3ALQA

Crystal structure of tnf-tnfr2 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
141
Chain Sequence
SDMPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFSGQGCPSTHVLLTHTISRIAVSYQTPVNLLSAIRSPCQANPWYEPIYLGGVFQLEPGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/cytokine receptor
molecule keywords Tumor necrosis factor
publication title Solution of the Structure of the TNF-TNFR2 Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 141
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3alqA00
1IQAA 4N90A 2TNFA 2WNUC 1PK6C 4MXWB 1KD7A 3LKJA 1XU1A 4TWTA 2WNVB 2E7AA 4F3JA 3FC0A 1WCKA 3K51A 1A8MA 3V56A 1O91A 2RJKA 4DOUA 1JH5A 3QD6A 1PK6A 4J6GA 4OUSA 3ALQA 4KGQA 4DB5A 4D7YA 2JG8A 4MSVA 3QBQA 4OULA 1I9RA 2KA3A 2JG9C 1U5YA 4KGGA 3B9IA 2R6QA 4QQ2A 1C3HA 1D2QA 4QQHA 3L9JT 1JTZX 4TSVA 5HBAA 4OUMA 1C28A 3B94A 2R32A 2RE9A 1OSGA 2WNUA 4KG8A 3B93A 4EN0A 1S55A 4G3YC 2AZ5A 3AB0A 3URFA 3TWIA 1KXGA 4G4FA 2WNVC 3MI8A 1U5XA 5BNQA 2RJLA 3ME2A 4RSUA 3TYJA 2ZPXA 1PK6B 4MXVA 2QDNA 2HEYF 1RJ7A 4NN0A 5L36A 2JG8B 5KWRA 4GIQA 2Q8OA 5TSWA 4HT1T 4MXWA 2X29A 1DG6A 2HEWF 2WNVA 1DU3D 2Z5WA 5KC6A 4QQPA 2QE3A 2JG9A 1U5ZA 2Q1MA 1RJ8A 2O0OA 1D4VB 2ZJCA 2HEVF 2JG8C 1OQEA 2WNUB 2TUNA 4E4DX 2JG9B 4QQOA 1OQDA 1D0GA 5L19A 3WD5A 1XU2A 4QQLA 1TNRA 5CIRA 3K48A 3IT8A 4QPYA 2R30A 1TNFA 1ALYA 1GR3A 2OIIA 5KC5A 4E4SA
chains in the Genus database with same CATH superfamily
1YI7A 2WT2A 3SITA 5T55A 1ENQA 4XW3A 5FO7B 5FZMA 2JDNA 4MXWB 4N43A 5A6XA 4NIGA 3RI9A 1B35B 2XL9A 1WMEA 3HNMA 4OHXA 4CPBD 2WL1A 1RUJ3 4QX3A 3ZLIA 2B5HA 2E7AA 2G1MA 2DCKA 3DKQA 4W6YA 5EV7A 1OBNA 4M4RA 1A8MA 5F5IA 1CJDA 3B7MA 4KQ7A 4BQ5A 4E2GA 4CP9B 1XXNA 3WP5A 3E5QA 4NIHA 4N9HA 3AYAA 4Q4W1 5T50A 5A3NA 3SISA 1D4M3 1LRHA 1DGRN 1VRH2 2B45X 2WYFA 3ACLA 3NMBA 5BY5A 3THPA 1CVNA 2WS92 1UW8A 1Q8PA 2J7MA 2RS11 4QXHA 4YNIA 2UY9A 3ILNA 5BNPB 3HBZA 4BQXA 4LA2A 3ELNA 2UU8A 3KGZA 1I6XA 2BNMA 2D5HA 2LM3A 4QDRA 3VV1A 3B9IA 1EP0A 1BEV2 2D6NA 5FY9A 2XL7A 3UV9A 1ZM1A 4IESA 4CA9A 1IG0A 3LSEA 4QQHA 2JDKA 2ZGTA 2OT7A 3OB8A 1MS0A 4NE9A 2RE9A 4AYUA 3VBHB 1EV13 1UU4A 1AVBA 1O8SA 3F95A 1VJ2A 3FBMA 2JD9A 4IE5A 4QAWA 1UU5A 2BGPA 1RL3A 2QBXA 1XE8A 5FWEA 1VBE1 4OQ9A 3KHCA 3RZKA 1W6NA 4XJ8A 4LO5B 3SQOA 4YGEA 3MUY1 1LULA 2XBO1 1S55A 3IIIA 4M0NA 1CN1A 2WWJA 2VCCA 3U07A 4DXTA 1JYCA 5FK7A 1ZRDA 1YQ6A 5DZFA 1ZRCA 3HN1A 2FCUA 2ZAAA 4PI2A 1FPN2 1LEDA 3HT2A 4YW6A 4LUKA 4OMDA 5JOZA 4QM9A 2WNOA 3AKRA 5ANQA 1F8VA 1FX5A 2GMPA 1RINA 2EA7A 4LUMA 1QJU1 3VBFA 4LIVA 1RJ7A 1LGBA 4UFHA 2ZGMA 3LOBA 2EALA 3UJQA 4AGVA 1IOAA 1F15A 2AEZA 1MEC1 1W6OA 3OPTA 3RSJA 3WHUA 1DG6A 1AYM1 3M70A 5I0TA 2XJSA 2I2SA 5DQ0A 4FXGB 5FZ3A 4CEWC 2VUJA 1O5UA 4LOTA 5A3MA 4NUBA 1W8ZA 3LD8A 1NAEA 5JOWA 1UIJA 2GNBA 5JMOA 4DMIA 4S2FA 1UF2C 1V6LA 3QCWA 5CU1A 4JVAA 4QGMA 1CAVB 3SCGA 4BYYA 3H50A 4UBGA 2ERFA 3GJAA 4MH0E 2C5DA 4BB3A 2TUNA 4Y5Z0 2RS53 2VM9A 3PIJA 1UX6A 1KEXA 1ZRRA 2R042 1LGNA 3I2FA 3A7QA 4QQOA 2XH6A 3SXWA 1GP6A 3W59A 4N43C 2VUDA 1DZQA 4IEZA 4LHKA 1QKQA 3WNPA 1OFSA 2LTNA 4GJZA 4DINB 3OBRA 3PTYA 2J22A 3HMYA 1F31A 4YFZA 5I8TA 5LA1A 1OUXA 3N9QA 4CE8A 1QDCA 4COZA 3MYXA 2X10A 4N90A 1QOTA 1KDKA 2Z4FA 4HKWA 3TEZA 3MICA 5DUVA 1KJLA 2VCBA 3ETQA 1IPJA 2Q30A 3LKJA 3NSTA 4NWWA 2PAEA 2JJ6A 4AEMA 2ZHMA 4IEXA 3D0JA 1BMV1 1UNBA 4X8NA 3ZYHA 4AVVA 1ODNA 3WP6A 5LBBA 5FXZA 2P3KA 3LDBA 1AR61 3ZN6B 5FY7A 4RD7A 2E6VA 3WG4A 4D7SA 1UKRA 4INDA 4LT5A 4XF1A 1QF3A 2GNDA 1AR81 3I7DA 4UW6A 3GM8A 2CWSA 1H6XA 2JDZA 3KF5A 4OUSA 2DDUA 2O14A 5FTTC 5C5TA 1YFUA 4URTA 4XABA 5LK7B 1ULFA 1TMF2 3O1TA 2ZA9A 4CEWB 1JS9A 1C5HA 1W8UA 1JI6A 1HB4A 3M8LA 1ND3C 3ZOIA 3ACHA 2FMDA 4JX0A 5EYXA 1CAUA 4YVWB 3RQ0A 3RGBA 3WY6A 5IVVA 1O3SA 3VDBA 2YC4A 2ZGPA 2DV9A 5J96B 1AX0A 4KGGA 4DO0A 4DZGA 4A42A 3VB9A 3J8F1 1UZVA 5FP4A 4YSFA 5HV4A 3A22A 3DYMA 4JGZA 5LWBA 2VO5A 2QQLA 1FMD1 3WG3A 4LHNA 1I1EA 4BIOA 1N3PA 5HBAA 2EIDA 4XACA 2W91A 3JB4C 4L11A 2W3JA 1GNHA 3ATGA 4YZ2A 2K46A 1JZ3A 4N43B 2WFPA 4XJUA 2YYOA 4CPBA 2ZGKA 3VBFC 1COV1 2EAKA 4XURA 1GANA 4KG8A 1MS4A 2AREA 3MIDA 3ZYBA 4E9KA 2NMOA 2HWF1 2NQYA 2QQMA 3ST7A 5FDBA 1BYHA 1RUF3 4HL0A 1PO22 4UAPA 5JZGC 5KR7A 2IC1A 5A33A 5D21A 1X9TA 3VL9A 1KS5A 3RS6A 1MQTA 1UO9A 3HEIA 3HJRA 4FPYA 3CF6E 5DDJ2 2H6BA 3R4UA 3PURA 1WW4A 3WNKA 5A7NA 2W1SA 1WZXA 4NN0A 2XHNA 5CB7A 3VDDA 2WFF3 2Z2SB 2HWE1 2R16A 2RR13 4TLFA 4FFGA 2D98A 1BVP1 1HRV3 2CSGA 1OT5A 3GXUA 2W52A 3SEEA 3ZXJA 4E8DA 4FPOB 4NHMA 1HB3A 2WZR2 1K12A 5DAQA 3VN4A 1AR91 4GMP3 3T0DA 2W9XA 2O0OA 3U4SA 1P8JA 3NO8A 1JOBA 1ND3B 3SH5A 3UJOA 4YZ3A 3ZIWA 2WN2A 2D6MA 4COVA 3GGLA 1XBFA 1GUIA 2WSUA 1HJGA 4S2HA 2VQAA 3U0ZA 1PO11 2O8QA 5A3OA 2ZKNA 2BV4A 1RVF1 2DUOA 3M3IA 4C0BA 5C71A 3B3QE 4XCAA 4S2GA 3S57A 1W2NA 3H3ZA 4EWEA 2Z69A 2P3IA 2B9VA 3SHRA 5LRRA 4A4AA 3MO4A 1EPZA 1DDLA 4Z82A 5A1FA 5IVCA 1OHFA 4A3XA 3VBFB 3VZLA 2A6WA 2E9QA 2HYKA 4FT8A 4LK6A 3KV9A 2EIEA 2WQ8A 5DAWA 3RJRA 1JZ6A 5FYMA 1VRH3 3EJKA 1W6OB 2JEMA 3B00A 4IGOA 5JXJA 5JPMB 4CCJA 2EAAA 4K9SA 5FZHA 4QWNA 4RR3C 2UWBA 1AR71 3I97A 3K51A 5HCBA 4XFHA 2IZWA 2DVFA 1GNYA 4H7LA 3H8RA 2PAMA 5CG8A 1BEV3 