4QDSA

Physical basis for nrp2 ligand binding
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
182
structure length
182
Chain Sequence
SHMFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for VEGF-C Binding to Neuropilin-2 and Sequestration by a Soluble Splice Form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Neuropilin-2
total genus 48
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdsA00
3GM8A 3THDA 2WUHA 2E32A 4KI5M 4ZXEA 4DUXA 1UY2A 1CZVA 2W1QA 4DUWA 2BBAA 4A45A 3U37A 2C26A 3NQHA 5CZKA 4CUBA 4CU8A 2WABA 3ZM8A 4XUOA 3K4AA 4JHZA 1JZ4A 5B4XA 3C7HA 5JXJA 1T2XA 3WF0A 3FN9A 1JYWA 1K42A 3WNPA 1OH4A 4ARXA 2W87A 1D7PM 1PX3A 2W94A 2ORXA 2QBXA 2RV9A 2VZOA 5J1XA 4OZOA 2W91A 4W50A 5HPOA 4XURA 3VDCA 4YPJA 2VZ1A 2W95A 1JYVA 4MO3M 2VMFA 1XC6A 3NNGA 5G04L 3CDZB 5F7UA 3K4ZA 4Z2AA 3I3BA 4ZZ5A 1O8SA 4D8MA 5IFPA 1W8NA 1TG7A 2WDBA 4M4PA 1NUKA 3WF2A 2WZ8A 1F4HA 1JHJA 1GQPA 3IAPA 3IDAA 2VQTA 4XVHA 3ECQA 4XUTA 3GXUA 4UAPA 5IFTA 2HLEA 2X09A 3HNYM 1LNSA 2J7MA 2YC4A 3VD7A 3IIIA 4QAWA 1PMHX 3CZJA 1ULPA 1K45A 2VL4A 3P6BA 2X10A 3NJXA 1GU3A 4CUAA 3FL7A 4GWIA 3K4DA 5EIYB 5IHRA 1GMMA 1XNTA 4BDVB 1NKGA 1R64A 4QDQA 3MV11 4W8JA 4L0PA 1CIYA 5LCWL 4MGQA 2VCCA 4QX3A 3WNOA 4XUQA 2Y6LA 2VC9A 1P8JA 2YFZA 2XHNA 1NAEA 5I0DA 3OG2A 3WF1A 4DXTA 3CKHA 3ACHA 2WZEA 2VR4A 3A7QA 2HYXA 3WF3A 4GZ9A 1OD3A 2J22A 1H6YA 2YFUA 4XUPA 5JUVA 2QQOA 1CZSA 2JE8A 4IUGA 4A3ZA 1OF3A 4PT6A 2E33A 3UETA 1UYXA 5IYYA 1RYYA 3E1F1 3VD9A 5LA0A 1UZ0A 2ZXQA 2J1AA 1H6XA 3OGRA 2WQ8A 1JYNA 2XONA 1O59A 3WEZA 4CU9A 2J1SA 2QQMA 4OYUA 3I3EA 2KD7A 5HXMA 4DEQA 4E8CA 3T09A 2W3JA 4RN5A 5DPNA 3LEGA 1UXXX 1UYYA 4E8DA 4LKSA 3ACGA 3NJVA 3OB8A 1W9SA 1BHGA 2VZ3A 2DDUA 1GUIA 4OUEA 1W0NA 3MV01 3VD3A 3OBAA 5LA1A 4LPLA 4P00B 4AAXA 3CIHA 5JMOA 2EICA 2J1EA 5B4NA 3THCA 3HJRA 1UY3A 4KWUA 2W47A 4DXRA 1SHWB 2XOMA 4QB6A 3W5NA 2Y6JA 3JXSA 2X05A 2ZEYA 3K46A 2QQNA 2WO2A 2VZUA 4BK4A 1UMIA 2XQXA 2CDOA 3IB3A 1OF4A 2B4KA 4QDRA 5IJRA 1UYZA 2B9VA 2DCJA 2E26A 2J1TA 3T0BA 1EUTA 2VTFA 4UOJA 4D0QA 4M4RA 1O8PA 4P02B 3C7GA 4A4AA 4A6OA 2LS6A 4PQQA 1DLCA 3LPGA 3HOBA 2YG0A 3LEKA 1GNYA 2VZTA 3VDAA 2J1UA 1MPXA 1JI6A 1F4AA 2QQLA 1JZ5A 3C7EA 4XZUG 3WNKA 3OGSA 2W1SA 5C7GA 2CDPA 1KEXA 2ZEWA 5C71A 2VCBA 3A21A 1UX7A 3FHAA 1L7RA 1JU3A 3EB7A 3MUZ1 1W9TA 2L9LA 2V72A 1EUUA 2WYSA 5JXHA 3VD5A 3VDBA 3CMGA 4A42A 4QX2A 5C70A 2DCKA 5DN2A 2Y64A 4OMCA 3C7OA 2JDAA 3OEBA 3D3AA 2Y6KA 3SKJE 3T2QA 4KMQA 5JXIA 1JZ3A 3ACIA 2BGPA 4A41A 2VZSA 3P1IA 1GOHA 3T2PA 2VOTA 2RVAA 4CVUA 2Y8KA 2Y6GA 3WQBA 2ID4A 2WO1A 1US2A 3A23A 4QB1A 3I2JA 2RJ2A 5EJ1B 3SKVA 2VMCA 3WNNA 4BXSV 2WO3A 4JKLA 3J7HA 1W9WA 4CUCA 4CU7A 3ETPA 1YQ2A 2WN3A 1K3IA 4A44A 2W1UA 3I97A 2OKXA 4LHSA 4JX0A 2VZQA 1PMJX 2VO5A 3LQCA 3OGVA 3SEPA 1HN1A 2QQKA 3WNLA 3T2OA 4JKKA 3I2KA 4ZZ8A 4P5YA 2BERA 2EIDA 1PX4A 4QDSA 4QB2A 3WNMA 3I3DA 4QX1A 3OEAA 1SG3A 2J1RA 1UXZA 2W46A 5LA2A 2W9XA 2QQIA 3NRUA 2EIBA 1I5PA 2VJXA 1XPWA 1DYOA 4QPWA 4ET7A 4CU6A 3C8XA 3I2HA 3GDBA 4JKMA 3MBWA 4DEVA 1IQDC 3K77A 3F2ZA 1JZ7A 1JZ6A 4FI9A 3C7FA 3GGLA 4BJ0A 4BK5A 3UNPA 1ULOA 3EYPA 3W5MA 2WBKA 2PQSA 2Z4FA 2VZPA 3T0AA 1UY4A 2QQJA 4DUVA 3VD4A 2W1WA 2V5DA 2WN2A 2JKXA 1K12A 1J83A 4HG6B 4MGSA 4TTGA 1US3A 4ZY9A 3T08A 4QX0A 2VMDA 3DYOA 3MUY1 1UY1A 3HPNA 4RYDA 3CZUA 3AC0A 4GWJA 2C4XA 3WF4A 3BN6A 4P08A 2VMEA 1OT5A 2VZVA 2YB7A 4TXWA 2R7EB 1JZ8A 3DYPA 2YC2A 3SEEA 2ORZA 4MOAA 2V4VA 3BGAA 1UMHA 5FUIA 1UWWA 3I2GA 2VZRA 1JZ2A 1L7QA 3IAQA 3HEIA 5G05L 3FHQA 1GOGA 1UY0A 4DXSA 2W92A 4W4ZA 2W5FA 3DECA 1WKYA 3DYMA 2E31A 1W8OA 1J84A 5A1AA 1WCQA 1KGYA 3A22A 1XNAA 2VCAA 3PUIA 2BZDA 1DP0A 1CX1A 2Y6HA 5DMYA 3I2FA 2ZEZA 2WAOA 5DQ0A 5EJZB 4UI9L 3CQOA 3T0DA 1CZTA 5JXGA 4OMDA 1GOFA 3WSOA 3MO4A 2BGOA 3K75B 4PF1A 4MADA 3LEIA 2C9KA 3HN3A 2VM9A 3I2IA 5CYYA 4LQRA 1SDDB 3LPFA 1W99A 3PUHA 2J1VA 2WAAA 3ACFA 2LW8A 2ZEXA 1JU4A 2JD9A 5JR2A 1NX9A 1JYXA 4XUNA 3HNBM 4AG4A 3LE0A 3HNMA 3ABZA 1TVGA 2VQUA 3UESA 2EIEA 4ARYA
chains in the Genus database with same CATH superfamily
5LASA 1UIJA 1AL22 5L7OC 1UY2A 3AYDA 5GZEA 1ASJ1 4C0BA 1XE8A 2W1QA 4GB31 5C33A 2RR11 4MH0E 3U37A 1JTZX 4XF0A 2DUOA 1RUF3 4HXCA 4ZPIA 3WXPA 2EIGA 2PHWA 3RZMA 2WABA 1F35A 5DZFA 4XUOA 1PGSA 4NHMA 4Y4RA 4KWJA 3ZM8A 1R1A1 3C7HA 5CEHA 4AVBA 2RS31 1PZ9A 1T2XA 4QXHA 3RZKA 3UGHA 1JYWA 2HWE3 4N53C 3N9OA 3ZSMA 1DBNA 2QQPA 4WM7A 3KQRA 3FLRA 1OH4A 3KGLA 4ARXA 1LOFC 1MVEA 1NLSA 2WIIB 3EJKA 2JG9C 3KB5A 5CISA 2XPJA 1W8FA 1JHNA 1RUJ2 2W94A 5LA9A 4EN8B 4CTEA 4IE5A 5J1XA 2W2IA 1UZWA 4FO9A 3M1HA 1AX1A 3OPTA 5FYTA 4UF0A 2VZ1A 2CL2A 1BZWA 2D97A 2W95A 3N7MA 1LHOA 2OQ6A 3VBSA 4B7EA 4Y22A 2JIGA 1OVPA 2WA4A 4TYSA 1XC6A 3NNGA 1NYWA 2RS52 3D8CA 2PMWB 5FJHA 1QHDA 1BEV1 4XBLA 5HCFA 5A6QA 1VBB2 4NVPA 2BNOA 2RS32 3H1YA 2IZWA 3ZFFA 4COZA 5IFPA 4QHOA 3TEZA 1H8TC 1TG7A 4LBNA 1UMZA 4Q27A 4IEOA 5FY9A 1NUKA 3QH6A 1A8MA 3CJIC 1RC6A 4TWTA 2YHJA 4XIKA 4LBQD 2B5HA 1DQ5A 4TSVA 2X53S 1UYPA 1O4TA 3QCWA 2FDIA 3IAPA 3IDAA 2VQTA 2JDYA 2E7TA 5HI0A 3ES4A 3KM5A 5IAXA 4KH9A 2P3IA 4CDUC 1LULA 3GXUA 4P5HA 4Q0UA 5FYVA 4DO0A 5BPXA 1JS9A 5FZ4A 3TEWA 2CY6A 2JDZA 4LORA 2ENRA 3GBFA 1APNA 4BQ2A 2EXKA 2D3PA 3VD7A 3WY6A 3AM2A 2GDFA 4QAWA 5FK8A 1AYM1 1C28A 2YV8A 1VLNA 1ULPA 2H6BA 4OHZA 5FO9B 2SBAA 3ZDVA 2Y33A 1TMF3 2D98A 5T55A 4NHXA 4IGQA 2XMLA 4JDMA 4LBLA 4AFMA 2BTVC 1Q5OA 2HWB3 5A33A 1CJDA 2HWF3 5FYHA 3AZZA 4PI2A 1CIYA 4YFWA 1W8UA 4E4SA 3POBA 1RL3A 4HANA 4EQVA 2A6XA 1S0GA 4IE0A 1ZM1A 1JBCA 1PGL1 2Y6LA 3S0MA 1GANA 2VC9A 1Q8SA 3VDDC 4ASLA 1TZOA 1FV3A 1VALA 1VP6A 3OG2A 4N9HA 1QU0A 4MGYE 5FZDA 4QPIA 1QH6A 2PA7A 2RM21 2VUJA 4HZFA 1YJKA 3ZFGC 5FZ6A 1YFYA 2HYXA 5M0TA 1VAKA 4U2AA 4FPEA 5D2AA 4AWDA 1R081 3UYJA 5BYNA 4MX3A 1HQLA 2YFUA 3VN4A 5JOWA 1CAXB 2QQOA 4JRAA 3FE5A 4RQPA 1QJU2 4WM7C 5FFOC 2HKXA 2E6VA 4A3ZA 5C4WB 3ZVXA 3UETA 1OOPA 3IBMA 1UYXA 4AK3A 3E1F1 1QGLA 3OYWB 1UZ0A 1VBD3 2LROA 1DGRN 5IVFA 3P5BA 1Q8PA 2R0HA 4FP3A 1PVC3 4MUVA 5F39A 3H8OA 5A1LA 1C5IA 3H8RA 2BFUL 2WFF1 4FOYA 1IS3A 1QQP3 2OT7A 5SV5A 4OULA 1CVNA 3S6PA 3SH5A 2R1BA 1O3SA 1ULEA 2ZX2A 2QUOA 2KD7A 1UZYA 1KS5A 4DEQA 3M3QA 4QHBA 1UPIA 2DFBA 4MXVA 3M3EA 2B45X 1JOJA 5KWRA 4N9IA 1SZBA 1Q3EA 4LO7A 1N1SA 4UFMA 1NCQC 4DPNA 2BWAA 1XJAA 4LKSA 1AXYA 3AVRA 2VMHA 4EWEA 1WLDA 1QJU1 3OUHA 1OLMA 1YEWA 1C8M1 1GSLA 3T4HB 3UGGA 5C5TA 1ZZCA 1W0NA 3MV01 5CA6A 1H2KA 3MIHA 4SLIA 5CFCC 3ZKYA 1ZRDA 4ATEA 4XILA 4P00B 3K3OA 1AX2A 2XDVA 3B02A 4Q0VA 4XJZA 1HJGA 3WNXA 1O3RA 5B4NA 5A3WA 4XABA 1EV12 3AXDA 3THCA 2DBNA 2R0FA 4CCEA 3GALA 3HJRA 4P14A 4XJWA 4HVQA 1R1A3 1S0DA 3WHTA 2EALA 1PO22 2ZAAA 3MYXA 3J4UH 3FMGA 5FZ0A 1QY4A 4FFHA 3AP7A 1E57A 3SCGA 4MLOA 2RJKA 1C5HA 5LB6A 3VBRB 3VKFC 2G1MA 2PLV1 1MACA 1RUC3 2WWJA 1HXS3 1WA4A 1GQHA 4W6WA 1GZWB 4IW3A 2X05A 5F32A 4BB3A 2QQNA 1A6CA 1LHWA 1IS4A 2D6MA 1C57A 4KBBA 1M4WA 3POYA 2RDSA 3K51A 1LOCA 3OY8B 3ZR5A 4N43A 2B9VA 5JAXA 1DF0A 2R061 1YFWA 2E63A 1W28A 1RUNA 4OUMA 2B39A 3IDBB 1CIWA 2XBO1 3CU7A 4HN1A 4D0QA 3WDUA 4ZU7A 3HR9A 1O8PA 2BGCA 4HSJA 5DAPA 4AAPA 3LFMA 5LRRA 2P37A 2LS6A 2VW2A 4ZKTB 2I45A 2ZZJA 3LPGA 1BK1A 2D6KA 2XR4A 3HOBA 3I54A 3LEKA 1ALYA 2A70A 1MPXA 4F7ZA 1JI6A 2Q8DA 3PLQA 3O5SA 1F4AA 1WCSA 2Y0OA 4NWWA 4JZRA 4A7ZA 3NWKA 1F5FA 4CCOA 2EXIA 1ZVFA 2W1SA 1B35A 5C7GA 3PIJA 1A8DA 2QQVA 1NXMA 4YZ4A 2ZEWA 1OMIA 2DF7A 3LZZA 4Q4X3 4BQ1A 1HKDA 1V6NA 2WNVC 3UKTA 4LOTA 4QQPA 3WG4A 3S5AA 1J59A 2BPA2 1YQ6A 3U07A 4E2QA 1JU3A 4KBZA 5I0RA 4ONUA 4GWNA 1UU6A 3MUZ1 5LBBA 3P3NA 1PVXA 2L9LA 1TNFA 1EUUA 2ARBA 2RDQA 2ZJCA 3ZXJA 2GC2A 2FDHA 4MG2A 1BVP1 5JI7A 1ND2C 3O12A 4CP9A 4YM3A 1RUOA 5LK5A 1OUSA 2A1XA 2XXZA 2GNBA 4D7SA 1VBC3 1YIPA 3JU9A 5D8AC 5F2SA 4N8MA 2DCKA 3N3HA 2Q8OA 4D94A 2DVDA 4AQSA 2VNVA 1ENQA 2IWGB 4TZDA 3O0VA 1LJ7A 5AVAA 1X33A 3RVHA 4KMQA 3WG1A 4XACA 3IWZA 4CE8A 1UQXA 3WW2A 2V09A 4E4ZA 5DAQA 5C8CC 4MGZE 4PF5A 4YG0A 1Q8VA 2BGPA 2R49A 1RUI3 2DU0A 3FBYA 5FYUA 1Y9GA 2ZGKA 3P1IA 4IV1A 3T2PA 4XC9A 4CVUA 4RS5B 3POEA 5EQUA 1FXZA 2ID4A 3NAPC 2BEOA 1US2A 2WO1A 3LDKA 4FPGA 2ZGOA 1JUHA 2E7AA 3G6JB 4UBHA 5T5OA 4OHXA 2JICA 5FBZA 1F31A 4AI0A 3A0KA 1QJY2 1Z7S1 3PJYA 3POWA 3SKVA 3OBRA 1NCQB 3WNNA 4BXSV 5FOJB 1SACA 4B4RA 4AOCA 5A3OA 3PURA 2YPJA 3POIA 5FP7A 2WA3A 2P6HA 3AK0A 3ETPA 5FMOS 4CA9A 1QXJA 4RQPC 1K3IA 1YFUA 2W1UA 2OS2A 4PLNA 5C3PA 3IN9A 2UURA 3K2OA 4QKFA 4W6XA 4CCKA 1EV11 2VW0A 2JJ6A 1HRI2 1LR5A 4TN7A 3OSDA 1OC1A 4QKBA 3WT3A 4O9GA 3WNLA 2GN3A 3AZYA 2C6SA 5FOBB 4P5YA 3VZOA 1S0IA 1RINA 3GCXA 3HIFA 4AHZA 3JBG3 5H9SA 1HIXA 4NIGA 4I01A 4GB33 1AR81 1F2NA 4RGAA 1BMV2 1QJX3 5DUVA 4IEQA 1AR61 4YVSA 5FLJA 2VG9A 1UXZA 5FZLA 5LA2A 4QXCA 1R092 4WVZA 4LJHA 3WHUA 4QQOA 3NRUA 4ZU5A 3T2TA 5DDJ2 4MV2A 3H1WA 1J1LA 2XJSA 1WMFA 2EVXA 4FTBA 4MYEA 3HT2A 1LCLA 2LUWA 2OXBA 4A6SA 3AMPA 1LU1A 4JKMA 5DUWA 1COV2 4DEVA 1DHKB 1FNZA 4MHRA 1RUI1 3LIGA 1W05A 4NIHA 1UD1A 2R32A 1OLME 2AEZA 2R6QA 3GGLA 3MF9A 3N9NA 4E2GA 4Z1VA 3LA3A 1W6QB 1ULOA 4NR1A 3ITQA 1CESA 1RUG2 4JV4A 4AQTA 1MEC3 4M3CA 1SFYA 2WT2A 3RNSA 4QXBA 3WX5A 2VZPA 2ZCWA 3H42B 3O1PA 2QQJA 5FKCA 3VD4A 3IMMA 1YXWA 1UOJA 2YY1A 2V5DA 3KCXA 4M0NA 3VZMA 4DY3A 5FMBA 1QH7A 4Q29A 3I2DA 3ZYHA 4D7YA 5L73A 1I5ZA 2YZ4A 1QXPA 4E27A 4MGSA 2Y60A 4J25A 2BRTA 2PHRA 2ES3A 4QX0A 1SLIA 5DUUA 5IW0A 2DTWA 5FZKA 4RYDA 5FZOA 4UFLA 1OI6A 3BODA 5A6ZA 4CPBA 3ENRA 1TME1 4A3XA 2C4XA 2A7AA 4GH4C 5DAWA 3BN6A 4P08A 3ZYGA 2TUNA 4CDQA 4CZSA 5K0UC 1OT5A 3ALQA 3INAA 3RMYA 3JUUA 2WLQA 2VZVA 3CEWA 5CIRA 5A6XA 1UOFA 5FYSA 2GH8A 4AF9A 2TNFA 3AFGA 4CP9B 1G86A 4HT1T 2GAUA 1UMHA 4QPGC 2ZGUA 4LO6B 4UW3A 1UWWA 2CHHA 3Q8FA 2VZRA 4JC1A 2CNAA 5GZDA 3RI9A 5F5IA 4DXZA 5KHIA 1AYM2 2ADEA 3J26N 5G05L 1JZ2A 3FHQA 1SMVA 3BKZA 5BXXA 4NRPA 3SHRA 4W4ZA 2W5FA 1DYKA 1RHI1 3I3QA 5E16A 1H9PA 2WLPA 4LLOA 4NE9A 5F8PA 4E4HA 3DYMA 2DCZA 2WNUB 4R4XA 1HRV3 1VBE3 2BYVE 3FZ3A 4AI3A 1ENXA 2Q1FA 1H2MA 5A1FA 2MEV2 1LKNA 3ME2A 4IV1B 4RA0A 3S5QA 1KGYA 2X5IB 4KGQA 4WZFA 4FFGA 2ZHMA 3CO2A 3GCWA 2XHKA 1D4VB 3WDYA 1VMFA 3ZX7A 3I3MA 3MIFA 2HEVF 4YM0A 4LUMA 3I7DA 4NIDA 5FRAA 4K21A 3VBFC 1VIWB 3O7OA 1QXRA 1ODNA 2WAOA 3CJXA 1NCRB 4CDWC 1X7NA 3ZXLA 1ST8A 3CQOA 1CZTA 2PN5A 1AYN2 1BEV3 3DEMA 4XJUA 3BI3A 4K3UA 2PAKA 4XTPA 1YUDA 3SH4A 3LSEA 1VRH3 1DGWX 5GLUA 1REFA 1V6LA 1VRH1 2RS51 1R082 4PF1A 4MADA 4AE2A 1UKGA 2UWCA 3LEIA 4FPLA 4E9KA 2C9KA 3HQXA 4HK9A 2K0GA 1DQ0A 4Z07A 3WCSA 2X29A 3J8F1 1X8EA 1XYPA 2WQ4A 5J48A 1ULCA 4P9LA 3I2IA 1CAUA 2P5BA 2AYHA 1QQP1 4B1LA 4IE6A 2HWE2 1CX4A 2J1VA 2DCTA 1XYOA 1EAH1 2WAAA 3ACFA 5A7PA 1LRHA 5ACA1 1AR83 4BQXA 1RVF1 2JD9A 1NX9A 5L7OB 1KFXL 2D40A 4NPLA 