4QDSA

Physical basis for nrp2 ligand binding
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
182
structure length
182
Chain Sequence
b'SHMFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIALRLELFGCRVTDAPCSNMLGMLSGLIADSQISAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neuropilin-2
publication title Structural Basis for VEGF-C Binding to Neuropilin-2 and Sequestration by a Soluble Splice Form.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 48
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4qdsA00
2W1UA 3LPFA 5EJZB 3FL7A 3UESA 1SG3A 4DXTA 4GWIA 2ZXQA 2VZVA 4A4AA 2XONA 2CDPA 2DCKA 4IUGA 1JHJA 3HPNA 5JXJA 1JYXA 3OEBA 5DQ0A 2JDAA 3T0DA 4E8DA 5HPOA 1CZVA 4A41A 4QX0A 5IFTA 3PUHA 3HOBA 2WYSA 3I2KA 4M4RA 3I97A 2V5DA 4GWJA 3PUIA 3MUY1 2EIBA 2VZQA 4QB6A 1EUTA 4W4ZA 1UMIA 3K4AA 3VD3A 3I3DA 1O8PA 2DDUA 3NQHA 2RVAA 5JMOA 2B9VA 5EIYB 2WZ8A 4ZZ5A 2ID4A 3IB3A 4BXSV 2ORZA 3WF0A 4CUBA 1W8NA 2QQKA 2QQIA 2E32A 1US3A 1OT5A 3OGSA 4LKSA 3CMGA 4QX1A 2J1EA 3THCA 3BGAA 2W46A 5DMYA 3WNMA 1UZ0A 3F2ZA 3J7HA 3GM8A 4QPWA 3EYPA 4DXSA 3K4ZA 1UXXX 1CZSA 3W5MA 2QQNA 2J1RA 3C8XA 2QQMA 4E8CA 3P6BA 4OUEA 2QBXA 1H6YA 3VD4A 2BZDA 2VMEA 1YQ2A 1I5PA 3GDBA 1GOFA 2EIDA 2L9LA 4DUWA 2VL4A 2V4VA 5G05L 1PX4A 3A22A 3HJRA 2E31A 4OYUA 3T0BA 2WO3A 2WO1A 3FHAA 5IYYA 3SEEA 2EIEA 4ARXA 1UX7A 3UETA 4UI9L 4RYDA 1TG7A 1UMHA 1JZ6A 2YB7A 1RYYA 2VQUA 4ET7A 2VMDA 1GOGA 3IAPA 1H6XA 4OZOA 1NX9A 5B4NA 5G04L 1LNSA 2VM9A 1GQPA 3C7EA 2VZ1A 3MV01 4CU9A 5IHRA 3VDBA 3WF1A 1UYZA 4MOAA 1UY3A 3ACGA 3GXUA 1JZ8A 3HNBM 5I0DA 5JR2A 1PMJX 3I2GA 4W8JA 5CZKA 4CU6A 2ZEXA 1UY0A 4LHSA 4L0PA 3WNOA 1DP0A 2KD7A 3ACHA 4ZZ8A 2RV9A 3P1IA 2VO5A 4FI9A 2Y6JA 4AAXA 4A44A 2J7MA 4BK4A 4PF1A 2QQOA 1CZTA 4CUAA 1JZ7A 4CU8A 1OF4A 4A6OA 1JYVA 2VZ3A 1BHGA 2WUHA 1IQDC 3DYOA 3WNNA 2OKXA 2VC9A 4LPLA 3IDAA 5J1XA 2XOMA 3I3EA 1J83A 1R64A 2W94A 1UXZA 3C7FA 4D8MA 4A3ZA 4DEQA 3HNMA 3LEIA 4XUPA 3MV11 4A42A 4KWUA 1UYYA 1F4HA 4XURA 2VTFA 3IIIA 2LS6A 2QQLA 4PQQA 1XNTA 4TXWA 1XNAA 3T2PA 1UY4A 3LPGA 3THDA 3DYMA 4XUOA 2HYXA 3VD5A 4BK5A 2WAAA 5DPNA 4QB1A 1OF3A 2ORXA 1OH4A 2Z4FA 2ZEYA 3C7GA 4P5YA 3NJVA 2VJXA 2C9KA 2X09A 3HNYM 2HLEA 3NNGA 1JU3A 2JE8A 3ABZA 2DCJA 1L7RA 4QX3A 1PX3A 1JZ2A 5C70A 4QB2A 2VZTA 5JXGA 1KEXA 3NJXA 2PQSA 2W95A 4MO3M 1K12A 3WEZA 1JYWA 4UAPA 4XUQA 2Y64A 3OGRA 3LE0A 3I2IA 3FHQA 4HG6B 1DLCA 1O59A 3WQBA 4PT6A 2JKXA 4JKKA 1L7QA 3T09A 2W9XA 1DYOA 4W50A 3T2OA 2X05A 3CQOA 2RJ2A 3LQCA 1W99A 2C4XA 3I3BA 4RN5A 5C7GA 4OMDA 2WBKA 3CKHA 5JUVA 1CIYA 2W92A 3T08A 1K3IA 5EJ1B 3I2FA 3ACIA 4UOJA 3WF3A 1JU4A 4XZUG 5JXIA 5CYYA 5B4XA 3E1F1 4QDSA 4YPJA 3WNLA 2WDBA 1CX1A 2E33A 4MGSA 1JYNA 2YC4A 3CIHA 3ETPA 1O8SA 2R7EB 3NRUA 3EB7A 2WZEA 2XHNA 4ZY9A 3ACFA 3MBWA 2X10A 3A7QA 1JI6A 3OB8A 2Y6HA 4CVUA 1W0NA 2J1TA 1ULPA 2WO2A 4JHZA 4DXRA 3W5NA 2WQ8A 1W9SA 2W91A 3K77A 3C7HA 2VMFA 3SKVA 2XQXA 3CZUA 2Y6KA 4XUTA 2J1VA 3K75B 4CU7A 5A1AA 2EICA 4MGQA 1GMMA 2JD9A 5LA0A 4A45A 2YC2A 4QX2A 2VZOA 2VZPA 2J1SA 1W8OA 3A21A 3BN6A 5JXHA 1GU3A 2Y6GA 3K4DA 4QAWA 5C71A 3MUZ1 2Y6LA 4DUVA 4AG4A 3D3AA 1EUUA 4LQRA 1P8JA 1UY2A 2E26A 3I2JA 1TVGA 2BBAA 4D0QA 1J84A 4OMCA 5DN2A 2W47A 4XVHA 2QQJA 1WCQA 4P08A 3ECQA 3VDAA 1ULOA 2VR4A 2VCBA 2J1AA 3LEGA 3WNPA 4TTGA 1SHWB 3VD7A 3ZM8A 3VDCA 1UYXA 3WNKA 3T0AA 5LCWL 4DUXA 1D7PM 2YFZA 2YG0A 1US2A 2BGOA 1OD3A 3IAQA 1NAEA 3U37A 3GGLA 1GUIA 2BGPA 3HEIA 2J1UA 1UWWA 4MADA 1F4AA 2VOTA 2VCCA 4JKMA 1UY1A 2VZRA 3A23A 4GZ9A 5IJRA 2VQTA 1W9TA 3C7OA 3K46A 1PMHX 2W87A 3OEAA 3OBAA 2V72A 4P00B 1GOHA 3CDZB 2W1QA 5F7UA 2WN3A 2C26A 2VMCA 3LEKA 3FN9A 3MO4A 5IFPA 4KMQA 2J22A 5HXMA 2LW8A 3OGVA 1XC6A 2W1SA 2W1WA 3I2HA 2VZSA 1JZ4A 4BJ0A 2WN2A 4M4PA 4XUNA 3AC0A 3DYPA 3DECA 1W9WA 3CZJA 2B4KA 2WABA 1HN1A 3HN3A 1K45A 3OG2A 3WF2A 4JKLA 3WSOA 3T2QA 1T2XA 4BDVB 5LA2A 1MPXA 1GNYA 1JZ5A 1XPWA 1JZ3A 2BERA 3VD9A 4JX0A 3JXSA 1WKYA 2W3JA 4Z2AA 2Y8KA 4CUCA 5LA1A 2VCAA 1NUKA 5FUIA 3WF4A 2W5FA 4QDQA 1NKGA 2ZEZA 4QDRA 4DEVA 1SDDB 2ZEWA 2VZUA 4ARYA 4ZXEA 3SKJE 3UNPA 1KGYA 2YFUA 2WAOA 4P02B 3SEPA 2CDOA 4KI5M 1K42A
chains in the Genus database with same CATH superfamily
2EF6A 4JGYA 3PLQA 3M3OA 2W1UA 5DDJ1 1M06G 4QM9A 4AAPA 4DXTA 4LXLA 1S0BA 1LULA 4IEYA 2ZXQA 5J36A 3WX5A 4A4AA 3KD4A 2XONA 1EV13 2CDPA 2DCKA 2H0VA 5A7NA 3QACA 3AK0A 3B00A 3UKNA 3IMMA 1AL22 2FCVA 4AF9A 5JXJA 2DURA 1AR71 3OEBA 2VU9A 2BNMA 2O8QA 3RMYA 3OD4A 5AVAA 3WP3A 3AVSA 4JGYB 4IQPA 1ZA4A 5FMCA 2WYFA 1ZBA3 2NYYA 4X6RB 3ZYIB 1AX2A 2WZR1 1BMV1 3OSDA 1UF2C 2V5DA 5FZGA 4QM8A 3GHNA 5FJKA 4ISQA 4QB6A 4Q0PA 1G8WA 1KJLA 3HQXA 4IETA 2K0GA 1WW4A 2WRAA 1PM7A 2VNVA 4IV3A 5C5TA 1BVP1 3NQHA 3LKJA 4COWA 1AL23 3SCFA 4IGOA 2B9VA 2QQUA 4NPRA 4UBGA 5EIYB 4XPVA 1D4M2 2ATFA 4ZZ5A 2ID4A 3IB3A 5KXDA 1HLCA 4N8MA 1DU3D 2C0ZA 2ORZA 2YHJA 3GJBA 2ZMNA 5FZKA 1ST8A 2V73A 4XQWA 3O7OA 2VXJA 3U75A 1W8NA 4CUBA 4GH4C 2QQKA 2GAUA 4AEJA 4CEYA 4ES8A 5C4WC 2XG3A 4CEWC 4Z82A 1BVVA 5A6XA 3CMGA 1C8M1 1QDOA 5CFCC 5GZDA 2J1EA 2RG4A 4IV3B 4Q4X2 5F6LB 4S2HA 2X29A 4D3WA 4U2AA 2WNOA 3I2DA 5GZFA 2CY6A 2VNGA 4FPLA 4CCEA 4DXSA 1RUF1 4EN8B 2ERFA 5FY0A 3ZYRA 1E57A 3WT3A 1ZZCA 1NOVA 5A80A 3UL2A 1LCLA 1D4M3 4GULA 4BPZA 5FYUA 3UKTA 5C8WA 3TN93 4OUEA 4RQPC 1NE4A 5KHIA 4CEYB 2QBXA 3HQUA 3JU9A 1S2KA 3VD4A 1Y9GA 2FQPA 3H0OA 3ZFFC 1NXMA 3RI9A 2HWE2 1UOFA 1YIFA 5LBFA 2A3WA 2RDQA 1WLWA 5JAXA 2EIDA 4ZPIA 4BMEA 1PMIA 1RUC2 2BJSA 3ZYGA 3WOGA 1PX4A 5CBLA 4COVA 1F9KA 1ZRDA 2BTVC 2FBEA 2OX0A 2XPJA 1RVF1 2WO3A 1YYNA 3FHAA 1FPN2 3M8LA 4NOTA 4JGZA 1LHNA 2EIEA 1MVQA 4N53A 4ARXA 2ZX0A 3UKVA 4AEDC 2AREA 1TG7A 1UMHA 4NRQA 1HRV2 2JDHA 3OTFA 4LBKA 5L7OC 3O0WA 1DQ4A 4XDQA 1O3TA 4Y1UA 4QU1A 4NE9A 1K5MA 1O4TA 4UWDA 4XJ8A 5FBJA 1YFXA 3FX3A 5FCCA 2WS92 1W6MA 4LBOA 4GD4A 1ENSA 4MLOA 4AI8A 1W8TA 1QOTA 3VHPA 2VM9A 4P9GA 1GQPA 4JGZB 2VGDA 1AYN2 1VBD1 1ND3B 4IEUA 4N53B 3USUB 5JCTA 2HWF1 2V09A 1FPN3 4U36A 2D6MA 2VZ1A 3WDWA 4CU9A 4RHV3 1EP0A 3WF1A 4N9HA 3LD8A 1YQ8A 3ZR5A 1UAIA 4GQ7A 4BYYA 4MOAA 1UY3A 4FAGA 5FZOA 3WHUA 3EMRA 1UU5A 1HRV3 1N1TA 1K5MB 3ROUA 1HW5A 2WKKA 3S57A 4MH0E 3POYA 1W6MB 3N3HA 4PBPA 2PXJA 2ZMLA 2YGLA 4HMZA 1XNKA 2DBIA 3CBNA 2KD7A 2JXAA 3GCWA 3JB8A 3AFGA 4AQTA 4D69A 5GZGA 3BB6A 1PIV2 2ZX3A 1QJZA 1IKPA 1TMF2 1WW6A 3P1IA 1JOJA 2H0BA 3O1TA 5A3MA 1BKZA 1RGSA 2O8OA 3RNSA 2J7MA 5FZOB 4BK4A 4PF1A 2QQOA 5D2AA 2DCTA 1HX6A 4HSLA 4UT5A 4CRQA 2FDGA 1A3KA 1OF4A 4XJZA 2D7FA 1Q5OA 1S2BA 4IE0A 5FOJB 5KC6A 3PL0A 5E16A 4CCDA 1BHGA 4M3CE 3KGLA 3SH3A 1E5SA 2VC9A 3GBGA 2R0FA 1WMEA 4MZUA 3RVHA 4D6SA 2XBO2 2ZHNA 3MGUA 1R64A 4FPGA 5J1XA 4X8PA 4JRAA 2QKDA 3C7FA 2XWBB 2C9AA 5KHHA 3RWNA 3BTAA 1XE8A 4DEQA 3HNMA 4NRPA 4J1WA 3RJ2X 5IW0A 4C90A 4HETA 4LO4B 1IZ3A 3QBQA 3FBYA 3OPTA 3FMGA 2P17A 4M0HA 4UFIA 1U0AA 5FMDA 1RJ8A 3VDDA 4O9GA 1XYPA 2GU9A 2QDNA 2P2KA 2BU9A 2XVGA 4S2FA 2H6BA 2HWB3 4OHYA 1GQHA 3DYMA 4KWLA 4PLMA 5DDJ3 2OPKA 5T5LA 1GR3A 4PI0A 1OA4A 4UW5A 1ND2C 4QB1A 1R1A1 5FFOC 5FXVA 3WR0A 1F35A 1IHMA 2RS52 4LHLA 4MX3A 2Z4FA 3H8UA 4KBBA 1H2MA 4W65A 4XFCA 1W8ZA 1LHVA 3VDDB 5LWBA 3RZKA 3C7GA 2P3KA 2GZWA 3LA7A 4RFRB 4NVPA 2C9KA 1RXGA 3I3QA 1JU3A 1I1EA 1OUXA 4R9CA 2RR12 2YU2A 1L7RA 4TN7A 1T6BX 1RUJ2 5IVCA 2DTWA 1PX3A 2DWRA 2JDMA 3OGJA 3PHMA 4P9XA 1CX4A 3ASIA 2IXKA 2AC1A 4XFHA 4L2NA 1J1LA 5DUXA 2ZCWA 5JVVA 2JG8C 1LJ7A 2W95A 5H9RA 3GBFA 2RS53 3CEWA 3IPVA 2MNGA 4LA3A 5FPBA 1OVPA 1IPJA 3V64A 4Q29A 3USSA 1W9FA 1YJKA 2XLFA 3C3VA 4NN0A 5BXXA 4WM7A 1V00A 2B39A 3DKQA 3LE0A 1GP5A 5GLVA 1UZWA 4SLIA 1OHFA 1Y4WA 2DVFA 2IWGB 3DUIA 3H9AA 4JZRA 5LB6A 2Y0OA 2YV8A 4OULA 1QNYA 1BEV1 1DLCA 1K5MC 1MEC1 2RR13 4O7XA 3UK9A 1HXS1 2Q8DA 3NV1A 1EPWA 2AENA 2OZ6A 4KU8A 4JKKA 1L7QA 3DL3A 3MIDA 1HDKA 2LRPA 1I5ZA 4QKBA 5LY2A 3ZXFA 3NMBA 4HFSA 5KWRA 2X05A 1YQ6A 4AWDA 3NNJA 3IPVB 2Y60A 1W99A 2C4XA 1CAWB 2PA7A 2RM21 1KQRA 1COV1 4XAAA 2VUJA 2A71A 3CKHA 4WM7B 1Q3EA 2IFRA 5A3OA 1K3IA 3D0SA 5EJ1B 3QH6A 4YM0A 5T5JA 3RGBA 2BRTA 1RUD1 3VL9A 1JU4A 3ZFGA 3HBZA 1YFWA 4N90A 2OXBA 4YW5A 1PO22 4P9IA 3LZZA 3E5QA 4YPJA 4MXWA 2E33A 4BQXA 1JYNA 1UCXA 1VBE3 2ARBA 2YC4A 3E5XA 2ILMA 3J7MA 1Z0HA 4XFGA 5FLHA 1BCXA 1DYKA 3AP7A 4K8FA 5FMOL 2ZHKA 1WBLA 3AKPA 3EB7A 1HKDA 4AVAA 1RUI2 1YWKA 3ALQA 2JE9A 2D3PA 2MHFA 4FO9A 4KNCA 4BLJA 4ZY9A 5T5OA 4LO8A 1F8VA 3A7QA 3ZFGB 3EBRA 3OB8A 3MPBA 3MIGA 2Y6HA 3THPA 2J1TA 1YCIA 2DVDA 1WCSA 5DAVA 1LU1A 2YPJA 1ULPA 4MXWB 3P5BA 5EP9A 5LEJA 5FZ4A 3OYWB 1POV0 5F3EA 3BTYA 5FYTA 4XC9A 3N36A 4W6YA 2W91A 4I30A 2K2SA 3BODA 3C7HA 2OPWA 2IFWA 1XU2A 2XQXA 3RWKX 4NIDA 3TEZA 1H4GA 4LORA 2FCUA 4YGDA 3AZVA 1UPIA 1VBD3 4LLOA 3MFAA 1RIRA 5KBFA 3BI3A 2DF7A 2IXHA 3ENRA 3CF6E 1KFUL 5FO7B 3VDDC 1MVEA 3R0RA 2VQ0A 5LA0A 4A45A 3PUAA 1QU0A 1VBA1 3VZMA 2YXSA 3RZJA 4QX2A 2TNFA 3PMEA 2PMWB 4COZA 3U1XA 4HBNA 2R072 3A21A 4QGNA 5JXHA 1GU3A 2Y6GA 4BQ2A 3FLPA 4IEPA 1HB1A 5E6HA 2JJ6A 4UBHA 5C71A 1MS1A 1XBFA 2VE1A 1DG6A 3WLUA 4AG4A 4QMAA 1AR91 4LQRA 1NG0A 2WC2A 2UU8A 3VKFC 2KM2A 2VOVA 2MEV1 5K0UB 2XR4A 1VBB3 4MG2A 1GWKA 3ZN6A 4EE2A 5JOYA 4D0QA 2WQ4A 4EQVA 5LK5A 4OMCA 1WWYA 2W47A 4ORFA 2CAUA 1FMD3 4XJAA 4BISA 3POBA 3GF6A 4RGGA 1H1AA 1POV3 2R073 2RMU1 2DUQA 2J1AA 4WVMA 3J7LA 4OHWA 4FPHA 3J7NA 1EAH3 4QQPA 5FZ9A 3WNPA 3V0AA 1QJU3 1E5HA 3VDCA 5BYNA 5IVFA 1UYXA 3LWCA 4YFZA 3OGGA 5LASA 1RUH2 2XUMA 2XUEA 3ZN6B 1KS4A 4Y22A 4CDWC 4XXPA 2R0HA 4GKXA 4X8NA 3H50A 5FKCA 2Q0AA 2RJKA 4WM7C 3ZIWA 2YG0A 2VMHA 2EXHA 4PIZA 2BGOA 4MV2A 1PHMA 3ZMNA 1OA3A 3TNQA 4WVMB 4XETA 2JDKA 3V0AB 3B9CA 1ODMA 3DKWA 4I0WB 3RZZA 2BGPA 4UYBA 4A7YA 4AFMA 3HEIA 5D21A 1H2KA 3N35A 2RDSA 4LE3A 1LU2A 2PLV3 1X7NA 2PTMA 4PCRA 2VCCA 4OVEA 4Y22B 4JKMA 2VZRA 5FAXA 3A23A 1LGBA 1AR61 5F5IA 1N3QA 1V6NA 1W9TA 3C7OA 5JIAA 4AVTA 1PMHX 3ZXJA 1S1AA 1X8MA 1GSLA 3OEAA 3RDIA 4YZ5A 3BALA 1BLZA 2ZGKA 4LHKA 2WNUA 1H9WA 5LBCA 1GOHA 5I8TA 2GH8A 2W1QA 4P5HA 4YVWC 5F7UA 5ACA3 1APNA 4QPIC 5HCAA 3FN9A 4TSVA 3MZHA 4N9IA 4KMQA 1OFSA 4MGKE 3X29B 5DUWA 4QPGC 4BMBA 3VBRC 1DZTA 4C0HA 3MIBA 4XIKA 4Q4W2 4S2GA 4CDQA 5C8CA 2HEVF 5FO9B 2W1WA 4GJYA 4AL9A 4BB3A 4I3GA 1R081 3I2HA 2VOKA 3IIAA 1AR82 3BOWA 4M4PA 5A3NA 2P37A 3AC0A 1UO9A 2XDVA 3NAPA 2FHRA 4XUNA 2WNUB 1TME3 3CZJA 2B4KA 3N4MA 2R042 2D44A 1XNCA 3U4SA 1MS0A 1LTEA 3HN3A 1DQ6A 1OOPA 3O0XA 1K45A 1LEDA 2DFCA 2OIIA 2RS31 4BU2A 5IK7A 1SBFA 1V6OA 3AKTA 5FP3A 1QJX3 4AI0A 4CDQB 1WA4A 5C8CB 3IDCB 4HVOA 4LBQA 1MPXA 4K9SA 4HONA 1FOD2 2BERA 3VD9A 4JX0A 2QDRA 4XCAA 4IV1C 2X8KA 1LB2A 3NAPB 1GZWA 1YHFA 2HWC2 1RITA 1NUKA 2JIGA 1BJQA 1C5HA 1W6NA 1PO11 3WVJA 3FUQA 1OOPB 4XMAA 4F8AA 1UMZA 4QDRA 1W28A 2JG9A 1LOGA 4H3WA 4NROA 