4QDSA

Physical basis for nrp2 ligand binding
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
182
structure length
182
Chain Sequence
SHMFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-2
publication title Structural Basis for VEGF-C Binding to Neuropilin-2 and Sequestration by a Soluble Splice Form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 48
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdsA00
2ORZA 4P5YA 4UI9L 4LKSA 4OZOA 2VM9A 5C71A 2W1WA 4BK4A 1W9WA 5JXGA 5CYYA 1KGYA 3AC0A 3HN3A 2VQUA 4AAXA 3DYOA 2VCCA 1UZ0A 3ACIA 2W5FA 1P8JA 1JHJA 1OT5A 1XC6A 1CZSA 2WZ8A 4E8DA 4ET7A 1F4HA 4OMDA 1JZ6A 2V72A 5A1AA 1J84A 3OB8A 2PQSA 3HPNA 5JR2A 5LA0A 3FHQA 1NKGA 2W47A 1XPWA 5DPNA 4RYDA 1NAEA 2J1VA 4OMCA 1UX7A 1W8OA 2BBAA 3GGLA 3IAPA 4DXSA 3WSOA 1H6XA 4QX1A 3K77A 1D7PM 3D3AA 2W1QA 3SEEA 4XVHA 4DXRA 4M4RA 1ULOA 1OF3A 4JX0A 4QX3A 4CUCA 2ZEZA 3C7HA 5DN2A 2W92A 3SEPA 4A45A 4DXTA 1XNTA 3LPFA 1JYWA 1PX4A 4ARYA 4CU7A 2VC9A 3OEAA 2VMFA 4E8CA 3ACGA 3IB3A 4A41A 2WBKA 5HPOA 2WQ8A 2C9KA 2QQIA 2J1UA 3PUIA 4XUPA 1EUTA 4A6OA 5F7UA 1JZ4A 4LQRA 1GMMA 4JKMA 2XONA 5EIYB 1CZTA 3VDCA 2Z4FA 3OGVA 3UNPA 2Y6KA 3SKJE 2J7MA 1DLCA 1DYOA 2YG0A 3ABZA 1BHGA 2E26A 3NJVA 1IQDC 3VDAA 1W0NA 2VL4A 3MUY1 3WNPA 3P6BA 3ECQA 4OYUA 1I5PA 4DUVA 5C70A 1KEXA 1RYYA 4MO3M 2E32A 2X05A 3J7HA 1UYXA 3IDAA 4BJ0A 5IYYA 3LQCA 4XUNA 3OGSA 2EICA 4D0QA 3C8XA 1UY4A 3HNMA 4QPWA 1UYYA 5G05L 3K4AA 3T08A 2R7EB 1K45A 4A3ZA 1K12A 2QQNA 1NUKA 1O8SA 1EUUA 2VZTA 2WO3A 3CZUA 4PF1A 2VZSA 2WUHA 3VD9A 3A21A 3ZM8A 2CDPA 5FUIA 5IFPA 1JZ2A 4A44A 2WABA 3DYPA 2VCBA 3A7QA 1CIYA 4W4ZA 2L9LA 3I2IA 1UY3A 1O8PA 4XUOA 2OKXA 3T0DA 3UETA 1UMIA 4JHZA 2EIDA 2VOTA 4QAWA 2V4VA 1W8NA 4GWIA 1JYNA 3E1F1 2B4KA 2BERA 2QQJA 2W9XA 3HNBM 1JI6A 3VDBA 3MV11 3PUHA 2WN2A 4P02B 4CU6A 3IIIA 1TG7A 2QQKA 4DEVA 2VZ1A 3ACFA 3DYMA 5G04L 1GQPA 2W94A 2VMCA 2BGOA 2VZPA 3HNYM 5B4XA 3OGRA 3LE0A 1XNAA 3WNNA 2W87A 4CUAA 3I2HA 3I3BA 4GWJA 2YB7A 3LEGA 1UY2A 1WCQA 4MADA 1O59A 2ZXQA 4M4PA 5C7GA 4ZY9A 3NRUA 2RVAA 2ZEYA 1UYZA 1WKYA 4UOJA 2WO2A 2YFUA 3C7EA 2XHNA 1UXZA 4XUTA 3WNMA 3WEZA 3I97A 3VD5A 3HEIA 3ETPA 3CZJA 2VJXA 2YC2A 2C4XA 1JYVA 1JZ5A 3FHAA 3T0AA 3CKHA 2VZ3A 3W5MA 2WYSA 3I2GA 2C26A 3CDZB 2Y6JA 3SKVA 2W95A 3VD4A 2HYXA 3THDA 2B9VA 4KMQA 3BN6A 4YPJA 2VTFA 1GOGA 3NNGA 2VMDA 4QX2A 1GUIA 4CU8A 2RV9A 4TTGA 3WNKA 4BXSV 2W1UA 2VZRA 2DCKA 1JZ8A 1US2A 3P1IA 2VMEA 2BGPA 2E31A 2JKXA 3OG2A 1YQ2A 3W5NA 2VZOA 1L7QA 1JU3A 1JU4A 5I0DA 1NX9A 4JKKA 3T2PA 4UAPA 5DMYA 4LHSA 3ACHA 4RN5A 3CIHA 5IJRA 1OF4A 2ID4A 1UY0A 4L0PA 2LS6A 4MGSA 2JDAA 4CUBA 5JXIA 4BDVB 2EIBA 3LEKA 1R64A 1W99A 4BK5A 3I3DA 2WAAA 1DP0A 4ZZ8A 5JUVA 2JE8A 5EJZB 4XZUG 3HOBA 2VR4A 2Y6GA 2DDUA 1GOFA 4QB6A 2VQTA 2WO1A 2J1AA 3WF3A 1JZ3A 1MPXA 3I2JA 1L7RA 1UWWA 3HJRA 4DUWA 1SDDB 3WF4A 2X10A 2XOMA 3VD7A 4QDRA 4QDSA 2JD9A 4CVUA 5JXJA 3FN9A 4KWUA 2BZDA 2W46A 2WN3A 4D8MA 1UXXX 2QBXA 2VZQA 4P08A 5JXHA 2Y6HA 4P00B 1ULPA 5J1XA 1GOHA 1GNYA 3I2FA 1TVGA 3A22A 4IUGA 2QQLA 5LA2A 4FI9A 2W1SA 1J83A 2YC4A 2RJ2A 3IAQA 2WDBA 3DECA 4MOAA 4ZXEA 4LPLA 2DCJA 3MO4A 3VD3A 3OEBA 2J1RA 3LEIA 3NQHA 1W9TA 1H6YA 2W3JA 3I2KA 3MBWA 3K75B 4ZZ5A 3WNLA 3THCA 1CZVA 2KD7A 3EB7A 1T2XA 1JZ7A 3I3EA 2YFZA 3WNOA 3CQOA 5IFTA 2E33A 3WF2A 4XURA 3C7OA 2J1SA 5IHRA 4HG6B 4KI5M 1OH4A 4AG4A 1US3A 3UESA 4A4AA 2CDOA 3BGAA 4QDQA 4W50A 4DEQA 4PT6A 5EJ1B 3GDBA 3T09A 2QQMA 4QX0A 3U37A 1HN1A 4ARXA 3MV01 5HXMA 3C7FA 1CX1A 2QQOA 3T0BA 2VZVA 2ZEXA 2VCAA 2Y8KA 2VO5A 2WZEA 1PMHX 2VZUA 3GXUA 3WQBA 5DQ0A 3A23A 5B4NA 1UMHA 2W91A 3WF1A 3CMGA 5LCWL 3T2QA 2J1TA 4XUQA 1GU3A 3NJXA 1SG3A 1PX3A 3C7GA 3F2ZA 2LW8A 5JMOA 1PMJX 5LA1A 2HLEA 3WF0A 2ORXA 1F4AA 1SHWB 4DUXA 1JYXA 2V5DA 2Y64A 3JXSA 4QB2A 2J22A 2X09A 4TXWA 2J1EA 3LPGA 4QB1A 4GZ9A 3T2OA 1LNSA 4A42A 2Y6LA 1OD3A 2WAOA 3FL7A 3OBAA 5CZKA 4OUEA 3K4ZA 4MGQA 1K42A 4JKLA 1W9SA 2EIEA 2XQXA 1K3IA 3GM8A 4W8JA 3K46A 4PQQA 4Z2AA 2ZEWA 4CU9A 3EYPA 1UY1A 3K4DA 3MUZ1
chains in the Genus database with same CATH superfamily
1Y9MA 2BFUS 1PGW1 4YNIA 4XETA 4XF4A 2KR2A 4LKSA 4OZOA 4AFAA 3MZHA 5CEHA 1XNDA 2R072 5K8SA 1QKQA 4COYA 1KGYA 1Q8QA 2VUAA 4B29A 4QPIB 4XQ4A 1BYHA 5J3UA 3N7JA 1W03A 1QHDA 1LU2A 1X8MA 1MS0A 4CXWA 4PI0A 4EN6B 4K8FA 1ACCA 1JHJA 1P8JA 4XFGA 1OOPA 4CEWC 2FMYA 4WM8B 1VBC2 3UL2A 3ATGA 4JDMA 4P5HA 4IE5A 1F4HA 1NY71 4GWNA 5CIRA 3T2TA 2A3XA 3PMSA 5A1AA 1J84A 5BPXA 3OB8A 4AI3A 2XR4A 4M3CE 5FIXA 5JR2A 5LA0A 1BLZA 2MEV2 2VNVA 3FHQA 1NKGA 2W47A 4LK7A 5DPNA 2SBAA 5FO8B 3VBUC 4E4ZA 5I91A 5F2SA 1NAEA 2J1VA 2ZGKA 4QXHA 4CP0A 4FAGA 1K5MB 1QU0A 1PM4A 4SLIA 3CJIA 2WQ4A 2BBAA 1H8TA 2DVDA 3R4DB 4ZS2A 3QBQA 3WSOA 1FV3A 3BU0A 2BDRA 2XWBB 1LOFA 1VBA1 3ORJA 4Q1PA 4FOQA 3ST7A 2OVUA 4IV3B 3NKTA 4AVCA 1D7PM 4FP2A 4H7MA 4MGIE 1DF0A 1FT9A 2EXJA 3JZVA 4HN0A 3LD8A 4HT1T 5FQ0B 2ZAAA 3MI8A 2ZZJA 1OF3A 2N7GA 4P9LA 4XF0A 4K6BA 5K0UA 1H8VA 4CDQA 5AFEA 4OZXA 1B35B 4MGKE 2BNNA 3W9AA 1RC6A 1J3RA 3MPBA 4ARYA 2VC9A 3POJA 4QM9A 4EQVA 2Z69A 2VMFA 3WR0A 5C6CA 1R092 2WNUA 4IEQA 4W6WA 1W8TA 2Q8OA 4OFGA 1OH3A 3KCXA 1V6MA 3KV9A 3RMYA 3SH3A 2G4IA 4XUPA 2NP0A 4EWAA 1OKQA 4D7YA 1RXFA 2JENA 3N35A 5L9VA 3I3MA 1J1TA 1YFXA 5F7UA 1ST8A 2BYVE 2ZACA 3RYKA 5AC93 2D97A 4FOYA 5DZGA 5T50A 1GMMA 2QDNA 3RYRA 5DDJ1 5L73A 3DN7A 4Q4W1 4LO7A 3VDCA 5FPBA 3RNSA 5A32A 1ND2A 4K1ZA 1XXNA 2NYYA 3H7JA 2CGPA 1MS5A 1REEA 3AMQA 3ZKYA 3ZDSA 3FFZA 1AXYA 1CAWA 2Y6KA 2PHTA 4UF0A 4YFWA 5A7NA 1DLCA 2IWGB 5E8AA 2YG0A 1BHGA 4ZU5A 1OBNA 2E26A 2VBPA 2VL4A 3RQ0A 3POFA 4YW4A 4OYUA 1UZWA 2FDFA 3WCSA 4MO3M 2E32A 2X05A 5FXWA 4TN7A 1BBT2 5C4WB 2A71A 5LBCA 3CNAA 1DGRN 5A7WB 3ON7A 1W8WA 2WLQA 1C5HA 3HNMA 1NCRA 2R0HA 1JYIA 1SPPB 3GBGA 4QPWA 2VMHA 3DCQA 3KWVA 2DTYA 4YLZA 5FYYA 2K46A 4NR1A 3H9AA 2XL9A 4JTNA 1PHMA 4LUMA 1PGW2 4Z82A 5CFCB 3DEMA 1YFYA 3BYWA 1C8M3 3UGHA 5A7PA 1YYNA 2RM23 3HT1A 1EUUA 4D6QA 1M06G 2HWE1 5GLWA 3CZUA 4MG2A 1F2NA 3AX4A 4PF1A 3M1HA 1D2SA 5IWFA 4JCKA 1ZZCA 1W8ZA 3MLLA 5GLVA 1GNHA 2CWMA 5FUIA 3SLIA 3USSA 1RUJ2 1BKZA 1V6JA 1ULDA 1STMA 3VKFC 1S0IA 5A3PA 1DYKA 1OI6A 4AI8A 1LCLA 2L9LA 4YVSC 5FCCA 3RGBA 3I2IA 2DBIA 1O8PA 5IK5A 3T0DA 3WG4A 5IVFA 3AKQA 2AUYA 3U11A 1UZZA 4PLNA 2EIDA 2R1BA 1LGCA 5CADA 3GHMA 1F8VA 4O65A 4QHBA 2TBVA 4XQDA 2BUKA 2VW1A 4QQOA 3T4HB 2R063 4GWIA 5FP3A 3E1F1 3TEXA 5F9TA 2NPIA 4GULA 3BIWE 2FZ1A 3J9SA 1LOEA 4N7UA 4CDWA 2FHRA 2QQJA 2W9XA 3H1WA 4YG3A 5DAPA 3RYPA 4EWDA 3OGGA 5FZCA 1JI6A 4MVTA 5DABA 2C6SA 2DCTA 3MV11 2RS53 3PUHA 1SLTA 2RS33 3WW1A 2D7FA 4Y4RA 3IM0A 4V2VA 5HV0A 3UYJA 1V0AA 1RUF1 2RDQA 4AE2A 4Q4Y3 3W20A 3MIGA 2QQKA 4LBQA 1OVPA 1MZ6A 1EV13 2G1MA 3DYMA 5JOYA 4WVMA 3VBFB 2BVVA 3E5UA 1CESA 3AP7A 4L9BA 3U78A 1PMIA 2OZJA 4Y22A 5FMDA 1DGLA 1UD1A 4E27A 2NM1A 1PO23 3AYCA 4LIUA 3LOIA 5T5PA 3ZFFB 4CUAA 4H2AA 4GWJA 3FBYA 1WCQA 2ZGQA 1W2TA 3UT0A 2ZXQA 3WVJA 4CDUC 5C7GA 3WG3A 4XAEA 2ZX0A 1O4TA 4HKWA 4ZY9A 4BH9A 3O7OA 3R0RA 2ZEYA 1WKYA 4UOJA 2A6WA 4HSLA 3ILNA 4D3WA 4JHTA 3OYWA 5I0UA 5LK7B 2W2IA 3S57A 3IBMA 2D6KA 1EAH3 2ZKNA 1O91A 3WDTA 3WEZA 3MIEA 4Q4W2 3ETPA 4GJZA 3HBKA 4W65A 2VJXA 3J26N 4M01A 1CPMA 3ZXJA 2ZGTA 2JB4A 1VRH2 4NPMA 4XFHA 2GC3A 2ZHLA 3PU8A 4XBNA 4MV2A 5LY2A 1V00A 5BNNA 3T0AA 1UX6A 3CKHA 2E63A 3LF7A 3I59B 2WYSA 5FOJB 5CISA 5L7OC 3O0VA 2YBSA 4Q8KA 3JD73 2RDNA 4KG0A 2W95A 1GQGA 5JOXA 2HYXA 4QMAA 2IXJA 5KHJA 5HCFA 4Y1VA 2DFBA 4DY5A 1Y7BA 2VTFA 3AKRA 5AC91 4J6GA 4LO6B 4IESA 3RI9A 3VDDB 3WDVA 3WINE 4BM8A 1CONA 4FQZA 4LMFA 3ZYHA 3D5OA 4UFIA 5A6YA 2QE3A 5FZFA 4QX2A 5H9RA 4AVTA 4YW7A 4GALA 4CU8A 1COV2 4IEZA 3N9QA 2ARCA 1F5JA 2ZCWA 5ABJA 1ZRIA 3WW4A 2CL2A 2DCKA 1JZ8A 1Q8SA 1KJLA 5EXOA 1POV0 3N7LA 2Z42A 2WL1A 3W5NA 1L7QA 2WWJA 1OOPC 3E6BA 5DUUA 4XFAA 3T2PA 3DPRA 3SISA 4QGMA 1ND3A 2IXIA 2CNAA 1OPOA 2NN8A 3ACHA 4ZU7A 3CIHA 5IVBA 1JBCA 3ZYGA 3TWIA 4R8HA 1ONAA 2D44A 5LATA 3KGLA 2OPWA 4HZFA 3JB4C 4Z07A 4AI0A 2JIGA 5DAQA 1LULA 1UPIA 2VBBA 4L0PA 1BEV2 3NJYA 2IZWA 4MGSA 4GJYA 4IV1C 5DAWA 5FYIA 1C8M1 4CUBA 5JXIA 2RM21 2OT7A 3TRSB 1D4VB 3IIAA 2YDEA 3WQ0A 1BVVA 3BOPA 5I8SA 2J42A 2GMEA 5F5IA 5E6HA 1GZWB 2TEPA 3I3DA 4NRQA 5D8AB 4ZZ8A 2JICA 5JUVA 4CCLA 2G9ZA 3WNXA 5FZ1A 5K0UC 4HKLA 3JUUA 4IL7A 2PAEA 1U5XA 2HJIA 4CDQC 3GALA 4FXGB 1BZWA 5C33A 5FMOL 1PK6B 2VR4A 2Y6GA 3VBOA 2DDUA 3ZYFA 2VQTA 2WO1A 4YW6A 4BB3A 3I2JA 2XLAA 1RJ8A 2FDIA 5JZGC 4IETA 1AYM2 1QGLA 1J3QA 2WNUC 1QQP2 4U36A 3B01A 2EA7A 4BWOA 4QGLA 3WF4A 3LIGA 3T30A 3GJBA 4QX7A 5HXVA 4EN7B 3VD7A 5BNPB 2ZBJA 1VALA 4WV8A 3AZZA 1KQRA 1PZ9A 4XF1A 4CVUA 4ES8A 5JXJA 3DL3A 3FN9A 4YGDA 1SQ4A 2XUEA 1G8WA 2WN3A 2DVGA 3MIBA 2RS51 3AP5A 1FPN3 2RS31 5IVCA 2Y6FA 2B9UA 5CBLA 4HK8A 1Z0HA 3L2HA 4TZDA 4XPVA 5C5TA 4Q4Y1 1VP6A 1W6NB 2YMZA 3Q9OA 3I2FA 5J1XA 3V0BB 4YGBA 4COZA 1V9U3 1HB1A 5FLHA 4AHWA 5LA9A 4FPGA 4I02A 2A70A 4V2WA 2QQLA 5LA2A 3WUCA 4YYOA 1QH6A 1PO21 1NCQA 1YCIA 2VOWA 4D6SA 2Q1FA 2A6ZA 2XJPA 3DECA 1NQDA 3WG1A 3IWZA 1ZX5A 2QZ3A 3ELNA 1IG0A 3GCXA 3ILRA 4LPLA 4Q0VA 4XFBA 3LFMA 4RQPB 3J8F1 1HRI3 2RMU3 1AR73 3LEIA 2P2KA 4YWAA 3NQHA 4K20A 2SLIA 4NJ4A 2VOXA 1IS4A 1TME1 2IFWA 2R042 3FC0A 4MXVA 4NAOA 1W39A 4XTPA 5D1IA 4CPBD 5LASA 4R9AA 1LGBA 1NCRC 3PUQA 5EWSA 4AAPA 2DUOA 2VU9A 4R4XA 3H0OA 2KD7A 3BODA 4YGCA 4XW3A 5CKNA 1EAH1 1NE6A 1NZCA 2PHUA 4TLGA 3CQOA 3RZZA 2GNTA 2OUJA 1F5FA 2J1SA 3ZFEB 2HWB3 4HG6B 4CEWA 5FXZA 2R32A 5FV3A 4BZ4A 4AG4A 4I09A 4LHNA 4OHVA 4IEVA 1QXJA 3KT4A 1CD3G 1QIQA 4DEQA 4Q27A 4W50A 2DTWA 3IKWA 1UKRA 1CJDA 4AW7A 4QX0A 3VBUA 1HN1A 2XPJA 1E57A 4XXAA 1UQXA 4DZGA 3NV2A 4RD7A 4SBVA 5CA6A 2QQOA 2XL7A 1UN1A 2VCAA 4EYUA 2WNOA 1NZIA 3MLJA 5FREA 3AM2A 4FPLA 5IK7A 3GXUA 1UYPA 3LZZA 3LA7A 2ARXA 2JE9A 5GKAC 5DQ0A 5FPZA 4IE4A 3SCHA 4JGZB 5B2GB 2QZ2A 4KBZA 3CMGA 2PA7A 5LCWL 1FX5A 3VBHA 4DMIA 3B69A 3S7EA 4K40A 5IVVA 3NJXA 1C8M2 1AR93 4NHMA 2RM22 2BU9A 4QXKA 5FMBA 1O5LA 2FMDA 2P3KA 3BIEA 4FTEA 1GSLA 2Z2SB 1XE0A 3V0AA 3S5AA 4OUSA 3POYA 1ODMA 1GBGA 5F5AA 1BBT3 5FYHA 4A2UA 5HBAA 3WF0A 5JDBA 4X8NA 2ORXA 3LWCA 3N9OA 3ACLA 4Q8LA 1VR3A 3PURA 4NIAA 2P6CA 2Y64A 3JXSA 4QQLA 2J22A 2X09A 4H14A 4TXWA 2J1EA 3LSEA 4YSFA 1S0GA 3E5XA 3B3QE 4QB1A 4QHZA 4WM7A 4GZ9A 4BQ5A 2QVSB 5FYVA 2Y6LA 1U12A 3WX5A 1W6PA 4PIZA 5FZ0A 2DCZA 5FY7A 3OBTA 4XYXA 5L36A 1K42A 4R4ZA 2R062 1R082 1KD7A 1A34A 4XFFA 3MIDA 3AJZA 3GM8A 1Q5OA 1XB9A 3DF0A 5K7PA 4CUGA 3K46A 4Z2AA 5FR3A 4LIVA 4BQXA 4HMZA 4Q0PA 4RGAA 3PUAA 5J7MA 1UY1A 5JI7A 2CGNA 3MLKA 2RS52 3MUZ1 1RUJ3 2RS32 3NV3A 4UI9L 1DLLA 4XDPA 4XTMA 5KHIA 1WMFA 1POV3 1X9PA 3WQ1A 4MUVA 5C3PA 4JRLA 3KLSA 4Q4Y2 5CYYA 5JXGA 3AC0A 3ME2A 1EV12 3EBRA 