1OLQA 5IWFA 5F3CA 2QNKA 5HV4A 2VQUA 4CCMA 3IPVA 4L97A 3LGRA 1AXZA 2HJIA 1LECA 3THDA 1O5UA 2WUHA 2E32A 1QOSA 3ACLA 3O0XA 1MS9A 4FPJA 3TAYA 2YBKA 5ANNA 3VBRA 5JZGC 4ZXEA 4LR4A 3TEXA 1AZDA 5EZWA 3RZZA 1GZWA 5CADA 1ASJ3 4D3WA 2W0XA 5FYMA 4A45A 4DRRA 4I0BA 2Q1MA 4M0HA 2VTXJ 1FAYA 4QKNA 5GZCA 3ST7A 5B4XA 3ZFEC 5K7PA 1DG6A 3D6EA 4N43B 5EFUA 3WF0A 3RZLA 2W08A 3FN9A 3WP5A 1DYPA 1VB4A 4LO8A 3ZXDA 5I8YA 1XNKA 1XU2A 3FFZA 3ZO0B 1SPPA 4ZS2A 4OHWA 1T6BX 2CYFA 2GMEA 4BQ5A 4GMP1 3ZYRA 2HWF1 3AP6A 2W87A 3OBTA 5GALA 1ULGA 4CDXC 4OVEA 1IS6A 3VBSC 3GHMA 2O14A 4YZ3A 2HBUA 3O1VA 5HPOA 2BNNA 3LA2A 2ZKNA 3LKJA 4YM2A 4EZHA 2DURA 4QU1A 3VDCA 3MW2A 3W58A 1RUJ1 4YPJA 1Q8OA 5FMOL 3ZFFC 1O6UA 1YYNA 5FZOB 2VVDA 4UFKA 1H8TA 3PUQA 4AHXA 2VMFA 4AW7A 3BALA 1O91A 5G04L 1MEC1 2OYZA 3PU8A 4S2FA 3K4ZA 2R062 3I3BA 5T50A 3AZWA 3MZHA 2Z2SB 4LO4B 4XHBA 2XG3A 4YGCA 1WD4A 4YLZA 2BNMA 1OBNA 4MXWA 1Y4WA 4PDWB 2DVBA 1RUD1 4XCBA 1FT9A 3VBHB 4IE7A 4R8HA 1F4HA 1YI9A 1GQPA 4LKDA 5FY4A 5GKAC 3UV9A 3O1UA 4CXWA 1LEMA 4N90A 5K4LA 1TNRA 3ECQA 4XFGA 4BWOA 4LIVA 1FOD2 5I8SA 2A3YA 1PO13 5LWBA 1OKQA 1NA1A 3ZYJB 3M2MA 3HNYM 5APAA 1LNSA 2YC4A 4CXXA 1UIKA 2XLAA 3ZSEA 1UAIA 5FBJA 1PZ8A 3IIIA 3DKQA 1CJPA 1XNDA 3N7LA 5FP3A 3MLLA 3IZOA 3H3LA 1K5JA 4LHLA 3TEYA 1XYNA 2JG8B 1K45A 3LB9A 1EY2A 4L8QA 2X10A 2ZACA 3NNLA 1GU3A 5A7NA 3WP6A 4FTEA 3FL7A 4CDWB 1D4M1 4YZ5A 1AF9A 5EIYB 4IEUA 5IT6A 5IHRA 1GMMA 3U75A 1V6JA 1ZBA2 4N7UA 1NKGA 1NCRA 2FCVA 1BBT2 5DABA 4L0PA 5BNNA 4Q4W1 1XQNA 2AR6A 4YW7A 1GWLA 2SLIA 4MGQA 5SV8A 1X9TA 3RGBA 1W8WA 2B46X 4QX3A 4YW5A 4BE3A 4MVTA 4XUQA 1QQP2 1PK6A 2YFZA 4FOQA 1SLLA 4P9WA 5FXXA 3NKTA 1W6MB 2YC0A 1NAEA 1QDCA 3AYAA 5FTTC 5I0DA 1NLQA 1PVC1 3E5XA 3GJAA 4DINB 4XFIA 1GWKA 2DVGA 2QZ2A 2TBVA 3CKHA 4L2NA 4XFBA 2VOWA 1QF3A 2Z5WA 1G6NA 3A7QA 3WF3A 4Z2WA 1OSGA 2GN7A 2QKDA 2PHLA 2J22A 1H6YA 3ZXGA 1H1AA 3EBRA 3SITA 2BBVA 4CXYA 4GKYA 4QX5A 2FMYA 1FMD2 2I2SA 2YYOA 4META 5LBEA 5AFEA 2GNMA 3ZFGB 3BPSA 2JE8A 3I2OA 4XTMA 4IUGA 4X8PA 2WQZC 2WNUC 4AQ2A 1OPOA 2BP6A 2NM1A 5L7OA 1Q56A 1VPHA 4WBBA 1RYYA 1CWPA 3WD5A 5LA0A 1C8M3 3DPRC 3E6CC 2X5IC 3R4SA 3IPVB 5FAXA 3OGRA 2WQ8A 3QACA 1O5LA 2BV4A 3RYKA 1CD3G 2P6CA 3R0RA 2J1SA 2HBTA 4PBOA 5C4WC 3KS7A 3I3EA 1YQ8A 4KQ7A 2GNTA 5HXMA 4YW2A 4G3YC 3AZXA 3PUSA 5F2WA 4YWAA 1BXHA 1ND3A 2W3JA 5C6CA 5H9RA 5FREA 1LOFA 1OA2A 1OUXA 3GZTB 2JG9A 3SC7X 2D6NA 3VBUC 1UX6A 2BQPA 2BU9A 1ULDA 2NN8A 4YGBA 1JOBA 1ZA7A 4QX7A 1VR3A 1BHGA 3KF5A 4IL7A 1SPPB 3AVSA 4Q4X1 1GUIA 4QHZA 4QPYA 4M3CF 4YG6A 5BNPA 3OBAA 4WVVA 5GLTA 1NLRA 1EYBA 2WT0A 1I9RA 4RGGA 4AAXA 2ZHKA 5JSRA 5JMOA 2EICA 4FAHA 1H0BA 2IUWA 4BYYA 5ISLA 3LCPA 2XL7A 2Q8EA 5A6YA 1ZRFA 1TME2 1PNFA 4KWUA 2W47A 2MPFA 2P3YA 2QDNA 2CV6A 2F6BA 2WO7A 3WVJA 1H8TB 1JOPA 2KXLA 4HSLA 1RUD2 4KWLA 4AYUA 2KM2A 4QB6A 2ZEYA 4LOSA 3VBHC 1WW6A 3VUOA 3V64A 2VZUA 2UWAA 1UMIA 4K7JA 2CDOA 2EAKA 3IB3A 3D5OA 3OGGA 3PVNA 3Q8EA 1RUG1 2VE1A 4KU7A 1XOYA 4I02A 4Q4X2 4Y33A 2B4KA 3VHRA 5BUVA 5IJRA 2B7YA 1UYZA 2P34A 1JODA 5GJ6A 3N4MA 2DCJA 2E26A 4NIAA 2HYKA 3KMHA 1Y9QA 2FZ1A 5CBLA 5F9TA 1RMU2 4BMBA 2DV9A 4YGDA 3MF6A 4UW4A 5I0TA 2VTFA 5T5PA 1HV1A 5HBAA 5KR7A 4WM7B 5IUQA 4LLFA 3RWKX 5FXZA 1OVSA 1GLHA 3POGA 4AR2A 3CJIB 4PQQA 5FP4A 1VBC2 1DLCA 3USUA 3WQ7A 1S55A 4G4FA 2DVFA 4R9CA 1GNYA 4E4DX 5KXBA 2J1UA 4IETA 2VCMA 4QGMA 2ZGLA 4CDXB 4UF0B 2ZX4A 2K46A 2YBSA 3C7EA 3ROUA 2HWE1 1WBLA 1MZ6A 3DKWA 1AR92 3ZMNA 4Q4V3 5F1RA 4XCAA 2BWCA 1XNCA 3P3PA 4G9SB 3U10A 1KEXA 1J3QA 1LOGA 5HV0A 2ZABA 3W21A 1LTEA 3LF7A 1AR62 1RUC1 3VDDA 1R091 1AR72 2QCSB 2DVAA 1L7RA 1RMU1 3M3OA 1VJ2A 2VVFA 1CAVA 3EB7A 4GWMA 4HONA 4IV3C 4LIUA 2XB6C 4Q1RA 5FR3A 2GU9A 1MR5A 5FKBA 5AC92 3L2HA 4IEZA 2XJTA 3OTFA 4EZ4A 4QXKA 2JXAA 3CMGA 1GZCA 1VAVA 4A42A 4QX2A 3OUIA 1I1EA 4YM1A 4OFGA 4OLLA 5DN2A 4PLOA 3J8F3 5FPAA 3U4XA 3C7OA 3OEBA 2WFF3 1DQ1A 4S2DA 5I0SA 3RWNA 1FYUA 2UWBA 2V4AA 2C0ZA 3SKJE 3T2QA 5JXIA 4CCCA 1CAUB 2OPWA 3KHCA 3VZLA 5A3TA 2DWRA 2KR2A 5FZCA 3PHMA 5EYXA 1ZZ7A 2GMPA 3TN92 4F83A 2XLGA 5LBCA 4Q4Y2 2V5YA 4XF3A 2RVAA 4EV0A 3FX3A 2XJVA 2BJSA 3U1XA 1CAWA 2WZR2 3WQBA 5T5LA 4Q4V1 5JZGB 3O1RA 4Q2FA 4LT5A 3A23A 1W6PB 3U14A 2ZGNA 4I3GA 3UL2A 2P3KA 2VMCA 3SXWA 3AKQA 2P3JA 1F5JA 1BYHA 5C8WA 2WO3A 4JKLA 4HPKB 1U12A 1W9WA 4IESA 3KVAA 4XFFA 3FUQA 1IG0A 1S1AA 4HVOA 1W0OA 3SQOA 1YQ2A 4CU7A 5C3SA 1RUH3 4PCRA 2ETEA 2XWBB 4LHSA 5GM0A 1U5XA 1ZBE1 1H4GA 1PMJX 3W9AA 1QDOA 3OGVA 2LRPA 4P9JA 3C2UA 2GC1A 3K3NA 1FNYA 2QQKA 2RDRA 4YVSC 1PGL2 4YW6A 3AXEA 5DG1A 4Q0QA 4NO4A 3I2KA 4ZZ8A 3ZPOA 1XE7A 2EIDA 1H1MA 4AEMA 4Z92B 2FQPA 4PIXA 1IHMA 3RPQA 2A6YA 4QDSA 3URFA 3THPA 3VBUB 2ZKLA 1FX5A 1ONAA 1LODA 2IVIB 3I3DA 5C4WA 3RSJA 4CP2A 1MEC2 3OUJA 1C1LA 2RDNA 3O1OA 2J1RA 1MQTA 4TLFA 1G9DA 4COYA 5T52A 1WGPA 4C91A 4FPKA 5A7WB 1KDMA 1UW8A 4R52A 4RHV2 3CBNA 4YW4A 5FY1A 4YZ1A 1ENSA 3GNEA 4BH9A 1W9YA 4IGOA 1SFNA 3RJ2X 3PMSA 4Q1PA 1XPWA 4BLJA 4N43C 3S7EA 2VNRA 4S2GA 4QPWA 4CRQA 5IVYA 1PGW1 2QZ3A 3I2HA 5A3UA 4AFBA 3GDBA 3CHXA 3HQUA 3CNAA 2RM22 3F2ZA 1JZ6A 2FHRA 1Z78A 3N7KA 3EQEA 5EHDA 4FI9A 1GP4A 1SLTA 4Q4W2 4PDWA 1COV1 1KQRA 1NOVA 4BJ0A 1HB2A 2HWD1 3MW4A 5FYYA 1LENA 2HWD3 3GZEA 3EYPA 4IE4A 3IMNA 2I74A 2WBKA 2R043 1QMJA 2ZMLA 3VLBB 4DFSA 5LY1A 2X8KA 3T30A 1VBA3 1SLAA 5JPNB 5FK7A 3AFKA 2IXHA 3E6BA 3H7YA 4RL7A 3T0AA 2DTYA 2VGDA 5FYBA 5KBFA 3BU0A 2D5FA 4DUVA 5A3PA 3LSDA 4BIFA 3L2YA 3GHNA 5DZGA 4DNYA 3GBWA 5A70A 2WN2A 5EP9A 2FCUA 4NAMA 5FZBA 1J83A 1NE6A 1JYCA 1LESA 3KD4A 3BOPA 4Q0PA 1I3HA 1JW6A 2A75A 4BMEA 2PHTA 4TTGA 2NLRA 3T08A 2JG8A 3BOWA 2ARXA 3DYOA 5J36A 3MUY1 4LUKA 5AC91 2XUEA 3VBSB 2MEV3 1EAH2 3HN1A 3M8LA 3UK9A 2GMMA 1UNBA 5CG8A 4QQ2A 3TN91 3AC0A 4GWJA 4MSVA 3KV9A 1NT0A 2JEMA 2VOXA 1FPN3 4XMAA 3KVBA 1U5IA 3NMBA 5FZIA 4CDUB 1F15A 4QU2A 5FZ9A 3H8XA 2RHPA 4Q0SA 2ZHLA 1QJX1 2QJVA 4UW6A 3N7JA 3DYPA 2WS93 2BDRA 2YC2A 1W3XA 1GP6A 1OA3A 2PLV2 1OH3A 1RUF1 4PIZA 2FDFA 1KXGA 1POV3 5LY2A 4W6YA 2JDKA 2WINB 5HCBA 3SCFA 1DQ2A 4S2HA 1AYN3 1BEV2 2PAMA 4BQWA 4CYDA 3O1SA 4DXSA 1L7LA 1SLBA 4LHKA 1WCDJ 1Z7S3 3DECA 5JSPA 1KJLA 4JHTA 4CCNA 4IEXA 1POV0 1S2KA 2E31A 4JDNA 1V6KA 2NZ9A 1PIV3 2CGNA 1MZFA 3RI8A 3VZNA 4BU2A 4COWA 1S0EA 3A22A 1CPMA 4JGZB 5DAXA 5CU1A 2VCAA 3M3CA 3X29B 2JE7A 3JQXA 2GP3A 2IC1A 1DQ6A 3AP5A 5FPZA 1DP0A 2XUMA 2Y6HA 4LBQB 4XQWA 3I2FA 2ZEZA 2JKBA 3RYRA 3PNAA 3AYCA 1X36A 4XAAA 2RMU1 3JD72 5JXGA 3ZPYA 4OMDA 1GOFA 3WSOA 1S0JA 2XH6A 3MO4A 4YVWC 3K75B 1ND3B 5KXDA 2XWJB 1AL23 3MLKA 4H7LA 5FPBA 3WP3A 3VHOA 2Y26A 1ASJ2 4FSJA 1RUE2 2UY8A 1JH5A 3HN3A 3QD6A 4AI2A 5CFDB 5CKQA 4CEYC 1O4ZA 5C3OA 1HW5A 1OLRA 5T54A 4HFSA 3BTAA 2PFWA 2FCTA 5A3NA 3VGIA 2VUCA 1YHFA 2WC2A 4B3NA 4C90A 4R4ZA 3GBGA 3KSCA 2FBEA 4QPIC 3EXUA 1AHSA 3PUHA 5FZMA 5FPXA 1HLCA 2AC1A 3SCHA 4HKLA 2LW8A 5A80A 2E7QA 3BTXA 1PGW2 1C1FA 3U78A 1FATA 1QJEA 2JX9A 1QNYA 4ZU4A 2YBPA 3LE0A 1LGNA 3HNMA 1RUJ3 3H3UA 1ZRRA 5GLZA 4DB5A 4H3WA 3OCPA 1VRBA 1HQNA 4WVMA 5BNQA 4UW5A 5F37A 5IATA 5D1IA 2W52A 2C1FA 3NW4A 1RHI3 3Q8CA 3J7MA 1PNGA 4GXLA 1RUE1 4B1MA 4DUWA 1W8TA 2BBAA 1Y3TA 3DXUA 4QD2A 3NQHA 3BIEA 3ETQA 3KT4A 4IEPA 1AR71 4CU8A 4XF1A 3I59B 2BFUS 2R063 3I4IA 3K4AA 1D2SA 2JDNA 4B29A 1ZZBA 3ILFA 1S0FA 3NVCA 2N7GA 4OI0A 2F4PA 4QKDA 4LHNA 2VW1A 5EJ3A 1DU3D 1WMEA 2CGOA 3WNPA 3ILRA 4D7TA 4XJ8A 3LA7A 5CG9A 1HXS1 1N3PA 1SBEA 5J3UA 4ZXKA 3JQWA 1D7PM 4J1WA 1A34A 4YVSB 2O8OA 4N53A 4R9BA 5A7QA 1Q43A 1S0CA 4XDQA 4ASKA 4DY5A 2ORXA 2QBXA 2RV9A 5ERLA 2WSVA 3AMQA 4OZOA 4XURA 4C8DA 1QEXA 4YFZA 2IFRA 5FZ8A 3BTZA 1QJFA 1JYVA 2ZGSA 1K5MC 5BNOA 4LK7A 5B2GB 1WA6X 2JB8A 1RUF2 2O1QA 5D21A 4QQHA 1HJFA 2JE9A 4BPZA 4QPGA 3EHKA 2Z79A 4QX8A 4ZZ5A 2FZ2A 1O8SA 2GALA 5JIUA 1JUIA 2EA7A 2G4IA 1TMF2 4L9BA 4QGNA 2VBBA 3O14A 5EYYA 4Y1VA 3RRDA 4EE2A 5C9AC 1O4YA 2LALA 3KGZA 1HRI1 1RVF3 1ZBA3 2XQRA 2CWMA 1J1TA 3AYEA 1BBT3 3VB9A 1W6QA 3U11A 2ERFA 2JECA 1V9U1 2AUYA 1LHUA 2MHFA 3WUDA 5C3RA 1MVQA 4AEJA 2J7MA 4I09A 5L9VA 4AGRA 2CTVA 3BUCA 1YQ5A 5A3LA 5FZ3A 1PMHX 2RS53 3CZJA 1YLLA 3V0BA 5C3QA 3P6BA 5IVCA 4CUAA 3FBMA 5JI9A 2RMU2 3JD71 2WNEA 2RS33 2VMIA 4GWIA 4HL0A 4NHYA 5F5AA 4XBNA 5EPAA 1V70A 3QH7A 2OZ6A 2ZGTA 1V6MA 4TLGA 5CNAA 4Y1YA 3LOBA 2HWC2 1W6PA 1XNTA 3N35A 4Y5TA 4GD4A 4BDVB 1KITA 1NZIA 2VVEA 4QDQA 3MV11 4W8JA 1LOEA 1URXA 1VBD2 2NQYA 4LKFA 1VB2A 2OUHA 1J3RA 4K6BA 1PVC2 3PTYA 4KNCA 4UFIA 2VPVA 4BHPA 4AL9A 3D4KA 2VCCA 3WNOA 1GWMA 4AVSA 1P8JA 1IPKA 2D6OX 3UKVA 4RGKA 1G8WA 3PDQA 3ZYFA 4K8RB 2VQAA 2WZEA 4GZ9A 5GZFA 1KD7A 2OUJA 1OD3A 3FUOA 1BVVA 4XUPA 3O1MA 1ND2A 4L99A 4Z8BA 4CPBD 5JUVA 1IQAA 5IK4A 4LBJA 3AKPA 4K8FA 4YSFA 1PM4A 2X5IA 1OQDA 1QWRA 1YQCA 2JWPA 3SNMA 2GP5A 3NNFA 1CQ9A 4EYUA 2WT1A 1XU1A 5IYYA 4LE4A 4M00A 2A3XA 3TNQA 1W3VA 1H6XA 1WCKA 4FQ4A 5A7WA 3V0AA 2GNDA 2MEV1 1ZYBA 4HN0A 3APBA 3UKNA 1TME3 4CU9A 3VBOC 2AGSA 4RD7A 4Y5SA 2Q8CA 2EAAA 4OYUA 1A78A 2PELA 1PO23 3KLSA 4E8CA 1DFQA 1V6OA 1RUD3 3KWVA 4RR3B 1SBFA 2R1DA 1RUC2 2A6WA 1HXS2 2JB4A 4JAAA 4LO5B 4FBFA 5BNNC 3LEGA 1UXXX 5FLHA 3OGJA 2PYTA 1AL0G 1UYYA 3SISA 3E97A 2PTMA 3EO6A 4GMP0 1GV9A 3ACGA 1VBB1 3NJVA 3OB8A 1W9SA 5JOZA 4I0WB 2VZ3A 5JPMB 3JZVA 5EWSA 3VD3A 5F5CA 4B4PA 3B93A 1W2TA 4LPLA 4H7MA 3AKTA 2PHXA 5CKNA 3ZSLA 2G9FA 4FT8A 4CUGA 5I93A 2J1EA 1ZRCA 1IKPA 4XHXA 4XFHA 2NYYA 2PHFA 4PIYA 1UY3A 1UPSA 1LGCA 2ZX0A 1WLTA 3ZLIA 1SDWA 3Q8BA 4NIIA 4AZZA 2IFWA 4Y22B 3BTYA 2B8MA 3H7JA 4ZS3A 4AHYA 5FO7B 4GMP3 3ZFEA 4XBQA 2Q5TA 2Y0IA 4ASMB 1SHWB 5JMCA 1QOTA 3W5NA 4CP0A 1OKOA 3FWEA 4D6SA 4WVWA 3DCQA 4NPMA 4Q4V2 2P2KA 3TOJA 1NA1C 3DGTA 5BY5A 3DF0A 2VMGA 5H9PA 1OFSA 4JGYB 2VULA 4AEKA 1BMV1 3T0BA 1RJ8A 1EUTA 4H55A 1M06G 4UOJA 4M4RA 5C8CA 1DGWA 3ZR6A 3MDPA 4P02B 2ILMA 4Y1UA 4A4AA 1WLWA 4IEWA 3NSTA 4BQYA 4XXAA 5IVBA 1ZBE2 3OOXA 5FY7A 1OPMA 1WW4A 2YG0A 4JGZC 2WJSA 5FLIA 5CFCA 2VZTA 2BUKA 4UFJA 2WS91 4OHYA 2QQLA 3RFRA 1LHNA 5ABJB 1FV2A 1SCSA 4XZUG 4Y1ZA 5DZEA 5KXCA 1UZZA 4NROA 1C4RA 3OGSA 1LOBA 2VUAA 1X8MA 3IM0A 3ZN5A 2WSUA 5H9QA 5C71A 2VCBA 5E88A 3ZSKA 3A21A 4GALA 3WDWA 3LEMA 3J9SA 1L3JA 2WZR3 4DMIA 5A32A 1ULFA 1B35C 3EMRA 1IKQA 3POFA 4ZHNA 2PHDA 1OFNA 2RS13 3LAGA 3VBHA 5CFDA 5J7MA 1W9TA 2DCYA 2WYSA 2VBPA 4YZ2A 5JXHA 4I2OA 3VD5A 3DV8A 4ES8A 2Y64A 5KHKA 4OMCA 1PZ7A 2JDAA 4Y5Z0 1MZ5A 3D3AA 3WW3A 5KC6A 5FO8B 1RUH2 4GIQA 2D6PA 1HRV1 1VBE1 4KL1A 3MHZA 4FFFA 1F9KA 2EXHA 1JZ3A 3ACIA 2XLFA 4FVVA 4GAZA 4CEWC 4Y4YA 4AGGA 4HLTA 3AL6A 4A41A 2VZSA 3U4SA 1NCRC 1BQPA 2VU9A 4XDOA 3WR0A 1GOHA 1YFXA 1J58A 1YI7A 2VOTA 3SLIA 2D93A 1UZVA 2IXLA 1POV1 2R073 4FFIA 1OOPB 5CVRA 5HCAA 2Y6GA 1WWYA 4BLIA 3JBG2 1IS5A 2CSGA 3MLJA 4GB32 3NV1A 2ET1A 1OQ1A 