3ALQA

Crystal structure of tnf-tnfr2 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
141
Chain Sequence
b'SDMPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFSGQGCPSTHVLLTHTISRIAVSYQTPVNLLSAIRSPCQANPWYEPIYLGGVFQLEPGDRLSAEINRPDYLDFAESGQVYFGIIAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor
publication title Solution of the Structure of the TNF-TNFR2 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 21
structure length 141
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3alqA00
4QQLA 2O0OA 4QPYA 2HEYF 5L36A 3AB0A 4OUSA 2E7AA 3WD5A 2JG9A 4G4FA 1WCKA 1U5YA 2Z5WA 2HEVF 1IQAA 5HBAA 1RJ8A 4E4SA 2Q1MA 2RE9A 1TNRA 3K51A 1A8MA 1PK6A 2TUNA 1KXGA 5KWRA 4QQ2A 4DOUA 1TNFA 1KD7A 2HEWF 2KA3A 1PK6B 5KC5A 2JG8A 4HT1T 4DB5A 1C3HA 4KGQA 3ME2A 1O91A 4OULA 4F3JA 1JH5A 1I9RA 2JG8B 3TWIA 4QQOA 1U5ZA 2RJLA 3K48A 4KGGA 3MI8A 4MXWA 1XU1A 2ZPXA 4N90A 3QBQA 4TWTA 5TSWA 4OUMA 3V56A 2WNVC 2R6QA 4EN0A 2RJKA 3QD6A 3TYJA 1D4VB 3URFA 4MXWB 2WNUC 2X29A 3IT8A 4QQPA 1RJ7A 1C28A 3LKJA 5BNQA 4KG8A 4MSVA 1JTZX 2R30A 4J6GA 4MXVA 4G3YC 1OQDA 3ALQA 3B94A 4D7YA 1DU3D 1ALYA 1DG6A 1GR3A 3B9IA 4GIQA 1D2QA 2JG9C 1U5XA 2Q8OA 5L19A 2OIIA 2ZJCA 2WNVA 4RSUA 5KC6A 2QDNA 4QQHA 2WNUA 2QE3A 1PK6C 4NN0A 3L9JT 2JG9B 1D0GA 2WNVB 1OQEA 4E4DX 1XU2A 1OSGA 3B93A 2AZ5A 5CIRA 2WNUB 1S55A 3FC0A 2R32A 4TSVA 2JG8C 2TNFA
chains in the Genus database with same CATH superfamily
1UXXX 2BWAA 3INAA 4RFT0 1KEXA 3VZNA 3WLUA 3RPQA 4B4QA 3IN9A 5FMOL 1R64A 4HFSA 4JKMA 5A33A 3V0AA 1XSQA 5IK5A 3BIEA 1W0PA 3I3QA 5LBFA 1K42A 2JG9A 4P00B 3SISA 2FQPA 3CBNA 3FHIB 4AFCA 1W2OA 2P3KA 4UXAA 1LHOA 4DEVA 2VMDA 2PQSA 2AACA 5DAWA 1COV2 5BY5A 3M3QA 2HWF3 1WMDA 