3VZJA 3ZN5A 2WO7A 4BH9A 3SKJE 4DIQA 1OQ1A 5A3UA 2YFUA 5K4LA 4LBQB 4P02B 1VALA 3WV6A 2VCMA 2CDOA 1REDA 1MZ5A 1BK1A 1LGNA 1O6UA 4URTA 4ZS2A 4CXWA 2BWCA 2NZ9A 3UESA 1FOD3 2VW2A 3LDBA 1VAVA 1RL3A 1GZWB 2HEYF 1QJEA 1NA1A 1ULGA 2VOWA 3H7YA 4DY3A 2VZVA 5A33A 4UF0A 2IXLA 2R063 1O3QA 2HH9A 4RR3C 2PAMA 1ODNA 2HWC3 2D3SA 4AK3A 3U4XA 2BP6A 1JHJA 3N9PA 3HPNA 5FBZA 2JG9B 5I0TA 5JLVA 5FYZA 1PZ9A 4LBNA 3T0DA 2UWAA 2TEPA 1RXFA 1U5XA 5CAZA 2W2IA 2DUPA 2A6XA 4QX0A 5LBBA 2ZTNA 3PUHA 3HOBA 2WIIB 2WYSA 4NR1A 4M4RA 1VLNA 1NA1B 1W0OA 1OQEA 3FC0A 3PUIA 3MUY1 4ONUA 4NUBA 4UF0B 5F8PA 1PK6A 2EIBA 2BFUL 3NV3A 1ZBE2 2G9ZA 3FLTA 1UMIA 2GMEA 2YY1A 3BOPA 4XDOA 1XSQA 3I3DA 2RVAA 2IXJA 1X82A 1QXJA 4N43C 4RGAA 3J9SA 4UFHA 4YW7A 1EPZA 1W05A 3ACLA 3Q8CA 2Y33A 1W8HA 2D6NA 5FP9A 5SV5A 3VBUA 3WF0A 3ZMOA 2XJVA 4XQDA 3N7LA 1R092 3N9QA 3B01A 4O65A 1UYPA 2PHUA 1PK6B 2E32A 5JR7B 1RJ7A 1QJFA 4A2UA 1SFYA 1US3A 5A7OA 3OGSA 2D98A 3ZPYA 3MYXA 3O1MA 2IUWA 4HVRA 1ZBE3 4LKEA 1MR5A 1ENRA 2GN7A 4AZZA 3O1PA 2CGPA 4AR2A 4Q4X1 1UOGA 2ZHLA 3K3NA 3F2ZA 3WNMA 4N7IA 1F5FA 4FXGB 4IE6A 1CAUA 4YVSC 2G9FA 3EYPA 2W68A 3K4ZA 3IBMA 1UXXX 5AC92 4Y1YA 2GDFA 1A34A 3W5MA 2QQNA 3BTXA 4B29A 2QQMA 3QOPA 1Q8PA 2VVFA 4PLNA 4O9EA 1O91A 3VBUB 3RZLA 2O1QA 1AR93 1VRH2 2WLPA 4YM2A 2QQPA 1RUG3 1LKNA 1GZCA 2LTNA 5FK8A 5FY9A 4NIAA 4FAHA 1LESA 5DAPA 4D7TA 2HWE1 1GANA 4TWTA 4Q8LA 5H9PA 4YG0A 1CAUB 1Q43A 2VY0A 3W59A 4CDQC 5F3IA 4CUGA 5C8CC 1N3OA 1YNAA 5DAXA 1RUC1 2VL4A 4BHPA 4K20A 3MW3A 2V4VA 5AC93 5IUQA 3RYKA 4AEKA 1VPHA 4OI2A 2ZKNA 5K7PA 4KH9A 4OYUA 3PJQA 2WSVA 3FFZA 2FZ2A 5IYYA 1W0PA 4CCJA 3AZXA 2FDJA 1B35A 1PVC2 3QD6A 1V9U2 1LEMA 1OOPC 3AP4A 1DIWA 1RUE1 1QGLA 1UX7A 4IE7A 5J37A 1H4HA 3HBKA 5KXEA 3RZHA 1DGWX 2VUCA 4P14A 2YB7A 4LLFA 4IEXA 4BQ1A 2CWMA 4BWOA 4XF4A 4ET7A 3KS7A 2Q5TA 5KC5A 3B69A 3IAPA 1N3PA 4GB32 1V6IA 4LA2A 4LIVA 4QGMA 4E2SA 1RUOA 1NX9A 2BUKA 1KD7A 5CG8A 2ZGOA 3RI8A 2YBPA 3DXTA 3ON7A 2GP3A 4KL1A 1W39A 2NQYA 3PTYA 1B35B 1AYN1 2VAUA 1SDWA 2OUJA 4E9KA 4OCTA 3SCGA 3ZXKA 2JDYA 4LUMA 4QX8A 4Y24A 2JG9C 2WFF3 3ZXLA 2PELA 2A3YA 1EV12 1ZREA 3QCWA 1AR63 1IS3A 1BZWA 4DY5A 3BU0A 5L9BA 1UU4A 4K6BA 2IC1A 1Q56A 1DQ0A 1PMJX 3I2GA 1IGOA 2FZ1A 1E5IA 4CDUA 4NPMA 2XKOA 1Z7S1 4CU6A 5JOWA 1CJDA 1UL9A 4LHSA 1FAYA 4L0PA 4OI4A 4YW2A 4AHWA 4CCNA 4FOWA 1JYIA 2Q1MA 4COYA 2DTYA 3ACHA 4Q4Y3 4ZZ8A 1RTVA 4AFCA 1LRHA 5FO8B 3JBG1 2JICA 2YGMA 4CCMA 1N1YA 4AW7A 3WINE 4YLZA 1TMF1 4LIUA 2XH6A 1QY4A 4S2DA 5BNQA 5GJ6A 5KR7A 4WVVA 3M3CA 2R1BA 4A44A 5CKNA 1F5JA 4LKDA 3AM2A 5A6YA 4LITA 5FY8A 4CDUB 3VBSB 4YARA 4XAEA 3O1SA 1J1TA 1D0GA 1XJAA 5CEHA 2NLRA 2WUHA 1IQDC 5FZDA 4HK9A 4HK8A 1OI6A 3VKOA 1QXRA 2OKXA 2BEOA 3IDAA 2D97A 4OI0A 1UXZA 4YW3A 2XKPA 1GZTA 1VP6A 2PN5A 1HIXA 5EPAA 1SCRA 4Q0SA 3GJAA 3O1UA 1W2AX 5A6QA 1CESA 3AP9A 1NCRA 3LEIA 4K1YA 5HBAA 4NJ4A 3VBUC 2PHLA 5LATA 2WLQA 1RHI2 4LK7A 4XF1A 4P9WA 5JSPA 3JD71 2VTFA 3C2UA 4M3CA 4QD2A 3IIIA 1JODA 3W21A 1W8UA 2HKXA 3UYJA 2VW0A 2DVAA 3I59A 3TN92 5C9AA 3T2TA 4YG6A 4JQRA 5JSRA 2GMMA 5ABJC 2G4IA 2QNKA 4XHBA 3THDA 1MQTB 1NCRB 1OQDA 2ADDA 2HYXA 4OI1A 3VD5A 5DPNA 3OY8A 5JZGA 3BKZA 1G9FA 4YWAA 2VPVA 1OH4A 2VNOA 5FZHA 1KJRA 2ZGNA 1K5JA 2IXIA 2BW8A 2ZEYA 1RHI3 3N9LA 5J98B 4A7ZA 5C33A 2RS12 2Y6FA 5LEKA 4M3CB 4Q27A 2HWD1 1BXHA 3ZPOA 2YBSA 4FPCA 4TLFA 3GALA 3WG2A 3I59B 4WM8C 5C9AB 2VJXA 5FYMA 5FDBA 3HNYM 1YC61 3NNGA 3WZ1A 2OUHA 5EYXA 5A1LA 3OF1A 4NO4A 3OUIA 4QX3A 4AI1A 3OY8B 3IN9A 1HRI1 3PVOA 1JUIA 2E7TA 2CWSA 4KG8A 5JZGB 5D8AA 2VZTA 4NHMA 1QKQA 4H2AA 1EYBA 2D40A 1WBFA 4AXOA 1KEXA 3NJXA 2PQSA 2RE9A 1BK0A 4Q4V2 3B5LB 5GM0A 5FPAA 1G9AA 1BBT1 3O1OA 1B35C 1UW8A 2RS13 5J48A 5FPVA 2QQWA 3VZOA 5L36A 3WCSA 2P6CA 3KF5A 4QWNA 1NT0A 5EHDA 3SCHA 1XQNA 2WNVB 5FZ6A 3KT1A 4HG6B 1H8TA 3R05A 5FPLA 4XYXA 1AHSA 4RHV2 3DCQA 1ND3A 2A3XA 3USUA 2FDKA 1O59A 2NMOA 3MW4A 4YZ3A 5D8AB 3WQBA 5ERLA 2CSGA 2JKXA 3HWJA 3VBHA 2QTWB 1D4VB 1DYOA 1AYM1 3WDVA 4Q8KA 2WT2A 2WNEA 3LQCA 1YFYA 1NCQA 1QQP3 4Q4V3 2R6QA 4RN5A 5F3GA 5FPZA 2XL7A 4L97A 3P3PA 4RL7A 3TAYA 5KXBA 3I54A 5CIRA 1W2TA 5L9RA 1H8TB 3T08A 2AR6A 1O5UA 1MS8A 3E6CC 3ACIA 3AKSA 4UOJA 3WF3A 4GIQA 2P3JA 4J6GA 5K8SA 4FVVA 4I0BA 5JXIA 3VBHB 1QF3A 1NLQA 4IL7A 5JDBA 2ZPXA 1PO21 3ZYBA 3RZMA 2GSYA 1DBNA 1PGW2 4F7ZA 4Q0UA 4LOTA 2JIJA 3ZXAC 1NCQB 3LSEA 1CX1A 3AJZA 1DGWA 1AL0G 1JOPA 4JGYC 1LOBA 3KHCA 4G4FA 2ZS6B 4F3JA 4QHBA 3CIHA 3ETPA 4LT5A 1W2OA 4INDA 4B7EA 2R7EB 1QJY1 3NRUA 4FBFA 1RUI1 4HN0A 1DF0A 3DXUA 3ACFA 2XL9A 5ABJA 2X10A 4UFLA 2NPIA 3IKWA 2FDFA 1JI6A 4AE2A 3M1HA 5C3OA 3KLSA 5F2WA 4BQYA 5EZWA 1UZYA 4GA9A 1QMJA 1ASJ2 2VBBA 1VE0A 1DGRA 1NE6A 2D5FA 3V0BA 2LROA 2G1MA 2QVSB 1QNWA 3VBFA 2JKBA 4CP9A 4UXAA 1W9SA 4DMIA 4YGBA 4NPLA 2P1BA 1LOFA 1HB3A 1NCRC 3KT7A 5ABJB 2HWB2 2IZWA 4FFIA 4E2QA 3CZUA 2Y6KA 5ANNA 4AHZA 4XUTA 1RMU3 4IV3C 2J1VA 5DDJ2 4EWAA 2VD7A 5A1AA 2EICA 2DYCA 4JV4A 1FYUA 2YU1A 2YC2A 3V0BB 1H2NA 4Y33A 1ASJ3 5FY7A 1WA6X 4DXZA 1ZZ9A 2VZOA 2VZPA 5FMOS 1AXZA 5FKBA 1DGRN 3VBFB 1SLCA 4CP9B 2DFBA 1AX0A 3AX4A 2CV6A 1AR72 2OZJA 4K7JA 4CEYC 5IVEA 2FDIA 5CFDA 4QAWA 4WVZA 2FD8A 1EY2A 4AFDA 5JZGC 3MUZ1 3ZKUA 2Y6LA 3DEMA 1EUUA 5J96B 3WP6A 3ZXGA 2C1FA 2KXLA 1QDCA 2PHFA 5FYBA 1BMV2 3I2JA 3JQWA 2EAAA 3EJKA 3ZIXA 2BBAA 3CJIA 2Z5WA 4AVBA 2WT1A 3WDUA 3WUCA 4XVHA 1ZYBA 5IVBA 5IVVA 4DB5A 1HJFA 1WCQA 3E97A 4K3UA 5I8YA 1SQ4A 5CFDB 3TYJA 3HD8B 3RFRA 4HXCA 1AR73 2VCBA 3FE5A 3LEGA 4C0BA 1AUYA 2A5ZA 4KQ7A 2A1XA 4MHUA 1Y7BA 5IWFA 3WNKA 1RUH1 3T0AA 5LCWL 3CJIB 3S7IA 2H6CA 2WZR3 1X50A 1H1MA 2W0XA 5BY5A 2BBVA 3K2OA 4UFJA 3H8OA 2JDZA 1C8M2 1JMUB 4QQOA 4HN1A 4IXLA 1US2A 1VAMA 3D8CA 5FZCA 3SH4A 4AI3A 4E4HA 3IAQA 1DGLA 1DYPA 4JGZC 1RUF2 1L3JA 1CAWA 1G6NA 1ND3C 4N53C 1ONAA 3JD73 5FZ8A 4Q26A 5DAQA 2DVGA 2J1UA 3LDKA 4FOQA 1T6GC 4HKLA 3AB0A 4KU7A 2VBDA 1F4AA 4MADA 3UJQA 1NCQC 3AJYA 3Q8BA 4YSFA 4GWMA 4A3XA 5DUUA 3THTA 3K46A 1KDMA 2W87A 3D5OA 1C8M3 1VBE2 3IZOA 4LTAA 2R49A 2ZGRA 2A6VA 3AYEA 3OBZA 3ZXEA 2VMCA 3LEKA 1RUF3 1AZDA 2HWD3 1N1VA 2MPFA 1CAXA 4XFFA 4BIFA 4QPYA 3ETQA 2JDUA 1NY71 4ZHNA 3R4SA 3OGVA 4Q4W1 4WVWA 1XC6A 4M0NA 3TBDA 1MS3A 2GH2A 4B4PA 2XLGA 1A8DA 3POFA 4D7SA 1YFUA 3VL8A 1JZ4A 1C1LA 1OFNA 3AYCA 4GKYA 1GV9A 1OBNA 4NIGA 1J3PA 2O14A 1UIKA 3M3EA 2R041 4XBLA 2ZBJA 3KV5A 5DZEA 3OYWA 1URXA 5EFUA 1CJPA 1JTZX 3LAGA 1CAXB 3NWKA 1LR5A 3J8F1 3OG2A 2XB6C 4XF3A 1XNBA 3KB5A 4V1PA 5IAXA 4JKLA 1JBCA 3VBOA 3WSOA 1T2XA 2ZZQA 3M7AA 5FP8A 1RVF3 4BE3A 1GNYA 1VBD2 4CP2A 2HWF2 3OPWA 4HL0A 5JIUA 3JXSA 1KITA 5L9VA 3K51A 3PIGA 4FQZA 4NHYA 4TYSA 1STMA 5A7WA 1WKYA 2W3JA 1D2SA 2E63A 1JS9A 3ILNA 4QT6A 4URAA 4Z2AA 5JPMB 1AYM3 1MZ6A 3H42B 3KV9A 1NKGA 2ZEZA 4QDQA 3SQOA 3W58A 2ET1A 1IQAA 3ZYJB 3UNPA 3VBOB 2VVEA 2X5IA 4LULA 2DV9A 1WMXA 5F5AA 1HB2A 3O12A 4KI5M 2Q4SA 3WY6A 4CDXA 4NIHA 4QHZA 3VGIA 4DNYA 3WUDA 5A7WB 3LPFA 5EJZB 1VBB2 4QQHA 3ATGA 2HWF3 2DU0A 3WDTA 4GWIA 3H1WA 3N7KA 4L9BA 5K0UA 2DCYA 5FIXA 1TQ5A 2P3YA 4BQ5A 3ELNA 3PMSA 2WQZC 5BNPB 1FMD2 2ARXA 2AEZA 3NL1A 1ULFA 5LBEA 5LRSA 4DINB 1Y43B 5FLIA 4LO6B 3HVDA 4ZKTB 1W03A 2ZMKA 1OUSA 1JYXA 2JDAA 2X5IB 2Y34A 3NNFA 5IVYA 1CZVA 1EAH2 4A41A 3ZSJA 4FPKA 4QGLA 1QJU2 2VECA 4B3NA 1UZZA 4CDXB 5I93A 1SPPA 3H3LA 3TEWA 5IK5A 2ZA9A 3I2KA 4XBQA 3I97A 4PIYA 2VZQA 1IKQA 1WLTA 3I49A 2HEWF 3O5SA 3KV4A 1D0HA 2XLAA 2YPDA 4W4ZA 2SBAA 3PVBB 2JENA 5CA6A 2WWSA 1GP6A 1UD1A 1O8PA 2DDUA 2DUOA 1PGL1 5EYYA 5C6CA 1VBC1 4KWKA 5A3WA 1H1IA 4Y1ZA 1IS4A 5GZCA 2WZ8A 4PDWA 4Y3OA 1SPPB 2W08A 1KS5A 2PLV2 1UQXA 2QQVA 4FPFA 1I3HA 4XFBA 5FXZA 1R091 1X9TA 1CQ9A 1VRBA 5A1FA 1GZ9A 4HZFA 3UGGA 4GMP1 4LKSA 1C1FA 1R1A2 2JX9A 4QX1A 2XVLA 3BGAA 3D4KA 2W46A 1J58A 1UNBA 3TRSB 3LSDA 5ACA2 1QIQA 4AI2A 1CZSA 5FMBA 2J1RA 4PDWB 1RUNA 4ZU7A 2C24A 3OPZA 3P6BA 1QWRA 4IEVA 1VRH1 4SBVA 1UKGA 4UW3A 2UY9A 4FTBA 2WL1A 4BLIA 4MSVA 4QXCA 4NAMA 2BZDA 3NJYA 3LOBA 4FOVA 1SLIA 5CNAA 1YQ2A 4AEMA 1TME2 3RJRA 3WCRA 1R1A3 2A70A 3ZOIA 2L9LA 1XSRA 3ZFGC 4AI9A 3G7DA 3R4DB 1GKBA 3HJRA 3PJYA 1QJX2 1IG3A 4XIOA 2E31A 3M70A 1S0GA 4QQ2A 2ZABA 3A4UA 1UPSA 4EYUA 5JI9A 5ISLA 2NMNA 3IDBB 3O14A 5FYYA 1V9U1 3ZLIA 4XXAA 3GBWA 3UETA 4HOOA 1PNFA 3MF6A 4UI9L 5JWPA 3GHMA 3WP4A 3S30A 4RYDA 1I6XA 3RZGA 4PJYA 1OPOA 1VAKA 1RYYA 2XJRA 2QUOA 3S7EA 4Y1XA 3PDQA 4LEJA 2VMDA 1GOGA 4KBZA 2VVDA 1COV2 4GB31 1OKOA 1SBEA 2LUWA 4OZOA 1VB2A 2B7YA 3AYAA 1OPMA 2B8MA 5B4NA 3AP5A 1L7LA 2IVIB 1CD3G 3ORJA 1CAVA 2CU5A 5IT6A 4JRLA 5I0UA 2GMPA 2O0OA 3C7EA 1PZ7A 3R4UA 2Z42A 3VDBA 3OUHA 1BEV3 1KDKA 2R062 1MEC3 3BPZA 4BQWA 1EV11 1HXS3 1UYZA 3FJSA 4RFT0 1FNZA 2X5IC 5F39A 2D6LX 1X9PA 4XACA 3HNBM 3ZFEA 1JZ8A 2GC3A 3POWA 1MZFA 1W2NA 1F2NA 2CAVA 4FPYA 2BPA2 2D6PA 2RM23 4I01A 1S0CA 1UY0A 1COV3 5K0UC 2ZGSA 4ES9A 4XF0A 5BNOA 5DG1A 1CAVB 4KGQA 1ZBA1 5F37A 3POGA 4CXYA 1JYTA 3SITA 5IAVA 5BUVA 1BYHA 3WNXA 5F3CA 1RUD3 1S55A 1ALYA 1OVSA 4LBQD 4FI9A 2ZZJA 2Y6JA 2JD4A 2Q8CA 1WUVA 1ZM1A 1OURA 2ZAAA 3MEPA 3RS6A 1QXPA 3ZFEB 5FZAA 1CZTA 4QXBA 1JYVA 1AL21 4ZU4A 4YW6A 4LR4A 3ZR6A 2UWBA 4Q5OA 3WNNA 4OFGA 2EXIA 1DLLA 2ZKLA 3PNAA 5BNOB 1G9BA 1PNGA 4LPLA 1FX5A 2XOMA 3ZKYA 4CSWA 3INAA 2W94A 1GBGA 1IPKA 1PGSA 2PYTA 2EAKA 4LHNA 3OOXA 1W04A 1LHWA 4D8MA 2ZGLA 5FWEA 4A3ZA 1G86A 1FXZA 3UV9A 1V6JA 4K8RB 4XF9A 3WW4A 1VJ2A 4A42A 4BCUA 2YYOA 2AZ5A 4XURA 1VMFA 4UW4A 2LS6A 4AFBA 1D4M1 1WW5A 2VQAA 5GALA 4CCLA 1XNTA 2ETEA 4MYEA 2YMZA 2A75A 4TXWA 1AR92 3HQRA 4D94A 5JSOA 1YI9A 1UY4A 3UJOA 1SFPA 1RUG2 4H7LA 4BZ4A 4XUOA 1HN0A 5A7PA 4CYDA 1WCKA 3FLRA 4ZXKA 4GMP0 2WAAA 3MLJA 4FPJA 1OF3A 2ES3A 1VBA3 3P3NA 3GYDA 5JOZA 5EV7A 4GWNA 3N9OA 4WZFA 3OUJA 1LGCA 3R6SA 2BYVE 2YDEA 2RMU2 5T55A 3NJVA 1WZXA 1QEXA 2I45A 2ADEA 2X09A 2HLEA 5DAWA 4MGIE 5C3QA 4JCKA 2JE8A 1TNFA 2WNUC 2VNRA 2DCJA 2JE7A 2MEV3 2VOXA 2ET7A 1OLME 1JZ2A 5C70A 2VTXA 1GWMA 4QB2A 3U10A 4OQ8A 3CLPA 2OQ7A 5F2SA 2JEMA 1HJGA 4CA9A 5A3PA 4W6XA 5ANQA 4MGTA 3FUOA 2WT0A 3MLLA 5FUPA 5T52A 2ZGMA 3NW4A 1OLRA 1H9PA 1JYWA 1CGPA 4HT1T 3B93A 4XUQA 5E1RA 2Q8EA 1UOJA 2Y64A 3OGRA 2C6SA 2P4EA 4HANA 1SBDA 1Q8VA 2RMU3 5CFCA 1AF9A 5FTTC 3NAPC 3I2IA 1LHOA 1WW7A 1YJLA 1FPN1 4BXFA 4RHV1 1S0JA 2WFF2 3DN7A 1F15A 4LJHA 4XFAA 5IVJA 1GWLA 1FNYA 2PAKA 4FFFA 1AR62 4X6QB 2GP5A 2W9XA 3T09A 4GMP3 5DABA 5EXOA 1HRV1 4RQPA 4YW4A 2KA3A 4CZSA 4QXKA 3Q8AA 3I3BA 5APAA 1A78A 3OCPA 5LA9A 5C7GA 4OMDA 3B3QE 5CFCB 2WS91 1Z78A 1W6OA 5FP4A 2CYFA 3WG1A 5J7MA 4Q4Y2 5FK7A 4CXXA 1CIYA 1ZZ8A 2W92A 1GNZA 4DPNA 2V5YA 4LKFA 3I2FA 5A3TA 3WW1A 2Z69A 2Y26A 1HB4A 2UYBA 1UX6A 3W20A 4HLTA 1AVBA 5CKQA 5B4XA 1S0IA 3E1F1 3RRDA 3U0ZA 2E53A 3B94A 4QDSA 4RQPB 5BNOC 1KXGA 2BVVA 3T3YA 4MUVA 2D3RA 5CKMA 