2VVDA 3Q8BA 2FD8A 5APAA 5EYYA 2HH9A 3MFCA 2DU1A 4O7XA 4YVWC 4H55A 2FBEA 4LHKA 2VCCA 5L7OB 4L11A 3E6DA 3JBG3 5BNNC 2EXIA 3EHKA 1YC61 1OT5A 2WFF3 3LEMA 1U5IA 1PO22 1XC6A 2V09A 1H30A 3N9MA 1SEFA 2JE7A 3K3NA 4EV0A 3SCGA 1ZREA 5FJKA 1DBNA 1VLNA 5FZLA 5E1RA 3MF6A 5AVPA 4DB5A 3B7MA 3KS7A 2RR12 5JIAA 1WLWA 1V6IA 2ZMLA 4RSUA 5FLJA 1OFNA 4ASMB 3JQXA 5GZCA 1CJPA 5J37A 4UW5A 1AXZA 1FPN1 3RMXA 2JDYA 2PELA 4FPKA 2WT2A 5A80A 1O3RA 1FNZA 1CPNA 4PI2A 1YXWA 3INAA 2UU8A 4QD2A 5FYCA 3AVSA 5FYZA 3SXWA 3V64A 1VBC1 3OGJA 1SBDA 1UX7A 2P1BA 1W8OA 2R0FA 1NT0A 1EAH2 4GQ7A 1V9U1 5ABJC 4DXSA 5J36A 1JODA 5GLZA 3HR9A 2PHDA 1OOPB 2GU9A 4YVSA 3KV4A 3VHNA 4DRRA 5L9BA 4BQWA 5C8CC 1OA4A 2V4AA 2JWPA 3AZYA 3PTRB 3O1UA 2D6LX 4XVHA 4M4RA 3THTA 3OSDA 5F2WA 4IGPA 4QX3A 2ZEZA 4CA9A 2R16A 1HB3A 1AL0G 1ND3C 2W92A 1BK0A 3NL1A 3OY8A 1HRI1 1XNTA 1AR71 1O5UA 2RMU1 1GR3A 5E88A 5EYXA 4E4DX 1UF2C 2LM3A 3TBDA 4CSWA 4COWA 5A33A 4XEZA 1PX4A 1GP6A 2D5HA 3CJIB 3JD72 4Q4X3 1H8TB 4Q26A 4CU7A 2JDPA 4NIGA 1VRBA 1S0EA 1ZZ9A 1LOGA 2I07B 3FLTA 1L3JA 2E6VA 2OA2A 3IB3A 4FFGA 4NVPA 5HPOA 1MQTA 2XJSA 3R4UA 3IDCB 1ZZ7A 3HWJA 3RFRA 3AYAA 3JU9A 2HWB1 4QGNA 1EUTA 5EHDA 3HQRA 2PN5A 1YIFA 2O8OA 5K0UB 4KQ7A 1KFXL 4FPOB 2OUHA 2EIGA 1HN0A 1IPKA 3NAPC 4BQ1A 4CDQB 4LQRA 2ZTNA 3U4SA 5BYNA 1JZ4A 4JKMA 3UKVA 4B4RA 5FUPA 1UO9A 2VAUA 1LHNA 3ZDVA 3AP6A 3B00A 2ARBA 5SV8A 2WNUB 3UKTA 1MVQA 3VBOC 2H0VA 5A3TA 3BALA 2J7MA 5FDBA 1HQLA 4JDOA 5FJHA 1DYOA 4CDUA 4QU1A 3OBZA 2TNFA 1IQDC 4B7EA 1PGL1 2AREA 3P6BA 3CLPA 4NE9A 2ET7A 3LCPA 4DUVA 2Y0OA 3URFA 4LLFA 2VNRA 1UYXA 3IDAA 1COV3 4TLFA 5EP9A 4FSJA 4BJ0A 5IYYA 4KL1A 1DGWX 5FYMA 1ZYBA 1DGWA 1W6QA 1C4RA 3RSJA 4UFJA 3V65A 3ZX7A 2GP3A 4N90A 5A32B 4BOWA 4D0QA 1ND2B 1AR91 3VBRA 1LOBA 3BTXA 5BNOC 2LROA 2RS13 1WLDA 1CAWB 1QDOA 1UYYA 2VH9A 4IE0A 4UF0B 5G05L 4ZHNA 1DZQA 1PIV2 2CYFA 2VY0A 2R7EB 2BRTA 3VL9A 2H6CA 4A3ZA 4A7ZA 5FZ8A 1CWPA 1LEMA 1O8SA 1BBT1 1W2OA 1Y9QA 4M3CF 4ZONA 2WO3A 2NQYA 2Z79A 1NYWA 2ZPXA 1I5ZA 1HJGA 3DKQA 2W0XA 4GKXA 1GZ9A 2BV4A 5IFPA 1E5RA 1B09A 5ANQA 2AEYA 4DRVA 4GH4C 1BEV3 2VCBA 5JI9A 1X7NA 2ATFA 2HWF2 1UY3A 4XUOA 1D0HA 3Q8CA 1UMIA 2MNGA 4JHZA 3TNPB 4AI1A 2FDKA 1LR5A 2WQZC 3OD4A 2QFEA 3P5BA 5FP4A 1QOTA 2GN7A 4KGQA 4ZXKA 3VZNA 3ZSKA 2KA3A 1Q3EA 1RUJ1 2G19A 1FPN2 2XXZA 2K0GA 1WW7A 2BERA 2C24A 4LITA 4LE4A 1POV1 3KF5A 3LGRA 1PVC3 3DXUA 5FAXA 3SHRA 4IEXA 5LB6A 5EPAA 1V9U2 3BCWA 1AYM3 1BQPA 2XG3A 3IDBB 1QQP3 2WN2A 4P02B 1LOCA 3H8XA 3NJZA 1N1VA 3JBG1 5FMCA 3O12A 3O0WA 3FJSA 3QOPA 2WFF1 3RZLA 3ACFA 4MGTA 4NIHA 5G04L 5CG8A 1GYKA 3ZO0B 2K2SA 2BGOA 2VZPA 3HNYM 4IEOA 5B4XA 1GQHA 3NNFA 1RUNA 1HRI2 2RMU2 1AR72 4IV1A 4CDWB 3RZHA 3WNNA 4FOWA 2BEOA 2ZMKA 1YHFA 4WZCA 5T52A 1N3OA 2JKBA 4XF3A 4AR2A 4E2QA 5C3RA 3LEGA 1S2EA 4N53C 5KWRA 5H9PA 1XSRA 1OLMA 4UW4A 2ZHNA 3W58A 3VBHC 1FV2A 2BW8A 4LBQB 5FZMA 4UFMA 3POSA 3IDEA 5FBZA 3NRUA 4XXPA 1UYZA 2XLGA 4WVMB 1G9FA 2PQQA 2HWB2 3WQ7A 4DOUA 3KVAA 3G6JB 4XDOA 2YFUA 4GAZA 4Y22B 1H1MA 2HWD3 5FO7B 1GNZA 1UXZA 4XUTA 5JZGA 4OI0A 1SACA 1X9TA 4GB32 3ZFGA 3FHIB 4QHOA 3HEIA 4LKFA 5FZOB 4FTSA 2R043 4URTA 5ANNA 4BISA 4F83A 2PHRA 3OUHA 5FXVA 1DG6A 1C1FA 2C4XA 2PLV3 1LRHA 2Y33A 2Z5WA 1NLQA 3CF6E 5I0TA 4WM7C 2D93A 4Q4X1 4ZU4A 5FPAA 3FHAA 1AR63 3UJQA 1PGL2 2YHJA 1U0AA 2GN3A 3E5QA 5L19A 3KM5A 1GLHA 4E2GA 3JQWA 2BFUL 4AVVA 3M4FA 3CDZB 3OYWB 5E89A 2Y6JA 3B9CA 3BPSA 1CN1A 5C9AB 1VRH1 3BN6A 2JECA 2UWAA 2B46X 2X29A 3P3PA 3C3VA 4JQRA 4NPLA 5CU1A 5A3WA 1QF3A 3LA2A 1YQCA 1S0JA 4HN1A 1AR92 1ENQA 2VW2A 5FBJA 3VHRA 1IG3A 5BNQA 2VMDA 2FQPA 2LALA 2W39A 2WS92 3HMYA 4OI4A 3RZGA 1RL3A 3KHBA 1W8FA 2EALA 3H7YA 5BNNB 1EYBA 3DGTA 4S2GA 5KHKA 3WNKA 4BXSV 2W1UA 5FP7A 2FZ2A 4RHV3 1C8NA 1DQ2A 2EAKA 5C5UA 5GZDA 4FP3A 3NMBA 4LE3A 3ZPYA 1US2A 2YUEA 1YFUA 2BGPA 4Q1RA 2JKXA 4W6YA 4RR3C 1WMDA 1YQ2A 1NG0A 4L2NA 5JSPA 5I0DA 3FUQA 5EZWA 4CEYC 1NX9A 3ZXGA 3BVCA 4UAPA 4I3PA 3VLBB 1COV1 1UCXA 1IQAA 4ONUA 4KH9A 3H1MA 3OD0A 4LHSA 4QXCA 4B4QA 1GICA 1H2LA 4H7LA 2XJQA 3ZYRA 5LBEA 3U07A 2GAUA 2VULA 5BV6A 4CCJA 2A1XA 2DVFA 5ABJB 4QPYA 1R1ZA 4XFIA 1UY0A 3GZUC 4G3YC 1RHI2 1TQ5A 3ZYIB 2GALA 4YZ2A 1H1IA 2Q8EA 5EV7A 3CL1A 4YGEA 4IXLA 4L92A 4NMIA 4QXBA 4AFCA 4BDVB 1LHOA 1AJOA 2JJ6A 4XABA 3DPRB 1W99A 1VBD3 1G9AA 5GM0A 3ROUA 1UU4A 1S0FA 3AMMA 3DXTA 2LRPA 3ZMOA 3HN1A 3PJQA 2JE8A 4PJYA 3JBG2 2EXHA 4K21A 1R083 1BEV1 1OQ1A 1RGSA 2WFF2 4EWEA 4HVQA 1XJAA 2GH2A 3AMHA 4ZKTB 2QDRA 3TAYA 1EY2A 1L7RA 4JGYB 4DNYA 1UWWA 4Y1YA 3HJRA 4YM2A 3MIHA 5L9RA 1VJ2A 1SDDB 4DUWA 1MQTC 2XOMA 4EZ4A 3M2MA 1NOVA 2WA3A 4YG6A 3PVOA 3VB9A 3M3QA 5JOWA 2A6XA 4S2DA 5LZ6A 2F6BA 1LAJA 1PVC1 1QJFA 3USUA 2W46A 3J7NA 1BMV2 3D8CA 2VZQA 4PDWC 1AYM1 5JXHA 1C1LA 3KF3A 1QQP1 2VOVA 3VUOA 1WW4A 2JG8C 2CAUA 4CXYA 4KU7A 2MHFA 5FWEA 1O6UA 1ULPA 3IMMA 1GNYA 3DKWA 3VZKA 2PXJA 4I01A 2RR13 2CTVA 2WLPA 3OUJA 3M70A 4A7YA 3GZTB 4C1WA 1VBB3 4DO0A 2A75A 4NIDA 2ENRA 2GZWA 5CAZA 1J83A 4FT8A 1R1A2 4IEPA 4CCNA 2OX0A 4U2AA 3IAQA 4ASKA 2WDBA 4OI2A 4INDA 5JPNB 1JMUB 4FFFA 3WDYA 4Q4X2 1JS9A 2WZPP 3VD3A 4RS5A 1SLLA 4DPNA 1GZCA 1W9TA 2E53A 3LDRA 4BIOA 4P9YA 2ZA9A 3POEA 2GSYA 1YFWA 3VBRC 1AYN2 4ISQA 5A7OA 1VMHA 4AQ2A 3K75B 1V6LA 3ZPOA 3RVHA 4FO9A 1WCKA 1T2XA 4YVWA 5F6KA 1JZ7A 4LT5A 2VUCA 1OURA 4JQTA 2PHFA 5GZFA 1MS1A 5IUQA 5FYSA 1NCQB 4YZ1A 2BWAA 5IFTA 2DVAA 2E33A 2OPKA 3AFKA 3C7OA 3MHZA 5GJ6A 5CFDC 5IHRA 1K5JA 4L97A 2R041 4TYSA 1YUDA 1OH4A 3T3YA 3LFIA 1VB2A 2CHHA 4XJZA 3AMPA 1ULGA 1UOGA 3APBA 4A4AA 3UESA 4J25A 4LBQD 2CDOA 3BGAA 2PLV1 3MYXA 4QDQA 1EPWA 4PT6A 3TOJA 5FPUA 2X5IC 3A0KA 3PNAA 4GMP3 3T09A 3WT3A 2QQMA 4V1PA 4IQPA 1IS6A 4ARXA 1YRZA 4XHXA 4OI1A 3VKMA 1AL23 1CX4A 3C7FA 3H3ZA 4LEJA 1CX1A 3HQXA 2YPDA 5FZGA 1DQ5A 2VZVA 5J48A 1QEXA 2ZEXA 3ZXLA 4NWWA 5JWPA 2E7AA 1ZRRA 2QJVA 4YM3A 1PNFA 5C8CA 2Q30A 4K1YA 4CEWB 4E4SA 3FZ3A 4MHRA 1RMU3 2RS12 4XJ9A 5B4NA 1UMHA 1W2UA 2BTVC 2W91A 4NHXA 5FP9A 4CDXC 1HXS3 1WBFA 1JUIA 5KC5A 3B94A 4XUQA 1JOPA 4J1XA 1BXHA 2D6NA 3R05A 3VBUB 2ZGRA 2VMGA 4CCMA 4P14A 3C7GA 3TEWA 3IMNA 3VBSC 2VBDA 4TWTA 5FZ6A 1SFNA 1X36A 2VPVA 1PMJX 2VUDA 1RUC3 3ENRA 1WW6A 2JDMA 5A3NA 4IDZA 2CSGA 2JDUA 3OCPA 3ZIWA 1IS3A 5AFBA 3MEPA 1UL9A 1A8MA 4QB2A 1LJ7A 4Y5SA 2OYZA 3TEYA 4DQAA 4R9DA 1O4ZA 3WP4A 1WA6X 2DURA 3KB5A 2UWCA 3AYEA 5F3IA 1PO13 4OCTA 3VBHB 3RZJA 2OW4A 2Q8CA 1PIV3 2ZGNA 3OPZA 1BJQA 1OLQA 4A42A 4AHYA 1FAYA 3FL7A 4ORFA 3NAPA 4X8PA 1NLRA 3N9PA 4NUBA 4JKLA 4HBNA 1ODNA 1QXPA 1W9FA 4XE9A 1G9DA 1LGNA 2R6QA 4LUKA 4B8EA 5JIUA 3V0AB 4CCKA 2JG9A 3SH5A 1HX6A 5FZ3A 2UY9A 2ZEWA 5A70A 1PVC2 2P3YA 4Y1ZA 4QPGC 5I8TA 4IEWA 3PHMA 1RUE2 2P5BA 4UW3A 3ZOIA 2ORZA 4P5YA 1IPSA 2GH8A 2O0OA 1S1AA 3ZFGC 5SV5A 2HWF3 1F35A 2VM9A 2W1WA 3I7DA 4M0NA 2R061 1R081 5E16A 4M0HA 3SQOA 4WM7B 1OHFA 5JSOA 1E5IA 3ZSMA 1V6NA 3O1PA 4N43C 1W6PB 3IZOA 4QU2A 3HN3A 4F7ZA 1GZTA 1UOJA 2VQUA 1GWMA 5JPMB 4QQ2A 1S2KA 1ZVFA 2W5FA 2WSVA 1JYTA 1H4GA 5BNOA 2JXAA 1OUSA 1NA1C 1SFYA 1CZSA 3ZYPA 5DN2A 3LB9A 4ET7A 4OMDA 1JZ6A 2V72A 1FNYA 1EV11 2JEMA 2UY8A 4IERA 2PQSA 2ZGSA 4Q4V3 4EN0A 2ADEA 4CZSA 2B42B 2P37A 1ASJ3 4OHYA 1KDKA 2V73A 1L7LA 3ZR5A 3U0ZA 3RJRA 4PQ9A 1ZNPA 3ES4A 2HWD2 2RR11 3IAPA 1I9RA 4GH4A 3SH4A 2NLRA 4CCCA 3AVRA 3ZSJA 4CTEA 4UFLA 4LJHA 3N7KA 4MX3A 4LNVA 3K77A 1LU1A 3UKNA 4C0BA 4OUMA 2P3JA 3D3AA 1XNCA 1ULFA 1Y3TA 3SEEA 2PLV2 2BGCA 4KWLA 1LB2A 4N9HA 4JX0A 4C1XA 3HAGA 1HLCA 4O9EA 2CGOA 2E51A 2BOJA 1QY4A 3ZN6A 1AR62 4M3CA 2IVJA 2VQAA 4AFBA 2WT1A 5CVRA 1GWKA 3TYJA 4XBQA 5DZEA 3WW2A 4HANA 1RUI2 4P9GA 3OEAA 5A7QA 3TN93 4PLOA 2RJLA 5CNAA 5GZGA 4YVSB 4GB33 4W6XA 2B39A 4A41A 4OHXA 4QQHA 2WQ8A 3WG2A 4HOOA 2C9KA 1DQ6A 1ENRA 2J1UA 3NO8A 3PUIA 4JTOA 4KU8A 1OXCA 1S2BA 2E7QA 5FLIA 3O1TA 2WC2A 3ZSLA 5K4LA 4K7JA 4XILA 2X8KA 5H9SA 2RDRA 3JD71 3OY8B 2WJSA 4OVEA 3ZLIA 3K48A 3NV1A 1IS5A 4QPIC 4RHV2 2ZGLA 1OFSA 3ASIA 3VKNA 3QH6A 2CU5A 2XJTA 2XONA 3GNEA 1G6NA 4GMP1 1WBLA 1PVXA 1H2MA 1OVSA 3OGVA 4Y3OA 3SCFA 4CCDA 4N9IA 4PCRA 3ZXAC 2ARAA 5A1FA 4N53A 4LBKA 4WM8C 2HYKA 3SKJE 1AL21 2YBPA 5ACA2 1REFA 1MQTB 3ABZA 2A7AA 1VAVA 1QWRA 3X29B 1YQ8A 4FTBA 3WV6A 1W0NA 1RVF2 3MUY1 3WNPA 4ATFA 4KG8A 4J1WA 1DGRA 5FY8A 5FZEA 5HV4A 2WS93 5BY5A 5FZBA 5C70A 5T55A 1RMU1 2D6MA 2VUJA 3J7HA 4XOGA 2GP5A 3MW4A 1ULEA 1W0PA 3LQCA 2WO7A 3AMNA 1K5MC 1AVBA 1W2AX 3IPVB 4XUNA 1HXS1 1BMV1 4RA0A 2UYBA 2WKKA 3OGSA 1O3QA 2EICA 1QJU2 4CP2A 3C8XA 5FZDA 1HKDA 4FVVA 1LODA 1UZYA 4XCBA 1FOD3 3T1MA 3N9NA 1WCUA 4YW3A 4IV3C 5FFOC 3T08A 4CDUB 1OLRA 1VBD2 4CP9A 1MS9A 1K45A 1RXGA 3FLRA 1RUC1 3O1RA 1NXMA 2QQNA 1NUKA 1XNKA 4Y5Z0 5GALA 3UGFA 1WA4A 4BQ2A 2B45X 1MS8A 3EQEA 3CBNA 3HD8B 3MFAA 1RUOA 2HEVF 5F37A 2VZSA 2WUHA 5LEKA 3VD9A 1HB4A 3A21A 3ZM8A 1W90A 1B35C 2Q1ZB 1H4HA 1RUG3 1DQ1A 2CDPA 1W6QB 2WWSA 1UNBA 1PO11 4OLLA 1JZ2A 4ISRA 1W6MA 1FATA 1PIV1 2I74A 2WABA 3MPPG 1RHI3 4RS5C 4Y20A 3VBRB 4AVSA 2P4EA 2ZGUA 3A7QA 1CIYA 5BXXA 1UAIA 4BXFA 3E97A 3OTFA 3AL5A 3SNMA 1SFPA 3GJAA 5EJ3A 3AZWA 2QTWB 1KDMA 2OKXA 4Y26A 4Y5TA 4YZ4A 3UETA 2BPA2 1KS5A 3ES1A 3RWKX 4A7KA 3B93A 2XJUA 2VOTA 5KC6A 5C3SA 1CAXA 4DIQA 2HKXA 1JYNA 5A6QA 2YGLA 4MSVA 4OHWA 1CAUA 2DV9A 3RI8A 3GCWA 1Q56A 1RTVA 2VVFA 1DU3D 2HWF1 2XBO2 4HK9A 4NN0A 4S2HA 4RR3A 3SC7X 1XSQA 3D6EA 3HNBM 4N8MA 5H9QA 4D94A 3VDBA 2UWBA 4CEYA 1OQEA 5DAVA 1O4YA 1Y9GA 2F4PA 3R6SA 1VBB2 4AEMA 4UXAA 4CU6A 4LKEA 4PIXA 2IXHA 1HRV3 1TG7A 4DEVA 4MXWA 1HQWA 3AJYA 3BI3A 1DZRA 1MACA 4HXCA 3AFGA 1GQPA 2W94A 1AF9A 2VMCA 3U1XA 4EE2A 1IZ3A 3OGRA 5FYUA 4BE3A 4TSVA 4Q4V1 5C4WC 4R9BA 3U10A 3ZVXA 2W87A 5J96B 2EAAA 2JX9A 3S6PA 1D4M2 4COVA 3KVBA 1G9BA 3I3BA 2A3WA 1ZBA3 2DVBA 1N47A 1O59A 1DZTA 4HONA 4B4PA 1GKBA 4KNCA 4M4PA 5CFCC 3WZ1A 4FAHA 2GMMA 1R1A3 3ZKUA 4AVAA 2P34A 3DV8A 4Y24A 4CP1A 2WO2A 2YU2A 3JCIA 2HWC3 1MZ5A 4IV1B 5FPVA 4EZHA 2IC1A 2NMOA 3Q8EA 4AF9A 2WNVA 3CZJA 1JOJA 2AENA 3WDWA 5HI0A 5IVJA 1OPMA 4BMBA 4NROA 2NZ9A 3CJXA 1VBE3 1AYN3 2YC2A 4IW3A 4YARA 1FXZA 1N1SA 1ZRFA 2ZKLA 4LR4A 4CE8A 4LLOA 1AL22 3M7AA 4MHUA 2DU0A 3TN91 2FDJA 4AEDA 4PDWA 5FZAA 2VZ3A 1TNFA 3ITQA 1Y4WA 4GB31 4EN9B 2JG8A 2C26A 3O0XA 4AGVA 2D6OX 3N3HA 3WLUA 1RMU2 1RUH2 2JG9C 3SKVA 1LECA 3VZJA 5JZGB 3VD4A 2UURA 3ZFGB 2XUMA 4A6SA 1F31A 2Q4SA 4Y1UA 2B9VA 4KMQA 1HXS2 1KXGA 3RPQA 1W2NA 1PM7A 1WD3A 1XYPA 4YG0A 4D7SA 5JMCA 1FYUA 1OC1A 4K9SA 5FZ7A 1HJFA 1GOGA 1ULCA 4MLOA 2EVXA 2QQUA 3OOXA 5A6XA 2AZ5A 5T3NA 3CU7A 2PYTA 5A3LA 2P3IA 1RUC2 3VBFC 2ZX2A 4FPHA 2VE1A 1UU6A 2VZRA 3VZOA 2LUWA 3P1IA 3S5QA 3QH7A 4XACA 2E31A 3LA3A 5DAXA 1VMFA 4I2OA 2VZOA 1WGPA 4EN8B 5A6ZA 1JU3A 4DXZA 1JU4A 2D5FA 2XJVA 3AXDA 2WS91 3ZFFC 3AP4A 1PO12 1Q8VA 