2AEZA 1AUYA 1PNFA 1QQP3 2VUJA 5ANNA 3LZZA 5KXCA 4BPZA 3ATGA 1O5UA 2HWE2 2OZJA 4GKYA 1IPKA 1NXD1 3OPTA 4YZ4A 4AEJA 4AZZA 1VBE3 2ZXQA 4QHBA 3MIDA 5JDBA 1CAXB 2DBIA 4COZA 2XVKA 4QT6A 5FOBB 1YO8A 3Q8BA 1NOVA 2IXKA 2GC1A 1S0JA 2D5HA 1MVQA 1SBEA 1GBGA 1QY4A 4YW2A 2QUOA 4AXOA 5A3WA 1UY0A 3NJZA 5I8YA 4QDRA 1NZIA 3ROUA 3M3IA 2VCMA 4I0WB 2OQ6A 1CPNA 3EBRA 1I9RA 3PUSA 3IZOA 1DYPA 4CEYC 3NWKA 2Z69A 2ZS6B 3MI8A 4GXLA 4JRLA 4EN6B 3GJBA 5B2GB 3AFKA 1NCQA 4QGMA 3FZ3A 5FY8A 1ENQA 2VULA 3O1VA 4A2UA 1POQA 4FXGB 3URFA 1EPWA 2WFF1 4LQRA 1F31A 4NPMA 4PI0A 1VBC1 1UZWA 2FZ1A 4QWNA 2YHJA 3S30A 5T54A 3G7DA 1ZBE2 1FMD2 4K9SA 1CGPA 4IV1B 1ULEA 2C1FA 1S2KA 1TME2 4YGBA 4Q4Y3 1LOCA 3E5UA 1LGCA 4WVWA 1K12A 5CFDB 2VE1A 3T1MA 4N43A 1R093 1H6YA 4YVSC 1ZYBA 2MEV3 3WQBA 3NKGA 1D2QA 5A3OA 3NNJA 4NHMA 2JG9C 4NIIA 1DZRA 1WW5A 2D6NA 1F4HA 3RQ0A 4D7TA 2ILMA 2OIIA 1V0AA 1AYM3 1PGSA 2F4LA 3MIFA 4LE3A 4XZUG 1AVBA 1H2NA 2GU9A 2ZGOA 2D3SA 5ISLA 2BWCA 2CDOA 2QDNA 3HT2A 3KT7A 4XTMA 1RUC2 4CTEA 1SBFA 4LO5B 1TVGA 2AH2A 4EYUA 2PAEA 4BDVB 4JTOA 5FKBA 4LIVA 3A21A 5A3MA 1RUG2 4ES8A 2NM1A 1H8VA 2ZGPA 2YYOA 3AMQA 2ZHLA 4WZCA 3VZOA 2WNVB 3TN91 5HXMA 5FQ0B 4RR3A 2BGPA 1Y9MA 4HSJA 1F5JA 2D6OX 3WP6A 3WF0A 3W58A 1VP6A 3DXTA 4MGIE 4HN1A 1UYYA 4CZSA 3I2FA 1S55A 1US3A 1PO11 4GKXA 2OW4A 3KF3A 4YG0A 1ZZBA 1OXCA 3K4DA 5LA9A 4AQ6A 4CUCA 3THCA 1LEDA 1KS4A 4RS5A 3ILFA 2WR9A 4L97A 4NRPA 5L73A 2VJXA 1HRI3 3VBSB 2DCKA 3I3EA 4AVCA 3I3MA 3JQXA 2XMLA 3FHAA 1RUJ3 3POYA 3VD7A 1SACA 1IS3A 3OGSA 1NZCA 3RJ2X 1Y9QA 5A7PA 3E6BA 1NCQC 1HXS1 1US2A 1CAVB 1I1EA 4YFZA 4K3UA 2J22A 1AJKA 1F9KA 1K3IA 4V2VA 1RB8G 2DWRA 4UFHA 2W47A 2CSGA 2EALA 5HV4A 4MGKE 3P5BA 3ACLA 2R041 2RG4A 3JB8A 