;  1VBD 1;  3AZW A;  3E5U A;  3BVC A;  5IVJ A;  4GKY A;  2IXH A;  2X29 A;  5FZO B;  3MPP G;  5M0T A;  2WYS A;  1KDM A;  5IVY A;  4YVW A;  2OZJ A;  1YFW A;  3RI8 A;  1DGL A;  3LZZ A;  4R9B A;  1I5P A;  1OLM A;  2TEP A;  2KM2 A;  4XQW A;  1SBD A;  1AJO A;  1PHM A;  4UT5 A;  1DQ6 A;  2Q8O A;  3VDD C;  3BN6 A;  4CVU A;  1RJ8 A;  4WVW A;  3AP5 A;  3J7L A;  1KIT A;  1W2O A;  3QBQ A;  3CZJ A;  2UWC A;  4AHZ A;  1SG3 A;  1HQN A;  1DLC A;  3LE0 A;  4I01 A;  5F2S A;  1AX0 A;  2WQ4 A;  1S2B A;  3J26 N;  3PTR B;  3LPG A;  3LEK A;  1CZT A;  2B45 X;  2EXH A;  3DV8 A;  3VN4 A;  4LO7 A;  5A6Z A;  1G9A A;  1HRV 2;  1XND A;  3VBR A;  4W6Y A;  4Q4X 1;  4LUK A;  1CZV A;  3FBM A;  2JEM A;  2TBV A;  4BQX A;  3JCI A;  5C3R A;  5LCW L;  1V00 A;  3RZG A;  2NMN A;  5F3E A;  1OQ1 A;  2LM3 A;  4A4A A;  2VQA A;  1O4Z A;  1UOJ A;  3ZXF A;  4E8C A;  3NNM A;  5FY7 A;  4IER A;  1H1A A;  1J83 A;  4I02 A;  5GAL A;  5C4W A;  5AC9 3;  5FO9 B;  1OA4 A;  4RL7 A;  1REE A;  2R06 2;  3LDR A;  5EYX A;  5I91 A;  4I0W B;  3H8U A;  3BGA A;  2PAM A;  5D2A A;  1Y7B A;  3GJA A;  3IN9 A;  5LK7 B;  1D4M 2;  3NL1 A;  1SAC A;  3ZM8 A;  5KHK A;  1H1I A;  1HRI 2;  4KBZ A;  1AJK A;  1HV1 A;  1Q8O A;  3CF6 E;  3WW3 A;  2I2S A;  1JZ8 A;  1S0F A;  4I0B A;  3RWK X;  3BU7 A;  1KGY A;  3KQR A;  4PT6 A;  3TEZ A;  4W6W A;  1XYP A;  1WKY A;  3ZDS A;  5J3U A;  3ENR A;  1XSQ A;  4YW4 A;  4YRD A;  4WM7 C;  4E8D A;  2K0G A;  3OBR A;  2GP5 A;  1VBB 1;  3T2T A;  4XTP A;  1W06 A;  3R4D B;  2R6Q A;  5FP7 A;  2QQJ A;  1SPP B;  4RR3 A;  5DG1 A;  2WAO A;  2B9V A;  2W46 A;  5HPO A;  3FLP A;  4ZU4 A;  1IKP A;  1VRH 2;  1JUH A;  2EXJ A;  2X09 A;  5LW9 A;  2P3Y A;  3FC0 A;  5GZG A;  1AR7 2;  2ARB A;  1HLC A;  4IEV A;  3QD6 A;  2E7T A;  1MS8 A;  1RUH 1;  3THT A;  1IG0 A;  5FRA A;  4EE2 A;  2CGP A;  3JD7 2;  2Y6J A;  1YIF A;  2OW4 A;  4QX5 A;  5DAV A;  1QJU 3;  5CZK A;  1UZW A;  1QGL A;  3I2O A;  2VBB A;  4Q1P A;  5HCB A;  1RIN A;  2R16 A;  1AXK A;  1LES A;  3LA7 A;  1JYT A;  4CEW C;  3M3E A;  1OPO A;  4LPL A;  4BHP A;  1HRV 1;  3B00 A;  1FYU A;  2VOW A;  1BVP 1;  2OQ7 A;  3LSD A;  1ZBE 2;  4AVT A;  5BNP A;  2ET7 A;  2OII A;  2CDO A;  3I2J A;  5FPB A;  2JIC A;  2ZBJ A;  4B4Q A;  4FAG A;  1AL0 G;  4HZF A;  1F2N A;  4CDU A;  3MID A;  2GC0 A;  1W0P A;  1NLS A;  1LNS A;  1OMI A;  3A7Q A;  4LA3 A;  4QPG C;  2Q8E A;  5C8C A;  5FZK A;  1JI6 A;  5FZA A;  3WCS A;  4Y22 A;  5FUI A;  4Y4Y A;  2P3K A;  2VD7 A;  3PHM A;  1RED A;  4IEU A;  2ZXQ A;  2ZGN A;  1B09 A;  1FPN 2;  2UU8 A;  3GCX A;  4QX0 A;  4NHX A;  3USU B;  2DUR A;  1MQT C;  1F5F A;  1JYX A;  4K8F A;  5F5C A;  1AXY A;  5IVE A;  2D3P A;  4IQP A;  1EV1 1;  5SV5 A;  4AK3 A;  3NW4 A;  4RD7 A;  4HET A;  2ZGR A;  5CIR A;  4FSJ A;  2PLV 3;  1W8N A;  4CDX A;  1C8N A;  1VR3 A;  3NAP B;  1JOP A;  1YQC A;  2VZO A;  4K8R B;  1ND3 C;  3OEB A;  4XJW A;  4UW6 A;  2LRP A;  3MEP A;  2I74 A;  1CZS A;  1W99 A;  4XQD A;  4CU6 A;  3RYP A;  2QFE A;  4B4R A;  4A7K A;  1CIY A;  4GUL A;  3VBU C;  4ORF A;  2GC2 A;  1OPM A;  5I0S A;  5FPA A;  1H30 A;  2Z4F A;  2OX0 A;  4GH4 C;  4UYB A;  3DYM A;  2Q8C A;  5BNN C;  2CV6 A;  5F39 A;  2YU2 A;  4LOS A;  5CKQ A;  5FZ9 A;  4XIL A;  5GLU A;  3UKV A;  1NCQ A;  4E4D X;  2ARX A;  4L0P A;  5J37 A;  4YG6 A;  2R1D A;  5CFD B;  2HWF 2;  3NKG A;  2AEN A;  1AL2 3;  4QQ2 A;  3OPW A;  3JB8 A;  5JR2 A;  3HT1 A;  4ZU7 A;  3VBF A;  3PIG A;  2ZGQ A;  4NRO A;  1ZBE 3;  3FX3 A;  2XQR A;  3V0B B;  3N9N A;  4BPZ A;  3DKQ A;  1RXF A;  1O8P A;  1Q8Q A;  4ZXE A;  3SXW A;  1RVF 1;  4YAR A;  4HOO A;  5CFD C;  5HV0 A;  3ALQ A;  4NPL A;  5CFD A;  1IHM A;  4X6Q B;  5EFU A;  4RQP A;  5T5J A;  4E9K A;  2R06 1;  3LEI A;  4AZZ A;  5CEH A;  2ZMK A;  4AQT A;  1MS1 A;  3SH4 A;  3ZFE B;  4AVB A;  1QJY 3;  2VNR A;  2V5D A;  3MW3 A;  5FAX A;  4K1Y A;  5GZE A;  1D2Q A;  5HXM A;  2WA3 A;  1OOP A;  4HSL A;  3R4S A;  4M3C E;  3DXU A;  4MGY E;  4XCA A;  3WG2 A;  1YLL A;  1CJD A;  1GZ9 A;  1PZ9 A;  5A6X A;  2XWJ B;  4QM9 A;  1I5Z A;  4GIQ A;  2K46 A;  4K21 A;  1QOT A;  4CEY C;  4Q4X 2;  5CB7 A;  4UW5 A;  3PLQ A;  2YUE A;  3IPV A;  4GXL A;  4NJ4 A;  4XEZ A;  3VKM A;  4JGY B;  4B1M A;  4CCK A;  1FV3 A;  4XF4 A;  3AYA A;  3P3N A;  2WZP P;  4N7I A;  3GDB A;  4C90 A;  2Q5T A;  3FL7 A;  2HYX A;  2XON A;  3HNY M;  3WXP A;  1DFQ A;  3VD3 A;  1KS4 A;  5AC9 1;  4KWU A;  2WO7 A;  4BJ0 A;  4B7E A;  1GUI A;  4EZ4 A;  1WLT A;  4IND A;  4F3J