3ALQA

Crystal structure of tnf-tnfr2 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
141
Chain Sequence
SDMPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFSGQGCPSTHVLLTHTISRIAVSYQTPVNLLSAIRSPCQANPWYEPIYLGGVFQLEPGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution of the Structure of the TNF-TNFR2 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
molecule keywords Tumor necrosis factor
total genus 21
structure length 141
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3alqA00
4E4DX 1JTZX 1S55A 3QBQA 1KD7A 4TWTA 2JG9A 5KC6A 1WCKA 1OSGA 5HBAA 4NN0A 1OQDA 2Q8OA 2RJKA 4QQLA 2Q1MA 1A8MA 4QQ2A 1RJ8A 2AZ5A 3LKJA 3WD5A 4D7YA 5KWRA 2QE3A 4DOUA 3B9IA 2WNUA 3K48A 4QQOA 1O91A 1TNFA 2WNVA 4MXVA 1C28A 4MXWB 3AB0A 3L9JT 1D2QA 2WNVC 3K51A 3TWIA 5BNQA 3QD6A 1D0GA 5L36A 2WNUB 4J6GA 1GR3A 4OUSA 2JG9C 3TYJA 2ZPXA 4EN0A 2RJLA 1JH5A 2HEWF 1U5YA 4QQHA 4OUMA 4E4SA 2QDNA 2R6QA 2R32A 4KGGA 1U5ZA 4OULA 1U5XA 1IQAA 2E7AA 2HEYF 4G3YC 4KGQA 4MXWA 5TSWA 4RSUA 1PK6A 3B93A 5L19A 2ZJCA 2HEVF 1I9RA 2JG8B 4GIQA 3MI8A 2JG8A 1ALYA 1TNRA 1RJ7A 5KC5A 1KXGA 3FC0A 4TSVA 2TNFA 1PK6C 1PK6B 4MSVA 3ME2A 2O0OA 1OQEA 2OIIA 1DU3D 2JG8C 2JG9B 4F3JA 3URFA 2KA3A 2R30A 2WNVB 1C3HA 1XU2A 2Z5WA 4N90A 4KG8A 1XU1A 5CIRA 3IT8A 3V56A 3ALQA 3B94A 2X29A 4DB5A 2TUNA 2WNUC 1DG6A 4G4FA 4QPYA 4QQPA 1D4VB 2RE9A 4HT1T
chains in the Genus database with same CATH superfamily
2GMPA 2DFCA 3ST7A 2BNOA 2EF6A 1PMIA 2AEYA 4U2AA 4WM7A 3M8LA 3DKQA 2W1QA 4XXPA 2R1DA 3L2HA 5JSOA 1C1FA 1S55A 4NIHA 4CDXB 4QDSA 5J09A 3U07A 2ZHMA 5E88A 5BUVA 4R8HA 5KC6A 2W3JA 5G05L 1OSGA 1AR71 4N8MA 1OH4A 2FDFA 3BPSA 2WO7A 3WX5A 1SG3A 1N1VA 3EB7A 1ZX5A 2I07B 4CDWA 3TNPB 2WRAA 4MV2A 5BNOA 2Y38A 2VD7A 3DEMA 5FZGA 4QKFA 5LZ6A 1LHOA 2O8OA 4Q0SA 2VZ1A 2BU9A 2HJIA 3NWKA 3ZXLA 1L7RA 2DVDA 1YFWA 2ERFA 3C3VA 2WN3A 5GLUA 3HR9A 1C28A 4XUTA 5FFOC 3WP3A 4P14A 4CU7A 1ST8A 5F5QA 2DCJA 3T2QA 3J7LA 2WWJA 2BP6A 2V09A 5C8CB 1GWMA 4EN6B 3ENRA 1ONAA 1K5MA 3OPTA 3UYJA 4B4PA 5BNNB 4RR3A 3ZFEC 5J3UA 4XILA 4EWDA 5KHJA 3GZUC 2VY0A 2LRPA 4L8QA 5LW9A 4QX5A 2RS13 2VNRA 1O3RA 4LE3A 2WDBA 2YBSA 2HWC2 1WMXA 2ZHLA 3K75B 4L0PA 1REEA 4LEJA 2VUJA 4C0BA 1QHDA 1F31A 2AGSA 4FTEA 1AR93 3UJQA 3OUJA 4AI9A 5CBLA 1ZBE3 2BDRA 2UWBA 4LIVA 5CG8A 4CCEA 4YG0A 1Z7S1 4DFSA 1JZ7A 2ZX4A 4YGDA 3OTFA 1UYXA 1ODMA 4I02A 5EHDA 5JIAA 3VBOA 4TLGA 2A6XA 2PHRA 4XIOA 2NMOA 4AZZA 3KS7A 3VHNA 3E6CC 2YBKA 3SH5A 2ZJCA 4Z07A 4Q26A 4PIZA 3KHBA 4Y5TA 3NAPB 2WLPA 4E4HA 3QLQA 3H8XA 3KM5A 1QOOA 3WF0A 4GA9A 2P3IA 3LEKA 1RJ7A 1SFPA 4YW7A 4MSVA 3ZYBA 3N9NA 4RD7A 4I3PA 5HI0A 3BN6A 3U75A 1LGCA 5GZEA 2ZGRA 1GZWB 1UU4A 5FZIA 1YIPA 2OIIA 3B02A 1RVF3 5FXXA 2JG9B 1ULFA 4K20A 3C7OA 3E97A 4L9BA 2OS2A 4EQVA 3DKWA 3IB3A 4IE0A 5BNNC 5CFDB 1W8FA 4RFRB 3M3OA 4UFJA 1ZBA3 3AP5A 2OPWA 3KV6A 5JSPA 4ZS2A 4AE2A 2JDAA 5FOBB 2JDPA 2ZGLA 3ZXGA 3P3PA 3ZIWA 5A7OA 4C91A 2YGMA 1LU1A 1NCRB 4FBFA 2DU1A 2RG4A 2YYOA 3BGAA 3JB4C 3OCPA 5FPZA 1SZBA 3WNNA 5F6KA 1OI6A 3WINE 1GZ9A 4ASMB 4N7IA 1AYN3 4XHXA 3B94A 2ZGUA 4OYUA 4NHLA 1DGWX 1IPSA 2DVAA 2J1RA 2W1SA 4G4FA 3TRSB 2BW8A 2X5IC 2WA3A 4BK4A 2C26A 5BNPA 3WT3A 1PO23 1DBNA 4N43B 1NXD1 2P3YA 5I0UA 1VBB2 4OQ8A 3NRUA 3UKNA 2B9VA 5F5CA 3GM8A 4P9XA 3IDBB 3CMGA 4DXSA 4YVSC 1XJAA 2JG9A 3D3AA 3VZOA 4AEDB 1MVQA 2P34A 1NE4A 4LLOA 1DQ0A 2AH2A 4QDQA 3WNOA 3FN9A 4EE2A 1VR3A 4O9GA 1ENSA 4WBBA 1DYPA 2A3YA 4Q4W2 1MACA 5LA2A 1UYYA 1MS8A 2XWBB 2ZZQA 1VBC3 2WS93 5A7WA 5ACA2 2V4AA 2Y34A 3OGGA 4QX7A 2R043 4PCRA 3PMEA 1AR81 4XQ4A 4NRMA 4XURA 3T4HB 1POV1 4GH4B 1OF3A 3AVSA 1ZBE1 3K77A 1H9PA 5A33B 2ZGKA 3WF3A 1PGW1 4GD4A 4CUGA 1NY72 3LSEA 4CPBA 1U12A 4YZ1A 3BU0A 4LO7A 4UWDA 3ZYPA 2XJPA 4QM9A 4P08A 3HQXA 1U5YA 1W8ZA 2D5HA 3OPZA 3AMHA 1U5ZA 2R063 3C7GA 2W9XA 3FLRA 3WY6A 1OPOA 2D3RA 2FCUA 3ZN4A 2VQUA 2BJSA 4FAHA 4JGYC 1UOFA 2EIGA 4MXWA 5IHRA 1LB2A 5KXBA 5IVFA 3IPVA 1KJLA 1OURA 1ZRRA 1OD3A 3DPRC 3N7MA 2WUHA 2BNMA 4GMP1 3WXPA 4AHWA 2VTXA 1G9DA 2QQPA 2Y6JA 3ORJA 4OMDA 4QXBA 4WM8A 4BQ1A 4HFSA 3SKVA 5LRRA 4XTPA 1WLDA 1JYCA 4XDPA 3UGFA 3LCPA 1RUI3 2OPKA 2R041 5KHHA 1UU6A 3WHUA 3IBMA 3V0AA 3LAGA 3RVHA 4CCCA 1FT9A 1OFNA 1QU0A 5EWSA 4Z8BA 1AR82 1UWWA 3FFZA 1S0DA 3ZSEA 4Q2FA 5KHGA 2RJ2A 2UWAA 2GN7A 3CJIB 3NKGA 4XUQA 1F4HA 3TN93 1NX9A 2VECA 2XH6A 2R30A 4X6QB 1GOHA 1LJ7A 3DUIA 4MGZE 3WW2A 3J8F2 3OD4A 3VL8A 5JOWA 3BOPA 1W9FA 4OHYA 3FMGA 2A6VA 4CSWA 3AZYA 3AMMA 1AJOA 4S2HA 1DGRA 3CIHA 4BPZA 5ACA3 5K9YA 1FMD3 5FYTA 1SLCA 4XW3A 4MZUA 1VBB1 1WBFA 3C8XA 1W3XA 1D0HA 5D1IA 2E9QA 4KWLA 4LKSA 4PDWA 3LFMA 4XJ9A 2ZKLA 4CXXA 3I2KA 1QMJA 2W39A 5F5AA 1URXA 4GB33 5LK7B 4AI0A 1IPJA 2PFWA 2PN5A 2YFUA 4HLTA 3IMNA 1VBB3 3MW4A 5FTTC 1V6JA 3TN92 2HWC1 3QBQA 3JD72 1UOJA 4TWTA 1RUF3 2W52A 3LDKA 1RUC1 4Q4X2 5K7PA 1ODNA 5FO9B 2DDUA 3JCIA 3Q9OA 1HB4A 2ZEYA 2ZMKA 1B35C 2PQQA 4PQQA 3HEIA 2VZ3A 2PHUA 4AFDA 1NCQA 3NV4A 3WD5A 2QE3A 2VMIA 4DOUA 1SLLA 5JXIA 1OLRA 4QQOA 2FDGA 3J7MA 1GKBA 3BALA 1KFUL 3MFCA 1NCRC 3LB9A 2VJXA 4QKDA 4RHV1 2A6YA 3CHXA 2BV4A 3BTAA 5FZHA 5DAWA 3KT7A 1ULCA 3MIEA 2B45X 4Y24A 5F6LB 4JKMA 2B5HA 4KL1A 2PTMA 1RUOA 