3MHZA 1XNDA 1UOBA 1XU1A 4DS0A 5M0TA 3VBSA 4AEDA 1W6OB 2ZAHA 4L8QA 4PHZA 2XJTA 1J59A 2RS32 1NA1C 2E51A 2WZEA 3H7JA 2XHNA 3BTZA 5L7OA 3MBWA 3B02A 2LM3A 1ULEA 2ZX2A 3I2OA 1PIV1 2XVKA 3FBMA 2E6VA 3DPRA 1WMFA 4CVUA 1W0NA 3MFCA 3JZVA 3PIJA 3VB9A 1R083 3IMNA 3ZYFA 5A32A 1H8VA 1HQWA 3KHBA 3NSTA 2WO2A 1F31A 2RHPA 5IK4A 3NJZA 1GYKA 3ES4A 4AEDB 4DXRA 3W5NA 1SACA 3AMQA 4BIOA 1PK6C 1AJKA 1JUHA 2RS33 2N7GA 3SC7X 5L7OB 3SKVA 2BGCA 2HWB1 3LA2A 2XBO1 4JAAA 1JYCA 5HCFA 1MACA 5IK8A 3DPRB 2CGNA 3J4UH 1HQLA 3K75B 4PLOA 4CU7A 4MGQA 5FPUA 3LF7A 5E8AA 3LGRA 5A32B 1MQTA 3PUQA 2EIGA 2JD9A 2P3IA 3AL5A 4LO7A 4YZ4A 2JECA 1V6MA 2ARCA 1QH7A 1YUDA 5FZBA 4HPKA 3D6EA 2BNOA 2W52A 1PO13 1JHNA 1M4WA 4NRMA 1VR3A 3BN6A 3MPPG 5BPXA 3K4DA 1YRZA 2Q8OA 3ZYPA 1VIWB 1UN1A 2XQRA 4J25A 4RS5A 3GNEA 1FV2A 4DUVA 3D3AA 2XWJB 5HCHA 1ENQA 4YGEA 2FMYA 1UY2A 3MIFA 1ZZ7A 4Q2FA 2E26A 2EXKA 3VN4A 4D6QA 4AOCA 4QU2A 4GXLA 5FYIA 3VKLA 2E7QA 4YRDA 3ZSLA 1J84A 4HPKB 2JB4A 1C5IA 4B8EA 5DN2A 4BOWA 2RS51 4LMFA 2DVBA 2QQJA 2DBNA 1SZBA 3ST7A 1Q8SA 2JB8A 3BIWE 3BUCA 4RS5B 3SHRA 1CVNA 5FYSA 2VR4A 2QZ2A 2HJIA 4XTMA 4YYOA 2ZACA 3ZM8A 4C1WA 4NHKA 2ZGUA 2WNVA 4A7KA 1GQGA 1N47A 4B7KA 2RR11 2FMDA 1RUJ1 2YROA 3NNLA 4FXKB 2OW4A 1OC1A 1YIPA 4K40A 5CB7A 5FWJA 1W2UA 1FI2A 2PQQA 2OT7A 3Q8EA 5FZEA 4IDZA 4QKFA 1QQP2 4OHXA 3HT1A 1YEWA 4Y20A 3V65A 5CISA 2E9QA 4P9JA 1A8MA 3VZLA 5GZEA 4DRRA 2G9GA 3E6DA 5FR3A 1GUIA 1ND2A 1QOSA 4JDNA 2D93A 1NZIA 1POQA 2BV4A 4OHVA 4R8HA 1UWWA 4C1XA 4LUKA 3AXDA 4B1MA 2VOTA 3NNMA 4QXHA 2NM1A 4GZ9A 2F6BA 5IJRA 4Z2WA 3RPQA 4DO0A 4YZ2A 2Q1ZB 1DQ5A 2EA7A 2UY8A 3OBAA 4RA0A 1ULCA 4Y20B 5K9YA 3S5AA 2LALA 1VBE1 2F17A 2GNDA 4Q4X3 4M00A 2V72A 5E88A 4AGVA 3CDZB 3L2HA 1O4ZA 5H9SA 4L11A 1ND2B 4FP2A 3VZKA 4OQ9A 3K48A 3DGTA 3VKNA 1U5YA 5A7QA 3FWEA 4IGPA 3KWVA 2JG8A 3POJA 1GICA 4L99A 3G6JB 4PBOA 5FYVA 5HXMA 1CR7A 2LW8A 2QCSB 3S6PA 2W1SA 2R16A 4ASKA 3LB9A 4CDUC 3VBSC 4E27A 1RUE2 3HT2A 2VZSA 2I07B 2HWE3 1NXD1 2XJSA 3DYPA 1W9WA 3SH5A 2WABA 1HV1A 1LECA 1PM4A 3E6BA 1ZVFA 4KG0A 5KHGA 4FT8A 3M3QA 3DPRC 1RUC3 4LO5B 2GC0A 2JG8B 2Q1FA 3WF2A 4JDOA 4AHXA 3T2QA 4BDVB 4COUA 1C4RA 1O4YA 4XMIA 1RMU2 5GKAC 1N1SA 4E4ZA 1CPNA 3AMNA 3AP6A 1JZ3A 1ZRFA 1ZA7A 2ZGQA 3PURA 1FATA 1VMHA 3WQ7A 1W6QA 2VBPA 1S0FA 5FJHA 4CUCA 1RUE3 1SLLA 4IERA 1NLSA 5LA1A 3S0MA 1UU6A 5LY1A 3ILFA 3WF4A 2D43A 3ZSKA 2W5FA 4IEOA 2BVBA 3EXUA 2CGOA 4YW1A 1C57A 3HR9A 3SISA 1C8NA 4M3CF 3WQ0A 4YNIA 4DEVA 2ZEWA 4YGCA 1Z7S2 4EROA 4UW6A 4XCBA 1DZRA 3KVBA 1MQTC 2WAOA 4BM8A 2WS93 4LBMA 3SEPA 4MXVA 3VZNA 1NQJA 5DZFA 1K42A 3SXWA 3JBG2 3H3UA 3ZSMA 5BV6A 1AYN3 1W6QB 1VBB1 3FL7A 4EN6B 2D5HA 1SG3A 5DG2A 3H8RA 5FZ1A 1W3VA 4XEZA 3HMYA 4GJZA 4NIIA 3AVRA 4RS5C 2YC0A 4Y1VA 3O0VA 1FMD1 4QKDA 5C9AC 4IUGA 3FZ3A 2XJQA 3OBRA 5D1IA 4NHLA 5FZ0A 3VV1A 3PU8A 4ZONA 3E5UA 1POV1 2R071 5HXVA 5DQ0A 3WXPA 3EQEA 4E8DA 5HPOA 1Z7S3 2GALA 1EAH1 1PVXA 2OQ6A 2ZJCA 3AZYA 3LFIA 1QJU1 1G7YA 4V2WA 4XDPA 1SEFA 1XXNA 5IFTA 2AEYA 2OVUA 2I74A 5L73A 3MW2A 2WZR2 3JBG3 3N9NA 4GWJA 1PIV3 3J26N 1WMDA 4OZXA 5F32A 3QLQA 4KWJA 5A7SA 1TMF3 3OD0A 3GCXA 3IT8A 5FY1A 1OA2A 1EUTA 1NQDA 3I8TA 3K4AA 3VD3A 1E5RA 1JOBA 2CTVA 3U11A 4R4ZA 4Q1PA 2PHTA 3LDRA 2WNVC 1FV3A 3LA3A 4AVSA 1QHDA 3JD72 4DRVA 5JMOA 4I2OA 4NHXA 4WZCA 4RD7A 5D8AC 3T30A 4C91A 4BXSV 4TZDA 2IXCA 2PLV1 3AFKA 1W6PA 1ZNPA 4M01A 4ZU5A 3U07A 2BDRA 2XBO3 1ZX5A 4I09A 5CG9A 4Q0QA 2DU1A 4TLGA 2QQIA 5GLZA 1IPSA 5HCBA 2YUEA 4ITCA 2GC1A 5CU1A 3CHXA 1C28A 1OT5A 5DUVA 3FHIB 2GC2A 4FFHA 5I91A 4CP0A 1W90A 3K3OA 3THCA 5DMYA 1UZ0A 4H55A 1H8TC 1R1ZA 1S2EA 3GM8A 3J7HA 4QPWA 3SLIA 3W9AA 5ACA1 2HWD2 1WD3A 2KR2A 3C8XA 3Q8FA 5FRAA 3VHNA 3VBHC 4E8CA 1W6PB 4JVAA 2ZHMA 4META 1OMIA 1SLAA 3H1MA 3KQRA 5FQ0A 1H6YA 2AYHA 5E89A 4B4RA 3AMMA 3JCIA 5GLTA 1HRI2 2ZX1A 4IGQA 5FZMA 5I8SA 2VMEA 4EZ4A 3WD5A 4CP1A 1TME1 1WLCA 3T4HB 1LODA 2FCTA 1I5PA 3GDBA 2YBKA 3IDEA 4FP3A 1GOFA 1W3XA 1MS5A 1REEA 1BBT2 3AMHA 3KV6A 3KCXA 4EWDA 4DUWA 3I7DA 5BNNA 1YO8A 1TZOA 2ARAA 4CDWA 5G05L 3A22A 4IESA 1QJX1 4XTPA 5T3NA 2WFPA 4XABA 2BWAA 2F4PA 1RVF2 5FQ0B 3T0BA 1Y9QA 2WO1A 4Y4RA 3SEEA 1DQ2A 5J09A 3AZZA 4OUSA 5FYCA 4EN0A 4EZHA 3T4VA 4XJUA 1XOYA 1RUJ3 4XILA 1HRI3 2HBUA 5CVRA 4ASLA 1AR81 5T50A 3JQXA 1JZ6A 1AYM2 5FZFA 3LFMA 2VQUA 3PU3A 5L19A 1VMJA 4I0AA 4HVQA 5BNNB 4CDWB 3SMHA 1CN1A 2C5DA 5FOBB 1BBT3 1WCUA 1H6XA 3MIEA 3I3MA 1TE1B 3BPSA 4J1XA 1H2LA 1OKQA 5J3UA 1X36A 5G04L 3TB0A 1LNSA 3GZUC 3O1VA 4Y5SA 2XJUA 1YLLA 3MLKA 1FOD1 4FPEA 5FYHA 4YVWA 3D0JA 3L9JT 4BQ4A 3MV01 4QPIA 5IHRA 1AX1A 3KMHA 3VBFC 2R061 3POIA 3KCCA 2P5BA 1JW6A 4AFAA 2HWC1 1LOFC 4QPGA 4ISRA 3VBRA 4Z07A 5TSWA 1V6LA 2IVJA 1NLRA 2WA3A 2ZGPA 3POSA 4NAOA 5A6ZA 3ACGA 2VMIA 3GXUA 3LIGA 5BNPA 5I0DA 1S0EA 4E4DX 4W8JA 5JR2A 4OUMA 1V70A 5FZLA 3S5QA 3ZDSA 5CZKA 5FREA 2VW1A 4EJRA 3WG3A 2ZEXA 4GALA 4Z8BA 3M4FA 1SLBA 3V56A 3A0KA 1QJY2 2EXJA 5EJ3A 3WNOA 1DP0A 4CCKA 3LEMA 4JTNA 1OD5A 4P9YA 4YVWB 2VH9A 3PVNA 5AFBA 2Z2SB 4QPIB 3KQ4B 3CNAA 4FCAA 1UZVA 1V6KA 5H9QA 3TEXA 1UKRA 4ATFA 2RV9A 2VO5A 4QPGB 5JPNB 4IW3A 3VBRB 4AAXA 5CFDC 2PHXA 1XYNA 2P6HA 1WD4A 1PO23 1W8WA 1YQ5A 4IEZA 3D82A 4Y26A 3DF0A 4FOYA 4ASMB 1JZ7A 4CUAA 1AXYA 4XZPA 4CU8A 4IEQA 4A6OA 1W8FA 4BA6A 5C5UA 2VZ3A 3EO6A 1NYWA 3MI8A 4IV1A 5AVPA 3DYOA 3NVCA 4YG3A 3CJIC 1RB8G 2XXZA 2JDPA 1YI7A 3AYDA 3MICA 5FXXA 1QJY3 4F83A 1AJOA 1RUI3 3I3EA 1J83A 3ZN4A 2D6OX 3SNMA 5F5QA 5A70A 3M3IA 1CONA 2HYKA 3HIFA 2TBVA 4DZGA 1W9YA 3TEYA 1ZBE1 2BQPA 4XUPA 4AQ2A 4LBLA 5FZ7A 1ZZBA 3OBTA 4QKNA 4XFIA 3MV11 4IV1B 1NZCA 4YM1A 1GLHA 4KWUA 1UYYA 1RINA 1F4HA 1UIJA 4HKOA 4LNVA 4CPBA 1DFQA 2B46X 3T1LA 1DDLA 4I02A 3WDXA 2EALA 2QQLA 4RR3A 4PQQA 3LCPA 3MDPA 3RYPA 1DCSA 1DQ1A 5FPXA 3JUUA 4AGGA 1XNAA 3T2PA 1HV0A 1H30A 3LPGA 4R4XA 1RUG1 3AKRA 3CU7A 1QH6A 3KCYA 4NMIA 2AACA 4AHYA 4CCOA 2Q30A 2QE3A 2VTXJ 4BK5A 4R9AA 3L2YA 1CWPA 1JH5A 1Y9MA 2B45X 2ORXA 3U14A 3WW3A 3ZVXA 1ACCA 3BCWA 1SMVA 5F6KA 2G19A 2Y0IA 5AC91 5F1RA 3ME2A 5C3PA 4CCCA 1TEIA 2NP0A 4RR3B 4OLLA 4K1ZA 4P5YA 1LAJA 5HV0A 1OSGA 3TOJA 5FY4A 4CPBD 3GZTB 1ULDA 5LZ6A 2BOJA 3LOIA 2BFUS 3ABZA 4N43A 5BNNC 5JI7A 2J42A 4FSJA 2XGXA 3PVEA 5C3RA 2GNBA 2WA4A 4AQSA 5JXGA 1SLTA 4WV8A 2Z79A 4BQ3A 2UWCA 1K12A 4MO3M 3WEZA 1XE7A 4UAPA 4H14A 3WDYA 4GAZA 3BIEA 1O3SA 1IG0A 3PTRB 2BNNA 5LRRA 1X33A 4G9SB 5CADA 3WQ1A 4JHTA 4RSUA 5FP7A 4QQLA 3FHQA 4MVTA 2Y38A 4YVSA 4I3PA 4PF5A 4N43B 3ZYHA 4D7YA 1PVC1 4IEWA 2WFF1 1Y3TA 1BEV2 3BU7A 3MF9A 1RUH3 1MEC2 4PT6A 5B2GB 1HXS2 1OLMA 2BOIA 2ZOEB 1Q8QA 5FV3A 4L92A 2UYAA 1U5ZA 1LENA 3GZAA 3HAGA 4W50A 3T2OA 3VBOC 3CQOA 1JXNA 2RJ2A 2I2SA 2VMGA 3N7JA 3ITQA 4FFGA 1WGPA 1FT9A 2RM22 3NO8A 4LE4A 3ZDVA 3VUOA 1D2QA 2WBKA 4C8DA 1V0AA 1CIWA 3KSCA 5JUVA 1GFF2 2PHRA 1Q8OA 4Q4Y1 5I0SA 4YVSB 1CPMA 1AXKA 5EWSA 1NY72 5C3SA 4LOSA 1RC6A 4R9BA 3APBA 1B09A 4CE8A 2QFEA 2HBTA 1RUD2 2WWUA 4JQTA 4XZUG 2OS2A 4HSJA 5BNPC 1TNRA 1S0DA 5CYYA 1OXCA 1QOOA 2A7AA 4AVCA 4FPOB 2PFWA 2SLIA 5A3LA 3WNLA 1LOEA 2R1DA 4FTEA 2WDBA 3IM0A 3IWZA 4CDXC 4MGSA 3AMPA 4XHXA 3AZWA 1ZRIA 2GNTA 1O8SA 3J8F2 1ZRCA 1GNHA 2ZGTA 2AUYA 1LOCA 2GNMA 3OJBA 3AKQA 4RGKA 4Z92B 1J3RA 4Q4W3 3VHOA 5FY5A 5JMCA 4K21A 3A0NA 2A73B 2GN3A 3KT4A 1ZZ6A 1MS4A 3CO2A 1LOAA 4FQ4A 1LHUA 1AR83 3NV2A 3N9MA 4JHZA 3QH7A 4D6RA 3I4IA 5JOXA 1SFNA 5EQUA 2ENRA 2R043 4PIXA 2WQ8A 5T5PA 2CHHA 2WJSA 1BQPA 1A6CA 1REFA 2E7AA 3K77A 4IE4A 3J8F3 4DFSA 3EHKA 4JTOA 2XJPA 2VMFA 4IE5A 4UFKA 4HKWA 4DOUA 4MHRA 3VLBB 4E4SA 4EN9B 2VUDA 2R30A 2A6ZA 1O7FA 3CJXA 2B5HA 1GMMA 2RJLA 2W39A 1W6NB 4QHOA 3ZXDA 2A6YA 2V4AA 2XHKA 4PDWC 5F5CA 1VBA2 2YZ4A 3NKTA 4AGRA 3Q9OA 4EV0A 1XE0A 3KZ4C 2JDNA 2WINB 5KHJA 1RHI1 2EVXA 2VXRA 2OYZA 3H8XA 2J1SA 2QJVA 1W8OA 4XBNA 5HV4A 3U78A 2XMLA 4O61A 4XW3A 1XYOA 3RYRA 4V2VA 4Q0VA 5LW9A 1U5IA 1VB4A 4YFWA 2F4LA 1G9DA 3TN91 5DZGA 2WZPP 1JN2P 3N7MA 1P8JA 4YM3A 2MEV2 3FFQA 1C3HA 4G3YC 5A33B 4R52A 1TVGA 4AVVA 4XOGA 2OA2A 5HI0A 1H0BA 1DZQA 1YQCA 4KGGA 3UGFA 2QZ3A 1SCSA 4Y5TA 1PGL2 2RS11 3AL6A 3ECQA 4P08A 4AYUA 1VBC2 4Z1VA 4QX7A 3VDAA 1ULOA 4PI2A 4XQ4A 4TTGA 1YXWA 3BVCA 4Q1RA 2VG9A 4ZS3A 3RG0A 5LK7B 1SHWB 1IS6A 3RQ0A 3VD7A 5F9TA 3TWIA 2WWJA 2CNAA 2RDRA 5FXWA 1OLQA 1W06A 5KXCA 4DUXA 1D7PM 2VULA 1KRIA 2X53S 3POEA 1S4CA 2YFZA 4PQ9A 4R9DA 2A6WA 3F95A 2K46A 4H7MA 5FLJA 5KHKA 1QQP1 4GH4A 4Q4V1 4ATEA 1OD3A 3T1MA 4FTSA 5I0RA 5C4WA 3H3ZA 4CEWA 1NAEA 1VBC3 2AGSA 3U37A 3GGLA 3WP5A 1HQNA 2K9ZA 2RDNA 5DXDA 4NWVA 1WLDA 1DHKB 3CL1A 3H1YA 4MGZE 5FUNA 1R093 1UY1A 3AXEA 3RMXA 4UFMA 4WBBA 4DQAA 4WM8A 2VQTA 1J3QA 3VHRA 3BYWA 2TUNA 4GH4B 2B9UA 3URFA 1XB9A 3ILRA 4EN7B 4XE9A 3WHTA 5C4WB 4P00B 4CEWB 5FZIA 2WN3A 2C26A 3ZFFA 3NV4A 2PAEA 3MO4A 5IFPA 5SV8A 3ZSEA 3KM5A 3KVAA 2ZX4A 4JC1A 3DV8A 1I9RA 2WR9A 4MGYE 2VUAA 3B7MA 2J22A 3KF3A 3M2MA 5GLWA 4LBJA 3ZFEC 1VRH3 5GLUA 4B4QA 3WG4A 4Y5Z0 4WM8B 1R082 3GZEA 3O1RA 2D6KA 4QX5A 4BJ0A 1PGW1 2WN2A 1KFXL 4Y4YA 3WW2A 3PUSA 4XJWA 1ENXA 2NN8A 3DECA 4CTEA 1OH3A 3RSJA 5IATA 1HN1A 3ZFFB 1PZ8A 3KGZA 4JDMA 1ZRRA 4XJ9A 3ZX7A 4E2GA 3B9IA 2JWPA 2DCZA 3ES1A 3UGHA 3MIHA 2AH2A 1X8EA 2B42B 3NKGA 5LA2A 3TNPB 1RMU1 2P34A 3LIHA 1MZEA 2CL2A 1U12A 1XPWA 1JZ5A 1GP4A 4N7UA 1MS9A 3UT0A 1PVC3 4P9LA 1V9U3 4EWEA 5AFEA 2Y8KA 1ASJ1 2VCAA 5FZ3A 4W6WA 4B1LA 1O3RA 5FUIA 3VKMA 4AQ6A 2PHWA 1PO12 1XRUA 2UURA 3JB4C 4NWWA 2PHDA 5T54A 1IS5A 4OHZA 1SDDB 1IOAA 1O5LA 2VZUA 4LK6A 4ARYA 4ZXEA 2R32A 3HN1A 4GB33 1G9CA 1KGYA 1WCDJ 3ZO0B 4A6SA 1ZBA2 2WSUA 4YZ1A 2FDHA
chains in the Genus database with same CATH topology