A;  1JBC A;  1FAT A;  4AGG A;  1W9S A;  1QY4 A;  4UFM A;  4Y1Y A;  1Q43 A;  2GAU A;  2VCB A;  3S5Q A;  2CAU A;  1QMJ A;  1N1T A;  4CCD A;  3S57 A;  1DQ4 A;  3IMN A;  3UV9 A;  4QXC A;  4DXR A;  1DQ0 A;  2VO5 A;  5FP8 A;  2ZAB A;  4BMB A;  4QXH A;  1TNF A;  3FLT A;  2V5Y A;  2YRO A;  4FPF A;  4HKO A;  4A44 A;  2EXI A;  2GP3 A;  1ZZC A;  1W6O A;  3HT2 A;  4QX3 A;  5FWJ A;  1GNY A;  3ACH A;  5A7S A;  3WUC A;  1D0G A;  3KVB A;  1KJL A;  4LE4 A;  4DOU A;  2UWA A;  1ZZ8 A;  3DPR A;  2GN3 A;  3DXT A;  5FWE A;  3DPR B;  1U5I A;  5JMO A;  1JOJ A;  1NYW A;  2B46 X;  1YWK A;  3ZLI A;  3MW4 A;  4XFH A;  2PHW A;  1O3T A;  1E57 A;  4CEW B;  1OC1 A;  4TXW A;  4AED A;  2WS9 1;  2F4L A;  1HN1 A;  1OHF A;  4XJ8 A;  4IDZ A;  1UZY A;  4XUN A;  4MUV A;  5FP3 A;  1QNY A;  2FDH A;  1DU3 D;  1GZW B;  3VZO A;  1J3Q A;  1C5I A;  1Z78 A;  4KU8 A;  3PVO A;  3THP A;  2FZ1 A;  1NE4 A;  1VP6 A;  3AL5 A;  3J7N A;  3LA3 A;  4MZU A;  4CEW A;  5FZ6 A;  3VZL A;  1MZ5 A;  1E5H A;  3GZE A;  4UWD A;  4CDU B;  3A23 A;  4CDW C;  5GKA C;  2GZW A;  3VBS A;  4CXY A;  4LK6 A;  3VBS C;  1HQW A;  3E5X A;  1S0J A;  2Z69 A;  5FZ0 A;  3RYK A;  4O61 A;  1PVX A;  1ZZ9 A;  1ZX5 A;  3ZR5 A;  2Y38 A;  2BVB A;  5FOB B;  4QDQ A;  3LFM A;  1NCQ B;  3AJY A;  3GBW A;  3K51 A;  1AHS A;  3NKT A;  3WIN E;  1WBL A;  2MEV 2;  2Q1Z B;  4TSV A;  5F5Q A;  3JD7 3;  4LQR A;  4H14 A;  5EV7 A;  3POE A;  5A80 A;  4AFD A;  4Z2A A;  2JDZ A;  3LIH A;  1D4V B;  1CIW A;  3U4X A;  3X29 B;  5C70 A;  2RM2 3;  3W58 A;  4JQT A;  3LWC A;  5FYZ A;  3P5B A;  2IZW A;  3EB7 A;  3Q9O A;  1FPN 3;  5EZW A;  4XXA A;  3O1M A;  4AE2 A;  2QQW A;  3PUA A;  4QDS A;  2QDN A;  4RR3 B;  1RIT A;  2FMD A;  2PHD A;  3VBH C;  4OHY A;  3NJY A;  4OUM A;  3JXS A;  3CBN A;  3BI3 A;  3POY A;  4K9S A;  2JD4 A;  2EIC A;  4GD4 A;  4QGN A;  3CIH A;  5T3N A;  1JHN A;  2HWC 1;  1PVC 1;  1ZYB A;  2WYF A;  4R8H A;  2W87 A;  1LGN A;  4KU7 A;  3EHK A;  1IS5 A;  3PME A;  5GLT A;  5B4X A;  2DVB A;  1BQP A;  1VRB A;  1XRU A;  4LBQ B;  4MGT A;  4GAZ A;  4LMF A;  5C9A B;  4XF0 A;  1L3J A;  3NWK A;  2XGX A;  3OPZ A;  3WF1 A;  1GLH A;  1TZO A;  3LDB A;  1DQ2 A;  1AR6 3;  4PJY A;  1NQJ A;  3TNQ A;  3ZOI A;  