4AXOA 3I8TA 4QQLA 3OD4A 4QB1A 1IG3A 4RR3C 2H0VA 3I2JA 2RJ2A 3WCRA 5EJ1B 1TE1B 1JXNA 2DBIA 4RS5C 4WVMB 1HV0A 3O0WA 3ZSJA 2P1BA 3J7HA 2DU1A 5DDJ3 4Y20A 5BNPC 3KHBA 4CUCA 1FOD1 4C1XA 2WN3A 4A44A 3I97A 4WM8C 3WUCA 4X8NA 2OKXA 1QJZA 2VZQA 2VO5A 3LQCA 4OI2A 5FWEA 4URAA 1RUI2 2P17A 1HN1A 4K40A 2AACA 4JKKA 4HOOA 5E6HA 4IXLA 3T2OA 2FD8A 1SBDA 2BW8A 2BERA 3WDVA 1NQDA 1H30A 3Q8AA 2PHUA 4Q26A 2R042 5JVVA 3WNMA 1RUG3 1VBA2 2XBO2 4UYBA 2TEPA 4F8AA 3WINE 2W46A 2W9XA 1QJY3 1ZRIA 3WLUA 1GQGA 2QQIA 4RSUA 2G9GA 4BOWA 2OPKA 4D6RA 5CAZA 2EIBA 1I5PA 4V2VA 1G7YA 3FJSA 5FZ1A 4RFRB 1DYOA 4MGKE 1JN2P 2F17A 2XVKA 3A0NA 2H6CA 4FTSA 4NJ4A 4FPOB 3FLTA 2BOJA 2FMDA 4HK8A 1EAH3 3K77A 4K20A 2BOIA 2K9ZA 2VXRA 1LU2A 2JG9B 5EV7A 3F95A 3UGFA 4D6QA 2WWUA 4XMIA 1RGSA 3C7FA 3VBRC 3WG3A 1LEDA 2YDEA 3B69A 4BK5A 3UNPA 4GA9A 3W5MA 4HMZA 2PQSA 2WS92 2Z4FA 4LA3A 4XEZA 4LITA 3PVOA 5TSWA 1DGLA 2GZWA 1D0GA 1NZCA 2WZR1 2Y34A 5KC5A 3ELNA 2W1WA 3MICA 1YCIA 1W2NA 1GZTA 4U36A 1Z0HA 1JYIA 1KDKA 5CFCB 2RS11 3AL5A 1UU4A 1K12A 3T1LA 3A4UA 3R4UA 3THTA 2HWC1 2NMOA 5ABJA 5E1RA 3H9AA 2HEYF 4XDPA 1VBD1 2VMDA 1HRV2 1VBE2 1EPZA 3AJYA 3HPNA 4KWKA 1PIV2 3T4VA 4FXGB 3WZ1A 1E5SA 4Q8LA 5FY8A 4AI8A 3CZUA 5LK7B 1PHMA 1AXKA 2ZBJA 3MFAA 5F6LB 4FQZA 2VMEA 5FJKA 1AR91 1V9U2 1J3PA 2HEWF 2YB7A 3JBG1 4TXWA 2O0OA 3DL3A 5IAVA 3ZXFA 2ZAHA 4NMIA 2RR13 4OCTA 1GR3A 4I3PA 4XETA 3VHPA 4MXWB 4IGPA 1GBGA 4LMFA 5LRSA 4QM9A 2V4VA 3BGAA 4BISA 1DZQA 3JD73 3BB6A 3ZYBA 1L7QA 1D4M3 3HEIA 3IAQA 4O61A 4XIOA 2VBDA 1GOGA 5ANQA 1O7FA 1R083 1MS0A 3CJIA 2W92A 4ISRA 4JRLA 3KV5A 3UJQA 4MZUA 4AI1A 2B42B 2GSYA 1YRZA 1WKYA 2VTXA 3NAPB 1ND2B 1GKBA 4AGVA 1J84A 1TEIA 2G9ZA 3FLPA 3NJZA 2Z42A 4OHVA 4ZONA 2W39A 2ZX1A 4IV3A 3VBFA 1XBFA 4V1PA 3GZUC 1XNAA 1UOBA 1VBC1 4DRVA 2YPDA 4LXLA 3BU7A 3BPZA 5KHGA 3KV4A 3ZXKA 2XJQA 4LK6A 5BV6A 1AR82 4QWNA 5DMYA 3WG2A 1VBA1 3V0AB 5FYIA 1XSRA 4BQ4A 2XGXA 1SLCA 2D5HA 1BCXA 2DFCA 3T0DA 3AMMA 5BNNB 4XJ9A 2A71A 4LTAA 4NN0A 4YGEA 5FP9A 2JDUA 1YWKA 4Y20B 3W59A 4DQAA 5K0UA 2XKPA 2Y6FA 2BGOA 3ZN6B 1PMIA 3RG0A 1KRIA 4CCLA 3WOGA 1RHI2 1W6MA 3AKSA 3RJRA 5GZGA 2MNGA 1W8ZA 3JB4C 2V73A 5HXVA 3J7LA 4XF9A 3RDIA 4LQRA 1UCXA 1X9PA 1SDDB 2DUQA 5FZ7A 1GNHA 1W2OA 1W99A 3LPFA 3H1MA 5LW9A 1RTVA 1VE0A 2ZA9A 3MGUA 1IPSA 3WW1A 2AREA 3ZFGA 4DS0A 2JENA 3NV3A 2J42A 4GKXA 1I6XA 4ORFA 5JR2A 1JYXA 3GF6A 2DUPA 4XUNA 5JOXA 3WQ0A 4BIOA 2CAUA 3MPBA 3ABZA 1TVGA 2Q0AA 4PQ9A 2R16A 4AFAA 2CAVA 3WP4A 2EIEA 5FYZA 4ARYA 2YU1A 3GM8A 1VRH2 5FPLA 3ZFEB 5K8SA 3AJZA 4KI5M 4DUXA 1X82A 2Q30A 4N7IA 1CZVA 1LB2A 4HBNA 1GYKA 1O3TA 1Q8QA 2ZGQA 2C26A 2LM3A 2IXCA 3R4DB 4J1XA 1YNAA 4AI9A 4XW3A 5CZKA 3VKLA 4CUBA 5IK8A 5J37A 2OQ7A 2ZTNA 4H14A 4JHZA 5JXJA 1JZ4A 4PBPA 4LNVA 2RG4A 1CR7A 3ON7A 2ZX3A 1Y9MA 1W9FA 3DUIA 3JB8A 1K42A 4DZGA 5DUXA 5FZFA 1W2UA 1JYTA 4AQ6A 4M3CB 1RVF2 4NHKA 2H0BA 2JIJA 3RZJA 1ZREA 1E5RA 4CEYA 1AVBA 2K2SA 3CLPA 3VBUA 2CU5A 1PX3A 2E53A 2VAUA 1REEA 1BJQA 5ACA3 2ZMKA 2ZGPA 2QQUA 5BNOC 4OI1A 2VZOA 4IDZA 4JTOA 1S4CA 1UO9A 2VY0A 2W91A 3D82A 4W50A 3TWIA 3AX4A 1S0BA 2G19A 4O7XA 4FAGA 4HVRA 3OPWA 2UY9A 2EF6A 5JCTA 3PIGA 3S57A 4MO3M 4HKOA 2D6LX 4Q8KA 1B35B 4URTA 1WMDA 2A3WA 3CDZB 3NV2A 5F7UA 1MZEA 4Z2AA 3MIEA 2IXKA 2RMU3 4MGIE 4MGTA 4D8MA 2QE3A 1W8NA 2DYCA 3OBZA 4DOUA 4BA6A 1MS8A 5A32B 5T5JA 2WDBA 1S2BA 2XJPA 4M4PA 4AVTA 3ZN4A 4LULA 5L36A 4M3CE 5I8TA 2HWC3 3WF2A 4LE3A 2WZ8A 3H0OA 1BBT1 3QOPA 1JHJA 1E5IA 1W6NB 2PAEA 1HB1A 1W06A 4IEVA 3UT0A 3OF1A 5KHHA 2O8QA 4XVHA 4XOGA 3E5UA 3KQ4B 2WR9A 4XUTA 2AENA 3DXTA 1MS4A 5ABJC 4UAPA 5E89A 2JG8C 1D0HA 1PO11 4EN0A 5IFTA 2HLEA 2X09A 5JDBA 4XAEA 2WNUA 4C0HA 3IT8A 3M70A 1YIFA 4LBOA 2QQWA 1H8VA 1BK0A 1ZX5A 1SQ4A 4P9XA 4XFCA 1VMJA 4GJYA 2NMNA 2VL4A 2XVGA 3PJQA 4UFHA 3E5QA 4CDXA 3NJXA 1POQA 1AYN1 3GZAA 1VBB3 3K4DA 4F3JA 1ACCA 4OI4A 4OZXA 4DIQA 3VDDB 5FUNA 4JVAA 1R64A 1XSQA 4IV1C 4RFT0 2QVSB 3ZXEA 4XPVA 1N3OA 1U5ZA 1PO21 4KU8A 5LCWL 1NCQA 3RZGA 4C1WA 1DGRA 5L9BA 5FZAA 1FOD3 4NUBA 3ZMOA 1ZA4A 3ZN6A 1PO12 2FDGA 2XHNA 1CGPA 2WNVA 1GP5A 4KG0A 5C9AA 3WF1A 3POSA 5IVJA 4DXTA 1T6GC 1YJLA 1RIRA 2VNOA 2QTWB 3ACHA 3B94A 4YW1A 2VR4A 4FOWA 3HD8B 5CB7A 3N9MA 3PL0A 2ARCA 1DZRA 3AMNA 1WMXA 5LZ6A 5J96B 3TBDA 4H2AA 1WZXA 1V6IA 4XQDA 1CN1A 3FHIB 1AX0A 3ZDSA 4YARA 1AUYA 2C24A 5D8AA 5FP8A 4PLMA 1SFPA 2R071 1CZSA 3KF3A 2WYFA 3AKRA 4Q5OA 2JDHA 5C5UA 1OF3A 3TRSB 4PT6A 2E33A 3B9CA 4FPCA 1C3HA 2HWB2 2C9AA 5CKMA 4Z82A 3VBOA 1ZZ8A 2HWF2 3HBZA 1FI2A 4O65A 1TQ5A 1W8HA 2C5DA 3VD9A 3AMHA 2ZXQA 4YVWA 2J1AA 3S30A 4LBQA 3OJBA 1STMA 3AP9A 1ENRA 3N9PA 5F3IA 1JYNA 4WM8B 2XONA 1O59A 4KG8A 1OOPC 4L11A 3WEZA 1W39A 3ZKUA 2VQ0A 2QQMA 4CSWA 1IPJA 2NP0A 5F3GA 4YG3A 2QDRA 2UYAA 2D3SA 3Q9OA 2D44A 1DCSA 1N47A 2LTNA 2VOKA 3QLQA 3T09A 4Y3OA 3VL9A 4FP2A 2OW4A 4WV8A 4NPRA 4RN5A 3VZJA 4AFDA 3N9LA 5DPNA 4AEDC 3VZKA 1R1ZA 1CONA 1AL21 4E8DA 1HB4A 4FOVA 5FY5A 2YXSA 1OD5A 4QT6A 1DZTA 1UL9A 5A7OA 1W6OA 1FMD3 3GJBA 4QGLA 1RXFA 1QJU3 1WD3A 4K1ZA 2OZJA 2ZMNA 5FIXA 2DDUA 1DIWA 2FDJA 3RZHA 4OUEA 4KGGA 3I49A 1CPNA 1OA4A 5LATA 5LA1A 4JCKA 4P9YA 3LIHA 2WL1A 3ZIWA 3OD0A 3CIHA 4M01A 5KHJA 3VKOA 4LEJA 4CDUA 5LEJA 1C8M2 1PIV1 3HQRA 1G9CA 3ILNA 2JDMA 3H8UA 2YROA 3MIDA 5I91A 1H2LA 1MQTB 4NHLA 3USSA 4NWVA 1RB8G 1REDA 3AP4A 5L9RA 1ZBE3 2PXJA 4X6RB 1S2EA 4CCJA 4EN6B 4DXRA 2XJRA 3B01A 3B7MA 1LHVA 2XOMA 2BVVA 2Y6JA 3JXSA 1MQTC 4EROA 5FZHA 1EP0A 4I0AA 5DG2A 1AR93 3K46A 4CDQB 2WO2A 4BK4A 2XKOA 2XQXA 2WNOA 1QOOA 1AR63 1U5YA 1GZ9A 1DQ4A 2YUEA 3KCCA 4FPFA 1OF4A 3I59A 5JLVA 3N9QA 4QDRA 4JTNA 4SBVA 3LDRA 4AVVA 3TB0A 2J1TA 5JIAA 5FZGA 1SCRA 1XXNA 3AB0A 4CDQC 2RS12 3B3QE 3HAGA 5AC93 2Q1ZB 3V65A 3PTRB 2ET7A 1EV13 3ES1A 3MIGA 1NA1B 1XB9A 2PQQA 3C7GA 3QBQA 3M7AA 4I30A 4XJAA 1R1A2 1K5MA 2AEYA 2IVJA 2QFEA 3WV6A 4A6OA 4N53B 5EXOA 4JGYC 4NRMA 2ZPXA 3IDEA 3N36A 3VL8A 3J8F2 5GLVA 3VDAA 3NAPA 4XXPA 5IK5A 4AHWA 2GC0A 1BKZA 4LBKA 4V2WA 3NL1A 2IXIA 3NO8A 2YMZA 5FY0A 4INDA 4Y24A 1JZ5A 1N1YA 3IKWA 4IV3B 3VBFB 4ISQA 3WNKA 3ZYIB 2P4EA 2WWSA 3HBKA 5FXWA 5F6KA 3TN93 2CDPA 1GICA 2R041 4FPYA 1N1VA 2XJUA 2Y38A 3IDCB 1FMD1 3SH3A 3ZYPA 4QPGB 2A73B 3UJOA 2ZZQA 2R072 5F5QA 1QKQA 3ZFFB 5E8AA 1UX7A 3FHAA 1PM7A 5DXDA 3WDTA 1OURA 1RMU3 3T1MA 4FPHA 4XZPA 2JD4A 5GLWA 5K9YA 5HCHA 1UOGA 2ZOEB 4K1YA 5L19A 2V72A 4GH4B 5JSOA 2FDKA 5K0UB 2D7FA 3VDBA 2WNVB 4BM8A 4YYOA 1WLCA 3PVBB 1WBFA 4XFAA 4Y1XA 5C70A 5JR7B 4BXFA 3RQ0A 4FXKB 3WW4A 5IVEA 4OQ8A 3KT7A 2AZ5A 4B4QA 5J09A 4JDOA 1G9BA 3LWCA 3NJYA 4UT5A 1DDLA 1O3QA 2Y6KA 2OA2A 3POJA 1KS4A 2YGLA 2E9QA 2VOVA 1F8VA 4FCAA 4MHUA 1IGOA 1G9AA 1HN0A 2A6ZA 3NNMA 1C8NA 3V0BB 3KV6A 4L92A 5F3EA 3MW3A 4ITCA 2ZS6B 3D0JA 2Y8KA 4JGZA 3VBOB 3VV1A 1AR73 4E2SA 1H4HA 3HMYA 2ZGRA 2F4LA 4BCUA 3PVEA 2XBO3 3U0ZA 3PU3A 4D69A 3ASIA 3ZIXA 3R05A 4P9IA 4IQPA 1W04A 3WDXA 3H3ZA 1QNWA 4WZCA 4COVA 4EJRA 1HQWA 2AH2A 1EPWA 5FQ0A 2WFF2 3DPRB 3B00A 3M3IA 3LDBA 3RS6A 2HH9A 1XE0A 2NPIA 3V56A 3KCYA 4QMAA 4JX0A 1LAJA 3HVDA 3BVCA 2A6VA 2WKKA 3NV4A 5A3MA 1W03A 4UBGA 3SEPA 4Q4Y3 2Q4SA 5BNPB 3SMHA 1QIQA 2OX0A 3CF6E 1H1IA 3IIAA 2EXJA 2ADDA 4XF4A 1BLZA 2HWD2 4UWDA 2BVBA 2RJLA 1PX4A 4IERA 4QB2A 4CEYB 5FPVA 5FV3A 4QX1A 2ZHNA 2I07B 2A5ZA 1SG3A 3OEAA 4IEYA 1ODMA 5FWJA 4CEWA 3MI8A 5DAVA 3HWJA 5T3NA 1IOAA 3KT1A 4ATFA 1YC61 3C3VA 1H9WA 1LOAA 4AEDA 1UKRA 1UN1A 3M4FA 4OQ9A 2VJXA 1HB3A 1ZZ9A 2D43A 3DN7A 1LGBA 2UU8A 3ZXAC 1YO8A 3FC0A 2IXJA 4CU6A 3C8XA 4ET7A 4LKEA 5LBFA 3J7NA 2ATFA 3NKGA 1XNBA 4EWDA 4RR3A 3MBWA 5I0UA 1IQDC 2XVLA 1U0AA 1HRI3 1MS1A 1ZBA1 1JZ7A 3PMEA 1NQJA 4EN9B 3D0SA 3TNPB 1FPN2 2E51A 2VH9A 2ZGMA 3E6DA 1V9U3 4R9DA 1KJRA 1W6NA 4CCDA 1NE4A 1QJX2 2RR12 2UYBA 5AVPA 3R6SA 3K48A 4YRDA 4XE9A 4Y26A 1WCUA 5FXVA 1HX6A 2YGMA 2B9UA 1K5MB 1R093 2XL9A 3RMXA 1UY4A 3MEPA 2WZPP 1UF2C 2ARAA 3USUB 1NY72 4RHV3 1D4M2 4PJYA 3RYPA 4EN7B 2JKXA 1V00A 5FYCA 2WFPA 1N3QA 4J6GA 2RE9A 4HG6B 1GFF2 4HETA 1G9FA 1QJY1 1Z7S2 1W90A 1US3A 1OQEA 1W2AX 1AJOA 3JCIA 4NOTA 5FCCA 4ZY9A 3G7DA 1UY1A 2R30A 3VHNA 1Y43B 4LBMA 1COV3 4CDWA 5BNOB 5CFDC 2RM23 3TYJA 3WQ1A 1XRUA 1RXGA 4Q4Y1 1FPN1 4W65A 2GH2A 3H50A 5A7SA 4K9SA 3WF4A 5FMCA 4Q4W3 2VXJA 1WW5A 2VD7A 1CAVB 1B09A 1HDKA 1V0AA 4XYXA 2R7EB 3W20A 3OY8A 4AVAA 1JZ8A 5LEKA 3SEEA 4ES9A 5AFBA 4GH4A 1D2QA 2ORZA 4JGYA 4PHZA 4MOAA 4GULA 4QM8A 1PK6B 2CWSA 2VNGA 5FUIA 3I2GA 1NY71 5C8CB 5C9AB 1DLLA 1TMF1 1A3KA 5FZEA 1UY0A 4PDWC 1RJ7A 3VKMA 3O1TA 1NG0A 3AZVA 4OUSA 3MIBA 3LOIA 4COUA 2HWB1 3GYDA 3BIWE 4R9AA 3VKNA 4BZ4A 1RUE3 1PK6C 1X50A 3ORJA 5JWPA 1W8OA 4NRQA 3B9IA 4X6QB 1VMHA 3FFQA 1NXD1 5D8AB 1WCQA 5DDJ1 5A1AA 1ZNPA 4AFCA 4JQTA 1ZZ6A 1GNZA 1MS5A 1MS3A 1CAWB 1SEFA 2JDPA 2OIIA 2Z69A 4A7YA 3ATGA 1H2NA 3MPPG 3PUIA 5FMDA 5JZGA 1JMUB 5FPUA 4YW3A 3ZOIA 2BZDA 2W68A 5KXEA 4YVWB 5IVVA 2CGPA 1CX1A 2OVUA 2PLV3 1UU5A 4WM8A 5DQ0A 5EJZB 4O9EA 4UXAA 3BYWA 1WW7A 3LD8A 4UI9L 5J98B 3S7IA 4CP1A 5A33B 1IZ3A 3B5LB 4LA2A 2D3RA 4NAOA 3LFIA 4HPKA 4XQ4A 4A7KA 1AYM3 4RHV1 4JQRA 5JOYA 5FQ0B 3DPRA 1OHFA 3NNJA 4GQ7A 4A2UA 4B7KA 3OPZA 3PUAA 4QPIB 4B8EA 1RITA 1KFUL 2VM9A 4EWAA 3MFCA 4BQ3A 4YNIA 1W6OB 3T3YA 5CYYA 2KA3A 1ND3C 1N1TA 1CAXA 1AJKA 4P9GA 1E5HA 2GC3A 4RQPB 4GJZA 2WRAA 4RS5A 1OXCA 4HKWA 3KZ4C 4PI0A 2ZEXA 1JU4A 2VECA 1WUVA 3HT1A 5FUPA 1RUH1 4CEWB 1VAMA 3HNBM 4AG4A 5IK7A 3OYWA 3BCWA 5ACA2 5FDBA 3L9JT 1W0PA 3CL1A 3UESA 2VUDA 4AEDB 4AVCA 2YU2A 1Y7BA
chains in the Genus database with same CATH topology