1RIRA 4JKKA 4ZS3A 2OS2A 1Z7S2 4BPZA 4N7IA 2XMLA 4H3WA 1W3VA 1YI7A 3H8UA 2YPJA 5CFDA 4QKFA 4XZPA 5IJRA 4NRMA 1Q8OA 4AEJA 1OF4A 3FBMA 4OHZA 1FOD1 3KV5A 3POIA 3Q8AA 3R4SA 2I2SA 1NLSA 3KT7A 3U4XA 3TB0A 1ZA4A 2VG9A 2X5IA 5DZFA 5FK7A 2E9QA 1GP5A 2LS6A 4YW2A 1NCRB 2ZMNA 1H2NA 1RUD3 2EIBA 2WYFA 3PU3A 4Q29A 1UOFA 3ALQA 1R64A 2Q5TA 1S55A 4AHZA 2ZGPA 2Y0IA 2AH2A 1SMVA 4M00A 1WUVA 4AEKA 3NV4A 4BK5A 2CY6A 4HL0A 5F3GA 2PMWB 1XBFA 2WAAA 5D2AA 4QX5A 5TSWA 5EJZB 2ZGMA 1FMD2 1UOBA 2RG4A 1RHI1 4KGGA 4BLJA 1KRIA 4FPEA 3KSCA 1GOFA 4QB6A 5JVVA 1WCSA 2J1AA 2VNGA 1AJKA 4NHLA 3VN4A 4CDXA 1MPXA 1JZ3A 3VV1A 2C9AA 1E5HA 3EJKA 1RUE3 4JVAA 4Q4V2 5F6LB 5T5JA 1WW5A 1C5IA 2YBKA 3MIFA 5DXDA 1ASJ2 4E9KA 2X10A 1S0CA 3VBSA 3VDDC 1W04A 3MGUA 4D69A 4QDSA 1YIPA 1J1LA 2JD9A 5IT6A 3BKZA 3KT1A 3VKOA 4KWUA 1H1AA 1LEDA 3KGZA 4GKYA 1RUF3 4RFRB 2DF7A 3ZXEA 2AC1A 4AQSA 4BMEA 2VOKA 4FOVA 4P08A 3H8OA 1GV9A 2R30A 4AGRA 4GMP0 2ZX3A 3GZEA 3QCWA 1A6CA 4B7KA 4QKNA 1HRV1 1GOHA 4DY3A 2Y38A 5FPLA 3OJBA 3A22A 4X6QB 2V5YA 4C91A 4IUGA 5FO9B 4FI9A 4I0AA 1N3PA 1OQDA 3FE5A 1CQ9A 4FPFA 5EQUA 5J09A 2XQRA 3LDBA 4MOAA 2QQVA 1LHVA 1C57A 3USUB 2VW0A 3BTZA 3FFQA 3OPTA 3TN92 1W8HA 3MO4A 1ZBA1 4QPGA 2JD4A 3MW2A 5LK5A 3OEBA 3WDXA 4LHLA 1A3KA 1FI2A 1OSGA 1CAVA 4S2FA 5C3QA 4GWMA 2W3JA 1SBEA 1YEWA 2R1DA 3I2KA 1DQ4A 3MBWA 4LO4B 4XFCA 1R1A1 2WZR2 1TMF3 4HPKA 4ZZ5A 3MDPA 3HVDA 4N43A 3THCA 3NWKA 1CZVA 2RE9A 3PVEA 3WNLA 2YGMA 2VTXJ 2OXBA 4AI2A 2HWC1 4LA2A 3I4IA 4YM0A 5D8AC 3I3EA 2YROA 3WNOA 4GXLA 4JAAA 2GNBA 3KMHA 1W8UA 4UT5A 3VKLA 5BUVA 1NA1A 1PZ7A 2WT0A 1N1TA 4KI5M 1AXKA 1VBE1 1AYN1 1RUI3 4RS5B 1HQNA 1MZFA 1PK6C 1US3A 3AYDA 4NIIA 4B1LA 1QMJA 1LKNA 3KCCA 2GC1A 1VAKA 1SCSA 2P6HA 5IK8A 1AR82 1UPSA 3U37A 1QJY3 4GD4A 4HLTA 2AACA 4GA9A 1KJRA 1QJX2 3PIGA 4YVWB 3HQUA 2XWJB 4Z8BA 5BNPC 4ITCA 1TEIA 2RJKA 4UYBA 2KXLA 2Y8KA 1AX2A 1W6OA 4Q0SA 2ZABA 2WZEA 2VZUA 3I8TA 3WQBA 5FY1A 1IKQA 3WW3A 1FOD2 5C8WA 3A23A 5A3MA 3M3EA 3WF1A 5LW9A 4PHZA 1XU1A 2DUPA 5ACA3 5FY0A 2J1TA 1GU3A 1RVF3 1PZ8A 1SG3A 1PX3A 5IW0A 4WVVA 1VMJA 1VB4A 2F4LA 2VXJA 4URAA 3QLQA 5FYBA 2HEWF 5FPXA 5JMOA 5HCBA 3PMEA 2RS11 5LA1A 1J59A 2A6YA 1RUG2 1V6KA 1A8DA 1QOSA 3K51A 5K9YA 3I2OA 5C8CB 1F4AA 4DUXA 2A6VA 4XF9A 1QJU3 4RQPC 3AL6A 2AGSA 4K8RB 3I49A 4LBLA 5FTTC 1LENA 4FCAA 3RWNA 2XLFA 1LNSA 2ETEA 5A1LA 1MEC3 1ND3B 4XJWA 4IE6A 2WAOA 4QPIA 5CZKA 1ZRDA 5KXCA 3K4ZA 4YZ3A 4LOTA 3ZMNA 2IVIB 3AB0A 1W9SA 2EIEA 1BCXA 4G9SB 2XQXA 1K3IA 3AK0A 4PLMA 3M3OA 4UFHA 5F8PA 4W8JA 5KBFA 1RUD1 2XHKA 2IXCA 1NE4A 4RGGA 2ZGOA 3ZFEC 1D2QA 5JLVA 1POQA 2A3YA 2UYAA 1PNGA 4WM8A 2QQPA 4CU9A 2BWCA 2JIJA 4BIFA 5I0RA 5DG2A 1QH7A 5I8YA 2GNDA 2OIIA 1VIWB 1YQ5A 2AYHA 1CVNA 2QCSB 5C71A 2C0ZA 1HW5A 4BK4A 2WNVC 1S4CA 1W9WA 3HIFA 1HRV2 1NY72 4NHKA 3MF9A 3NAPB 1SZBA 5KXEA 4WBBA 4P9WA 1VPHA 1K5MA 2YZ4A 4AAXA 3DYOA 1ENSA 2TUNA 5LBFA 1UZ0A 3ACIA 4AEDC 1RUE1 2JG9B 2WWUA 3I3QA 5IAXA 1I6XA 1G86A 2WNEA 3VBOB 2XBO3 4XIKA 1UKGA 2WZ8A 4IV3A 4E8DA 3W59A 3VHPA 1ZBA2 4JGZC 4HETA 1Y43B 3HPNA 5FQ0A 1VBA2 1SBFA 4KWKA 2WIIB 3PL0A 5F39A 1XPWA 4FFHA 4RYDA 4CCEA 1WWYA 3GBFA 3ILFA 1YQ6A 3NW4A 1B35A 4B3NA 4OMCA 3V56A 2HWC2 2XGXA 3POGA 5LBBA 1JOBA 3GGLA 1AZDA 5F5CA 1H6XA 5BNOB 4HSJA 3H50A 1T6BX 4QX1A 2H6BA 5FZOA 1HV0A 4IGQA 1HIXA 1D4M3 3LAGA 3M8LA 4Z2WA 1VBE2 4XDQA 5FY4A 5F32A 2W1QA 2F17A 3AKSA 3J8F3 4DXRA 4NPRA 3THPA 4HFSA 1CGPA 1ULOA 4MZUA 1TME3 1X50A 2XDVA 4CUCA 5FZHA 2HWD1 3C7HA 1XQNA 1WMEA 3H1YA 4A45A 1N1YA 3SEPA 3VHOA 4DXTA 2ZHMA 3LPFA 4XMIA 2AEZA 5FY5A 2FDGA 4Y1XA 2ZJCA 1YI9A 4MGYE 5D21A 1JYWA 2C5DA 2YYOA 1DHKB 4FQ4A 3RZKA 1JYCA 3KD4A 2WINB 3ETQA 1TMF1 4GH4B 4KWJA 3ZIXA 1XYNA 4Q5OA 5C9AA 1QJZA 2XVKA 5CKMA 5DDJ2 5FMOS 4E8CA 3IN9A 3ACGA 5FXXA 5FKCA 5IAVA 2WBKA 3SMHA 5KXBA 5KHGA 1A78A 2HBUA 3AKPA 2QQIA 5T5LA 1AR61 4NOTA 3QD6A 1ZBE3 3N9LA 1W06A 2VD7A 1EPZA 4A6OA 3GF6A 2VQ0A 5A3OA 2B8MA 2G9GA 1RUI1 2X53S 5KHHA 3ZXDA 5LRSA 3LSDA 4YW5A 3ZN6B 5FZKA 4FPYA 4M3CB 3ZXKA 5C4WA 3O1VA 5EIYB 1CZTA 4LBOA 4LULA 2Z4FA 5A7WA 3P3NA 4PBPA 2PAMA 1QJY1 3CO2A 3HT2A 4R9CA 3UNPA 1QOOA 4WVZA 1RUH3 2VCMA 2IFRA 2YU1A 1SPPA 1URXA 4JZRA 5T5OA 5KR7A 4WZFA 2VMIA 3GYDA 4MH0E 4LO8A 3C2UA 4AI9A 1RITA 5CFCA 2RHPA 3NJVA 5FY9A 4Q2FA 3U75A 3VDAA 1KFUL 3VZMA 5I0SA 4RHV1 1IGOA 3ECQA 4LTAA 1I1EA 2ERFA 1X33A 1I5PA 2AR6A 3BTAA 3J4UH 1KEXA 1RYYA 3PIJA 3SITA 3VL8A 1QNWA 2VGDA 5JCTA 1XE7A 1H9PA 1OA2A 1SLCA 2FCTA 1OD5A 4C0HA 2IUWA 2HWE2 4F8AA 3PJYA 3RS6A 4QKBA 5ACA1 1UZVA 1XRUA 2HBTA 4RL7A 1G7YA 1QJEA 2EF6A 3BUCA 3ZXFA 1UY4A 2CAVA 2ZHKA 1RUD2 1RVF1 4N53B 5ERLA 3K4AA 4EROA 3ZYBA 4NO4A 4AFDA 5DG1A 4AL9A 1Z7S3 2W52A 5EFUA 1K12A 4AVBA 1BVP1 5CKQA 2VZTA 2YV8A 1YLLA 4XC9A 4G4FA 4MYEA 4GIQA 5LEJA 1QJU1 2BQPA 1QXRA 4QM8A 3UV9A 2XKPA 1IHMA 2WSUA 3H3LA 4AGGA 4LA3A 3LIHA 4A44A 3CJIC 1VBD1 1H8TC 4CXXA 1MEC1 3DYPA 4C90A 4JGYA 2WR9A 5FP8A 4W4ZA 1LOFC 3WD5A 2QQWA 4BU2A 3G7DA 4YM1A 2ZS6B 4IEYA 3RJ2X 2DCYA 4CP9B 1U5ZA 1NQJA 3RZMA 4RGKA 1JYXA 2XVGA 1IOAA 2NMNA 3VBFA 4CPBA 4QAWA 4OQ8A 4CYDA 2O14A 2V4VA 5F5QA 1W8NA 3KQRA 1FMD3 1OA3A 1ENXA 1RUF2 2B4KA 3WUDA 3K3OA 5I93A 1JXNA 3AKTA 4D6RA 1M4WA 1UIKA 1X82A 5F1RA 1IPJA 3O14A 4AQ6A 1OLME 3ZFFA 2P17A 1W6MB 4XMAA 4NAMA 4Y20B 3LOBA 3B5LB 3RDIA 4AHXA 4CCOA 1MVEA 2E7TA 2VECA 2WA4A 5LRRA 2ZZQA 1JTZX 1LHWA 3FUOA 3NKGA 3ZSEA 4CRQA 2R073 3VGIA 3IIIA 5GZEA 1AX1A 5HCAA 2VZ1A 4QWNA 2XBO1 1CAXB 1MZEA 2PHXA 5JAXA 4B1MA 1KS4A 2BNMA 1DYPA 3D0SA 3LE0A 4RFT0 4BQYA 1XNAA 4A3XA 2ZX4A 1CAUB 2D43A 3RG0A 1H2KA 4RR3B 4ZPIA 1VAMA 1VBB1 3BOWA 4CEYB 3I2HA 1VBC3 1ND2C 5F3EA 5IK4A 1WLTA 3WP3A 3BPZA 3TEZA 1WD4A 2YB7A 1TMF2 4XHBA 2OQ6A 1UY2A 4I3GA 3WP6A 1APNA 4ATEA 4MADA 2FDHA 2MEV3 3B02A 3LKJA 4HVOA 3MICA 2WRAA 2PHWA 4MXWB 4UBHA 1G9CA 4OULA 3TNQA 2RVAA 2D3SA 4XJ8A 3I59A 2JDNA 1X8EA 3PVNA 4HKOA 3WDUA 2ZAHA 1D4M1 1LOAA 1T6GC 3C7EA 4BA6A 3KHCA 1REDA 2XHNA 5KXDA 3S0MA 3WNMA 4F3JA 1VE0A 2BJSA 5FOBB 3I97A 3HBZA 3VD5A 5LY1A 3WHTA 4UW6A 2GC2A 2XB6C 4AWDA 1QJY2 4JDNA 3RRDA 3VDDA 1I3HA 2R49A 2WZR3 2CWSA 3UJOA 3BU7A 4OQ9A 1JYVA 5AC92 3K2OA 3PLQA 4LK6A 5M0TA 1JZ5A 1V70A 2XH6A 3NVCA 3MW3A 1EP0A 1QDCA 4Y33A 5F3CA 1U5YA 3W5MA 1BK1A 4BLIA 3I2GA 3S7IA 5A33B 3H8RA 4D7TA 4XCAA 2D3PA 3PTYA 1W28A 3EO6A 2Q0AA 2A73B 1ZBE1 1LHUA 1R093 3THDA 5AVAA 5IVEA 4P9XA 2WNVB 4YPJA 2W08A 4BQ4A 5C3OA 2KM2A 1AR83 4BYYA 4NHYA 3NNGA 1C3HA 3I2DA 4LOSA 3F95A 1JH5A 1QJX3 3S30A 1GUIA 3OBRA 1RUH1 2RV9A 3D0JA 4QX8A 5A7SA 4AEDB 2Y34A 4TTGA 3T1LA 4PDWB 4EJRA 1XYOA 1RB8G 1GFF2 1OMIA 2JG8B 5CG9A 2OQ7A 3GHNA 2VMEA 4CDWC 3OG2A 4XAAA 4JC1A 2A5ZA 4YRDA 1C28A 2QUOA 1MEC2 1Q43A 1MS3A 5FZIA 1GZWA 4AQTA 5DMYA 1YJKA 5D8AA 5DUWA 3N4MA 2PAKA 1GWLA 3WCRA 4RN5A 1MR5A 5ISLA 2RDSA 3M3IA 2ID4A 2D98A 4META 3WP5A 4AZZA 4BHPA 1PK6A 3J7MA 3D82A 4P9JA 1QNYA 1V6OA 2IXKA 4KBBA 1H0BA 4QQPA 5IATA 3T4VA 1Z7S1 2D40A 1ZM1A 3GBWA 1ALYA 4FFIA 2JDAA 2ZOEB 2PHLA 2VXRA 2YXSA 1DFQA 1WZXA 3LEKA 2O8QA 2ET1A 2Y60A 1HV1A 4DFSA 2Q1MA 1WLCA 2JB8A 1LESA 4LBJA 5BNPA 1TZOA 4DS0A 4NWVA 1O7FA 1DQ0A 1UU5A 2C1FA 1F15A 1DP0A 3UGGA 4Z1VA 4XZUG 4AYUA 3KCYA 5CFDB 4L8QA 1RINA 3J7LA 1ZRCA 4FPJA 3HOBA 1NXD1 4X6RB 2BBVA 1OKOA 5GLUA 3AZXA 3POWA 3D4KA 3CHXA 3WF3A 5HCHA 2XKOA 4LORA 2X5IB 4PF5A 1W6NA 2BOIA 3H3UA 3V0BA 4P9IA 5C9AC 5J98B 4YW1A 4C8DA 1JN2P 4FXKB 4MGZE 4AFMA 4O61A 1ZA7A 1FMD1 3QACA 2ILMA 4AXOA 4QDRA 2JDZA 3OUIA 4Y4YA 1JUHA 4Q0QA 5GLTA 4I0WB 5DUXA 1J3PA 2ADDA 2BZDA 5FWJA 1H9WA 5DUVA 1UXXX 4D8MA 1O3SA 2DUQA 2QBXA 4QKDA 1GANA 2JDKA 2G9FA 4RQPA 2Y6HA 4LBNA 1DIWA 4HVRA 4I30A 4PIYA 3WXPA 4P00B 2R071 4LO5B 4CDXB 3ZR6A 1ASJ1 2HEYF 4Q0UA 3I54A 1TVGA 2B7YA 2I45A 5CB7A 2DWRA 2DFCA 3GZAA 3J8F2 3OPWA 1SCRA 2PFWA 2QNKA 3IT8A 5FRAA 1TME2 2VVEA 1W9YA 2JDHA 4AOCA 1VBA3 3AXEA 3VBSB 4AK3A 1HB2A 2W1SA 2YC4A 3A4UA 4LXLA 4XBLA 2RJ2A 5JR7B 1YWKA 4FBFA 3U14A 3ZFEA 5LWBA 1W0OA 3CEWA 5FUNA 4ZXEA 2VNOA 2GNMA 3E6CC 3M3CA 1SLBA 2DCJA 4ES9A 2J1RA 1D0GA 1Z78A 2MEV1 3WY6A 4BQ3A 5FZ4A 4O9GA 1H6YA 3VZLA 2VTXA 1XE8A 4DINB 3KZ4C 1YNAA 1S0BA 1DDLA 2D3RA 1ZBE2 1F9KA 3EB7A 4JV4A 1TNRA 3DPRC 3O1OA 3LDKA 3DUIA 2O1QA 3UK9A 2GDFA 2YFZA 4JRAA 4ASLA 1GP4A 3WF2A 2XJRA 3AP9A 4LKDA 4XURA 3NNMA 3PDQA 1WCDJ 4K3UA 1UW8A 3W21A 3ZN4A 4YFZA 1OUXA 4QPGB 1ZZBA 3A0NA 2PTMA 2WZR1 1YO8A 4JGZA 1CAVB 1W05A 3JB8A 2H0BA 5EJ1B 4COUA 2CV6A 2FCUA 5DDJ3 4Q4W3 1JW6A 3GDBA 3N36A 1AHSA 1HDKA 4JGYC 3KV6A 1JHNA 1RJ7A 4HPKB 3NNLA 1UMZA 3MV01 4N43B 1VRH3 3AZVA 1MS4A 5HXMA 4UBGA 4XQWA 2DYCA 3L2YA 4E4HA 2IXLA 3B9IA 1S0DA 2LTNA 1J58A 2FCVA 1CR7A 3EXUA 1DCSA 3L9JT 3T0BA 3FMGA 3O1MA 1R091 1AUYA 1ZZ6A 3IPVA 3NNJA 1NA1B 2VO5A 2YC0A 1PMHX 4NRPA 1AR81 1AX0A 3H42B 1IKPA 3OF1A 2WFPA 4PBOA 3O5SA 4BCUA 3FLPA 4XIOA 4XJAA 1QJX1 3WHUA 3WOGA 1YJLA 4I0BA 2BNOA 3T2QA 3FX3A 2OZ6A 1TE1B 4Z92B 1SDWA 1XOYA 1E5SA 4XJUA 1LTEA 2BP6A 1WMXA 2YY1A 3F2ZA 3FWEA 4IGOA 3N7MA 2LW8A 1SLIA 3BTYA 2ZX1A 1CIWA 1O3TA 5FKBA 5T54A 5FYTA 1W6OB 4YZ5A 5JSRA 2HLEA 1N3QA 1PGSA 2HWE3 3POBA 2MPFA 1SHWB 4R52A 2K9ZA 5FK8A 2EXKA 1XNBA 1ZZ8A 3NSTA 4FPCA 2DBNA 5IVYA 2V5DA 3ZYJB 5JOZA 5A3UA 2ES3A 2BVBA 4IE7A 3LPGA 2GC0A 4IEUA 1KITA 1Q8PA 3T2OA 5FZ9A 1W3XA 2B5HA 4QT6A 1OD3A 1SLAA 4UFKA 1RUG1 3PUSA 3OBAA 2W68A 3EMRA 3KQ4B 4MGQA 4OUEA 4WVWA 3ZN5A 1XU2A 3BB6A 5L7OA 2XVLA 2Q8DA 3PVBB 2Y26A 4LBMA 1NCQC 4E2SA 4PQQA 4UWDA 3O1SA 3Q8FA 2GMPA 4L99A 3EYPA 2QKDA 3K4DA 1UIJA 2D6PA
chains in the Genus database with same CATH topology