4CU6A 2IXCA 4L9BA 2XJTA 4H2AA 4CSWA 2XR4A 4DY5A 1JH5A 2GC2A 3FMGA 4J6GA 2OXBA 1RHI2 4XBNA 2RJ2A 2VMGA 4WBBA 4CRQA 3SKJE 1HV1A 3OCPA 5KXBA 1K3IA 3FWEA 3MLLA 4GALA 1LU2A 1VALA 3LPFA 2WO3A 4MHUA 2JG9C 4BWOA 4IE4A 1R091 4HVOA 4RHV1 4AGRA 3O14A 1R64A 2BTVC 2R072 3AP9A 5I0RA 5DZEA 4LKDA 1FPN3 1BBT2 1OPMA 1XYPA 2B8MA 5L73A 3KLSA 4KBZA 2B46X 4IV1A 4FPFA 4XC9A 3PJQA 3WUDA 1HX6A 4B29A 1SLCA 3D3AA 5GLWA 3ES4A 2WNUA 3CEWA 1IS5A 3NNJA 3VL8A 3VDDC 1W9TA 4GWIA 4XDPA 1QWRA 2ZGNA 1QGLA 2ZX4A 2AZ5A 2PXJA 4C90A 4FP2A 1KXGA 1RUG2 1G86A 3HN3A 3RMYA 3WXPA 5C8WA 1UZWA 4DUXA 1PVXA 2VOXA 4Q4X1 4QPGA 4XTPA 5FLIA 1E5SA 2WN3A 2WKKA 3ZYRA 3AKQA 4YW4A 4BZ4A 5I8YA 3WINE 5D2AA 5FYSA 1NLQA 1MZ5A 2YUEA 5LY1A 3T2PA 4CCMA 5EP9A 5JR2A 3ROUA 1CAUB 1CESA 2R043 1O6UA 1W0OA 4LO8A 1ODMA 2QQNA 3DF0A 2OKXA 3OD4A 4DRRA 3GDBA 3P5BA 3PHMA 5FO9B 4M00A 5F9TA 5FYTA 4JGZB 5JI7A 4IE0A 4B4RA 1GQPA 1U5ZA 2JDAA 4K8RB 5AC91 4NHXA 2Y26A 5IFPA 4D7TA 1H8TA 3PJYA 4MUVA 1VBB2 2CDOA 1XQNA 1HXS2 1ASJ1 3AZZA 3TNQA 2JG9B 1WMFA 3WQ1A 1EUUA 3LEMA 3RZJA 4FQZA 1GZTA 1RUC1 1OQ1A 3I3BA 3ORJA 4XFIA 3WD5A 3I2OA 5A33B 5F2SA 4A44A 3NL1A 2D3SA 2Y34A 3AP6A 4UWDA 3GBFA 3R4SA 4PQQA 1MQTB 2D97A 2VR4A 3QACA 3VD5A 1D7PM 1TNFA 1ALYA 3PU8A 5F1RA 1GR3A 2JDHA 3PMEA 5H9QA 4ASLA 2RMU2 1L7RA 2NPIA 2D6PA 3N9OA 5FY1A 4ASKA 3UGFA 5F5QA 2BEOA 2TNFA 4FOVA 3LF7A 2Y33A 4JRAA 3VDDB 4ATFA 3CU7A 2JENA 4M0HA 5BXXA 4A7KA 1A6CA 2XVGA 4CU8A 3WEZA 2PHWA 4XDOA 1TMF3 3JXSA 3HAGA 1UPIA 4L99A 1AL21 1S0EA 3A0KA 4U2AA 5FZIA 2BGOA 2D6OX 2ZAHA 4JQTA 1AZDA 3FZ3A 4DNYA 5DAVA 3AZVA 2IFRA 2XVLA 4KNCA 3RI8A 1QXRA 2A3XA 3C2UA 1NOVA 2ZTNA 3QD6A 5FK8A 3S6PA 4KU7A 3HT1A 4CP1A 1F4HA 5GZEA 1W99A 3VBOA 4B3NA 1PGL2 1AF9A 1DGRA 1QJX3 1GZCA 3H3LA 2E33A 4H55A 4M01A 3SEPA 5K9YA 1JODA 4X8PA 2V4AA 1OKOA 4YZ5A 1UMZA 3DYOA 3OGGA 1H6YA 1K5MC 3UYJA 1RUE1 2YV8A 4UFJA 2L9LA 1PO23 4R4ZA 5BYNA 4CUAA 4CDQA 2QQKA 2ZMNA 2VMCA 5BPXA 4PBOA 2LROA 5DDJ3 2GH2A 2CGPA 1XB9A 1GLHA 4LBNA 3WW1A 1R082 5I8SA 4YM3A 1VBA2 2R32A 4GD4A 1FOD2 4QKBA 5F5CA 2VULA 5CFDA 2PHXA 4LLOA 5EZWA 3MDPA 5JAXA 4ES8A 1WA6X 3KCCA 5FZFA 1W3VA 1CPNA 1J83A 2V72A 4KWUA 5C4WA 3NVCA 4B1LA 2OZ6A 2PLV2 2W94A 3MIGA 3POBA 4B7EA 4JDMA 1Q8OA 2HWD2 3FJSA 5IVYA 5F3CA 4CXXA 2WZR3 3R05A 4QHBA 3BTZA 3N7MA 2B42B 4PLOA 3WV6A 5BNQA 5ISLA 1XNBA 5KXCA 1K45A 2GZWA 2P1BA 5KHKA 1ZVFA 4IUGA 4BQ3A 1EUTA 3MPBA 1JU4A 4OZOA 1WD3A 2WSVA 5IAVA 3RJ2X 3WW2A 5IK8A 3S7IA 3TEWA 1H8TC 2VMEA 5A6QA 1JUIA 1X8MA 1QH7A 3W58A 2ZX2A 4CP0A 3AKPA 4MGKE 1WLCA 1LB2A 3MIBA 4D6QA 1XNKA 2VC9A 4JRLA 2HEWF 3IDAA 5FPZA 2Q1FA 5H9RA 1QQP2 3S5QA 5C9AB 4XUNA 1T2XA 3I2HA 1HIXA 4C91A 4IV1B 2JDMA 2PHFA 5FMOL 4FP3A 2VH9A 4X6QB 1LNSA 1W39A 5CKNA 2WNUB 3I2GA 1AJOA 2GP3A 3O12A 4AK3A 3H9AA 4OMCA 5F6LB 1BK1A 5IVBA 3GZAA 4JKKA 3N9PA 1O3TA 3GCWA 4QU2A 4SLIA 2XWBB 4Z2WA 3B02A 4BXSV 1ZREA 1HLCA 2VOTA 1HRI2 3ITQA 4Q0SA 4R9DA 3DCQA 5A6YA 5CVRA 1OI6A 1YJLA 4NVPA 5C5UA 1OD5A 2DWRA 5FXVA 4NIAA 3TRSB 2PA7A 5HV0A 4OVEA 4Y4YA 2BVVA 4QPGB 3BI3A 1ND2A 4B4PA 2VTXA 2IXJA 1KS4A 1H1AA 4XFAA 2XOMA 4LR4A 5J3UA 4OHVA 3TEYA 2HWC1 3AX4A 3HBKA 4RQPC 4YRDA 2BQPA 2OW4A 5FZ9A 4AI0A 1FI2A 5IK5A 1IS6A 4NPLA 4QKFA 3J4UH 5DZGA 3TB0A 5IWFA 2GU9A 2XLGA 3RWKX 4Z07A 2W39A 3ILFA 1W9FA 5B2GB 2MHFA 5FPBA 4IEQA 1C8M2 1TEIA 4Y3OA 2R073 1XE0A 2D43A 4RFT0 1H2MA 1SEFA 2VGDA 3GZEA 4HKLA 4J1XA 1BBT3 1GU3A 3BPSA 3P3NA 2EXIA 4QXKA 5IYYA 1H8TB 3M3EA 5ACA1 3G7DA 4MV2A 5FMBA 5F5AA 5CFDC 1PX4A 2V5YA 3MFAA 4IETA 2PHRA 1W0NA 5GALA 1SCRA 3AL6A 4PLMA 5FZOB 4I0BA 4Y5SA 4OHZA 1R1A2 2EF6A 3CJIC 5C4WC 3H8OA 5FPUA 1SLBA 1D2SA 4CDUC 4I0AA 4MLOA 2W47A 4LOSA 3MUZ1 5JMCA 3WDVA 2F17A 4FPGA 1XC6A 1RB8G 3EB7A 3UT0A 1ACCA 2WDBA 1N1YA 1NY71 4AVCA 1OA4A 4RYDA 1IS4A 4P9LA 1Z78A 3DPRA 3Q8CA 4L8QA 1SHWB 1OXCA 1J1TA 5FZKA 2WO7A 1RUH3 4I30A 4ZU4A 5JIUA 3O1SA 3WDWA 4D94A 3AB0A 3U4XA 2HLEA 2VMIA 5DUWA 1CAWA 3TWIA 3WF3A 4CCDA 2TEPA 2J1VA 1GZ9A 2XKOA 1W28A 3WUCA 3JQWA 5FZDA 3JUUA 4K6BA 1I3HA 5FYIA 3K4AA 1LOEA 2BFUS 3BODA 5EWSA 2VECA 2WRAA 3M1HA 3M2MA 2YG0A 3VBOB 3THTA 4IEWA 2ADDA 1VBB3 2CNAA 4MYEA 3LAGA 1HXS3 3E1F1 3ZFEC 1VAVA 4FI9A 1WLTA 1UYXA 2H0BA 3OBTA 4P9JA 5DPNA 5FZGA 4AFAA 1DIWA 1V6OA 1XYOA 3CLPA 2Z5WA 3OTFA 4IXLA 5EYYA 4CDQB 1J58A 2DFBA 1NKGA 2G19A 4GULA 3ZXAC 2VCMA 1F35A 4F83A 1GOGA 3ZN4A 4DUVA 1LOFA 5CKQA 3AMQA 4YW3A 5FYUA 4GB32 5A3TA 4YM2A 2LS6A 4ARXA 5FYCA 3I3QA 2RMU3 1NCRC 2JE7A 3H3UA 2R1DA 4HK8A 4URAA 5CFDB 2DF7A 2UYAA 2XJUA 3POJA 1DCSA 1J3PA 1PVC2 1KFUL 1REFA 5FIXA 4AQSA 3QH6A 4META 2NP0A 1AYN3 1LODA 3CJIB 3I4IA 5C4WB 1UYZA 2FCTA 4PQ9A 4QQLA 2C9AA 2BDRA 3OPZA 3USUA 4CEYC 1OPOA 1Q8VA 4BM8A 4YPJA 3JD73 4O61A 3HWJA 2R0HA 5E89A 1BZWA 2ILMA 4Y1XA 1TME2 3UGHA 1JYVA 1WBLA 3C7GA 3WW4A 5CA6A 3VBUC 4HOOA 1UWWA 5FREA 1UOJA 3O0WA 3ZPYA 4N8MA 4BQYA 5E88A 1QXPA 2DFCA 3WZ1A 4Y1UA 4EN8B 3FL7A 3ZN6A 3N3HA 1KGYA 3K4ZA 1KQRA 4BLIA 4HN1A 1LENA 4QB2A 3C8XA 2GALA 5L7OA 3OD0A 1GWKA 3J7MA 4HSLA 4P9WA 3VHPA 3DN7A 1VBD1 4MGYE 2YZ4A 5FRAA 2PHTA 3I2JA 3UGGA 4CUCA 2PHDA 4BQWA 5FZ0A 1POV3 3OGSA 4CEWA 1ONAA 4UF0A 4YW1A 4C0HA 5ERLA 1O91A 4Q0UA 1IPSA 4WV8A 3NNMA 