3GM8A 3THDA 2WUHA 2E32A 4KI5M 4ZXEA 4DUXA 1UY2A 1CZVA 2W1QA 4DUWA 2BBAA 4A45A 3U37A 2C26A 3NQHA 5CZKA 4CUBA 4CU8A 2WABA 3ZM8A 4XUOA 3K4AA 4JHZA 1JZ4A 5B4XA 3C7HA 5JXJA 1T2XA 3WF0A 3FN9A 1JYWA 1K42A 3WNPA 1OH4A 4ARXA 2W87A 1D7PM 1PX3A 2W94A 2ORXA 2QBXA 2RV9A 2VZOA 5J1XA 4OZOA 2W91A 4W50A 5HPOA 4XURA 3VDCA 4YPJA 2VZ1A 2W95A 1JYVA 4MO3M 2VMFA 1XC6A 3NNGA 5G04L 3CDZB 5F7UA 3K4ZA 4Z2AA 3I3BA 4ZZ5A 1O8SA 4D8MA 5IFPA 1W8NA 1TG7A 2WDBA 4M4PA 1NUKA 3WF2A 2WZ8A 1F4HA 1JHJA 1GQPA 3IAPA 3IDAA 2VQTA 4XVHA 3ECQA 4XUTA 3GXUA 4UAPA 5IFTA 2HLEA 2X09A 3HNYM 1LNSA 2J7MA 2YC4A 3VD7A 3IIIA 4QAWA 1PMHX 3CZJA 1ULPA 1K45A 2VL4A 3P6BA 2X10A 3NJXA 1GU3A 4CUAA 3FL7A 4GWIA 3K4DA 5EIYB 5IHRA 1GMMA 1XNTA 4BDVB 1NKGA 1R64A 4QDQA 3MV11 4W8JA 4L0PA 1CIYA 5LCWL 4MGQA 2VCCA 4QX3A 3WNOA 4XUQA 2Y6LA 2VC9A 1P8JA 2YFZA 2XHNA 1NAEA 5I0DA 3OG2A 3WF1A 4DXTA 3CKHA 3ACHA 2WZEA 2VR4A 3A7QA 2HYXA 3WF3A 4GZ9A 1OD3A 2J22A 1H6YA 2YFUA 4XUPA 5JUVA 2QQOA 1CZSA 2JE8A 4IUGA 4A3ZA 1OF3A 4PT6A 2E33A 3UETA 1UYXA 5IYYA 1RYYA 3E1F1 3VD9A 5LA0A 1UZ0A 2ZXQA 2J1AA 1H6XA 3OGRA 2WQ8A 1JYNA 2XONA 1O59A 3WEZA 4CU9A 2J1SA 2QQMA 4OYUA 3I3EA 2KD7A 5HXMA 4DEQA 4E8CA 3T09A 2W3JA 4RN5A 5DPNA 3LEGA 1UXXX 1UYYA 4E8DA 4LKSA 3ACGA 3NJVA 3OB8A 1W9SA 1BHGA 2VZ3A 2DDUA 1GUIA 4OUEA 1W0NA 3MV01 3VD3A 3OBAA 5LA1A 4LPLA 4P00B 4AAXA 3CIHA 5JMOA 2EICA 2J1EA 5B4NA 3THCA 3HJRA 1UY3A 4KWUA 2W47A 4DXRA 1SHWB 2XOMA 4QB6A 3W5NA 2Y6JA 3JXSA 2X05A 2ZEYA 3K46A 2QQNA 2WO2A 2VZUA 4BK4A 1UMIA 2XQXA 2CDOA 3IB3A 1OF4A 2B4KA 4QDRA 5IJRA 1UYZA 2B9VA 2DCJA 2E26A 2J1TA 3T0BA 1EUTA 2VTFA 4UOJA 4D0QA 4M4RA 1O8PA 4P02B 3C7GA 4A4AA 4A6OA 2LS6A 4PQQA 1DLCA 3LPGA 3HOBA 2YG0A 3LEKA 1GNYA 2VZTA 3VDAA 2J1UA 1MPXA 1JI6A 1F4AA 2QQLA 1JZ5A 3C7EA 4XZUG 3WNKA 3OGSA 2W1SA 5C7GA 2CDPA 1KEXA 2ZEWA 5C71A 2VCBA 3A21A 1UX7A 3FHAA 1L7RA 1JU3A 3EB7A 3MUZ1 1W9TA 2L9LA 2V72A 1EUUA 2WYSA 5JXHA 3VD5A 3VDBA 3CMGA 4A42A 4QX2A 5C70A 2DCKA 5DN2A 2Y64A 4OMCA 3C7OA 2JDAA 3OEBA 3D3AA 2Y6KA 3SKJE 3T2QA 4KMQA 5JXIA 1JZ3A 3ACIA 2BGPA 4A41A 2VZSA 3P1IA 1GOHA 3T2PA 2VOTA 2RVAA 4CVUA 2Y8KA 2Y6GA 3WQBA 2ID4A 2WO1A 1US2A 3A23A 4QB1A 3I2JA 2RJ2A 5EJ1B 3SKVA 2VMCA 3WNNA 4BXSV 2WO3A 4JKLA 3J7HA 1W9WA 4CUCA 4CU7A 3ETPA 1YQ2A 2WN3A 1K3IA 4A44A 2W1UA 3I97A 2OKXA 4LHSA 4JX0A 2VZQA 1PMJX 2VO5A 3LQCA 3OGVA 3SEPA 1HN1A 2QQKA 3WNLA 3T2OA 4JKKA 3I2KA 4ZZ8A 4P5YA 2BERA 2EIDA 1PX4A 4QDSA 4QB2A 3WNMA 3I3DA 4QX1A 3OEAA 1SG3A 2J1RA 1UXZA 2W46A 5LA2A 2W9XA 2QQIA 3NRUA 2EIBA 1I5PA 2VJXA 1XPWA 1DYOA 4QPWA 4ET7A 4CU6A 3C8XA 3I2HA 3GDBA 4JKMA 3MBWA 4DEVA 1IQDC 3K77A 3F2ZA 1JZ7A 1JZ6A 4FI9A 3C7FA 3GGLA 4BJ0A 4BK5A 3UNPA 1ULOA 3EYPA 3W5MA 2WBKA 2PQSA 2Z4FA 2VZPA 3T0AA 1UY4A 2QQJA 4DUVA 3VD4A 2W1WA 2V5DA 2WN2A 2JKXA 1K12A 1J83A 4HG6B 4MGSA 4TTGA 1US3A 4ZY9A 3T08A 4QX0A 2VMDA 3DYOA 3MUY1 1UY1A 3HPNA 4RYDA 3CZUA 3AC0A 4GWJA 2C4XA 3WF4A 3BN6A 4P08A 2VMEA 1OT5A 2VZVA 2YB7A 4TXWA 2R7EB 1JZ8A 3DYPA 2YC2A 3SEEA 2ORZA 4MOAA 2V4VA 3BGAA 1UMHA 5FUIA 1UWWA 3I2GA 2VZRA 1JZ2A 1L7QA 3IAQA 3HEIA 5G05L 3FHQA 1GOGA 1UY0A 4DXSA 2W92A 4W4ZA 2W5FA 3DECA 1WKYA 3DYMA 2E31A 1W8OA 1J84A 5A1AA 1WCQA 1KGYA 3A22A 1XNAA 2VCAA 3PUIA 2BZDA 1DP0A 1CX1A 2Y6HA 5DMYA 3I2FA 2ZEZA 2WAOA 5DQ0A 5EJZB 4UI9L 3CQOA 3T0DA 1CZTA 5JXGA 4OMDA 1GOFA 3WSOA 3MO4A 2BGOA 3K75B 4PF1A 4MADA 3LEIA 2C9KA 3HN3A 2VM9A 3I2IA 5CYYA 4LQRA 1SDDB 3LPFA 1W99A 3PUHA 2J1VA 2WAAA 3ACFA 2LW8A 2ZEXA 1JU4A 2JD9A 5JR2A 1NX9A 1JYXA 4XUNA 3HNBM 4AG4A 3LE0A 3HNMA 3ABZA 1TVGA 2VQUA 3UESA 2EIEA 4ARYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GM8 A;  3THD A;  2WUH A;  2E32 A;  4KI5 M;  4ZXE A;  4DUX A;  1UY2 A;  1CZV A;  2W1Q A;  4DUW A;  2BBA A;  4A45 A;  3U37 A;  2C26 A;  3NQH A;  5CZK A;  4CUB A;  4CU8 A;  2WAB A;  3ZM8 A;  4XUO A;  3K4A A;  4JHZ A;  1JZ4 A;  5B4X A;  3C7H A;  5JXJ A;  1T2X A;  3WF0 A;  3FN9 A;  1JYW A;  1K42 A;  3WNP A;  1OH4 A;  4ARX A;  2W87 A;  1D7P M;  1PX3 A;  2W94 A;  2ORX A;  2QBX A;  2RV9 A;  2VZO A;  5J1X A;  4OZO A;  2W91 A;  4W50 A;  5HPO A;  4XUR A;  3VDC A;  4YPJ A;  2VZ1 A;  2W95 A;  1JYV A;  4MO3 M;  2VMF A;  1XC6 A;  3NNG A;  5G04 L;  3CDZ B;  5F7U A;  3K4Z A;  4Z2A A;  3I3B A;  4ZZ5 A;  1O8S A;  4D8M A;  5IFP A;  1W8N A;  1TG7 A;  2WDB A;  4M4P A;  1NUK A;  3WF2 A;  2WZ8 A;  1F4H A;  1JHJ A;  1GQP A;  3IAP A;  3IDA A;  2VQT A;  4XVH A;  3ECQ A;  4XUT A;  3GXU A;  4UAP A;  5IFT A;  2HLE A;  2X09 A;  3HNY M;  1LNS A;  2J7M A;  2YC4 A;  3VD7 A;  3III A;  4QAW A;  1PMH X;  3CZJ A;  1ULP A;  1K45 A;  2VL4 A;  3P6B A;  2X10 A;  3NJX A;  1GU3 A;  4CUA A;  3FL7 A;  4GWI A;  3K4D A;  5EIY B;  5IHR A;  1GMM A;  1XNT A;  4BDV B;  1NKG A;  1R64 A;  4QDQ A;  3MV1 1;  4W8J A;  4L0P A;  1CIY A;  5LCW L;  4MGQ A;  2VCC A;  4QX3 A;  3WNO A;  4XUQ A;  2Y6L A;  2VC9 A;  1P8J A;  2YFZ A;  2XHN A;  1NAE A;  5I0D A;  3OG2 A;  3WF1 A;  4DXT A;  3CKH A;  3ACH A;  2WZE A;  2VR4 A;  3A7Q A;  2HYX A;  3WF3 A;  4GZ9 A;  1OD3 A;  2J22 A;  1H6Y A;  2YFU A;  4XUP A;  5JUV A;  2QQO A;  1CZS A;  2JE8 A;  4IUG A;  4A3Z A;  1OF3 A;  4PT6 A;  2E33 A;  3UET A;  1UYX A;  5IYY A;  1RYY A;  3E1F 1;  3VD9 A;  5LA0 A;  1UZ0 A;  2ZXQ A;  2J1A A;  1H6X A;  3OGR A;  2WQ8 A;  1JYN A;  2XON A;  1O59 A;  3WEZ A;  4CU9 A;  2J1S A;  2QQM A;  4OYU A;  3I3E A;  2KD7 A;  5HXM A;  4DEQ A;  4E8C A;  3T09 A;  2W3J A;  4RN5 A;  5DPN A;  3LEG A;  1UXX X;  1UYY A;  4E8D A;  4LKS A;  3ACG A;  3NJV A;  3OB8 A;  1W9S A;  1BHG A;  2VZ3 A;  2DDU A;  1GUI A;  4OUE A;  1W0N A;  3MV0 1;  3VD3 A;  3OBA A;  5LA1 A;  4LPL A;  4P00 B;  4AAX A;  3CIH A;  5JMO A;  2EIC A;  2J1E A;  5B4N A;  3THC A;  3HJR A;  1UY3 A;  4KWU A;  2W47 A;  4DXR A;  1SHW B;  2XOM A;  4QB6 A;  3W5N A;  2Y6J A;  3JXS A;  2X05 A;  2ZEY A;  3K46 A;  2QQN A;  2WO2 A;  2VZU A;  4BK4 A;  1UMI A;  2XQX A;  2CDO A;  3IB3 A;  1OF4 A;  2B4K A;  4QDR A;  5IJR A;  1UYZ A;  2B9V A;  2DCJ A;  2E26 A;  2J1T A;  3T0B A;  1EUT A;  2VTF A;  4UOJ A;  4D0Q A;  4M4R A;  1O8P A;  4P02 B;  3C7G A;  4A4A A;  4A6O A;  2LS6 A;  4PQQ A;  1DLC A;  3LPG A;  3HOB A;  2YG0 A;  3LEK A;  1GNY A;  2VZT A;  3VDA A;  2J1U A;  1MPX A;  1JI6 A;  1F4A A;  2QQL A;  1JZ5 A;  3C7E A;  4XZU G;  3WNK A;  3OGS A;  2W1S A;  5C7G A;  2CDP A;  1KEX A;  2ZEW A;  5C71 A;  2VCB A;  3A21 A;  1UX7 A;  3FHA A;  1L7R A;  1JU3 A;  3EB7 A;  3MUZ 1;  1W9T A;  2L9L A;  2V72 A;  1EUU A;  2WYS A;  5JXH A;  3VD5 A;  3VDB A;  3CMG A;  4A42 A;  4QX2 A;  5C70 A;  2DCK A;  5DN2 A;  2Y64 A;  4OMC A;  3C7O A;  2JDA A;  3OEB A;  3D3A A;  2Y6K A;  3SKJ E;  3T2Q A;  4KMQ A;  5JXI A;  1JZ3 A;  3ACI A;  2BGP A;  4A41 A;  2VZS A;  3P1I A;  1GOH A;  3T2P A;  2VOT A;  2RVA A;  4CVU A;  2Y8K A;  2Y6G A;  3WQB A;  2ID4 A;  2WO1 A;  1US2 A;  3A23 A;  4QB1 A;  3I2J A;  2RJ2 A;  5EJ1 B;  3SKV A;  2VMC A;  3WNN A;  4BXS V;  2WO3 A;  4JKL A;  3J7H A;  1W9W A;  4CUC A;  4CU7 A;  3ETP A;  1YQ2 A;  2WN3 A;  1K3I A;  4A44 A;  2W1U A;  3I97 A;  2OKX A;  4LHS A;  4JX0 A;  2VZQ A;  1PMJ X;  2VO5 A;  3LQC A;  3OGV A;  3SEP A;  1HN1 A;  2QQK A;  3WNL A;  3T2O A;  4JKK A;  3I2K A;  4ZZ8 A;  4P5Y A;  2BER A;  2EID A;  1PX4 A;  4QDS A;  4QB2 A;  3WNM A;  3I3D A;  4QX1 A;  3OEA A;  1SG3 A;  2J1R A;  1UXZ A;  2W46 A;  5LA2 A;  2W9X A;  2QQI A;  3NRU A;  2EIB A;  1I5P A;  2VJX A;  1XPW A;  1DYO A;  4QPW A;  4ET7 A;  4CU6 A;  3C8X A;  3I2H A;  3GDB A;  4JKM A;  3MBW A;  4DEV A;  1IQD C;  3K77 A;  3F2Z A;  1JZ7 A;  1JZ6 A;  4FI9 A;  3C7F A;  3GGL A;  4BJ0 A;  4BK5 A;  3UNP A;  1ULO A;  3EYP A;  3W5M A;  2WBK A;  2PQS A;  2Z4F A;  2VZP A;  3T0A A;  1UY4 A;  2QQJ A;  4DUV A;  3VD4 A;  2W1W A;  2V5D A;  2WN2 A;  2JKX A;  1K12 A;  1J83 A;  4HG6 B;  4MGS A;  4TTG A;  1US3 A;  4ZY9 A;  3T08 A;  4QX0 A;  2VMD A;  3DYO A;  3MUY 1;  1UY1 A;  3HPN A;  4RYD A;  3CZU A;  3AC0 A;  4GWJ A;  2C4X A;  3WF4 A;  3BN6 A;  4P08 A;  2VME A;  1OT5 A;  2VZV A;  2YB7 A;  4TXW A;  2R7E B;  1JZ8 A;  3DYP A;  2YC2 A;  3SEE A;  2ORZ A;  4MOA A;  2V4V A;  3BGA A;  1UMH A;  5FUI A;  1UWW A;  3I2G A;  2VZR A;  1JZ2 A;  1L7Q A;  3IAQ A;  3HEI A;  5G05 L;  3FHQ A;  1GOG A;  1UY0 A;  4DXS A;  2W92 A;  4W4Z A;  2W5F A;  3DEC A;  1WKY A;  3DYM A;  2E31 A;  1W8O A;  1J84 A;  5A1A A;  1WCQ A;  1KGY A;  3A22 A;  1XNA A;  2VCA A;  3PUI A;  2BZD A;  1DP0 A;  1CX1 A;  2Y6H A;  5DMY A;  3I2F A;  2ZEZ A;  2WAO A;  5DQ0 A;  5EJZ B;  4UI9 L;  3CQO A;  3T0D A;  1CZT A;  5JXG A;  4OMD A;  1GOF A;  3WSO A;  3MO4 A;  2BGO A;  3K75 B;  4PF1 A;  4MAD A;  3LEI A;  2C9K A;  3HN3 A;  2VM9 A;  3I2I A;  5CYY A;  4LQR A;  1SDD B;  3LPF A;  1W99 A;  3PUH A;  2J1V A;  2WAA A;  3ACF A;  2LW8 A;  2ZEX A;  1JU4 A;  2JD9 A;  5JR2 A;  1NX9 A;  1JYX A;  4XUN A;  3HNB M;  4AG4 A;  3LE0 A;  3HNM A;  3ABZ A;  1TVG A;  2VQU A;  3UES A;  2EIE A;  4ARY A; 
#chains in the Genus database with same CATH topology
 5LAS A;  1UIJ A;  1AL2 2;  5L7O C;  1UY2 A;  3AYD A;  5GZE A;  1ASJ 1;  4C0B A;  1XE8 A;  2W1Q A;  4GB3 1;  5C33 A;  2RR1 1;  4MH0 E;  3U37 A;  1JTZ X;  4XF0 A;  2DUO A;  1RUF 3;  4HXC A;  4ZPI A;  3WXP A;  2EIG A;  2PHW A;  3RZM A;  2WAB A;  1F35 A;  5DZF A;  4XUO A;  1PGS A;  4NHM A;  4Y4R A;  4KWJ A;  3ZM8 A;  1R1A 1;  3C7H A;  5CEH A;  4AVB A;  2RS3 1;  1PZ9 A;  1T2X A;  4QXH A;  3RZK A;  3UGH A;  1JYW A;  2HWE 3;  4N53 C;  3N9O A;  3ZSM A;  1DBN A;  2QQP A;  4WM7 A;  3KQR A;  3FLR A;  1OH4 A;  3KGL A;  4ARX A;  1LOF C;  1MVE A;  1NLS A;  2WII B;  3EJK A;  2JG9 C;  3KB5 A;  5CIS A;  2XPJ A;  1W8F A;  1JHN A;  1RUJ 2;  2W94 A;  5LA9 A;  4EN8 B;  4CTE A;  4IE5 A;  5J1X A;  2W2I A;  1UZW A;  4FO9 A;  3M1H A;  1AX1 A;  3OPT A;  5FYT A;  4UF0 A;  2VZ1 A;  2CL2 A;  1BZW A;  2D97 A;  2W95 A;  3N7M A;  1LHO A;  2OQ6 A;  3VBS A;  4B7E A;  4Y22 A;  2JIG A;  1OVP A;  2WA4 A;  4TYS A;  1XC6 A;  3NNG A;  1NYW A;  2RS5 2;  3D8C A;  2PMW B;  5FJH A;  1QHD A;  1BEV 1;  4XBL A;  5HCF A;  5A6Q A;  1VBB 2;  4NVP A;  2BNO A;  2RS3 2;  3H1Y A;  2IZW A;  3ZFF A;  4COZ A;  5IFP A;  4QHO A;  3TEZ A;  1H8T C;  1TG7 A;  4LBN A;  1UMZ A;  4Q27 A;  4IEO A;  5FY9 A;  1NUK A;  3QH6 A;  1A8M A;  3CJI C;  1RC6 A;  4TWT A;  2YHJ A;  4XIK A;  4LBQ D;  2B5H A;  1DQ5 A;  4TSV A;  2X53 S;  1UYP A;  1O4T A;  3QCW A;  2FDI A;  3IAP A;  3IDA A;  2VQT A;  2JDY A;  2E7T A;  5HI0 A;  3ES4 A;  3KM5 A;  5IAX A;  4KH9 A;  2P3I A;  4CDU C;  1LUL A;  3GXU A;  4P5H A;  4Q0U A;  5FYV A;  4DO0 A;  5BPX A;  1JS9 A;  5FZ4 A;  3TEW A;  2CY6 A;  2JDZ A;  4LOR A;  2ENR A;  3GBF A;  1APN A;  4BQ2 A;  2EXK A;  2D3P A;  3VD7 A;  3WY6 A;  3AM2 A;  2GDF A;  4QAW A;  5FK8 A;  1AYM 1;  1C28 A;  2YV8 A;  1VLN A;  1ULP A;  2H6B A;  4OHZ A;  5FO9 B;  2SBA A;  3ZDV A;  2Y33 A;  1TMF 3;  2D98 A;  5T55 A;  4NHX A;  4IGQ A;  2XML A;  4JDM A;  4LBL A;  4AFM A;  2BTV C;  1Q5O A;  2HWB 3;  5A33 A;  1CJD A;  2HWF 3;  5FYH A;  3AZZ A;  4PI2 A;  1CIY A;  4YFW A;  1W8U A;  4E4S A;  3POB A;  1RL3 A;  4HAN A;  4EQV A;  2A6X A;  1S0G A;  4IE0 A;  1ZM1 A;  1JBC A;  1PGL 1;  2Y6L A;  3S0M A;  1GAN A;  2VC9 A;  1Q8S A;  3VDD C;  4ASL A;  1TZO A;  1FV3 A;  1VAL A;  1VP6 A;  3OG2 A;  4N9H A;  1QU0 A;  4MGY E;  5FZD A;  4QPI A;  1QH6 A;  2PA7 A;  2RM2 1;  2VUJ A;  4HZF A;  1YJK A;  3ZFG C;  5FZ6 A;  1YFY A;  2HYX A;  5M0T A;  1VAK A;  4U2A A;  4FPE A;  5D2A A;  4AWD A;  1R08 1;  3UYJ A;  5BYN A;  4MX3 A;  1HQL A;  2YFU A;  3VN4 A;  5JOW A;  1CAX B;  2QQO A;  4JRA A;  3FE5 A;  4RQP A;  1QJU 2;  4WM7 C;  5FFO C;  2HKX A;  2E6V A;  4A3Z A;  5C4W B;  3ZVX A;  3UET A;  1OOP A;  3IBM A;  1UYX A;  4AK3 A;  3E1F 1;  1QGL A;  3OYW B;  1UZ0 A;  1VBD 3;  2LRO A;  