2ORZA 4P5YA 4UI9L 4LKSA 4OZOA 2VM9A 5C71A 2W1WA 4BK4A 1W9WA 5JXGA 5CYYA 1KGYA 3AC0A 3HN3A 2VQUA 4AAXA 3DYOA 2VCCA 1UZ0A 3ACIA 2W5FA 1P8JA 1JHJA 1OT5A 1XC6A 1CZSA 2WZ8A 4E8DA 4ET7A 1F4HA 4OMDA 1JZ6A 2V72A 5A1AA 1J84A 3OB8A 2PQSA 3HPNA 5JR2A 5LA0A 3FHQA 1NKGA 2W47A 1XPWA 5DPNA 4RYDA 1NAEA 2J1VA 4OMCA 1UX7A 1W8OA 2BBAA 3GGLA 3IAPA 4DXSA 3WSOA 1H6XA 4QX1A 3K77A 1D7PM 3D3AA 2W1QA 3SEEA 4XVHA 4DXRA 4M4RA 1ULOA 1OF3A 4JX0A 4QX3A 4CUCA 2ZEZA 3C7HA 5DN2A 2W92A 3SEPA 4A45A 4DXTA 1XNTA 3LPFA 1JYWA 1PX4A 4ARYA 4CU7A 2VC9A 3OEAA 2VMFA 4E8CA 3ACGA 3IB3A 4A41A 2WBKA 5HPOA 2WQ8A 2C9KA 2QQIA 2J1UA 3PUIA 4XUPA 1EUTA 4A6OA 5F7UA 1JZ4A 4LQRA 1GMMA 4JKMA 2XONA 5EIYB 1CZTA 3VDCA 2Z4FA 3OGVA 3UNPA 2Y6KA 3SKJE 2J7MA 1DLCA 1DYOA 2YG0A 3ABZA 1BHGA 2E26A 3NJVA 1IQDC 3VDAA 1W0NA 2VL4A 3MUY1 3WNPA 3P6BA 3ECQA 4OYUA 1I5PA 4DUVA 5C70A 1KEXA 1RYYA 4MO3M 2E32A 2X05A 3J7HA 1UYXA 3IDAA 4BJ0A 5IYYA 3LQCA 4XUNA 3OGSA 2EICA 4D0QA 3C8XA 1UY4A 3HNMA 4QPWA 1UYYA 5G05L 3K4AA 3T08A 2R7EB 1K45A 4A3ZA 1K12A 2QQNA 1NUKA 1O8SA 1EUUA 2VZTA 2WO3A 3CZUA 4PF1A 2VZSA 2WUHA 3VD9A 3A21A 3ZM8A 2CDPA 5FUIA 5IFPA 1JZ2A 4A44A 2WABA 3DYPA 2VCBA 3A7QA 1CIYA 4W4ZA 2L9LA 3I2IA 1UY3A 1O8PA 4XUOA 2OKXA 3T0DA 3UETA 1UMIA 4JHZA 2EIDA 2VOTA 4QAWA 2V4VA 1W8NA 4GWIA 1JYNA 3E1F1 2B4KA 2BERA 2QQJA 2W9XA 3HNBM 1JI6A 3VDBA 3MV11 3PUHA 2WN2A 4P02B 4CU6A 3IIIA 1TG7A 2QQKA 4DEVA 2VZ1A 3ACFA 3DYMA 5G04L 1GQPA 2W94A 2VMCA 2BGOA 2VZPA 3HNYM 5B4XA 3OGRA 3LE0A 1XNAA 3WNNA 2W87A 4CUAA 3I2HA 3I3BA 4GWJA 2YB7A 3LEGA 1UY2A 1WCQA 4MADA 1O59A 2ZXQA 4M4PA 5C7GA 4ZY9A 3NRUA 2RVAA 2ZEYA 1UYZA 1WKYA 4UOJA 2WO2A 2YFUA 3C7EA 2XHNA 1UXZA 4XUTA 3WNMA 3WEZA 3I97A 3VD5A 3HEIA 3ETPA 3CZJA 2VJXA 2YC2A 2C4XA 1JYVA 1JZ5A 3FHAA 3T0AA 3CKHA 2VZ3A 3W5MA 2WYSA 3I2GA 2C26A 3CDZB 2Y6JA 3SKVA 2W95A 3VD4A 2HYXA 3THDA 2B9VA 4KMQA 3BN6A 4YPJA 2VTFA 1GOGA 3NNGA 2VMDA 4QX2A 1GUIA 4CU8A 2RV9A 4TTGA 3WNKA 4BXSV 2W1UA 2VZRA 2DCKA 1JZ8A 1US2A 3P1IA 2VMEA 2BGPA 2E31A 2JKXA 3OG2A 1YQ2A 3W5NA 2VZOA 1L7QA 1JU3A 1JU4A 5I0DA 1NX9A 4JKKA 3T2PA 4UAPA 5DMYA 4LHSA 3ACHA 4RN5A 3CIHA 5IJRA 1OF4A 2ID4A 1UY0A 4L0PA 2LS6A 4MGSA 2JDAA 4CUBA 5JXIA 4BDVB 2EIBA 3LEKA 1R64A 1W99A 4BK5A 3I3DA 2WAAA 1DP0A 4ZZ8A 5JUVA 2JE8A 5EJZB 4XZUG 3HOBA 2VR4A 2Y6GA 2DDUA 1GOFA 4QB6A 2VQTA 2WO1A 2J1AA 3WF3A 1JZ3A 1MPXA 3I2JA 1L7RA 1UWWA 3HJRA 4DUWA 1SDDB 3WF4A 2X10A 2XOMA 3VD7A 4QDRA 4QDSA 2JD9A 4CVUA 5JXJA 3FN9A 4KWUA 2BZDA 2W46A 2WN3A 4D8MA 1UXXX 2QBXA 2VZQA 4P08A 5JXHA 2Y6HA 4P00B 1ULPA 5J1XA 1GOHA 1GNYA 3I2FA 1TVGA 3A22A 4IUGA 2QQLA 5LA2A 4FI9A 2W1SA 1J83A 2YC4A 2RJ2A 3IAQA 2WDBA 3DECA 4MOAA 4ZXEA 4LPLA 2DCJA 3MO4A 3VD3A 3OEBA 2J1RA 3LEIA 3NQHA 1W9TA 1H6YA 2W3JA 3I2KA 3MBWA 3K75B 4ZZ5A 3WNLA 3THCA 1CZVA 2KD7A 3EB7A 1T2XA 1JZ7A 3I3EA 2YFZA 3WNOA 3CQOA 5IFTA 2E33A 3WF2A 4XURA 3C7OA 2J1SA 5IHRA 4HG6B 4KI5M 1OH4A 4AG4A 1US3A 3UESA 4A4AA 2CDOA 3BGAA 4QDQA 4W50A 4DEQA 4PT6A 5EJ1B 3GDBA 3T09A 2QQMA 4QX0A 3U37A 1HN1A 4ARXA 3MV01 5HXMA 3C7FA 1CX1A 2QQOA 3T0BA 2VZVA 2ZEXA 2VCAA 2Y8KA 2VO5A 2WZEA 1PMHX 2VZUA 3GXUA 3WQBA 5DQ0A 3A23A 5B4NA 1UMHA 2W91A 3WF1A 3CMGA 5LCWL 3T2QA 2J1TA 4XUQA 1GU3A 3NJXA 1SG3A 1PX3A 3C7GA 3F2ZA 2LW8A 5JMOA 1PMJX 5LA1A 2HLEA 3WF0A 2ORXA 1F4AA 1SHWB 4DUXA 1JYXA 2V5DA 2Y64A 3JXSA 4QB2A 2J22A 2X09A 4TXWA 2J1EA 3LPGA 4QB1A 4GZ9A 3T2OA 1LNSA 4A42A 2Y6LA 1OD3A 2WAOA 3FL7A 3OBAA 5CZKA 4OUEA 3K4ZA 4MGQA 1K42A 4JKLA 1W9SA 2EIEA 2XQXA 1K3IA 3GM8A 4W8JA 3K46A 4PQQA 4Z2AA 2ZEWA 4CU9A 3EYPA 1UY1A 3K4DA 3MUZ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ORZ A;  4P5Y A;  4UI9 L;  4LKS A;  4OZO A;  2VM9 A;  5C71 A;  2W1W A;  4BK4 A;  1W9W A;  5JXG A;  5CYY A;  1KGY A;  3AC0 A;  3HN3 A;  2VQU A;  4AAX A;  3DYO A;  2VCC A;  1UZ0 A;  3ACI A;  2W5F A;  1P8J A;  1JHJ A;  1OT5 A;  1XC6 A;  1CZS A;  2WZ8 A;  4E8D A;  4ET7 A;  1F4H A;  4OMD A;  1JZ6 A;  2V72 A;  5A1A A;  1J84 A;  3OB8 A;  2PQS A;  3HPN A;  5JR2 A;  5LA0 A;  3FHQ A;  1NKG A;  2W47 A;  1XPW A;  5DPN A;  4RYD A;  1NAE A;  2J1V A;  4OMC A;  1UX7 A;  1W8O A;  2BBA A;  3GGL A;  3IAP A;  4DXS A;  3WSO A;  1H6X A;  4QX1 A;  3K77 A;  1D7P M;  3D3A A;  2W1Q A;  3SEE A;  4XVH A;  4DXR A;  4M4R A;  1ULO A;  1OF3 A;  4JX0 A;  4QX3 A;  4CUC A;  2ZEZ A;  3C7H A;  5DN2 A;  2W92 A;  3SEP A;  4A45 A;  4DXT A;  1XNT A;  3LPF A;  1JYW A;  1PX4 A;  4ARY A;  4CU7 A;  2VC9 A;  3OEA A;  2VMF A;  4E8C A;  3ACG A;  3IB3 A;  4A41 A;  2WBK A;  5HPO A;  2WQ8 A;  2C9K A;  2QQI A;  2J1U A;  3PUI A;  4XUP A;  1EUT A;  4A6O A;  5F7U A;  1JZ4 A;  4LQR A;  1GMM A;  4JKM A;  2XON A;  5EIY B;  1CZT A;  3VDC A;  2Z4F A;  3OGV A;  3UNP A;  2Y6K A;  3SKJ E;  2J7M A;  1DLC A;  1DYO A;  2YG0 A;  3ABZ A;  1BHG A;  2E26 A;  3NJV A;  1IQD C;  3VDA A;  1W0N A;  2VL4 A;  3MUY 1;  3WNP A;  3P6B A;  3ECQ A;  4OYU A;  1I5P A;  4DUV A;  5C70 A;  1KEX A;  1RYY A;  4MO3 M;  2E32 A;  2X05 A;  3J7H A;  1UYX A;  3IDA A;  4BJ0 A;  5IYY A;  3LQC A;  4XUN A;  3OGS A;  2EIC A;  4D0Q A;  3C8X A;  1UY4 A;  3HNM A;  4QPW A;  1UYY A;  5G05 L;  3K4A A;  3T08 A;  2R7E B;  1K45 A;  4A3Z A;  1K12 A;  2QQN A;  1NUK A;  1O8S A;  1EUU A;  2VZT A;  2WO3 A;  3CZU A;  4PF1 A;  2VZS A;  2WUH A;  3VD9 A;  3A21 A;  3ZM8 A;  2CDP A;  5FUI A;  5IFP A;  1JZ2 A;  4A44 A;  2WAB A;  3DYP A;  2VCB A;  3A7Q A;  1CIY A;  4W4Z A;  2L9L A;  3I2I A;  1UY3 A;  1O8P A;  4XUO A;  2OKX A;  3T0D A;  3UET A;  1UMI A;  4JHZ A;  2EID A;  2VOT A;  4QAW A;  2V4V A;  1W8N A;  4GWI A;  1JYN A;  3E1F 1;  2B4K A;  2BER A;  2QQJ A;  2W9X A;  3HNB M;  1JI6 A;  3VDB A;  3MV1 1;  3PUH A;  2WN2 A;  4P02 B;  4CU6 A;  3III A;  1TG7 A;  2QQK A;  4DEV A;  2VZ1 A;  3ACF A;  3DYM A;  5G04 L;  1GQP A;  2W94 A;  2VMC A;  2BGO A;  2VZP A;  3HNY M;  5B4X A;  3OGR A;  3LE0 A;  1XNA A;  3WNN A;  2W87 A;  4CUA A;  3I2H A;  3I3B A;  4GWJ A;  2YB7 A;  3LEG A;  1UY2 A;  1WCQ A;  4MAD A;  1O59 A;  2ZXQ A;  4M4P A;  5C7G A;  4ZY9 A;  3NRU A;  2RVA A;  2ZEY A;  1UYZ A;  1WKY A;  4UOJ A;  2WO2 A;  2YFU A;  3C7E A;  2XHN A;  1UXZ A;  4XUT A;  3WNM A;  3WEZ A;  3I97 A;  3VD5 A;  3HEI A;  3ETP A;  3CZJ A;  2VJX A;  2YC2 A;  2C4X A;  1JYV A;  1JZ5 A;  3FHA A;  3T0A A;  3CKH A;  2VZ3 A;  3W5M A;  2WYS A;  3I2G A;  2C26 A;  3CDZ B;  2Y6J A;  3SKV A;  2W95 A;  3VD4 A;  2HYX A;  3THD A;  2B9V A;  4KMQ A;  3BN6 A;  4YPJ A;  2VTF A;  1GOG A;  3NNG A;  2VMD A;  4QX2 A;  1GUI A;  4CU8 A;  2RV9 A;  4TTG A;  3WNK A;  4BXS V;  2W1U A;  2VZR A;  2DCK A;  1JZ8 A;  1US2 A;  3P1I A;  2VME A;  2BGP A;  2E31 A;  2JKX A;  3OG2 A;  1YQ2 A;  3W5N A;  2VZO A;  1L7Q A;  1JU3 A;  1JU4 A;  5I0D A;  1NX9 A;  4JKK A;  3T2P A;  4UAP A;  5DMY A;  4LHS A;  3ACH A;  4RN5 A;  3CIH A;  5IJR A;  1OF4 A;  2ID4 A;  1UY0 A;  4L0P A;  2LS6 A;  4MGS A;  2JDA A;  4CUB A;  5JXI A;  4BDV B;  2EIB A;  3LEK A;  1R64 A;  1W99 A;  4BK5 A;  3I3D A;  2WAA A;  1DP0 A;  4ZZ8 A;  5JUV A;  2JE8 A;  5EJZ B;  4XZU G;  3HOB A;  2VR4 A;  2Y6G A;  2DDU A;  1GOF A;  4QB6 A;  2VQT A;  2WO1 A;  2J1A A;  3WF3 A;  1JZ3 A;  1MPX A;  3I2J A;  1L7R A;  1UWW A;  3HJR A;  4DUW A;  1SDD B;  3WF4 A;  2X10 A;  2XOM A;  3VD7 A;  4QDR A;  4QDS A;  2JD9 A;  4CVU A;  5JXJ A;  3FN9 A;  4KWU A;  2BZD A;  2W46 A;  2WN3 A;  4D8M A;  1UXX X;  2QBX A;  2VZQ A;  4P08 A;  5JXH A;  2Y6H A;  4P00 B;  1ULP A;  5J1X A;  1GOH A;  1GNY A;  3I2F A;  1TVG A;  3A22 A;  4IUG A;  2QQL A;  5LA2 A;  4FI9 A;  2W1S A;  1J83 A;  2YC4 A;  2RJ2 A;  3IAQ A;  2WDB A;  3DEC A;  4MOA A;  4ZXE A;  4LPL A;  2DCJ A;  3MO4 A;  3VD3 A;  3OEB A;  2J1R A;  3LEI A;  3NQH A;  1W9T A;  1H6Y A;  2W3J A;  3I2K A;  3MBW A;  3K75 B;  4ZZ5 A;  3WNL A;  3THC A;  1CZV A;  2KD7 A;  3EB7 A;  1T2X A;  1JZ7 A;  3I3E A;  2YFZ A;  3WNO A;  3CQO A;  5IFT A;  2E33 A;  3WF2 A;  4XUR A;  3C7O A;  2J1S A;  5IHR A;  4HG6 B;  4KI5 M;  1OH4 A;  4AG4 A;  1US3 A;  3UES A;  4A4A A;  2CDO A;  3BGA A;  4QDQ A;  4W50 A;  4DEQ A;  4PT6 A;  5EJ1 B;  3GDB A;  3T09 A;  2QQM A;  4QX0 A;  3U37 A;  1HN1 A;  4ARX A;  3MV0 1;  5HXM A;  3C7F A;  1CX1 A;  2QQO A;  3T0B A;  2VZV A;  2ZEX A;  2VCA A;  2Y8K A;  2VO5 A;  2WZE A;  1PMH X;  2VZU A;  3GXU A;  3WQB A;  5DQ0 A;  3A23 A;  5B4N A;  1UMH A;  2W91 A;  3WF1 A;  3CMG A;  5LCW L;  3T2Q A;  2J1T A;  4XUQ A;  1GU3 A;  3NJX A;  1SG3 A;  1PX3 A;  3C7G A;  3F2Z A;  2LW8 A;  5JMO A;  1PMJ X;  5LA1 A;  2HLE A;  3WF0 A;  2ORX A;  1F4A A;  1SHW B;  4DUX A;  1JYX A;  2V5D A;  2Y64 A;  3JXS A;  4QB2 A;  2J22 A;  2X09 A;  4TXW A;  2J1E A;  3LPG A;  4QB1 A;  4GZ9 A;  3T2O A;  1LNS A;  4A42 A;  2Y6L A;  1OD3 A;  2WAO A;  3FL7 A;  3OBA A;  5CZK A;  4OUE A;  3K4Z A;  4MGQ A;  1K42 A;  4JKL A;  1W9S A;  2EIE A;  2XQX A;  1K3I A;  3GM8 A;  4W8J A;  3K46 A;  4PQQ A;  4Z2A A;  2ZEW A;  4CU9 A;  3EYP A;  1UY1 A;  3K4D A;  3MUZ 1; 
#chains in the Genus database with same CATH topology
 1Y9M A;  2BFU S;  1PGW 1;  4YNI A;  4XET A;  4XF4 A;  2KR2 A;  4LKS A;  4OZO A;  4AFA A;  3MZH A;  5CEH A;  1XND A;  2R07 2;  5K8S A;  1QKQ A;  4COY A;  1KGY A;  1Q8Q A;  2VUA A;  4B29 A;  4QPI B;  4XQ4 A;  1BYH A;  5J3U A;  3N7J A;  1W03 A;  1QHD A;  1LU2 A;  1X8M A;  1MS0 A;  4CXW A;  4PI0 A;  4EN6 B;  4K8F A;  1ACC A;  1JHJ A;  1P8J A;  4XFG A;  1OOP A;  4CEW C;  2FMY A;  4WM8 B;  1VBC 2;  3UL2 A;  3ATG A;  4JDM A;  4P5H A;  4IE5 A;  1F4H A;  1NY7 1;  4GWN A;  5CIR A;  3T2T A;  2A3X A;  3PMS A;  5A1A A;  1J84 A;  5BPX A;  3OB8 A;  4AI3 A;  2XR4 A;  4M3C E;  5FIX A;  5JR2 A;  5LA0 A;  1BLZ A;  2MEV 2;  2VNV A;  3FHQ A;  1NKG A;  2W47 A;  4LK7 A;  5DPN A;  2SBA A;  5FO8 B;  3VBU C;  4E4Z A;  5I91 A;  5F2S A;  1NAE A;  2J1V A;  2ZGK A;  4QXH A;  4CP0 A;  4FAG A;  1K5M B;  1QU0 A;  1PM4 A;  4SLI A;  3CJI A;  2WQ4 A;  2BBA A;  1H8T A;  2DVD A;  3R4D B;  4ZS2 A;  3QBQ A;  3WSO A;  1FV3 A;  3BU0 A;  2BDR A;  2XWB B;  1LOF A;  1VBA 1;  3ORJ A;  4Q1P A;  4FOQ A;  3ST7 A;  2OVU A;  4IV3 B;  3NKT A;  4AVC A;  1D7P M;  4FP2 A;  4H7M A;  4MGI E;  1DF0 A;  1FT9 A;  2EXJ A;  3JZV A;  4HN0 A;  3LD8 A;  4HT1 T;  5FQ0 B;  2ZAA A;  3MI8 A;  2ZZJ A;  1OF3 A;  2N7G A;  4P9L A;  4XF0 A;  4K6B A;  5K0U A;  1H8V A;  4CDQ A;  5AFE A;  4OZX A;  1B35 B;  4MGK E;  2BNN A;  3W9A A;  1RC6 A;  1J3R A;  3MPB A;  4ARY A;  2VC9 A;  3POJ A;  4QM9 A;  4EQV A;  2Z69 A;  2VMF A;  3WR0 A;  5C6C A;  1R09 2;  2WNU A;  4IEQ A;  4W6W A;  1W8T A;  2Q8O A;  4OFG A;  1OH3 A;  3KCX A;  1V6M A;  3KV9 A;  3RMY A;  3SH3 A;  2G4I A;  4XUP A;  2NP0 A;  4EWA A;  1OKQ A;  4D7Y A;  1RXF A;  2JEN A;  3N35 A;  5L9V A;  3I3M A;  1J1T A;  1YFX A;  5F7U A;  1ST8 A;  2BYV E;  2ZAC A;  3RYK A;  5AC9 3;  2D97 A;  4FOY A;  5DZG A;  5T50 A;  1GMM A;  2QDN A;  3RYR A;  5DDJ 1;  5L73 A;  3DN7 A;  4Q4W 1;  4LO7 A;  3VDC A;  5FPB A;  3RNS A;  5A32 A;  1ND2 A;  4K1Z A;  1XXN A;  2NYY A;  3H7J A;  2CGP A;  1MS5 A;  1REE A;  3AMQ A;  3ZKY A;  3ZDS A;  3FFZ A;  1AXY A;  1CAW A;  2Y6K A;  2PHT A;  4UF0 A;  4YFW A;  5A7N A;  1DLC A;  2IWG B;  5E8A A;  2YG0 A;  1BHG A;  4ZU5 A;  1OBN A;  2E26 A;  2VBP A;  2VL4 A;  3RQ0 A;  3POF A;  4YW4 A;  4OYU A;  1UZW A;  2FDF A;  3WCS A;  4MO3 M;  2E32 A;  2X05 A;  5FXW A;  4TN7 A;  1BBT 2;  5C4W B;  2A71 A;  5LBC A;  3CNA A;  1DGR N;  5A7W B;  3ON7 A;  1W8W A;  2WLQ A;  1C5H A;  3HNM A;  1NCR A;  2R0H A;  1JYI A;  1SPP B;  3GBG A;  4QPW A;  2VMH A;  3DCQ A;  3KWV A;  2DTY A;  4YLZ A;  5FYY A;  2K46 A;  4NR1 A;  3H9A A;  2XL9 A;  4JTN A;  1PHM A;  4LUM A;  1PGW 2;  4Z82 A;  5CFC B;  3DEM A;  1YFY A;  3BYW A;  1C8M 3;  3UGH A;  5A7P A;  1YYN A;  2RM2 3;  3HT1 A;  1EUU A;  4D6Q A;  1M06 G;  2HWE 1;  