2A73B 3N9MA 1L7RA 5FY4A 4EWDA 2JB8A 3TEZA 5FP9A 2XLAA 4LOSA 1C5IA 4AAPA 4IV3B 4GD4A 4FFHA 1PIV3 1N47A 1PM4A 3JXSA 4N43C 1QJX1 3D0SA 1FPN2 1GSLA 2WSUA 2Q4SA 3WT3A 3E6CC 1S0DA 1VJ2A 3D82A 3WXPA 4UI9L 1N3PA 2RS11 1CPMA 4Z2AA 3MYXA 5HXVA 4CDQB 3OGGA 5BNNB 4Y22A 1OQ1A 1J3RA 1DQ2A 4ASMB 5C6CA 3S0MA 1U12A 2CWMA 4YW7A 2W9XA 1D2SA 1QJY2 4V1PA 5EQUA 3GCXA 4E9KA 4EQVA 4ZZ8A 5LY1A 5LA2A 1UY3A 4AAXA 1KQRA 1ZNPA 2PHFA 4D6SA 4ZPIA 3C8XA 2QQLA 4Z82A 1GMMA 5HV0A 1J3QA 4UW6A 3HD8B 2HWF1 2P6HA 1POV3 2RHPA 1CESA 1ZRCA 2D93A 1QQP1 1VBD1 2BZDA 4B7KA 1S2BA 1DQ0A 2ARAA 1IS6A 5A3UA 1CN1A 3ZN6B 1MPXA 4I0BA 1VBE1 3CO2A 4CDXA 2YU1A 4RS5C 3OCPA 2DBNA 3VBOA 3MEPA 1PZ8A 3T0BA 1CD3G 1R082 2ZABA 3SH3A 4BISA 4UF0A 1XJAA 4F8AA 2D6PA 3KV5A 4YM1A 3I2OA 4OI0A 3TNPB 2VZTA 3WY6A 1RVF3 2RM22 5CYYA 4FPHA 5FZOA 1FNYA 5CNAA 3KF5A 1NAEA 4JZRA 2ORZA 3ES1A 3MICA 4RGKA 5FZHA 5IK8A 2QBXA 4NWVA 4MGQA 3SCFA 2PLV3 3WW2A 2R0FA 1AXYA 5ANQA 1NYWA 4AFDA 4HK8A 1W9WA 2C26A 3VV1A 1UZZA 1IKPA 1PVC2 2D6MA 1ZBA1 4Y33A 1W8NA 5FXXA 1W6PA 1UNBA 3PUQA 4LHKA 5FYTA 4A42A 3I49A 4C8DA 2TNFA 5A3TA 3RFRA 3H42B 4XABA 4ISQA 5AVAA 5FZFA 4LO4B 3UL2A 1UOJA 2XBO3 3WDVA 4LBOA 1FT9A 4I3GA 1W6OA 2O8OA 2CHHA 4WVVA 1WW4A 4HPKA 4MGZE 3HQUA 1DIWA 1MZFA 1U5YA 3H7YA 1AX0A 5AFEA 2HYXA 2RDSA 3CMGA 3GHNA 5FZ1A 4CDUA 4FQZA 4PCRA 2A75A 1S0FA 2NLRA 5H9RA 4Q4Y1 1S0IA 2ADDA 5A32B 5T3NA 5FZ0A 4IE4A 1BLZA 4OHXA 1R091 3Q8CA 3VZMA 3O1RA 3POBA 3S57A 2MEV1 2RS52 5FYMA 1KRIA 4X6RB 2VZUA 3LEIA 3U0ZA 2Y64A 4OZXA 4BQWA 5FTTC 3CLPA 3BU0A 1G8WA 4JDOA 4AI3A 4XF3A 2W39A 3RMYA 1Q8QA 4QHOA 5A3NA 1N1SA 3FWEA 3KSCA 4A7YA 1JYVA 4KBBA 4XVHA 2IWGB 4FI9A 2OUJA 3KD4A 2ZGMA 4I3PA 4Q1PA 2FHRA 2WZR2 4CCNA 1DYKA 1CJDA 