1DGR N;  5IVF A;  3P5B A;  1Q8P A;  2R0H A;  4FP3 A;  1PVC 3;  4MUV A;  5F39 A;  3H8O A;  5A1L A;  1C5I A;  3H8R A;  2BFU L;  2WFF 1;  4FOY A;  1IS3 A;  1QQP 3;  2OT7 A;  5SV5 A;  4OUL A;  1CVN A;  3S6P A;  3SH5 A;  2R1B A;  1O3S A;  1ULE A;  2ZX2 A;  2QUO A;  2KD7 A;  1UZY A;  1KS5 A;  4DEQ A;  3M3Q A;  4QHB A;  1UPI A;  2DFB A;  4MXV A;  3M3E A;  2B45 X;  1JOJ A;  5KWR A;  4N9I A;  1SZB A;  1Q3E A;  4LO7 A;  1N1S A;  4UFM A;  1NCQ C;  4DPN A;  2BWA A;  1XJA A;  4LKS A;  1AXY A;  3AVR A;  2VMH A;  4EWE A;  1WLD A;  1QJU 1;  3OUH A;  1OLM A;  1YEW A;  1C8M 1;  1GSL A;  3T4H B;  3UGG A;  5C5T A;  1ZZC A;  1W0N A;  3MV0 1;  5CA6 A;  1H2K A;  3MIH A;  4SLI A;  5CFC C;  3ZKY A;  1ZRD A;  4ATE A;  4XIL A;  4P00 B;  3K3O A;  1AX2 A;  2XDV A;  3B02 A;  4Q0V A;  4XJZ A;  1HJG A;  3WNX A;  1O3R A;  5B4N A;  5A3W A;  4XAB A;  1EV1 2;  3AXD A;  3THC A;  2DBN A;  2R0F A;  4CCE A;  3GAL A;  3HJR A;  4P14 A;  4XJW A;  4HVQ A;  1R1A 3;  1S0D A;  3WHT A;  2EAL A;  1PO2 2;  2ZAA A;  3MYX A;  3J4U H;  3FMG A;  5FZ0 A;  1QY4 A;  4FFH A;  3AP7 A;  1E57 A;  3SCG A;  4MLO A;  2RJK A;  1C5H A;  5LB6 A;  3VBR B;  3VKF C;  2G1M A;  2PLV 1;  1MAC A;  1RUC 3;  2WWJ A;  1HXS 3;  1WA4 A;  1GQH A;  4W6W A;  1GZW B;  4IW3 A;  2X05 A;  5F32 A;  4BB3 A;  2QQN A;  1A6C A;  1LHW A;  1IS4 A;  2D6M A;  1C57 A;  4KBB A;  1M4W A;  3POY A;  2RDS A;  3K51 A;  1LOC A;  3OY8 B;  3ZR5 A;  4N43 A;  2B9V A;  5JAX A;  1DF0 A;  2R06 1;  1YFW A;  2E63 A;  1W28 A;  1RUN A;  4OUM A;  2B39 A;  3IDB B;  1CIW A;  2XBO 1;  3CU7 A;  4HN1 A;  4D0Q A;  3WDU A;  4ZU7 A;  3HR9 A;  1O8P A;  2BGC A;  4HSJ A;  5DAP A;  4AAP A;  3LFM A;  5LRR A;  2P37 A;  2LS6 A;  2VW2 A;  4ZKT B;  2I45 A;  2ZZJ A;  3LPG A;  1BK1 A;  2D6K A;  2XR4 A;  3HOB A;  3I54 A;  3LEK A;  1ALY A;  2A70 A;  1MPX A;  4F7Z A;  1JI6 A;  2Q8D A;  3PLQ A;  3O5S A;  1F4A A;  1WCS A;  2Y0O A;  4NWW A;  4JZR A;  4A7Z A;  3NWK A;  1F5F A;  4CCO A;  2EXI A;  1ZVF A;  2W1S A;  1B35 A;  5C7G A;  3PIJ A;  1A8D A;  2QQV A;  1NXM A;  4YZ4 A;  2ZEW A;  1OMI A;  2DF7 A;  3LZZ A;  4Q4X 3;  4BQ1 A;  1HKD A;  1V6N A;  2WNV C;  3UKT A;  4LOT A;  4QQP A;  3WG4 A;  3S5A A;  1J59 A;  2BPA 2;  1YQ6 A;  3U07 A;  4E2Q A;  1JU3 A;  4KBZ A;  5I0R A;  4ONU A;  4GWN A;  1UU6 A;  3MUZ 1;  5LBB A;  3P3N A;  1PVX A;  2L9L A;  1TNF A;  1EUU A;  2ARB A;  2RDQ A;  2ZJC A;  3ZXJ A;  2GC2 A;  2FDH A;  4MG2 A;  1BVP 1;  5JI7 A;  1ND2 C;  3O12 A;  4CP9 A;  4YM3 A;  1RUO A;  5LK5 A;  1OUS A;  2A1X A;  2XXZ A;  2GNB A;  4D7S A;  1VBC 3;  1YIP A;  3JU9 A;  5D8A C;  5F2S A;  4N8M A;  2DCK A;  3N3H A;  2Q8O A;  4D94 A;  2DVD A;  4AQS A;  2VNV A;  1ENQ A;  2IWG B;  4TZD A;  3O0V A;  1LJ7 A;  5AVA A;  1X33 A;  3RVH A;  4KMQ A;  3WG1 A;  4XAC A;  3IWZ A;  4CE8 A;  1UQX A;  3WW2 A;  2V09 A;  4E4Z A;  5DAQ A;  5C8C C;  4MGZ E;  4PF5 A;  4YG0 A;  1Q8V A;  2BGP A;  2R49 A;  1RUI 3;  2DU0 A;  3FBY A;  5FYU A;  1Y9G A;  2ZGK A;  3P1I A;  4IV1 A;  3T2P A;  4XC9 A;  4CVU A;  4RS5 B;  3POE A;  5EQU A;  1FXZ A;  2ID4 A;  3NAP C;  2BEO A;  1US2 A;  2WO1 A;  3LDK A;  4FPG A;  2ZGO A;  1JUH A;  2E7A A;  3G6J B;  4UBH A;  5T5O A;  4OHX A;  2JIC A;  5FBZ A;  1F31 A;  4AI0 A;  3A0K A;  1QJY 2;  1Z7S 1;  3PJY A;  3POW A;  3SKV A;  3OBR A;  1NCQ B;  3WNN A;  4BXS V;  5FOJ B;  1SAC A;  4B4R A;  4AOC A;  5A3O A;  3PUR A;  2YPJ A;  3POI A;  5FP7 A;  2WA3 A;  2P6H A;  3AK0 A;  3ETP A;  5FMO S;  4CA9 A;  1QXJ A;  4RQP C;  1K3I A;  1YFU A;  2W1U A;  2OS2 A;  4PLN A;  5C3P A;  3IN9 A;  2UUR A;  3K2O A;  4QKF A;  4W6X A;  4CCK A;  1EV1 1;  2VW0 A;  2JJ6 A;  1HRI 2;  1LR5 A;  4TN7 A;  3OSD A;  1OC1 A;  4QKB A;  3WT3 A;  4O9G A;  3WNL A;  2GN3 A;  3AZY A;  2C6S A;  5FOB B;  4P5Y A;  3VZO A;  1S0I A;  1RIN A;  3GCX A;  3HIF A;  4AHZ A;  3JBG 3;  5H9S A;  1HIX A;  4NIG A;  4I01 A;  4GB3 3;  1AR8 1;  1F2N A;  4RGA A;  1BMV 2;  1QJX 3;  5DUV A;  4IEQ A;  1AR6 1;  4YVS A;  5FLJ A;  2VG9 A;  1UXZ A;  5FZL A;  5LA2 A;  4QXC A;  1R09 2;  4WVZ A;  4LJH A;  3WHU A;  4QQO A;  3NRU A;  4ZU5 A;  3T2T A;  5DDJ 2;  4MV2 A;  3H1W A;  1J1L A;  2XJS A;  1WMF A;  2EVX A;  4FTB A;  4MYE A;  3HT2 A;  1LCL A;  2LUW A;  2OXB A;  4A6S A;  3AMP A;  1LU1 A;  4JKM A;  5DUW A;  1COV 2;  4DEV A;  1DHK B;  1FNZ A;  4MHR A;  1RUI 1;  3LIG A;  1W05 A;  4NIH A;  1UD1 A;  2R32 A;  1OLM E;  2AEZ A;  2R6Q A;  3GGL A;  3MF9 A;  3N9N A;  4E2G A;  4Z1V A;  3LA3 A;  1W6Q B;  1ULO A;  4NR1 A;  3ITQ A;  1CES A;  1RUG 2;  4JV4 A;  4AQT A;  1MEC 3;  4M3C A;  1SFY A;  2WT2 A;  3RNS A;  4QXB A;  3WX5 A;  2VZP A;  2ZCW A;  3H42 B;  3O1P A;  2QQJ A;  5FKC A;  3VD4 A;  3IMM A;  1YXW A;  1UOJ A;  2YY1 A;  2V5D A;  3KCX A;  4M0N A;  3VZM A;  4DY3 A;  5FMB A;  1QH7 A;  4Q29 A;  3I2D A;  3ZYH A;  4D7Y A;  5L73 A;  1I5Z A;  2YZ4 A;  1QXP A;  4E27 A;  4MGS A;  2Y60 A;  4J25 A;  2BRT A;  2PHR A;  2ES3 A;  4QX0 A;  1SLI A;  5DUU A;  5IW0 A;  2DTW A;  5FZK A;  4RYD A;  5FZO A;  4UFL A;  1OI6 A;  3BOD A;  5A6Z A;  4CPB A;  3ENR A;  1TME 1;  4A3X A;  2C4X A;  2A7A A;  4GH4 C;  5DAW A;  3BN6 A;  4P08 A;  3ZYG A;  2TUN A;  4CDQ A;  4CZS A;  5K0U C;  1OT5 A;  3ALQ A;  3INA A;  3RMY A;  3JUU A;  2WLQ A;  2VZV A;  3CEW A;  5CIR A;  5A6X A;  1UOF A;  5FYS A;  2GH8 A;  4AF9 A;  2TNF A;  3AFG A;  4CP9 B;  1G86 A;  4HT1 T;  2GAU A;  1UMH A;  4QPG C;  2ZGU A;  4LO6 B;  4UW3 A;  1UWW A;  2CHH A;  3Q8F A;  2VZR A;  4JC1 A;  2CNA A;  5GZD A;  3RI9 A;  5F5I A;  4DXZ A;  5KHI A;  1AYM 2;  2ADE A;  3J26 N;  5G05 L;  1JZ2 A;  3FHQ A;  1SMV A;  3BKZ A;  5BXX A;  4NRP A;  3SHR A;  4W4Z A;  2W5F A;  1DYK A;  1RHI 1;  3I3Q A;  5E16 A;  1H9P A;  2WLP A;  4LLO A;  4NE9 A;  5F8P A;  4E4H A;  3DYM A;  2DCZ A;  2WNU B;  4R4X A;  1HRV 3;  1VBE 3;  2BYV E;  3FZ3 A;  4AI3 A;  1ENX A;  2Q1F A;  1H2M A;  5A1F A;  2MEV 2;  1LKN A;  3ME2 A;  4IV1 B;  4RA0 A;  3S5Q A;  1KGY A;  2X5I B;  4KGQ A;  4WZF A;  4FFG A;  2ZHM A;  3CO2 A;  3GCW A;  2XHK A;  1D4V B;  3WDY A;  1VMF A;  3ZX7 A;  3I3M A;  3MIF A;  2HEV F;  4YM0 A;  4LUM A;  3I7D A;  4NID A;  5FRA A;  4K21 A;  3VBF C;  1VIW B;  3O7O A;  1QXR A;  1ODN A;  2WAO A;  3CJX A;  1NCR B;  4CDW C;  1X7N A;  3ZXL A;  1ST8 A;  3CQO A;  1CZT A;  2PN5 A;  1AYN 2;  1BEV 3;  3DEM A;  4XJU A;  3BI3 A;  4K3U A;  2PAK A;  4XTP A;  1YUD A;  3SH4 A;  3LSE A;  1VRH 3;  1DGW X;  5GLU A;  1REF A;  1V6L A;  1VRH 1;  2RS5 1;  1R08 2;  4PF1 A;  4MAD A;  4AE2 A;  1UKG A;  2UWC A;  3LEI A;  4FPL A;  4E9K A;  2C9K A;  3HQX A;  4HK9 A;  2K0G A;  1DQ0 A;  4Z07 A;  3WCS A;  2X29 A;  3J8F 1;  1X8E A;  1XYP A;  2WQ4 A;  5J48 A;  1ULC A;  4P9L A;  3I2I A;  1CAU A;  2P5B A;  2AYH A;  1QQP 1;  4B1L A;  4IE6 A;  2HWE 2;  1CX4 A;  2J1V A;  2DCT A;  1XYO A;  1EAH 1;  2WAA A;  3ACF A;  5A7P A;  1LRH A;  5ACA 1;  1AR8 3;  4BQX A;  1RVF 1;  2JD9 A;  1NX9 A;  5L7O B;  1KFX L;  2D40 A;  4NPL A;  1OLQ A;  5IWF A;  5F3C A;  2QNK A;  5HV4 A;  2VQU A;  4CCM A;  3IPV A;  4L97 A;  3LGR A;  1AXZ A;  2HJI A;  1LEC A;  3THD A;  1O5U A;  2WUH A;  2E32 A;  1QOS A;  3ACL A;  3O0X A;  1MS9 A;  4FPJ A;  3TAY A;  2YBK A;  5ANN A;  3VBR A;  5JZG C;  4ZXE A;  4LR4 A;  3TEX A;  1AZD A;  5EZW A;  3RZZ A;  1GZW A;  5CAD A;  1ASJ 3;  4D3W A;  2W0X A;  5FYM A;  4A45 A;  4DRR A;  4I0B A;  2Q1M A;  4M0H A;  2VTX J;  1FAY A;  4QKN A;  5GZC A;  3ST7 A;  5B4X A;  3ZFE C;  5K7P A;  1DG6 A;  3D6E A;  4N43 B;  5EFU A;  3WF0 A;  3RZL A;  2W08 A;  3FN9 A;  3WP5 A;  1DYP A;  1VB4 A;  4LO8 A;  3ZXD A;  5I8Y A;  1XNK A;  1XU2 A;  3FFZ A;  3ZO0 B;  1SPP A;  4ZS2 A;  4OHW A;  1T6B X;  2CYF A;  2GME A;  4BQ5 A;  4GMP 1;  3ZYR A;  2HWF 1;  3AP6 A;  2W87 A;  3OBT A;  5GAL A;  1ULG A;  4CDX C;  4OVE A;  1IS6 A;  3VBS C;  3GHM A;  2O14 A;  4YZ3 A;  2HBU A;  3O1V A;  5HPO A;  2BNN A;  3LA2 A;  2ZKN A;  3LKJ A;  4YM2 A;  4EZH A;  2DUR A;  4QU1 A;  3VDC A;  3MW2 A;  3W58 A;  1RUJ 1;  4YPJ A;  1Q8O A;  5FMO L;  3ZFF C;  1O6U A;  1YYN A;  5FZO B;  2VVD A;  4UFK A;  1H8T A;  3PUQ A;  4AHX A;  2VMF A;  4AW7 A;  3BAL A;  1O91 A;  5G04 L;  1MEC 1;  2OYZ A;  3PU8 A;  4S2F A;  3K4Z A;  2R06 2;  3I3B A;  5T50 A;  3AZW A;  3MZH A;  2Z2S B;  4LO4 B;  4XHB A;  2XG3 A;  4YGC A;  1WD4 A;  4YLZ A;  2BNM A;  1OBN A;  4MXW A;  1Y4W A;  4PDW B;  2DVB A;  1RUD 1;  4XCB A;  1FT9 A;  3VBH B;  4IE7 A;  4R8H A;  1F4H A;  1YI9 A;  1GQP A;  4LKD A;  5FY4 A;  5GKA C;  3UV9 A;  3O1U A;  4CXW A;  1LEM A;  4N90 A;  5K4L A;  1TNR A;  3ECQ A;  4XFG A;  4BWO A;  4LIV A;  1FOD 2;  5I8S A;  2A3Y A;  1PO1 3;  5LWB A;  1OKQ A;  1NA1 A;  3ZYJ B;  3M2M A;  3HNY M;  5APA A;  1LNS A;  2YC4 A;  4CXX A;  1UIK A;  2XLA A;  3ZSE A;  1UAI A;  5FBJ A;  1PZ8 A;  3III A;  3DKQ A;  1CJP A;  1XND A;  3N7L A;  5FP3 A;  3MLL A;  3IZO A;  3H3L A;  1K5J A;  4LHL A;  3TEY A;  1XYN A;  2JG8 B;  1K45 A;  3LB9 A;  1EY2 A;  4L8Q A;  2X10 A;  2ZAC A;  3NNL A;  1GU3 A;  5A7N A;  3WP6 A;  4FTE A;  3FL7 A;  4CDW B;  1D4M 1;  4YZ5 A;  1AF9 A;  5EIY B;  4IEU A;  5IT6 A;  5IHR A;  1GMM A;  3U75 A;  1V6J A;  1ZBA 2;  4N7U A;  1NKG A;  1NCR A;  2FCV A;  1BBT 2;  5DAB A;  4L0P A;  5BNN A;  4Q4W 1;  1XQN A;  2AR6 A;  4YW7 A;  1GWL A;  2SLI A;  4MGQ A;  5SV8 A;  1X9T A;  3RGB A;  1W8W A;  2B46 X;  4QX3 A;  4YW5 A;  4BE3 A;  4MVT A;  4XUQ A;  1QQP 2;  1PK6 A;  2YFZ A;  4FOQ A;  1SLL A;  4P9W A;  5FXX A;  3NKT A;  1W6M B;  2YC0 A;  1NAE A;  1QDC A;  3AYA A;  5FTT C;  5I0D A;  1NLQ A;  1PVC 1;  3E5X A;  3GJA A;  4DIN B;  4XFI A;  1GWK A;  2DVG A;  2QZ2 A;  2TBV A;  3CKH A;  4L2N A;  4XFB A;  2VOW A;  1QF3 A;  2Z5W A;  1G6N A;  3A7Q A;  3WF3 A;  4Z2W A;  1OSG A;  2GN7 A;  2QKD A;  2PHL A;  2J22 A;  1H6Y A;  3ZXG A;  1H1A A;  3EBR A;  3SIT A;  2BBV A;  4CXY A;  4GKY A;  4QX5 A;  2FMY A;  1FMD 2;  2I2S A;  2YYO A;  4MET A;  5LBE A;  5AFE A;  2GNM A;  3ZFG B;  3BPS A;  2JE8 A;  3I2O A;  4XTM A;  4IUG A;  4X8P A;  2WQZ C;  2WNU C;  4AQ2 A;  1OPO A;  2BP6 A;  2NM1 A;  5L7O A;  1Q56 A;  1VPH A;  4WBB A;  1RYY A;  1CWP A;  3WD5 A;  5LA0 A;  1C8M 3;  3DPR C;  3E6C C;  2X5I C;  3R4S A;  3IPV B;  5FAX A;  3OGR A;  2WQ8 A;  3QAC A;  1O5L A;  2BV4 A;  3RYK A;  1CD3 G;  2P6C A;  3R0R A;  2J1S A;  2HBT A;  4PBO A;  5C4W C;  3KS7 A;  3I3E A;  1YQ8 A;  4KQ7 A;  2GNT A;  5HXM A;  4YW2 A;  4G3Y C;  3AZX A;  3PUS A;  5F2W A;  4YWA A;  1BXH A;  1ND3 A;  2W3J A;  5C6C A;  5H9R A;  5FRE A;  1LOF A;  1OA2 A;  1OUX A;  3GZT