5GLW A;  3CZU A;  4MG2 A;  1F2N A;  3AX4 A;  4PF1 A;  3M1H A;  1D2S A;  5IWF A;  4JCK A;  1ZZC A;  1W8Z A;  3MLL A;  5GLV A;  1GNH A;  2CWM A;  5FUI A;  3SLI A;  3USS A;  1RUJ 2;  1BKZ A;  1V6J A;  1ULD A;  1STM A;  3VKF C;  1S0I A;  5A3P A;  1DYK A;  1OI6 A;  4AI8 A;  1LCL A;  2L9L A;  4YVS C;  5FCC A;  3RGB A;  3I2I A;  2DBI A;  1O8P A;  5IK5 A;  3T0D A;  3WG4 A;  5IVF A;  3AKQ A;  2AUY A;  3U11 A;  1UZZ A;  4PLN A;  2EID A;  2R1B A;  1LGC A;  5CAD A;  3GHM A;  1F8V A;  4O65 A;  4QHB A;  2TBV A;  4XQD A;  2BUK A;  2VW1 A;  4QQO A;  3T4H B;  2R06 3;  4GWI A;  5FP3 A;  3E1F 1;  3TEX A;  5F9T A;  2NPI A;  4GUL A;  3BIW E;  2FZ1 A;  3J9S A;  1LOE A;  4N7U A;  4CDW A;  2FHR A;  2QQJ A;  2W9X A;  3H1W A;  4YG3 A;  5DAP A;  3RYP A;  4EWD A;  3OGG A;  5FZC A;  1JI6 A;  4MVT A;  5DAB A;  2C6S A;  2DCT A;  3MV1 1;  2RS5 3;  3PUH A;  1SLT A;  2RS3 3;  3WW1 A;  2D7F A;  4Y4R A;  3IM0 A;  4V2V A;  5HV0 A;  3UYJ A;  1V0A A;  1RUF 1;  2RDQ A;  4AE2 A;  4Q4Y 3;  3W20 A;  3MIG A;  2QQK A;  4LBQ A;  1OVP A;  1MZ6 A;  1EV1 3;  2G1M A;  3DYM A;  5JOY A;  4WVM A;  3VBF B;  2BVV A;  3E5U A;  1CES A;  3AP7 A;  4L9B A;  3U78 A;  1PMI A;  2OZJ A;  4Y22 A;  5FMD A;  1DGL A;  1UD1 A;  4E27 A;  2NM1 A;  1PO2 3;  3AYC A;  4LIU A;  3LOI A;  5T5P A;  3ZFF B;  4CUA A;  4H2A A;  4GWJ A;  3FBY A;  1WCQ A;  2ZGQ A;  1W2T A;  3UT0 A;  2ZXQ A;  3WVJ A;  4CDU C;  5C7G A;  3WG3 A;  4XAE A;  2ZX0 A;  1O4T A;  4HKW A;  4ZY9 A;  4BH9 A;  3O7O A;  3R0R A;  2ZEY A;  1WKY A;  4UOJ A;  2A6W A;  4HSL A;  3ILN A;  4D3W A;  4JHT A;  3OYW A;  5I0U A;  5LK7 B;  2W2I A;  3S57 A;  3IBM A;  2D6K A;  1EAH 3;  2ZKN A;  1O91 A;  3WDT A;  3WEZ A;  3MIE A;  4Q4W 2;  3ETP A;  4GJZ A;  3HBK A;  4W65 A;  2VJX A;  3J26 N;  4M01 A;  1CPM A;  3ZXJ A;  2ZGT A;  2JB4 A;  1VRH 2;  4NPM A;  4XFH A;  2GC3 A;  2ZHL A;  3PU8 A;  4XBN A;  4MV2 A;  5LY2 A;  1V00 A;  5BNN A;  3T0A A;  1UX6 A;  3CKH A;  2E63 A;  3LF7 A;  3I59 B;  2WYS A;  5FOJ B;  5CIS A;  5L7O C;  3O0V A;  2YBS A;  4Q8K A;  3JD7 3;  2RDN A;  4KG0 A;  2W95 A;  1GQG A;  5JOX A;  2HYX A;  4QMA A;  2IXJ A;  5KHJ A;  5HCF A;  4Y1V A;  2DFB A;  4DY5 A;  1Y7B A;  2VTF A;  3AKR A;  5AC9 1;  4J6G A;  4LO6 B;  4IES A;  3RI9 A;  3VDD B;  3WDV A;  3WIN E;  4BM8 A;  1CON A;  4FQZ A;  4LMF A;  3ZYH A;  3D5O A;  4UFI A;  5A6Y A;  2QE3 A;  5FZF A;  4QX2 A;  5H9R A;  4AVT A;  4YW7 A;  4GAL A;  4CU8 A;  1COV 2;  4IEZ A;  3N9Q A;  2ARC A;  1F5J A;  2ZCW A;  5ABJ A;  1ZRI A;  3WW4 A;  2CL2 A;  2DCK A;  1JZ8 A;  1Q8S A;  1KJL A;  5EXO A;  1POV 0;  3N7L A;  2Z42 A;  2WL1 A;  3W5N A;  1L7Q A;  2WWJ A;  1OOP C;  3E6B A;  5DUU A;  4XFA A;  3T2P A;  3DPR A;  3SIS A;  4QGM A;  1ND3 A;  2IXI A;  2CNA A;  1OPO A;  2NN8 A;  3ACH A;  4ZU7 A;  3CIH A;  5IVB A;  1JBC A;  3ZYG A;  3TWI A;  4R8H A;  1ONA A;  2D44 A;  5LAT A;  3KGL A;  2OPW A;  4HZF A;  3JB4 C;  4Z07 A;  4AI0 A;  2JIG A;  5DAQ A;  1LUL A;  1UPI A;  2VBB A;  4L0P A;  1BEV 2;  3NJY A;  2IZW A;  4MGS A;  4GJY A;  4IV1 C;  5DAW A;  5FYI A;  1C8M 1;  4CUB A;  5JXI A;  2RM2 1;  2OT7 A;  3TRS B;  1D4V B;  3IIA A;  2YDE A;  3WQ0 A;  1BVV A;  3BOP A;  5I8S A;  2J42 A;  2GME A;  5F5I A;  5E6H A;  1GZW B;  2TEP A;  3I3D A;  4NRQ A;  5D8A B;  4ZZ8 A;  2JIC A;  5JUV A;  4CCL A;  2G9Z A;  3WNX A;  5FZ1 A;  5K0U C;  4HKL A;  3JUU A;  4IL7 A;  2PAE A;  1U5X A;  2HJI A;  4CDQ C;  3GAL A;  4FXG B;  1BZW A;  5C33 A;  5FMO L;  1PK6 B;  2VR4 A;  2Y6G A;  3VBO A;  2DDU A;  3ZYF A;  2VQT A;  2WO1 A;  4YW6 A;  4BB3 A;  3I2J A;  2XLA A;  1RJ8 A;  2FDI A;  5JZG C;  4IET A;  1AYM 2;  1QGL A;  1J3Q A;  2WNU C;  1QQP 2;  4U36 A;  3B01 A;  2EA7 A;  4BWO A;  4QGL A;  3WF4 A;  3LIG A;  3T30 A;  3GJB A;  4QX7 A;  5HXV A;  4EN7 B;  3VD7 A;  5BNP B;  2ZBJ A;  1VAL A;  4WV8 A;  3AZZ A;  1KQR A;  1PZ9 A;  4XF1 A;  4CVU A;  4ES8 A;  5JXJ A;  3DL3 A;  3FN9 A;  4YGD A;  1SQ4 A;  2XUE A;  1G8W A;  2WN3 A;  2DVG A;  3MIB A;  2RS5 1;  3AP5 A;  1FPN 3;  2RS3 1;  5IVC A;  2Y6F A;  2B9U A;  5CBL A;  4HK8 A;  1Z0H A;  3L2H A;  4TZD A;  4XPV A;  5C5T A;  4Q4Y 1;  1VP6 A;  1W6N B;  2YMZ A;  3Q9O A;  3I2F A;  5J1X A;  3V0B B;  4YGB A;  4COZ A;  1V9U 3;  1HB1 A;  5FLH A;  4AHW A;  5LA9 A;  4FPG A;  4I02 A;  2A70 A;  4V2W A;  2QQL A;  5LA2 A;  3WUC A;  4YYO A;  1QH6 A;  1PO2 1;  1NCQ A;  1YCI A;  2VOW A;  4D6S A;  2Q1F A;  2A6Z A;  2XJP A;  3DEC A;  1NQD A;  3WG1 A;  3IWZ A;  1ZX5 A;  2QZ3 A;  3ELN A;  1IG0 A;  3GCX A;  3ILR A;  4LPL A;  4Q0V A;  4XFB A;  3LFM A;  4RQP B;  3J8F 1;  1HRI 3;  2RMU 3;  1AR7 3;  3LEI A;  2P2K A;  4YWA A;  3NQH A;  4K20 A;  2SLI A;  4NJ4 A;  2VOX A;  1IS4 A;  1TME 1;  2IFW A;  2R04 2;  3FC0 A;  4MXV A;  4NAO A;  1W39 A;  4XTP A;  5D1I A;  4CPB D;  5LAS A;  4R9A A;  1LGB A;  1NCR C;  3PUQ A;  5EWS A;  4AAP A;  2DUO A;  2VU9 A;  4R4X A;  3H0O A;  2KD7 A;  3BOD A;  4YGC A;  4XW3 A;  5CKN A;  1EAH 1;  1NE6 A;  1NZC A;  2PHU A;  4TLG A;  3CQO A;  3RZZ A;  2GNT A;  2OUJ A;  1F5F A;  2J1S A;  3ZFE B;  2HWB 3;  4HG6 B;  4CEW A;  5FXZ A;  2R32 A;  5FV3 A;  4BZ4 A;  4AG4 A;  4I09 A;  4LHN A;  4OHV A;  4IEV A;  1QXJ A;  3KT4 A;  1CD3 G;  1QIQ A;  4DEQ A;  4Q27 A;  4W50 A;  2DTW A;  3IKW A;  1UKR A;  1CJD A;  4AW7 A;  4QX0 A;  3VBU A;  1HN1 A;  2XPJ A;  1E57 A;  4XXA A;  1UQX A;  4DZG A;  3NV2 A;  4RD7 A;  4SBV A;  5CA6 A;  2QQO A;  2XL7 A;  1UN1 A;  2VCA A;  4EYU A;  2WNO A;  1NZI A;  3MLJ A;  5FRE A;  3AM2 A;  4FPL A;  5IK7 A;  3GXU A;  1UYP A;  3LZZ A;  3LA7 A;  2ARX A;  2JE9 A;  5GKA C;  5DQ0 A;  5FPZ A;  4IE4 A;  3SCH A;  4JGZ B;  5B2G B;  2QZ2 A;  4KBZ A;  3CMG A;  2PA7 A;  5LCW L;  1FX5 A;  3VBH A;  4DMI A;  3B69 A;  3S7E A;  4K40 A;  5IVV A;  3NJX A;  1C8M 2;  1AR9 3;  4NHM A;  2RM2 2;  2BU9 A;  4QXK A;  5FMB A;  1O5L A;  2FMD A;  2P3K A;  3BIE A;  4FTE A;  1GSL A;  2Z2S B;  1XE0 A;  3V0A A;  3S5A A;  4OUS A;  3POY A;  1ODM A;  1GBG A;  5F5A A;  1BBT 3;  5FYH A;  4A2U A;  5HBA A;  3WF0 A;  5JDB A;  4X8N A;  2ORX A;  3LWC A;  3N9O A;  3ACL A;  4Q8L A;  1VR3 A;  3PUR A;  4NIA A;  2P6C A;  2Y64 A;  3JXS A;  4QQL A;  2J22 A;  2X09 A;  4H14 A;  4TXW A;  2J1E A;  3LSE A;  4YSF A;  1S0G A;  3E5X A;  3B3Q E;  4QB1 A;  4QHZ A;  4WM7 A;  4GZ9 A;  4BQ5 A;  2QVS B;  5FYV A;  2Y6L A;  1U12 A;  3WX5 A;  1W6P A;  4PIZ A;  5FZ0 A;  2DCZ A;  5FY7 A;  3OBT A;  4XYX A;  5L36 A;  1K42 A;  4R4Z A;  2R06 2;  1R08 2;  1KD7 A;  1A34 A;  4XFF A;  3MID A;  3AJZ A;  3GM8 A;  1Q5O A;  1XB9 A;  3DF0 A;  5K7P A;  4CUG A;  3K46 A;  4Z2A A;  5FR3 A;  4LIV A;  4BQX A;  4HMZ A;  4Q0P A;  4RGA A;  3PUA A;  5J7M A;  1UY1 A;  5JI7 A;  2CGN A;  3MLK A;  2RS5 2;  3MUZ 1;  1RUJ 3;  2RS3 2;  3NV3 A;  4UI9 L;  1DLL A;  4XDP A;  4XTM A;  5KHI A;  1WMF A;  1POV 3;  1X9P A;  3WQ1 A;  4MUV A;  5C3P A;  4JRL A;  3KLS A;  4Q4Y 2;  5CYY A;  5JXG A;  3AC0 A;  3ME2 A;  1EV1 2;  3EBR A;  2VVD A;  3Q8B A;  2FD8 A;  5APA A;  5EYY A;  2HH9 A;  3MFC A;  2DU1 A;  4O7X A;  4YVW C;  4H55 A;  2FBE A;  4LHK A;  2VCC A;  5L7O B;  4L11 A;  3E6D A;  3JBG 3;  5BNN C;  2EXI A;  3EHK A;  1YC6 1;  1OT5 A;  2WFF 3;  3LEM A;  1U5I A;  1PO2 2;  1XC6 A;  2V09 A;  1H30 A;  3N9M A;  1SEF A;  2JE7 A;  3K3N A;  4EV0 A;  3SCG A;  1ZRE A;  5FJK A;  1DBN A;  1VLN A;  5FZL A;  5E1R A;  3MF6 A;  5AVP A;  4DB5 A;  3B7M A;  3KS7 A;  2RR1 2;  5JIA A;  1WLW A;  1V6I A;  2ZML A;  4RSU A;  5FLJ A;  1OFN A;  4ASM B;  3JQX A;  5GZC A;  1CJP A;  5J37 A;  4UW5 A;  1AXZ A;  1FPN 1;  3RMX A;  2JDY A;  2PEL A;  4FPK A;  2WT2 A;  5A80 A;  1O3R A;  1FNZ A;  1CPN A;  4PI2 A;  1YXW A;  3INA A;  2UU8 A;  4QD2 A;  5FYC A;  3AVS A;  5FYZ A;  3SXW A;  3V64 A;  1VBC 1;  3OGJ A;  1SBD A;  1UX7 A;  2P1B A;  1W8O A;  2R0F A;  1NT0 A;  1EAH 2;  4GQ7 A;  1V9U 1;  5ABJ C;  4DXS A;  5J36 A;  1JOD A;  5GLZ A;  3HR9 A;  2PHD A;  1OOP B;  2GU9 A;  4YVS A;  3KV4 A;  3VHN A;  4DRR A;  5L9B A;  4BQW A;  5C8C C;  1OA4 A;  2V4A A;  2JWP A;  3AZY A;  3PTR B;  3O1U A;  2D6L X;  4XVH A;  4M4R A;  3THT A;  3OSD A;  5F2W A;  4IGP A;  4QX3 A;  2ZEZ A;  4CA9 A;  2R16 A;  1HB3 A;  1AL0 G;  1ND3 C;  2W92 A;  1BK0 A;  3NL1 A;  3OY8 A;  1HRI 1;  1XNT A;  1AR7 1;  1O5U A;  2RMU 1;  1GR3 A;  5E88 A;  5EYX A;  4E4D X;  1UF2 C;  2LM3 A;  3TBD A;  4CSW A;  4COW A;  5A33 A;  4XEZ A;  1PX4 A;  1GP6 A;  2D5H A;  3CJI B;  3JD7 2;  4Q4X 3;  1H8T B;  4Q26 A;  4CU7 A;  2JDP A;  4NIG A;  1VRB A;  1S0E A;  1ZZ9 A;  1LOG A;  2I07 B;  3FLT A;  1L3J A;  2E6V A;  2OA2 A;  3IB3 A;  4FFG A;  4NVP A;  5HPO A;  1MQT A;  2XJS A;  3R4U A;  3IDC B;  1ZZ7 A;  3HWJ A;  3RFR A;  3AYA A;  3JU9 A;  2HWB 1;  4QGN A;  1EUT A;  5EHD A;  3HQR A;  2PN5 A;  1YIF A;  2O8O A;  5K0U B;  4KQ7 A;  1KFX L;  4FPO B;  2OUH A;  2EIG A;  1HN0 A;  1IPK A;  3NAP C;  4BQ1 A;  4CDQ B;  4LQR A;  2ZTN A;  3U4S A;  5BYN A;  1JZ4 A;  4JKM A;  3UKV A;  4B4R A;  5FUP A;  1UO9 A;  2VAU A;  1LHN A;  3ZDV A;  3AP6 A;  3B00 A;  2ARB A;  5SV8 A;  2WNU B;  3UKT A;  1MVQ A;  3VBO C;  2H0V A;  5A3T A;  3BAL A;  2J7M A;  5FDB A;  1HQL A;  4JDO A;  5FJH A;  1DYO A;  4CDU A;  4QU1 A;  3OBZ A;  2TNF A;  1IQD C;  4B7E A;  1PGL 1;  2ARE A;  3P6B A;  3CLP A;  4NE9 A;  2ET7 A;  3LCP A;  4DUV A;  2Y0O A;  3URF A;  4LLF A;  2VNR A;  1UYX A;  3IDA A;  1COV 3;  4TLF A;  5EP9 A;  4FSJ A;  4BJ0 A;  5IYY A;  4KL1 A;  1DGW X;  5FYM A;  1ZYB A;  1DGW A;  1W6Q A;  1C4R A;  3RSJ A;  4UFJ A;  3V65 A;  3ZX7 A;  2GP3 A;  4N90 A;  5A32 B;  4BOW A;  4D0Q A;  1ND2 B;  1AR9 1;  3VBR A;  1LOB A;  3BTX A;  5BNO C;  2LRO A;  2RS1 3;  1WLD A;  1CAW B;  1QDO A;  1UYY A;  2VH9 A;  4IE0 A;  4UF0 B;  5G05 L;  4ZHN A;  1DZQ A;  1PIV 2;  2CYF A;  2VY0 A;  2R7E B;  2BRT A;  3VL9 A;  2H6C A;  4A3Z A;  4A7Z A;  5FZ8 A;  1CWP A;  1LEM A;  1O8S A;  1BBT 1;  1W2O A;  1Y9Q A;  4M3C F;  4ZON A;  2WO3 A;  2NQY A;  2Z79 A;  1NYW A;  2ZPX A;  1I5Z A;  1HJG A;  3DKQ A;  2W0X A;  4GKX A;  1GZ9 A;  2BV4 A;  5IFP A;  1E5R A;  1B09 A;  5ANQ A;  2AEY A;  4DRV A;  4GH4 C;  1BEV 3;  2VCB A;  5JI9 A;  1X7N A;  2ATF A;  2HWF 2;  1UY3 A;  4XUO A;  1D0H A;  3Q8C A;  1UMI A;  2MNG A;  4JHZ A;  3TNP B;  4AI1 A;  2FDK A;  1LR5 A;  2WQZ C;  3OD4 A;  2QFE A;  3P5B A;  5FP4 A;  1QOT A;  2GN7 A;  4KGQ A;  4ZXK A;  3VZN A;  3ZSK A;  2KA3 A;  1Q3E A;  1RUJ 1;  2G19 A;  1FPN 2;  2XXZ A;  2K0G A;  1WW7 A;  2BER A;  2C24 A;  4LIT A;  4LE4 A;  1POV 1;  3KF5 A;  3LGR A;  1PVC 3;  3DXU A;  5FAX