3T0BA 4RL7A 5L73A 5FZ4A 4PBOA 2UU8A 2WZR2 3PDQA 4NWVA 5FZ8A 4BIOA 1OMIA 5CAZA 1XYOA 2E6VA 4RQPB 1DZRA 4BLJA 1A78A 1V6OA 4BZ4A 2R073 4O9EA 4DRVA 1VBE1 4LITA 3VBRB 3ZLIA 1ZA4A 4GWIA 1PX4A 1POV0 1US2A 1BXHA 3DN7A 3W20A 4FPYA 3T1MA 5FZ7A 4KU8A 2VMEA 3ASIA 4W65A 3K4AA 4L97A 3KSCA 3VD3A 4QXCA 4AF9A 4P02B 2YFZA 1JS9A 2IVJA 2ZMNA 2ZBJA 4JGZB 5CA6A 4W6YA 3LA7A 5BNOB 5BNPB 2D7FA 2MNGA 4AXOA 1D7PM 3WNLA 3MI8A 2B46X 1R091 1XNAA 1TNRA 2Z4FA 5FQ0B 4MUVA 3HIFA 4K8FA 2W1UA 5SV5A 3SLIA 4P9YA 2YU2A 1SQ4A 2VTFA 2H0VA 4PDWB 3VZKA 3EJKA 2O0OA 3OGRA 1N1SA 4XF9A 3SH3A 4DY5A 4E8CA 1MZEA 3I2IA 5FMOS 5L9RA 4NPLA 5FUIA 4B4RA 1ZM1A 3HNBM 1E5RA 2A7AA 4UW4A 3JU9A 2DBNA 3ACLA 4C1WA 5C8CC 3RG0A 5D8AB 2L9LA 1CAUB 2VZTA 1CN1A 4XETA 1VRH3 5CU1A 2VU9A 3O1UA 2PXJA 4M4PA 1RUC2 3I59B 1JZ5A 1WMFA 4NIDA 2P3JA 1PO13 2BOIA 2VMCA 1W8UA 1O4YA 4Q5OA 1AR83 4P9LA 5H9RA 1HDKA 4IL7A 2OQ6A 4R4ZA 3I3EA 1Q3EA 2R072 5FK7A 3R4UA 4A6OA 4CDUA 2FCTA 5LY1A 2VQ0A 2C24A 4Q4V2 4BXSV 5LEJA 3RZGA 3MYXA 1EV13 2Y26A 3PU3A 1ND2A 5FXZA 1ULDA 2J42A 2W5FA 2VZSA 4XC9A 4AHYA 3HQRA 2Q1ZB 1TME1 1V00A 4B1MA 3VDCA 2HLEA 4GULA 5IW0A 1UY2A 1NCQC 2F4LA 5BV6A 3BIWE 4D6QA 1LU2A 3POBA 3VKNA 2GMEA 2G9GA 4IDZA 4ASLA 1C8M1 2XL7A 3B3QE 3ZSLA 3AKQA 2R062 1REDA 3HN3A 4NN0A 2RJKA 4N53B 4NRPA 3WNPA 1A8MA 1O5LA 1CQ9A 1LEDA 4GMP3 4QQ2A 4IQPA 3VBRA 4QPGA 5KWRA 1QQP3 3JBG1 1Y7BA 1GSLA 1SLTA 2VR4A 1S0EA 3KV4A 1ND2C 5JOXA 4RR3B 3TEZA 2Z2SB 1C8M3 5A3OA 3JD73 2DVBA 1QKQA 1SACA 3ZMNA 4AW7A 4XDQA 4E2GA 3L9JT 5FLHA 4BE3A 4FPGA 3K2OA 3LF7A 5A33A 2EVXA 3AYDA 1R1ZA 2VNGA 4NIGA 3OUHA 2PAKA 3FL7A 1O8SA 5SV8A 2WFF2 1HX6A 1PVXA 1MZ6A 1J1TA 4EN0A 1G9FA 1BEV1 1GQHA 1I6XA 4Y1VA 1JH5A 3MPPG 2H0BA 1AR92 2HWE2 2O14A 2XJTA 1WUVA 4FFFA 4W8JA 4OHZA 3VLBB 4HOOA 3ILRA 4LKFA 4XHBA 2VE1A 3PIJA 3Q8BA 2R6QA 4DXTA 1JZ8A 4LR4A 2LW8A 5LA1A 1J83A 4JGZA 1W8HA 4NOTA 3UL2A 2MPFA 3HNYM 3AL5A 1LRHA 5HPOA 2XG3A 4QPGC 2PHWA 2JEMA 3OY8A 4E2QA 4XOGA 2B9UA 1G9AA 3ZKYA 3S7IA 2GNDA 2W87A 5A70A 1PMHX 3C7FA 1Q8OA 4YVSA 3OSDA 2F4PA 1NY71 1UY1A 1LOGA 1W8OA 2GP3A 1OVPA 2ILMA 2IXIA 3IKWA 2ZEXA 3M3EA 3TNQA 5KXDA 4ZU4A 5FWEA 1SFNA 2YHJA 4JC1A 1WWYA 5FUNA 5KR7A 5K8SA 2EXHA 3DPRA 4Y5Z0 1WW7A 2BWAA 4YPJA 4AHZA 5J36A 5JIUA 4XQWA 4RS5C 1TG7A 1L3JA 5T55A 5FKCA 2W08A 3CEWA 3HJRA 1LGNA 4JGZC 4KI5M 5JOZA 4BQ5A 2KA3A 4LXLA 5I93A 4OQ9A 5KHIA 2ZX2A 4N90A 3LZZA 2VZQA 1PNFA 5K0UC 2YXSA 2OX0A 4CYDA 2FDIA 1ND2B 1QJU1 2XLAA 1NUKA 3H0OA 1XNKA 4RGAA 2WS91 5DXDA 1BMV1 2E33A 5JMOA 4QPIB 3BOWA 2RS11 4N9HA 3W9AA 2B7YA 2R16A 5FO8B 4TZDA 2A3WA 2Y6KA 4WVMA 4NUBA 2HWF3 5EFUA 3WNXA 1R1A2 2WNUC 4GAZA 1QWRA 4BMBA 3WV6A 4UW5A 1KFXL 1Q8QA 2QQNA 4LBLA 1W6MB 1OOPC 2VTXJ 3DYOA 4H7LA 1GYKA 2GNBA 2FMDA 4XFCA 4PJYA 1JYNA 2BGOA 4TN7A 2ATFA 1O3QA 1UAIA 2DFBA 2UYAA 4ZZ8A 1DP0A 1A8DA 1NQJA 1W6OA 3GXUA 3VKOA 1QGLA 1GP5A 1WKYA 2BBAA 1ZBE2 3N9QA 4QB2A 4IUGA 2B8MA 5K0UA 3WDYA 2W68A 4UAPA 1OQDA 4A3XA 2IC1A 1I1EA 1W2NA 1R092 2QQWA 2Q1MA 4Y1ZA 1V9U2 3LA2A 3ZYGA 2P37A 5LA9A 2RS52 4D7YA 4IEVA 1QJX3 3Q8FA 4Q4W1 2Q8EA 4BQ4A 2WNUA 1CIWA 1JW6A 3HWJA 1HQNA 5IVYA 3PUAA 2WNVA 3S5QA 4FCAA 4LOSA 2ET7A 2R7EB 3WDTA 4BK5A 1Y4WA 5JR7B 1WW6A 4NMIA 1Q8VA 4INDA 3AMPA 2JXAA 2YPJA 3M70A 2VZRA 3GYDA 5F2WA 2WAAA 4YM2A 1T6BX 2EIEA 3FBMA 1SBFA 4EN7B 4AVSA 1NXMA 4XJZA 1V6LA 3AZXA 4COVA 1UY4A 1TME2 2ZPXA 3G7DA 2P6HA 3AYCA 2K2SA 3KQ4B 3A4UA 3O14A 4URAA 4XACA 1EPZA 2MEV3 1XBFA 1YEWA 2XWJB 1UZZA 1SMVA 2VL4A 3M7AA 4HMZA 4O7XA 1TME3 1FMD1 4M3CB 5L7OA 4HETA 4CEWB 3AMQA 3WUDA 1GICA 1YO8A 3BTZA 4HANA 5ERLA 4S2FA 5DQ0A 5B2GB 5BNOC 3O1RA 4G9SB 4QKBA 5FMCA 1WA4A 3U4XA 2BOJA 3T09A 4XEZA 2J1AA 1CAXB 2ARXA 4BWOA 4CP1A 4ZU5A 2E7TA 4Y26A 1W3VA 5EV7A 1ALYA 2Y6FA 2J7MA 2CWMA 3ILNA 4RQPA 4TSVA 1WW4A 4CDQB 1W6PA 1YHFA 3SQOA 1R093 2QQLA 1RUE2 2AYHA 3POFA 5AFEA 3H1WA 3OUIA 4FPLA 1QNYA 4NRQA 4XFFA 4LKEA 1XE8A 2RDNA 3TN91 4QX0A 3POIA 5FJHA 5C3RA 3SC7X 4GKXA 1S2EA 3USSA 1STMA 4D7TA 1RUF1 1RMU3 2WNVB 3GNEA 4M0NA 2VNVA 2ARBA 4YFZA 3W5MA 2JKBA 2GALA 3EMRA 5HCBA 2WQZC 1UZYA 3O1PA 1XB9A 4QX2A 5LBFA 2JE8A 4L2NA 3GHMA 4NO4A 4PLOA 2QBXA 1R1A3 2J1VA 4CPBD 1NLSA 1LTEA 2XXZA 3MBWA 4YZ4A 5CVRA 3IT8A 1CVNA 1E5IA 1PO11 2D40A 1UZVA 2WZR1 2W47A 2J1TA 2D6OX 2IXKA 3FJSA 4XYXA 5LBCA 4E27A 4EWAA 1JU3A 3RWNA 3HVDA 1H8TC 2NMNA 3ZX7A 2NYYA 5DUUA 1LOCA 3OBZA 4M3CE 2VXRA 1RUD3 1DG6A 3O0XA 3AYAA 1OKQA 2EAKA 5EZWA 1D4VB 1EAH1 4RS5A 4YW4A 2G19A 3ECQA 4FPKA 5FY1A 1FV3A 5E8AA 4K1YA 1PHMA 1VBE3 1Y3TA 1OKOA 2Y60A 3CKHA 4WVWA 3PL0A 4AVTA 5FZ6A 1C1LA 4XF3A 3AYEA 3R05A 4DS0A 1AHSA 4FOWA 1ND3B 1GQGA 1QH7A 1UMIA 4YYOA 4UF0B 2NP0A 3R0RA 4BMEA 4MH0E 1UXXX 4BQXA 1GNZA 1IS4A 5CEHA 5FQ0A 2IXJA 2HH9A 5FZDA 4MLOA 2ZZJA 4I2OA 4QPIC 1W6PB 1RJ8A 4XXAA 3PTYA 3AXDA 1F35A 5FY4A 3NNGA 3VZNA 5IK8A 5FYMA 2PLV2 4OHXA 5GLWA 5T3NA 5AFBA 4AGVA 1UKGA 5K0UB 1WLCA 2XQXA 3RMXA 4P9WA 3SHRA 1KITA 1MS4A 3ZXJA 1Q8PA 3POWA 1YQ2A 2IXLA 4NAOA 2Y6LA 5CG9A 2EXKA 1KS5A 4MX3A 2JDZA 1ZZCA 5C3SA 3C7HA 1QJZA 3LD8A 4BXFA 2YU1A 2VCCA 4H55A 4CDUC 4K9SA 4QQHA 4J1WA 4PLNA 3WDVA 5JPMB 2QDNA 1AX1A 2C1FA 1FNZA 3RS6A 1JOBA 2P3KA 3J8F1 4HKWA 3UJOA 4IGQA 