4GWNA 1LHNA 1G6NA 2W46A 1J3QA 1QOSA 1TZOA 4QGLA 1R083 4YM0A 1Y43B 4Q4Y3 1ULCA 1VBA3 1JYXA 1FOD3 3WDUA 3GZUC 1DQ4A 1RGSA 1DQ2A 4K1ZA 3KF3A 4XF9A 3DPRC 1RITA 2D3RA 4XZUG 2VVFA 2VOKA 4COUA 2RVAA 3LEIA 2JDUA 1RYYA 2VL4A 2DURA 2PLV3 2YGLA 1S0DA 4EN9B 2VXJA 3CZJA 1JYNA 4HMZA 3BALA 3NJVA 2HWD3 1NCRB 2XGXA 3T30A 2CYFA 1FNZA 2FBEA 3OJBA 4NIDA 4R9CA 1ND2B 3K3NA 3VKOA 4Q4W2 3DEMA 1W8FA 2BW8A 4KG0A 1PZ9A 5FZBA 4QT6A 3K2OA 2ZEWA 2K0GA 1KDMA 2RS12 2WYSA 3WLUA 1MS3A 2Y6LA 1QXJA 3LIGA 2VMHA 1CAXA 3AKSA 1NLSA 2YY1A 3I59A 5FY8A 4LBKA 4DEQA 3VBUB 3N4MA 4IERA 2RHPA 1G9BA 4G4FA 1LJ7A 4ONUA 1QQP3 2BGCA 3L2YA 1OFNA 1JHNA 4UFIA 1JU3A 1VMHA 2IFWA 4NRQA 1DF0A 3BU0A 4XDQA 5FO8B 3BTXA 1YC61 3PVNA 4AWDA 4EZ4A 4K20A 2B39A 1LOFC 5FUIA 1ENSA 1FV3A 3A0NA 5K4LA 1Z7S1 2JECA 1VBE2 2Q8OA 3VZNA 4FBFA 2IXHA 1QHDA 1WW5A 2XBO2 1SDDB 2EXJA 2PMWB 3WHTA 1DZTA 3ACFA 4LBMA 5LY2A 2WNVA 5A3PA 1ND3A 1JOJA 1H4GA 3WDYA 1LESA 1HRI3 2MEV1 4Y22A 3GYDA 4LULA 5IAXA 2QCSB 1SACA 5FBZA 1RIRA 1QJU2 3PLQA 2GH8A 5FZ1A 2P34A 1VPHA 3DPRB 5EIYB 1I5ZA 4OFGA 1Q8QA 1V00A 1V6IA 1JYWA 1MEC2 2GMEA 2LRPA 1N1TA 3IMNA 2Z42A 3J26N 3VUOA 5I0SA 1AYM2 3VD9A 1YRZA 5L7OC 1NXMA 1CAWB 3CZUA 3BYWA 4QB6A 4XQDA 3RNSA 4FOQA 4YLZA 2CWMA 5JZGA 2R30A 2OUHA 2YXSA 5IVJA 1C8M3 2OIIA 2I74A 3WG1A 2UWAA 4BJ0A 4AZZA 5JDBA 4JC1A 5J09A 1CPMA 2JE9A 1MZEA 4P9XA 5JCTA 1OH4A 2C0ZA 1CR7A 2K9ZA 5KHJA 5FZ4A 1Y9MA 3I3DA 4XJAA 2XG3A 3WCSA 2OQ7A 4J1WA 4ARYA 4PHZA 1R1A3 3AXDA 3BVCA 3AYEA 3WNMA 3S0MA 3OYWB 3ZXKA 3I2DA 4XQWA 3CQOA 3POSA 5FYZA 4ZXEA 3RZGA 5F3IA 2YPDA 4BQ4A 2VNVA 1C5IA 1YNAA 4GWMA 4NMIA 1RUI1 3AP5A 4UFLA 1PK6A 5EJ1B 3VZKA 2VBBA 3ALQA 2WNEA 3D4KA 2BERA 3OUHA 2JKBA 3WG2A 2VY0A 3HIFA 5LBFA 2C9KA 1XSQA 2WQ4A 2XDVA 3QBQA 4QX8A 4PLNA 5T5OA 3USUB 1BMV2 2YBSA 4NWVA 1Y9GA 5F8PA 2BZDA 3KM5A 1GQHA 1WKYA 4XQ4A 1AR62 2ZZQA 5FYHA 3OY8A 1J59A 1G9FA 1G9DA 4V2WA 2VW1A 3IZOA 1BCXA 3WQBA 1A8DA 1AR82 1O4ZA 3JBG1 3IKWA 1CIYA 4M3CE 2ADEA 2ORXA 3QOPA 1HDKA 4AI9A 2ZGRA 1C28A 5KXEA 3H0OA 4I3GA 1GFF2 2CAVA 4U36A 5FY0A 3O1RA 1ST8A 5L7OB 4MVTA 4AI3A 1J3RA 3MPPG 1S2EA 1S4CA 5DMYA 5A70A 5GZCA 2Y64A 4E2QA 3TAYA 4BISA 2KR2A 5CBLA 4BIFA 4WZCA 5FV3A 1MR5A 4EROA 1DGWA 2ID4A 4Q4V3 4ASMB 1W2UA 1QJY1 3N9MA 1A3KA 3J8F2 1T6BX 4RR3A 1D0HA 4UF0B 4XHBA 5FBJA 2WNVC 2XJQA 3MI8A 2RDQA 3OF1A 1FMD2 4UBHA 2W87A 3MEPA 1VMJA 5FYYA 2OPWA 5CFCA 3D5OA 2ZPXA 1V9U1 5J1XA 4TZDA 4GB33 2A70A 3H8XA 1L3JA 4LA3A 3T0BA 2RS31 3PUAA 4NHLA 3OSDA 4JTNA 4QXBA 4YVSC 1LCLA 2R49A 3MW4A 1COV2 4CU9A 4FPLA 3NAPA 1PVC3 5A1LA 5T3NA 4CCLA 2PELA 1AX2A 2HWF2 4I01A 1WLWA 5K7PA 2FDFA 3E6DA 3I2KA 4LLFA 4PDWC 4XPVA 1YQ2A 5I0DA 2WT0A 2JG9A 3ZYGA 3IDCB 4Q8KA 2A5ZA 1W04A 2DVAA 3IB3A 4CDXC 2A71A 1WCDJ 1OA3A 4DXSA 2E7TA 3W20A 1WLDA 5JPNB 2FDIA 1VIWB 4A6SA 2AC1A 1Q8SA 2E51A 2H0VA 4HFSA 2JG8C 3IM0A 1OQEA 5FLJA 2ARCA 2Q1ZB 1SLAA 2HWE2 3D8CA 3IIAA 5EJZB 2Q4SA 4K40A 4LKSA 3VKFC 1UCXA 4AG4A 3NNGA 5JXIA 1RUNA 5GLTA 3SCFA 1CAXB 5F3EA 2G9GA 3I59B 3VZJA 1C1LA 3WNLA 5KXDA 2VZ1A 4JTOA 1AR92 1WCQA 1X82A 2RM21 4LPLA 4QPWA 2XQXA 2J1SA 4M3CF 4AVSA 4O9GA 1OLMA 1U12A 1N3QA 1QJX1 1O4TA 3ZN5A 5I0UA 1NCQC 1RUD1 2E7QA 1JZ7A 4MGQA 2W2IA 1HKDA 4IEVA 3RZMA 4AOCA 1PK6C 4FOWA 5JUVA 3VDCA 1DBNA 1RUOA 1XNCA 1Z0HA 4IEPA 5FXXA 5FOBB 5FKCA 1PO12 2LW8A 2Y0IA 3MLJA 4TWTA 5A1AA 1RVF2 2WNVB 3UKNA 1WCKA 4FFIA 1NX9A 4Y22B 4XJ9A 3ACGA 3VBRC 1VAMA 3N7KA 1W2OA 4P02B 1CJPA 1H2NA 2HWB1 4OI0A 4Q4W3 3H7JA 1PIV1 2FDKA 2UURA 2VNGA 3POFA 3LSDA 4WM8C 1S0CA 5A80A 3AYCA 2RS13 5FQ0A 1RXFA 1QDOA 4Q1PA 2V09A 4NAMA 1AR72 5GZDA 4I09A 2Q5TA 4LBLA 4YW2A 4HPKB 4AFCA 2YFUA 2WS93 5JZGB 3NW4A 1H8VA 4QPIC 5FUNA 3T1LA 1N1SA 3PVOA 3I49A 2C6SA 4BK4A 1LTEA 1ZZ8A 3LGRA 2ES3A 3LEGA 4KH9A 4K7JA 1JTZX 1XE7A 2X5IC 1W05A 1AXZA 4TSVA 5CFCC 3LPGA 2WAAA 5FPVA 1L7QA 4BHPA 4XZPA 2XJPA 2PQQA 2ZMLA 5E8AA 2VMDA 2WZ8A 1VBE3 2WINB 4ZS2A 3WR0A 4JHTA 2F6BA 1FAYA 2XBO3 3NAPC 3OPWA 1R092 4FPHA 3URFA 1DQ6A 4RHV2 4ZKTB 1O59A 4R8HA 4R9AA 1FATA 4P5YA 1ZZBA 3ZSLA 1NCQB 1X9PA 5FYBA 1UY2A 2WABA 5FMDA 1PK6B 5BNNA 1QJU3 2G4IA 1UKGA 1WWYA 4UI9L 5KWRA 2JIGA 4GIQA 4KU8A 3NWKA 1WBFA 3VHNA 1MEC3 1GKBA 3BIWE 3UETA 4D0QA 5J36A 3VBSA 3VBRB 1AYM3 4G9SB 4UFMA 4GWJA 1PHMA 3KVBA 3EMRA 1XNDA 3VD7A 2FHRA 1G7YA 2CU5A 2YU1A 3LZZA 4AI1A 3OY8B 1OKQA 5ANNA 2QE3A 1K5MA 2D3PA 3AVSA 4AVAA 5F37A 3H1MA 5FPLA 4Q4X2 5L9VA 5C7GA 2D6KA 1LHWA 1RMU1 1A34A 5GZFA 2HEVF 2VD7A 3OUIA 4Q1RA 4BE3A 1NQDA 4YG0A 1W6QB 2WJSA 4K8FA 4XAAA 2RG4A 3RZZA 1FT9A 2WQZC 3KWVA 3QH7A 1US2A 3ABZA 1SLTA 4SBVA 4QKNA 3HPNA 1Y7BA 4FOYA 4W6WA 4QPIB 2PHUA 4LTAA 4RR3B 3C7EA 3ZVXA 2ZXQA 3JCIA 2BUKA 4AVTA 2VTFA 4CUBA 4DQAA 1ZBA1 1REDA 3O1VA 1CWPA 5AC92 2X5IB 5CFCB 4QPYA 3BU7A 1NA1C 4IE6A 3ZFFA 5FPAA 3RWNA 1XPWA 4Y26A 4AVBA 3IAPA 2W5FA 1RXGA 2G9FA 3LFIA 4XBLA 5FP9A 1PM4A 2W68A 4Q0QA 2YGMA 3THCA 4FSJA 1ASJ2 3NAPB 2Y60A 4JV4A 2BRTA 4UW5A 1C4RA 1S0IA 1PGSA 1JZ8A 4ISRA 2DCYA 1RUC2 3IBMA 3RZHA 2AACA 2ARAA 4E27A 2BU9A 1N3OA 4AEDC 1W9WA 3AYDA 1AR63 3NV4A 3W5NA 4AE2A 4DFSA 4JQRA 3E5XA 2QKDA 1BLZA 2RJKA 5FZOA 1DLLA 4AW7A 4HZFA 4IV3A 1V6KA 3BOPA 1AR83 1RUH1 2BNNA 4GMP0 2Y6JA 2OA2A 