A;  3SHR A;  4IEX A;  5LB6 A;  5EPA A;  1V9U 2;  3BCW A;  1AYM 3;  1BQP A;  2XG3 A;  3IDB B;  1QQP 3;  2WN2 A;  4P02 B;  1LOC A;  3H8X A;  3NJZ A;  1N1V A;  3JBG 1;  5FMC A;  3O12 A;  3O0W A;  3FJS A;  3QOP A;  2WFF 1;  3RZL A;  3ACF A;  4MGT A;  4NIH A;  5G04 L;  5CG8 A;  1GYK A;  3ZO0 B;  2K2S A;  2BGO A;  2VZP A;  3HNY M;  4IEO A;  5B4X A;  1GQH A;  3NNF A;  1RUN A;  1HRI 2;  2RMU 2;  1AR7 2;  4IV1 A;  4CDW B;  3RZH A;  3WNN A;  4FOW A;  2BEO A;  2ZMK A;  1YHF A;  4WZC A;  5T52 A;  1N3O A;  2JKB A;  4XF3 A;  4AR2 A;  4E2Q A;  5C3R A;  3LEG A;  1S2E A;  4N53 C;  5KWR A;  5H9P A;  1XSR A;  1OLM A;  4UW4 A;  2ZHN A;  3W58 A;  3VBH C;  1FV2 A;  2BW8 A;  4LBQ B;  5FZM A;  4UFM A;  3POS A;  3IDE A;  5FBZ A;  3NRU A;  4XXP A;  1UYZ A;  2XLG A;  4WVM B;  1G9F A;  2PQQ A;  2HWB 2;  3WQ7 A;  4DOU A;  3KVA A;  3G6J B;  4XDO A;  2YFU A;  4GAZ A;  4Y22 B;  1H1M A;  2HWD 3;  5FO7 B;  1GNZ A;  1UXZ A;  4XUT A;  5JZG A;  4OI0 A;  1SAC A;  1X9T A;  4GB3 2;  3ZFG A;  3FHI B;  4QHO A;  3HEI A;  4LKF A;  5FZO B;  4FTS A;  2R04 3;  4URT A;  5ANN A;  4BIS A;  4F83 A;  2PHR A;  3OUH A;  5FXV A;  1DG6 A;  1C1F A;  2C4X A;  2PLV 3;  1LRH A;  2Y33 A;  2Z5W A;  1NLQ A;  3CF6 E;  5I0T A;  4WM7 C;  2D93 A;  4Q4X 1;  4ZU4 A;  5FPA A;  3FHA A;  1AR6 3;  3UJQ A;  1PGL 2;  2YHJ A;  1U0A A;  2GN3 A;  3E5Q A;  5L19 A;  3KM5 A;  1GLH A;  4E2G A;  3JQW A;  2BFU L;  4AVV A;  3M4F A;  3CDZ B;  3OYW B;  5E89 A;  2Y6J A;  3B9C A;  3BPS A;  1CN1 A;  5C9A B;  1VRH 1;  3BN6 A;  2JEC A;  2UWA A;  2B46 X;  2X29 A;  3P3P A;  3C3V A;  4JQR A;  4NPL A;  5CU1 A;  5A3W A;  1QF3 A;  3LA2 A;  1YQC A;  1S0J A;  4HN1 A;  1AR9 2;  1ENQ A;  2VW2 A;  5FBJ A;  3VHR A;  1IG3 A;  5BNQ A;  2VMD A;  2FQP A;  2LAL A;  2W39 A;  2WS9 2;  3HMY A;  4OI4 A;  3RZG A;  1RL3 A;  3KHB A;  1W8F A;  2EAL A;  3H7Y A;  5BNN B;  1EYB A;  3DGT A;  4S2G A;  5KHK A;  3WNK A;  4BXS V;  2W1U A;  5FP7 A;  2FZ2 A;  4RHV 3;  1C8N A;  1DQ2 A;  2EAK A;  5C5U A;  5GZD A;  4FP3 A;  3NMB A;  4LE3 A;  3ZPY A;  1US2 A;  2YUE A;  1YFU A;  2BGP A;  4Q1R A;  2JKX A;  4W6Y A;  4RR3 C;  1WMD A;  1YQ2 A;  1NG0 A;  4L2N A;  5JSP A;  5I0D A;  3FUQ A;  5EZW A;  4CEY C;  1NX9 A;  3ZXG A;  3BVC A;  4UAP A;  4I3P A;  3VLB B;  1COV 1;  1UCX A;  1IQA A;  4ONU A;  4KH9 A;  3H1M A;  3OD0 A;  4LHS A;  4QXC A;  4B4Q A;  1GIC A;  1H2L A;  4H7L A;  2XJQ A;  3ZYR A;  5LBE A;  3U07 A;  2GAU A;  2VUL A;  5BV6 A;  4CCJ A;  2A1X A;  2DVF A;  5ABJ B;  4QPY A;  1R1Z A;  4XFI A;  1UY0 A;  3GZU C;  4G3Y C;  1RHI 2;  1TQ5 A;  3ZYI B;  2GAL A;  4YZ2 A;  1H1I A;  2Q8E A;  5EV7 A;  3CL1 A;  4YGE A;  4IXL A;  4L92 A;  4NMI A;  4QXB A;  4AFC A;  4BDV B;  1LHO A;  1AJO A;  2JJ6 A;  4XAB A;  3DPR B;  1W99 A;  1VBD 3;  1G9A A;  5GM0 A;  3ROU A;  1UU4 A;  1S0F A;  3AMM A;  3DXT A;  2LRP A;  3ZMO A;  3HN1 A;  3PJQ A;  2JE8 A;  4PJY A;  3JBG 2;  2EXH A;  4K21 A;  1R08 3;  1BEV 1;  1OQ1 A;  1RGS A;  2WFF 2;  4EWE A;  4HVQ A;  1XJA A;  2GH2 A;  3AMH A;  4ZKT B;  2QDR A;  3TAY A;  1EY2 A;  1L7R A;  4JGY B;  4DNY A;  1UWW A;  4Y1Y A;  3HJR A;  4YM2 A;  3MIH A;  5L9R A;  1VJ2 A;  1SDD B;  4DUW A;  1MQT C;  2XOM A;  4EZ4 A;  3M2M A;  1NOV A;  2WA3 A;  4YG6 A;  3PVO A;  3VB9 A;  3M3Q A;  5JOW A;  2A6X A;  4S2D A;  5LZ6 A;  2F6B A;  1LAJ A;  1PVC 1;  1QJF A;  3USU A;  2W46 A;  3J7N A;  1BMV 2;  3D8C A;  2VZQ A;  4PDW C;  1AYM 1;  5JXH A;  1C1L A;  3KF3 A;  1QQP 1;  2VOV A;  3VUO A;  1WW4 A;  2JG8 C;  2CAU A;  4CXY A;  4KU7 A;  2MHF A;  5FWE A;  1O6U A;  1ULP A;  3IMM A;  1GNY A;  3DKW A;  3VZK A;  2PXJ A;  4I01 A;  2RR1 3;  2CTV A;  2WLP A;  3OUJ A;  3M70 A;  4A7Y A;  3GZT B;  4C1W A;  1VBB 3;  4DO0 A;  2A75 A;  4NID A;  2ENR A;  2GZW A;  5CAZ A;  1J83 A;  4FT8 A;  1R1A 2;  4IEP A;  4CCN A;  2OX0 A;  4U2A A;  3IAQ A;  4ASK A;  2WDB A;  4OI2 A;  4IND A;  5JPN B;  1JMU B;  4FFF A;  3WDY A;  4Q4X 2;  1JS9 A;  2WZP P;  3VD3 A;  4RS5 A;  1SLL A;  4DPN A;  1GZC A;  1W9T A;  2E53 A;  3LDR A;  4BIO A;  4P9Y A;  2ZA9 A;  3POE A;  2GSY A;  1YFW A;  3VBR C;  1AYN 2;  4ISQ A;  5A7O A;  1VMH A;  4AQ2 A;  3K75 B;  1V6L A;  3ZPO A;  3RVH A;  4FO9 A;  1WCK A;  1T2X A;  4YVW A;  5F6K A;  1JZ7 A;  4LT5 A;  2VUC A;  1OUR A;  4JQT A;  2PHF A;  5GZF A;  1MS1 A;  5IUQ A;  5FYS A;  1NCQ B;  4YZ1 A;  2BWA A;  5IFT A;  2DVA A;  2E33 A;  2OPK A;  3AFK A;  3C7O A;  3MHZ A;  5GJ6 A;  5CFD C;  5IHR A;  1K5J A;  4L97 A;  2R04 1;  4TYS A;  1YUD A;  1OH4 A;  3T3Y A;  3LFI A;  1VB2 A;  2CHH A;  4XJZ A;  3AMP A;  1ULG A;  1UOG A;  3APB A;  4A4A A;  3UES A;  4J25 A;  4LBQ D;  2CDO A;  3BGA A;  2PLV 1;  3MYX A;  4QDQ A;  1EPW A;  4PT6 A;  3TOJ A;  5FPU A;  2X5I C;  3A0K A;  3PNA A;  4GMP 3;  3T09 A;  3WT3 A;  2QQM A;  4V1P A;  4IQP A;  1IS6 A;  4ARX A;  1YRZ A;  4XHX A;  4OI1 A;  3VKM A;  1AL2 3;  1CX4 A;  3C7F A;  3H3Z A;  4LEJ A;  1CX1 A;  3HQX A;  2YPD A;  5FZG A;  1DQ5 A;  2VZV A;  5J48 A;  1QEX A;  2ZEX A;  3ZXL A;  4NWW A;  5JWP A;  2E7A A;  1ZRR A;  2QJV A;  4YM3 A;  1PNF A;  5C8C A;  2Q30 A;  4K1Y A;  4CEW B;  4E4S A;  3FZ3 A;  4MHR A;  1RMU 3;  2RS1 2;  4XJ9 A;  5B4N A;  1UMH A;  1W2U A;  2BTV C;  2W91 A;  4NHX A;  5FP9 A;  4CDX C;  1HXS 3;  1WBF A;  1JUI A;  5KC5 A;  3B94 A;  4XUQ A;  1JOP A;  4J1X A;  1BXH A;  2D6N A;  3R05 A;  3VBU B;  2ZGR A;  2VMG A;  4CCM A;  4P14 A;  3C7G A;  3TEW A;  3IMN A;  3VBS C;  2VBD A;  4TWT A;  5FZ6 A;  1SFN A;  1X36 A;  2VPV A;  1PMJ X;  2VUD A;  1RUC 3;  3ENR A;  1WW6 A;  2JDM A;  5A3N A;  4IDZ A;  2CSG A;  2JDU A;  3OCP A;  3ZIW A;  1IS3 A;  5AFB A;  3MEP A;  1UL9 A;  1A8M A;  4QB2 A;  1LJ7 A;  4Y5S A;  2OYZ A;  3TEY A;  4DQA A;  4R9D A;  1O4Z A;  3WP4 A;  1WA6 X;  2DUR A;  3KB5 A;  2UWC A;  3AYE A;  5F3I A;  1PO1 3;  4OCT A;  3VBH B;  3RZJ A;  2OW4 A;  2Q8C A;  1PIV 3;  2ZGN A;  3OPZ A;  1BJQ A;  1OLQ A;  4A42 A;  4AHY A;  1FAY A;  3FL7 A;  4ORF A;  3NAP A;  4X8P A;  1NLR A;  3N9P A;  4NUB A;  4JKL A;  4HBN A;  1ODN A;  1QXP A;  1W9F A;  4XE9 A;  1G9D A;  1LGN A;  2R6Q A;  4LUK A;  4B8E A;  5JIU A;  3V0A B;  4CCK A;  2JG9 A;  3SH5 A;  1HX6 A;  5FZ3 A;  2UY9 A;  2ZEW A;  5A70 A;  1PVC 2;  2P3Y A;  4Y1Z A;  4QPG C;  5I8T A;  4IEW A;  3PHM A;  1RUE 2;  2P5B A;  4UW3 A;  3ZOI A;  2ORZ A;  4P5Y A;  1IPS A;  2GH8 A;  2O0O A;  1S1A A;  3ZFG C;  5SV5 A;  2HWF 3;  1F35 A;  2VM9 A;  2W1W A;  3I7D A;  4M0N A;  2R06 1;  1R08 1;  5E16 A;  4M0H A;  3SQO A;  4WM7 B;  1OHF A;  5JSO A;  1E5I A;  3ZSM A;  1V6N A;  3O1P A;  4N43 C;  1W6P B;  3IZO A;  4QU2 A;  3HN3 A;  4F7Z A;  1GZT A;  1UOJ A;  2VQU A;  1GWM A;  5JPM B;  4QQ2 A;  1S2K A;  1ZVF A;  2W5F A;  2WSV A;  1JYT A;  1H4G A;  5BNO A;  2JXA A;  1OUS A;  1NA1 C;  1SFY A;  1CZS A;  3ZYP A;  5DN2 A;  3LB9 A;  4ET7 A;  4OMD A;  1JZ6 A;  2V72 A;  1FNY A;  1EV1 1;  2JEM A;  2UY8 A;  4IER A;  2PQS A;  2ZGS A;  4Q4V 3;  4EN0 A;  2ADE A;  4CZS A;  2B42 B;  2P37 A;  1ASJ 3;  4OHY A;  1KDK A;  2V73 A;  1L7L A;  3ZR5 A;  3U0Z A;  3RJR A;  4PQ9 A;  1ZNP A;  3ES4 A;  2HWD 2;  2RR1 1;  3IAP A;  1I9R A;  4GH4 A;  3SH4 A;  2NLR A;  4CCC A;  3AVR A;  3ZSJ A;  4CTE A;  4UFL A;  4LJH A;  3N7K A;  4MX3 A;  4LNV A;  3K77 A;  1LU1 A;  3UKN A;  4C0B A;  4OUM A;  2P3J A;  3D3A A;  1XNC A;  1ULF A;  1Y3T A;  3SEE A;  2PLV 2;  2BGC A;  4KWL A;  1LB2 A;  4N9H A;  4JX0 A;  4C1X A;  3HAG A;  1HLC A;  4O9E A;  2CGO A;  2E51 A;  2BOJ A;  1QY4 A;  3ZN6 A;  1AR6 2;  4M3C A;  2IVJ A;  2VQA A;  4AFB A;  2WT1 A;  5CVR A;  1GWK A;  3TYJ A;  4XBQ A;  5DZE A;  3WW2 A;  4HAN A;  1RUI 2;  4P9G A;  3OEA A;  5A7Q A;  3TN9 3;  4PLO A;  2RJL A;  5CNA A;  5GZG A;  4YVS B;  4GB3 3;  4W6X A;  2B39 A;  4A41 A;  4OHX A;  4QQH A;  2WQ8 A;  3WG2 A;  4HOO A;  2C9K A;  1DQ6 A;  1ENR A;  2J1U A;  3NO8 A;  3PUI A;  4JTO A;  4KU8 A;  1OXC A;  1S2B A;  2E7Q A;  5FLI A;  3O1T A;  2WC2 A;  3ZSL A;  5K4L A;  4K7J A;  4XIL A;  2X8K A;  5H9S A;  2RDR A;  3JD7 1;  3OY8 B;  2WJS A;  4OVE A;  3ZLI A;  3K48 A;  3NV1 A;  1IS5 A;  4QPI C;  4RHV 2;  2ZGL A;  1OFS A;  3ASI A;  3VKN A;  3QH6 A;  2CU5 A;  2XJT A;  2XON A;  3GNE A;  1G6N A;  4GMP 1;  1WBL A;  1PVX A;  1H2M A;  1OVS A;  3OGV A;  4Y3O A;  3SCF A;  4CCD A;  4N9I A;  4PCR A;  3ZXA C;  2ARA A;  5A1F A;  4N53 A;  4LBK A;  4WM8 C;  2HYK A;  3SKJ E;  1AL2 1;  2YBP A;  5ACA 2;  1REF A;  1MQT B;  3ABZ A;  2A7A A;  1VAV A;  1QWR A;  3X29 B;  1YQ8 A;  4FTB A;  3WV6 A;  1W0N A;  1RVF 2;  3MUY 1;  3WNP A;  4ATF A;  4KG8 A;  4J1W A;  1DGR A;  5FY8 A;  5FZE A;  5HV4 A;  2WS9 3;  5BY5 A;  5FZB A;  5C70 A;  5T55 A;  1RMU 1;  2D6M A;  2VUJ A;  3J7H A;  4XOG A;  2GP5 A;  3MW4 A;  1ULE A;  1W0P A;  3LQC A;  2WO7 A;  3AMN A;  1K5M C;  1AVB A;  1W2A X;  3IPV B;  4XUN A;  1HXS 1;  1BMV 1;  4RA0 A;  2UYB A;  2WKK A;  3OGS A;  1O3Q A;  2EIC A;  1QJU 2;  4CP2 A;  3C8X A;  5FZD A;  1HKD A;  4FVV A;  1LOD A;  1UZY A;  4XCB A;  1FOD 3;  3T1M A;  3N9N A;  1WCU A;  4YW3 A;  4IV3 C;  5FFO C;  3T08 A;  4CDU B;  1OLR A;  1VBD 2;  4CP9 A;  1MS9 A;  1K45 A;  1RXG A;  3FLR A;  1RUC 1;  3O1R A;  1NXM A;  2QQN A;  1NUK A;  1XNK A;  4Y5Z 0;  5GAL A;  3UGF A;  1WA4 A;  4BQ2 A;  2B45 X;  1MS8 A;  3EQE A;  3CBN A;  3HD8 B;  3MFA A;  1RUO A;  2HEV F;  5F37 A;  2VZS A;  2WUH A;  5LEK A;  3VD9 A;  1HB4 A;  3A21 A;  3ZM8 A;  1W90 A;  1B35 C;  2Q1Z B;  1H4H A;  1RUG 3;  1DQ1 A;  2CDP A;  1W6Q B;  2WWS A;  1UNB A;  1PO1 1;  4OLL A;  1JZ2 A;  4ISR A;  1W6M A;  1FAT A;  1PIV 1;  2I74 A;  2WAB A;  3MPP G;  1RHI 3;  4RS5 C;  4Y20 A;  3VBR B;  4AVS A;  2P4E A;  2ZGU A;  3A7Q A;  1CIY A;  5BXX A;  1UAI A;  4BXF A;  3E97 A;  3OTF A;  3AL5 A;  3SNM A;  1SFP A;  3GJA A;  5EJ3 A;  3AZW A;  2QTW B;  1KDM A;  2OKX A;  4Y26 A;  4Y5T A;  4YZ4 A;  3UET A;  2BPA 2;  1KS5 A;  3ES1 A;  3RWK X;  4A7K A;  3B93 A;  2XJU A;  2VOT A;  5KC6 A;  5C3S A;  1CAX A;  4DIQ A;  2HKX A;  1JYN A;  5A6Q A;  2YGL A;  4MSV A;  4OHW A;  1CAU A;  2DV9 A;  3RI8 A;  3GCW A;  1Q56 A;  1RTV A;  2VVF A;  1DU3 D;  2HWF 1;  2XBO 2;  4HK9 A;  4NN0 A;  4S2H A;  4RR3 A;  3SC7 X;  1XSQ A;  3D6E A;  3HNB M;  4N8M A;  5H9Q A;  4D94 A;  3VDB A;  2UWB A;  4CEY A;  1OQE A;  5DAV A;  1O4Y A;  1Y9G A;  2F4P A;  3R6S A;  1VBB 2;  4AEM A;  4UXA A;  4CU6 A;  4LKE A;  4PIX A;  2IXH A;  1HRV 3;  1TG7 A;  4DEV A;  4MXW A;  1HQW A;  3AJY A;  3BI3 A;  1DZR A;  1MAC A;  4HXC A;  3AFG A;  1GQP A;  2W94 A;  1AF9 A;  2VMC A;  3U1X A;  4EE2 A;  1IZ3 