2XOMA 3BB6A 2AC1A 1GZTA 1AL23 4LPLA 2NLRA 4JAAA 3A22A 4NROA 4P9JA 4AAXA 2Y0OA 4U36A 5A3TA 5IFTA 1G86A 1QDCA 3WUCA 2H6CA 1E57A 2RR13 4Y33A 5FZ9A 5JDBA 1G6NA 3R6SA 4MHUA 1Z0HA 4COYA 3DYMA 1D4M1 5AVAA 4D8MA 4AEMA 5FXVA 1EP0A 2P4EA 5F8PA 3DF0A 1AL22 5CNAA 2Y6GA 2VBBA 5LBEA 1W2TA 1H2NA 4BLIA 4UBHA 1PK6B 4GQ7A 4FOQA 4N53A 4YARA 4LUKA 5C71A 2VZVA 4F83A 1OXCA 2PELA 1RUH3 3CL1A 2YV8A 3QH6A 1AXZA 2E32A 1DU3D 2W46A 5EJZB 5FYIA 3UGHA 3WW3A 3ITQA 2XLGA 5LASA 1LECA 1YQ5A 4FPEA 1UD1A 1C8NA 4W4ZA 2UY9A 4MGQA 4LBJA 5KBFA 5F2SA 5LEKA 4OI4A 1C3HA 4Q4Y1 3J9SA 3UETA 1JHNA 5CYYA 2GZWA 4AVVA 2VGDA 4LO5B 1FOD3 1VRBA 4KG8A 2D3SA 4AYUA 2W2IA 3O1MA 1YFXA 4MVTA 2DCYA 3VD9A 4CEYC 5F5IA 4P5HA 3LDBA 3V56A 3VBFB 3RNSA 4XZPA 2SBAA 4RQPC 4N53C 3U4SA 1GUIA 2P2KA 2VW0A 3NVCA 1KEXA 2XLFA 1JBCA 1OFSA 2J22A 4UFMA 1PGW2 2ZCWA 4LULA 2VUCA 2DTWA 4LBQD 2QZ3A 2C0ZA 2OQ7A 2X8KA 3FLPA 3E6BA 4YVSB 5JXJA 1ZVFA 4OI2A 3RWKX 1C4RA 5C9AA 4E4DX 4ES9A 3CBNA 2UYBA 4MYEA 4CUCA 5ACA1 3PURA 1Y43B 4PIXA 4DIQA 1WLWA 2DCZA 4UYBA 1PM7A 4HN0A 4UW3A 1BHGA 1J84A 4CXYA 3HAGA 1MEC3 1BK1A 5CKQA 1RMU1 4LBMA 2E31A 3KGLA 2V73A 3AJZA 3LPGA 1UKRA 1QOSA 3KB5A 3UNPA 5EJ1B 1JUHA 2YUEA 4XFAA 3U78A 4MOAA 3AP6A 3K48A 3WG4A 4ZKTB 1VE0A 5FZOA 3OEAA 2Z69A 5FPLA 4AI1A 4CDXC 4YW1A 4MXWB 2N7GA 2XHNA 1SCRA 3RZZA 3FHQA 3U1XA 4DXRA 3B01A 1DF0A 4CP9A 5JWPA 1W9TA 2OXBA 4DNYA 5APAA 2PMWB 2WNOA 4K8RB 2D5FA 3S30A 1WGPA 3OGVA 4K40A 2JDHA 3WF2A 5EXOA 5GLVA 4PI2A 2JDYA 1RYYA 4BYYA 1CONA 2B39A 4LHKA 1OLME 2QKDA 3O5SA 2VMDA 1VIWB 4A44A 4E4SA 3MF9A 4I0WB 3ZIXA 1G7YA 3NAPA 4CU9A 2IVIB 4K21A 1ZRIA 4IEZA 2WJSA 2ZGNA 3FX3A 3KWVA 2YPDA 1AXKA 1S0FA 4KGQA 2VUDA 4DZGA 3GF6A 5A3NA 4QX8A 2QQUA 4UOJA 3IDCB 3WF1A 3Q8AA 3B93A 5C9AB 4D0QA 3ZM8A 3VDBA 4YZ2A 3LIGA 3O0VA 2WKKA 1GU3A 4V1PA 4A3ZA 2VW1A 1T2XA 3SEEA 2HWD3 3UV9A 4EZ4A 3HN1A 3KT4A 2K46A 1ZREA 2EIBA 4A7KA 4CRQA 3D4KA 1POV3 3KD4A 4CDWB 3F95A 1V0AA 4Q8KA 2QZ2A 5FZMA 5EQUA 4FPJA 4IEYA 1OUXA 1OH3A 3AP9A 3PIGA 4HONA 3M3QA 3AX4A 3N3HA 2FMYA 5A7NA 3URFA 2SLIA 1RUH1 1WD3A 1VBE2 2XR4A 3N9MA 4GJYA 4RYDA 4AG4A 1UU5A 2G9FA 4QX3A 1GLHA 5DDJ3 4CTEA 3BYWA 1QJEA 2VOXA 1IG0A 1Q8SA 1H8VA 1TQ5A 4ZU7A 4XFGA 2YC2A 3ZN6B 4RA0A 5IVVA 1S1AA 3FUQA 2JB4A 2DUOA 3CDZB 5FZBA 2P6CA 4CDUB 1F9KA 1BEV3 5A3PA 1D4M3 3ZFGA 1W99A 4EN9B 3LFIA 2XPJA 4DB5A 1SBDA 3F2ZA 2WNEA 2RR11 2HBUA 3VBOC 4RHV2 4ZXKA 2VULA 4L11A 3VBSC 2ZEZA 3I2DA 2JE7A 3WOGA 1YXWA 1S4CA 4LKDA 3H8UA 1SLAA 3WDXA 4Q1RA 4QB6A 5F3GA 4HKLA 4XJAA 5C8CA 5F9TA 4ES8A 2VCMA 2D43A 5FY9A 4NIIA 1CAXA 5G04L 4RR3C 1OOPB 3ZFEA 2JKXA 4ET7A 1VMJA 1QXRA 1MS3A 3S0MA 4Y3OA 2QQKA 3AM2A 3DECA 4IXLA 4IEQA 1HJGA 3ES4A 1DGRN 1GZCA 5FPXA 4FQ4A 1DGLA 2AZ5A 2WINB 4XJUA 3DGTA 4GWJA 3GGLA 1YQ6A 1OA4A 4ARXA 4FP2A 5E16A 4XF4A 1ND3C 3AKRA 3PNAA 1SBEA 4WM8B 4LA3A 5FZEA 1HXS3 5D2AA 5IFPA 1LOAA 2K9ZA 1QQP1 3L2YA 3MO4A 4YGBA 4KNCA 1W2UA 1O3TA 3K51A 3QACA 3VBHA 5C3PA 2DCTA 2ZX1A 4M3CA 5L7OB 1DYKA 3WQ0A 3RDIA 1YLLA 1IGOA 2RJLA 2XDVA 3MGUA 4FOVA 1K5JA 3LDRA 3WNMA 3SEPA 3LPFA 5JI7A 5F37A 1H2LA 3K46A 4IGOA 5DZFA 1PGL1 1BVP1 1SPPB 2ZABA 3MLLA 1Q5OA 4AL9A 1ZZ8A 3A0KA 4HK8A 4M4RA 1VP6A 1NYWA 5T54A 1JI6A 1ND3A 2ZA9A 4LLFA 4W50A 4BU2A 1F4AA 3RQ0A 1BBT1 1BQPA 4FQZA 4BISA 5J1XA 3WVJA 2ET1A 1OPMA 1HB2A 2NZ9A 2UURA 1X9TA 4MG2A 4QPGB 2XUEA 1UPIA 3KMHA 1AX0A 4OZXA 4O61A 3PVBB 2R042 1RUJ2 2YG0A 1NOVA 4W6XA 4YFWA 5C5UA 1GOFA 2I2SA 3THCA 2XGXA 4S2DA 3IPVB 5BXXA 1HXS1 3RYPA 2BERA 3EO6A 4IE6A 4HPKA 5DAXA 1TEIA 1FMD2 3C2UA 5LB6A 3H3UA 2WAOA 4AQSA 4DEVA 1LOBA 2JG8C 2WN2A 4JDNA 3WP6A 2X5IA 3CLPA 4D7SA 2QDRA 3NAPC 5BNPC 3O1VA 3A0NA 1XNDA 5GLZA 4HSLA 1J59A 1QEXA 1MQTA 4Y1UA 2IUWA 1MZFA 4XDOA 3BCWA 3BIEA 2DF7A 4XUNA 1SFYA 5FREA 3ZSMA 4FPFA 2RMU2 4XF1A 4XQDA 3VN4A 3NQHA 4JVAA 5HXVA 2XJQA 3VZLA 1F15A 3WDWA 2DV9A 4DXZA 3MFAA 1VBC1 2DUPA 4IV1A 4DPNA 1EAH3 2JECA 4ISQA 4XMAA 3AVRA 2HWF2 1XU1A 4WVZA 4Y4RA 3SITA 5I0SA 1DDLA 4IEUA 1W03A 1W90A 1PO21 2O1QA 3H50A 4QPIA 4QGNA 3O0WA 4JZRA 2RM22 3FFQA 4IW3A 4MADA 2HWB2 1ENRA 2PHDA 3ETPA 4JGYA 3IN9A 1K3IA 5F32A 3RRDA 2KR2A 3VV1A 4HT1T 1O6UA 4XTMA 3TEWA 1U5IA 4PQ9A 1NCQB 2ZTNA 3ZVXA 4KG0A 1CD3G 1JZ4A 2ZOEB 1JZ3A 3VKFC 5JSRA 2E63A 1JOJA 3ZXDA 1YI7A 5C8WA 2Y0IA 1COV2 3BPZA 4AR2A 1KS4A 4IV1C 1L7QA 4XMIA 3T08A 4AGGA 1QIQA 2EXJA 4LE4A 5HBAA 5IYYA 4Z92B 1F5JA 5C70A 2WT2A 2Z42A 1OHFA 2TBVA 4K3UA 5EYXA 3ZXEA 3MIBA 1B35B 3GJAA 1WMDA 3ABZA 3B9IA 1ZZ6A 1WCQA 5C4WB 2BEOA 1US3A 3H7JA 4PLMA 4FSJA 1CAWA 4B3NA 2Y6HA 4I30A 1J3RA 1S0IA 1V70A 3LEMA 1C57A 4OVEA 5GLTA 5CFCB 5F3EA 2EIDA 3ZYIB 4YNIA 1XSQA 1IS6A 1W0OA 2GNMA 2WNVC 1RUG3 4YVWC 4HVQA 5BNQA 1IQDC 3QD6A 4Q4Y2 2VVFA 5E89A 3T0AA 4Q0VA 3WP5A 1GR3A 5A7WB 1J3QA 3R4DB 4IETA 1W6MA 4KU7A 2DUQA 4KMQA 3DXTA 4LJHA 1HB3A 1HLCA 2CGPA 5FBZA 2IXCA 2HWC3 4PDWC 4Y22B 4BOWA 1S0CA 3NJZA 4D94A 4MGTA 1AL21 1K12A 1KDMA 3ZDVA 1HN1A 4ONUA 4P9IA 3FUOA 3CJIA 1W6OB 3MV11 3WDUA 3KQRA 3PUIA 2VQAA 2ZGPA 3OGSA 1VB4A 1LHVA 1RUD1 4G3YC 3BKZA 2FZ2A 4RSUA 4FAGA 3LWCA 4ATEA 4C1XA 4E8DA 3ILFA 4OI0A 4JGYB 1QJY3 5L19A 2VO5A 4I09A 1PO22 1XOYA 1SEFA 4TYSA 1VBD2 3WR0A 3WW1A 1HQWA 4QKNA 3I2FA 