B;  2JG9 A;  3SC7 X;  2D6N A;  3VBU C;  1UX6 A;  2BQP A;  2BU9 A;  1ULD A;  2NN8 A;  4YGB A;  1JOB A;  1ZA7 A;  4QX7 A;  1VR3 A;  1BHG A;  3KF5 A;  4IL7 A;  1SPP B;  3AVS A;  4Q4X 1;  1GUI A;  4QHZ A;  4QPY A;  4M3C F;  4YG6 A;  5BNP A;  3OBA A;  4WVV A;  5GLT A;  1NLR A;  1EYB A;  2WT0 A;  1I9R A;  4RGG A;  4AAX A;  2ZHK A;  5JSR A;  5JMO A;  2EIC A;  4FAH A;  1H0B A;  2IUW A;  4BYY A;  5ISL A;  3LCP A;  2XL7 A;  2Q8E A;  5A6Y A;  1ZRF A;  1TME 2;  1PNF A;  4KWU A;  2W47 A;  2MPF A;  2P3Y A;  2QDN A;  2CV6 A;  2F6B A;  2WO7 A;  3WVJ A;  1H8T B;  1JOP A;  2KXL A;  4HSL A;  1RUD 2;  4KWL A;  4AYU A;  2KM2 A;  4QB6 A;  2ZEY A;  4LOS A;  3VBH C;  1WW6 A;  3VUO A;  3V64 A;  2VZU A;  2UWA A;  1UMI A;  4K7J A;  2CDO A;  2EAK A;  3IB3 A;  3D5O A;  3OGG A;  3PVN A;  3Q8E A;  1RUG 1;  2VE1 A;  4KU7 A;  1XOY A;  4I02 A;  4Q4X 2;  4Y33 A;  2B4K A;  3VHR A;  5BUV A;  5IJR A;  2B7Y A;  1UYZ A;  2P34 A;  1JOD A;  5GJ6 A;  3N4M A;  2DCJ A;  2E26 A;  4NIA A;  2HYK A;  3KMH A;  1Y9Q A;  2FZ1 A;  5CBL A;  5F9T A;  1RMU 2;  4BMB A;  2DV9 A;  4YGD A;  3MF6 A;  4UW4 A;  5I0T A;  2VTF A;  5T5P A;  1HV1 A;  5HBA A;  5KR7 A;  4WM7 B;  5IUQ A;  4LLF A;  3RWK X;  5FXZ A;  1OVS A;  1GLH A;  3POG A;  4AR2 A;  3CJI B;  4PQQ A;  5FP4 A;  1VBC 2;  1DLC A;  3USU A;  3WQ7 A;  1S55 A;  4G4F A;  2DVF A;  4R9C A;  1GNY A;  4E4D X;  5KXB A;  2J1U A;  4IET A;  2VCM A;  4QGM A;  2ZGL A;  4CDX B;  4UF0 B;  2ZX4 A;  2K46 A;  2YBS A;  3C7E A;  3ROU A;  2HWE 1;  1WBL A;  1MZ6 A;  3DKW A;  1AR9 2;  3ZMN A;  4Q4V 3;  5F1R A;  4XCA A;  2BWC A;  1XNC A;  3P3P A;  4G9S B;  3U10 A;  1KEX A;  1J3Q A;  1LOG A;  5HV0 A;  2ZAB A;  3W21 A;  1LTE A;  3LF7 A;  1AR6 2;  1RUC 1;  3VDD A;  1R09 1;  1AR7 2;  2QCS B;  2DVA A;  1L7R A;  1RMU 1;  3M3O A;  1VJ2 A;  2VVF A;  1CAV A;  3EB7 A;  4GWM A;  4HON A;  4IV3 C;  4LIU A;  2XB6 C;  4Q1R A;  5FR3 A;  2GU9 A;  1MR5 A;  5FKB A;  5AC9 2;  3L2H A;  4IEZ A;  2XJT A;  3OTF A;  4EZ4 A;  4QXK A;  2JXA A;  3CMG A;  1GZC A;  1VAV A;  4A42 A;  4QX2 A;  3OUI A;  1I1E A;  4YM1 A;  4OFG A;  4OLL A;  5DN2 A;  4PLO A;  3J8F 3;  5FPA A;  3U4X A;  3C7O A;  3OEB A;  2WFF 3;  1DQ1 A;  4S2D A;  5I0S A;  3RWN A;  1FYU A;  2UWB A;  2V4A A;  2C0Z A;  3SKJ E;  3T2Q A;  5JXI A;  4CCC A;  1CAU B;  2OPW A;  3KHC A;  3VZL A;  5A3T A;  2DWR A;  2KR2 A;  5FZC A;  3PHM A;  5EYX A;  1ZZ7 A;  2GMP A;  3TN9 2;  4F83 A;  2XLG A;  5LBC A;  4Q4Y 2;  2V5Y A;  4XF3 A;  2RVA A;  4EV0 A;  3FX3 A;  2XJV A;  2BJS A;  3U1X A;  1CAW A;  2WZR 2;  3WQB A;  5T5L A;  4Q4V 1;  5JZG B;  3O1R A;  4Q2F A;  4LT5 A;  3A23 A;  1W6P B;  3U14 A;  2ZGN A;  4I3G A;  3UL2 A;  2P3K A;  2VMC A;  3SXW A;  3AKQ A;  2P3J A;  1F5J A;  1BYH A;  5C8W A;  2WO3 A;  4JKL A;  4HPK B;  1U12 A;  1W9W A;  4IES A;  3KVA A;  4XFF A;  3FUQ A;  1IG0 A;  1S1A A;  4HVO A;  1W0O A;  3SQO A;  1YQ2 A;  4CU7 A;  5C3S A;  1RUH 3;  4PCR A;  2ETE A;  2XWB B;  4LHS A;  5GM0 A;  1U5X A;  1ZBE 1;  1H4G A;  1PMJ X;  3W9A A;  1QDO A;  3OGV A;  2LRP A;  4P9J A;  3C2U A;  2GC1 A;  3K3N A;  1FNY A;  2QQK A;  2RDR A;  4YVS C;  1PGL 2;  4YW6 A;  3AXE A;  5DG1 A;  4Q0Q A;  4NO4 A;  3I2K A;  4ZZ8 A;  3ZPO A;  1XE7 A;  2EID A;  1H1M A;  4AEM A;  4Z92 B;  2FQP A;  4PIX A;  1IHM A;  3RPQ A;  2A6Y A;  4QDS A;  3URF A;  3THP A;  3VBU B;  2ZKL A;  1FX5 A;  1ONA A;  1LOD A;  2IVI B;  3I3D A;  5C4W A;  3RSJ A;  4CP2 A;  1MEC 2;  3OUJ A;  1C1L A;  2RDN A;  3O1O A;  2J1R A;  1MQT A;  4TLF A;  1G9D A;  4COY A;  5T52 A;  1WGP A;  4C91 A;  4FPK A;  5A7W B;  1KDM A;  1UW8 A;  4R52 A;  4RHV 2;  3CBN A;  4YW4 A;  5FY1 A;  4YZ1 A;  1ENS A;  3GNE A;  4BH9 A;  1W9Y A;  4IGO A;  1SFN A;  3RJ2 X;  3PMS A;  4Q1P A;  1XPW A;  4BLJ A;  4N43 C;  3S7E A;  2VNR A;  4S2G A;  4QPW A;  4CRQ A;  5IVY A;  1PGW 1;  2QZ3 A;  3I2H A;  5A3U A;  4AFB A;  3GDB A;  3CHX A;  3HQU A;  3CNA A;  2RM2 2;  3F2Z A;  1JZ6 A;  2FHR A;  1Z78 A;  3N7K A;  3EQE A;  5EHD A;  4FI9 A;  1GP4 A;  1SLT A;  4Q4W 2;  4PDW A;  1COV 1;  1KQR A;  1NOV A;  4BJ0 A;  1HB2 A;  2HWD 1;  3MW4 A;  5FYY A;  1LEN A;  2HWD 3;  3GZE A;  3EYP A;  4IE4 A;  3IMN A;  2I74 A;  2WBK A;  2R04 3;  1QMJ A;  2ZML A;  3VLB B;  4DFS A;  5LY1 A;  2X8K A;  3T30 A;  1VBA 3;  1SLA A;  5JPN B;  5FK7 A;  3AFK A;  2IXH A;  3E6B A;  3H7Y A;  4RL7 A;  3T0A A;  2DTY A;  2VGD A;  5FYB A;  5KBF A;  3BU0 A;  2D5F A;  4DUV A;  5A3P A;  3LSD A;  4BIF A;  3L2Y A;  3GHN A;  5DZG A;  4DNY A;  3GBW A;  5A70 A;  2WN2 A;  5EP9 A;  2FCU A;  4NAM A;  5FZB A;  1J83 A;  1NE6 A;  1JYC A;  1LES A;  3KD4 A;  3BOP A;  4Q0P A;  1I3H A;  1JW6 A;  2A75 A;  4BME A;  2PHT A;  4TTG A;  2NLR A;  3T08 A;  2JG8 A;  3BOW A;  2ARX A;  3DYO A;  5J36 A;  3MUY 1;  4LUK A;  5AC9 1;  2XUE A;  3VBS B;  2MEV 3;  1EAH 2;  3HN1 A;  3M8L A;  3UK9 A;  2GMM A;  1UNB A;  5CG8 A;  4QQ2 A;  3TN9 1;  3AC0 A;  4GWJ A;  4MSV A;  3KV9 A;  1NT0 A;  2JEM A;  2VOX A;  1FPN 3;  4XMA A;  3KVB A;  1U5I A;  3NMB A;  5FZI A;  4CDU B;  1F15 A;  4QU2 A;  5FZ9 A;  3H8X A;  2RHP A;  4Q0S A;  2ZHL A;  1QJX 1;  2QJV A;  4UW6 A;  3N7J A;  3DYP A;  2WS9 3;  2BDR A;  2YC2 A;  1W3X A;  1GP6 A;  1OA3 A;  2PLV 2;  1OH3 A;  1RUF 1;  4PIZ A;  2FDF A;  1KXG A;  1POV 3;  5LY2 A;  4W6Y A;  2JDK A;  2WIN B;  5HCB A;  3SCF A;  1DQ2 A;  4S2H A;  1AYN 3;  1BEV 2;  2PAM A;  4BQW A;  4CYD A;  3O1S A;  4DXS A;  1L7L A;  1SLB A;  4LHK A;  1WCD J;  1Z7S 3;  3DEC A;  5JSP A;  1KJL A;  4JHT A;  4CCN A;  4IEX A;  1POV 0;  1S2K A;  2E31 A;  4JDN A;  1V6K A;  2NZ9 A;  1PIV 3;  2CGN A;  1MZF A;  3RI8 A;  3VZN A;  4BU2 A;  4COW A;  1S0E A;  3A22 A;  1CPM A;  4JGZ B;  5DAX A;  5CU1 A;  2VCA A;  3M3C A;  3X29 B;  2JE7 A;  3JQX A;  2GP3 A;  2IC1 A;  1DQ6 A;  3AP5 A;  5FPZ A;  1DP0 A;  2XUM A;  2Y6H A;  4LBQ B;  4XQW A;  3I2F A;  2ZEZ A;  2JKB A;  3RYR A;  3PNA A;  3AYC A;  1X36 A;  4XAA A;  2RMU 1;  3JD7 2;  5JXG A;  3ZPY A;  4OMD A;  1GOF A;  3WSO A;  1S0J A;  2XH6 A;  3MO4 A;  4YVW C;  3K75 B;  1ND3 B;  5KXD A;  2XWJ B;  1AL2 3;  3MLK A;  4H7L A;  5FPB A;  3WP3 A;  3VHO A;  2Y26 A;  1ASJ 2;  4FSJ A;  1RUE 2;  2UY8 A;  1JH5 A;  3HN3 A;  3QD6 A;  4AI2 A;  5CFD B;  5CKQ A;  4CEY C;  1O4Z A;  5C3O A;  1HW5 A;  1OLR A;  5T54 A;  4HFS A;  3BTA A;  2PFW A;  2FCT A;  5A3N A;  3VGI A;  2VUC A;  1YHF A;  2WC2 A;  4B3N A;  4C90 A;  4R4Z A;  3GBG A;  3KSC A;  2FBE A;  4QPI C;  3EXU A;  1AHS A;  3PUH A;  5FZM A;  5FPX A;  1HLC A;  2AC1 A;  3SCH A;  4HKL A;  2LW8 A;  5A80 A;  2E7Q A;  3BTX A;  1PGW 2;  1C1F A;  3U78 A;  1FAT A;  1QJE A;  2JX9 A;  1QNY A;  4ZU4 A;  2YBP A;  3LE0 A;  1LGN A;  3HNM A;  1RUJ 3;  3H3U A;  1ZRR A;  5GLZ A;  4DB5 A;  4H3W A;  3OCP A;  1VRB A;  1HQN A;  4WVM A;  5BNQ A;  4UW5 A;  5F37 A;  5IAT A;  5D1I A;  2W52 A;  2C1F A;  3NW4 A;  1RHI 3;  3Q8C A;  3J7M A;  1PNG A;  4GXL A;  1RUE 1;  4B1M A;  4DUW A;  1W8T A;  2BBA A;  1Y3T A;  3DXU A;  4QD2 A;  3NQH A;  3BIE A;  3ETQ A;  3KT4 A;  4IEP A;  1AR7 1;  4CU8 A;  4XF1 A;  3I59 B;  2BFU S;  2R06 3;  3I4I A;  3K4A A;  1D2S A;  2JDN A;  4B29 A;  1ZZB A;  3ILF A;  1S0F A;  3NVC A;  2N7G A;  4OI0 A;  2F4P A;  4QKD A;  4LHN A;  2VW1 A;  5EJ3 A;  1DU3 D;  1WME A;  2CGO A;  3WNP A;  3ILR A;  4D7T A;  4XJ8 A;  3LA7 A;  5CG9 A;  1HXS 1;  1N3P A;  1SBE A;  5J3U A;  4ZXK A;  3JQW A;  1D7P M;  4J1W A;  1A34 A;  4YVS B;  2O8O A;  4N53 A;  4R9B A;  5A7Q A;  1Q43 A;  1S0C A;  4XDQ A;  4ASK A;  4DY5 A;  2ORX A;  2QBX A;  2RV9 A;  5ERL A;  2WSV A;  3AMQ A;  4OZO A;  4XUR A;  4C8D A;  1QEX A;  4YFZ A;  2IFR A;  5FZ8 A;  3BTZ A;  1QJF A;  1JYV A;  2ZGS A;  1K5M C;  5BNO A;  4LK7 A;  5B2G B;  1WA6 X;  2JB8 A;  1RUF 2;  2O1Q A;  5D21 A;  4QQH A;  1HJF A;  2JE9 A;  4BPZ A;  4QPG A;  3EHK A;  2Z79 A;  4QX8 A;  4ZZ5 A;  2FZ2 A;  1O8S A;  2GAL A;  5JIU A;  1JUI A;  2EA7 A;  2G4I A;  1TMF 2;  4L9B A;  4QGN A;  2VBB A;  3O14 A;  5EYY A;  4Y1V A;  3RRD A;  4EE2 A;  5C9A C;  1O4Y A;  2LAL A;  3KGZ A;  1HRI 1;  1RVF 3;  1ZBA 3;  2XQR A;  2CWM A;  1J1T A;  3AYE A;  1BBT 3;  3VB9 A;  1W6Q A;  3U11 A;  2ERF A;  2JEC A;  1V9U 1;  2AUY A;  1LHU A;  2MHF A;  3WUD A;  5C3R A;  1MVQ A;  4AEJ A;  2J7M A;  4I09 A;  5L9V A;  4AGR A;  2CTV A;  3BUC A;  1YQ5 A;  5A3L A;  5FZ3 A;  1PMH X;  2RS5 3;  3CZJ A;  1YLL A;  3V0B A;  5C3Q A;  3P6B A;  5IVC A;  4CUA A;  3FBM A;  5JI9 A;  2RMU 2;  3JD7 1;  2WNE A;  2RS3 3;  2VMI A;  4GWI A;  4HL0 A;  4NHY A;  5F5A A;  4XBN A;  5EPA A;  1V70 A;  3QH7 A;  2OZ6 A;  2ZGT A;  1V6M A;  4TLG A;  5CNA A;  4Y1Y A;  3LOB A;  2HWC 2;  1W6P A;  1XNT A;  3N35 A;  4Y5T A;  4GD4 A;  4BDV B;  1KIT A;  1NZI A;  2VVE A;  4QDQ A;  3MV1 1;  4W8J A;  1LOE A;  1URX A;  1VBD 2;  2NQY A;  4LKF A;  1VB2 A;  2OUH A;  1J3R A;  4K6B A;  1PVC 2;  3PTY A;  4KNC A;  4UFI A;  2VPV A;  4BHP A;  4AL9 A;  3D4K A;  2VCC A;  3WNO A;  1GWM A;  4AVS A;  1P8J A;  1IPK A;  2D6O X;  3UKV A;  4RGK A;  1G8W A;  3PDQ A;  3ZYF A;  4K8R B;  2VQA A;  2WZE A;  4GZ9 A;  5GZF A;  1KD7 A;  2OUJ A;  1OD3 A;  3FUO A;  1BVV A;  4XUP A;  3O1M A;  1ND2 A;  4L99 A;  4Z8B A;  4CPB D;  5JUV A;  1IQA A;  5IK4 A;  4LBJ A;  3AKP A;  4K8F A;  4YSF A;  1PM4 A;  2X5I A;  1OQD A;  1QWR A;  1YQC A;  2JWP A;  3SNM A;  2GP5 A;  3NNF A;  1CQ9 A;  4EYU A;  2WT1 A;  1XU1 A;  5IYY A;  4LE4 A;  4M00 A;  2A3X A;  3TNQ A;  1W3V A;  1H6X A;  1WCK A;  4FQ4 A;  5A7W A;  3V0A A;  2GND A;  2MEV 1;  1ZYB A;  4HN0 A;  3APB A;  3UKN A;  1TME 3;  4CU9 A;  3VBO C;  2AGS A;  4RD7 A;  4Y5S A;  2Q8C A;  2EAA A;  4OYU A;  1A78 A;  2PEL A;  1PO2 3;  3KLS A;  4E8C A;  1DFQ A;  1V6O A;  1RUD 3;  3KWV A;  4RR3 B;  1SBF A;  2R1D A;  1RUC 2;  2A6W A;  1HXS 2;  2JB4 A;  4JAA A;  4LO5 B;  4FBF A;  5BNN C;  3LEG A;  1UXX X;  5FLH A;  3OGJ A;  2PYT A;  1AL0 G;  1UYY A;  3SIS A;  3E97 A;  2PTM A;  3EO6 A;  4GMP 0;  1GV9 A;  3ACG A;  1VBB 1;  3NJV A;  3OB8 A;  1W9S A;  5JOZ A;  4I0W B;  2VZ3 A;  5JPM B;  3JZV A;  5EWS A;  3VD3 A;  5F5C A;  4B4P A;  3B93 A;  1W2T A;  4LPL A;  4H7M A;  3AKT A;  2PHX A;  5CKN A;  3ZSL A;  2G9F A;  4FT8 A;  4CUG A;  5I93 A;  2J1E A;  1ZRC A;  1IKP A;  4XHX A;  4XFH A;  2NYY A;  2PHF A;  4PIY A;  1UY3 A;  1UPS A;  1LGC A;  2ZX0 A;  1WLT A;  3ZLI A;  1SDW A;  3Q8B A;  4NII A;  4AZZ A;  2IFW A;  4Y22 B;  3BTY A;  2B8M A;  3H7J A;  4ZS3 A;  4AHY A;  5FO7 B;  4GMP 3;  3ZFE A;  4XBQ A;  2Q5T A;  2Y0I A;  4ASM B;  1SHW B;  5JMC A;  1QOT A;  3W5N A;  