A;  3OGR A;  5FYU A;  4BE3 A;  4TSV A;  4Q4V 1;  5C4W C;  4R9B A;  3U10 A;  3ZVX A;  2W87 A;  5J96 B;  2EAA A;  2JX9 A;  3S6P A;  1D4M 2;  4COV A;  3KVB A;  1G9B A;  3I3B A;  2A3W A;  1ZBA 3;  2DVB A;  1N47 A;  1O59 A;  1DZT A;  4HON A;  4B4P A;  1GKB A;  4KNC A;  4M4P A;  5CFC C;  3WZ1 A;  4FAH A;  2GMM A;  1R1A 3;  3ZKU A;  4AVA A;  2P34 A;  3DV8 A;  4Y24 A;  4CP1 A;  2WO2 A;  2YU2 A;  3JCI A;  2HWC 3;  1MZ5 A;  4IV1 B;  5FPV A;  4EZH A;  2IC1 A;  2NMO A;  3Q8E A;  4AF9 A;  2WNV A;  3CZJ A;  1JOJ A;  2AEN A;  3WDW A;  5HI0 A;  5IVJ A;  1OPM A;  4BMB A;  4NRO A;  2NZ9 A;  3CJX A;  1VBE 3;  1AYN 3;  2YC2 A;  4IW3 A;  4YAR A;  1FXZ A;  1N1S A;  1ZRF A;  2ZKL A;  4LR4 A;  4CE8 A;  4LLO A;  1AL2 2;  3M7A A;  4MHU A;  2DU0 A;  3TN9 1;  2FDJ A;  4AED A;  4PDW A;  5FZA A;  2VZ3 A;  1TNF A;  3ITQ A;  1Y4W A;  4GB3 1;  4EN9 B;  2JG8 A;  2C26 A;  3O0X A;  4AGV A;  2D6O X;  3N3H A;  3WLU A;  1RMU 2;  1RUH 2;  2JG9 C;  3SKV A;  1LEC A;  3VZJ A;  5JZG B;  3VD4 A;  2UUR A;  3ZFG B;  2XUM A;  4A6S A;  1F31 A;  2Q4S A;  4Y1U A;  2B9V A;  4KMQ A;  1HXS 2;  1KXG A;  3RPQ A;  1W2N A;  1PM7 A;  1WD3 A;  1XYP A;  4YG0 A;  4D7S A;  5JMC A;  1FYU A;  1OC1 A;  4K9S A;  5FZ7 A;  1HJF A;  1GOG A;  1ULC A;  4MLO A;  2EVX A;  2QQU A;  3OOX A;  5A6X A;  2AZ5 A;  5T3N A;  3CU7 A;  2PYT A;  5A3L A;  2P3I A;  1RUC 2;  3VBF C;  2ZX2 A;  4FPH A;  2VE1 A;  1UU6 A;  2VZR A;  3VZO A;  2LUW A;  3P1I A;  3S5Q A;  3QH7 A;  4XAC A;  2E31 A;  3LA3 A;  5DAX A;  1VMF A;  4I2O A;  2VZO A;  1WGP A;  4EN8 B;  5A6Z A;  1JU3 A;  4DXZ A;  1JU4 A;  2D5F A;  2XJV A;  3AXD A;  2WS9 1;  3ZFF C;  3AP4 A;  1PO1 2;  1Q8V A;  1RIR A;  4JKK A;  4ZS3 A;  2OS2 A;  1Z7S 2;  4BPZ A;  4N7I A;  2XML A;  4H3W A;  1W3V A;  1YI7 A;  3H8U A;  2YPJ A;  5CFD A;  4QKF A;  4XZP A;  5IJR A;  4NRM A;  1Q8O A;  4AEJ A;  1OF4 A;  3FBM A;  4OHZ A;  1FOD 1;  3KV5 A;  3POI A;  3Q8A A;  3R4S A;  2I2S A;  1NLS A;  3KT7 A;  3U4X A;  3TB0 A;  1ZA4 A;  2VG9 A;  2X5I A;  5DZF A;  5FK7 A;  2E9Q A;  1GP5 A;  2LS6 A;  4YW2 A;  1NCR B;  2ZMN A;  1H2N A;  1RUD 3;  2EIB A;  2WYF A;  3PU3 A;  4Q29 A;  1UOF A;  3ALQ A;  1R64 A;  2Q5T A;  1S55 A;  4AHZ A;  2ZGP A;  2Y0I A;  2AH2 A;  1SMV A;  4M00 A;  1WUV A;  4AEK A;  3NV4 A;  4BK5 A;  2CY6 A;  4HL0 A;  5F3G A;  2PMW B;  1XBF A;  2WAA A;  5D2A A;  4QX5 A;  5TSW A;  5EJZ B;  2ZGM A;  1FMD 2;  1UOB A;  2RG4 A;  1RHI 1;  4KGG A;  4BLJ A;  1KRI A;  4FPE A;  3KSC A;  1GOF A;  4QB6 A;  5JVV A;  1WCS A;  2J1A A;  2VNG A;  1AJK A;  4NHL A;  3VN4 A;  4CDX A;  1MPX A;  1JZ3 A;  3VV1 A;  2C9A A;  1E5H A;  3EJK A;  1RUE 3;  4JVA A;  4Q4V 2;  5F6L B;  5T5J A;  1WW5 A;  1C5I A;  2YBK A;  3MIF A;  5DXD A;  1ASJ 2;  4E9K A;  2X10 A;  1S0C A;  3VBS A;  3VDD C;  1W04 A;  3MGU A;  4D69 A;  4QDS A;  1YIP A;  1J1L A;  2JD9 A;  5IT6 A;  3BKZ A;  3KT1 A;  3VKO A;  4KWU A;  1H1A A;  1LED A;  3KGZ A;  4GKY A;  1RUF 3;  4RFR B;  2DF7 A;  3ZXE A;  2AC1 A;  4AQS A;  4BME A;  2VOK A;  4FOV A;  4P08 A;  3H8O A;  1GV9 A;  2R30 A;  4AGR A;  4GMP 0;  2ZX3 A;  3GZE A;  3QCW A;  1A6C A;  4B7K A;  4QKN A;  1HRV 1;  1GOH A;  4DY3 A;  2Y38 A;  5FPL A;  3OJB A;  3A22 A;  4X6Q B;  2V5Y A;  4C91 A;  4IUG A;  5FO9 B;  4FI9 A;  4I0A A;  1N3P A;  1OQD A;  3FE5 A;  1CQ9 A;  4FPF A;  5EQU A;  5J09 A;  2XQR A;  3LDB A;  4MOA A;  2QQV A;  1LHV A;  1C57 A;  3USU B;  2VW0 A;  3BTZ A;  3FFQ A;  3OPT A;  3TN9 2;  1W8H A;  3MO4 A;  1ZBA 1;  4QPG A;  2JD4 A;  3MW2 A;  5LK5 A;  3OEB A;  3WDX A;  4LHL A;  1A3K A;  1FI2 A;  1OSG A;  1CAV A;  4S2F A;  5C3Q A;  4GWM A;  2W3J A;  1SBE A;  1YEW A;  2R1D A;  3I2K A;  1DQ4 A;  3MBW A;  4LO4 B;  4XFC A;  1R1A 1;  2WZR 2;  1TMF 3;  4HPK A;  4ZZ5 A;  3MDP A;  3HVD A;  4N43 A;  3THC A;  3NWK A;  1CZV A;  2RE9 A;  3PVE A;  3WNL A;  2YGM A;  2VTX J;  2OXB A;  4AI2 A;  2HWC 1;  4LA2 A;  3I4I A;  4YM0 A;  5D8A C;  3I3E A;  2YRO A;  3WNO A;  4GXL A;  4JAA A;  2GNB A;  3KMH A;  1W8U A;  4UT5 A;  3VKL A;  5BUV A;  1NA1 A;  1PZ7 A;  2WT0 A;  1N1T A;  4KI5 M;  1AXK A;  1VBE 1;  1AYN 1;  1RUI 3;  4RS5 B;  1HQN A;  1MZF A;  1PK6 C;  1US3 A;  3AYD A;  4NII A;  4B1L A;  1QMJ A;  1LKN A;  3KCC A;  2GC1 A;  1VAK A;  1SCS A;  2P6H A;  5IK8 A;  1AR8 2;  1UPS A;  3U37 A;  1QJY 3;  4GD4 A;  4HLT A;  2AAC A;  4GA9 A;  1KJR A;  1QJX 2;  3PIG A;  4YVW B;  3HQU A;  2XWJ B;  4Z8B A;  5BNP C;  4ITC A;  1TEI A;  2RJK A;  4UYB A;  2KXL A;  2Y8K A;  1AX2 A;  1W6O A;  4Q0S A;  2ZAB A;  2WZE A;  2VZU A;  3I8T A;  3WQB A;  5FY1 A;  1IKQ A;  3WW3 A;  1FOD 2;  5C8W A;  3A23 A;  5A3M A;  3M3E A;  3WF1 A;  5LW9 A;  4PHZ A;  1XU1 A;  2DUP A;  5ACA 3;  5FY0 A;  2J1T A;  1GU3 A;  1RVF 3;  1PZ8 A;  1SG3 A;  1PX3 A;  5IW0 A;  4WVV A;  1VMJ A;  1VB4 A;  2F4L A;  2VXJ A;  4URA A;  3QLQ A;  5FYB A;  2HEW F;  5FPX A;  5JMO A;  5HCB A;  3PME A;  2RS1 1;  5LA1 A;  1J59 A;  2A6Y A;  1RUG 2;  1V6K A;  1A8D A;  1QOS A;  3K51 A;  5K9Y A;  3I2O A;  5C8C B;  1F4A A;  4DUX A;  2A6V A;  4XF9 A;  1QJU 3;  4RQP C;  3AL6 A;  2AGS A;  4K8R B;  3I49 A;  4LBL A;  5FTT C;  1LEN A;  4FCA A;  3RWN A;  2XLF A;  1LNS A;  2ETE A;  5A1L A;  1MEC 3;  1ND3 B;  4XJW A;  4IE6 A;  2WAO A;  4QPI A;  5CZK A;  1ZRD A;  5KXC A;  3K4Z A;  4YZ3 A;  4LOT A;  3ZMN A;  2IVI B;  3AB0 A;  1W9S A;  2EIE A;  1BCX A;  4G9S B;  2XQX A;  1K3I A;  3AK0 A;  4PLM A;  3M3O A;  4UFH A;  5F8P A;  4W8J A;  5KBF A;  1RUD 1;  2XHK A;  2IXC A;  1NE4 A;  4RGG A;  2ZGO A;  3ZFE C;  1D2Q A;  5JLV A;  1POQ A;  2A3Y A;  2UYA A;  1PNG A;  4WM8 A;  2QQP A;  4CU9 A;  2BWC A;  2JIJ A;  4BIF A;  5I0R A;  5DG2 A;  1QH7 A;  5I8Y A;  2GND A;  2OII A;  1VIW B;  1YQ5 A;  2AYH A;  1CVN A;  2QCS B;  5C71 A;  2C0Z A;  1HW5 A;  4BK4 A;  2WNV C;  1S4C A;  1W9W A;  3HIF A;  1HRV 2;  1NY7 2;  4NHK A;  3MF9 A;  3NAP B;  1SZB A;  5KXE A;  4WBB A;  4P9W A;  1VPH A;  1K5M A;  2YZ4 A;  4AAX A;  3DYO A;  1ENS A;  2TUN A;  5LBF A;  1UZ0 A;  3ACI A;  4AED C;  1RUE 1;  2JG9 B;  2WWU A;  3I3Q A;  5IAX A;  1I6X A;  1G86 A;  2WNE A;  3VBO B;  2XBO 3;  4XIK A;  1UKG A;  2WZ8 A;  4IV3 A;  4E8D A;  3W59 A;  3VHP A;  1ZBA 2;  4JGZ C;  4HET A;  1Y43 B;  3HPN A;  5FQ0 A;  1VBA 2;  1SBF A;  4KWK A;  2WII B;  3PL0 A;  5F39 A;  1XPW A;  4FFH A;  4RYD A;  4CCE A;  1WWY A;  3GBF A;  3ILF A;  1YQ6 A;  3NW4 A;  1B35 A;  4B3N A;  4OMC A;  3V56 A;  2HWC 2;  2XGX A;  3POG A;  5LBB A;  1JOB A;  3GGL A;  1AZD A;  5F5C A;  1H6X A;  5BNO B;  4HSJ A;  3H50 A;  1T6B X;  4QX1 A;  2H6B A;  5FZO A;  1HV0 A;  4IGQ A;  1HIX A;  1D4M 3;  3LAG A;  3M8L A;  4Z2W A;  1VBE 2;  4XDQ A;  5FY4 A;  5F32 A;  2W1Q A;  2F17 A;  3AKS A;  3J8F 3;  4DXR A;  4NPR A;  3THP A;  4HFS A;  1CGP A;  1ULO A;  4MZU A;  1TME 3;  1X50 A;  2XDV A;  4CUC A;  5FZH A;  2HWD 1;  3C7H A;  1XQN A;  1WME A;  3H1Y A;  4A45 A;  1N1Y A;  3SEP A;  3VHO A;  4DXT A;  2ZHM A;  3LPF A;  4XMI A;  2AEZ A;  5FY5 A;  2FDG A;  4Y1X A;  2ZJC A;  1YI9 A;  4MGY E;  5D21 A;  1JYW A;  2C5D A;  2YYO A;  1DHK B;  4FQ4 A;  3RZK A;  1JYC A;  3KD4 A;  2WIN B;  3ETQ A;  1TMF 1;  4GH4 B;  4KWJ A;  3ZIX A;  1XYN A;  4Q5O A;  5C9A A;  1QJZ A;  2XVK A;  5CKM A;  5DDJ 2;  5FMO S;  4E8C A;  3IN9 A;  3ACG A;  5FXX A;  5FKC A;  5IAV A;  2WBK A;  3SMH A;  5KXB A;  5KHG A;  1A78 A;  2HBU A;  3AKP A;  2QQI A;  5T5L A;  1AR6 1;  4NOT A;  3QD6 A;  1ZBE 3;  3N9L A;  1W06 A;  2VD7 A;  1EPZ A;  4A6O A;  3GF6 A;  2VQ0 A;  5A3O A;  2B8M A;  2G9G A;  1RUI 1;  2X53 S;  5KHH A;  3ZXD A;  5LRS A;  3LSD A;  4YW5 A;  3ZN6 B;  5FZK A;  4FPY A;  4M3C B;  3ZXK A;  5C4W A;  3O1V A;  5EIY B;  1CZT A;  4LBO A;  4LUL A;  2Z4F A;  5A7W A;  3P3N A;  4PBP A;  2PAM A;  1QJY 1;  3CO2 A;  3HT2 A;  4R9C A;  3UNP A;  1QOO A;  4WVZ A;  1RUH 3;  2VCM A;  2IFR A;  2YU1 A;  1SPP A;  1URX A;  4JZR A;  5T5O A;  5KR7 A;  4WZF A;  2VMI A;  3GYD A;  4MH0 E;  4LO8 A;  3C2U A;  4AI9 A;  1RIT A;  5CFC A;  2RHP A;  3NJV A;  5FY9 A;  4Q2F A;  3U75 A;  3VDA A;  1KFU L;  3VZM A;  5I0S A;  4RHV 1;  1IGO A;  3ECQ A;  4LTA A;  1I1E A;  2ERF A;  1X33 A;  1I5P A;  2AR6 A;  3BTA A;  3J4U H;  1KEX A;  1RYY A;  3PIJ A;  3SIT A;  3VL8 A;  1QNW A;  2VGD A;  5JCT A;  1XE7 A;  1H9P A;  1OA2 A;  1SLC A;  2FCT A;  1OD5 A;  4C0H A;  2IUW A;  2HWE 2;  4F8A A;  3PJY A;  3RS6 A;  4QKB A;  5ACA 1;  1UZV A;  1XRU A;  2HBT A;  4RL7 A;  1G7Y A;  1QJE A;  2EF6 A;  3BUC A;  3ZXF A;  1UY4 A;  2CAV A;  2ZHK A;  1RUD 2;  1RVF 1;  4N53 B;  5ERL A;  3K4A A;  4ERO A;  3ZYB A;  4NO4 A;  4AFD A;  5DG1 A;  4AL9 A;  1Z7S 3;  2W52 A;  5EFU A;  1K12 A;  4AVB A;  1BVP 1;  5CKQ A;  2VZT A;  2YV8 A;  1YLL A;  4XC9 A;  4G4F A;  4MYE A;  4GIQ A;  5LEJ A;  1QJU 1;  2BQP A;  1QXR A;  4QM8 A;  3UV9 A;  2XKP A;  1IHM A;  2WSU A;  3H3L A;  4AGG A;  4LA3 A;  3LIH A;  4A44 A;  3CJI C;  1VBD 1;  1H8T C;  4CXX A;  1MEC 1;  3DYP A;  4C90 A;  4JGY A;  2WR9 A;  5FP8 A;  4W4Z A;  1LOF C;  3WD5 A;  2QQW A;  4BU2 A;  3G7D A;  4YM1 A;  2ZS6 B;  4IEY A;  3RJ2 X;  2DCY A;  4CP9 B;  1U5Z A;  1NQJ A;  3RZM A;  4RGK A;  1JYX A;  2XVG A;  1IOA A;  2NMN A;  3VBF A;  4CPB A;  4QAW A;  4OQ8 A;  4CYD A;  2O14 A;  2V4V A;  5F5Q A;  1W8N A;  3KQR A;  1FMD 3;  1OA3 A;  1ENX A;  1RUF 2;  2B4K A;  3WUD A;  3K3O A;  5I93 A;  1JXN A;  3AKT A;  4D6R A;  1M4W A;  1UIK A;  1X82 A;  5F1R A;  1IPJ A;  3O14 A;  4AQ6 A;  1OLM E;  3ZFF A;  2P17 A;  1W6M B;  4XMA A;  4NAM A;  4Y20 B;  3LOB A;  3B5L B;  3RDI A;  4AHX A;  4CCO A;  1MVE A;  2E7T A;  2VEC A;  2WA4 A;  5LRR A;  2ZZQ A;  1JTZ X;  1LHW A;  3FUO A;  3NKG A;  3ZSE A;  4CRQ A;  2R07 3;  3VGI A;  3III A;  5GZE A;  1AX1 A;  5HCA A;  2VZ1 A;  4QWN A;  2XBO 1;  1CAX B;  1MZE A;  2PHX A;  5JAX A;  4B1M A;  1KS4 A;  2BNM A;  1DYP A;  3D0S A;  3LE0 A;  4RFT 0;  4BQY A;  1XNA A;  4A3X A;  2ZX4 A;  1CAU B;  2D43 A;  3RG0 A;  1H2K A;  4RR3 B;  4ZPI A;  1VAM A;  1VBB 1;  3BOW A;  4CEY B;  3I2H A;  1VBC 3;  1ND2 C;  5F3E A;  5IK4 A;  1WLT A;  3WP3 A;  3BPZ A;  3TEZ A;  1WD4 A;  2YB7 A;  1TMF 2;  4XHB A;  2OQ6 A;  1UY2 A;  4I3G A;  3WP6 A;  1APN A;  4ATE A;  4MAD A;  2FDH A;  2MEV 3;  3B02 A;  3LKJ A;  4HVO A;  3MIC A;  2WRA A;  2PHW A;  4MXW B;  4UBH A;  1G9C A;  4OUL A;  3TNQ A;  2RVA A;  2D3S A;  4XJ8 A;  3I59 A;  2JDN A;  1X8E A;  3PVN A;  4HKO A;  3WDU A;  2ZAH A;  1D4M 1;  1LOA A;  1T6G C;  3C7E A;  4BA6 A;  3KHC A;  1RED A;  2XHN A;  5KXD A;  3S0M A;  3WNM A;  4F3J A;  1VE0 A;  2BJS A;  