4JKLA 5LY2A 3VBUC 4RGKA 2ZACA 2XHKA 4N7UA 2IXHA 5FZAA 2FQPA 2VVDA 4B7EA 2PHTA 5B4XA 5LRSA 1RITA 2A3XA 5I0TA 1AF9A 3ME2A 3RSJA 1FYUA 4CU8A 4QT6A 1FOD1 3T2OA 2BQPA 2RVAA 4ZZ5A 2W1WA 4D6RA 1Z7S2 2XB6C 1FPN3 2XUMA 4LUMA 3PLQA 4QM8A 1ZRFA 1A6CA 1N1YA 4CCLA 1R082 4HBNA 1ZBA2 5D8AA 1GWKA 5F7UA 2QJVA 4BQYA 3O1OA 5T50A 2YC4A 1HXS2 3ZR5A 1X8MA 4MGSA 5I91A 3RZLA 4GKYA 3M4FA 4EJRA 3ACFA 3VBUA 5C4WC 5IK5A 1VBA2 5A1LA 2E7QA 1MQTB 2GDFA 1DQ6A 3AK0A 4KBZA 4Q0QA 1AR61 1FPN1 1PMJX 3MW2A 4IV3C 3USUA 5C3OA 1GP6A 4XFIA 4ZXEA 5JMCA 1FX5A 1XPWA 2BGCA 2WYSA 2PHFA 2DVFA 3I3BA 4M3CF 1BBT3 4IV1B 2DBIA 1DGWA 2BUKA 2YZ4A 4MO3M 3VDAA 3POJA 5ABJC 1DZTA 1H8TA 4A6SA 1RUC3 4QMAA 2B42B 4H2AA 5FPUA 3I3MA 4ZY9A 4A2UA 1W05A 3LEIA 4P00B 1MR5A 1H4HA 3AMNA 5ISLA 4OUEA 1RHI1 1XQNA 2X09A 4HG6B 5F3CA 1GMMA 5FR3A 4LOTA 4R4XA 2VM9A 4A45A 4AEDA 1GFF2 2ETEA 2XKOA 1FNYA 3K4DA 5EP9A 4LNVA 3N4MA 4SLIA 2O8QA 2VCBA 1UMZA 1S0JA 5HCHA 2HWE3 3ZMOA 1UOBA 1YIFA 3GDBA 4I0BA 2XJSA 1O4TA 2CAVA 1LHUA 1H1IA 2WFF3 2Z79A 2OKXA 3M3IA 4K1ZA 4P5YA 3V0BB 2R0HA 3PVNA 4DRRA 1WLTA 2LUWA 2AENA 1HRV1 1LKNA 1W6QB 1O8PA 3E1F1 2BFUS 4QU1A 3MF6A 3RJ2X 1DIWA 1VALA 4EZHA 1OBNA 1X50A 3GBFA 1JOPA 3ZO0B 3KV5A 4Y22A 3VBOB 3CJIC 5T5JA 4LBQB 4J6GA 3ZSKA 1G9CA 2G4IA 3MIFA 3TBDA 3NL1A 4NPMA 4RS5B 2WQ4A 4XIKA 2PLV1 2RS31 2HEWF 3C7EA 4FPOB 5JXHA 5DMYA 2YY1A 2PYTA 5IT6A 1HRI1 1Y9QA 4HN1A 2VQTA 2CAUA 5FRAA 2D93A 4UW6A 1VBA3 3GBWA 3O12A 3EQEA 1U5XA 1IS3A 3VD7A 2HYKA 3LOIA 4OZOA 4QB1A 1XE7A 2RV9A 4XUOA 4OI1A 3H8OA 1LOFC 2VOTA 2WZPP 3TAYA 1QJX1 4K6BA 4WM7B 2R0FA 5J98B 3DPRB 4NR1A 1OLMA 4WM7C 1X33A 4Z2AA 4FTSA 1FPN2 2WL1A 1HV0A 5A80A 1AR72 4JX0A 1VBA1 3KLSA 4Y20B 5LBBA 3RZKA 1HV1A 2JD9A 3JD71 5A7SA 2WO1A 5AVPA 1JHJA 4RN5A 4CDWC 4QAWA 3I4IA 1MS9A 1UYPA 3J4UH 1QXPA 3IDAA 3PUHA 4TTGA 1V6MA 3A21A 3EHKA 4XJWA 2W94A 3G6JB 2DCKA 4LQRA 5FZLA 4LT5A 4CEWA 4MGKE 3VBHB 1TMF1 2Y33A 1PO12 4CCKA 3POGA 1UQXA 1YJLA 2VBPA 5FXWA 2ZAHA 2CWSA 2RMU3 4X6RB 1AXYA 1XU2A 3UKTA 5I8SA 2V5YA 3POEA 2DVGA 3GJBA 2DYCA 2YC0A 5IVCA 5J48A 3I8TA 2WFPA 4Q4W3 1W8NA 3B7MA 3WZ1A 2JENA 1WZXA 1DZQA 4CCDA 2AREA 1RUE1 2FDKA 2ZX0A 1IOAA 4V2WA 5GZDA 1ACCA 3BTXA 4AEDC 5DUXA 5IVEA 1UMHA 1X8EA 5C6CA 4QGLA 1RB8G 3PVOA 4CCOA 3FHIB 5AC91 1S2KA 4ZPIA 1XYPA 2C9AA 2Q8CA 2DTYA 3I2GA 1S0BA 4META 2VAUA 3FWEA 4JV4A 4AFBA 5DG1A 1JUIA 2D6NA 2MEV1 3OBAA 4XJ8A 2XJUA 5FZ3A 1ZBA1 4FFIA 5F1RA 2ZKNA 3I2OA 2Q8DA 4ASKA 1QF3A 1ULGA 2PHXA 2FCVA 2RDQA 2R49A 1R1A1 3EBRA 2JJ6A 1RUI2 1ASJ1 1PIV1 1K42A 4ARYA 5J37A 1S2BA 4FPCA 4XCBA 4MGIE 5ANQA 3T1LA 1FOD2 1HB1A 4AVCA 2NM1A 1BMV2 3KGZA 4NE9A 5DZEA 3O1TA 3RPQA 2VMHA 4QWNA 2WSUA 2IWGB 2G1MA 2CDPA 2YBPA 3AB0A 1D2QA 3B00A 4JHTA 1LULA 4NVPA 5BNNA 2CNAA 1RINA 4NHXA 5IAXA 1H30A 1HQLA 1SLBA 4JHZA 2EA7A 4ATFA 1NQDA 2WNUB 1VBD1 2QUOA 4JTNA 2GN3A 2ZHNA 3PJYA 3ZYRA 2FDHA 3AC0A 4YZ3A 1DCSA 2PQSA 3JZVA 5BPXA 4EN8B 2RS51 2DU0A 2YDEA 3OD0A 4X8PA 5A3LA 2CV6A 2LM3A 4KGGA 1H1MA 1V9U1 4CXWA 1DLCA 4AGRA 3CU7A 2JIJA 3OGJA 2XVKA 4CP2A 4FOYA 3DCQA 3RI8A 4IESA 3AL6A 4J25A 4LO8A 3INAA 5TSWA 3WSOA 5K4LA 3MLJA 3MUZ1 4UBGA 3SXWA 5BYNA 4D3WA 2HEVF 2C6SA 1UF2C 1I9RA 4O65A 3DL3A 2JG8B 3UKVA 4QD2A 3QCWA 4DINB 1OLQA 5CKMA 2W91A 2JDKA 1VBC2 2QQIA 1IS5A 5KC5A 1EUTA 3AZWA 4K7JA 3PMSA 1BEV2 1PK6C 3VHPA 2VZOA 2FD8A 3POYA 3ZFGC 2KD7A 4FI9A 3BTYA 3BUCA 5FPVA 2GU9A 5FWJA 1ZRCA 3LOBA 1JODA 5HCFA 5FLJA 1LENA 2RS12 3DXUA 3BVCA 5JVVA 1RUJ3 2BFUL 1XC6A 4CVUA 2HBTA 2VOWA 1VAKA 4C8DA 1YYNA 1OQ1A 1RVF1 4GH4A 3ZFFA 4IEXA 4YVWA 3SH4A 1BVVA 5FYYA 2KXLA 3ZKUA 2Y64A 2Z5WA 3M3CA 4XF0A 3TOJA 3IM0A 4LBKA 3RFRA 3GBGA 3PUQA 3OJBA 1HJFA 5IK4A 3IZOA 2OT7A 4IERA 4B7KA 5T5PA 1W39A 1X9PA 3E5UA 1C5IA 2R061 3AXEA 4HK9A 1PGSA 2P17A 2VZPA 4Z1VA 4UFLA 4UFIA 4PF5A 3V0AB 2ZHKA 1DQ2A 1VRH1 4EROA 2X29A 1VLNA 4S2GA 2TUNA 3KCXA 3V64A 5HCAA 5L7OC 4BM8A 2WWUA 5GZGA 4AK3A 5LA0A 4KQ7A 3JQXA 3HPNA 2AUYA 2C9KA 3KHCA 3OBTA 1TVGA 2Q1FA 2RE9A 4OMCA 3THTA 2BWCA 3UT0A 3TEYA 2CU5A 3J7NA 5E6HA 3VHRA 5AC93 5LK5A 4QXKA 2A5ZA 3JQWA 1W9YA 4FTBA 3HT2A 4CU6A 1BKZA 3IMMA 2GMMA 5FZKA 4AHXA 3KVBA 4MGYE 3ZR6A 3ZYJB 3RGBA 4Z2WA 1RUNA 1S0GA 2RMU1 3ZYFA 5KXCA 1AYM3 4BCUA 2GC0A 2XQRA 1MEC1 1REFA 4WV8A 4AQ6A 1NCRA 4BA6A 2WYFA 2NPIA 5EJ3A 3I59A 2E53A 1ZNPA 2EALA 3AKTA 3VHOA 1AR63 2JDMA 5I8TA 4XABA 3ZOIA 1RUF2 1X36A 2R071 4Q4X3 1AZDA 4MXVA 5JI9A 2JWPA 3S6PA 2WZ8A 1W0NA 4COUA 5JOYA 5JAXA 2D44A 2WC2A 5FMDA 3J26N 1W6QA 1O7FA 2QQOA 2XBO2 3USUB 3WF4A 4BDVB 1W9WA 2VBDA 3VBSA 5ABJB 5A32B 1IKPA 1GOGA 1LEMA 3JBG3 3NJXA 2WA4A 4V2VA 2DWRA 4YGCA 4OUSA 4YM0A 2JD4A 5DN2A 4R9AA 3U37A 4OHWA 2ZEWA 2WBKA 4Y4YA 3H3LA 4LTAA 3VZMA 1BJQA 3ZN5A 1W9SA 4NIAA 4J1XA 3BODA 1CX1A 1IHMA 5T52A 5C3QA 1MPXA 5JLVA 3NKTA 4Q4Y3 1K5MB 2E7AA 3P6BA 4HSJA 4LBNA 5FP4A 1AUYA 4RFT0 1JYWA 4DY3A 2ORXA 1NE6A 4CP9B 1PK6A 3VDDB 1UOGA 5D8AC 1XYNA 3UGGA 5EPAA 3VDDC 2BTVC 4XFHA 5FPAA 3WG3A 5FYBA 3AP4A 5L9BA 2WQ8A 2E26A 3O7OA 2UY8A 3D82A 3IDEA 3CQOA 4Y20A 3A23A 1SCSA 1T6GC 2ES3A 1WCSA 2XMLA 2TNFA 1QJFA 3K4ZA 4QX1A 2A6ZA 2LALA 5CB7A 4CDQC 1AVBA 5L9VA 3E5QA 1ZZ9A 2WO3A 3LEGA 3OOXA 5A32A 1FXZA 1OQEA 5FO7B 