2W1UA 3LPFA 5EJZB 3FL7A 3UESA 1SG3A 4DXTA 4GWIA 2ZXQA 2VZVA 4A4AA 2XONA 2CDPA 2DCKA 4IUGA 1JHJA 3HPNA 5JXJA 1JYXA 3OEBA 5DQ0A 2JDAA 3T0DA 4E8DA 5HPOA 1CZVA 4A41A 4QX0A 5IFTA 3PUHA 3HOBA 2WYSA 3I2KA 4M4RA 3I97A 2V5DA 4GWJA 3PUIA 3MUY1 2EIBA 2VZQA 4QB6A 1EUTA 4W4ZA 1UMIA 3K4AA 3VD3A 3I3DA 1O8PA 2DDUA 3NQHA 2RVAA 5JMOA 2B9VA 5EIYB 2WZ8A 4ZZ5A 2ID4A 3IB3A 4BXSV 2ORZA 3WF0A 4CUBA 1W8NA 2QQKA 2QQIA 2E32A 1US3A 1OT5A 3OGSA 4LKSA 3CMGA 4QX1A 2J1EA 3THCA 3BGAA 2W46A 5DMYA 3WNMA 1UZ0A 3F2ZA 3J7HA 3GM8A 4QPWA 3EYPA 4DXSA 3K4ZA 1UXXX 1CZSA 3W5MA 2QQNA 2J1RA 3C8XA 2QQMA 4E8CA 3P6BA 4OUEA 2QBXA 1H6YA 3VD4A 2BZDA 2VMEA 1YQ2A 1I5PA 3GDBA 1GOFA 2EIDA 2L9LA 4DUWA 2VL4A 2V4VA 5G05L 1PX4A 3A22A 3HJRA 2E31A 4OYUA 3T0BA 2WO3A 2WO1A 3FHAA 5IYYA 3SEEA 2EIEA 4ARXA 1UX7A 3UETA 4UI9L 4RYDA 1TG7A 1UMHA 1JZ6A 2YB7A 1RYYA 2VQUA 4ET7A 2VMDA 1GOGA 3IAPA 1H6XA 4OZOA 1NX9A 5B4NA 5G04L 1LNSA 2VM9A 1GQPA 3C7EA 2VZ1A 3MV01 4CU9A 5IHRA 3VDBA 3WF1A 1UYZA 4MOAA 1UY3A 3ACGA 3GXUA 1JZ8A 3HNBM 5I0DA 5JR2A 1PMJX 3I2GA 4W8JA 5CZKA 4CU6A 2ZEXA 1UY0A 4LHSA 4L0PA 3WNOA 1DP0A 2KD7A 3ACHA 4ZZ8A 2RV9A 3P1IA 2VO5A 4FI9A 2Y6JA 4AAXA 4A44A 2J7MA 4BK4A 4PF1A 2QQOA 1CZTA 4CUAA 1JZ7A 4CU8A 1OF4A 4A6OA 1JYVA 2VZ3A 1BHGA 2WUHA 1IQDC 3DYOA 3WNNA 2OKXA 2VC9A 4LPLA 3IDAA 5J1XA 2XOMA 3I3EA 1J83A 1R64A 2W94A 1UXZA 3C7FA 4D8MA 4A3ZA 4DEQA 3HNMA 3LEIA 4XUPA 3MV11 4A42A 4KWUA 1UYYA 1F4HA 4XURA 2VTFA 3IIIA 2LS6A 2QQLA 4PQQA 1XNTA 4TXWA 1XNAA 3T2PA 1UY4A 3LPGA 3THDA 3DYMA 4XUOA 2HYXA 3VD5A 4BK5A 2WAAA 5DPNA 4QB1A 1OF3A 2ORXA 1OH4A 2Z4FA 2ZEYA 3C7GA 4P5YA 3NJVA 2VJXA 2C9KA 2X09A 3HNYM 2HLEA 3NNGA 1JU3A 2JE8A 3ABZA 2DCJA 1L7RA 4QX3A 1PX3A 1JZ2A 5C70A 4QB2A 2VZTA 5JXGA 1KEXA 3NJXA 2PQSA 2W95A 4MO3M 1K12A 3WEZA 1JYWA 4UAPA 4XUQA 2Y64A 3OGRA 3LE0A 3I2IA 3FHQA 4HG6B 1DLCA 1O59A 3WQBA 4PT6A 2JKXA 4JKKA 1L7QA 3T09A 2W9XA 1DYOA 4W50A 3T2OA 2X05A 3CQOA 2RJ2A 3LQCA 1W99A 2C4XA 3I3BA 4RN5A 5C7GA 4OMDA 2WBKA 3CKHA 5JUVA 1CIYA 2W92A 3T08A 1K3IA 5EJ1B 3I2FA 3ACIA 4UOJA 3WF3A 1JU4A 4XZUG 5JXIA 5CYYA 5B4XA 3E1F1 4QDSA 4YPJA 3WNLA 2WDBA 1CX1A 2E33A 4MGSA 1JYNA 2YC4A 3CIHA 3ETPA 1O8SA 2R7EB 3NRUA 3EB7A 2WZEA 2XHNA 4ZY9A 3ACFA 3MBWA 2X10A 3A7QA 1JI6A 3OB8A 2Y6HA 4CVUA 1W0NA 2J1TA 1ULPA 2WO2A 4JHZA 4DXRA 3W5NA 2WQ8A 1W9SA 2W91A 3K77A 3C7HA 2VMFA 3SKVA 2XQXA 3CZUA 2Y6KA 4XUTA 2J1VA 3K75B 4CU7A 5A1AA 2EICA 4MGQA 1GMMA 2JD9A 5LA0A 4A45A 2YC2A 4QX2A 2VZOA 2VZPA 2J1SA 1W8OA 3A21A 3BN6A 5JXHA 1GU3A 2Y6GA 3K4DA 4QAWA 5C71A 3MUZ1 2Y6LA 4DUVA 4AG4A 3D3AA 1EUUA 4LQRA 1P8JA 1UY2A 2E26A 3I2JA 1TVGA 2BBAA 4D0QA 1J84A 4OMCA 5DN2A 2W47A 4XVHA 2QQJA 1WCQA 4P08A 3ECQA 3VDAA 1ULOA 2VR4A 2VCBA 2J1AA 3LEGA 3WNPA 4TTGA 1SHWB 3VD7A 3ZM8A 3VDCA 1UYXA 3WNKA 3T0AA 5LCWL 4DUXA 1D7PM 2YFZA 2YG0A 1US2A 2BGOA 1OD3A 3IAQA 1NAEA 3U37A 3GGLA 1GUIA 2BGPA 3HEIA 2J1UA 1UWWA 4MADA 1F4AA 2VOTA 2VCCA 4JKMA 1UY1A 2VZRA 3A23A 4GZ9A 5IJRA 2VQTA 1W9TA 3C7OA 3K46A 1PMHX 2W87A 3OEAA 3OBAA 2V72A 4P00B 1GOHA 3CDZB 2W1QA 5F7UA 2WN3A 2C26A 2VMCA 3LEKA 3FN9A 3MO4A 5IFPA 4KMQA 2J22A 5HXMA 2LW8A 3OGVA 1XC6A 2W1SA 2W1WA 3I2HA 2VZSA 1JZ4A 4BJ0A 2WN2A 4M4PA 4XUNA 3AC0A 3DYPA 3DECA 1W9WA 3CZJA 2B4KA 2WABA 1HN1A 3HN3A 1K45A 3OG2A 3WF2A 4JKLA 3WSOA 3T2QA 1T2XA 4BDVB 5LA2A 1MPXA 1GNYA 1JZ5A 1XPWA 1JZ3A 2BERA 3VD9A 4JX0A 3JXSA 1WKYA 2W3JA 4Z2AA 2Y8KA 4CUCA 5LA1A 2VCAA 1NUKA 5FUIA 3WF4A 2W5FA 4QDQA 1NKGA 2ZEZA 4QDRA 4DEVA 1SDDB 2ZEWA 2VZUA 4ARYA 4ZXEA 3SKJE 3UNPA 1KGYA 2YFUA 2WAOA 4P02B 3SEPA 2CDOA 4KI5M 1K42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W1U A;  3LPF A;  5EJZ B;  3FL7 A;  3UES A;  1SG3 A;  4DXT A;  4GWI A;  2ZXQ A;  2VZV A;  4A4A A;  2XON A;  2CDP A;  2DCK A;  4IUG A;  1JHJ A;  3HPN A;  5JXJ A;  1JYX A;  3OEB A;  5DQ0 A;  2JDA A;  3T0D A;  4E8D A;  5HPO A;  1CZV A;  4A41 A;  4QX0 A;  5IFT A;  3PUH A;  3HOB A;  2WYS A;  3I2K A;  4M4R A;  3I97 A;  2V5D A;  4GWJ A;  3PUI A;  3MUY 1;  2EIB A;  2VZQ A;  4QB6 A;  1EUT A;  4W4Z A;  1UMI A;  3K4A A;  3VD3 A;  3I3D A;  1O8P A;  2DDU A;  3NQH A;  2RVA A;  5JMO A;  2B9V A;  5EIY B;  2WZ8 A;  4ZZ5 A;  2ID4 A;  3IB3 A;  4BXS V;  2ORZ A;  3WF0 A;  4CUB A;  1W8N A;  2QQK A;  2QQI A;  2E32 A;  1US3 A;  1OT5 A;  3OGS A;  4LKS A;  3CMG A;  4QX1 A;  2J1E A;  3THC A;  3BGA A;  2W46 A;  5DMY A;  3WNM A;  1UZ0 A;  3F2Z A;  3J7H A;  3GM8 A;  4QPW A;  3EYP A;  4DXS A;  3K4Z A;  1UXX X;  1CZS A;  3W5M A;  2QQN A;  2J1R A;  3C8X A;  2QQM A;  4E8C A;  3P6B A;  4OUE A;  2QBX A;  1H6Y A;  3VD4 A;  2BZD A;  2VME A;  1YQ2 A;  1I5P A;  3GDB A;  1GOF A;  2EID A;  2L9L A;  4DUW A;  2VL4 A;  2V4V A;  5G05 L;  1PX4 A;  3A22 A;  3HJR A;  2E31 A;  4OYU A;  3T0B A;  2WO3 A;  2WO1 A;  3FHA A;  5IYY A;  3SEE A;  2EIE A;  4ARX A;  1UX7 A;  3UET A;  4UI9 L;  4RYD A;  1TG7 A;  1UMH A;  1JZ6 A;  2YB7 A;  1RYY A;  2VQU A;  4ET7 A;  2VMD A;  1GOG A;  3IAP A;  1H6X A;  4OZO A;  1NX9 A;  5B4N A;  5G04 L;  1LNS A;  2VM9 A;  1GQP A;  3C7E A;  2VZ1 A;  3MV0 1;  4CU9 A;  5IHR A;  3VDB A;  3WF1 A;  1UYZ A;  4MOA A;  1UY3 A;  3ACG A;  3GXU A;  1JZ8 A;  3HNB M;  5I0D A;  5JR2 A;  1PMJ X;  3I2G A;  4W8J A;  5CZK A;  4CU6 A;  2ZEX A;  1UY0 A;  4LHS A;  4L0P A;  3WNO A;  1DP0 A;  2KD7 A;  3ACH A;  4ZZ8 A;  2RV9 A;  3P1I A;  2VO5 A;  4FI9 A;  2Y6J A;  4AAX A;  4A44 A;  2J7M A;  4BK4 A;  4PF1 A;  2QQO A;  1CZT A;  4CUA A;  1JZ7 A;  4CU8 A;  1OF4 A;  4A6O A;  1JYV A;  2VZ3 A;  1BHG A;  2WUH A;  1IQD C;  3DYO A;  3WNN A;  2OKX A;  2VC9 A;  4LPL A;  3IDA A;  5J1X A;  2XOM A;  3I3E A;  1J83 A;  1R64 A;  2W94 A;  1UXZ A;  3C7F A;  4D8M A;  4A3Z A;  4DEQ A;  3HNM A;  3LEI A;  4XUP A;  3MV1 1;  4A42 A;  4KWU A;  1UYY A;  1F4H A;  4XUR A;  2VTF A;  3III A;  2LS6 A;  2QQL A;  4PQQ A;  1XNT A;  4TXW A;  1XNA A;  3T2P A;  1UY4 A;  3LPG A;  3THD A;  3DYM A;  4XUO A;  2HYX A;  3VD5 A;  4BK5 A;  2WAA A;  5DPN A;  4QB1 A;  1OF3 A;  2ORX A;  1OH4 A;  2Z4F A;  2ZEY A;  3C7G A;  4P5Y A;  3NJV A;  2VJX A;  2C9K A;  2X09 A;  3HNY M;  2HLE A;  3NNG A;  1JU3 A;  2JE8 A;  3ABZ A;  2DCJ A;  1L7R A;  4QX3 A;  1PX3 A;  1JZ2 A;  5C70 A;  4QB2 A;  2VZT A;  5JXG A;  1KEX A;  3NJX A;  2PQS A;  2W95 A;  4MO3 M;  1K12 A;  3WEZ A;  1JYW A;  4UAP A;  4XUQ A;  2Y64 A;  3OGR A;  3LE0 A;  3I2I A;  3FHQ A;  4HG6 B;  1DLC A;  1O59 A;  3WQB A;  4PT6 A;  2JKX A;  4JKK A;  1L7Q A;  3T09 A;  2W9X A;  1DYO A;  4W50 A;  3T2O A;  2X05 A;  3CQO A;  2RJ2 A;  3LQC A;  1W99 A;  2C4X A;  3I3B A;  4RN5 A;  5C7G A;  4OMD A;  2WBK A;  3CKH A;  5JUV A;  1CIY A;  2W92 A;  3T08 A;  1K3I A;  5EJ1 B;  3I2F A;  3ACI A;  4UOJ A;  3WF3 A;  1JU4 A;  4XZU G;  5JXI A;  5CYY A;  5B4X A;  3E1F 1;  4QDS A;  4YPJ A;  3WNL A;  2WDB A;  1CX1 A;  2E33 A;  4MGS A;  1JYN A;  2YC4 A;  3CIH A;  3ETP A;  1O8S A;  2R7E B;  3NRU A;  3EB7 A;  2WZE A;  2XHN A;  4ZY9 A;  3ACF A;  3MBW A;  2X10 A;  3A7Q A;  1JI6 A;  3OB8 A;  2Y6H A;  4CVU A;  1W0N A;  2J1T A;  1ULP A;  2WO2 A;  4JHZ A;  4DXR A;  3W5N A;  2WQ8 A;  1W9S A;  2W91 A;  3K77 A;  3C7H A;  2VMF A;  3SKV A;  2XQX A;  3CZU A;  2Y6K A;  4XUT A;  2J1V A;  3K75 B;  4CU7 A;  5A1A A;  2EIC A;  4MGQ A;  1GMM A;  2JD9 A;  5LA0 A;  4A45 A;  2YC2 A;  4QX2 A;  2VZO A;  2VZP A;  2J1S A;  1W8O A;  3A21 A;  3BN6 A;  5JXH A;  1GU3 A;  2Y6G A;  3K4D A;  4QAW A;  5C71 A;  3MUZ 1;  2Y6L A;  4DUV A;  4AG4 A;  3D3A A;  1EUU A;  4LQR A;  1P8J A;  1UY2 A;  2E26 A;  3I2J A;  1TVG A;  2BBA A;  4D0Q A;  1J84 A;  4OMC A;  5DN2 A;  2W47 A;  4XVH A;  2QQJ A;  1WCQ A;  4P08 A;  3ECQ A;  3VDA A;  1ULO A;  2VR4 A;  2VCB A;  2J1A A;  3LEG A;  3WNP A;  4TTG A;  1SHW B;  3VD7 A;  3ZM8 A;  3VDC A;  1UYX A;  3WNK A;  3T0A A;  5LCW L;  4DUX A;  1D7P M;  2YFZ A;  2YG0 A;  1US2 A;  2BGO A;  1OD3 A;  3IAQ A;  1NAE A;  3U37 A;  3GGL A;  1GUI A;  2BGP A;  3HEI A;  2J1U A;  1UWW A;  4MAD A;  1F4A A;  2VOT A;  2VCC A;  4JKM A;  1UY1 A;  2VZR A;  3A23 A;  4GZ9 A;  5IJR A;  2VQT A;  1W9T A;  3C7O A;  3K46 A;  1PMH X;  2W87 A;  3OEA A;  3OBA A;  2V72 A;  4P00 B;  1GOH A;  3CDZ B;  2W1Q A;  5F7U A;  2WN3 A;  2C26 A;  2VMC A;  3LEK A;  3FN9 A;  3MO4 A;  5IFP A;  4KMQ A;  2J22 A;  5HXM A;  2LW8 A;  3OGV A;  1XC6 A;  2W1S A;  2W1W A;  3I2H A;  2VZS A;  1JZ4 A;  4BJ0 A;  2WN2 A;  4M4P A;  4XUN A;  3AC0 A;  3DYP A;  3DEC A;  1W9W A;  3CZJ A;  2B4K A;  2WAB A;  1HN1 A;  3HN3 A;  1K45 A;  3OG2 A;  3WF2 A;  4JKL A;  3WSO A;  3T2Q A;  1T2X A;  4BDV B;  5LA2 A;  1MPX A;  1GNY A;  1JZ5 A;  1XPW A;  1JZ3 A;  2BER A;  3VD9 A;  4JX0 A;  3JXS A;  1WKY A;  2W3J A;  4Z2A A;  2Y8K A;  4CUC A;  5LA1 A;  2VCA A;  1NUK A;  5FUI A;  3WF4 A;  2W5F A;  4QDQ A;  1NKG A;  2ZEZ A;  4QDR A;  4DEV A;  1SDD B;  2ZEW A;  2VZU A;  4ARY A;  4ZXE A;  3SKJ E;  3UNP A;  1KGY A;  2YFU A;  2WAO A;  4P02 B;  3SEP A;  2CDO A;  4KI5 M;  1K42 A; 
#chains in the Genus database with same CATH topology
 2EF6 A;  4JGY A;  3PLQ A;  3M3O A;  2W1U A;  5DDJ 1;  1M06 G;  4QM9 A;  4AAP A;  4DXT A;  4LXL A;  1S0B A;  1LUL A;  4IEY A;  2ZXQ A;  5J36 A;  3WX5 A;  4A4A A;  3KD4 A;  2XON A;  1EV1 3;  2CDP A;  2DCK A;  2H0V A;  5A7N A;  3QAC A;  3AK0 A;  3B00 A;  3UKN A;  3IMM A;  1AL2 2;  2FCV A;  4AF9 A;  5JXJ A;  2DUR A;  1AR7 1;  3OEB A;  2VU9 A;  2BNM A;  2O8Q A;  3RMY A;  3OD4 A;  5AVA A;  3WP3 A;  3AVS A;  4JGY B;  4IQP A;  1ZA4 A;  5FMC A;  2WYF A;  1ZBA 3;  2NYY A;  4X6R B;  3ZYI B;  1AX2 A;  2WZR 1;  1BMV 1;  3OSD A;  1UF2 C;  2V5D A;  5FZG A;  4QM8 A;  3GHN A;  5FJK A;  4ISQ A;  4QB6 A;  4Q0P A;  1G8W A;  1KJL A;  3HQX A;  4IET A;  2K0G A;  1WW4 A;  2WRA A;  1PM7 A;  2VNV A;  4IV3 A;  5C5T A;  1BVP 1;  3NQH A;  3LKJ A;  4COW A;  1AL2 3;  3SCF A;  4IGO A;  2B9V A;  2QQU A;  4NPR A;  4UBG A;  5EIY B;  4XPV A;  1D4M 2;  2ATF A;  4ZZ5 A;  2ID4 A;  3IB3 A;  5KXD A;  1HLC A;  4N8M A;  1DU3 D;  2C0Z A;  2ORZ A;  2YHJ A;  3GJB A;  2ZMN A;  5FZK A;  1ST8 A;  2V73 A;  4XQW A;  3O7O A;  2VXJ A;  3U75 A;  1W8N A;  4CUB A;  4GH4 C;  2QQK A;  2GAU A;  4AEJ A;  4CEY A;  4ES8 A;  5C4W C;  2XG3 A;  4CEW C;  4Z82 A;  1BVV A;  5A6X A;  3CMG A;  1C8M 1;  1QDO A;  5CFC C;  5GZD A;  2J1E A;  2RG4 A;  4IV3 B;  4Q4X 2;  5F6L B;  4S2H A;  2X29 A;  4D3W A;  4U2A A;  2WNO A;  3I2D A;  5GZF A;  2CY6 A;  2VNG A;  4FPL A;  4CCE A;  4DXS A;  1RUF 1;  4EN8 B;  2ERF A;  5FY0 A;  3ZYR A;  1E57 A;  3WT3 A;  1ZZC A;  1NOV A;  5A80 A;  3UL2 A;  1LCL A;  1D4M 3;  4GUL A;  4BPZ A;  5FYU A;  3UKT A;  5C8W A;  3TN9 3;  4OUE A;  4RQP C;  1NE4 A;  5KHI A;  4CEY B;  2QBX A;  3HQU A;  3JU9 A;  1S2K A;  3VD4 A;  1Y9G A;  2FQP A;  3H0O A;  3ZFF C;  1NXM A;  3RI9 A;  2HWE 2;  1UOF A;  1YIF A;  5LBF A;  2A3W A;  2RDQ A;  1WLW A;  5JAX A;  2EID A;  4ZPI A;  4BME A;  1PMI A;  1RUC 2;  2BJS A;  3ZYG A;  3WOG A;  1PX4 A;  5CBL A;  4COV A;  1F9K A;  1ZRD A;  2BTV C;  2FBE A;  2OX0 A;  2XPJ A;  1RVF 1;  2WO3 A;  1YYN A;  3FHA A;  1FPN 2;  3M8L A;  4NOT A;  4JGZ A;  1LHN A;  2EIE A;  1MVQ A;  4N53 A;  4ARX A;  2ZX0 A;  3UKV A;  4AED C;  2ARE A;  1TG7 A;  1UMH A;  4NRQ A;  1HRV 2;  2JDH A;  3OTF A;  4LBK A;  5L7O C;  3O0W A;  1DQ4 A;  4XDQ A;  1O3T A;  4Y1U A;  4QU1 A;  4NE9 A;  1K5M A;  1O4T A;  4UWD A;  4XJ8 A;  5FBJ A;  1YFX A;  3FX3 A;  5FCC A;  2WS9 2;  1W6M A;  4LBO A;  4GD4 A;  1ENS A;  4MLO A;  4AI8 A;  1W8T A;  1QOT A;  3VHP A;  2VM9 A;  4P9G A;  1GQP A;  4JGZ B;  2VGD A;  1AYN 2;  1VBD 1;  1ND3 B;  4IEU A;  4N53 B;  3USU B;  5JCT A;  2HWF 1;  2V09 A;  1FPN 3;  4U36 A;  2D6M A;  2VZ1 A;  3WDW A;  4CU9 A;  4RHV 3;  1EP0 A;  3WF1 A;  4N9H A;  3LD8 A;  1YQ8 A;  3ZR5 