3JBG2 1CAWB 1HW5A 2XJVA 1QDOA 4CDXC 2FMDA 2JG8B 4LLFA 4AQTA 3HPNA 5JZGB 1H6XA 1ND2A 2VTXA 3BVCA 3VBOC 3RZJA 3H0OA 2OPWA 1W6NB 3I2GA 4QAWA 4EN7B 1UOGA 3I3DA 2VQAA 3IDAA 4IEVA 2E53A 2I45A 3RI9A 5FV3A 5K0UB 1LU2A 2VQTA 4LEJA 4EZHA 1RUE1 3ZIXA 2XR4A 3MHZA 1C28A 1HRI1 3ILNA 1YHFA 3HN1A 3WUDA 1RUJ1 3KLSA 5EHDA 5BV6A 1J58A 4CCJA 2FDFA 2AEYA 1YQ2A 4G9SB 2P37A 4BZ4A 2AGSA 4Y26A 3PMEA 4D7SA 4JVAA 1DBNA 1VRH3 2QZ2A 2YY1A 4H55A 3HNMA 1NY72 1O4ZA 1QH7A 3H7JA 4D7YA 3JZVA 4FOYA 4CCMA 5FOJB 2Y6HA 3KB5A 1HRV2 2XLGA 3HNBM 4AI1A 2DU0A 3O1PA 4OI2A 3LFMA 1K5JA 1VMHA 2B42B 2WC2A 2ZAHA 2P17A 1RC6A 1W8FA 4XFIA 4XUQA 4CDUC 3LOBA 4O61A 2K46A 4R9DA 5KHIA 4CEYB 5A7WB 2OVUA 3T4HB 2VVFA 1DGRN 3IMNA 1FV3A 3LDBA 1EV13 3NRUA 4GJZA 4LA2A 4Q4W3 3MFCA 4IEQA 4LBKA 3ZVXA 5K9YA 5CG8A 3MGUA 3O5SA 4PBPA 5JI9A 5T5OA 4LBQB 2IXHA 4IEZA 1B35C 4UT5A 1GOGA 1NE4A 4YYOA 2YBKA 4IEPA 4AFBA 3CF6E 1QGLA 3CDZB 2JKBA 4HKOA 3OD4A 1G86A 2QQVA 1TQ5A 1W39A 2HEYF 5L36A 5G04L 3ZOIA 1AR73 5A6XA 4XACA 3HNYM 4AW7A 2JDAA 3J9SA 3ABZA 1UU6A 1LODA 5JOYA 5DXDA 5FYZA 4DUXA 1IZ3A 1ND2C 4YVSB 2ZEWA 2DVBA 1POV1 4AFAA 1Q3EA 5A33B 4KU7A 3V0AB 2V4VA 1DLCA 4YVWA 4ZXEA 3LEGA 2XQRA 5FP3A 3ZYPA 2BYVE 1YQ6A 1VLNA 1ASJ2 5LB6A 2HYKA 1UWWA 3WNXA 2WSVA 4QM8A 4XAAA 2TUNA 5C70A 1AR92 2VOTA 2BNNA 1PX4A 2W95A 2JDYA 4QDQA 1WA4A 5DAPA 3VD3A 4EZ4A 1HKDA 2VOXA 2ZHKA 4A7ZA 3P1IA 2J7MA 1RUI3 2HEWF 4N7IA 5JPNB 5FYHA 3AMMA 3ZN5A 1ENSA 5KHGA 1RVF1 4CCOA 5AFBA 2WFPA 1DHKB 1CAVA 3CQOA 4OHVA 5FZKA 5FZ8A 4JQRA 4XZPA 3ZSKA 5J1XA 3RZGA 1TMF3 1OLRA 3ZSJA 4EE2A 3EQEA 3GJAA 2PLV1 4L2NA 4NIGA 5FY7A 1C1LA 1CWPA 3MO4A 3WG1A 4JQTA 1XNKA 2D43A 3T2QA 2UWBA 2VZQA 3LE0A 3QBQA 2LS6A 5FP4A 3GF6A 2R6QA 3O1OA 