1W6NA 2CTVA 1CZTA 4TXWA 5A3UA 1UY3A 3FE5A 2XJRA 3AZZA 3ZYHA 5FDBA 5I0DA 4YW6A 5DAPA 2A70A 1CPNA 1ZYBA 1WBLA 2H6BA 3HOBA 4M01A 5GZFA 3PHMA 2TEPA 4X8NA 4AOCA 1KGYA 4A7YA 1E5HA 1DYOA 4QHBA 1XNTA 3GZEA 4YG3A 3DV8A 1CR7A 4JQTA 2NN8A 1DFQA 1QJX2 3RI9A 2RS53 2KM2A 4PF1A 5CIRA 2HWB3 3N7KA 3CF6E 4A41A 1V9U3 4IE7A 4NJ4A 2J1UA 3NV3A 4R9DA 1VMFA 2ZXQA 3VBFA 2GP5A 1UIKA 3GCXA 4E9KA 3T2TA 2XBO1 1HRI2 1EYBA 2QCSB 4E2SA 3V0BA 4CA9A 1FATA 2X53S 1NA1C 3OYWA 3WHTA 1BK0A 1VPHA 1VBD3 2WSVA 3A7QA 2CL2A 1OC1A 3R4SA 1YI9A 5F3IA 4BH9A 4AEJA 4CZSA 1ENXA 2FHRA 3ZPYA 1RHI3 4L99A 2D6LX 3HQUA 3RZJA 3NNJA 2HWD1 1LODA 2A75A 1O4ZA 1JN2P 4Q4X1 1K45A 3OPWA 5FMBA 3WW4A 2GC1A 2VOKA 1YWKA 2Q0AA 1LHNA 2WT1A 2X5IB 2QQVA 5FKBA 2WS92 1IKQA 1DLLA 1FAYA 4LK7A 1Z78A 5FZCA 1O59A 1UW8A 2FDJA 4XBNA 4HVOA 4QXHA 2FZ1A 1NZCA 1Y9MA 1QDOA 4GJZA 1MEC2 2GAUA 5GZCA 1WW5A 4AI3A 1LESA 1QXJA 5DDJ1 4XBLA 3MPBA 3N35A 4JCKA 1TNFA 2WLQA 3V65A 1PVC1 3BI3A 4UF0A 5KXEA 3GZAA 1F5FA 1LAJA 1RGSA 4BQWA 1ULPA 3PJQA 3VD5A 1UXZA 3OEBA 4M0HA 4F7ZA 2D97A 1NA1B 1KQRA 3KF5A 3JXSA 3B69A 2QFEA 1MS5A 3D8CA 4XAEA 3LSDA 4QHOA 3QH7A 1N3QA 3KT1A 4AVBA 2D6KA 4A42A 5KHKA 4HKOA 1JYXA 1RUG1 4BQ2A 1X82A 4BHPA 1N3OA 1CAUA 2I74A 3ACHA 5ABJA 4OULA 2VW2A 1W6NB 1IQAA 5JZGC 3AFGA 2LROA 4NHKA 3WQBA 1LR5A 1UZ0A 1N47A 1PNGA 2CSGA 4YM3A 1I3HA 3LE0A 1CAVA 1GV9A 2VMFA 1AYM1 1WA6X 3CNAA 4YGEA 1C5HA 1R083 4HPKB 3B5LB 4XZUG 3SCGA 5GALA 5GM0A 5C9AC 3NNLA 3D0JA 5IVJA 4GB31 1G8WA 1Z7S3 2FBEA 4ISRA 2IZWA 3HNMA 4F8AA 1TMF3 5HXMA 4QU2A 4H7MA 4HXCA 3ZSJA 4C0HA 1NT0A 1RVF2 2ENRA 4A4AA 1AR91 4IE5A 2JG8A 4FVVA 5BY5A 1HKDA 4PI0A 1RTVA 3I97A 2RM23 4I3GA 3LIHA 2OUHA 2QNKA 1POQA 4FPHA 2CGOA 3CZUA 2PA7A 2AACA 3H7YA 1DQ1A 3HT1A 5FZFA 4FXGB 3WG1A 2ARAA 4ZHNA 1UYZA 1IZ3A 4A7ZA 1OT5A 3OB8A 5M0TA 1WCUA 2F17A 1W2AX 3ZFEB 1YCIA 1BYHA 2VOVA 2YGLA 5CFDA 3SCHA 5I0RA 1QJY2 2XBO3 2ZAAA 3NV1A 3W58A 1M06G 4AQ2A 1VB2A 1W06A 4YZ5A 1RMU2 2EICA 1RXGA 3AKPA 5FZ1A 3FHAA 2A6WA 5IUQA 3H8RA 4RHV3 1YQ8A 1UIJA 2W0XA 1ULOA 1NA1A 4AWDA 4JQRA 4NPRA 3H3ZA 2G9ZA 2VZUA 2GC2A 1XRUA 1D4M2 1IG3A 5DG2A 1F8VA 4BJ0A 2X10A 1RIRA 4CCJA 3ALQA 4GMP0 3B9CA 3MDPA 4KWJA 5FZOB 4DUWA 4Y5SA 2HWB1 1KDKA 1PVC2 1W0PA 4QPYA 2JE9A 3MEPA 4IEOA 4QQPA 2D98A 5DDJ2 1AYN1 3ZFFB 3MIDA 4N43A 5IK7A 2Q4SA 4WZFA 1OA2A 2ZGMA 5CISA 5FY0A 2C4XA 1G9BA 5FAXA 5CFDC 1JTZX 4HZFA 2EAAA 1CJDA 4C90A 2D6MA 1H4GA 4Q0PA 1KD7A 1BLZA 1HRV3 4Q4V1 5FOJB 2IFWA 2OUJA 1UZWA 2Q5TA 1E5SA 3P3NA 4QPWA 5CZKA 3VZJA 1SDWA 3TEXA 1WCKA 1LGBA 2WFF1 4GZ9A 5HV4A 2Q8OA 4LO4B 2MEV2 1J3PA 2VNOA 4WVVA 4QQLA 5CKNA 1UL9A 1ASJ2 1PIV2 3H1MA 4ZS3A 3W5NA 5FP7A 2BNNA 4I0AA 3Q8EA 2A73B 3LKJA 2BBVA 5T5OA 3KVAA 2HWD2 5A6XA 3AFKA 1EUUA 1SHWB 3NNMA 4CEYA 3O1SA 3I54A 4LHLA 4YW3A 1COV3 1LOFA 1QJU3 3NJVA 1W2OA 4DO0A 1CAVB 3NW4A 3N9LA 5H9QA 2PHLA 4AQTA 2GC3A 1CZVA 3PTRB 4N43C 3D5OA 5FMOL 3SMHA 5FZ0A 1SPPA 5LATA 1W8WA 4YLZA 3GZTB 5IWFA 1D0GA 3GCWA 2JX9A 1CX4A 4ORFA 3WQ1A 4Y1YA 1H8TB 4IE4A 1A3KA 3T30A 4FT8A 5F39A 1CJPA 2WO2A 2XONA 3M2MA 1SDDB 1V6NA 1MS0A 4RGGA 1RC6A 4UI9L 5DZGA 1EAH2 1YNAA 2RM21 5I8YA 2RS33 3FZ3A 1PGL2 4UFKA 3N9PA 2BVVA 3IAPA 2ZS6B 2QQMA 1YQCA 2MHFA 3FLTA 1NZIA 2ZX3A 4GIQA 3RYKA 4YW5A 1WD4A 3VKMA 4CDXA 2OYZA 1JMUB 1K5MC 4H14A 4IEPA 4OHVA 1LHWA 2UWCA 2GNTA 2I45A 2P5BA 4CCNA 3S5AA 1DQ4A 3IIIA 1QQP2 3KZ4C 1ULEA 1KXGA 3DYPA 3MV01 4PT6A 3ZFGB 3ZXKA 3OY8B 5A1FA 3VGIA 3ROUA 1N1TA 1OVSA 3AKSA 1H6XA 2VC9A 3I3QA 1TZOA 3KCCA 3VBUB 4D6SA 4EYUA 5IVBA 2A1XA 3CZJA 4YWAA 1O3SA 5A3MA 4F3JA 1PZ8A 2CYFA 1MS1A 3OF1A 1YJKA 2YROA 1YFYA 2ZGTA 4IV3A 3WP4A 1O5UA 4WVMB 4Y1XA 4H3WA 1RXFA 3ZDSA 3VUOA 5FY7A 4KWUA 1B35A 1B09A 5JZGB 4WM8C 1A34A 2ZGSA 3MUY1 4FFHA 3T3YA 2XVGA 3H42B 3MLKA 4NHMA 1LNSA 4XAAA 3W21A 4FO9A 3THPA 3ON7A 5FP9A 1HW5A 1CIYA 3I3DA 1OUSA 5EYYA 2K0GA 5FYSA 1QNWA 2JICA 4JDOA 5EIYB 3IWZA 2BPA2 1OD5A 2VXJA 3VB9A 3RYRA 1HRV2 3OG2A 1Q56A 3AP7A 4GXLA 4YRDA 2WT0A 4UFHA 5GKAC 3VDDA 5CFCC 4UT5A 3WCSA 4BB3A 1JZ2A 3D0SA 4B1LA 4WZCA 1HIXA 4GALA 3ZFFC 3ATGA 4XPVA 5DAVA 1JYIA 5DAQA 1Y9GA 2JB8A 1PZ9A 1RUH2 5FYHA 4CDQA 1M4WA 3I49A 5A6YA 2WWSA 4M00A 3WQ7A 3OBRA 4QHZA 4XCAA 1ZZ7A 4XE9A 1BZWA 3NNFA 3HBZA 3CJXA 1GNHA 1MQTC 1VAMA 1I5PA 2V4VA 2W95A 5FYUA 3HD8B 1H2KA 1IPKA 3LGRA 3NO8A 3OYWB 4Z82A 2AR6A 3WLUA 4EWEA 4YSFA 3RMYA 5A7QA 1WMEA 4NWWA 1PX3A 3J8F3 1UX7A 2OVUA 3S57A 3U10A 1RHI2 5CFCA 2XKPA 3Q8CA 4KBBA 4COZA 2YMZA 4YG6A 1TE1B 1YFUA 2GH8A 5C4WA 4PIYA 1W04A 1AR62 2JG9C 5IAVA 5A6ZA 3TYJA 5JZGA 4LK6A 3T4VA 5IJRA 2GSYA 1RUE3 5IATA 1V6IA 2VMGA 1NAEA 2WIIB 3PVEA 4OUMA 3VBFC 4Q29A 5FUPA 2XVLA 4CEYB 1VAVA 1ZZBA 1JZ6A 2OA2A 2HYXA 1YUDA 4CP0A 4DMIA 5LCWL 1LOEA 2W92A 1FI2A 2JIGA 4N9IA 4CE8A 2XL9A 4IEWA 2JDNA 2NQYA 3GALA 1HN0A 3PUSA 5JXGA 4AFCA 3MHZA 3N7LA 3RZMA 1CPMA 2QVSB 1AJKA 1H6YA 2OZJA 3IIAA 4GWNA 1ZRDA 3KF3A 1R081 5FK8A 2LS6A 3TB0A 1CAWB 5JPNB 1QJU2 1NLRA 1VJ2A 5C5TA 3H9AA 4AFMA 4CEWC 3SISA 2CHHA 1EV12 3FC0A 2BYVE 5HV0A 2A71A 2WABA 2ZGOA 3NJYA 4QGMA 4DQAA 1GNYA 1Q43A 1ASJ3 1PIV3 3WG2A 5E1RA 2RDSA 1GZWA 3MW3A 3P1IA 4CUAA 4XVHA 4OLLA 2VG9A 4FFGA 2GH2A 4HL0A 4QDRA 2VVEA 5FYZA 5GJ6A 3VKLA 