A;  1UAI A;  4GQ7 A;  4BYY A;  4MOA A;  1UY3 A;  4FAG A;  5FZO A;  3WHU A;  3EMR A;  1UU5 A;  1HRV 3;  1N1T A;  1K5M B;  3ROU A;  1HW5 A;  2WKK A;  3S57 A;  4MH0 E;  3POY A;  1W6M B;  3N3H A;  4PBP A;  2PXJ A;  2ZML A;  2YGL A;  4HMZ A;  1XNK A;  2DBI A;  3CBN A;  2KD7 A;  2JXA A;  3GCW A;  3JB8 A;  3AFG A;  4AQT A;  4D69 A;  5GZG A;  3BB6 A;  1PIV 2;  2ZX3 A;  1QJZ A;  1IKP A;  1TMF 2;  1WW6 A;  3P1I A;  1JOJ A;  2H0B A;  3O1T A;  5A3M A;  1BKZ A;  1RGS A;  2O8O A;  3RNS A;  2J7M A;  5FZO B;  4BK4 A;  4PF1 A;  2QQO A;  5D2A A;  2DCT A;  1HX6 A;  4HSL A;  4UT5 A;  4CRQ A;  2FDG A;  1A3K A;  1OF4 A;  4XJZ A;  2D7F A;  1Q5O A;  1S2B A;  4IE0 A;  5FOJ B;  5KC6 A;  3PL0 A;  5E16 A;  4CCD A;  1BHG A;  4M3C E;  3KGL A;  3SH3 A;  1E5S A;  2VC9 A;  3GBG A;  2R0F A;  1WME A;  4MZU A;  3RVH A;  4D6S A;  2XBO 2;  2ZHN A;  3MGU A;  1R64 A;  4FPG A;  5J1X A;  4X8P A;  4JRA A;  2QKD A;  3C7F A;  2XWB B;  2C9A A;  5KHH A;  3RWN A;  3BTA A;  1XE8 A;  4DEQ A;  3HNM A;  4NRP A;  4J1W A;  3RJ2 X;  5IW0 A;  4C90 A;  4HET A;  4LO4 B;  1IZ3 A;  3QBQ A;  3FBY A;  3OPT A;  3FMG A;  2P17 A;  4M0H A;  4UFI A;  1U0A A;  5FMD A;  1RJ8 A;  3VDD A;  4O9G A;  1XYP A;  2GU9 A;  2QDN A;  2P2K A;  2BU9 A;  2XVG A;  4S2F A;  2H6B A;  2HWB 3;  4OHY A;  1GQH A;  3DYM A;  4KWL A;  4PLM A;  5DDJ 3;  2OPK A;  5T5L A;  1GR3 A;  4PI0 A;  1OA4 A;  4UW5 A;  1ND2 C;  4QB1 A;  1R1A 1;  5FFO C;  5FXV A;  3WR0 A;  1F35 A;  1IHM A;  2RS5 2;  4LHL A;  4MX3 A;  2Z4F A;  3H8U A;  4KBB A;  1H2M A;  4W65 A;  4XFC A;  1W8Z A;  1LHV A;  3VDD B;  5LWB A;  3RZK A;  3C7G A;  2P3K A;  2GZW A;  3LA7 A;  4RFR B;  4NVP A;  2C9K A;  1RXG A;  3I3Q A;  1JU3 A;  1I1E A;  1OUX A;  4R9C A;  2RR1 2;  2YU2 A;  1L7R A;  4TN7 A;  1T6B X;  1RUJ 2;  5IVC A;  2DTW A;  1PX3 A;  2DWR A;  2JDM A;  3OGJ A;  3PHM A;  4P9X A;  1CX4 A;  3ASI A;  2IXK A;  2AC1 A;  4XFH A;  4L2N A;  1J1L A;  5DUX A;  2ZCW A;  5JVV A;  2JG8 C;  1LJ7 A;  2W95 A;  5H9R A;  3GBF A;  2RS5 3;  3CEW A;  3IPV A;  2MNG A;  4LA3 A;  5FPB A;  1OVP A;  1IPJ A;  3V64 A;  4Q29 A;  3USS A;  1W9F A;  1YJK A;  2XLF A;  3C3V A;  4NN0 A;  5BXX A;  4WM7 A;  1V00 A;  2B39 A;  3DKQ A;  3LE0 A;  1GP5 A;  5GLV A;  1UZW A;  4SLI A;  1OHF A;  1Y4W A;  2DVF A;  2IWG B;  3DUI A;  3H9A A;  4JZR A;  5LB6 A;  2Y0O A;  2YV8 A;  4OUL A;  1QNY A;  1BEV 1;  1DLC A;  1K5M C;  1MEC 1;  2RR1 3;  4O7X A;  3UK9 A;  1HXS 1;  2Q8D A;  3NV1 A;  1EPW A;  2AEN A;  2OZ6 A;  4KU8 A;  4JKK A;  1L7Q A;  3DL3 A;  3MID A;  1HDK A;  2LRP A;  1I5Z A;  4QKB A;  5LY2 A;  3ZXF A;  3NMB A;  4HFS A;  5KWR A;  2X05 A;  1YQ6 A;  4AWD A;  3NNJ A;  3IPV B;  2Y60 A;  1W99 A;  2C4X A;  1CAW B;  2PA7 A;  2RM2 1;  1KQR A;  1COV 1;  4XAA A;  2VUJ A;  2A71 A;  3CKH A;  4WM7 B;  1Q3E A;  2IFR A;  5A3O A;  1K3I A;  3D0S A;  5EJ1 B;  3QH6 A;  4YM0 A;  5T5J A;  3RGB A;  2BRT A;  1RUD 1;  3VL9 A;  1JU4 A;  3ZFG A;  3HBZ A;  1YFW A;  4N90 A;  2OXB A;  4YW5 A;  1PO2 2;  4P9I A;  3LZZ A;  3E5Q A;  4YPJ A;  4MXW A;  2E33 A;  4BQX A;  1JYN A;  1UCX A;  1VBE 3;  2ARB A;  2YC4 A;  3E5X A;  2ILM A;  3J7M A;  1Z0H A;  4XFG A;  5FLH A;  1BCX A;  1DYK A;  3AP7 A;  4K8F A;  5FMO L;  2ZHK A;  1WBL A;  3AKP A;  3EB7 A;  1HKD A;  4AVA A;  1RUI 2;  1YWK A;  3ALQ A;  2JE9 A;  2D3P A;  2MHF A;  4FO9 A;  4KNC A;  4BLJ A;  4ZY9 A;  5T5O A;  4LO8 A;  1F8V A;  3A7Q A;  3ZFG B;  3EBR A;  3OB8 A;  3MPB A;  3MIG A;  2Y6H A;  3THP A;  2J1T A;  1YCI A;  2DVD A;  1WCS A;  5DAV A;  1LU1 A;  2YPJ A;  1ULP A;  4MXW B;  3P5B A;  5EP9 A;  5LEJ A;  5FZ4 A;  3OYW B;  1POV 0;  5F3E A;  3BTY A;  5FYT A;  4XC9 A;  3N36 A;  4W6Y A;  2W91 A;  4I30 A;  2K2S A;  3BOD A;  3C7H A;  2OPW A;  2IFW A;  1XU2 A;  2XQX A;  3RWK X;  4NID A;  3TEZ A;  1H4G A;  4LOR A;  2FCU A;  4YGD A;  3AZV A;  1UPI A;  1VBD 3;  4LLO A;  3MFA A;  1RIR A;  5KBF A;  3BI3 A;  2DF7 A;  2IXH A;  3ENR A;  3CF6 E;  1KFU L;  5FO7 B;  3VDD C;  1MVE A;  3R0R A;  2VQ0 A;  5LA0 A;  4A45 A;  3PUA A;  1QU0 A;  1VBA 1;  3VZM A;  2YXS A;  3RZJ A;  4QX2 A;  2TNF A;  3PME A;  2PMW B;  4COZ A;  3U1X A;  4HBN A;  2R07 2;  3A21 A;  4QGN A;  5JXH A;  1GU3 A;  2Y6G A;  4BQ2 A;  3FLP A;  4IEP A;  1HB1 A;  5E6H A;  2JJ6 A;  4UBH A;  5C71 A;  1MS1 A;  1XBF A;  2VE1 A;  1DG6 A;  3WLU A;  4AG4 A;  4QMA A;  1AR9 1;  4LQR A;  1NG0 A;  2WC2 A;  2UU8 A;  3VKF C;  2KM2 A;  2VOV A;  2MEV 1;  5K0U B;  2XR4 A;  1VBB 3;  4MG2 A;  1GWK A;  3ZN6 A;  4EE2 A;  5JOY A;  4D0Q A;  2WQ4 A;  4EQV A;  5LK5 A;  4OMC A;  1WWY A;  2W47 A;  4ORF A;  2CAU A;  1FMD 3;  4XJA A;  4BIS A;  3POB A;  3GF6 A;  4RGG A;  1H1A A;  1POV 3;  2R07 3;  2RMU 1;  2DUQ A;  2J1A A;  4WVM A;  3J7L A;  4OHW A;  4FPH A;  3J7N A;  1EAH 3;  4QQP A;  5FZ9 A;  3WNP A;  3V0A A;  1QJU 3;  1E5H A;  3VDC A;  5BYN A;  5IVF A;  1UYX A;  3LWC A;  4YFZ A;  3OGG A;  5LAS A;  1RUH 2;  2XUM A;  2XUE A;  3ZN6 B;  1KS4 A;  4Y22 A;  4CDW C;  4XXP A;  2R0H A;  4GKX A;  4X8N A;  3H50 A;  5FKC A;  2Q0A A;  2RJK A;  4WM7 C;  3ZIW A;  2YG0 A;  2VMH A;  2EXH A;  4PIZ A;  2BGO A;  4MV2 A;  1PHM A;  3ZMN A;  1OA3 A;  3TNQ A;  4WVM B;  4XET A;  2JDK A;  3V0A B;  3B9C A;  1ODM A;  3DKW A;  4I0W B;  3RZZ A;  2BGP A;  4UYB A;  4A7Y A;  4AFM A;  3HEI A;  5D21 A;  1H2K A;  3N35 A;  2RDS A;  4LE3 A;  1LU2 A;  2PLV 3;  1X7N A;  2PTM A;  4PCR A;  2VCC A;  4OVE A;  4Y22 B;  4JKM A;  2VZR A;  5FAX A;  3A23 A;  1LGB A;  1AR6 1;  5F5I A;  1N3Q A;  1V6N A;  1W9T A;  3C7O A;  5JIA A;  4AVT A;  1PMH X;  3ZXJ A;  1S1A A;  1X8M A;  1GSL A;  3OEA A;  3RDI A;  4YZ5 A;  3BAL A;  1BLZ A;  2ZGK A;  4LHK A;  2WNU A;  1H9W A;  5LBC A;  1GOH A;  5I8T A;  2GH8 A;  2W1Q A;  4P5H A;  4YVW C;  5F7U A;  5ACA 3;  1APN A;  4QPI C;  5HCA A;  3FN9 A;  4TSV A;  3MZH A;  4N9I A;  4KMQ A;  1OFS A;  4MGK E;  3X29 B;  5DUW A;  4QPG C;  4BMB A;  3VBR C;  1DZT A;  4C0H A;  3MIB A;  4XIK A;  4Q4W 2;  4S2G A;  4CDQ A;  5C8C A;  2HEV F;  5FO9 B;  2W1W A;  4GJY A;  4AL9 A;  4BB3 A;  4I3G A;  1R08 1;  3I2H A;  2VOK A;  3IIA A;  1AR8 2;  3BOW A;  4M4P A;  5A3N A;  2P37 A;  3AC0 A;  1UO9 A;  2XDV A;  3NAP A;  2FHR A;  4XUN A;  2WNU B;  1TME 3;  3CZJ A;  2B4K A;  3N4M A;  2R04 2;  2D44 A;  1XNC A;  3U4S A;  1MS0 A;  1LTE A;  3HN3 A;  1DQ6 A;  1OOP A;  3O0X A;  1K45 A;  1LED A;  2DFC A;  2OII A;  2RS3 1;  4BU2 A;  5IK7 A;  1SBF A;  1V6O A;  3AKT A;  5FP3 A;  1QJX 3;  4AI0 A;  4CDQ B;  1WA4 A;  5C8C B;  3IDC B;  4HVO A;  4LBQ A;  1MPX A;  4K9S A;  4HON A;  1FOD 2;  2BER A;  3VD9 A;  4JX0 A;  2QDR A;  4XCA A;  4IV1 C;  2X8K A;  1LB2 A;  3NAP B;  1GZW A;  1YHF A;  2HWC 2;  1RIT A;  1NUK A;  2JIG A;  1BJQ A;  1C5H A;  1W6N A;  1PO1 1;  3WVJ A;  3FUQ A;  1OOP B;  4XMA A;  4F8A A;  1UMZ A;  4QDR A;  1W28 A;  2JG9 A;  1LOG A;  4H3W A;  4NRO A;  3VZJ A;  3ZN5 A;  2WO7 A;  4BH9 A;  3SKJ E;  4DIQ A;  1OQ1 A;  5A3U A;  2YFU A;  5K4L A;  4LBQ B;  4P02 B;  1VAL A;  3WV6 A;  2VCM A;  2CDO A;  1RED A;  1MZ5 A;  1BK1 A;  1LGN A;  1O6U A;  4URT A;  4ZS2 A;  4CXW A;  2BWC A;  2NZ9 A;  3UES A;  1FOD 3;  2VW2 A;  3LDB A;  1VAV A;  1RL3 A;  1GZW B;  2HEY F;  1QJE A;  1NA1 A;  1ULG A;  2VOW A;  3H7Y A;  4DY3 A;  2VZV A;  5A33 A;  4UF0 A;  2IXL A;  2R06 3;  1O3Q A;  2HH9 A;  4RR3 C;  2PAM A;  1ODN A;  2HWC 3;  2D3S A;  4AK3 A;  3U4X A;  2BP6 A;  1JHJ A;  3N9P A;  3HPN A;  5FBZ A;  2JG9 B;  5I0T A;  5JLV A;  5FYZ A;  1PZ9 A;  4LBN A;  3T0D A;  2UWA A;  2TEP A;  1RXF A;  1U5X A;  5CAZ A;  2W2I A;  2DUP A;  2A6X A;  4QX0 A;  5LBB A;  2ZTN A;  3PUH A;  3HOB A;  2WII B;  2WYS A;  4NR1 A;  4M4R A;  1VLN A;  1NA1 B;  1W0O A;  1OQE A;  3FC0 A;  3PUI A;  3MUY 1;  4ONU A;  4NUB A;  4UF0 B;  5F8P A;  1PK6 A;  2EIB A;  2BFU L;  3NV3 A;  1ZBE 2;  2G9Z A;  3FLT A;  1UMI A;  2GME A;  2YY1 A;  3BOP A;  4XDO A;  1XSQ A;  3I3D A;  2RVA A;  2IXJ A;  1X82 A;  1QXJ A;  4N43 C;  4RGA A;  3J9S A;  4UFH A;  4YW7 A;  1EPZ A;  1W05 A;  3ACL A;  3Q8C A;  2Y33 A;  1W8H A;  2D6N A;  5FP9 A;  5SV5 A;  3VBU A;  3WF0 A;  3ZMO A;  2XJV A;  4XQD A;  3N7L A;  1R09 2;  3N9Q A;  3B01 A;  4O65 A;  1UYP A;  2PHU A;  1PK6 B;  2E32 A;  5JR7 B;  1RJ7 A;  1QJF A;  4A2U A;  1SFY A;  1US3 A;  5A7O A;  3OGS A;  2D98 A;  3ZPY A;  3MYX A;  3O1M A;  2IUW A;  4HVR A;  1ZBE 3;  4LKE A;  1MR5 A;  1ENR A;  2GN7 A;  4AZZ A;  3O1P A;  2CGP A;  4AR2 A;  4Q4X 1;  1UOG A;  2ZHL A;  3K3N A;  3F2Z A;  3WNM A;  4N7I A;  1F5F A;  4FXG B;  4IE6 A;  1CAU A;  4YVS C;  2G9F A;  3EYP A;  2W68 A;  3K4Z A;  3IBM A;  1UXX X;  5AC9 2;  4Y1Y A;  2GDF A;  1A34 A;  3W5M A;  2QQN A;  3BTX A;  4B29 A;  2QQM A;  3QOP A;  1Q8P A;  2VVF A;  4PLN A;  4O9E A;  1O91 A;  3VBU B;  3RZL A;  2O1Q A;  1AR9 3;  1VRH 2;  2WLP A;  4YM2 A;  2QQP A;  1RUG 3;  1LKN A;  1GZC A;  2LTN A;  5FK8 A;  5FY9 A;  4NIA A;  4FAH A;  1LES A;  5DAP A;  4D7T A;  2HWE 1;  1GAN A;  4TWT A;  4Q8L A;  5H9P A;  4YG0 A;  1CAU B;  1Q43 A;  2VY0 A;  3W59 A;  4CDQ C;  5F3I A;  4CUG A;  5C8C C;  1N3O A;  1YNA A;  5DAX A;  1RUC 1;  2VL4 A;  4BHP A;  4K20 A;  3MW3 A;  2V4V A;  5AC9 3;  5IUQ A;  3RYK A;  4AEK A;  1VPH A;  4OI2 A;  2ZKN A;  5K7P A;  4KH9 A;  4OYU A;  3PJQ A;  2WSV A;  3FFZ A;  2FZ2 A;  5IYY A;  1W0P A;  4CCJ A;  3AZX A;  2FDJ A;  1B35 A;  1PVC 2;  3QD6 A;  1V9U 2;  1LEM A;  1OOP C;  3AP4 A;  1DIW A;  1RUE 1;  1QGL A;  1UX7 A;  4IE7 A;  5J37 A;  1H4H A;  3HBK A;  5KXE A;  3RZH A;  1DGW X;  2VUC A;  4P14 A;  2YB7 A;  4LLF A;  4IEX A;  4BQ1 A;  2CWM A;  4BWO A;  4XF4 A;  4ET7 A;  3KS7 A;  2Q5T A;  5KC5 A;  3B69 A;  3IAP A;  1N3P A;  4GB3 2;  1V6I A;  4LA2 A;  4LIV A;  4QGM A;  4E2S A;  1RUO A;  1NX9 A;  2BUK A;  1KD7 A;  5CG8 A;  2ZGO A;  3RI8 A;  2YBP A;  3DXT A;  3ON7 A;  2GP3 A;  4KL1 A;  1W39 A;  2NQY A;  3PTY A;  1B35 B;  1AYN 1;  2VAU A;  1SDW A;  2OUJ A;  4E9K A;  4OCT A;  3SCG A;  3ZXK A;  2JDY A;  4LUM A;  4QX8 A;  4Y24 A;  2JG9 C;  2WFF 3;  3ZXL A;  2PEL A;  2A3Y A;  1EV1 2;  1ZRE A;  3QCW A;  1AR6 3;  1IS3 A;  1BZW A;  4DY5 A;  3BU0 A;  5L9B A;  1UU4 A;  4K6B A;  2IC1 A;  1Q56 A;  1DQ0 A;  1PMJ X;  3I2G A;  1IGO A;  2FZ1 A;  1E5I A;  4CDU A;  4NPM A;  2XKO A;  1Z7S 1;  4CU6 A;  5JOW A;  1CJD A;  1UL9 A;  4LHS A;  1FAY A;  4L0P A;  4OI4 A;  4YW2 A;  4AHW A;  4CCN A;  4FOW A;  1JYI A;  2Q1M A;  4COY A;  2DTY A;  3ACH A;  4Q4Y 3;  4ZZ8 A;  1RTV A;  4AFC A;  1LRH A;  5FO8 B;  3JBG 1;  2JIC A;  2YGM A;  4CCM A;  1N1Y A;  4AW7 A;  3WIN E;  4YLZ A;  1TMF 