4D6Q A;  1SDW A;  2VQ0 A;  2EIB A;  4GB3 2;  4HK9 A;  3ZN6 B;  4FPL A;  3WDW A;  2CAV A;  4Y33 A;  2R07 2;  4M3C F;  1O91 A;  1CD3 G;  3UJQ A;  4G3Y C;  4BB3 A;  3UGH A;  1JYI A;  4K1Z A;  4Q27 A;  1EV1 3;  2VBD A;  1AR7 3;  4URA A;  2DYC A;  1VBB 2;  4UF0 A;  1G9B A;  1DCS A;  1VAL A;  4WM8 B;  1W8Z A;  3SQO A;  3VBF C;  3I7D A;  3W9A A;  4BQY A;  5TSW A;  3HEI A;  3N9Q A;  1ZRE A;  1UXZ A;  1XNT A;  2MPF A;  3PU8 A;  3VDA A;  4QHO A;  4Y26 A;  1U5X A;  2HH9 A;  4ASL A;  5DAQ A;  1ND2 B;  5C7G A;  3KT7 A;  4R9D A;  5AFE A;  1DG6 A;  2E33 A;  3WDT A;  5FYS A;  3WNX A;  4EYU A;  2PHR A;  2ARE A;  3PTY A;  4HPK A;  4DPN A;  2ZGP A;  1AX2 A;  1COV 2;  2XJS A;  1V9U 1;  4Y1V A;  5EJZ B;  3LQC A;  5APA A;  5C8C C;  3PU3 A;  3WNK A;  2ZCW A;  4CP2 A;  2XJT A;  3OD0 A;  1HIX A;  3GXU A;  3PIJ A;  1K5J A;  1RXG A;  2XML A;  4O65 A;  1X9P A;  5AC9 2;  5CKM A;  3BOP A;  4GH4 B;  1NZI A;  1ULG A;  1PNF A;  2XBO 3;  4FI9 A;  4HT1 T;  4QWN A;  2JDM A;  4IV1 B;  2ET1 A;  4LK7 A;  1H2K A;  4QHZ A;  4Q0P A;  4UFL A;  5FZ3 A;  2EIE A;  4COV A;  2R49 A;  2NM1 A;  1BMV 1;  5DN2 A;  1YI7 A;  3U75 A;  1HKD A;  2RMU 2;  2XUE A;  4AI9 A;  3IT8 A;  4YM3 A;  5I93 A;  5LA0 A;  1VBA 3;  3HVD A;  5DDJ 2;  5A3W A;  3K4Z A;  1QEX A;  5B2G B;  3T2Q A;  4YFW A;  2GAL A;  2PMW B;  1X50 A; 
#chains in the Genus database with same CATH homology
 3OGR A;  3I3D A;  4W4Z A;  4KI5 M;  3OB8 A;  1W8O A;  5C71 A;  3NJV A;  2ZEY A;  4DEQ A;  5IJR A;  2RV9 A;  5IFP A;  3C7E A;  3WF3 A;  3FN9 A;  3NNG A;  4JKL A;  4JKM A;  1UYY A;  4ZZ8 A;  2JE8 A;  3OGS A;  2QQL A;  2PQS A;  4A45 A;  2L9L A;  2YB7 A;  4GWI A;  1W9W A;  1NKG A;  2BER A;  4BDV B;  4PF1 A;  3WSO A;  3CQO A;  1CX1 A;  4M4P A;  3C7F A;  4DUX A;  2Y6H A;  1UY0 A;  3HNB M;  1JU3 A;  2DDU A;  4A3Z A;  4CU7 A;  2W91 A;  3OBA A;  2XOM A;  4P08 A;  1K45 A;  2WO3 A;  1US3 A;  2JDA A;  1OF3 A;  4OZO A;  1H6X A;  2WN3 A;  2VZ3 A;  4IUG A;  4CUB A;  3IAQ A;  3E1F 1;  2E26 A;  2YG0 A;  3T08 A;  1F4A A;  4DXS A;  2ORX A;  2J1U A;  2VTF A;  2VMF A;  3SEP A;  3WEZ A;  1GQP A;  3T0B A;  2BGP A;  1JHJ A;  3VD5 A;  3C7O A;  3I2F A;  2VZV A;  2WN2 A;  3P6B A;  4RYD A;  3MUZ 1;  5IFT A;  