1JYVA 1JYTA 1J1LA 3I2JA 1KRIA 1W28A 4B29A 2DURA 4SBVA 1WCDJ 4LMFA 4Q8LA 4BIFA 5C7GA 4Q27A 1VRH2 1ZA7A 3KCYA 4OCTA 4W6WA 4MHRA 3SKJE 4XFBA 2J1EA 3E6DA 1UPSA 2BRTA 4TLFA 2VCAA 4D69A 1MVEA 1PVC3 1CGPA 1H1AA 1NKGA 1RUD2 2ZGQA 1U0AA 3AZVA 3SNMA 2CGNA 3WCRA 5LWBA 1NLQA 3HMYA 4R52A 2JDUA 1FV2A 2HWF1 1D2SA 1QJY1 3FBYA 3U14A 3N7JA 4GWMA 1W8TA 2ADDA 5FYVA 4B8EA 5FJKA 4LIUA 2PAEA 2RHPA 2C5DA 3ACGA 2CY6A 3MIGA 2ARCA 2XJVA 4JKKA 3ZXFA 2X05A 4OFGA 3VL9A 5DUWA 3ETQA 4ITCA 5DABA 1AL0G 3MZHA 1RUI1 2OZ6A 4GH4C 1PZ7A 1R64A 4YM1A 2V72A 3ELNA 4LO6B 3U11A 4JDMA 3W59A 5A7PA 1HRI3 2D6PA 2VH9A 2R1BA 3CO2A 2ID4A 3UK9A 1APNA 2E51A 2YB7A 3K3OA 4LBOA 4PBPA 1XNBA 3SCFA 1SLIA 5DPNA 3ZXAC 5J96B 1OA3A 1X7NA 1AYN2 4AAPA 4R9BA 5FBJA 1AYM2 4LHSA 2BVBA 5FY5A 2PAMA 4URTA 4P9GA 5T5LA 4B4QA 2F6BA 3LQCA 2LTNA 2WZR3 4JTOA 3BU7A 5FYCA 3ES1A 1UNBA 4AFAA 4KH9A 1O91A 2EXIA 3MICA 5JCTA 1H0BA 4LHNA 4LORA 2QQJA 1COV1 2ADEA 3QOPA 4JRAA 3IAQA 1DQ5A 2QTWB 4Q0UA 4CCMA 1PM4A 1UO9A 3NMBA 4DEQA 1NG0A 2VPVA 1F2NA 1OF4A 5FP3A 3TWIA 3VBSB 3APBA 1VMHA 2PLV3 3T2PA 5L36A 1LCLA 4Q1PA 3X29B 3I2HA 5JUVA 3VBHC 1GANA 2Y8KA 4Q4V3 1EV11 1AX2A 3POSA 1UX6A 4IV3B 2D3PA 2ZMLA 1L7LA 1P8JA 1QOTA 3HBKA 2R32A 1H9WA 2ORZA 4FXKB 3LA3A 4FP3A 4NHYA 1RL3A 4IGPA 1UY0A 1MZ5A 1XSRA 4LBQA 5ANNA 5H9PA 4LA2A 4COWA 5C33A 4NAMA 2HEYF 1H2MA 1JU4A 3NSTA 5A6QA 4ZONA 3WEZA 1V6KA 4KWKA 2HWE1 3ACIA 4XBQA 5CADA 4PHZA 2BZDA 3I7DA 5A3WA 1UN1A 4AEKA 3H1YA 3P5BA 3UESA 4GB32 3JB8A 3MIHA 3T0DA 1XXNA 3K3NA 5FP8A 3U0ZA 5DUVA 5A1AA 1KJRA 2BGPA 4UXAA 2HKXA 5H9SA 1I5ZA 1GP4A 4HVRA 3THDA 3J7HA 5FCCA 3AJYA 4I01A 4JRLA 1CESA 5FPBA 2B4KA 5J7MA 1XNCA 1EPWA 2V5DA 3KV9A 1YC61 5AC92 4YW2A 1XE0A 3EXUA 3D6EA 2RDRA 3ZN6A 2OW4A 1N3PA 3JBG2 3NV2A 2IFRA 1RUG2 2AEZA 1RUJ1 2Q30A 3N9OA 2J1SA 1QY4A 3RZHA 1DHKB 5D21A 1EY2A 2CDOA 4AI8A 2RR12 4CUBA 5FLIA 1QH6A 1C8M2 4XUPA 3S7EA 3WNKA 5B4NA 3JUUA 1JXNA 2RS32 3GHNA 1BBT2 1YRZA 5FV3A 3VBRC 5FY8A 1GBGA 4L92A 3EYPA 4DUXA 1CZSA 2WZEA 3PU8A 3VD4A 1GQPA 1ENQA 5JR2A 1CWPA 1GWLA 5FIXA 3N36A 1OOPA 2P1BA 3RJRA 4AVAA 4E4ZA 3E5XA 3M1HA 1UCXA 2WR9A 1J58A 3ZPOA 4EV0A 4AI2A 4DUVA 1AR73 2VUAA 1BCXA 1TMF2 4YVWB 4BQ3A 4R9CA
chains in the Genus database with same CATH topology
2GMPA 2DFCA 3ST7A 2BNOA 2EF6A 1PMIA 4U2AA 4WM7A 3M8LA 4XXPA 2R1DA 3L2HA 5JSOA 1C1FA 1S55A 4CDXB 5J09A 3U07A 2ZHMA 5E88A 5BUVA 4R8HA 5KC6A 1OSGA 1AR71 3WX5A 1N1VA 1ZX5A 2I07B 4CDWA 3TNPB 4MV2A 5BNOA 2Y38A 1LHOA 2O8OA 4Q0SA 3ZXLA 2HJIA 3NWKA 2DVDA 1YFWA 2ERFA 3C3VA 5GLUA 3HR9A 1C28A 5FFOC 3WP3A 4P14A 5F5QA 2DCJA 2V09A 5C8CB 4EN6B 3ENRA 1ONAA 1K5MA 4B4PA 5BNNB 5KHJA 5J3UA 4RR3A 3ZFEC 4XILA 4EWDA 3GZUC 2VY0A 4L8QA 4QX5A 2RS13 2VNRA 1O3RA 4LE3A 2HWC2 2ZHLA 4LEJA 4C0BA 1REEA 2VUJA 1QHDA 1F31A 2AGSA 4FTEA 1AR93 3UJQA 5CBLA 1ZBE3 2UWBA 5CG8A 4YG0A 1Z7S1 4DFSA 2ZX4A 4YGDA 3OTFA 4I02A 5JIAA 3VBOA 2A6XA 2PHRA 4XIOA 2NMOA 3KS7A 3VHNA 3E6CC 3SH5A 2ZJCA 4Z07A 4Q26A 4PIZA 3NAPB 2WLPA 3QLQA 3KM5A 1QOOA 4GA9A 2P3IA 1RJ7A 4MSVA 5HI0A 4RD7A 4I3PA 1LGCA 5GZEA 2ZGRA 1GZWB 1UU4A 1YIPA 2OIIA 3B02A 1RVF3 2JG9B 1ULFA 4K20A 3E97A 4L9BA 3DKWA 5BNNC 3M3OA 1ZBA3 3AP5A 5JSPA 4AE2A 5FOBB 2ZGLA 3ZXGA 3P3PA 3ZIWA 4C91A 2YGMA 1LU1A 1NCRB 4FBFA 2DU1A 2YYOA 3JB4C 3OCPA 5FPZA 5F6KA 1OI6A 3WINE 1GZ9A 4ASMB 4N7IA 1AYN3 4XHXA 3B94A 2ZGUA 4NHLA 1DGWX 2DVAA 4G4FA 3TRSB 2BW8A 2X5IC 2WA3A 5BNPA 3WT3A 1PO23 1DBNA 4N43B 1NXD1 5I0UA 1VBB2 3UKNA 4P9XA 3IDBB 4YVSC 2JG9A 4AEDB 3VZOA 1MVQA 2P34A 1NE4A 4LLOA 1DQ0A 2AH2A 1VR3A 4O9GA 1ENSA 4WBBA 1DYPA 2A3YA 4Q4W2 1MACA 1MS8A 2XWBB 2ZZQA 1VBC3 2WS93 5ACA2 3OGGA 2R043 4PCRA 3PMEA 1AR81 4XQ4A 1POV1 4GH4B 5A33B 1ZBE1 1H9PA 2ZGKA 1PGW1 1NY72 3LSEA 1U12A 4YZ1A 4LO7A 3ZYPA 2XJPA 4QM9A 3HQXA 1U5YA 2D5HA 3OPZA 3AMHA 1U5ZA 2R063 3FLRA 3WY6A 1OPOA 2D3RA 3ZN4A 4FAHA 4JGYC 2EIGA 4MXWA 1LB2A 5KXBA 3IPVA 1KJLA 1ZRRA 3N7MA 3DPRC 4GMP1 2BNMA 3WXPA 4AHWA 1G9DA 2QQPA 4WM8A 4BQ1A 4HFSA 5LRRA 4XTPA 1WLDA 1JYCA 3LCPA 1RUI3 2OPKA 2R041 5KHHA 1UU6A 3WHUA 3IBMA 3V0AA 3LAGA 1FT9A 1OFNA 1QU0A 5EWSA 4Z8BA 1AR82 3FFZA 1S0DA 3ZSEA 4Q2FA 5KHGA 2UWAA 2GN7A 3CJIB 3NKGA 3TN93 2VECA 2XH6A 2R30A 4X6QB 1LJ7A 3DUIA 4MGZE 3WW2A 3J8F2 3OD4A 3VL8A 5JOWA 3BOPA 4OHYA 3FMGA 2A6VA 3AZYA 3AMMA 1AJOA 4S2HA 1DGRA 4BPZA 5ACA3 5K9YA 1FMD3 1SLCA 4XW3A 4MZUA 1VBB1 1WBFA 5D1IA 1D0HA 2E9QA 4KWLA 4PDWA 4XJ9A 2ZKLA 1QMJA 2W39A 1URXA 4GB33 5LK7B 4AI0A 1IPJA 2PFWA 2PN5A 4HLTA 3IMNA 1VBB3 3MW4A 5FTTC 1V6JA 3TN92 2HWC1 3QBQA 3JD72 4TWTA 1RUF3 2W52A 4Q4X2 1RUC1 5K7PA 5FO9B 3JCIA 3Q9OA 2ZMKA 1B35C 2PQQA 2PHUA 4AFDA 1NCQA 3NV4A 3WD5A 2QE3A 2VMIA 4DOUA 1SLLA 1OLRA 4QQOA 1GKBA 3BALA 1KFUL 3MFCA 1NCRC 3LB9A 4RHV1 2A6YA 3BTAA 3KT7A 1ULCA 3MIEA 2B45X 4Y24A 5F6LB 2B5HA 4KL1A 2PTMA 1RUOA 4RL7A 5L73A 4PBOA 2UU8A 2WZR2 4NWVA 4BIOA 1OMIA 5CAZA 1XYOA 2E6VA 4RQPB 1DZRA 4BLJA 1A78A 1V6OA 4BZ4A 2R073 4O9EA 4DRVA 1VBE1 3VBRB 1ZA4A 1POV0 1BXHA 3DN7A 4FPYA 3T1MA 4KU8A 3ASIA 4W65A 4L97A 3KSCA 4AF9A 2ZMNA 4JGZB 2ZBJA 5CA6A 4W6YA 3LA7A 5BNOB 5BNPB 2D7FA 2MNGA 4AXOA 3MI8A 2B46X 1R091 1TNRA 5FQ0B 4MUVA 3HIFA 4K8FA 5SV5A 3SLIA 4P9YA 1SQ4A 