1;  4LIU A;  2XH6 A;  1QY4 A;  4S2D A;  5BNQ A;  5GJ6 A;  5KR7 A;  4WVV A;  3M3C A;  2R1B A;  4A44 A;  5CKN A;  1F5J A;  4LKD A;  3AM2 A;  5A6Y A;  4LIT A;  5FY8 A;  4CDU B;  3VBS B;  4YAR A;  4XAE A;  3O1S A;  1J1T A;  1D0G A;  1XJA A;  5CEH A;  2NLR A;  2WUH A;  1IQD C;  5FZD A;  4HK9 A;  4HK8 A;  1OI6 A;  3VKO A;  1QXR A;  2OKX A;  2BEO A;  3IDA A;  2D97 A;  4OI0 A;  1UXZ A;  4YW3 A;  2XKP A;  1GZT A;  1VP6 A;  2PN5 A;  1HIX A;  5EPA A;  1SCR A;  4Q0S A;  3GJA A;  3O1U A;  1W2A X;  5A6Q A;  1CES A;  3AP9 A;  1NCR A;  3LEI A;  4K1Y A;  5HBA A;  4NJ4 A;  3VBU C;  2PHL A;  5LAT A;  2WLQ A;  1RHI 2;  4LK7 A;  4XF1 A;  4P9W A;  5JSP A;  3JD7 1;  2VTF A;  3C2U A;  4M3C A;  4QD2 A;  3III A;  1JOD A;  3W21 A;  1W8U A;  2HKX A;  3UYJ A;  2VW0 A;  2DVA A;  3I59 A;  3TN9 2;  5C9A A;  3T2T A;  4YG6 A;  4JQR A;  5JSR A;  2GMM A;  5ABJ C;  2G4I A;  2QNK A;  4XHB A;  3THD A;  1MQT B;  1NCR B;  1OQD A;  2ADD A;  2HYX A;  4OI1 A;  3VD5 A;  5DPN A;  3OY8 A;  5JZG A;  3BKZ A;  1G9F A;  4YWA A;  2VPV A;  1OH4 A;  2VNO A;  5FZH A;  1KJR A;  2ZGN A;  1K5J A;  2IXI A;  2BW8 A;  2ZEY A;  1RHI 3;  3N9L A;  5J98 B;  4A7Z A;  5C33 A;  2RS1 2;  2Y6F A;  5LEK A;  4M3C B;  4Q27 A;  2HWD 1;  1BXH A;  3ZPO A;  2YBS A;  4FPC A;  4TLF A;  3GAL A;  3WG2 A;  3I59 B;  4WM8 C;  5C9A B;  2VJX A;  5FYM A;  5FDB A;  3HNY M;  1YC6 1;  3NNG A;  3WZ1 A;  2OUH A;  5EYX A;  5A1L A;  3OF1 A;  4NO4 A;  3OUI A;  4QX3 A;  4AI1 A;  3OY8 B;  3IN9 A;  1HRI 1;  3PVO A;  1JUI A;  2E7T A;  2CWS A;  4KG8 A;  5JZG B;  5D8A A;  2VZT A;  4NHM A;  1QKQ A;  4H2A A;  1EYB A;  2D40 A;  1WBF A;  4AXO A;  1KEX A;  3NJX A;  2PQS A;  2RE9 A;  1BK0 A;  4Q4V 2;  3B5L B;  5GM0 A;  5FPA A;  1G9A A;  1BBT 1;  3O1O A;  1B35 C;  1UW8 A;  2RS1 3;  5J48 A;  5FPV A;  2QQW A;  3VZO A;  5L36 A;  3WCS A;  2P6C A;  3KF5 A;  4QWN A;  1NT0 A;  5EHD A;  3SCH A;  1XQN A;  2WNV B;  5FZ6 A;  3KT1 A;  4HG6 B;  1H8T A;  3R05 A;  5FPL A;  4XYX A;  1AHS A;  4RHV 2;  3DCQ A;  1ND3 A;  2A3X A;  3USU A;  2FDK A;  1O59 A;  2NMO A;  3MW4 A;  4YZ3 A;  5D8A B;  3WQB A;  5ERL A;  2CSG A;  2JKX A;  3HWJ A;  3VBH A;  2QTW B;  1D4V B;  1DYO A;  1AYM 1;  3WDV A;  4Q8K A;  2WT2 A;  2WNE A;  3LQC A;  1YFY A;  1NCQ A;  1QQP 3;  4Q4V 3;  2R6Q A;  4RN5 A;  5F3G A;  5FPZ A;  2XL7 A;  4L97 A;  3P3P A;  4RL7 A;  3TAY A;  5KXB A;  3I54 A;  5CIR A;  1W2T A;  5L9R A;  1H8T B;  3T08 A;  2AR6 A;  1O5U A;  1MS8 A;  3E6C C;  3ACI A;  3AKS A;  4UOJ A;  3WF3 A;  4GIQ A;  2P3J A;  4J6G A;  5K8S A;  4FVV A;  4I0B A;  5JXI A;  3VBH B;  1QF3 A;  1NLQ A;  4IL7 A;  5JDB A;  2ZPX A;  1PO2 1;  3ZYB A;  3RZM A;  2GSY A;  1DBN A;  1PGW 2;  4F7Z A;  4Q0U A;  4LOT A;  2JIJ A;  3ZXA C;  1NCQ B;  3LSE A;  1CX1 A;  3AJZ A;  1DGW A;  1AL0 G;  1JOP A;  4JGY C;  1LOB A;  3KHC A;  4G4F A;  2ZS6 B;  4F3J A;  4QHB A;  3CIH A;  3ETP A;  4LT5 A;  1W2O A;  4IND A;  4B7E A;  2R7E B;  1QJY 1;  3NRU A;  4FBF A;  1RUI 1;  4HN0 A;  1DF0 A;  3DXU A;  3ACF A;  2XL9 A;  5ABJ A;  2X10 A;  4UFL A;  2NPI A;  3IKW A;  2FDF A;  1JI6 A;  4AE2 A;  3M1H A;  5C3O A;  3KLS A;  5F2W A;  4BQY A;  5EZW A;  1UZY A;  4GA9 A;  1QMJ A;  1ASJ 2;  2VBB A;  1VE0 A;  1DGR A;  1NE6 A;  2D5F A;  3V0B A;  2LRO A;  2G1M A;  2QVS B;  1QNW A;  3VBF A;  2JKB A;  4CP9 A;  4UXA A;  1W9S A;  4DMI A;  4YGB A;  4NPL A;  2P1B A;  1LOF A;  1HB3 A;  1NCR C;  3KT7 A;  5ABJ B;  2HWB 2;  2IZW A;  4FFI A;  4E2Q A;  3CZU A;  2Y6K A;  5ANN A;  4AHZ A;  4XUT A;  1RMU 3;  4IV3 C;  2J1V A;  5DDJ 2;  4EWA A;  2VD7 A;  5A1A A;  2EIC A;  2DYC A;  4JV4 A;  1FYU A;  2YU1 A;  2YC2 A;  3V0B B;  1H2N A;  4Y33 A;  1ASJ 3;  5FY7 A;  1WA6 X;  4DXZ A;  1ZZ9 A;  2VZO A;  2VZP A;  5FMO S;  1AXZ A;  5FKB A;  1DGR N;  3VBF B;  1SLC A;  4CP9 B;  2DFB A;  1AX0 A;  3AX4 A;  2CV6 A;  1AR7 2;  2OZJ A;  4K7J A;  4CEY C;  5IVE A;  2FDI A;  5CFD A;  4QAW A;  4WVZ A;  2FD8 A;  1EY2 A;  4AFD A;  5JZG C;  3MUZ 1;  3ZKU A;  2Y6L A;  3DEM A;  1EUU A;  5J96 B;  3WP6 A;  3ZXG A;  2C1F A;  2KXL A;  1QDC A;  2PHF A;  5FYB A;  1BMV 2;  3I2J A;  3JQW A;  2EAA A;  3EJK A;  3ZIX A;  2BBA A;  3CJI A;  2Z5W A;  4AVB A;  2WT1 A;  3WDU A;  3WUC A;  4XVH A;  1ZYB A;  5IVB A;  5IVV A;  4DB5 A;  1HJF A;  1WCQ A;  3E97 A;  4K3U A;  5I8Y A;  1SQ4 A;  5CFD B;  3TYJ A;  3HD8 B;  3RFR A;  4HXC A;  1AR7 3;  2VCB A;  3FE5 A;  3LEG A;  4C0B A;  1AUY A;  2A5Z A;  4KQ7 A;  2A1X A;  4MHU A;  1Y7B A;  5IWF A;  3WNK A;  1RUH 1;  3T0A A;  5LCW L;  3CJI B;  3S7I A;  2H6C A;  2WZR 3;  1X50 A;  1H1M A;  2W0X A;  5BY5 A;  2BBV A;  3K2O A;  4UFJ A;  3H8O A;  2JDZ A;  1C8M 2;  1JMU B;  4QQO A;  4HN1 A;  4IXL A;  1US2 A;  1VAM A;  3D8C A;  5FZC A;  3SH4 A;  4AI3 A;  4E4H A;  3IAQ A;  1DGL A;  1DYP A;  4JGZ C;  1RUF 2;  1L3J A;  1CAW A;  1G6N A;  1ND3 C;  4N53 C;  1ONA A;  3JD7 3;  5FZ8 A;  4Q26 A;  5DAQ A;  2DVG A;  2J1U A;  3LDK A;  4FOQ A;  1T6G C;  4HKL A;  3AB0 A;  4KU7 A;  2VBD A;  1F4A A;  4MAD A;  3UJQ A;  1NCQ C;  3AJY A;  3Q8B A;  4YSF A;  4GWM A;  4A3X A;  5DUU A;  3THT A;  3K46 A;  1KDM A;  2W87 A;  3D5O A;  1C8M 3;  1VBE 2;  3IZO A;  4LTA A;  2R49 A;  2ZGR A;  2A6V A;  3AYE A;  3OBZ A;  3ZXE A;  2VMC A;  3LEK A;  1RUF 3;  1AZD A;  2HWD 3;  1N1V A;  2MPF A;  1CAX A;  4XFF A;  4BIF A;  4QPY A;  3ETQ A;  2JDU A;  1NY7 1;  4ZHN A;  3R4S A;  3OGV A;  4Q4W 1;  4WVW A;  1XC6 A;  4M0N A;  3TBD A;  1MS3 A;  2GH2 A;  4B4P A;  2XLG A;  1A8D A;  3POF A;  4D7S A;  1YFU A;  3VL8 A;  1JZ4 A;  1C1L A;  1OFN A;  3AYC A;  4GKY A;  1GV9 A;  1OBN A;  4NIG A;  1J3P A;  2O14 A;  1UIK A;  3M3E A;  2R04 1;  4XBL A;  2ZBJ A;  3KV5 A;  5DZE A;  3OYW A;  1URX A;  5EFU A;  1CJP A;  1JTZ X;  3LAG A;  1CAX B;  3NWK A;  1LR5 A;  3J8F 1;  3OG2 A;  2XB6 C;  4XF3 A;  1XNB A;  3KB5 A;  4V1P A;  5IAX A;  4JKL A;  1JBC A;  3VBO A;  3WSO A;  1T2X A;  2ZZQ A;  3M7A A;  5FP8 A;  1RVF 3;  4BE3 A;  1GNY A;  1VBD 2;  4CP2 A;  2HWF 2;  3OPW A;  4HL0 A;  5JIU A;  3JXS A;  1KIT A;  5L9V A;  3K51 A;  3PIG A;  4FQZ A;  4NHY A;  4TYS A;  1STM A;  5A7W A;  1WKY A;  2W3J A;  1D2S A;  2E63 A;  1JS9 A;  3ILN A;  4QT6 A;  4URA A;  4Z2A A;  5JPM B;  1AYM 3;  1MZ6 A;  3H42 B;  3KV9 A;  1NKG A;  2ZEZ A;  4QDQ A;  3SQO A;  3W58 A;  2ET1 A;  1IQA A;  3ZYJ B;  3UNP A;  3VBO B;  2VVE A;  2X5I A;  4LUL A;  2DV9 A;  1WMX A;  5F5A A;  1HB2 A;  3O12 A;  4KI5 M;  2Q4S A;  3WY6 A;  4CDX A;  4NIH A;  4QHZ A;  3VGI A;  4DNY A;  3WUD A;  5A7W B;  3LPF A;  5EJZ B;  1VBB 2;  4QQH A;  3ATG A;  2HWF 3;  2DU0 A;  3WDT A;  4GWI A;  3H1W A;  3N7K A;  4L9B A;  5K0U A;  2DCY A;  5FIX A;  1TQ5 A;  2P3Y A;  4BQ5 A;  3ELN A;  3PMS A;  2WQZ C;  5BNP B;  1FMD 2;  2ARX A;  2AEZ A;  3NL1 A;  1ULF A;  5LBE A;  5LRS A;  4DIN B;  1Y43 B;  5FLI A;  4LO6 B;  3HVD A;  4ZKT B;  1W03 A;  2ZMK A;  1OUS A;  1JYX A;  2JDA A;  2X5I B;  2Y34 A;  3NNF A;  5IVY A;  1CZV A;  1EAH 2;  4A41 A;  3ZSJ A;  4FPK A;  4QGL A;  1QJU 2;  2VEC A;  4B3N A;  1UZZ A;  4CDX B;  5I93 A;  1SPP A;  3H3L A;  3TEW A;  5IK5 A;  2ZA9 A;  3I2K A;  4XBQ A;  3I97 A;  4PIY A;  2VZQ A;  1IKQ A;  1WLT A;  3I49 A;  2HEW F;  3O5S A;  3KV4 A;  1D0H A;  2XLA A;  2YPD A;  4W4Z A;  2SBA A;  3PVB B;  2JEN A;  5CA6 A;  2WWS A;  1GP6 A;  1UD1 A;  1O8P A;  2DDU A;  2DUO A;  1PGL 1;  5EYY A;  5C6C A;  1VBC 1;  4KWK A;  5A3W A;  1H1I A;  4Y1Z A;  1IS4 A;  5GZC A;  2WZ8 A;  4PDW A;  4Y3O A;  1SPP B;  2W08 A;  1KS5 A;  2PLV 2;  1UQX A;  2QQV A;  4FPF A;  1I3H A;  4XFB A;  5FXZ A;  1R09 1;  1X9T A;  1CQ9 A;  1VRB A;  5A1F A;  1GZ9 A;  4HZF A;  3UGG A;  4GMP 1;  4LKS A;  1C1F A;  1R1A 2;  2JX9 A;  4QX1 A;  2XVL A;  3BGA A;  3D4K A;  2W46 A;  1J58 A;  1UNB A;  3TRS B;  3LSD A;  5ACA 2;  1QIQ A;  4AI2 A;  1CZS A;  5FMB A;  2J1R A;  4PDW B;  1RUN A;  4ZU7 A;  2C24 A;  3OPZ A;  3P6B A;  1QWR A;  4IEV A;  1VRH 1;  4SBV A;  1UKG A;  4UW3 A;  2UY9 A;  4FTB A;  2WL1 A;  4BLI A;  4MSV A;  4QXC A;  4NAM A;  2BZD A;  3NJY A;  3LOB A;  4FOV A;  1SLI A;  5CNA A;  1YQ2 A;  4AEM A;  1TME 2;  3RJR A;  3WCR A;  1R1A 3;  2A70 A;  3ZOI A;  2L9L A;  1XSR A;  3ZFG C;  4AI9 A;  3G7D A;  3R4D B;  1GKB A;  3HJR A;  3PJY A;  1QJX 2;  1IG3 A;  4XIO A;  2E31 A;  3M70 A;  1S0G A;  4QQ2 A;  2ZAB A;  3A4U A;  1UPS A;  4EYU A;  5JI9 A;  5ISL A;  2NMN A;  3IDB B;  3O14 A;  5FYY A;  1V9U 1;  3ZLI A;  4XXA A;  3GBW A;  3UET A;  4HOO A;  1PNF A;  3MF6 A;  4UI9 L;  5JWP A;  3GHM A;  3WP4 A;  3S30 A;  4RYD A;  1I6X A;  3RZG A;  4PJY A;  1OPO A;  1VAK A;  1RYY A;  2XJR A;  2QUO A;  3S7E A;  4Y1X A;  3PDQ A;  4LEJ A;  2VMD A;  1GOG A;  4KBZ A;  2VVD A;  1COV 2;  4GB3 1;  1OKO A;  1SBE A;  2LUW A;  4OZO A;  1VB2 A;  2B7Y A;  3AYA A;  1OPM A;  2B8M A;  5B4N A;  3AP5 A;  1L7L A;  2IVI B;  1CD3 G;  3ORJ A;  1CAV A;  2CU5 A;  5IT6 A;  4JRL A;  5I0U A;  2GMP A;  2O0O A;  3C7E A;  1PZ7 A;  3R4U A;  2Z42 A;  3VDB A;  3OUH A;  1BEV 3;  1KDK A;  2R06 2;  1MEC 3;  3BPZ A;  4BQW A;  1EV1 1;  1HXS 3;  1UYZ A;  3FJS A;  4RFT 0;  1FNZ A;  2X5I C;  5F39 A;  2D6L X;  1X9P A;  4XAC A;  3HNB M;  3ZFE A;  1JZ8 A;  2GC3 A;  3POW A;  1MZF A;  1W2N A;  1F2N A;  2CAV A;  4FPY A;  2BPA 2;  2D6P A;  2RM2 3;  4I01 A;  1S0C A;  1UY0 A;  1COV 3;  5K0U C;  2ZGS A;  4ES9 A;  4XF0 A;  5BNO A;  5DG1 A;  1CAV B;  4KGQ A;  1ZBA 1;  5F37 A;  3POG A;  4CXY A;  1JYT A;  3SIT A;  5IAV A;  5BUV A;  1BYH A;  3WNX A;  5F3C A;  1RUD 3;  1S55 A;  1ALY A;  1OVS A;  4LBQ D;  4FI9 A;  2ZZJ A;  2Y6J A;  2JD4 A;  2Q8C A;  1WUV A;  1ZM1 A;  1OUR A;  2ZAA A;  3MEP A;  3RS6 A;  1QXP A;  3ZFE B;  5FZA A;  1CZT A;  4QXB A;  1JYV A;  1AL2 1;  4ZU4 A;  4YW6 A;  4LR4 A;  3ZR6 A;  2UWB A;  4Q5O A;  3WNN A;  4OFG A;  2EXI A;  1DLL A;  2ZKL A;  3PNA A;  5BNO B;  1G9B A;  1PNG A;  4LPL A;  1FX5 A;  2XOM A;  3ZKY A;  4CSW A;  3INA A;  2W94 A;  1GBG A;  1IPK A;  1PGS A;  2PYT A;  2EAK A;  4LHN A;  3OOX A;  1W04 A;  1LHW A;  4D8M A;  2ZGL A;  5FWE A;  4A3Z A;  1G86 A;  1FXZ A;  3UV9 A;  1V6J A;  4K8R B;  4XF9 A;  3WW4 A;  1VJ2 A;  4A42 A;  4BCU A;  2YYO A;  2AZ5 A;  4XUR A;  1VMF A;  4UW4 A;  2LS6 A;  4AFB A;  1D4M 1;  1WW5 A;  2VQA A;  5GAL A;  4CCL A;  1XNT A;  2ETE A;  4MYE A;  2YMZ A;  2A75 A;  4TXW A;  1AR9 2;  3HQR A;  4D94 A;  5JSO A;  1YI9 A;  1UY4 A;  3UJO A;  1SFP A;  1RUG 2;  4H7L A;  4BZ4 A;  4XUO A;  1HN0 A;  5A7P A;  4CYD A;  1WCK A;  3FLR A;  4ZXK A;  4GMP 0;  2WAA A;  3MLJ A;  4FPJ A;  1OF3 A;  2ES3 A;  1VBA 3;  3P3N