3GBGA 4Q2FA 4I09A 4Q8LA 3LCPA 5A7OA 1Q8PA 1E57A 4FP2A 2CGOA 2GAUA 3LOIA 3F95A 3NSTA 3CZJA 3RGBA 1BBT3 4OFGA 1RJ7A 1VBB2 5FK7A 2Z42A 1PVXA 2QZ3A 1NCQB 3AC0A 4HXCA 1D4M3 4AF9A 1BMV2 1LNSA 4BQXA 4O9GA 2JXAA 3IIAA 2DCZA 1CONA 1CZSA 1OPMA 5G05L 2WNEA 4Y1VA 5DG2A 4QKBA 4COWA 4YGDA 3IPVA 4CUAA 1OA3A 4RGAA 1GP4A 3PIJA 1UZ0A 1REEA 1Q56A 1ZZ8A 2O14A 1L7QA 2ZKNA 5LK7B 4HZFA 1J3PA 1GP5A 1Y3TA 3ACIA 2YG0A 2R062 4XEZA 3T08A 3WF4A 1HB1A 2C9KA 2Y34A 4UWDA 5L19A 4LT5A 4N43B 3POEA 4IL7A 2EA7A 3N35A 4M01A 5BNPA 3WX5A 4YVWC 5FWJA 1WGPA 2I07B 3LGRA 3OJBA 4WVZA 5C3SA 2VY0A 3ZLIA 2RJ2A 2B7YA 1XE8A 2DCYA 1KDKA 3MV11 4MOAA 3VHPA 5IFTA 2UY8A 1TG7A 2LTNA 1GZ9A 1OA4A 1W2UA 4ET7A 5F9TA 3MZHA 1UX7A 3U4XA 4IDZA 2PELA 5EYXA 3ZR5A 1SPPB 4LNVA 1ZA7A 1V9U2 5I8SA 3T3YA 4M00A 1W8UA 2EAAA 4QD2A 4XPVA 4N8MA 2PQQA 2VZOA 2JKXA 2JE8A 3WDWA 1URXA 3O0VA 3SNMA 4GH4A 2VD7A 2YPDA 4LORA 4NOTA 2BP6A 4A41A 4HETA 4ZKTB 3NJYA 2BDRA 1Z0HA 1E5HA 1CX4A 2AENA 3GZEA 1JHNA 1IQAA 1FATA 2D3RA 2RMU2 3GALA 3K3OA 3D3AA 5FXZA 1O3SA 1O8PA 5C9AA 3BTYA 3KV9A 4RS5B 3JUUA 2IFWA 1VRH1 2VCAA 4OHZA 1OF3A 1XNCA 4DS0A 5GZEA 1RUH2 2VZ3A 2NZ9A 5KR7A 1W9TA 2RDNA 3CKHA 3SXWA 1AHSA 3P6BA 5JOZA 2XHNA 1YFWA 4R8HA 4A6SA 3WG4A 3DKQA 5HCHA 1QDCA 1UD1A 5FAXA 3HIFA 3SHRA 4Q5OA 5FYBA 5C8CA 3WEZA 3J8F1 4QU2A 5KC5A 4DB5A 1IKQA 1V6IA 5F39A 1U5IA 1RTVA 1C4RA 3I54A 4BE3A 4XF4A 1EV11 4TTGA 4Q4W1 1W8ZA 2Q30A 3FUOA 4M4RA 2WO3A 3SEEA 3NNGA 4XQDA 5FYYA 1HQNA 2IXIA 4ASLA 5CA6A 3WQ7A 1KFUL 1Y43B 4ASKA 3J7NA 4QQOA 4DXRA 3T2PA 2RJLA 3AXDA 2GNBA 4MXWA 1XNDA 3KWVA 4GB33 3T0DA 1HV0A 1SEFA 2EAKA 4YZ3A 4TYSA 5DZFA 5C7GA 5AC92 2VXRA 1PZ7A 5TSWA 1UY4A 1W8TA 4QM9A 3VHRA 1ZZ6A 2GMEA 3N9PA 1LHVA 3RDIA 5F5IA 