2JDYA 5FJKA 1YXWA 1EAH1 2WBKA 1ZRIA 4TXWA 4O65A 1HV0A 2VZPA 3APBA 1JUHA 2XLAA 1NUKA 1AL22 2EXKA 4KBBA 4P9YA 5FPXA 4A6OA 1QIQA 3J8F3 5KBFA 1E5HA 5HCFA 3RMXA 1C3HA 3OGRA 2VG9A 1OVSA 4A2UA 1FMD3 4LMFA 3D6EA 1MS1A 1ZZ7A 2VVEA 4P00B 4CTEA 4XUOA 5BNNC 1NZIA 1B09A 4WVWA 5AFEA 4O9EA 4GJYA 3KT4A 1COV3 3ZM8A 1AHSA 1XOYA 1OF4A 2W08A 4OCTA 2TBVA 2XB6C 4RQPA 2J1UA 1RUE2 4LE3A 2HWF3 1JN2P 4QHOA 5FZEA 5AFBA 3VBSC 3WNXA 1C57A 3ZXFA 1H2LA 4CDWC 3PUIA 3VZOA 1DYPA 1U5XA 4RSUA 3TYJA 2A6ZA 2A7AA 3CNAA 5I91A 3K75B 1PNGA 1AYN1 2IWGB 2VBPA 2CL2A 3WX5A 3K46A 3M7AA 1H1MA 4W8JA 3I54A 1MS9A 3FLRA 3L2HA 5FZ6A 4CXWA 2HWE3 3JD71 1OF3A 4FFHA 4HT1T 4F7ZA 1YIFA 3IPVA 4NROA 3EO6A 2BOIA 3KZ4C 4ORFA 4YWAA 3O1OA 4L97A 4XUPA 5CEHA 1CIWA 2VW2A 4H7MA 1CX1A 3LDKA 3TN91 5KC6A 4FPEA 3CJIA 3P3PA 1AR93 4PIXA 1SBEA 4K21A 4CDUA 4XF0A 4HG6B 3FLTA 1BKZA 1GQGA 1VBC1 1ZBE1 2YBPA 2ZHLA 3GNEA 1WMDA 2BOJA 3ZFFC 4ATEA 2QQPA 3S5AA 1UN1A 2HBUA 2WO2A 3KCXA 4DUWA 2JWPA 2ET7A 2J42A 4E4DX 2A3YA 1YFYA 1V0AA 2P5BA 3NKTA 1NE6A 2WC2A 4RN5A 1OQDA 3O5SA 4BDVB 5EJ3A 4FO9A 5L19A 1PO13 1YFWA 2VE1A 4BMEA 1URXA 4UXAA 1GSLA 1RVF3 1W2TA 1W06A 1W3XA 1RC6A 3O1MA 1NQJA 1YQ8A 1NLRA 2R061 1SMVA 4E4ZA 4ZHNA 3RZLA 2VAUA 4Q4Y1 3UK9A 5DXDA 1O4YA 3BB6A 2E32A 2BNOA 5BNNB 1M06G 2O1QA 2WZPP 1WGPA 3MF6A 3C7OA 2YHJA 4IV3C 1LHVA 1W6PB 2BBAA 3GBWA 3DV8A 5J48A 4FTSA 1H0BA 2JDPA 4LO4B 3B9CA 3VBSB 4QU1A 5C3RA 1MVEA 2WA3A 5AVPA 4AEKA 1RUJ1 2GN7A 4CDWB 2R1BA 3WNNA 3FC0A 3ZFEA 1AR73 1OC1A 5FZAA 1QEXA 1FYUA 1K5MB 3WQ0A 4PT6A 3J7NA 4YZ4A 5A7OA 1ZYBA 3BCWA 4LIUA 3N9NA 3CHXA 4QX2A 1OH3A 2DBIA 1LOCA 4V1PA 4OI4A 4P5HA 2ATFA 4D6RA 2HJIA 1PMIA 2YC0A 4FXKB 2WZEA 3ACIA 1D4M1 3WW3A 1HB1A 2HWC2 1YHFA 1NCRA 4KGQA 4XFFA 4XCBA 2ZHNA 2I07B 4R9BA 3WDXA 3ZXLA 4FTBA 2DCJA 2A6XA 4EN6B 1RHI3 1Q5OA 4Q27A 4MO3M 1R093 3ZKYA 1N47A 4RHV3 3KV4A 4TN7A 4XYXA 4CEYA 4B7KA 2R6QA 3ZFFB 4QQ2A 5BV6A 2AYHA 2RDRA 1AXKA 1GBGA 1SCSA 4QD2A 3AMMA 1UOFA 2PN5A 1QU0A 3VBUA 4OUMA 1LAJA 1Q43A 5ACA2 2VZRA 1Y9QA 1EV11 2A6VA 2GNMA 3EQEA 3PU3A 3ZSKA 2QDRA 4P14A 2D6LX 1SFYA 4AXOA 2PFWA 3TBDA 4XAEA 2XONA 4EN0A 4NAOA 3WOGA 3O7OA 1OOPC 1Q56A 1W90A 5FR3A 1E57A 2FZ2A 5FZ7A 4AQ6A 4IV3B 4ZONA 2QQJA 1N1VA 3KV6A 2GAUA 2VW0A 1VAKA 1NY72 1KFXL 4Q4X3 5GKAC 3R4DB 4Y24A 2GC0A 2CGOA 1RUG3 3HVDA 4I2OA 2ORZA 1UZYA 3CKHA 3POWA 3ZIXA 1H4HA 1US3A 3BUCA 3AMHA 5F3GA 1A78A 1UPSA 2QJVA 4HVRA 2B9UA 1HJFA 1WW6A 1PGW1 1OVPA 4CP2A 2QUOA 4C1XA 4XIKA 3U11A 1X50A 3ZKUA 1NT0A 1GP5A 3DXTA 3EXUA 2VZ3A 4FCAA 3WNOA 4BPZA 5DG2A 4H14A 5AC93 3DXUA 3GZTB 5C3QA 2OVUA 2P37A 1D4VB 2QZ3A 4AI2A 2ZJCA 5EFUA 2QNKA 5FAXA 3ZYJB 3M3QA 1EY2A 3K4DA 2DU1A 2Y6FA 1X33A 2RS51 1ASJ3 2XJRA 4PJYA 3N7JA 4RQPB 2R0FA 1DYOA 1QJZA 1GOFA 3GHNA 4EWDA 3Q9OA 1VP6A 4JZRA 1QY4A 5GLVA 2CV6A 5CIRA 3WT3A 3ZYPA 4OHYA 3LB9A 4XUQA 5JOXA 3CJXA 2C24A 2OQ6A 4BMBA 4KMQA 2JXAA 3GALA 4AI8A 1HB2A 3HQXA 1UOBA 1BQPA 1QNYA 5CKMA 3U14A 1KRIA 3OYWA 5FMCA 2MNGA 2VJXA 3IPVB 3SC7X 4XMIA 4N7UA 3M3OA 4DPNA 3AP7A 1XU1A 5CAZA 1OOPB 4PCRA 4UFKA 4XILA 4F3JA 1W8OA 2WLPA 3RYPA 1ENXA 1AL23 4P9IA 1G8WA 4QDQA 3G6JB 4CDUB 3R0RA 1EYBA 2EVXA 2VCAA 5CADA 1BJQA 5IW0A 4DOUA 3VDAA 1S2BA 4IEYA 5GLUA 4M4PA 4A7YA 4YGCA 4YGDA 1QMJA 5FYVA 1JYIA 4DB5A 2DVGA 3MW2A 5LW9A 1NZCA 4Q4V1 1G9AA 2EIGA 2JE8A 3ES1A 1LU1A 4MSVA 4QKDA 3KGLA 3GF6A 3MFCA 1VBD2 4MG2A 1GNZA 3GBGA 2KA3A 1RUE3 3FUQA 1ULDA 1U5YA 1SLLA 2C4XA 3JQXA 3OBAA 2VTXJ 1UL9A 3SMHA 2BBVA 2F4PA 1V6MA 2PAKA 5BUVA 3AMNA 4NR1A 3EYPA 5A7PA 4JKMA 3AZWA 2VU9A 1CONA 1NE4A 3FX3A 2MPFA 2ETEA 4WVVA 1SBDA 5JVVA 3ZFEB 1H30A 1UMHA 2GC1A 2ZBJA 4FPKA 4G3YC 5HXMA 1X8EA 4B1MA 4E8CA 1RUF1 3GHMA 5JR7B 1QOOA 5DAPA 4Z1VA 4AL9A 3ZFGA 4YG3A 1GYKA 3LA3A 3T08A 2XMLA 5HCAA 1YWKA 2RJLA 4DS0A 3QLQA 2NYYA 2X53S 2EICA 2DVDA 1CZSA 2HBTA 3VBHC 4AFBA 5JXHA 3AP4A 5L36A 5HI0A 1LHOA 3KCYA 3ZMNA 2WFF1 2RR11 1XNAA 3B5LB 2YBKA 5JSOA 1HRV1 3RVHA 1DZRA 2VXRA 4CEYB 2AENA 1IS3A 5F2WA 5IVEA 1JHJA 2Q1MA 4GMP1 4FQ4A 5DG1A 1PM7A 3KHBA 3WQ7A 3KT1A 1RJ8A 2ZX3A 1VB4A 1WCSA 2O8OA 1Z7S2 4Y1ZA 2ZHKA 3K77A 5FOJB 1F5JA 3POYA 5IUQA 4Y1VA 1UY0A 1H1IA 1F2NA 2LALA 1D0GA 2WWUA 2YDEA 3WF0A 5KHIA 2ZGQA 2E53A 3MV01 4W4ZA 4X6RB 2MEV2 3POEA 3MIEA 4P9GA 4QX5A 3AK0A 3K48A 4EQVA 5LA2A 3POIA 1QJEA 3NRUA 4ES9A 1YQCA 2QQVA 2VBDA 4Y5TA 1TG7A 5KC5A 4E4SA 3NV3A 1IQAA 4R4XA 5JSRA 4GAZA 3ILRA 5A7QA 5FZ8A 1O5LA 1LECA 4KWKA 2J1AA 1VRH1 3VLBB 2HWC3 1DFQA 5FY4A 4XUTA 2WS91 3Q8FA 4YVSA 2X05A 3HNBM 4Q0PA 4B4QA 3ZR6A 4EE2A 2D40A 2Y8KA 1UU6A 2VQTA 3NV2A 3T2QA 2ZCWA 3PNAA 4MGIE 5APAA 4BK5A 3O1UA 3SCHA 2Y6HA 5F32A 5C8CA 2J1TA 3CMGA 4PDWA 1GP4A 2W1WA 1BEV1 2YROA 1UY1A 4UYBA 1CZTA 2ZMKA 4CDXA 5T5PA 2DUPA 4HPKA 3CIHA 3KD4A 5ACA3 5JXGA 2XKPA 2JG8A 3OGVA 4MHRA 3CL1A 4LORA 2XVKA 1O7FA 4OULA 2XJVA 2P3YA 4JCKA 4XXPA 2RDNA 3DECA 1MZFA 3JB8A 3LOIA 4CCCA 5CISA 2FD8A 2OYZA 1V6JA 2RV9A 2WWSA 4KI5M 3LA2A 3FBYA 4UOJA 4XFGA 2XLFA 4NHKA 1DHKB 1FPN1 4LKFA 3UESA 1XRUA 3A23A 3ZYFA 3ZFGC 2KD7A 4D6SA 4Q29A 2C26A 1RUI2 1W8HA 2RDSA 3IDBB 5J98B 3B94A 4JAAA 1V6NA 3Q8AA 4CCKA 1UX7A 4A7ZA 1NCQA 3SH3A 3SKVA 2QQOA 4Y20A 2Q8DA 3MIFA 5F39A 5JLVA 4YVWC 