1UYX A;  2E32 A;  2WYS A;  3MV0 1;  1UY2 A;  1I5P A;  3T0D A;  4CVU A;  3HJR A;  3BN6 A;  1K12 A;  3J7H A;  1EUU A;  1PX3 A;  3WF2 A;  2WQ8 A;  3CZJ A;  2W94 A;  1SG3 A;  3D3A A;  1DLC A;  3LE0 A;  5G04 L;  5DQ0 A;  1PMJ X;  3LPG A;  3I2H A;  3LEK A;  1CZT A;  3K46 A;  2DCK A;  3I2K A;  2VMD A;  3EYP A;  1CZV A;  4JKK A;  5LCW L;  4BK5 A;  4A4A A;  4MO3 M;  2WBK A;  1O59 A;  4E8C A;  2WAB A;  4UI9 L;  2Y6K A;  3HNM A;  3HOB A;  4OUE A;  4DUV A;  1OD3 A;  1J83 A;  3III A;  2VZS A;  3P1I A;  4XVH A;  1IQD C;  3THD A;  1H6Y A;  1DP0 A;  2WDB A;  3BGA A;  3I97 A;  3MBW A;  1O8S A;  3WF0 A;  3WNP A;  4UOJ A;  4LKS A;  2VR4 A;  3ZM8 A;  2VJX A;  1PMH X;  1J84 A;  2Y6G A;  3PUH A;  4XUT A;  1JZ8 A;  3LEG A;  4W8J A;  1KGY A;  3VD7 A;  4PT6 A;  1BHG A;  1WKY A;  3C7G A;  3T0A A;  1OH4 A;  4E8D A;  1W0N A;  2YC4 A;  3UES A;  2QQJ A;  1GOF A;  3UET A;  3UNP A;  2WAO A;  2B9V A;  2W46 A;  5HPO A;  2X09 A;  4UAP A;  2QBX A;  1WCQ A;  5CYY A;  1F4H A;  2VME A;  1JYW A;  1UZ0 A;  2KD7 A;  2VZ1 A;  2BGO A;  5IYY A;  2Y6J A;  5CZK A;  2W47 A;  2ZEX A;  1L7R A;  3HPN A;  3CDZ B;  4LPL A;  4ZY9 A;  2VZT A;  2CDO A;  2WAA A;  2BZD A;  3I2J A;  3T2O A;  4P00 B;  1JZ7 A;  2V4V A;  1ULP A;  2X10 A;  3ACF A;  1LNS A;  1JZ2 A;  3A7Q A;  1JI6 A;  3K77 A;  3DEC A;  5FUI A;  2VMC A;  2C9K A;  3I2I A;  2Y8K A;  2ZXQ A;  5JXG A;  3CMG A;  4MOA A;  4QX0 A;  1JYX A;  3CZU A;  1UMH A;  2VL4 A;  1JU4 A;  2W1Q A;  1OT5 A;  4AG4 A;  3SKJ E;  2R7E B;  4A6O A;  2VZQ A;  1JZ3 A;  1W8N A;  3W5M A;  1P8J A;  4ARX A;  4QB1 A;  2VZO A;  1UMI A;  4LHS A;  1K3I A;  3OEB A;  4P5Y A;  4CU6 A;  1CZS A;  1W99 A;  5DPN A;  5JUV A;  1UWW A;  1W9T A;  1CIY A;  2C26 A;  3WNM A;  2WZ8 A;  1UYZ A;  4DUW A;  4XUR A;  2Z4F A;  3ETP A;  2VCA A;  3DYM A;  1EUT A;  1UX7 A;  2CDP A;  3VDC A;  3WNO A;  1JZ6 A;  4W50 A;  3GM8 A;  4L0P A;  5LA1 A;  2V72 A;  3T09 A;  1GMM A;  2QQN A;  2QQO A;  1ULO A;  3WNN A;  5JR2 A;  2VQT A;  4JHZ A;  1SHW B;  4JX0 A;  3WNL A;  2Y6L A;  2QQI A;  5A1A A;  1O8P A;  4ZXE A;  4ARY A;  2J7M A;  4RN5 A;  1NAE A;  4BK4 A;  4CU9 A;  4CU8 A;  2W1S A;  5LA2 A;  3LEI A;  3VD9 A;  3DYP A;  5J1X A;  2J1R A;  4ET7 A;  2HLE