2H0VA 4PDWB 3VZKA 3EJKA 2O0OA 4EV0A 1N1SA 4XF9A 3SH3A 4DY5A 1MZEA 5FMOS 4B4RA 1ZM1A 2A7AA 4UW4A 3JU9A 3ACLA 4C1WA 5C8CC 3RG0A 5D8AB 1CAUB 1CN1A 4XETA 1VRH3 5CU1A 2VU9A 1RUC2 3I59B 1WMFA 2P3JA 1PO13 1O4YA 1AR83 4P9LA 5H9RA 1HDKA 4IL7A 4R4ZA 2R072 1Q3EA 3R4UA 4CDUA 2VQ0A 4Q4V2 5LEJA 3MYXA 1EV13 2Y26A 1ND2A 1ULDA 4AHYA 2Q1ZB 1TME1 1V00A 4GULA 1NCQC 5BV6A 3BIWE 1LU2A 3VKNA 2GMEA 2G9GA 4ASLA 1C8M1 3B3QE 2XL7A 3ZSLA 3AKQA 2R062 1REDA 4NN0A 2RJKA 4N53B 1A8MA 1O5LA 1CQ9A 1LEDA 4GMP3 4QQ2A 4IQPA 3VBRA 4QPGA 5KWRA 1QQP3 3JBG1 1Y7BA 1GSLA 1SLTA 1S0EA 5JOXA 1ND2C 4RR3B 2Z2SB 1C8M3 3JD73 2DVBA 1QKQA 1SACA 3ZMNA 4AW7A 4XDQA 4E2GA 3L9JT 5FLHA 4BE3A 4FPGA 5A33A 2EVXA 3AYDA 1R1ZA 2VNGA 2PAKA 5SV8A 2WFF2 1HX6A 1PVXA 1MZ6A 1J1TA 4EN0A 1G9FA 1BEV1 1GQHA 1I6XA 4Y1VA 1JH5A 3MPPG 2H0BA 1AR92 2HWE2 2XJTA 4OHZA 1WUVA 4BM8A 3VLBB 4XHBA 3ILRA 2R6QA 4LR4A 4JGZA 4NOTA 3UL2A 2MPFA 1LRHA 2XG3A 4QPGC 2PHWA 2JEMA 3OY8A 4E2QA 4XOGA 2B9UA 1G9AA 3S7IA 2GNDA 1Q8OA 4YVSA 2F4PA 1NY71 2ILMA 1LOGA 3IKWA 4GIQA 4JGYB 3TNQA 2IXIA 3M3EA 5KXDA 4ZU4A 1SFNA 2YHJA 4JC1A 5K8SA 2EXHA 3DPRA 4Y5Z0 1WW7A 2BWAA 4AHZA 5J36A 5JIUA 4XQWA 4RS5C 1L3JA 5T55A 2W08A 3CEWA 1LGNA 4JGZC 5JOZA 2KA3A 5I93A 5KHIA 2ZX2A 4N90A 3LZZA 1PNFA 5K0UC 2YXSA 4CYDA 1ND2B 1QJU1 2XLAA 3H0OA 1XNKA 4RGAA 2WS91 5DXDA 1BMV1 4QPIB 3BOWA 2RS11 4N9HA 3W9AA 2B7YA 2R16A 5FO8B 4TZDA 2A3WA 4WVMA 3WNXA 2HWF3 5EFUA 1R1A2 2WNUC 1QWRA 4BMBA 3WV6A 4UW5A 1KFXL 1Q8QA 4LBLA 1W6MB 1OOPC 4H7LA 1GYKA 2GNBA 2FMDA 4XFCA 4PJYA 2ATFA 1O3QA 1UAIA 2DFBA 2UYAA 1A8DA 1NQJA 1W6OA 3VKOA 1QGLA 1ZBE2 5K0UA 2B8MA 3WDYA 2W68A 1OQDA 4A3XA 2IC1A 1I1EA 4Y1ZA 1R092 2Q1MA 1V9U2 3LA2A 3ZYGA 2P37A 4D7YA 2RS52 4IEVA 1QJX3 4Q4W1 2WNUA 1CIWA 1JW6A 3HWJA 1HQNA 2WNVA 4FCAA 2ET7A 3WDTA 5JR7B 1WW6A 1Q8VA 4INDA 3AMPA 2JXAA 2YPJA 3M70A 3GYDA 4YM2A 3FBMA 1SBFA 4EN7B 4AVSA 1NXMA 4XJZA 1V6LA 3AZXA 4COVA 1TME2 2ZPXA 3G7DA 3AYCA 2K2SA 3A4UA 3O14A 1EPZA 2MEV3 2XWJB 1UZZA 1SMVA 3M7AA 4HMZA 1TME3 1FMD1 4M3CB 5L7OA 4HETA 4CEWB 3AMQA 3WUDA 1GICA 1YO8A 4HANA 5BNOC 4S2FA 5B2GB 4G9SB 1WA4A 3U4XA 4XEZA 1CAXB 2ARXA 4BWOA 4CP1A 4ZU5A 2E7TA 4Y26A 5EV7A 1ALYA 3ILNA 4CDQB 2CWMA 4RQPA 4TSVA 1WW4A 1W6PA 1YHFA 1R093 1RUE2 2AYHA 5AFEA 3H1WA 4FPLA 1QNYA 4XFFA 1XE8A 3TN91 4GKXA 3USSA 4D7TA 1RUF1 1RMU3 2WNVB 3GNEA 4M0NA 2ARBA 4YFZA 2JKBA 2GALA 5HCBA 2WQZC 1UZYA 4L2NA 3GHMA 4NO4A 4PLOA 1R1A3 1NLSA 1LTEA 4YZ4A 4COWA 5CVRA 3IT8A 1CVNA 1PO11 2D40A 5AC93 2WZR1 4EWAA 2D6OX 2IXKA 3FJSA 4XYXA 4E27A 3RWNA 1H8TC 2NMNA 3ZX7A 2NYYA 5DUUA 1LOCA 4M3CE 2VXRA 1RUD3 1DG6A 3O0XA 3AYAA 1OKQA 2EAKA 5EZWA 1D4VB 1EAH1 4RS5A 4YW4A 3ECQA 4FPKA 1FV3A 5E8AA 4K1YA 1PHMA 1VBE3 1Y3TA 4WVWA 4AVTA 1C1LA 4XF3A 3AYEA 3R05A 4DS0A 1AHSA 4FOWA 1ND3B 1GQGA 1QH7A 4YYOA 2NP0A 3R0RA 4BMEA 4MH0E 1GNZA 1IS4A 5FQ0A 2IXJA 4MLOA 2ZZJA 4I2OA 4QPIC 1W6PB 1RJ8A 4XXAA 3PTYA 3AXDA 3VZNA 5IK8A 2PLV2 4OHXA 5GLWA 5T3NA 5AFBA 4AGVA 1UKGA 5K0UB 1WLCA 3RMXA 4P9WA 3SHRA 1KITA 1MS4A 3ZXJA 1Q8PA 3POWA 2IXLA 5CG9A 2EXKA 1KS5A 4MX3A 2JDZA 1ZZCA 1QJZA 4H55A 4CDUC 4K9SA 4QQHA 4J1WA 4PLNA 3WDVA 5JPMB 2QDNA 1AX1A 2C1FA 1FNZA 3RS6A 2P3KA 3J8F1 4HKWA 3UJOA 3BB6A 1AL23 4P9JA 2NLRA 4JAAA 2Y0OA 4U36A 1G86A 1QDCA 3WUCA 2H6CA 1E57A 2RR13 5JDBA 1G6NA 3R6SA 1Z0HA 4COYA 1D4M1 5AVAA 4AEMA 1EP0A 3DF0A 1AL22 5CNAA 1H2NA 4BLIA 4UBHA 1PK6B 4GQ7A 4FOQA 4N53A 4YARA 4LUKA 4F83A 2PELA 1RUH3 3CL1A 2YV8A 3QH6A 1AXZA 3WW3A 1DU3D 2XLGA 1LECA 4FPEA 1UD1A 1C8NA 2UY9A 4LBJA 5KBFA 5LEKA 4OI4A 1C3HA 4Q4Y1 3J9SA 1JHNA 2GZWA 4AVVA 2VGDA 4LO5B 1FOD3 4KG8A 2D3SA 4AYUA 1YFXA 4MVTA 2DCYA 4CEYC 4P5HA 3V56A 3VBFB 3RNSA 4XZPA 2SBAA 4RQPC 4N53C 2P2KA 2VW0A 3NVCA 2XLFA 1JBCA 1OFSA 1PGW2 2ZCWA 4LULA 4LBQD 2DTWA 2QZ3A 2C0ZA 3FLPA 2X8KA 3E6BA 4YVSB 1ZVFA 4OI2A 1C4RA 5C9AA 4E4DX 4ES9A 2UYBA 4MYEA 5ACA1 1Y43B 4PIXA 1WLWA 2DCZA 1PM7A 4HN0A 4UW3A 3HAGA 1MEC3 1BK1A 1RMU1 4LBMA 3KGLA 2V73A 3AJZA 1UKRA 1QOSA 3KB5A 1JUHA 2YUEA 4XFAA 3WG4A 4ZKTB 3AP6A 3K48A 2Z69A 4CDXC 4AI1A 4YW1A 4MXWB 2N7GA 1SCRA 3RZZA 3B01A 1DF0A 5JWPA 4DNYA 2D5FA 3S30A 1WGPA 4K40A 5EXOA 5GLVA 4BYYA 1CONA 2B39A 4LHKA 2QKDA 3O5SA 1VIWB 4E4SA 3MF9A 4I0WB 3ZIXA 1G7YA 3NAPA 4K21A 4IEZA 2WJSA 2ZGNA 3FX3A 1AXKA 1S0FA 4KGQA 4DZGA 3GF6A 3IDCB 3B93A 5C9AB 4YZ2A 3O0VA 2WKKA 4V1PA 2VW1A 2HWD3 3UV9A 3HN1A 3KT4A 1ZREA 4A7KA 4CRQA 3D4KA 1POV3 3KD4A 4CDWB 4Q8KA 2QZ2A 4FPJA 4IEYA 3AP9A 3M3QA 3AX4A 3N3HA 2FMYA 3URFA 2SLIA 1RUH1 1WD3A 1VBE2 4AG4A 1UU5A 2G9FA 1GLHA 5DDJ3 4CTEA 2VOXA 1Q8SA 1H8VA 1TQ5A 4ZU7A 4XFGA 3ZN6B 4RA0A 1S1AA 3FUQA 2DUOA 4CDUB 1F9KA 1BEV3 1D4M3 3ZFGA 4EN9B 2XPJA 4DB5A 1SBDA 2WNEA 2RR11 3VBOC 4RHV2 4ZXKA 2VULA 4L11A 3VBSC 3I2DA 2JE7A 3WOGA 1YXWA 3H8UA 1SLAA 3WDXA 4Q1RA 4HKLA 4XJAA 5C8CA 5F9TA 4ES8A 2D43A 1CAXA 4RR3C 1OOPB 3ZFEA 1QXRA 1MS3A 3S0MA 3AM2A 4IXLA 4IEQA 3ES4A 1DGRN 1GZCA 5FPXA 4FQ4A 1DGLA 2AZ5A 2WINB 4XJUA 3DGTA 1OA4A 4FP2A 5E16A 4XF4A 1ND3C 3AKRA 3PNAA 1SBEA 4WM8B 4LA3A 1HXS3 1LOAA 2K9ZA 1QQP1 3L2YA 4YGBA 4KNCA 1W2UA 1O3TA 3K51A 3QACA 3VBHA 2DCTA 2ZX1A 4M3CA 5L7OB 1DYKA 3WQ0A 3RDIA 1YLLA 1IGOA 2RJLA 3MGUA 4FOVA 5JI7A 