5BNPC 5F3CA 5JZGC 1LOBA 5APAA 1YUDA 1OD3A 1OFNA 4YG3A 5FUIA 2D6LX 4K20A 4F83A 1AR71 2X10A 2XWJB 1POV0 2A3XA 3KQRA 3RZZA 4BK4A 1CAWA 3OF1A 4XBNA 5C8WA 4HMZA 4QPIC 4Y22B 4D69A 3SCHA 4B3NA 3BALA 4UW4A 5FZAA 3RVHA 4QX8A 4JV4A 4LBNA 4LKFA 2H0BA 2P2KA 1OVSA 2BGCA 1G9FA 1NXMA 2WAOA 3AK0A 1RXGA 3N3HA 4Y20A 1MVEA 3TN93 5CFCA 2BUKA 1OQDA 5K0UA 4Q26A 2HWC3 1CAUA 1DGRA 1O3TA 3E1F1 4GH4C 2ZMNA 5SV5A 4M4PA 2A3YA 3WNKA 4BM8A 1YJKA 3A0KA 2WS92 1W05A 3N9LA 1RUI1 3JD72 4FOQA 1CQ9A 1MQTA 5F5CA 4CEWA 3R4DB 2HWD2 4NIHA 4BCUA 2VM9A 1ZZ7A 5CAZA 4CDXB 5C9AC 5KXEA 3ZKYA 2XJRA 2F4PA 5H9SA 2W0XA 3EYPA 4HSLA 3VBOB 1NCRB 5DDJ3 3DPRC 1TMF1 2QE3A 2ORXA 3UESA 3H8RA 3AVRA 3UNPA 2QQJA 3WHTA 1AL23 1X7NA 3N9OA 2VW2A 4Q4X2 5BYNA 5LWBA 2Y33A 4O7XA 2Q1FA 4PLNA 3THTA 4Z92B 2JD9A 2QQIA 1AR82 5CG9A 1YJLA 3M8LA 1BK0A 4XIOA 3WSOA 5DAXA 5C8CC 2ZGNA 2XB6C 4UFLA 1APNA 3J7MA 4TXWA 4OQ9A 1LR5A 1W3XA 3BB6A 3RMXA 2O0OA 3E97A 1MEC2 2FDIA 2ID4A 2BFUS 2JE7A 1AX2A 1BBT1 2ZOEB 5J09A 1JZ8A 3R4UA 2WT2A 3OB8A 3ST7A 1W6PB 4QX7A 4QXCA 5ERLA 2QQKA 3NMBA 5IVYA 4Y1UA 1YXWA 4GMP3 1I3HA 1D4M1 2WNOA 3VGIA 3AKTA 2FDJA 4CU6A 4FAHA 2L9LA 4ORFA 4A6OA 4CU9A 3OPZA 5C3PA 1JN2P 1W6OB 3E6DA 3L2HA 4H2AA 1V6NA 4HPKB 4XFAA 1JZ3A 4WM7A 5F2WA 1H2LA 4XFHA 1CJPA 4QQ2A 4CDUB 1G7YA 3O1TA 4JHTA 3NL1A 3ETQA 4YVSA 2KA3A 5CB7A 4CP1A 3SITA 2VNGA 4KGQA 1KS5A 2W52A 3LPFA 1B35B 3TAYA 3S7EA 5JXIA 3KM5A 4META 5CFCC 3ZFFA 4RD7A 5K0UC 4E4HA 2ZGQA 3PTYA 4ES9A 2ZZQA 4ZZ5A 1IQDC 1C1FA 4CDWA 4E2SA 1VBD3 3KCYA 3DUIA 1IS4A 3BIWE 4NAMA 4QX5A 1O59A 4CEWC 1JOPA 1MQTC 1NQDA 1H0BA 4XURA 2TBVA 5L7OA 1G9AA 1IS5A 4D8MA 3ZPYA 3C7HA 3U11A 2ZCWA 4S2HA 2JX9A 5IK4A 2VMFA 2G4IA 1ND2B 1Q43A 5F2SA 1AYN2 5JCTA 