A;  3GYD A;  5JOZ A;  5EV7 A;  4GWN A;  3N9O A;  4WZF A;  3OUJ A;  1LGC A;  3R6S A;  2BYV E;  2YDE A;  2RMU 2;  5T55 A;  3NJV A;  1WZX A;  1QEX A;  2I45 A;  2ADE A;  2X09 A;  2HLE A;  5DAW A;  4MGI E;  5C3Q A;  4JCK A;  2JE8 A;  1TNF A;  2WNU C;  2VNR A;  2DCJ A;  2JE7 A;  2MEV 3;  2VOX A;  2ET7 A;  1OLM E;  1JZ2 A;  5C70 A;  2VTX A;  1GWM A;  4QB2 A;  3U10 A;  4OQ8 A;  3CLP A;  2OQ7 A;  5F2S A;  2JEM A;  1HJG A;  4CA9 A;  5A3P A;  4W6X A;  5ANQ A;  4MGT A;  3FUO A;  2WT0 A;  3MLL A;  5FUP A;  5T52 A;  2ZGM A;  3NW4 A;  1OLR A;  1H9P A;  1JYW A;  1CGP A;  4HT1 T;  3B93 A;  4XUQ A;  5E1R A;  2Q8E A;  1UOJ A;  2Y64 A;  3OGR A;  2C6S A;  2P4E A;  4HAN A;  1SBD A;  1Q8V A;  2RMU 3;  5CFC A;  1AF9 A;  5FTT C;  3NAP C;  3I2I A;  1LHO A;  1WW7 A;  1YJL A;  1FPN 1;  4BXF A;  4RHV 1;  1S0J A;  2WFF 2;  3DN7 A;  1F15 A;  4LJH A;  4XFA A;  5IVJ A;  1GWL A;  1FNY A;  2PAK A;  4FFF A;  1AR6 2;  4X6Q B;  2GP5 A;  2W9X A;  3T09 A;  4GMP 3;  5DAB A;  5EXO A;  1HRV 1;  4RQP A;  4YW4 A;  2KA3 A;  4CZS A;  4QXK A;  3Q8A A;  3I3B A;  5APA A;  1A78 A;  3OCP A;  5LA9 A;  5C7G A;  4OMD A;  3B3Q E;  5CFC B;  2WS9 1;  1Z78 A;  1W6O A;  5FP4 A;  2CYF A;  3WG1 A;  5J7M A;  4Q4Y 2;  5FK7 A;  4CXX A;  1CIY A;  1ZZ8 A;  2W92 A;  1GNZ A;  4DPN A;  2V5Y A;  4LKF A;  3I2F A;  5A3T A;  3WW1 A;  2Z69 A;  2Y26 A;  1HB4 A;  2UYB A;  1UX6 A;  3W20 A;  4HLT A;  1AVB A;  5CKQ A;  5B4X A;  1S0I A;  3E1F 1;  3RRD A;  3U0Z A;  2E53 A;  3B94 A;  4QDS A;  4RQP B;  5BNO C;  1KXG A;  2BVV A;  3T3Y A;  4MUV A;  2D3R A;  5CKM A;  3MHZ A;  1XND A;  1UOB A;  1XU1 A;  4DS0 A;  5M0T A;  3VBS A;  4AED A;  1W6O B;  2ZAH A;  4L8Q A;  4PHZ A;  2XJT A;  1J59 A;  2RS3 2;  1NA1 C;  2E51 A;  2WZE A;  3H7J A;  2XHN A;  3BTZ A;  5L7O A;  3MBW A;  3B02 A;  2LM3 A;  1ULE A;  2ZX2 A;  3I2O A;  1PIV 1;  2XVK A;  3FBM A;  2E6V A;  3DPR A;  1WMF A;  4CVU A;  1W0N A;  3MFC A;  3JZV A;  3PIJ A;  3VB9 A;  1R08 3;  3IMN A;  3ZYF A;  5A32 A;  1H8V A;  1HQW A;  3KHB A;  3NST A;  2WO2 A;  1F31 A;  2RHP A;  5IK4 A;  3NJZ A;  1GYK A;  3ES4 A;  4AED B;  4DXR A;  3W5N A;  1SAC A;  3AMQ A;  4BIO A;  1PK6 C;  1AJK A;  1JUH A;  2RS3 3;  2N7G A;  3SC7 X;  5L7O B;  3SKV A;  2BGC A;  2HWB 1;  3LA2 A;  2XBO 1;  4JAA A;  1JYC A;  5HCF A;  1MAC A;  5IK8 A;  3DPR B;  2CGN A;  3J4U H;  1HQL A;  3K75 B;  4PLO A;  4CU7 A;  4MGQ A;  5FPU A;  3LF7 A;  5E8A A;  3LGR A;  5A32 B;  1MQT A;  3PUQ A;  2EIG A;  2JD9 A;  2P3I A;  3AL5 A;  4LO7 A;  4YZ4 A;  2JEC A;  1V6M A;  2ARC A;  1QH7 A;  1YUD A;  5FZB A;  4HPK A;  3D6E A;  2BNO A;  2W52 A;  1PO1 3;  1JHN A;  1M4W A;  4NRM A;  1VR3 A;  3BN6 A;  3MPP G;  5BPX A;  3K4D A;  1YRZ A;  2Q8O A;  3ZYP A;  1VIW B;  1UN1 A;  2XQR A;  4J25 A;  4RS5 A;  3GNE A;  1FV2 A;  4DUV A;  3D3A A;  2XWJ B;  5HCH A;  1ENQ A;  4YGE A;  2FMY A;  1UY2 A;  3MIF A;  1ZZ7 A;  4Q2F A;  2E26 A;  2EXK A;  3VN4 A;  4D6Q A;  4AOC A;  4QU2 A;  4GXL A;  5FYI A;  3VKL A;  2E7Q A;  4YRD A;  3ZSL A;  1J84 A;  4HPK B;  2JB4 A;  1C5I A;  4B8E A;  5DN2 A;  4BOW A;  2RS5 1;  4LMF A;  2DVB A;  2QQJ A;  2DBN A;  1SZB A;  3ST7 A;  1Q8S A;  2JB8 A;  3BIW E;  3BUC A;  4RS5 B;  3SHR A;  1CVN A;  5FYS A;  2VR4 A;  2QZ2 A;  2HJI A;  4XTM A;  4YYO A;  2ZAC A;  3ZM8 A;  4C1W A;  4NHK A;  2ZGU A;  2WNV A;  4A7K A;  1GQG A;  1N47 A;  4B7K A;  2RR1 1;  2FMD A;  1RUJ 1;  2YRO A;  3NNL A;  4FXK B;  2OW4 A;  1OC1 A;  1YIP A;  4K40 A;  5CB7 A;  5FWJ A;  1W2U A;  1FI2 A;  2PQQ A;  2OT7 A;  3Q8E A;  5FZE A;  4IDZ A;  4QKF A;  1QQP 2;  4OHX A;  3HT1 A;  1YEW A;  4Y20 A;  3V65 A;  5CIS A;  2E9Q A;  4P9J A;  1A8M A;  3VZL A;  5GZE A;  4DRR A;  2G9G A;  3E6D A;  5FR3 A;  1GUI A;  1ND2 A;  1QOS A;  4JDN A;  2D93 A;  1NZI A;  1POQ A;  2BV4 A;  4OHV A;  4R8H A;  1UWW A;  4C1X A;  4LUK A;  3AXD A;  4B1M A;  2VOT A;  3NNM A;  4QXH A;  2NM1 A;  4GZ9 A;  2F6B A;  5IJR A;  4Z2W A;  3RPQ A;  4DO0 A;  4YZ2 A;  2Q1Z B;  1DQ5 A;  2EA7 A;  2UY8 A;  3OBA A;  4RA0 A;  1ULC A;  4Y20 B;  5K9Y A;  3S5A A;  2LAL A;  1VBE 1;  2F17 A;  2GND A;  4Q4X 3;  4M00 A;  2V72 A;  5E88 A;  4AGV A;  3CDZ B;  3L2H A;  1O4Z A;  5H9S A;  4L11 A;  1ND2 B;  4FP2 A;  3VZK A;  4OQ9 A;  3K48 A;  3DGT A;  3VKN A;  1U5Y A;  5A7Q A;  3FWE A;  4IGP A;  3KWV A;  2JG8 A;  3POJ A;  1GIC A;  4L99 A;  3G6J B;  4PBO A;  5FYV A;  5HXM A;  1CR7 A;  2LW8 A;  2QCS B;  3S6P A;  2W1S A;  2R16 A;  4ASK A;  3LB9 A;  4CDU C;  3VBS C;  4E27 A;  1RUE 2;  3HT2 A;  2VZS A;  2I07 B;  2HWE 3;  1NXD 1;  2XJS A;  3DYP A;  1W9W A;  3SH5 A;  2WAB A;  1HV1 A;  1LEC A;  1PM4 A;  3E6B A;  1ZVF A;  4KG0 A;  5KHG A;  4FT8 A;  3M3Q A;  3DPR C;  1RUC 3;  4LO5 B;  2GC0 A;  2JG8 B;  2Q1F A;  3WF2 A;  4JDO A;  4AHX A;  3T2Q A;  4BDV B;  4COU A;  1C4R A;  1O4Y A;  4XMI A;  1RMU 2;  5GKA C;  1N1S A;  4E4Z A;  1CPN A;  3AMN A;  3AP6 A;  1JZ3 A;  1ZRF A;  1ZA7 A;  2ZGQ A;  3PUR A;  1FAT A;  1VMH A;  3WQ7 A;  1W6Q A;  2VBP A;  1S0F A;  5FJH A;  4CUC A;  1RUE 3;  1SLL A;  4IER A;  1NLS A;  5LA1 A;  3S0M A;  1UU6 A;  5LY1 A;  3ILF A;  3WF4 A;  2D43 A;  3ZSK A;  2W5F A;  4IEO A;  2BVB A;  3EXU A;  2CGO A;  4YW1 A;  1C57 A;  3HR9 A;  3SIS A;  1C8N A;  4M3C F;  3WQ0 A;  4YNI A;  4DEV A;  2ZEW A;  4YGC A;  1Z7S 2;  4ERO A;  4UW6 A;  4XCB A;  1DZR A;  3KVB A;  1MQT C;  2WAO A;  4BM8 A;  2WS9 3;  4LBM A;  3SEP A;  4MXV A;  3VZN A;  1NQJ A;  5DZF A;  1K42 A;  3SXW A;  3JBG 2;  3H3U A;  3ZSM A;  5BV6 A;  1AYN 3;  1W6Q B;  1VBB 1;  3FL7 A;  4EN6 B;  2D5H A;  1SG3 A;  5DG2 A;  3H8R A;  5FZ1 A;  1W3V A;  4XEZ A;  3HMY A;  4GJZ A;  4NII A;  3AVR A;  4RS5 C;  2YC0 A;  4Y1V A;  3O0V A;  1FMD 1;  4QKD A;  5C9A C;  4IUG A;  3FZ3 A;  2XJQ A;  3OBR A;  5D1I A;  4NHL A;  5FZ0 A;  3VV1 A;  3PU8 A;  4ZON A;  3E5U A;  1POV 1;  2R07 1;  5HXV A;  5DQ0 A;  3WXP A;  3EQE A;  4E8D A;  5HPO A;  1Z7S 3;  2GAL A;  1EAH 1;  1PVX A;  2OQ6 A;  2ZJC A;  3AZY A;  3LFI A;  1QJU 1;  1G7Y A;  4V2W A;  4XDP A;  1SEF A;  1XXN A;  5IFT A;  2AEY A;  2OVU A;  2I74 A;  5L73 A;  3MW2 A;  2WZR 2;  3JBG 3;  3N9N A;  4GWJ A;  1PIV 3;  3J26 N;  1WMD A;  4OZX A;  5F32 A;  3QLQ A;  4KWJ A;  5A7S A;  1TMF 3;  3OD0 A;  3GCX A;  3IT8 A;  5FY1 A;  1OA2 A;  1EUT A;  1NQD A;  3I8T A;  3K4A A;  3VD3 A;  1E5R A;  1JOB A;  2CTV A;  3U11 A;  4R4Z A;  4Q1P A;  2PHT A;  3LDR A;  2WNV C;  1FV3 A;  3LA3 A;  4AVS A;  1QHD A;  3JD7 2;  4DRV A;  5JMO A;  4I2O A;  4NHX A;  4WZC A;  4RD7 A;  5D8A C;  3T30 A;  4C91 A;  4BXS V;  4TZD A;  2IXC A;  2PLV 1;  3AFK A;  1W6P A;  1ZNP A;  4M01 A;  4ZU5 A;  3U07 A;  2BDR A;  2XBO 3;  1ZX5 A;  4I09 A;  5CG9 A;  4Q0Q A;  2DU1 A;  4TLG A;  2QQI A;  5GLZ A;  1IPS A;  5HCB A;  2YUE A;  4ITC A;  2GC1 A;  5CU1 A;  3CHX A;  1C28 A;  1OT5 A;  5DUV A;  3FHI B;  2GC2 A;  4FFH A;  5I91 A;  4CP0 A;  1W90 A;  3K3O A;  3THC A;  5DMY A;  1UZ0 A;  4H55 A;  1H8T C;  1R1Z A;  1S2E A;  3GM8 A;  3J7H A;  4QPW A;  3SLI A;  3W9A A;  5ACA 1;  2HWD 2;  1WD3 A;  2KR2 A;  3C8X A;  3Q8F A;  5FRA A;  3VHN A;  3VBH C;  4E8C A;  1W6P B;  4JVA A;  2ZHM A;  4MET A;  1OMI A;  1SLA A;  3H1M A;  3KQR A;  5FQ0 A;  1H6Y A;  2AYH A;  5E89 A;  4B4R A;  3AMM A;  3JCI A;  5GLT A;  1HRI 2;  2ZX1 A;  4IGQ A;  5FZM A;  5I8S A;  2VME A;  4EZ4 A;  3WD5 A;  4CP1 A;  1TME 1;  1WLC A;  3T4H B;  1LOD A;  2FCT A;  1I5P A;  3GDB A;  2YBK A;  3IDE A;  4FP3 A;  1GOF A;  1W3X A;  1MS5 A;  1REE A;  1BBT 2;  3AMH A;  3KV6 A;  3KCX A;  4EWD A;  4DUW A;  3I7D A;  5BNN A;  1YO8 A;  1TZO A;  2ARA A;  4CDW A;  5G05 L;  3A22 A;  4IES A;  1QJX 1;  4XTP A;  5T3N A;  2WFP A;  4XAB A;  2BWA A;  2F4P A;  1RVF 2;  5FQ0 B;  3T0B A;  1Y9Q A;  2WO1 A;  4Y4R A;  3SEE A;  1DQ2 A;  5J09 A;  3AZZ A;  4OUS A;  5FYC A;  4EN0 A;  4EZH A;  3T4V A;  4XJU A;  1XOY A;  1RUJ 3;  4XIL A;  1HRI 3;  2HBU A;  5CVR A;  4ASL A;  1AR8 1;  5T50 A;  3JQX A;  1JZ6 A;  1AYM 2;  5FZF A;  3LFM A;  2VQU A;  3PU3 A;  5L19 A;  1VMJ A;  4I0A A;  4HVQ A;  5BNN B;  4CDW B;  3SMH A;  1CN1 A;  2C5D A;  5FOB B;  1BBT 3;  1WCU A;  1H6X A;  3MIE A;  3I3M A;  1TE1 B;  3BPS A;  4J1X A;  1H2L A;  1OKQ A;  5J3U A;  1X36 A;  5G04 L;  3TB0 A;  1LNS A;  3GZU C;  3O1V A;  4Y5S A;  2XJU A;  1YLL A;  3MLK A;  1FOD 1;  4FPE A;  5FYH A;  4YVW A;  3D0J A;  3L9J T;  4BQ4 A;  3MV0 1;  4QPI A;  5IHR A;  1AX1 A;  3KMH A;  3VBF C;  2R06 1;  3POI A;  3KCC A;  2P5B A;  1JW6 A;  4AFA A;  2HWC 1;  1LOF C;  4QPG A;  4ISR A;  3VBR A;  4Z07 A;  5TSW A;  1V6L A;  2IVJ A;  1NLR A;  2WA3 A;  2ZGP A;  3POS A;  4NAO A;  5A6Z A;  3ACG A;  2VMI A;  3GXU A;  3LIG A;  5BNP A;  5I0D A;  1S0E A;  4E4D X;  4W8J A;  5JR2 A;  4OUM A;  1V70 A;  5FZL A;  3S5Q A;  3ZDS A;  5CZK A;  5FRE A;  2VW1 A;  4EJR A;  3WG3 A;  2ZEX A;  4GAL A;  4Z8B A;  3M4F A;  1SLB A;  3V56 A;  3A0K A;  1QJY 2;  2EXJ A;  5EJ3 A;  3WNO A;  1DP0 A;  4CCK A;  3LEM A;  4JTN A;  1OD5 A;  4P9Y A;  4YVW B;  2VH9 A;  3PVN A;  5AFB A;  2Z2S B;  4QPI B;  3KQ4 B;  3CNA A;  4FCA A;  1UZV A;  1V6K A;  5H9Q A;  3TEX A;  1UKR A;  4ATF A;  2RV9 A;  2VO5 A;  4QPG B;  5JPN B;  4IW3 A;  3VBR B;  4AAX A;  5CFD C;  2PHX A;  1XYN A;  2P6H A;  1WD4 A;  1PO2 3;  1W8W A;  1YQ5 A;  4IEZ A;  3D82 A;  4Y26 A;  3DF0 A;  4FOY A;  4ASM B;  1JZ7 A;  4CUA A;  1AXY A;  4XZP A;  4CU8 A;  4IEQ A;  4A6O A;  1W8F A;  4BA6 A;  5C5U A;  2VZ3 A;  3EO6 A;  1NYW A;  3MI8 A;  4IV1 A;  5AVP A;  3DYO A;  3NVC A;  4YG3 A;  3CJI C;  1RB8 G;  2XXZ A;  2JDP A;  1YI7 A;  3AYD A;  3MIC A;  5FXX A;  1QJY 3;  4F83 A;  1AJO A;  1RUI 3;  3I3E A;  1J83 A;  3ZN4 A;  2D6O X;  3SNM A;  5F5Q A;  5A70 A;  3M3I A;  1CON A;  2HYK A;  3HIF A;  2TBV A;  4DZG A;  1W9Y A;  3TEY A;  1ZBE 1;  2BQP A;  4XUP A;  4AQ2 A;  4LBL A;  5FZ7 A;  1ZZB A;  3OBT A;  4QKN A;  4XFI A;  3MV1 1;  4IV1 B;  1NZC A;  4YM1 A;  1GLH A;  4KWU A;  1UYY A;  1RIN A;  1F4H A;  1UIJ A;  4HKO A;  4LNV A;  4CPB A;  1DFQ A;  2B46 X;  3T1L A;  1DDL A;  4I02 A;  3WDX A;  2EAL A;  2QQL A;  4RR3 A;  4PQQ A;  3LCP A;  3MDP A;  3RYP A;  1DCS A;  1DQ1 A;  5FPX A;  3JUU A;  4AGG A;  1XNA A;  3T2P A;  1HV0 A;  1H30 A;  3LPG A;  4R4X A;  1RUG 1;  3AKR A;  3CU7 A;  1QH6 A;  3KCY A;  4NMI A;  2AAC A;  4AHY A;  4CCO A;  2Q30 A;  2QE3 A;  2VTX J;  4BK5 A;  4R9A A;  3L2Y A;  1CWP A;  1JH5 A;  1Y9M A;  2B45 X;  2ORX A;  3U14 A;  3WW3 A;  3ZVX A;  1ACC A;  3BCW A;  1SMV A;  5F6K A;  2G19 A;  2Y0I A;  5AC9 1;  5F1R A;  3ME2 A;  5C3P A;  4CCC A;  1TEI A;  2NP0 