4CP0 A;  1OKO A;  3FWE A;  4D6S A;  4WVW A;  3DCQ A;  4NPM A;  4Q4V 2;  2P2K A;  3TOJ A;  1NA1 C;  3DGT A;  5BY5 A;  3DF0 A;  2VMG A;  5H9P A;  1OFS A;  4JGY B;  2VUL A;  4AEK A;  1BMV 1;  3T0B A;  1RJ8 A;  1EUT A;  4H55 A;  1M06 G;  4UOJ A;  4M4R A;  5C8C A;  1DGW A;  3ZR6 A;  3MDP A;  4P02 B;  2ILM A;  4Y1U A;  4A4A A;  1WLW A;  4IEW A;  3NST A;  4BQY A;  4XXA A;  5IVB A;  1ZBE 2;  3OOX A;  5FY7 A;  1OPM A;  1WW4 A;  2YG0 A;  4JGZ C;  2WJS A;  5FLI A;  5CFC A;  2VZT A;  2BUK A;  4UFJ A;  2WS9 1;  4OHY A;  2QQL A;  3RFR A;  1LHN A;  5ABJ B;  1FV2 A;  1SCS A;  4XZU G;  4Y1Z A;  5DZE A;  5KXC A;  1UZZ A;  4NRO A;  1C4R A;  3OGS A;  1LOB A;  2VUA A;  1X8M A;  3IM0 A;  3ZN5 A;  2WSU A;  5H9Q A;  5C71 A;  2VCB A;  5E88 A;  3ZSK A;  3A21 A;  4GAL A;  3WDW A;  3LEM A;  3J9S A;  1L3J A;  2WZR 3;  4DMI A;  5A32 A;  1ULF A;  1B35 C;  3EMR A;  1IKQ A;  3POF A;  4ZHN A;  2PHD A;  1OFN A;  2RS1 3;  3LAG A;  3VBH A;  5CFD A;  5J7M A;  1W9T A;  2DCY A;  2WYS A;  2VBP A;  4YZ2 A;  5JXH A;  4I2O A;  3VD5 A;  3DV8 A;  4ES8 A;  2Y64 A;  5KHK A;  4OMC A;  1PZ7 A;  2JDA A;  4Y5Z 0;  1MZ5 A;  3D3A A;  3WW3 A;  5KC6 A;  5FO8 B;  1RUH 2;  4GIQ A;  2D6P A;  1HRV 1;  1VBE 1;  4KL1 A;  3MHZ A;  4FFF A;  1F9K A;  2EXH A;  1JZ3 A;  3ACI A;  2XLF A;  4FVV A;  4GAZ A;  4CEW C;  4Y4Y A;  4AGG A;  4HLT A;  3AL6 A;  4A41 A;  2VZS A;  3U4S A;  1NCR C;  1BQP A;  2VU9 A;  4XDO A;  3WR0 A;  1GOH A;  1YFX A;  1J58 A;  1YI7 A;  2VOT A;  3SLI A;  2D93 A;  1UZV A;  2IXL A;  1POV 1;  2R07 3;  4FFI A;  1OOP B;  5CVR A;  5HCA A;  2Y6G A;  1WWY A;  4BLI A;  3JBG 2;  1IS5 A;  2CSG A;  3MLJ A;  4GB3 2;  3NV1 A;  2ET1 A;  1OQ1 A;  4AXO A;  3I8T A;  4QQL A;  3OD4 A;  4QB1 A;  1IG3 A;  4RR3 C;  2H0V A;  3I2J A;  2RJ2 A;  3WCR A;  5EJ1 B;  1TE1 B;  1JXN A;  2DBI A;  4RS5 C;  4WVM B;  1HV0 A;  3O0W A;  3ZSJ A;  2P1B A;  3J7H A;  2DU1 A;  5DDJ 3;  4Y20 A;  5BNP C;  3KHB A;  4CUC A;  1FOD 1;  4C1X A;  2WN3 A;  4A44 A;  3I97 A;  4WM8 C;  3WUC A;  4X8N A;  2OKX A;  1QJZ A;  2VZQ A;  2VO5 A;  3LQC A;  4OI2 A;  5FWE A;  4URA A;  1RUI 2;  2P17 A;  1HN1 A;  4K40 A;  2AAC A;  4JKK A;  4HOO A;  5E6H A;  4IXL A;  3T2O A;  2FD8 A;  1SBD A;  2BW8 A;  2BER A;  3WDV A;  1NQD A;  1H30 A;  3Q8A A;  2PHU A;  4Q26 A;  2R04 2;  5JVV A;  3WNM A;  1RUG 3;  1VBA 2;  2XBO 2;  4UYB A;  2TEP A;  4F8A A;  3WIN E;  2W46 A;  2W9X A;  1QJY 3;  1ZRI A;  3WLU A;  1GQG A;  2QQI A;  4RSU A;  2G9G A;  4BOW A;  2OPK A;  4D6R A;  5CAZ A;  2EIB A;  1I5P A;  4V2V A;  1G7Y A;  3FJS A;  5FZ1 A;  4RFR B;  1DYO A;  4MGK E;  1JN2 P;  2F17 A;  2XVK A;  3A0N A;  2H6C A;  4FTS A;  4NJ4 A;  4FPO B;  3FLT A;  2BOJ A;  2FMD A;  4HK8 A;  1EAH 3;  3K77 A;  4K20 A;  2BOI A;  2K9Z A;  2VXR A;  1LU2 A;  2JG9 B;  5EV7 A;  3F95 A;  3UGF A;  4D6Q A;  2WWU A;  4XMI A;  1RGS A;  3C7F A;  3VBR C;  3WG3 A;  1LED A;  2YDE A;  3B69 A;  4BK5 A;  3UNP A;  4GA9 A;  3W5M A;  4HMZ A;  2PQS A;  2WS9 2;  2Z4F A;  4LA3 A;  4XEZ A;  4LIT A;  3PVO A;  5TSW A;  1DGL A;  2GZW A;  1D0G A;  1NZC A;  2WZR 1;  2Y34 A;  5KC5 A;  3ELN A;  2W1W A;  3MIC A;  1YCI A;  1W2N A;  1GZT A;  4U36 A;  1Z0H A;  1JYI A;  1KDK A;  5CFC B;  2RS1 1;  3AL5 A;  1UU4 A;  1K12 A;  3T1L A;  3A4U A;  3R4U A;  3THT A;  2HWC 1;  2NMO A;  5ABJ A;  5E1R A;  3H9A A;  2HEY F;  4XDP A;  1VBD 1;  2VMD A;  1HRV 2;  1VBE 2;  1EPZ A;  3AJY A;  3HPN A;  4KWK A;  1PIV 2;  3T4V A;  4FXG B;  3WZ1 A;  1E5S A;  4Q8L A;  5FY8 A;  4AI8 A;  3CZU A;  5LK7 B;  1PHM A;  1AXK A;  2ZBJ A;  3MFA A;  5F6L B;  4FQZ A;  2VME A;  5FJK A;  1AR9 1;  1V9U 2;  1J3P A;  2HEW F;  2YB7 A;  3JBG 1;  4TXW A;  2O0O A;  3DL3 A;  5IAV A;  3ZXF A;  2ZAH A;  4NMI A;  2RR1 3;  4OCT A;  1GR3 A;  4I3P A;  4XET A;  3VHP A;  4MXW B;  4IGP A;  1GBG A;  4LMF A;  5LRS A;  4QM9 A;  2V4V A;  3BGA A;  4BIS A;  1DZQ A;  3JD7 3;  3BB6 A;  3ZYB A;  1L7Q A;  1D4M 3;  3HEI A;  3IAQ A;  4O61 A;  4XIO A;  2VBD A;  1GOG A;  5ANQ A;  1O7F A;  1R08 3;  1MS0 A;  3CJI A;  2W92 A;  4ISR A;  4JRL A;  3KV5 A;  3UJQ A;  4MZU A;  4AI1 A;  2B42 B;  2GSY A;  1YRZ A;  1WKY A;  2VTX A;  3NAP B;  1ND2 B;  1GKB A;  4AGV A;  1J84 A;  1TEI A;  2G9Z A;  3FLP A;  3NJZ A;  2Z42 A;  4OHV A;  4ZON A;  2W39 A;  2ZX1 A;  4IV3 A;  3VBF A;  1XBF A;  4V1P A;  3GZU C;  1XNA A;  1UOB A;  1VBC 1;  4DRV A;  2YPD A;  4LXL A;  3BU7 A;  3BPZ A;  5KHG A;  3KV4 A;  3ZXK A;  2XJQ A;  4LK6 A;  5BV6 A;  1AR8 2;  4QWN A;  5DMY A;  3WG2 A;  1VBA 1;  3V0A B;  5FYI A;  1XSR A;  4BQ4 A;  2XGX A;  1SLC A;  2D5H A;  1BCX A;  2DFC A;  3T0D A;  3AMM A;  5BNN B;  4XJ9 A;  2A71 A;  4LTA A;  4NN0 A;  4YGE A;  5FP9 A;  2JDU A;  1YWK A;  4Y20 B;  3W59 A;  4DQA A;  5K0U A;  2XKP A;  2Y6F A;  2BGO A;  3ZN6 B;  1PMI A;  3RG0 A;  1KRI A;  4CCL A;  3WOG A;  1RHI 2;  1W6M A;  3AKS A;  3RJR A;  5GZG A;  2MNG A;  1W8Z A;  3JB4 C;  2V73 A;  5HXV A;  3J7L A;  4XF9 A;  3RDI A;  4LQR A;  1UCX A;  1X9P A;  1SDD B;  2DUQ A;  5FZ7 A;  1GNH A;  1W2O A;  1W99 A;  3LPF A;  3H1M A;  5LW9 A;  1RTV A;  1VE0 A;  2ZA9 A;  3MGU A;  1IPS A;  3WW1 A;  2ARE A;  3ZFG A;  4DS0 A;  2JEN A;  3NV3 A;  2J42 A;  4GKX A;  1I6X A;  4ORF A;  5JR2 A;  1JYX A;  3GF6 A;  2DUP A;  4XUN A;  5JOX A;  3WQ0 A;  4BIO A;  2CAU A;  3MPB A;  3ABZ A;  1TVG A;  2Q0A A;  4PQ9 A;  2R16 A;  4AFA A;  2CAV A;  3WP4 A;  2EIE A;  5FYZ A;  4ARY A;  2YU1 A;  3GM8 A;  1VRH 2;  5FPL A;  3ZFE B;  5K8S A;  3AJZ A;  4KI5 M;  4DUX A;  1X82 A;  2Q30 A;  4N7I A;  1CZV A;  1LB2 A;  4HBN A;  1GYK A;  1O3T A;  1Q8Q A;  2ZGQ A;  2C26 A;  2LM3 A;  2IXC A;  3R4D B;  4J1X A;  1YNA A;  4AI9 A;  4XW3 A;  5CZK A;  3VKL A;  4CUB A;  5IK8 A;  5J37 A;  2OQ7 A;  2ZTN A;  4H14 A;  4JHZ A;  5JXJ A;  1JZ4 A;  4PBP A;  4LNV A;  2RG4 A;  1CR7 A;  3ON7 A;  2ZX3 A;  1Y9M A;  1W9F A;  3DUI A;  3JB8 A;  1K42 A;  4DZG A;  5DUX A;  5FZF A;  1W2U A;  1JYT A;  4AQ6 A;  4M3C B;  1RVF 2;  4NHK A;  2H0B A;  2JIJ A;  3RZJ A;  1ZRE A;  1E5R A;  4CEY A;  1AVB A;  2K2S A;  3CLP A;  3VBU A;  2CU5 A;  1PX3 A;  2E53 A;  2VAU A;  1REE A;  1BJQ A;  5ACA 3;  2ZMK A;  2ZGP A;  2QQU A;  5BNO C;  4OI1 A;  2VZO A;  4IDZ A;  4JTO A;  1S4C A;  1UO9 A;  2VY0 A;  2W91 A;  3D82 A;  4W50 A;  3TWI A;  3AX4 A;  1S0B A;  2G19 A;  4O7X A;  4FAG A;  4HVR A;  3OPW A;  2UY9 A;  2EF6 A;  5JCT A;  3PIG A;  3S57 A;  4MO3 M;  4HKO A;  2D6L X;  4Q8K A;  1B35 B;  4URT A;  1WMD A;  2A3W A;  3CDZ B;  3NV2 A;  5F7U A;  1MZE A;  4Z2A A;  3MIE A;  2IXK A;  2RMU 3;  4MGI E;  4MGT A;  4D8M A;  2QE3 A;  1W8N A;  2DYC A;  3OBZ A;  4DOU A;  4BA6 A;  1MS8 A;  5A32 B;  5T5J A;  2WDB A;  1S2B A;  2XJP A;  4M4P A;  4AVT A;  3ZN4 A;  4LUL A;  5L36 A;  4M3C E;  5I8T A;  2HWC 3;  3WF2 A;  4LE3 A;  2WZ8 A;  3H0O A;  1BBT 1;  3QOP A;  1JHJ A;  1E5I A;  1W6N B;  2PAE A;  1HB1 A;  1W06 A;  4IEV A;  3UT0 A;  3OF1 A;  5KHH A;  2O8Q A;  4XVH A;  4XOG A;  3E5U A;  3KQ4 B;  2WR9 A;  4XUT A;  2AEN A;  3DXT A;  1MS4 A;  5ABJ C;  4UAP A;  5E89 A;  2JG8 C;  1D0H A;  1PO1 1;  4EN0 A;  5IFT A;  2HLE A;  2X09 A;  5JDB A;  4XAE A;  2WNU A;  4C0H A;  3IT8 A;  3M70 A;  1YIF A;  4LBO A;  2QQW A;  1H8V A;  1BK0 A;  1ZX5 A;  1SQ4 A;  4P9X A;  4XFC A;  1VMJ A;  4GJY A;  2NMN A;  2VL4 A;  2XVG A;  3PJQ A;  4UFH A;  3E5Q A;  4CDX A;  3NJX A;  1POQ A;  1AYN 1;  3GZA A;  1VBB 3;  3K4D A;  4F3J A;  1ACC A;  4OI4 A;  4OZX A;  4DIQ A;  3VDD B;  5FUN A;  4JVA A;  1R64 A;  1XSQ A;  4IV1 C;  4RFT 0;  2QVS B;  3ZXE A;  4XPV A;  1N3O A;  1U5Z A;  1PO2 1;  4KU8 A;  5LCW L;  1NCQ A;  3RZG A;  4C1W A;  1DGR A;  5L9B A;  5FZA A;  1FOD 3;  4NUB A;  3ZMO A;  1ZA4 A;  3ZN6 A;  1PO1 2;  2FDG A;  2XHN A;  1CGP A;  2WNV A;  1GP5 A;  4KG0 A;  5C9A A;  3WF1 A;  3POS A;  5IVJ A;  4DXT A;  1T6G C;  1YJL A;  1RIR A;  2VNO A;  2QTW B;  3ACH A;  3B94 A;  4YW1 A;  2VR4 A;  4FOW A;  3HD8 B;  5CB7 A;  3N9M A;  3PL0 A;  2ARC A;  1DZR A;  3AMN A;  1WMX A;  5LZ6 A;  5J96 B;  3TBD A;  4H2A A;  1WZX A;  1V6I A;  4XQD A;  1CN1 A;  3FHI B;  1AX0 A;  3ZDS A;  4YAR A;  1AUY A;  2C24 A;  5D8A A;  5FP8 A;  4PLM A;  1SFP A;  2R07 1;  1CZS A;  3KF3 A;  2WYF A;  3AKR A;  4Q5O A;  2JDH A;  5C5U A;  1OF3 A;  3TRS B;  4PT6 A;  2E33 A;  3B9C A;  4FPC A;  1C3H A;  2HWB 2;  2C9A A;  5CKM A;  4Z82 A;  3VBO A;  1ZZ8 A;  2HWF 2;  3HBZ A;  1FI2 A;  4O65 A;  1TQ5 A;  1W8H A;  2C5D A;  3VD9 A;  3AMH A;  2ZXQ A;  4YVW A;  2J1A A;  3S30 A;  4LBQ A;  3OJB A;  1STM A;  3AP9 A;  1ENR A;  3N9P A;  5F3I A;  1JYN A;  4WM8 B;  2XON A;  1O59 A;  4KG8 A;  1OOP C;  4L11 A;  3WEZ A;  1W39 A;  3ZKU A;  2VQ0 A;  2QQM A;  4CSW A;  1IPJ A;  2NP0 A;  5F3G A;  4YG3 A;  2QDR A;  2UYA A;  2D3S A;  3Q9O A;  2D44 A;  1DCS A;  1N47 A;  2LTN A;  2VOK A;  3QLQ A;  3T09 A;  4Y3O A;  3VL9 A;  4FP2 A;  2OW4 A;  4WV8 A;  4NPR A;  4RN5 A;  3VZJ A;  4AFD A;  3N9L A;  5DPN A;  4AED C;  3VZK A;  1R1Z A;  1CON A;  1AL2 1;  4E8D A;  1HB4 A;  4FOV A;  5FY5 A;  2YXS A;  1OD5 A;  4QT6 A;  1DZT A;  1UL9 A;  5A7O A;  1W6O A;  1FMD 3;  3GJB A;  4QGL A;  1RXF A;  1QJU 3;  1WD3 A;  4K1Z A;  2OZJ A;  2ZMN A;  5FIX A;  2DDU A;  1DIW A;  2FDJ A;  3RZH A;  4OUE A;  4KGG A;  3I49 A;  1CPN A;  1OA4 A;  5LAT A;  5LA1 A;  4JCK A;  4P9Y A;  3LIH A;  2WL1 A;  3ZIW A;  3OD0 A;  3CIH A;  4M01 A;  5KHJ A;  3VKO A;  4LEJ A;  4CDU A;  5LEJ A;  1C8M 2;  1PIV 1;  3HQR A;  1G9C A;  3ILN A;  2JDM A;  3H8U A;  2YRO A;  3MID A;  5I91 A;  1H2L A;  1MQT B;  4NHL A;  3USS A;  4NWV A;  1RB8 G;  1RED A;  3AP4 A;  5L9R A;  1ZBE 3;  2PXJ A;  4X6R B;  1S2E A;  4CCJ A;  4EN6 B;  4DXR A;  2XJR A;  3B01 A;  3B7M A;  1LHV A;  2XOM A;  2BVV A;  2Y6J A;  3JXS A;  1MQT C;  4ERO A;  5FZH A;  1EP0 A;  4I0A A;  5DG2 A;  1AR9 3;  3K46 A;  4CDQ B;  2WO2 A;  4BK4 A;  2XKO A;  2XQX A;  2WNO A;  1QOO A;  1AR6 3;  1U5Y A;  1GZ9 A;  1DQ4 A;  2YUE A;  3KCC A;  4FPF A;  1OF4 A;  3I59 A;  5JLV A;  3N9Q A;  4QDR A;  4JTN A;  4SBV A;  3LDR A;  4AVV A;  3TB0 A;  2J1T A;  5JIA A;  5FZG A;  1SCR A;  1XXN A;  3AB0 A;  4CDQ C;  2RS1 2;  3B3Q E;  3HAG A;  5AC9 3;  2Q1Z B;  3V65 A;  3PTR B;  2ET7 A;  1EV1 3;  3ES1 A;  3MIG A;  1NA1 B;  1XB9 A;  2PQQ A;  3C7G A;  3QBQ A;  3M7A A;  4I30 A;  4XJA A;  1R1A 2;  1K5M A;  2AEY A;  2IVJ A;  2QFE A;  3WV6 A;  4A6O A;  4N53 B;  5EXO A;  4JGY C;  4NRM A;  2ZPX A;  3IDE A;  3N36 A;  3VL8 A;  3J8F 2;  5GLV A;  3VDA A;  3NAP A;  4XXP A;  5IK5 A;  4AHW A;  2GC0 A;  1BKZ A;  4LBK A;  4V2W