3B93A 1GWLA 5FZCA 4RS5C 1XYNA 4W65A 4NHYA 4XTMA 5FUPA 3TNPB 1OUSA 4ZZ8A 3N9LA 4ET7A 4XIOA 4IEUA 2LUWA 1ZNPA 2GN3A 5IJRA 1IG3A 1HN1A 1RTVA 1ZZCA 3FFQA 3JBG2 3VBRA 5F7UA 4COWA 1POV0 3WF2A 5FXWA 4RA0A 4DIQA 4GXLA 2VOVA 2EIBA 4IDZA 1HQLA 4IGQA 3HOBA 2R041 1WD4A 4WM8A 2GP5A 3KQ4B 2EXHA 2OZJA 3T4HB 3VKLA 5GZGA 1W6QA 1QJY2 2UWCA 4DRVA 4BU2A 4D3WA 2D44A 3D82A 1YJKA 3PL0A 4YG6A 4CCNA 1UYYA 4FFFA 4WZFA 3WSOA 1SBFA 2IXIA 4A3ZA 3AFKA 4B8EA 4E4HA 1SPPB 4QPIA 1V9U2 5LBCA 4NJ4A 3VD3A 3J7HA 2RS32 1V70A 2Y6GA 1OLME 3LWCA 3IAQA 1ENRA 2X5IA 4Q26A 2P4EA 2Y0OA 3U78A 1W8TA 3AXEA 3DGTA 2K2SA 3E6BA 4Y1YA 3W5MA 4KWLA 3BGAA 3DKWA 4AHZA 1DQ5A 2XQRA 1PX3A 1WW7A 4Q8LA 5SV8A 3ZXGA 3NJYA 3N36A 1IKPA 3ZFGB 2VUAA 3MGUA 1IHMA 5FCCA 5LA9A 3AM2A 4W50A 2NZ9A 1GWMA 4NRPA 3INAA 5C8CC 3WF4A 4CXYA 1JZ5A 1W8WA 3PVEA 1SLIA 4AGGA 4AHYA 2YU2A 2X09A 3OEAA 3WVJA 1FV2A 1SG3A 4QX7A 4HKOA 3KQRA 4YM1A 1TME3 2PTMA 4RS5B 3P6BA 5L9BA 2W1UA 1GZWB 5M0TA 2I45A 1TMF1 4FPCA 3VHOA 4ZZ5A 3WCRA 3O0XA 1VBD3 1W0PA 3CDZB 3PIGA 1Y3TA 5EPAA 5FY5A 3PVBB 5SV5A 1ULGA 3JU9A 1MZ6A 5A3LA 3V56A 2RM22 4P08A 3BN6A 5FMOS 3VKMA 1KITA 2VQUA 3H1WA 2ZACA 1XNTA 4RGKA 1QJX2 2ZABA 2WO1A 4BQ2A 1RUD2 1W9SA 4YYOA 3ON7A 3WDTA 1BK0A 1PZ7A 2P6HA 2BFUL 2AEYA 2DCZA 4IE7A 4HXCA 4LHLA 1I9RA 1VB2A 5GLZA 4DEVA 1GMMA 1REEA 4M3CA 1JZ4A 4OQ8A 3JZVA 4LJHA 3ZYIB 5T52A 1PO21 2FZ1A 4GA9A 4YGBA 2HWB2 4QHZA 4UT5A 1AXYA 5DDJ1 5K8SA 4ITCA 1PIV2 2GMMA 2VZUA 3SH4A 2DUQA 3UKTA 1NA1A 3LDRA 2CTVA 1AL0G 4MGTA 1H9WA 1S2KA 2YB7A 1L7LA 2WLQA 3DUIA 3OUJA 4BH9A 4TTGA 4YVSB 1CX4A 1PZ8A 5T54A 5C33A 4V2VA 3FE5A 3MIHA 2VNOA 4NIIA 1JZ2A 5C8CB 3LFMA 1JBCA 1SZBA 4PDWB 4COYA 1LOBA 4I02A 2WZR1 4NPRA 3FHAA 2QTWB 2BWCA 3KMHA 4QDSA 1FNYA 3ZXEA 4LBQD 2P3JA 4CDXB 4Z92B 5E16A 2A1XA 1W6NB 3CO2A 4MXVA 1UMIA 4LE4A 5A7SA 3UKVA 5LA0A 1Z7S3 1QH6A 2JG8B 4LO7A 5CZKA 5EQUA 5C3SA 5TSWA 5C70A 3RPQA 2XWJB 4FVVA 4LO6B 2XUMA 3C3VA 3J9SA 5FZLA 1NG0A 4J25A 4WVMA 2PQSA 4XETA 3T2OA 4FTEA 5FJHA 1F5FA 1DGLA 3V65A 2MEV3 3PTRB 4QQPA 2W95A 4XEZA 5IK7A 2PHLA 2WR9A 2D5FA 5B4XA 2Q0AA 3AL5A 2HH9A 3OOXA 5CYYA 4R52A 1C1FA 3NQHA 4KL1A 1SDWA 2D93A 3E5UA 4L2NA 5JIAA 4TYSA 2B7YA 1F4AA 1JOPA 1DQ0A 4Y20B 1OD3A 4XJZA 5FKBA 3SLIA 1UIKA 2JD4A 4BLJA 2GNTA 4TLGA 1J84A 5F6KA 2OPKA 1IKQA 1MS5A 1K42A 3OGJA 3N35A 1W6PA 3PUSA 1J1LA 4JGZC 2J1EA 3AJYA 2W92A 4WM7A 4N9IA 4XXAA 1ZX5A 4YFWA 5A32A 2ZGUA 2QFEA 2HKXA 5G05L 4CDWA 1PMJX 1RMU2 4HSJA 2WIIB 1O8PA 3AKTA 3FHQA 1RHI1 3C7HA 1U0AA 1ZA4A 2AUYA 3DYPA 5A3UA 2YPJA 3K3OA 3O0VA 4Q2FA 4WM8B 1LOGA 1W9YA 1UOGA 2ZGSA 1ULEA 3SNMA 4LXLA 1Y4WA 3LEKA 4CCOA 3DL3A 1LGCA 3ECQA 1CZVA 1ZBA2 4EYUA 3NNFA 1MQTC 1T6GC 3OG2A 3VGIA 4CU7A 1O3QA 5FP8A 2ZGOA 4A45A 5LBEA 5E6HA 2R071 3ZR5A 4W6XA 5I93A 1E5RA 1BBT1 1YFXA 1VLNA 3KT7A 1EPWA 4XE9A 3RRDA 1JMUB 1X36A 1RUI3 3IDEA 4LEJA 5G04L 2AH2A 3CBNA 4ZU5A 2ARXA 3MLKA 3C7FA 2ZEZA 2NM1A 4D7YA 1W03A 3U37A 2VPVA 3H1YA 4Q0VA 5FP7A 3NNLA 5FP3A 2V73A 2VZVA 3I3EA 4EWAA 1UXXX 1GICA 2DYCA 3H7YA 4QX0A 3T0AA 2WA4A 3PUHA 2ZEYA 1RUG1 3N7LA 3X29B 5T5LA 4Z2AA 4ZU7A 1STMA 5DN2A 5D8AA 4D8MA 1D2QA 2P2KA 3JBG3 5LB6A 1RUH2 3L9JT 3A21A 1OLQA 4XFCA 2VUCA 5H9SA 5ABJA 3EHKA 3PMSA 3VKNA 1EAH2 4EZHA 2OUJA 3MV11 1NXD1 4HETA 4PF5A 4OI1A 4DXZA 3V0BA 2AGSA 4RL7A 1OMIA 4RGAA 1YCIA 4FAGA 1M4WA 3IN9A 2VMFA 2JX9A 1MS8A 3ZDVA 2FDGA 3AJZA 1QJY3 1JYTA 2BJSA 4GZ9A 4YARA 2E31A 3BTYA 4YW5A 2CGNA 1PMHX 2FCVA 5IFTA 3PDQA 5JSPA 1YUDA 1V9U3 4NO4A 4UW3A 4BOWA 2CAUA 2IUWA 4OLLA 1OA2A 3Q8BA 4PI0A 2QQIA 1C8NA 2RS33 1IPKA 5C3OA 5E1RA 1H2KA 2WT1A 4AEDA 1VBB1 1APNA 2DTYA 1HXS1 1S1AA 2X29A 4S2DA 5LEJA 4M3CB 1LHUA 4HONA 4C8DA 5DABA 1YEWA 4OYUA 2D7FA 5JI9A 1VE0A 3THDA 4BQ1A 3T09A 3T1MA 2FDHA 3U1XA 2HYXA 3BKZA 3ZXDA 4XVHA 4AAXA 1UYPA 3KB5A 3NKGA 1S0BA 4OZXA 2CDPA 3GJBA 3H8UA 5GJ6A 4BCUA 1AYN2 1NA1B 4WM7C 3WP4A 2RMU1 4NOTA 4GH4A 4CZSA 2XPJA 3KSCA 3J7LA 3JD72 4C1WA 5LZ6A 1AUYA 2VQ0A 2CHHA 4CUGA 4AR2A 4AF9A 3D0SA 2A73B 4NRMA 5IVFA 2A75A 2WAOA 5CG9A 3LCPA 2BVBA 4JGYA 4Y4RA 1TNRA 1UXZA 2YC2A 3V0AA 3MW3A 3TN92 1S0FA 3TEXA 4AEDB 4LBQA 3FFZA 4HN0A 4Q5OA 5LCWL 3IT8A 1OOPA 5EHDA 4MOAA 2RM23 5LATA 4IV1C 1VBC2 1W6MA 2DCTA 4CYDA 1ZBE2 3NJXA 1TQ5A 4JDNA 1QNWA 1XSRA 3H42B 4BXFA 2WNUC 4N7IA 1RUD3 4XBQA 4I0WB 4IGPA 1OLRA 3ZX7A 4EV0A 4KWJA 1PGL1 1NYWA 4N53A 2C1FA 4WVMB 1FXZA 4A41A 1H9PA 4Z8BA 2R062 4JHZA 4AEJA 2BP6A 1POV1 1IZ3A 4Q4Y2 3NV1A 4QX1A 2E26A 5A7WA 1CGPA 4QPGC 5L9RA 2VNRA 3MBWA 2HWB3 3HD8B 1CQ9A 2KXLA 4LKEA 4WVZA 5D8AC 1ZZ9A 3IWZA 1PIV3 4Y33A 4F8AA 1WUVA 1R081 1IQDC 5BNOA 1VBA1 4MGSA 5ABJC 1FOD1 1TE1B 2UY8A 3U75A 3O1PA 1ZA7A 3T3YA 1AX1A 3AC0A 4PBPA 3M4FA 1RUJ2 4QXCA 3FHIB 1U5IA 3ZSEA 1O3RA 2YFZA 2PLV1 3FN9A 3BPZA 3NJZA 4WM7B 5A32B 3P1IA 1W2AX 3VHRA 2HWD1 3MHZA 3BTAA 4PIZA 4YW7A 2SBAA 4XF4A 5K0UA 2GSYA 2QQWA 5J7MA 2SLIA 5KHHA 2UYBA 1D4M2 2DU0A 3OEBA 4QM8A 4I3PA 3ZO0B 1OSGA 1LKNA 2FDJA 4MADA 5DUUA 1WA4A 4LQRA 4HANA 2CY6A 3VD4A 4DXRA 1JW6A 1GOHA 3BIEA 2ZGLA 1SFNA 1QQP1 3A4UA 3LA7A 4HLTA 4NPMA 1UD1A 3ZMOA 1JXNA 3BOWA 3W9AA 3ME2A 5GM0A 1Q3EA 1UZZA 1BXHA 4IL7A 2JICA 3AFGA 1UY3A 1YO8A 1ZZ6A 2QDNA 2HEYF 1EV12 2ZKLA 