A;  4RR3 B;  4OLL A;  4K1Z A;  4P5Y A;  1LAJ A;  5HV0 A;  1OSG A;  3TOJ A;  5FY4 A;  4CPB D;  3GZT B;  1ULD A;  5LZ6 A;  2BOJ A;  3LOI A;  2BFU S;  3ABZ A;  4N43 A;  5BNN C;  5JI7 A;  2J42 A;  4FSJ A;  2XGX A;  3PVE A;  5C3R A;  2GNB A;  2WA4 A;  4AQS A;  5JXG A;  1SLT A;  4WV8 A;  2Z79 A;  4BQ3 A;  2UWC A;  1K12 A;  4MO3 M;  3WEZ A;  1XE7 A;  4UAP A;  4H14 A;  3WDY A;  4GAZ A;  3BIE A;  1O3S A;  1IG0 A;  3PTR B;  2BNN A;  5LRR A;  1X33 A;  4G9S B;  5CAD A;  3WQ1 A;  4JHT A;  4RSU A;  5FP7 A;  4QQL A;  3FHQ A;  4MVT A;  2Y38 A;  4YVS A;  4I3P A;  4PF5 A;  4N43 B;  3ZYH A;  4D7Y A;  1PVC 1;  4IEW A;  2WFF 1;  1Y3T A;  1BEV 2;  3BU7 A;  3MF9 A;  1RUH 3;  1MEC 2;  4PT6 A;  5B2G B;  1HXS 2;  1OLM A;  2BOI A;  2ZOE B;  1Q8Q A;  5FV3 A;  4L92 A;  2UYA A;  1U5Z A;  1LEN A;  3GZA A;  3HAG A;  4W50 A;  3T2O A;  3VBO C;  3CQO A;  1JXN A;  2RJ2 A;  2I2S A;  2VMG A;  3N7J A;  3ITQ A;  4FFG A;  1WGP A;  1FT9 A;  2RM2 2;  3NO8 A;  4LE4 A;  3ZDV A;  3VUO A;  1D2Q A;  2WBK A;  4C8D A;  1V0A A;  1CIW A;  3KSC A;  5JUV A;  1GFF 2;  2PHR A;  1Q8O A;  4Q4Y 1;  5I0S A;  4YVS B;  1CPM A;  1AXK A;  5EWS A;  1NY7 2;  5C3S A;  4LOS A;  1RC6 A;  4R9B A;  3APB A;  1B09 A;  4CE8 A;  2QFE A;  2HBT A;  1RUD 2;  2WWU A;  4JQT A;  4XZU G;  2OS2 A;  4HSJ A;  5BNP C;  1TNR A;  1S0D A;  5CYY A;  1OXC A;  1QOO A;  2A7A A;  4AVC A;  4FPO B;  2PFW A;  2SLI A;  5A3L A;  3WNL A;  1LOE A;  2R1D A;  4FTE A;  2WDB A;  3IM0 A;  3IWZ A;  4CDX C;  4MGS A;  3AMP A;  4XHX A;  3AZW A;  1ZRI A;  2GNT A;  1O8S A;  3J8F 2;  1ZRC A;  1GNH A;  2ZGT A;  2AUY A;  1LOC A;  2GNM A;  3OJB A;  3AKQ A;  4RGK A;  4Z92 B;  1J3R A;  4Q4W 3;  3VHO A;  5FY5 A;  5JMC A;  4K21 A;  3A0N A;  2A73 B;  2GN3 A;  3KT4 A;  1ZZ6 A;  1MS4 A;  3CO2 A;  1LOA A;  4FQ4 A;  1LHU A;  1AR8 3;  3NV2 A;  3N9M A;  4JHZ A;  3QH7 A;  4D6R A;  3I4I A;  5JOX A;  1SFN A;  5EQU A;  2ENR A;  2R04 3;  4PIX A;  2WQ8 A;  5T5P A;  2CHH A;  2WJS A;  1BQP A;  1A6C A;  1REF A;  2E7A A;  3K77 A;  4IE4 A;  3J8F 3;  4DFS A;  3EHK A;  4JTO A;  2XJP A;  2VMF A;  4IE5 A;  4UFK A;  4HKW A;  4DOU A;  4MHR A;  3VLB B;  4E4S A;  4EN9 B;  2VUD A;  2R30 A;  2A6Z A;  1O7F A;  3CJX A;  2B5H A;  1GMM A;  2RJL A;  2W39 A;  1W6N B;  4QHO A;  3ZXD A;  2A6Y A;  2V4A A;  2XHK A;  4PDW C;  5F5C A;  1VBA 2;  2YZ4 A;  3NKT A;  4AGR A;  3Q9O A;  4EV0 A;  1XE0 A;  3KZ4 C;  2JDN A;  2WIN B;  5KHJ A;  1RHI 1;  2EVX A;  2VXR A;  2OYZ A;  3H8X A;  2J1S A;  2QJV A;  1W8O A;  4XBN A;  5HV4 A;  3U78 A;  2XML A;  4O61 A;  4XW3 A;  1XYO A;  3RYR A;  4V2V A;  4Q0V A;  5LW9 A;  1U5I A;  1VB4 A;  4YFW A;  2F4L A;  1G9D A;  3TN9 1;  5DZG A;  2WZP P;  1JN2 P;  3N7M A;  1P8J A;  4YM3 A;  2MEV 2;  3FFQ A;  1C3H A;  4G3Y C;  5A33 B;  4R52 A;  1TVG A;  4AVV A;  4XOG A;  2OA2 A;  5HI0 A;  1H0B A;  1DZQ A;  1YQC A;  4KGG A;  3UGF A;  2QZ3 A;  1SCS A;  4Y5T A;  1PGL 2;  2RS1 1;  3AL6 A;  3ECQ A;  4P08 A;  4AYU A;  1VBC 2;  4Z1V A;  4QX7 A;  3VDA A;  1ULO A;  4PI2 A;  4XQ4 A;  4TTG A;  1YXW A;  3BVC A;  4Q1R A;  2VG9 A;  4ZS3 A;  3RG0 A;  5LK7 B;  1SHW B;  1IS6 A;  3RQ0 A;  3VD7 A;  5F9T A;  3TWI A;  2WWJ A;  2CNA A;  2RDR A;  5FXW A;  1OLQ A;  1W06 A;  5KXC A;  4DUX A;  1D7P M;  2VUL A;  1KRI A;  2X53 S;  3POE A;  1S4C A;  2YFZ A;  4PQ9 A;  4R9D A;  2A6W A;  3F95 A;  2K46 A;  4H7M A;  5FLJ A;  5KHK A;  1QQP 1;  4GH4 A;  4Q4V 1;  4ATE A;  1OD3 A;  3T1M A;  4FTS A;  5I0R A;  5C4W A;  3H3Z A;  4CEW A;  1NAE A;  1VBC 3;  2AGS A;  3U37 A;  3GGL A;  3WP5 A;  1HQN A;  2K9Z A;  2RDN A;  5DXD A;  4NWV A;  1WLD A;  1DHK B;  3CL1 A;  3H1Y A;  4MGZ E;  5FUN A;  1R09 3;  1UY1 A;  3AXE A;  3RMX A;  4UFM A;  4WBB A;  4DQA A;  4WM8 A;  2VQT A;  1J3Q A;  3VHR A;  3BYW A;  2TUN A;  4GH4 B;  2B9U A;  3URF A;  1XB9 A;  3ILR A;  4EN7 B;  4XE9 A;  3WHT A;  5C4W B;  4P00 B;  4CEW B;  5FZI A;  2WN3 A;  2C26 A;  3ZFF A;  3NV4 A;  2PAE A;  3MO4 A;  5IFP A;  5SV8 A;  3ZSE A;  3KM5 A;  3KVA A;  2ZX4 A;  4JC1 A;  3DV8 A;  1I9R A;  2WR9 A;  4MGY E;  2VUA A;  3B7M A;  2J22 A;  3KF3 A;  3M2M A;  5GLW A;  4LBJ A;  3ZFE C;  1VRH 3;  5GLU A;  4B4Q A;  3WG4 A;  4Y5Z 0;  4WM8 B;  1R08 2;  3GZE A;  3O1R A;  2D6K A;  4QX5 A;  4BJ0 A;  1PGW 1;  2WN2 A;  1KFX L;  4Y4Y A;  3WW2 A;  3PUS A;  4XJW A;  1ENX A;  2NN8 A;  3DEC A;  4CTE A;  1OH3 A;  3RSJ A;  5IAT A;  1HN1 A;  3ZFF B;  1PZ8 A;  3KGZ A;  4JDM A;  1ZRR A;  4XJ9 A;  3ZX7 A;  4E2G A;  3B9I A;  2JWP A;  2DCZ A;  3ES1 A;  3UGH A;  3MIH A;  2AH2 A;  1X8E A;  2B42 B;  3NKG A;  5LA2 A;  3TNP B;  1RMU 1;  2P34 A;  3LIH A;  1MZE A;  2CL2 A;  1U12 A;  1XPW A;  1JZ5 A;  1GP4 A;  4N7U A;  1MS9 A;  3UT0 A;  1PVC 3;  4P9L A;  1V9U 3;  4EWE A;  5AFE A;  2Y8K A;  1ASJ 1;  2VCA A;  5FZ3 A;  4W6W A;  4B1L A;  1O3R A;  5FUI A;  3VKM A;  4AQ6 A;  2PHW A;  1PO1 2;  1XRU A;  2UUR A;  3JB4 C;  4NWW A;  2PHD A;  5T54 A;  1IS5 A;  4OHZ A;  1SDD B;  1IOA A;  1O5L A;  2VZU A;  4LK6 A;  4ARY A;  4ZXE A;  2R32 A;  3HN1 A;  4GB3 3;  1G9C A;  1KGY A;  1WCD J;  3ZO0 B;  4A6S A;  1ZBA 2;  2WSU A;  4YZ1 A;  2FDH A; 
#chains in the Genus database with same CATH homology
 2W1U A;  3LPF A;  5EJZ B;  3FL7 A;  3UES A;  1SG3 A;  4DXT A;  4GWI A;  2ZXQ A;  2VZV A;  4A4A A;  2XON A;  2CDP A;  2DCK A;  4IUG A;  1JHJ A;  3HPN A;  5JXJ A;  1JYX A;  3OEB A;  5DQ0 A;  2JDA A;  3T0D A;  4E8D A;  5HPO A;  1CZV A;  4A41 A;  4QX0 A;  5IFT A;  3PUH A;  3HOB A;  2WYS A;  3I2K A;  4M4R A;  3I97 A;  2V5D A;  4GWJ A;  3PUI A;  3MUY 1;  2EIB A;  2VZQ A;  4QB6 A;  1EUT A;  4W4Z A;  1UMI A;  3K4A A;  3VD3 A;  3I3D A;  1O8P A;  2DDU A;  3NQH A;  2RVA A;  5JMO A;  2B9V A;  5EIY B;  2WZ8 A;  4ZZ5 A;  2ID4 A;  3IB3 A;  4BXS V;  2ORZ A;  3WF0 A;  4CUB A;  1W8N A;  2QQK A;  2QQI A;  2E32 A;  1US3 A;  1OT5 A;  3OGS A;  4LKS A;  3CMG A;  4QX1 A;  2J1E A;  3THC A;  3BGA A;  2W46 A;  5DMY A;  3WNM A;  1UZ0 A;  3F2Z A;  3J7H A;  3GM8 A;  4QPW A;  3EYP A;  4DXS A;  3K4Z A;  1UXX X;  1CZS A;  3W5M A;  2QQN A;  2J1R A;  3C8X A;  2QQM A;  4E8C A;  3P6B A;  4OUE A;  2QBX A;  1H6Y A;  3VD4 A;  2BZD A;  2VME A;  1YQ2 A;  1I5P A;  3GDB A;  1GOF A;  2EID A;  2L9L A;  4DUW A;  2VL4 A;  2V4V A;  5G05 L;  1PX4 A;  3A22 A;  3HJR A;  2E31 A;  4OYU A;  3T0B A;  2WO3 A;  2WO1 A;  3FHA A;  5IYY A;  3SEE A;  2EIE A;  4ARX A;  1UX7 A;  3UET A;  4UI9 L;  4RYD A;  1TG7 A;  1UMH A;  1JZ6 A;  2YB7 A;  1RYY A;  2VQU A;  4ET7 A;  2VMD A;  1GOG A;  3IAP A;  1H6X A;  4OZO A;  1NX9 A;  5B4N A;  5G04 L;  1LNS A;  2VM9 A;  1GQP A;  3C7E A;  2VZ1 A;  3MV0 1;  4CU9 A;  5IHR A;  3VDB A;  3WF1 A;  1UYZ A;  4MOA A;  1UY3 A;  3ACG A;  3GXU A;  1JZ8 A;  3HNB M;  5I0D A;  5JR2 A;  1PMJ X;  3I2G A;  4W8J A;  5CZK A;  4CU6 A;  2ZEX A;  1UY0 A;  4LHS A;  4L0P A;  3WNO A;  1DP0 A;  2KD7 A;  3ACH A;  4ZZ8 A;  2RV9 A;  3P1I A;  2VO5 A;  4FI9 A;  2Y6J A;  4AAX A;  4A44 A;  2J7M A;  4BK4 A;  4PF1 A;  2QQO A;  1CZT A;  4CUA A;  1JZ7 A;  4CU8 A;  1OF4 A;  4A6O A;  1JYV A;  2VZ3 A;  1BHG A;  2WUH A;  1IQD C;  3DYO A;  3WNN A;  2OKX A;  2VC9 A;  4LPL A;  3IDA A;  5J1X A;  2XOM A;  3I3E A;  1J83 A;  1R64 A;  2W94 A;  1UXZ A;  3C7F A;  4D8M A;  4A3Z A;  4DEQ A;  3HNM A;  3LEI A;  4XUP A;  3MV1 1;  4A42 A;  4KWU A;  1UYY A;  1F4H A;  4XUR A;  2VTF A;  3III A;  2LS6 A;  2QQL A;  4PQQ A;  1XNT A;  4TXW A;  1XNA A;  3T2P A;  1UY4 A;  3LPG A;  3THD A;  3DYM A;  4XUO A;  2HYX A;  3VD5 A;  4BK5 A;  2WAA A;  5DPN A;  4QB1 A;  1OF3 A;  2ORX A;  1OH4 A;  2Z4F A;  2ZEY A;  3C7G A;  4P5Y A;  3NJV A;  2VJX A;  2C9K A;  2X09 A;  3HNY M;  2HLE A;  3NNG A;  1JU3 A;  2JE8 A;  3ABZ A;  2DCJ A;  1L7R A;  4QX3 A;  1PX3 A;  1JZ2 A;  5C70 A;  4QB2 A;  2VZT A;  5JXG A;  1KEX A;  3NJX A;  2PQS A;  2W95 A;  4MO3 M;  1K12 A;  3WEZ A;  1JYW A;  4UAP A;  4XUQ A;  2Y64 A;  3OGR A;  3LE0 A;  3I2I A;  3FHQ A;  4HG6 B;  1DLC A;  1O59 A;  3WQB A;  4PT6 A;  2JKX A;  4JKK A;  1L7Q A;  3T09 A;  2W9X A;  1DYO A;  4W50 A;  3T2O A;  2X05 A;  3CQO A;  2RJ2 A;  3LQC A;  1W99 A;  2C4X A;  3I3B A;  4RN5 A;  5C7G A;  4OMD A;  2WBK A;  3CKH A;  5JUV A;  1CIY A;  2W92 A;  3T08 A;  1K3I A;  5EJ1 B;  3I2F A;  3ACI A;  4UOJ A;  3WF3 A;  1JU4 A;  4XZU G;  5JXI A;  5CYY A;  5B4X A;  3E1F 1;  4QDS A;  4YPJ A;  3WNL A;  2WDB A;  1CX1 A;  2E33 A;  4MGS A;  1JYN A;  2YC4 A;  3CIH A;  3ETP A;  1O8S A;  2R7E B;  3NRU A;  3EB7 A;  2WZE A;  2XHN A;  4ZY9 A;  3ACF A;  3MBW A;  2X10 A;  3A7Q A;  1JI6 A;  3OB8 A;  2Y6H A;  4CVU A;  1W0N A;  2J1T A;  1ULP A;  2WO2 A;  4JHZ A;  4DXR A;  3W5N A;  2WQ8 A;  1W9S A;  2W91 A;  3K77 A;  3C7H A;  2VMF A;  3SKV A;  2XQX A;  3CZU A;  2Y6K A;  4XUT A;  2J1V A;  3K75 B;  4CU7 A;  5A1A A;  2EIC A;  4MGQ A;  1GMM A;  2JD9 A;  5LA0 A;  4A45 A;  2YC2 A;  4QX2 A;  2VZO A;  2VZP A;  2J1S A;  1W8O A;  3A21 A;  3BN6 A;  5JXH A;  1GU3 A;  2Y6G A;  3K4D A;  4QAW A;  5C71 A;  3MUZ 1;  2Y6L A;  4DUV A;  4AG4 A;  3D3A A;  1EUU A;  4LQR A;  1P8J A;  1UY2 A;  2E26 A;  3I2J A;  1TVG A;  2BBA A;  4D0Q A;  1J84 A;  4OMC A;  5DN2 A;  2W47 A;  4XVH A;  2QQJ A;  1WCQ A;  4P08 A;  3ECQ A;  3VDA A;  1ULO A;  2VR4 A;  2VCB A;  2J1A A;  3LEG A;  3WNP A;  4TTG A;  1SHW B;  3VD7 A;  3ZM8 A;  3VDC A;  1UYX A;  3WNK A;  3T0A A;  5LCW L;  4DUX A;  1D7P M;  2YFZ A;  2YG0 A;  1US2 A;  2BGO A;  1OD3 A;  3IAQ A;  1NAE A;  3U37 A;  3GGL A;  1GUI A;  2BGP A;  3HEI A;  2J1U A;  1UWW A;  4MAD A;  1F4A A;  2VOT A;  2VCC A;  4JKM A;  1UY1 A;  2VZR A;  3A23 A;  4GZ9 A;  5IJR A;  2VQT A;  1W9T A;  3C7O A;  3K46 A;  1PMH X;  2W87 A;  3OEA A;  3OBA A;  2V72 A;  4P00 B;  1GOH A;  3CDZ B;  2W1Q A;  5F7U A;  2WN3 A;  2C26 A;  2VMC A;  3LEK A;  3FN9 A;  3MO4 A;  5IFP A;  4KMQ A;  2J22 A;  5HXM A;  2LW8 A;  3OGV A;  1XC6 A;  2W1S A;  2W1W A;  3I2H A;  2VZS A;  1JZ4 A;  4BJ0 A;  2WN2 A;  4M4P A;  4XUN A;  3AC0 A;  3DYP A;  3DEC A;  1W9W A;  3CZJ A;  2B4K A;  2WAB A;  1HN1 A;  3HN3 A;  1K45 A;  3OG2 A;  3WF2 A;  4JKL A;  3WSO A;  3T2Q A;  1T2X A;  4BDV B;  5LA2 A;  1MPX A;  1GNY A;  1JZ5 A;  1XPW A;  1JZ3 A;  2BER A;  3VD9 A;  4JX0 A;  3JXS A;  1WKY A;  2W3J A;  4Z2A A;  2Y8K A;  4CUC A;  5LA1 A;  2VCA A;  1NUK A;  5FUI A;  3WF4 A;  2W5F A;  4QDQ A;  1NKG A;  2ZEZ A;  4QDR A;  4DEV A;  1SDD B;  2ZEW A;  2VZU A;  4ARY A;  4ZXE A;  3SKJ E;  3UNP A;  1KGY A;  2YFU A;  2WAO A;  4P02 B;  3SEP A;  2CDO A;  4KI5 M;  1K42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...