4EWAA 1RMU2 1NLSA 1ZZ9A 3LWCA 4E27A 2BVVA 5FO7B 4HBNA 2BEOA 2WWUA 1WMEA 3AP5A 2HWB2 4IGOA 3FL7A 1ODMA 4QXBA 4KWJA 1XXNA 2XH6A 2JIJA 1O8SA 4IESA 3HBKA 3ZYFA 2BNMA 3MF6A 4NRMA 1P8JA 5D8AA 4FFGA 1CZVA 3OBRA 4QPWA 1ZBA3 2QQWA 3N9NA 3ZYIB 2ATFA 3E5QA 1J83A 1D7PM 3AMNA 1WUVA 1ZBE1 2IC1A 1F2NA 2BOIA 2CTVA 2NMNA 3RS6A 2WZEA 4Y1YA 4DRVA 3H3LA 4AEKA 1X33A 2Y26A 3NNFA 3WCRA 4BLIA 5DUUA 2XUMA 1LGNA 4MZUA 1UIKA 2LM3A 5FY5A 3BPSA 1R1ZA 4AFMA 4B29A 2ARXA 2IUWA 2PHDA 4MX3A 5J37A 4WM7C 3ZXKA 1OT5A 3SKVA 1SLBA 4M3CE 3PVEA 5CZKA 4WV8A 3O0XA 1YIFA 2YUEA 2UWAA 3LD8A 3UYJA 4GB31 3HR9A 2YBSA 2CNAA 2UURA 1JUIA 1U0AA 2WO7A 5FMDA 5F3EA 4U36A 1LULA 1XNAA 2PN5A 2VMCA 1JU3A 3D0JA 3DN7A 4MGYE 1BXHA 1GQGA 4HKLA 5F3GA 5JXGA 1GP6A 5DAQA 3KS7A 3UKTA 5A6ZA 2JWPA 4DUWA 1RUG1 2LUWA 3ZFFC 1DZQA 2CWSA 3Q9OA 4DINB 5LA1A 2ZKLA 2J1SA 2DV9A 1GQHA 4G4FA 4XF1A 1ZVFA 2FCTA 4KMQA 4CDWC 1JYCA 4CCDA 2WT1A 1SPPA 2WFF2 4TN7A 3SQOA 2N7GA 5FLHA 1VBC2 2XJQA 4CRQA 2XONA 3M3EA 1LECA 4QX1A 5L7OC 1M06G 1DLLA 1KJLA 1OVPA 3LAGA 4XF0A 3HAGA 2HWC1 1H4HA 2G9FA 5DUWA 4DPNA 2CU5A 1ZREA 4YVWB 2H0VA 4NVPA 2ZX2A 3HWJA 1XSRA 4AI9A 1UIJA 1VBA3 1FI2A 5EWSA 1VAMA 2CGPA 1GNYA 1RUE3 4KI5M 1UN1A 4Z07A 4ARXA 2VCBA 3MIEA 4PQQA 4SBVA 5FLJA 1IOAA 5DDJ1 1WD4A 3IDCB 3ZDVA 5D8AC 4JGYA 2W94A 3TNQA 1AL21 2QJVA 1BEV2 1SLIA 2QTWB 2WJSA 4NIAA 4C0BA 1LEMA 3OBAA 5JPMB 2DUQA 2XOMA 1NA1C 1ULCA 1JYWA 3O7OA 5BNOA 4TZDA 1UCXA 4OZOA 4E4ZA 1S0GA 3MUZ1 1OHFA 4OUMA 3DEMA 5FYIA 5T5LA 3BCWA 3PDQA 4BU2A 1FOD2 4IE6A 4BOWA 2XJPA 5IAVA 3U78A 4PBOA 1NKGA 1PGL2 4MHRA 1ENRA 1FPN1 4AL9A 1YFUA 4YW1A 3WNLA 2RS33 3M1HA 4J1XA 4EN8B 4ZU7A 4P9WA 2QVSB 1PO12 3VBUA 4GMP1 1N1YA 3OEBA 4QX3A 3ZXFA 2FD8A 4MXVA 4DEQA 