3ENRA 1YQ5A 3LQCA 2Q8CA 1VR3A 4GH4C 2DBNA 2IXKA 1LEMA 2BWAA 5LRSA 4MXWA 1DQ1A 4OI2A 2N7GA 1B35A 3HR9A 4ZPIA 2G9ZA 2XUEA 4IEOA 3WP3A 4LBOA 1HRI1 1DU3D 4ISQA 4JGYC 1VRBA 3M3CA 5D8AB 2DTWA 4BA6A 1WMXA 1YI9A 2BYVE 4GQ7A 3T4VA 5ABJB 3EBRA 1RMU3 4AFMA 4AQ2A 4CP9A 5LEKA 3VBOC 1S0GA 4AHWA 3V0BB 2ZX1A 1ULPA 2ZX0A 2PYTA 3E97A 1WCUA 1BHGA 5DAXA 5A6ZA 1DP0A 1PGW2 1YYNA 5D1IA 3ETPA 1XU2A 2WUHA 3AMPA 4AFDA 3IMMA 4HK9A 4N53C 2B4KA 5DUXA 5BNPA 2ZOEB 4QMAA 5JOYA 4CDQC 2W1QA 2AR6A 4LNVA 2IVJA 1MPXA 1ZBA3 3HNYM 3ZPOA 5AVAA 2JKXA 1C8M1 3T2TA 4EJRA 5FWJA 2VZOA 4UW4A 2ZS6B 1YLLA 2RS52 3VBHA 2V4VA 4QB1A 1KD7A 4GKXA 2JIJA 4FPJA 4LBJA 3UL2A 5BNOC 4L0PA 5C9AA 2P6CA 3RYKA 3B01A 4CVUA 2NN8A 4LK7A 4HVQA 1MVQA 3FLPA 3OBZA 4QGNA 2A6YA 1R1A1 2BPA2 3S30A 1LR5A 2ET1A 2E63A 5FQ0B 4FAHA 5KHGA 1AJKA 1GV9A 1LOAA 1RUC3 4XFBA 4CCEA 4H3WA 4IW3A 2GDFA 2ZEXA 2VVDA 5HPOA 4GH4B 3RYRA 5B4NA 5IHRA 2VZTA 5K0UC 2OX0A 3KV5A 1PNFA 1QJFA 2ENRA 3ASIA 3FUOA 1UAIA 3WF1A 3S7EA 1EAH3 1W8NA 2VZQA 5CNAA 3E6CC 4D69A 4DY3A 4JGYB 2JB8A 4PIYA 4XMAA 4XHXA 4O7XA 3V0AB 5A3WA 1XJAA 3MF9A 2XHKA 3HQRA 4LBQB 2Y6KA 2QVSB 1HN0A 1ULOA 4K1YA 3ZDSA 2Z79A 4ZXKA 3ZSJA 1W6MB 4JKLA 2A3WA 5HXVA 2ZZJA 4XOGA 4MX3A 5LK5A 1HQNA 2Y38A 3KS7A 1POQA 4E2SA 2R7EB 3W21A 3B69A 4Q4V2 1CAVA 5IATA 4N53B 1X7NA 2FQPA 2QZ2A 2QQUA 4AAPA 5T5JA 1I5PA 5LASA 1UQXA 3LE0A 4OHWA 1R1ZA 1B35C 1K5JA 5J37A 4XF3A 1DLCA 5A7WB 4IQPA 4JDOA 2IXLA 3ZSMA 4OUEA 3F2ZA 1ND2C 2F4LA 5FLHA 2ARBA 3AZYA 1ZRFA 3AVRA 4GB31 1VMFA 3RG0A 3HQUA 4GKYA 5BNOB 4MZUA 1DGWX 3PUQA 4PF1A 3R6SA 3I3MA 3POGA 3GCXA 2X8KA 1SPPA 2NLRA 1PVC1 2VOWA 1YIPA 1SFPA 4HBNA 2NMNA 2FMYA 1RUF2 2JB4A 3I2IA 3VZMA 2YMZA 2VZSA 5IK4A 3LIHA 5HCHA 1CD3G 3TN93 1DYKA 3Q8EA 5BNPC 3TOJA 5K0UB 1UZ0A 3UNPA 1TME1 3USSA 4MGZE 1HW5A 4RGGA 1VBC3 4ZY9A 2P17A 1ZBE3 1F9KA 4ZS3A 2IVIB 4AHXA 1MACA 2WFF2 2H6CA 5C6CA 2V5DA 2RR12 4LITA 4AQTA 5JWPA 4LHSA 3MZHA 1TVGA 2J1RA 2KM2A 3RDIA 2Q8EA 5FFOC 1HRV2 1SQ4A 1UY4A 3I8TA 4K3UA 4L92A 1S0JA 2OS2A 2W0XA 4RFRB 5C9AC 4XJWA 3AZXA 4YVWA 1BVVA 2GC3A 2XXZA 5H9PA 4RS5A 5C3PA 1GZWA 3V64A 2R063 5EXOA 4YZ1A 2DVBA 3KVAA 3U10A 5IT6A 1KJRA 3RFRA 1E5IA 1G9CA 1OURA 1HQWA 1IGOA 4EN7B
chains in the Genus database with same CATH topology
1YI7A 2WT2A 3SITA 5T55A 1ENQA 4XW3A 5FO7B 4MXWB 4N43A 3RI9A 1B35B 2XL9A 1WMEA 4OHXA 2WL1A 1RUJ3 2B5HA 2E7AA 2DCKA 4W6YA 5EV7A 1A8MA 1CJDA 3B7MA 4KQ7A 4E2GA 1XXNA 3WP5A 3E5QA 4N9HA 3AYAA 4Q4W1 5T50A 3SISA 1D4M3 1LRHA 1DGRN 1VRH2 2B45X 3ACLA 5BY5A 3THPA 1CVNA 2WS92 1UW8A 1Q8PA 2RS11 4YNIA 2UY9A 3ILNA 5BNPB 3HBZA 4LA2A 3ELNA 2UU8A 3KGZA 1I6XA 2BNMA 2D5HA 2LM3A 3VV1A 3B9IA 1EP0A 1BEV2 2D6NA 3UV9A 2XL7A 1ZM1A 4IESA 3LSEA 4QQHA 2ZGTA 1MS0A 2RE9A 4AYUA 3VBHB 1EV13 1UU4A 1AVBA 3FBMA 1VJ2A 5C9AB 1UU5A 1RL3A 1XE8A 1VBE1 1W6NA 4XJ8A 4LO5B 4YGEA 1LULA 2XBO1 1S55A 4M0NA 1CN1A 3U07A 1JYCA 1ZRDA 5DZFA 1ZRCA 3HN1A 2ZAAA 1FPN2 1LEDA 3HT2A 4LUKA 5JOZA 4QM9A 3AKRA 1F8VA 1FX5A 2GMPA 1RINA 2EA7A 4LUMA 1QJU1 3VBFA 1RJ7A 1LGBA 2ZGMA 3LOBA 2EALA 3UJQA 4AGVA 1IOAA 1MEC1 1W6OA 3RSJA 3WHUA 1DG6A 1AYM1 3M70A 5I0TA 2XJSA 2I2SA 4FXGB 4CEWC 2VUJA 1O5UA 5A3MA 5JOWA 1UIJA 2GNBA 4DMIA 4S2FA 1UF2C 1V6LA 3QCWA 5CU1A 4JVAA 4QGMA 1CAVB 3SCGA 4BYYA 3H50A 4UBGA 2ERFA 4MH0E 2C5DA 2TUNA 4Y5Z0 2RS53 1UX6A 1ZRRA 2R042 4QQOA 1LGNA 3SXWA 3W59A 2XH6A 4N43C 1DZQA 4IEZA 4LHKA 1QKQA 1OFSA 2LTNA 4DINB 3OBRA 3PTYA 3HMYA 1F31A 4YFZA 5I8TA 1QDCA 4COZA 3MYXA 4N90A 1QOTA 1KDKA 4HKWA 3MICA 5DUVA 1KJLA 3ETQA 1IPJA 2Q30A 3LKJA 3NSTA 4NWWA 2PAEA 2JJ6A 4AEMA 2ZHMA 4IEXA 3D0JA 1BMV1 4X8NA 4AVVA 3WP6A 2P3KA 1AR61 3ZN6B 4RD7A 2E6VA 3WG4A 1UKRA 4INDA 4LT5A 4XF1A 1QF3A 2GNDA 1AR81 3I7DA 4UW6A 2CWSA 2JDZA 4OUSA 5FTTC 1YFUA 4URTA 5LK7B 1ULFA 1TMF2 2ZA9A 4CEWB 3M8LA 1C5HA 1ND3C 2FMDA 5EYXA 3RQ0A 1CAUA 4YVWB 3WY6A 1O3SA 2ZGPA 2DV9A 5J96B 1AX0A 4KGGA 4DZGA 3J8F1 4YSFA 4JGZA 3WG3A 1FMD1 4LHNA 1I1EA 4BIOA 1N3PA 5HBAA 3JB4C 4L11A 3ATGA 1GNHA 4YZ2A 4N43B 2WFPA 4XJUA 2YYOA 2ZGKA 3VBFC 1COV1 2EAKA 1GANA 4KG8A 1MS4A 2AREA 3MIDA 4E9KA 2NMOA 2HWF1 2NQYA 3ST7A 5FDBA 1BYHA 1RUF3 4HL0A 1PO22 5JZGC 2IC1A 5A33A 3VL9A 1KS5A 3RS6A 1MQTA 4FPYA 5DDJ2 3CF6E 2H6BA 3R4UA 1WW4A 4NN0A 5CB7A 3VDDA 2WFF3 2Z2SB 2HWE1 2R16A 2RR13 4TLFA 2D98A 1BVP1 1HRV3 2W52A 3ZXJA 4FPOB 4NHMA 2WZR2 3VN4A 1AR91 4GMP3 2O0OA 3NO8A 1ND3B 3SH5A 3UJOA 4YZ3A 3ZIWA 4COVA 2D6MA 2WSUA 4S2HA 2VQAA 3U0ZA 1PO11 2O8QA 2ZKNA 1RVF1 2DUOA 3M3IA 4C0BA 3B3QE 4S2GA 3H3ZA 4EWEA 2Z69A 2P3IA 3SHRA 5LRRA 1EPZA 1DDLA 4Z82A 1OHFA 4A3XA 3VBFB 3VZLA 2A6WA 2E9QA 2HYKA 4FT8A 3RJRA 1VRH3 3EJKA 1W6OB 2JEMA 3B00A 5JPMB 2EAAA 4K9SA 4RR3C 2UWBA 1AR71 3K51A 5HCBA 4XFHA 2IZWA 2DVFA 4H7LA 2PAMA 5CG8A 1BEV3 2IXCA 4L9BA 2XJTA 4DY5A 1JH5A 2GC2A 3FMGA 4J6GA 1RHI2 4XBNA 2VMGA 4WBBA 4CRQA 1HV1A 3OCPA 5KXBA 3FWEA 3MLLA 4GALA 1LU2A 1VALA 4BWOA 2JG9C 1R091 4HVOA 4RHV1 4AGRA 3O14A 2BTVC 2R072 3AP9A 5I0RA 5DZEA 1FPN3 1BBT2 1OPMA 1XYPA 2B8MA 5L73A 3KLSA 2B46X 4IV1A 4FPFA 3PJQA 3WUDA 1HX6A 4B29A 1SLCA 5GLWA 3ES4A 2WNUA 3CEWA 1IS5A 3VL8A 3VDDC 1QWRA 2ZGNA 1QGLA 2ZX4A 2AZ5A 4C90A 4FP2A 1KXGA 1RUG2 1G86A 3RMYA 5C8WA 