A;  3NL1 A;  2IXI A;  3NO8 A;  2YMZ A;  5FY0 A;  4IND A;  4Y24 A;  1JZ5 A;  1N1Y A;  3IKW A;  4IV3 B;  3VBF B;  4ISQ A;  3WNK A;  3ZYI B;  2P4E A;  2WWS A;  3HBK A;  5FXW A;  5F6K A;  3TN9 3;  2CDP A;  1GIC A;  2R04 1;  4FPY A;  1N1V A;  2XJU A;  2Y38 A;  3IDC B;  1FMD 1;  3SH3 A;  3ZYP A;  4QPG B;  2A73 B;  3UJO A;  2ZZQ A;  2R07 2;  5F5Q A;  1QKQ A;  3ZFF B;  5E8A A;  1UX7 A;  3FHA A;  1PM7 A;  5DXD A;  3WDT A;  1OUR A;  1RMU 3;  3T1M A;  4FPH A;  4XZP A;  2JD4 A;  5GLW A;  5K9Y A;  5HCH A;  1UOG A;  2ZOE B;  4K1Y A;  5L19 A;  2V72 A;  4GH4 B;  5JSO A;  2FDK A;  5K0U B;  2D7F A;  3VDB A;  2WNV B;  4BM8 A;  4YYO A;  1WLC A;  3PVB B;  1WBF A;  4XFA A;  4Y1X A;  5C70 A;  5JR7 B;  4BXF A;  3RQ0 A;  4FXK B;  3WW4 A;  5IVE A;  4OQ8 A;  3KT7 A;  2AZ5 A;  4B4Q A;  5J09 A;  4JDO A;  1G9B A;  3LWC A;  3NJY A;  4UT5 A;  1DDL A;  1O3Q A;  2Y6K A;  2OA2 A;  3POJ A;  1KS4 A;  2YGL A;  2E9Q A;  2VOV A;  1F8V A;  4FCA A;  4MHU A;  1IGO A;  1G9A A;  1HN0 A;  2A6Z A;  3NNM A;  1C8N A;  3V0B B;  3KV6 A;  4L92 A;  5F3E A;  3MW3 A;  4ITC A;  2ZS6 B;  3D0J A;  2Y8K A;  4JGZ A;  3VBO B;  3VV1 A;  1AR7 3;  4E2S A;  1H4H A;  3HMY A;  2ZGR A;  2F4L A;  4BCU A;  3PVE A;  2XBO 3;  3U0Z A;  3PU3 A;  4D69 A;  3ASI A;  3ZIX A;  3R05 A;  4P9I A;  4IQP A;  1W04 A;  3WDX A;  3H3Z A;  1QNW A;  4WZC A;  4COV A;  4EJR A;  1HQW A;  2AH2 A;  1EPW A;  5FQ0 A;  2WFF 2;  3DPR B;  3B00 A;  3M3I A;  3LDB A;  3RS6 A;  2HH9 A;  1XE0 A;  2NPI A;  3V56 A;  3KCY A;  4QMA A;  4JX0 A;  1LAJ A;  3HVD A;  3BVC A;  2A6V A;  2WKK A;  3NV4 A;  5A3M A;  1W03 A;  4UBG A;  3SEP A;  4Q4Y 3;  2Q4S A;  5BNP B;  3SMH A;  1QIQ A;  2OX0 A;  3CF6 E;  1H1I A;  3IIA A;  2EXJ A;  2ADD A;  4XF4 A;  1BLZ A;  2HWD 2;  4UWD A;  2BVB A;  2RJL A;  1PX4 A;  4IER A;  4QB2 A;  4CEY B;  5FPV A;  5FV3 A;  4QX1 A;  2ZHN A;  2I07 B;  2A5Z A;  1SG3 A;  3OEA A;  4IEY A;  1ODM A;  5FWJ A;  4CEW A;  3MI8 A;  5DAV A;  3HWJ A;  5T3N A;  1IOA A;  3KT1 A;  4ATF A;  1YC6 1;  3C3V A;  1H9W A;  1LOA A;  4AED A;  1UKR A;  1UN1 A;  3M4F A;  4OQ9 A;  2VJX A;  1HB3 A;  1ZZ9 A;  2D43 A;  3DN7 A;  1LGB A;  2UU8 A;  3ZXA C;  1YO8 A;  3FC0 A;  2IXJ A;  4CU6 A;  3C8X A;  4ET7 A;  4LKE A;  5LBF A;  3J7N A;  2ATF A;  3NKG A;  1XNB A;  4EWD A;  4RR3 A;  3MBW A;  5I0U A;  1IQD C;  2XVL A;  1U0A A;  1HRI 3;  1MS1 A;  1ZBA 1;  1JZ7 A;  3PME A;  1NQJ A;  4EN9 B;  3D0S A;  3TNP B;  1FPN 2;  2E51 A;  2VH9 A;  2ZGM A;  3E6D A;  1V9U 3;  4R9D A;  1KJR A;  1W6N A;  4CCD A;  1NE4 A;  1QJX 2;  2RR1 2;  2UYB A;  5AVP A;  3R6S A;  3K48 A;  4YRD A;  4XE9 A;  4Y26 A;  1WCU A;  5FXV A;  1HX6 A;  2YGM A;  2B9U A;  1K5M B;  1R09 3;  2XL9 A;  3RMX A;  1UY4 A;  3MEP A;  2WZP P;  1UF2 C;  2ARA A;  3USU B;  1NY7 2;  4RHV 3;  1D4M 2;  4PJY A;  3RYP A;  4EN7 B;  2JKX A;  1V00 A;  5FYC A;  2WFP A;  1N3Q A;  4J6G A;  2RE9 A;  4HG6 B;  1GFF 2;  4HET A;  1G9F A;  1QJY 1;  1Z7S 2;  1W90 A;  1US3 A;  1OQE A;  1W2A X;  1AJO A;  3JCI A;  4NOT A;  5FCC A;  4ZY9 A;  3G7D A;  1UY1 A;  2R30 A;  3VHN A;  1Y43 B;  4LBM A;  1COV 3;  4CDW A;  5BNO B;  5CFD C;  2RM2 3;  3TYJ A;  3WQ1 A;  1XRU A;  1RXG A;  4Q4Y 1;  1FPN 1;  4W65 A;  2GH2 A;  3H50 A;  5A7S A;  4K9S A;  3WF4 A;  5FMC A;  4Q4W 3;  2VXJ A;  1WW5 A;  2VD7 A;  1CAV B;  1B09 A;  1HDK A;  1V0A A;  4XYX A;  2R7E B;  3W20 A;  3OY8 A;  4AVA A;  1JZ8 A;  5LEK A;  3SEE A;  4ES9 A;  5AFB A;  4GH4 A;  1D2Q A;  2ORZ A;  4JGY A;  4PHZ A;  4MOA A;  4GUL A;  4QM8 A;  1PK6 B;  2CWS A;  2VNG A;  5FUI A;  3I2G A;  1NY7 1;  5C8C B;  5C9A B;  1DLL A;  1TMF 1;  1A3K A;  5FZE A;  1UY0 A;  4PDW C;  1RJ7 A;  3VKM A;  3O1T A;  1NG0 A;  3AZV A;  4OUS A;  3MIB A;  3LOI A;  4COU A;  2HWB 1;  3GYD A;  3BIW E;  4R9A A;  3VKN A;  4BZ4 A;  1RUE 3;  1PK6 C;  1X50 A;  3ORJ A;  5JWP A;  1W8O A;  4NRQ A;  3B9I A;  4X6Q B;  1VMH A;  3FFQ A;  1NXD 1;  5D8A B;  1WCQ A;  5DDJ 1;  5A1A A;  1ZNP A;  4AFC A;  4JQT A;  1ZZ6 A;  1GNZ A;  1MS5 A;  1MS3 A;  1CAW B;  1SEF A;  2JDP A;  2OII A;  2Z69 A;  4A7Y A;  3ATG A;  1H2N A;  3MPP G;  3PUI A;  5FMD A;  5JZG A;  1JMU B;  5FPU A;  4YW3 A;  3ZOI A;  2BZD A;  2W68 A;  5KXE A;  4YVW B;  5IVV A;  2CGP A;  1CX1 A;  2OVU A;  2PLV 3;  1UU5 A;  4WM8 A;  5DQ0 A;  5EJZ B;  4O9E A;  4UXA A;  3BYW A;  1WW7 A;  3LD8 A;  4UI9 L;  5J98 B;  3S7I A;  4CP1 A;  5A33 B;  1IZ3 A;  3B5L B;  4LA2 A;  2D3R A;  4NAO A;  3LFI A;  4HPK A;  4XQ4 A;  4A7K A;  1AYM 3;  4RHV 1;  4JQR A;  5JOY A;  5FQ0 B;  3DPR A;  1OHF A;  3NNJ A;  4GQ7 A;  4A2U A;  4B7K A;  3OPZ A;  3PUA A;  4QPI B;  4B8E A;  1RIT A;  1KFU L;  2VM9 A;  4EWA A;  3MFC A;  4BQ3 A;  4YNI A;  1W6O B;  3T3Y A;  5CYY A;  2KA3 A;  1ND3 C;  1N1T A;  1CAX A;  1AJK A;  4P9G A;  1E5H A;  2GC3 A;  4RQP B;  4GJZ A;  2WRA A;  4RS5 A;  1OXC A;  4HKW A;  3KZ4 C;  4PI0 A;  2ZEX A;  1JU4 A;  2VEC A;  1WUV A;  3HT1 A;  5FUP A;  1RUH 1;  4CEW B;  1VAM A;  3HNB M;  4AG4 A;  5IK7 A;  3OYW A;  3BCW A;  5ACA 2;  5FDB A;  3L9J T;  1W0P A;  3CL1 A;  3UES A;  2VUD A;  4AED B;  4AVC A;  2YU2 A;  1Y7B A; 
#chains in the Genus database with same CATH homology
 3GM8 A;  3THD A;  2WUH A;  2E32 A;  4KI5 M;  4ZXE A;  4DUX A;  1UY2 A;  1CZV A;  2W1Q A;  4DUW A;  2BBA A;  4A45 A;  3U37 A;  2C26 A;  3NQH A;  5CZK A;  4CUB A;  4CU8 A;  2WAB A;  3ZM8 A;  4XUO A;  3K4A A;  4JHZ A;  1JZ4 A;  5B4X A;  3C7H A;  5JXJ A;  1T2X A;  3WF0 A;  3FN9 A;  1JYW A;  1K42 A;  3WNP A;  1OH4 A;  4ARX A;  2W87 A;  1D7P M;  1PX3 A;  2W94 A;  2ORX A;  2QBX A;  2RV9 A;  2VZO A;  5J1X A;  4OZO A;  2W91 A;  4W50 A;  5HPO A;  4XUR A;  3VDC A;  4YPJ A;  2VZ1 A;  2W95 A;  1JYV A;  4MO3 M;  2VMF A;  1XC6 A;  3NNG A;  5G04 L;  3CDZ B;  5F7U A;  3K4Z A;  4Z2A A;  3I3B A;  4ZZ5 A;  1O8S A;  4D8M A;  5IFP A;  1W8N A;  1TG7 A;  2WDB A;  4M4P A;  1NUK A;  3WF2 A;  2WZ8 A;  1F4H A;  1JHJ A;  1GQP A;  3IAP A;  3IDA A;  2VQT A;  4XVH A;  3ECQ A;  4XUT A;  3GXU A;  4UAP A;  5IFT A;  2HLE A;  2X09 A;  3HNY M;  1LNS A;  2J7M A;  2YC4 A;  3VD7 A;  3III A;  4QAW A;  1PMH X;  3CZJ A;  1ULP A;  1K45 A;  2VL4 A;  3P6B A;  2X10 A;  3NJX A;  1GU3 A;  4CUA A;  3FL7 A;  4GWI A;  3K4D A;  5EIY B;  5IHR A;  1GMM A;  1XNT A;  4BDV B;  1NKG A;  1R64 A;  4QDQ A;  3MV1 1;  4W8J A;  4L0P A;  1CIY A;  5LCW L;  4MGQ A;  2VCC A;  4QX3 A;  3WNO A;  4XUQ A;  2Y6L A;  2VC9 A;  1P8J A;  2YFZ A;  2XHN A;  1NAE A;  5I0D A;  3OG2 A;  3WF1 A;  4DXT A;  3CKH A;  3ACH A;  2WZE A;  2VR4 A;  3A7Q A;  2HYX A;  3WF3 A;  4GZ9 A;  1OD3 A;  2J22 A;  1H6Y A;  2YFU A;  4XUP A;  5JUV A;  2QQO A;  1CZS A;  2JE8 A;  4IUG A;  4A3Z A;  1OF3 A;  4PT6 A;  2E33 A;  3UET A;  1UYX A;  5IYY A;  1RYY A;  3E1F 1;  3VD9 A;  5LA0 A;  1UZ0 A;  2ZXQ A;  2J1A A;  1H6X A;  3OGR A;  2WQ8 A;  1JYN A;  2XON A;  1O59 A;  3WEZ A;  4CU9 A;  2J1S A;  2QQM A;  4OYU A;  3I3E A;  2KD7 A;  5HXM A;  4DEQ A;  4E8C A;  3T09 A;  2W3J A;  4RN5 A;  5DPN A;  3LEG A;  1UXX X;  1UYY A;  4E8D A;  4LKS A;  3ACG A;  3NJV A;  3OB8 A;  1W9S A;  1BHG A;  2VZ3 A;  2DDU A;  1GUI A;  4OUE A;  1W0N A;  3MV0 1;  3VD3 A;  3OBA A;  5LA1 A;  4LPL A;  4P00 B;  4AAX A;  3CIH A;  5JMO A;  2EIC A;  2J1E A;  5B4N A;  3THC A;  3HJR A;  1UY3 A;  4KWU A;  2W47 A;  4DXR A;  1SHW B;  2XOM A;  4QB6 A;  3W5N A;  2Y6J A;  3JXS A;  2X05 A;  2ZEY A;  3K46 A;  2QQN A;  2WO2 A;  2VZU A;  4BK4 A;  1UMI A;  2XQX A;  2CDO A;  3IB3 A;  1OF4 A;  2B4K A;  4QDR A;  5IJR A;  1UYZ A;  2B9V A;  2DCJ A;  2E26 A;  2J1T A;  3T0B A;  1EUT A;  2VTF A;  4UOJ A;  4D0Q A;  4M4R A;  1O8P A;  4P02 B;  3C7G A;  4A4A A;  4A6O A;  2LS6 A;  4PQQ A;  1DLC A;  3LPG A;  3HOB A;  2YG0 A;  3LEK A;  1GNY A;  2VZT A;  3VDA A;  2J1U A;  1MPX A;  1JI6 A;  1F4A A;  2QQL A;  1JZ5 A;  3C7E A;  4XZU G;  3WNK A;  3OGS A;  2W1S A;  5C7G A;  2CDP A;  1KEX A;  2ZEW A;  5C71 A;  2VCB A;  3A21 A;  1UX7 A;  3FHA A;  1L7R A;  1JU3 A;  3EB7 A;  3MUZ 1;  1W9T A;  2L9L A;  2V72 A;  1EUU A;  2WYS A;  5JXH A;  3VD5 A;  3VDB A;  3CMG A;  4A42 A;  4QX2 A;  5C70 A;  2DCK A;  5DN2 A;  2Y64 A;  4OMC A;  3C7O A;  2JDA A;  3OEB A;  3D3A A;  2Y6K A;  3SKJ E;  3T2Q A;  4KMQ A;  5JXI A;  1JZ3 A;  3ACI A;  2BGP A;  4A41 A;  2VZS A;  3P1I A;  1GOH A;  3T2P A;  2VOT A;  2RVA A;  4CVU A;  2Y8K A;  2Y6G A;  3WQB A;  2ID4 A;  2WO1 A;  1US2 A;  3A23 A;  4QB1 A;  3I2J A;  2RJ2 A;  5EJ1 B;  3SKV A;  2VMC A;  3WNN A;  4BXS V;  2WO3 A;  4JKL A;  3J7H A;  1W9W A;  4CUC A;  4CU7 A;  3ETP A;  1YQ2 A;  2WN3 A;  1K3I A;  4A44 A;  2W1U A;  3I97 A;  2OKX A;  4LHS A;  4JX0 A;  2VZQ A;  1PMJ X;  2VO5 A;  3LQC A;  3OGV A;  3SEP A;  1HN1 A;  2QQK A;  3WNL A;  3T2O A;  4JKK A;  3I2K A;  4ZZ8 A;  4P5Y A;  2BER A;  2EID A;  1PX4 A;  4QDS A;  4QB2 A;  3WNM A;  3I3D A;  4QX1 A;  3OEA A;  1SG3 A;  2J1R A;  1UXZ A;  2W46 A;  5LA2 A;  2W9X A;  2QQI A;  3NRU A;  2EIB A;  1I5P A;  2VJX A;  1XPW A;  1DYO A;  4QPW A;  4ET7 A;  4CU6 A;  3C8X A;  3I2H A;  3GDB A;  4JKM A;  3MBW A;  4DEV A;  1IQD C;  3K77 A;  3F2Z A;  1JZ7 A;  1JZ6 A;  4FI9 A;  3C7F A;  3GGL A;  4BJ0 A;  4BK5 A;  3UNP A;  1ULO A;  3EYP A;  3W5M A;  2WBK A;  2PQS A;  2Z4F A;  2VZP A;  3T0A A;  1UY4 A;  2QQJ A;  4DUV A;  3VD4 A;  2W1W A;  2V5D A;  2WN2 A;  2JKX A;  1K12 A;  1J83 A;  4HG6 B;  4MGS A;  4TTG A;  1US3 A;  4ZY9 A;  3T08 A;  4QX0 A;  2VMD A;  3DYO A;  3MUY 1;  1UY1 A;  3HPN A;  4RYD A;  3CZU A;  3AC0 A;  4GWJ A;  2C4X A;  3WF4 A;  3BN6 A;  4P08 A;  2VME A;  1OT5 A;  2VZV A;  2YB7 A;  4TXW A;  2R7E B;  1JZ8 A;  3DYP A;  2YC2 A;  3SEE A;  2ORZ A;  4MOA A;  2V4V A;  3BGA A;  1UMH A;  5FUI A;  1UWW A;  3I2G A;  2VZR A;  1JZ2 A;  1L7Q A;  3IAQ A;  3HEI A;  5G05 L;  3FHQ A;  1GOG A;  1UY0 A;  4DXS A;  2W92 A;  4W4Z A;  2W5F A;  3DEC A;  1WKY A;  3DYM A;  2E31 A;  1W8O A;  1J84 A;  5A1A A;  1WCQ A;  1KGY A;  3A22 A;  1XNA A;  2VCA A;  3PUI A;  2BZD A;  1DP0 A;  1CX1 A;  2Y6H A;  5DMY A;  3I2F A;  2ZEZ A;  2WAO A;  5DQ0 A;  5EJZ B;  4UI9 L;  3CQO A;  3T0D A;  1CZT A;  5JXG A;  4OMD A;  1GOF A;  3WSO A;  3MO4 A;  2BGO A;  3K75 B;  4PF1 A;  4MAD A;  3LEI A;  2C9K A;  3HN3 A;  2VM9 A;  3I2I A;  5CYY A;  4LQR A;  1SDD B;  3LPF A;  1W99 A;  3PUH A;  2J1V A;  2WAA A;  3ACF A;  2LW8 A;  2ZEX A;  1JU4 A;  2JD9 A;  5JR2 A;  1NX9 A;  1JYX A;  4XUN A;  3HNB M;  4AG4 A;  3LE0 A;  3HNM A;  3ABZ A;  1TVG A;  2VQU A;  3UES A;  2EIE A;  4ARY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...