5FOB B;  3I97 A;  3HBZ A;  3VD5 A;  5LY1 A;  3WHT A;  4UW6 A;  2GC2 A;  2XB6 C;  4AWD A;  1QJY 2;  4JDN A;  3RRD A;  3VDD A;  1I3H A;  2R49 A;  2WZR 3;  2CWS A;  3UJO A;  3BU7 A;  4OQ9 A;  1JYV A;  5AC9 2;  3K2O A;  3PLQ A;  4LK6 A;  5M0T A;  1JZ5 A;  1V70 A;  2XH6 A;  3NVC A;  3MW3 A;  1EP0 A;  1QDC A;  4Y33 A;  5F3C A;  1U5Y A;  3W5M A;  1BK1 A;  4BLI A;  3I2G A;  3S7I A;  5A33 B;  3H8R A;  4D7T A;  4XCA A;  2D3P A;  3PTY A;  1W28 A;  3EO6 A;  2Q0A A;  2A73 B;  1ZBE 1;  1LHU A;  1R09 3;  3THD A;  5AVA A;  5IVE A;  4P9X A;  2WNV B;  4YPJ A;  2W08 A;  4BQ4 A;  5C3O A;  2KM2 A;  1AR8 3;  4BYY A;  4NHY A;  3NNG A;  1C3H A;  3I2D A;  4LOS A;  3F95 A;  1JH5 A;  1QJX 3;  3S30 A;  1GUI A;  3OBR A;  1RUH 1;  2RV9 A;  3D0J A;  4QX8 A;  5A7S A;  4AED B;  2Y34 A;  4TTG A;  3T1L A;  4PDW B;  4EJR A;  1XYO A;  1RB8 G;  1GFF 2;  1OMI A;  2JG8 B;  5CG9 A;  2OQ7 A;  3GHN A;  2VME A;  4CDW C;  3OG2 A;  4XAA A;  4JC1 A;  2A5Z A;  4YRD A;  1C28 A;  2QUO A;  1MEC 2;  1Q43 A;  1MS3 A;  5FZI A;  1GZW A;  4AQT A;  5DMY A;  1YJK A;  5D8A A;  5DUW A;  3N4M A;  2PAK A;  1GWL A;  3WCR A;  4RN5 A;  1MR5 A;  5ISL A;  2RDS A;  3M3I A;  2ID4 A;  2D98 A;  4MET A;  3WP5 A;  4AZZ A;  4BHP A;  1PK6 A;  3J7M A;  3D82 A;  4P9J A;  1QNY A;  1V6O A;  2IXK A;  4KBB A;  1H0B A;  4QQP A;  5IAT A;  3T4V A;  1Z7S 1;  2D40 A;  1ZM1 A;  3GBW A;  1ALY A;  4FFI A;  2JDA A;  2ZOE B;  2PHL A;  2VXR A;  2YXS A;  1DFQ A;  1WZX A;  3LEK A;  2O8Q A;  2ET1 A;  2Y60 A;  1HV1 A;  4DFS A;  2Q1M A;  1WLC A;  2JB8 A;  1LES A;  4LBJ A;  5BNP A;  1TZO A;  4DS0 A;  4NWV A;  1O7F A;  1DQ0 A;  1UU5 A;  2C1F A;  1F15 A;  1DP0 A;  3UGG A;  4Z1V A;  4XZU G;  4AYU A;  3KCY A;  5CFD B;  4L8Q A;  1RIN A;  3J7L A;  1ZRC A;  4FPJ A;  3HOB A;  1NXD 1;  4X6R B;  2BBV A;  1OKO A;  5GLU A;  3AZX A;  3POW A;  3D4K A;  3CHX A;  3WF3 A;  5HCH A;  2XKO A;  4LOR A;  2X5I B;  4PF5 A;  1W6N A;  2BOI A;  3H3U A;  3V0B A;  4P9I A;  5C9A C;  5J98 B;  4YW1 A;  4C8D A;  1JN2 P;  4FXK B;  4MGZ E;  4AFM A;  4O61 A;  1ZA7 A;  1FMD 1;  3QAC A;  2ILM A;  4AXO A;  4QDR A;  2JDZ A;  3OUI A;  4Y4Y A;  1JUH A;  4Q0Q A;  5GLT A;  4I0W B;  5DUX A;  1J3P A;  2ADD A;  2BZD A;  5FWJ A;  1H9W A;  5DUV A;  1UXX X;  4D8M A;  1O3S A;  2DUQ A;  2QBX A;  4QKD A;  1GAN A;  2JDK A;  2G9F A;  4RQP A;  2Y6H A;  4LBN A;  1DIW A;  4HVR A;  4I30 A;  4PIY A;  3WXP A;  4P00 B;  2R07 1;  4LO5 B;  4CDX B;  3ZR6 A;  1ASJ 1;  2HEY F;  4Q0U A;  3I54 A;  1TVG A;  2B7Y A;  2I45 A;  5CB7 A;  2DWR A;  2DFC A;  3GZA A;  3J8F 2;  3OPW A;  1SCR A;  2PFW A;  2QNK A;  3IT8 A;  5FRA A;  1TME 2;  2VVE A;  1W9Y A;  2JDH A;  4AOC A;  1VBA 3;  3AXE A;  3VBS B;  4AK3 A;  1HB2 A;  2W1S A;  2YC4 A;  3A4U A;  4LXL A;  4XBL A;  2RJ2 A;  5JR7 B;  1YWK A;  4FBF A;  3U14 A;  3ZFE A;  5LWB A;  1W0O A;  3CEW A;  5FUN A;  4ZXE A;  2VNO A;  2GNM A;  3E6C C;  3M3C A;  1SLB A;  2DCJ A;  4ES9 A;  2J1R A;  1D0G A;  1Z78 A;  2MEV 1;  3WY6 A;  4BQ3 A;  5FZ4 A;  4O9G A;  1H6Y A;  3VZL A;  2VTX A;  1XE8 A;  4DIN B;  3KZ4 C;  1YNA A;  1S0B A;  1DDL A;  2D3R A;  1ZBE 2;  1F9K A;  3EB7 A;  4JV4 A;  1TNR A;  3DPR C;  3O1O A;  3LDK A;  3DUI A;  2O1Q A;  3UK9 A;  2GDF A;  2YFZ A;  4JRA A;  4ASL A;  1GP4 A;  3WF2 A;  2XJR A;  3AP9 A;  4LKD A;  4XUR A;  3NNM A;  3PDQ A;  1WCD J;  4K3U A;  1UW8 A;  3W21 A;  3ZN4 A;  4YFZ A;  1OUX A;  4QPG B;  1ZZB A;  3A0N A;  2PTM A;  2WZR 1;  1YO8 A;  4JGZ A;  1CAV B;  1W05 A;  3JB8 A;  2H0B A;  5EJ1 B;  4COU A;  2CV6 A;  2FCU A;  5DDJ 3;  4Q4W 3;  1JW6 A;  3GDB A;  3N36 A;  1AHS A;  1HDK A;  4JGY C;  3KV6 A;  1JHN A;  1RJ7 A;  4HPK B;  3NNL A;  1UMZ A;  3MV0 1;  4N43 B;  1VRH 3;  3AZV A;  1MS4 A;  5HXM A;  4UBG A;  4XQW A;  2DYC A;  3L2Y A;  4E4H A;  2IXL A;  3B9I A;  1S0D A;  2LTN A;  1J58 A;  2FCV A;  1CR7 A;  3EXU A;  1DCS A;  3L9J T;  3T0B A;  3FMG A;  3O1M A;  1R09 1;  1AUY A;  1ZZ6 A;  3IPV A;  3NNJ A;  1NA1 B;  2VO5 A;  2YC0 A;  1PMH X;  4NRP A;  1AR8 1;  1AX0 A;  3H42 B;  1IKP A;  3OF1 A;  2WFP A;  4PBO A;  3O5S A;  4BCU A;  3FLP A;  4XIO A;  4XJA A;  1QJX 1;  3WHU A;  3WOG A;  1YJL A;  4I0B A;  2BNO A;  3T2Q A;  3FX3 A;  2OZ6 A;  1TE1 B;  4Z92 B;  1SDW A;  1XOY A;  1E5S A;  4XJU A;  1LTE A;  2BP6 A;  1WMX A;  2YY1 A;  3F2Z A;  3FWE A;  4IGO A;  3N7M A;  2LW8 A;  1SLI A;  3BTY A;  2ZX1 A;  1CIW A;  1O3T A;  5FKB A;  5T54 A;  5FYT A;  1W6O B;  4YZ5 A;  5JSR A;  2HLE A;  1N3Q A;  1PGS A;  2HWE 3;  3POB A;  2MPF A;  1SHW B;  4R52 A;  2K9Z A;  5FK8 A;  2EXK A;  1XNB A;  1ZZ8 A;  3NST A;  4FPC A;  2DBN A;  5IVY A;  2V5D A;  3ZYJ B;  5JOZ A;  5A3U A;  2ES3 A;  2BVB A;  4IE7 A;  3LPG A;  2GC0 A;  4IEU A;  1KIT A;  1Q8P A;  3T2O A;  5FZ9 A;  1W3X A;  2B5H A;  4QT6 A;  1OD3 A;  1SLA A;  4UFK A;  1RUG 1;  3PUS A;  3OBA A;  2W68 A;  3EMR A;  3KQ4 B;  4MGQ A;  4OUE A;  4WVW A;  3ZN5 A;  1XU2 A;  3BB6 A;  5L7O A;  2XVL A;  2Q8D A;  3PVB B;  2Y26 A;  4LBM A;  1NCQ C;  4E2S A;  4PQQ A;  4UWD A;  3O1S A;  3Q8F A;  2GMP A;  4L99 A;  3EYP A;  2QKD A;  3K4D A;  1UIJ A;  2D6P A; 
#chains in the Genus database with same CATH homology
 2ORZ A;  4P5Y A;  4UI9 L;  4LKS A;  4OZO A;  2VM9 A;  5C71 A;  2W1W A;  4BK4 A;  1W9W A;  5JXG A;  5CYY A;  1KGY A;  3AC0 A;  3HN3 A;  2VQU A;  4AAX A;  3DYO A;  2VCC A;  1UZ0 A;  3ACI A;  2W5F A;  1P8J A;  1JHJ A;  1OT5 A;  1XC6 A;  1CZS A;  2WZ8 A;  4E8D A;  4ET7 A;  1F4H A;  4OMD A;  1JZ6 A;  2V72 A;  5A1A A;  1J84 A;  3OB8 A;  2PQS A;  3HPN A;  5JR2 A;  5LA0 A;  3FHQ A;  1NKG A;  2W47 A;  1XPW A;  5DPN A;  4RYD A;  1NAE A;  2J1V A;  4OMC A;  1UX7 A;  1W8O A;  2BBA A;  3GGL A;  3IAP A;  4DXS A;  3WSO A;  1H6X A;  4QX1 A;  3K77 A;  1D7P M;  3D3A A;  2W1Q A;  3SEE A;  4XVH A;  4DXR A;  4M4R A;  1ULO A;  1OF3 A;  4JX0 A;  4QX3 A;  4CUC A;  2ZEZ A;  3C7H A;  5DN2 A;  2W92 A;  3SEP A;  4A45 A;  4DXT A;  1XNT A;  3LPF A;  1JYW A;  1PX4 A;  4ARY A;  4CU7 A;  2VC9 A;  3OEA A;  2VMF A;  4E8C A;  3ACG A;  3IB3 A;  4A41 A;  2WBK A;  5HPO A;  2WQ8 A;  2C9K A;  2QQI A;  2J1U A;  3PUI A;  4XUP A;  1EUT A;  4A6O A;  5F7U A;  1JZ4 A;  4LQR A;  1GMM A;  4JKM A;  2XON A;  5EIY B;  1CZT A;  3VDC A;  2Z4F A;  3OGV A;  3UNP A;  2Y6K A;  3SKJ E;  2J7M A;  1DLC A;  1DYO A;  2YG0 A;  3ABZ A;  1BHG A;  2E26 A;  3NJV A;  1IQD C;  3VDA A;  1W0N A;  2VL4 A;  3MUY 1;  3WNP A;  3P6B A;  3ECQ A;  4OYU A;  1I5P A;  4DUV A;  5C70 A;  1KEX A;  1RYY A;  4MO3 M;  2E32 A;  2X05 A;  3J7H A;  1UYX A;  3IDA A;  4BJ0 A;  5IYY A;  3LQC A;  4XUN A;  3OGS A;  2EIC A;  4D0Q A;  3C8X A;  1UY4 A;  3HNM A;  4QPW A;  1UYY A;  5G05 L;  3K4A A;  3T08 A;  2R7E B;  1K45 A;  4A3Z A;  1K12 A;  2QQN A;  1NUK A;  1O8S A;  1EUU A;  2VZT A;  2WO3 A;  3CZU A;  4PF1 A;  2VZS A;  2WUH A;  3VD9 A;  3A21 A;  3ZM8 A;  2CDP A;  5FUI A;  5IFP A;  1JZ2 A;  4A44 A;  2WAB A;  3DYP A;  2VCB A;  3A7Q A;  1CIY A;  4W4Z A;  2L9L A;  3I2I A;  1UY3 A;  1O8P A;  4XUO A;  2OKX A;  3T0D A;  3UET A;  1UMI A;  4JHZ A;  2EID A;  2VOT A;  4QAW A;  2V4V A;  1W8N A;  4GWI A;  1JYN A;  3E1F 1;  2B4K A;  2BER A;  2QQJ A;  2W9X A;  3HNB M;  1JI6 A;  3VDB A;  3MV1 1;  3PUH A;  2WN2 A;  4P02 B;  4CU6 A;  3III A;  1TG7 A;  2QQK A;  4DEV A;  2VZ1 A;  3ACF A;  3DYM A;  5G04 L;  1GQP A;  2W94 A;  2VMC A;  2BGO A;  2VZP A;  3HNY M;  5B4X A;  3OGR A;  3LE0 A;  1XNA A;  3WNN A;  2W87 A;  4CUA A;  3I2H A;  3I3B A;  4GWJ A;  2YB7 A;  3LEG A;  1UY2 A;  1WCQ A;  4MAD A;  1O59 A;  2ZXQ A;  4M4P A;  5C7G A;  4ZY9 A;  3NRU A;  2RVA A;  2ZEY A;  1UYZ A;  1WKY A;  4UOJ A;  2WO2 A;  2YFU A;  3C7E A;  2XHN A;  1UXZ A;  4XUT A;  3WNM A;  3WEZ A;  3I97 A;  3VD5 A;  3HEI A;  3ETP A;  3CZJ A;  2VJX A;  2YC2 A;  2C4X A;  1JYV A;  1JZ5 A;  3FHA A;  3T0A A;  3CKH A;  2VZ3 A;  3W5M A;  2WYS A;  3I2G A;  2C26 A;  3CDZ B;  2Y6J A;  3SKV A;  2W95 A;  3VD4 A;  2HYX A;  3THD A;  2B9V A;  4KMQ A;  3BN6 A;  4YPJ A;  2VTF A;  1GOG A;  3NNG A;  2VMD A;  4QX2 A;  1GUI A;  4CU8 A;  2RV9 A;  4TTG A;  3WNK A;  4BXS V;  2W1U A;  2VZR A;  2DCK A;  1JZ8 A;  1US2 A;  3P1I A;  2VME A;  2BGP A;  2E31 A;  2JKX A;  3OG2 A;  1YQ2 A;  3W5N A;  2VZO A;  1L7Q A;  1JU3 A;  1JU4 A;  5I0D A;  1NX9 A;  4JKK A;  3T2P A;  4UAP A;  5DMY A;  4LHS A;  3ACH A;  4RN5 A;  3CIH A;  5IJR A;  1OF4 A;  2ID4 A;  1UY0 A;  4L0P A;  2LS6 A;  4MGS A;  2JDA A;  4CUB A;  5JXI A;  4BDV B;  2EIB A;  3LEK A;  1R64 A;  1W99 A;  4BK5 A;  3I3D A;  2WAA A;  1DP0 A;  4ZZ8 A;  5JUV A;  2JE8 A;  5EJZ B;  4XZU G;  3HOB A;  2VR4 A;  2Y6G A;  2DDU A;  1GOF A;  4QB6 A;  2VQT A;  2WO1 A;  2J1A A;  3WF3 A;  1JZ3 A;  1MPX A;  3I2J A;  1L7R A;  1UWW A;  3HJR A;  4DUW A;  1SDD B;  3WF4 A;  2X10 A;  2XOM A;  3VD7 A;  4QDR A;  4QDS A;  2JD9 A;  4CVU A;  5JXJ A;  3FN9 A;  4KWU A;  2BZD A;  2W46 A;  2WN3 A;  4D8M A;  1UXX X;  2QBX A;  2VZQ A;  4P08 A;  5JXH A;  2Y6H A;  4P00 B;  1ULP A;  5J1X A;  1GOH A;  1GNY A;  3I2F A;  1TVG A;  3A22 A;  4IUG A;  2QQL A;  5LA2 A;  4FI9 A;  2W1S A;  1J83 A;  2YC4 A;  2RJ2 A;  3IAQ A;  2WDB A;  3DEC A;  4MOA A;  4ZXE A;  4LPL A;  2DCJ A;  3MO4 A;  3VD3 A;  3OEB A;  2J1R A;  3LEI A;  3NQH A;  1W9T A;  1H6Y A;  2W3J A;  3I2K A;  3MBW A;  3K75 B;  4ZZ5 A;  3WNL A;  3THC A;  1CZV A;  2KD7 A;  3EB7 A;  1T2X A;  1JZ7 A;  3I3E A;  2YFZ A;  3WNO A;  3CQO A;  5IFT A;  2E33 A;  3WF2 A;  4XUR A;  3C7O A;  2J1S A;  5IHR A;  4HG6 B;  4KI5 M;  1OH4 A;  4AG4 A;  1US3 A;  3UES A;  4A4A A;  2CDO A;  3BGA A;  4QDQ A;  4W50 A;  4DEQ A;  4PT6 A;  5EJ1 B;  3GDB A;  3T09 A;  2QQM A;  4QX0 A;  3U37 A;  1HN1 A;  4ARX A;  3MV0 1;  5HXM A;  3C7F A;  1CX1 A;  2QQO A;  3T0B A;  2VZV A;  2ZEX A;  2VCA A;  2Y8K A;  2VO5 A;  2WZE A;  1PMH X;  2VZU A;  3GXU A;  3WQB A;  5DQ0 A;  3A23 A;  5B4N A;  1UMH A;  2W91 A;  3WF1 A;  3CMG A;  5LCW L;  3T2Q A;  2J1T A;  4XUQ A;  1GU3 A;  3NJX A;  1SG3 A;  1PX3 A;  3C7G A;  3F2Z A;  2LW8 A;  5JMO A;  1PMJ X;  5LA1 A;  2HLE A;  3WF0 A;  2ORX A;  1F4A A;  1SHW B;  4DUX A;  1JYX A;  2V5D A;  2Y64 A;  3JXS A;  4QB2 A;  2J22 A;  2X09 A;  4TXW A;  2J1E A;  3LPG A;  4QB1 A;  4GZ9 A;  3T2O A;  1LNS A;  4A42 A;  2Y6L A;  1OD3 A;  2WAO A;  3FL7 A;  3OBA A;  5CZK A;  4OUE A;  3K4Z A;  4MGQ A;  1K42 A;  4JKL A;  1W9S A;  2EIE A;  2XQX A;  1K3I A;  3GM8 A;  4W8J A;  3K46 A;  4PQQ A;  4Z2A A;  2ZEW A;  4CU9 A;  3EYP A;  1UY1 A;  3K4D A;  3MUZ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...