3WXPA 1PVXA 2VOXA 4Q4X1 4QPGA 4XTPA 5FLIA 2WKKA 3ZYRA 3AKQA 4YW4A 4BZ4A 5I8YA 3WINE 2YUEA 1MZ5A 3ROUA 1CAUB 1CESA 2R043 4LO8A 1W0OA 3DF0A 3OD4A 4DRRA 3PHMA 5FO9B 4M00A 5F9TA 5JI7A 4JGZB 4B4RA 1U5ZA 5AC91 2Y26A 4D7TA 1H8TA 3PJYA 4MUVA 1VBB2 1XQNA 1HXS2 1ASJ1 3AZZA 3TNQA 2JG9B 1WMFA 3WQ1A 4FQZA 1RUC1 1OQ1A 4XFIA 3WD5A 5A33B 3NL1A 2D3SA 3AP6A 3GBFA 3R4SA 1MQTB 2D97A 3QACA 1TNFA 1ALYA 5F1RA 1GR3A 3PMEA 5H9QA 4ASLA 2RMU2 2NPIA 2D6PA 5F5QA 2BEOA 2TNFA 4FOVA 4JRAA 3VDDB 4ATFA 3CU7A 2JENA 4M0HA 5BXXA 4A7KA 1A6CA 2XVGA 2PHWA 1TMF3 3HAGA 1UPIA 4L99A 1AL21 1S0EA 3A0KA 4U2AA 2D6OX 2ZAHA 1AZDA 3FZ3A 4DNYA 3AZVA 2IFRA 2XVLA 4KNCA 3RI8A 1QXRA 2A3XA 3C2UA 1NOVA 2ZTNA 3QD6A 3S6PA 4KU7A 3HT1A 4CP1A 5GZEA 3VBOA 4B3NA 1PGL2 1AF9A 1DGRA 1QJX3 1GZCA 4H55A 4M01A 5K9YA 4X8PA 4YZ5A 1UMZA 3OGGA 1K5MC 1RUE1 2YV8A 1PO23 4R4ZA 5BYNA 4CDQA 2ZMNA 5BPXA 4PBOA 5DDJ3 2GH2A 2CGPA 1GLHA 4LBNA 3WW1A 1R082 5I8SA 4YM3A 1VBA2 2R32A 1FOD2 2VULA 5CFDA 2PHXA 4LLOA 5EZWA 3MDPA 5JAXA 4ES8A 3KCCA 1CPNA 5C4WA 3NVCA 2OZ6A 2PLV2 3MIGA 4B7EA 4JDMA 1Q8OA 2HWD2 3FJSA 2WZR3 3R05A 4QHBA 3N7MA 2B42B 4PLOA 3WV6A 5BNQA 1XNBA 5KXCA 2GZWA 5KHKA 1ZVFA 3MPBA 1WD3A 2WSVA 3RJ2X 3WW2A 5IK8A 3S7IA 1H8TC 1JUIA 1X8MA 1QH7A 3W58A 2ZX2A 4CP0A 3AKPA 4MGKE 1WLCA 1LB2A 3MIBA 1XNKA 4JRLA 2HEWF 5FPZA 5H9RA 1QQP2 1HIXA 4C91A 4IV1B 2PHFA 5FMOL 4FP3A 2VH9A 4X6QB 1W39A 2WNUB 1AJOA 3O12A 4AK3A 3H9AA 5F6LB 1BK1A 3GZAA 1O3TA 4QU2A 4SLIA 2XWBB 4Z2WA 3B02A 1ZREA 1HLCA 1HRI2 4Q0SA 4R9DA 5CVRA 1OI6A 1YJLA 4NVPA 1OD5A 2DWRA 3TRSB 2PA7A 4OVEA 4Y4YA 2BVVA 4QPGB 1ND2A 4B4PA 2IXJA 1KS4A 1H1AA 4XFAA 4LR4A 5J3UA 4OHVA 2HWC1 3AX4A 4RQPC 4YRDA 2BQPA 2OW4A 4AI0A 1FI2A 5IK5A 1IS6A 3J4UH 5DZGA 3TB0A 2GU9A 2XLGA 4Z07A 2W39A 3ILFA 5B2GB 2MHFA 4IEQA 1C8M2 1TEIA 2R073 2D43A 4RFT0 1H2MA 1SEFA 2VGDA 4HKLA 4J1XA 1BBT3 3P3NA 2EXIA 4QXKA 1H8TB 3M3EA 5ACA1 3G7DA 4MV2A 5CFDC 2V5YA 3MFAA 4IETA 2PHRA 5GALA 1SCRA 4PLMA 4I0BA 4OHZA 1R1A2 2EF6A 3CJIC 5C4WC 1SLBA 1D2SA 4CDUC 4I0AA 4MLOA 5JMCA 3WDVA 4FPGA 1RB8G 1N1YA 1NY71 4AVCA 1OA4A 1IS4A 4P9LA 1Z78A 3DPRA 4L8QA 1J1TA 5JIUA 4I30A 1RUH3 4ZU4A 3WDWA 4D94A 3AB0A 3U4XA 2VMIA 5DUWA 1CAWA 3TWIA 2TEPA 1GZ9A 2XKOA 3WUCA 3JQWA 3JUUA 4K6BA 1I3HA 1LOEA 2BFUS 3BODA 5EWSA 2VECA 3M1HA 3M2MA 3VBOB 3THTA 4IEWA 1VBB3 2CNAA 4MYEA 3LAGA 1HXS3 3ZFEC 1VAVA 1WLTA 4P9JA 2H0BA 3OBTA 4AFAA 1DIWA 1V6OA 1XYOA 3CLPA 2Z5WA 3OTFA 4IXLA 5EYYA 4CDQB 1J58A 2DFBA 4GULA 3ZXAC 4F83A 3ZN4A 1LOFA 4YW3A 3AMQA 4GB32 4YM2A 2RMU3 1NCRC 2JE7A 3H3UA 2R1DA 4HK8A 5CFDB 2DF7A 2UYAA 2XJUA 1PVC2 1J3PA 1REFA 1KFUL 4AQSA 3QH6A 4META 2NP0A 1AYN3 1LODA 3CJIB 3I4IA 5C4WB 4PQ9A 4QQLA 2C9AA 3OPZA 3USUA 4CEYC 1OPOA 1Q8VA 4BM8A 3JD73 3HWJA 2R0HA 5E89A 1BZWA 2ILMA 4Y1XA 1TME2 1WBLA 3WW4A 5CA6A 3VBUC 5FREA 3O0WA 3ZPYA 5E88A 1QXPA 2DFCA 3WZ1A 4Y1UA 4EN8B 3ZN6A 3N3HA 1KQRA 4BLIA 4HN1A 1LENA 2GALA 5L7OA 3OD0A 4HSLA 4P9WA 3VHPA 3DN7A 1VBD1 4MGYE 2YZ4A 5FRAA 2PHTA 2PHDA 1POV3 4CEWA 1ONAA 4YW1A 4C0HA 1O91A 4Q0UA 4WV8A 4GWNA 1LHNA 1G6NA 1J3QA 1QOSA 4QGLA 4YM0A 1R083 1Y43B 4Q4Y3 1ULCA 1VBA3 1FOD3 3WDUA 3GZUC 1DQ4A 1RGSA 1DQ2A 4K1ZA 4XF9A 3DPRC 1RITA 2D3RA 2VVFA 2VOKA 4COUA 2DURA 2PLV3 2YGLA 1S0DA 4EN9B 4HMZA 3BALA 2HWD3 1NCRB 2XGXA 2CYFA 1FNZA 2FBEA 3OJBA 4R9CA 1ND2B 3VKOA 4Q4W2 2BW8A 4KG0A 1PZ9A 4QT6A 2K0GA 1KDMA 2RS12 3WLUA 1MS3A 1QXJA 2VMHA 1CAXA 3AKSA 1NLSA 2YY1A 3I59A 4LBKA 3VBUB 3N4MA 4IERA 2RHPA 1G9BA 4G4FA 1LJ7A 4ONUA 1QQP3 2BGCA 3L2YA 1OFNA 1JHNA 2IFWA 1DF0A 4XDQA 5FO8B 4AWDA 3PVNA 4K20A 2B39A 1LOFC 1ENSA 1FV3A 3A0NA 1Z7S1 2JECA 1VBE2 2Q8OA 3VZNA 4FBFA 2IXHA 1QHDA 1WW5A 2XBO2 2EXJA 3WHTA 1DZTA 4LBMA 2WNVA 1ND3A 1JOJA 1H4GA 3WDYA 1LESA 1HRI3 2MEV1 4Y22A 3GYDA 4LULA 2QCSB 1SACA 5FBZA 1RIRA 1QJU2 3PLQA 2GH8A 2P34A 3DPRB 1I5ZA 4OFGA 1Q8QA 1V00A 1V6IA 1MEC2 2GMEA 1N1TA 3IMNA 2Z42A 3J26N 3VUOA 5I0SA 1AYM2 1YRZA 5L7OC 1NXMA 1CAWB 4XQDA 3RNSA 4FOQA 4YLZA 2CWMA 5JZGA 2R30A 2OUHA 2YXSA 1C8M3 2OIIA 2I74A 3WG1A 2UWAA 5JDBA 4JC1A 5J09A 1CPMA 2JE9A 1MZEA 4P9XA 5JCTA 2C0ZA 1CR7A 2K9ZA 5KHJA 4XJAA 2XG3A 3WCSA 4J1WA 1R1A3 3AXDA 3AYEA 3S0MA 3OYWB 3ZXKA 3I2DA 4XQWA 3POSA 1C5IA 1YNAA 4GWMA 1RUI1 3AP5A 3VZKA 1PK6A 3ALQA 2WNEA 3D4KA 2JKBA 3WG2A 2VY0A 3HIFA 3QBQA 2WQ4A 5T5OA 3USUB 1BMV2 4PLNA 4NWVA 3KM5A 1GQHA 1AR62 4XQ4A 2ZZQA 3OY8A 1J59A 1G9FA 1G9DA 2VW1A 1BCXA 1A8DA 1AR82 1O4ZA 3JBG1 3IKWA 4M3CE 3QOPA 1HDKA 2ZGRA 1C28A 5KXEA 3H0OA 4I3GA 1GFF2 2CAVA 4U36A 5L7OB 4MVTA 4AI3A 1J3RA 3MPPG 5GZCA 4E2QA 3TAYA 5CBLA 4BIFA 4WZCA 1MR5A 4EROA 1DGWA 4Q4V3 4ASMB 1W2UA 1QJY1 4RR3A 1A3KA 3J8F2 4XHBA 5IUQA 1D0HA 2WNVC 2XJQA 3MI8A 3OF1A 1FMD2 4UBHA 5CFCA 3MEPA 3D5OA 2ZPXA 1V9U1 4TZDA 4GB33 2A70A 1L3JA 4LA3A 2RS31 4NHLA 4JTNA 4YVSC 1LCLA 2R49A 3MW4A 1COV2 4FPLA 3NAPA 1PVC3 5T3NA 2PELA 1AX2A 2HWF2 4I01A 1WLWA 5K7PA 3E6DA 4PDWC 4LLFA 4XPVA 2WT0A 2JG9A 3ZYGA 3IDCB 4Q8KA 2A5ZA 2DVAA 4CDXC 2A71A 1WCDJ 1OA3A 2E7TA 1WLDA 5JPNB 1VIWB 1Q8SA 2E51A 2H0VA 4HFSA 2JG8C 3IM0A 1OQEA 5FLJA 2Q1ZB 1SLAA 2HWE2 3D8CA 3IIAA 3VKFC 2Q4SA 4K40A 4AG4A 1UCXA 1RUNA 5GLTA 3SCFA 1CAXB 2G9GA 3I59B 3VZJA 1C1LA 5KXDA 