1H2LA 5DZFA 1PGL1 1BVP1 2ZABA 3MLLA 1Q5OA 1ZZ8A 3A0KA 4HK8A 1VP6A 1NYWA 5T54A 1ND3A 2ZA9A 4LLFA 3RQ0A 1BBT1 1BQPA 4FQZA 3WVJA 2ET1A 1OPMA 2NZ9A 2UURA 4QPGB 3KMHA 1UPIA 1AX0A 4OZXA 3PVBB 2R042 1RUJ2 1NOVA 4W6XA 4YFWA 2I2SA 2XGXA 4S2DA 3IPVB 5BXXA 1HXS1 3RYPA 3EO6A 4HPKA 1TEIA 1FMD2 3C2UA 3H3UA 4AQSA 5JAXA 1LOBA 2JG8C 4JDNA 3WP6A 4D7SA 2X5IA 3CLPA 5BNPC 2QDRA 3NAPC 3A0NA 1XNDA 5GLZA 4HSLA 1J59A 1MQTA 4Y1UA 1MZFA 3BCWA 2DF7A 1SFYA 5FREA 3ZSMA 4FPFA 2RMU2 4XF1A 4XQDA 3VN4A 4JVAA 5HXVA 2XJQA 3VZLA 3WDWA 2DV9A 4DXZA 3MFAA 1VBC1 2DUPA 4IV1A 4DPNA 1EAH3 2JECA 4ISQA 4XMAA 4WVZA 2HWF2 1XU1A 3SITA 5I0SA 1DDLA 4IEUA 2O1QA 1PO21 3H50A 4QPIA 4QGNA 3O0WA 2RM22 3FFQA 2HWB2 1ENRA 2PHDA 4JGYA 3IN9A 3RRDA 3VV1A 4HT1T 4XTMA 1U5IA 4PQ9A 1NCQB 2ZTNA 3ZVXA 4KG0A 1CD3G 2ZOEB 3VKFC 5JSRA 2E63A 1JOJA 3ZXDA 1YI7A 5C8WA 2Y0IA 1COV2 3BPZA 1KS4A 4IV1C 4XMIA 4AGGA 2EXJA 4LE4A 5HBAA 4Z92B 1F5JA 2WT2A 2Z42A 1OHFA 2TBVA 4K3UA 5EYXA 3ZXEA 3MIBA 1B35B 1WMDA 3B9IA 1ZZ6A 5C4WB 2BEOA 4FSJA 3H7JA 4PLMA 1CAWA 4B3NA 4I30A 1J3RA 1S0IA 1V70A 1C57A 4OVEA 5GLTA 5CFCB 3ZYIB 4YNIA 1IS6A 1W0OA 2GNMA 2WNVC 1RUG3 4YVWC 4HVQA 5BNQA 4Q4Y2 3QD6A 3WP5A 2VVFA 5E89A 4Q0VA 1GR3A 1J3QA 3R4DB 4IETA 1W6MA 4KU7A 2DUQA 1HLCA 2CGPA 5FBZA 2IXCA 2HWC3 4PDWC 4Y22B 4BOWA 1S0CA 3NJZA 4D94A 1AL21 1KDMA 4ONUA 4P9IA 3FUOA 3CJIA 1W6OB 3WDUA 3KQRA 2VQAA 2ZGPA 2FZ2A 1VB4A 1LHVA 1RUD1 4G3YC 4RSUA 4FAGA 3LWCA 4ATEA 4C1XA 3ILFA 4OI0A 1QJY3 5L19A 4I09A 1PO22 4TYSA 1SEFA 3WR0A 1VBD2 3WW1A 1HQWA 3VBUC 2ZACA 2XHKA 4N7UA 2IXHA 2FQPA 2VVDA 4B7EA 2PHTA 5LRSA 1RITA 2A3XA 5I0TA 1AF9A 3ME2A 3RSJA 1FYUA 4QT6A 1FOD1 2BQPA 1Z7S2 2XB6C 1FPN3 2XUMA 4LUMA 3PLQA 4QM8A 1ZRFA 1A6CA 1N1YA 1R082 4HBNA 1ZBA2 5D8AA 2QJVA 5T50A 1HXS2 1X8MA 5I91A 4GKYA 3M4FA 4EJRA 3VBUA 5C4WC 5IK5A 1VBA2 2E7QA 1MQTB 2GDFA 1DQ6A 3AK0A 4Q0QA 1AR61 1FPN1 3MW2A 3USUA 4IV3C 4XFIA 5JMCA 1FX5A 2BGCA 2PHFA 2DVFA 4M3CF 1BBT3 4IV1B 1DGWA 2BUKA 2YZ4A 5ABJC 1DZTA 1H8TA 1RUC3 4QMAA 2B42B 4A2UA 1MR5A 1H4HA 3AMNA 1RHI1 1XQNA 4R4XA 4AEDA 1GFF2 2ETEA 2XKOA 1FNYA 4LNVA 3N4MA 4SLIA 2O8QA 1UMZA 1S0JA 2HWE3 3ZMOA 1YIFA 4I0BA 2XJSA 1O4TA 2CAVA 1LHUA 1H1IA 2WFF3 2Z79A 3M3IA 4K1ZA 3V0BB 2R0HA 3PVNA 4DRRA 1WLTA 2LUWA 2AENA 1HRV1 1LKNA 1W6QB 2BFUS 3MF6A 3RJ2X 1DIWA 1VALA 1X50A 3GBFA 3ZO0B 4Y22A 3VBOB 3CJIC 5T5JA 4LBQB 4J6GA 3ZSKA 1G9CA 2G4IA 3MIFA 3TBDA 3NL1A 4RS5B 2WQ4A 4XIKA 2PLV1 2RS31 2HEWF 4FPOB 2YY1A 2PYTA 5IT6A 1HRI1 1Y9QA 4HN1A 2CAUA 5FRAA 2D93A 4UW6A 1VBA3 3GBWA 3O12A 3EQEA 1U5XA 1IS3A 2HYKA 3LOIA 1XE7A 4OI1A 1LOFC 2WZPP 3TAYA 1QJX1 4K6BA 4WM7B 2R0FA 5J98B 3DPRB 4NR1A 4WM7C 4FTSA 1X33A 1FPN2 2WL1A 1HV0A 1AR72 1VBA1 3KLSA 4Y20B 1HV1A 3JD71 5AVPA 4CDWC 3I4IA 1MS9A 3J4UH 1QXPA 1V6MA 4XJWA 3EHKA 3G6JB 2DCKA 4LT5A 4CEWA 4MGKE 3VBHB 1TMF1 1PO12 1YJLA 2ZAHA 2CWSA 2RMU3 4X6RB 1AXYA 1XU2A 3UKTA 5I8SA 2V5YA 2DVGA 2DYCA 2YC0A 5J48A 3I8TA 2WFPA 4Q4W3 3B7MA 3WZ1A 2JENA 1DZQA 2AREA 1RUE1 2ZX0A 1IOAA 5GZDA 4AEDC 5DUXA 1X8EA 5C6CA 4QGLA 1RB8G 3PVOA 3FHIB 5AC91 1S2KA 1XYPA 2C9AA 2DTYA 1S0BA 4META 3FWEA 4JV4A 4AFBA 5DG1A 1JUIA 2D6NA 2MEV1 4XJ8A 2XJUA 1ZBA1 5F1RA 2ZKNA 1QF3A 1ULGA 2PHXA 2R49A 1R1A1 3EBRA 2JJ6A 1RUI2 1ASJ1 1PIV1 5J37A 1S2BA 4FPCA 4MGIE 3T1LA 1FOD2 4AVCA 1BMV2 2NM1A 3KGZA 5DZEA 3RPQA 2VMHA 2WSUA 2IWGB 3B00A 3AB0A 1D2QA 1LULA 4NVPA 5BNNA 2CNAA 1RINA 1H30A 1HQLA 1SLBA 2EA7A 4ATFA 1NQDA 2WNUB 1VBD1 2QUOA 4JTNA 2GN3A 2ZHNA 3PJYA 3ZYRA 4YZ3A 3JZVA 5BPXA 4EN8B 2RS51 2DU0A 2YDEA 3OD0A 4X8PA 5A3LA 2CV6A 2LM3A 4KGGA 1H1MA 1V9U1 4AGRA 3CU7A 3OGJA 2XVKA 4CP2A 4FOYA 3RI8A 4IESA 4LO8A 3INAA 5TSWA 3MLJA 4UBGA 3SXWA 5BYNA 4D3WA 2HEVF 1UF2C 1I9RA 3DL3A 2JG8B 3UKVA 4QD2A 3QCWA 4DINB 1OLQA 1VBC2 1IS5A 5KC5A 3AZWA 4K7JA 3PMSA 1BEV2 1PK6C 3VHPA 3POYA 3ZFGC 1ZRCA 3LOBA 2GU9A 5HCFA 5FLJA 1LENA 2RS12 5JVVA 1RUJ3 2BFUL 2VOWA 1VAKA 1YYNA 1OQ1A 1RVF1 4GH4A 3ZFFA 4IEXA 4YVWA 3SH4A 1BVVA 2KXLA 2Z5WA 3M3CA 4XF0A 3TOJA 3IM0A 4LBKA 3GBGA 3OJBA 5IK4A 4IERA 4B7KA 5T5PA 1W39A 3E5UA 4HK9A 1C5IA 2R061 3AXEA 4Z1VA 1PGSA 2P17A 4PF5A 3V0AB 2ZHKA 1DQ2A 1VRH1 4EROA 2X29A 1VLNA 4S2GA 2TUNA 3KCXA 3V64A 5HCAA 5L7OC 5GZGA 4AK3A 4KQ7A 3JQXA 2AUYA 3OBTA 2RE9A 3THTA 2BWCA 5LK5A 4QXKA 2A5ZA 3JQWA 4FTBA 3HT2A 1BKZA 4AHXA 2GMMA 4MGYE 3ZYJB 4Z2WA 1RUNA 1S0GA 2RMU1 5KXCA 1AYM3 4BCUA 2GC0A 1MEC1 1REFA 4WV8A 4AQ6A 1NCRA 4BA6A 2NPIA 5EJ3A 3I59A 2E53A 3AKTA 1ZNPA 2EALA 3VHOA 1AR63 5I8TA 1RUF2 1X36A 2R071 4Q4X3 1AZDA 4MXVA 5JI9A 3S6PA 4COUA 5JOYA 2D44A 2WC2A 3J26N 1W6QA 1O7FA 2XBO2 3USUB 3VBSA 5ABJB 5A32B 1IKPA 1LEMA 3JBG3 2WA4A 2DWRA 4YGCA 4OUSA 4YM0A 2JD4A 4R9AA 4OHWA 4Y4YA 4LTAA 3VZMA 1BJQA 3ZN5A 4J1XA 3BODA 1IHMA 5T52A 5JLVA 3NKTA 4Q4Y3 1K5MB 2E7AA 4HSJA 4LBNA 1AUYA 4RFT0 4DY3A 1NE6A 1PK6A 3VDDB 5D8AC 1XYNA 3VDDC 2BTVC 4XFHA 3WG3A 3AP4A 3O7OA 2UY8A 3D82A 3IDEA 4Y20A 1SCSA 1T6GC 2ES3A 1WCSA 2TNFA 2A6ZA 2LALA 5CB7A 4CDQC 1AVBA 3E5QA 1ZZ9A 5A32A 1FXZA 1OQEA 5FO7B 1W6NA 2CTVA 3FE5A 2XJRA 3AZZA 5FDBA 2A70A 1CPNA 1ZYBA 1WBLA 2H6BA 4M01A 5GZFA 3PHMA 2TEPA 4X8NA 4A7YA 4QHBA 4YG3A 3DV8A 1CR7A 3RI9A 1DFQA 2NN8A 1QJX2 2RS53 2KM2A 5CIRA