A;  2V5D A;  5DMY A;  5HXM A;  3IAP A;  3K4A A;  1R64 A;  3A21 A;  2QQM A;  4HG6 B;  3I2G A;  2J22 A;  1TG7 A;  1TVG A;  5JXJ A;  3OG2 A;  3GDB A;  1NUK A;  1UY4 A;  4XUQ A;  3FL7 A;  3HNY M;  2HYX A;  2XON A;  1L7Q A;  3VD3 A;  5I0D A;  4GZ9 A;  2JD9 A;  2VQU A;  4KWU A;  4BJ0 A;  3VDB A;  1GUI A;  4QDR A;  5JXI A;  1W9S A;  2VCB A;  3ECQ A;  5B4N A;  1UY3 A;  4DXR A;  2VO5 A;  2ID4 A;  4A42 A;  2W9X A;  2BBA A;  2VOT A;  3AC0 A;  3DYO A;  4A44 A;  3SKV A;  1K42 A;  4QX3 A;  4XUO A;  3VD4 A;  1GNY A;  1MPX A;  3ACH A;  3SEE A;  3PUI A;  3IDA A;  3K4D A;  3WF4 A;  5JMO A;  4QAW A;  1GOH A;  1UY1 A;  2J1T A;  2X05 A;  4M4R A;  5EIY B;  2W1U A;  4TXW A;  3NJX A;  2W3J A;  1HN1 A;  3MO4 A;  4XUN A;  3C7H A;  1DYO A;  4AAX A;  3FHQ A;  3FHA A;  4KMQ A;  3IB3 A;  3MV1 1;  2RJ2 A;  3GGL A;  3I3E A;  4OMC A;  2YFZ A;  1SDD B;  2VM9 A;  3A23 A;  3K75 B;  2XQX A;  2VC9 A;  2YFU A;  4XUP A;  4A41 A;  4CUA A;  3ACG A;  2RVA A;  2VZR A;  3U37 A;  5F7U A;  4QDQ A;  2OKX A;  3T2P A;  4Z2A A;  4LQR A;  2ZEZ A;  3I3B A;  4MGQ A;  5C70 A;  2W1W A;  1OF4 A;  1JYV A;  4OMD A;  1UXX X;  3MUY 1;  1US2 A;  2ORZ A;  4QB6 A;  3EB7 A;  2Y64 A;  2B4K A;  4MGS A;  4ZZ5 A;  2J1V A;  4PQQ A;  4QDS A;  2LW8 A;  3A22 A;  2C4X A;  1T2X A;  3ABZ A;  4D0Q A;  2E31 A;  3OEA A;  3JXS A;  4BXS V;  4GWJ A;  2EIC A;  2WO2 A;  2XHN A;  4DEV A;  3CIH A;  1KEX A;  3CKH A;  2W87 A;  5B4X A;  1XPW A;  4YPJ A;  3WF1 A;  1JYN A;  3F2Z A;  2LS6 A;  2QQK A;  5JXH A;  3NRU A;  2EIB A;  1GU3 A;  2W95 A;  2W92 A;  3LPF A;  5EJ1 B;  3NQH A;  1RYY A;  4DXT A;  2EID A;  1XC6 A;  2WUH A;  2J1S A;  3W5N A;  3THC A;  3HEI A;  3OGV A;  1UXZ A;  1XNT A;  2JKX A;  5G05 L;  4TTG A;  2W5F A;  4QPW A;  2J1E A;  3VDA A;  1PX4 A;  5C7G A;  2WO1 A;  2E33 A;  3ACI A;  2WZE A;  2DCJ A;  1D7P M;  4MAD A;  4XZU G;  4QX2 A;  4OYU A;  4QB2 A;  5EJZ B;  3LQC A;  1NX9 A;  3C8X A;  3WNK A;  2J1A A;  3HN3 A;  3GXU A;  1GOG A;  4CUC A;  4P02 B;  3WQB A;  4FI9 A;  1YQ2 A;  2EIE A;  4D8M A;  5IHR A;  5DN2 A;  2VCC A;  2VZP A;  5LA0 A;  2VZU A;  1JZ4 A;  1JZ5 A;  1XNA A;  3K4Z A;  4QX1 A;  3T2Q A;  2YC2 A;  2ZEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...