4JTOA 1AR92 1X82A 2RM21 4M3CF 4AVSA 4O9GA 1U12A 1N3QA 1QJX1 1O4TA 3ZN5A 5I0UA 1NCQC 1RUD1 2E7QA 1HKDA 4IEVA 1RUOA 1PK6C 4FOWA 1DBNA 1XNCA 1Z0HA 4IEPA 5FOBB 1PO12 2Y0IA 3MLJA 4TWTA 1RVF2 2WNVB 3UKNA 1WCKA 4Y22B 4XJ9A 3VBRC 1VAMA 3N7KA 1CJPA 1H2NA 2HWB1 4OI0A 4Q4W3 3H7JA 1PIV1 2UURA 2VNGA 3LSDA 4WM8C 1S0CA 3AYCA 2RS13 1QDOA 4Q1PA 2V09A 1AR72 5GZDA 4I09A 2Q5TA 4LBLA 4YW2A 4HPKB 4AFCA 5JZGB 2WS93 3NW4A 1H8VA 4QPIC 3T1LA 1N1SA 3PVOA 1LTEA 1ZZ8A 3LGRA 2ES3A 4KH9A 4K7JA 1JTZX 1XE7A 2X5IC 4TSVA 1AXZA 5CFCC 4BHPA 4XZPA 2XJPA 2PQQA 2ZMLA 5E8AA 1VBE3 2WINB 3WR0A 2F6BA 1FAYA 2XBO3 3NAPC 1R092 4FPHA 3URFA 1DQ6A 4RHV2 4ZKTB 4R8HA 4R9AA 1FATA 1ZZBA 3ZSLA 1NCQB 1PK6B 5BNNA 1QJU3 2G4IA 1UKGA 5KWRA 4GIQA 4KU8A 3NWKA 1WBFA 3VHNA 1MEC3 1GKBA 3BIWE 5J36A 3VBSA 3VBRB 1AYM3 4G9SB 1PHMA 1XNDA 2FHRA 1G7YA 3LZZA 4AI1A 3OY8B 1OKQA 2QE3A 1K5MA 2D3PA 4AVAA 3H1MA 4Q4X2 2D6KA 1LHWA 1RMU1 5GZFA 2HEVF 4Q1RA 4BE3A 1NQDA 4YG0A 1W6QB 2WJSA 4K8FA 3RZZA 1FT9A 2WQZC 3QH7A 1SLTA 4SBVA 1Y7BA 4FOYA 4W6WA 4QPIB 2PHUA 4LTAA 4RR3B 4DQAA 3ZVXA 4AVTA 3JCIA 2BUKA 1ZBA1 1REDA 5AC92 2X5IB 5CFCB 4QPYA 3BU7A 1NA1C 3ZFFA 3RWNA 4Y26A 4AVBA 2G9FA 4XBLA 2W68A 4Q0QA 2YGMA 4FSJA 1ASJ2 3NAPB 4JV4A 4UW5A 1C4RA 1S0IA 1PGSA 4ISRA 2DCYA 1RUC2 3IBMA 4E27A 1N3OA 4AEDC 3AYDA 1AR63 3NV4A 4AE2A 4DFSA 4JQRA 3E5XA 2QKDA 2RJKA 4AW7A 1DLLA 4HZFA 4IV3A 1V6KA 3BOPA 1AR83 1RUH1 2BNNA 4GMP0 2OA2A 1YXWA 1EAH1 1HV0A 3APBA 1JUHA 2XLAA 1AL22 2EXKA 4KBBA 4P9YA 5FPXA 3J8F3 5KBFA 5HCFA 3RMXA 1C3HA 2VG9A 4A2UA 1FMD3 3D6EA 1MS1A 1ZZ7A 2VVEA 4CTEA 5BNNC 1B09A 4WVWA 5AFEA 4O9EA 3KT4A 1COV3 1AHSA 2W08A 2TBVA 2XB6C 4RQPA 1RUE2 4LE3A 2HWF3 1JN2P 5AFBA 3VBSC 3WNXA 1C57A 3ZXFA 1H2LA 4CDWC 3VZOA 1DYPA 1U5XA 4RSUA 3TYJA 2A6ZA 2A7AA 3CNAA 5I91A 1PNGA 1AYN1 2IWGB 2CL2A 3WX5A 3M7AA 1H1MA 3I54A 1MS9A 3FLRA 3L2HA 2HWE3 3JD71 4HT1T 4F7ZA 1YIFA 3IPVA 3EO6A 3KZ4C 4ORFA 4L97A 1CIWA 2VW2A 4H7MA 5KC6A 3TN91 4FPEA 3CJIA 3P3PA 1AR93 4PIXA 1SBEA 4K21A 4CDUA 4XF0A 3FLTA 1BKZA 1GQGA 1VBC1 1ZBE1 2ZHLA 3GNEA 1WMDA 3ZFFC 4ATEA 2QQPA 1UN1A 3KCXA 2ET7A 4E4DX 2A3YA 1YFYA 3NKTA 1NE6A 2WC2A 1OQDA 3O5SA 5EJ3A 4FO9A 5L19A 1PO13 1YFWA 4BMEA 1URXA 4UXAA 1GSLA 1RVF3 1RC6A 1NQJA 1NLRA 2R061 1SMVA 4E4ZA 3UK9A 4Q4Y1 5DXDA 1O4YA 3BB6A 5BNNB 2BNOA 1M06G 2O1QA 2WZPP 1WGPA 3MF6A 2YHJA 4IV3C 1LHVA 1W6PB 3GBWA 3DV8A 5J48A 4FTSA 1H0BA 4LO4B 3B9CA 3VBSB 1MVEA 2WA3A 5AVPA 4AEKA 1RUJ1 2GN7A 4CDWB 2R1BA 3FC0A 3ZFEA 1AR73 1FYUA 1K5MB 3WQ0A 4YZ4A 1ZYBA 3BCWA 1LOCA 4V1PA 4OI4A 4P5HA 2ATFA 2HJIA 1PMIA 2YC0A 4FXKB 1D4M1 3WW3A 2HWC2 1YHFA 1NCRA 4KGQA 4XFFA 2ZHNA 2I07B 4R9BA 3WDXA 3ZXLA 4FTBA 2DCJA 2A6XA 4EN6B 1RHI3 1Q5OA 4Q27A 1R093 1N47A 4RHV3 4XYXA 4CEYA 4B7KA 2R6QA 3ZFFB 4QQ2A 5BV6A 2AYHA 1AXKA 1GBGA 1SCSA 4QD2A 3AMMA 2PN5A 1QU0A 3VBUA 4OUMA 1Q43A 5ACA2 1Y9QA 1EV11 2A6VA 2GNMA 3EQEA 3ZSKA 2QDRA 4P14A 2D6LX 1SFYA 4AXOA 2PFWA 3TBDA 4EN0A 3WOGA 3O7OA 1OOPC 1Q56A 1E57A 2FZ2A 4AQ6A 4IV3B 1N1VA 2GAUA 2VW0A 1VAKA 1NY72 1KFXL 4Q4X3 5GKAC 3R4DB 4Y24A 2GC0A 2CGOA 1RUG3 4I2OA 1UZYA 3POWA 3ZIXA 1H4HA 3AMHA 1A78A 1UPSA 2QJVA 4HVRA 2B9UA 1WW6A 1PGW1 4CP2A 2QUOA 4C1XA 4XIKA 3U11A 1X50A 3EXUA 4FCAA 4BPZA 5DG2A 4H14A 5AC93 3GZTB 2OVUA 2P37A 1D4VB 2QZ3A 4AI2A 2ZJCA 5EFUA 2QNKA 5FAXA 3ZYJB 3M3QA 1EY2A 2DU1A 1X33A 2RS51 1ASJ3 2XJRA 4PJYA 3N7JA 4RQPB 2R0FA 1QJZA 3GHNA 4EWDA 3Q9OA 1VP6A 1QY4A 5GLVA 2CV6A 5CIRA 3WT3A 3ZYPA 4OHYA 3LB9A 3CJXA 4BMBA 2JXAA 3GALA 4AI8A 3HQXA 1BQPA 1QNYA 1KRIA 3OYWA 2MNGA 3IPVB 4XMIA 4N7UA 3M3OA 4DPNA 3AP7A 1XU1A 5CAZA 1OOPB 4PCRA 4XILA 4F3JA 2WLPA 3RYPA 1ENXA 1AL23 4P9IA 1G8WA 3G6JB 4CDUB 3R0RA 1EYBA 2EVXA 5CADA 1BJQA 4DOUA 1S2BA 4IEYA 5GLUA 4A7YA 4YGCA 4YGDA 1QMJA 1JYIA 4DB5A 2DVGA 3MW2A 1G9AA 1NZCA 4Q4V1 2EIGA 3ES1A 1LU1A 4MSVA 3KGLA 3GF6A 3MFCA 1VBD2 1GNZA 3GBGA 2KA3A 1RUE3 3FUQA 1ULDA 1U5YA 1SLLA 3JQXA 1UL9A 3SMHA 2BBVA 2F4PA 1V6MA 2PAKA 5BUVA 3AMNA 4NR1A 3AZWA 2VU9A 1CONA 1NE4A 3FX3A 2MPFA 2ETEA 4WVVA 1SBDA 5JVVA 3ZFEB 1H30A 2GC1A 2ZBJA 4FPKA 4G3YC 1X8EA 1RUF1 3GHMA 5JR7B 1QOOA 4Z1VA 3ZFGA 4YG3A 1GYKA 3LA3A 5HCAA 1YWKA 2RJLA 4DS0A 3QLQA 2NYYA 2X53S 2DVDA 3VBHC 4AFBA 5L36A 3AP4A 5HI0A 1LHOA 3KCYA 3ZMNA 2WFF1 2RR11 3B5LB 5JSOA 1HRV1 1DZRA 2VXRA 4CEYB 2AENA 1IS3A 2Q1MA 4GMP1 4FQ4A 5DG1A 1PM7A 3WQ7A 3KT1A 1RJ8A 2ZX3A 1VB4A 1WCSA 2O8OA 1Z7S2 4Y1ZA 2ZHKA 5FOJB 1F5JA 3POYA 4Y1VA 1F2NA 1H1IA 2LALA 1D0GA 2YDEA 5KHIA 2ZGQA 2E53A 4X6RB 2MEV2 3MIEA 4P9GA 4QX5A 3AK0A 3K48A 4ES9A 5KC5A 4E4SA 3NV3A 1IQAA 4R4XA 5JSRA 3ILRA 1O5LA 1LECA 4KWKA 1VRH1 3VLBB 2HWC3 1DFQA 2WS91 4YVSA 4Q0PA 4B4QA 2D40A 1UU6A 3NV2A 2ZCWA 3PNAA 4MGIE 3SCHA 5C8CA 4PDWA 1BEV1 2YROA 2ZMKA 4CDXA 5T5PA 2DUPA 4HPKA 3KD4A 5ACA3 2XKPA 2JG8A 3CL1A 2XVKA 1O7FA 4OULA 2XJVA 4JCKA 4XXPA 3LOIA 3JB8A 1MZFA 2OYZA 1V6JA 2WWSA 3LA2A 3FBYA 4XFGA 2XLFA 4NHKA 1DHKB 1FPN1 4D7SA 1XRUA 3ZFGC 4Q29A 1RUI2 3IDBB 5J98B 3B94A 4JAAA 1V6NA 4A7ZA 1NCQA 3SH3A 4Y20A 3MIFA 5JLVA 4YVWC 3B93A 4RS5C 1XYNA 4W65A 4XTMA 3TNPB 4XIOA 4IEUA 2LUWA 1ZNPA 2GN3A 1RTVA 1ZZCA 3FFQA 3JBG2 3VBRA 4COWA 1POV0 4RA0A 4GXLA 2VOVA 1HQLA 2R041 1WD4A 4WM8A 2EXHA