2SBAA 1ZX5A 3VN4A 5F1RA 3TEWA 4NHYA 4NR1A 1BKZA 3F2ZA 1OLME 4JDNA 4IXLA 4CXXA 4F7ZA 5LA0A 2PTMA 4FXKB 2FZ2A 1WBLA 2B39A 1RINA 2XVGA 5FYUA 1OOPA 1PO22 4LO6B 4C1XA 2GNMA 2ZGLA 1SDWA 1AZDA 1JZ6A 4OQ8A 4P5YA 1CIWA 3IPVB 1W8OA 3OBTA 4UAPA 4OCTA 3VHNA 2XL9A 4XHBA 3ZFGA 4QQHA 4OLLA 2R042 1VALA 5FZ4A 3FE5A 3QACA 4IE0A 3ILRA 5K8SA 3EB7A 5F32A 3MUY1 1R081 5BNPB 3OUJA 2WKKA 2DVDA 2E9QA 4AEDA 4BWOA 4LJHA 1H4GA 2PMWB 3KGLA 4C90A 3WUCA 2AZ5A 4YW4A 3WNOA 1O3QA 1ST8A 1QJX2 2RM21 3P3PA 3HEIA 2BQPA 3IWZA 4TSVA 1I5ZA 3VUOA 4QPIB 4UW3A 2OKXA 1DQ5A 1VIWB 1ULDA 4MUVA 4XDOA 2PHWA 5A6QA 1PGW2 1NCRA 2C6SA 2IXJA 2KM2A 4CXYA 4LXLA 2A6VA 1YI7A 3H1YA 3K4AA 2YV8A 3K75B 1SG3A 2E6VA 3ZYRA 3MPPG 4EWEA 3I2JA 4JGYC 3AKRA 1MS1A 1GU3A 5F6LB 4AWDA 4A45A 4A3ZA 2VOKA 3KCXA 3LDKA 2EXIA 4R52A 5BNOC 5IW0A 2FBEA 4GH4B 4B4PA 3WNPA 5GJ6A 2ZEYA 3OG2A 2ZX0A 1A8MA 1OH4A 2UYBA 4UYBA 5J96B 1WCQA 1YEWA 2HWF2 4XXAA 1IHMA 4BXSV 5C9AB 4OYUA 5KXBA 5FKCA 4ZXKA 1GNZA 1K5MA 5T50A 3VBUC 1SDDB 2YC4A 4MYEA 3DPRB 1WLWA 2ARBA 1A3KA 3IAPA 3B00A 1W9YA 5A1FA 2C24A 2VO5A 4YM0A 3M3OA 2QKDA 3FFQA 4XILA 1UMIA 2J1UA 4URAA 2HBUA 3GBFA 2WN2A 1F5FA 3POIA 4M0NA 2I74A 5C8CB 5E6HA 4IE5A 2R063 4LOTA 4RA0A 4COVA 2Y6GA 4C0HA 5JSOA 1OOPC 3AM2A 1IGOA 1EYBA 4GALA 4FP3A 1KJRA 3W59A 3ZR6A 5IHRA 4IEUA 1X9PA 1W28A 1X82A 1G6NA 4GWNA 1B35A 5JIAA 4FPLA 3ZSMA 2ZBJA 2YZ4A 1HDKA 3ZFGC 1HJGA 1J84A 4MXWB 4PDWB 4BQ5A 3JBG1 2G9GA 1AL0G 2X29A 5DZEA 4QQPA 4FPJA 2BFUL 3VBHA 3GDBA 3VD4A 1OPOA 4XJAA 1SQ4A 4AEDC 2CGNA 1RUD3 4BHPA 1C8M3 2KR2A 1RUF3 4GULA 2OPKA 5CBLA 1VB4A 3FHQA 4LO7A 1R1A3 1JHJA 1BHGA 1GOHA 1NCRC 1E5RA 5D1IA 3U37A 1KFXL 4YW5A 4AVTA 5A6YA 3VBRA 1OURA 2VZSA 4Q4Y2 3VDCA 3POWA 4NHXA 3NV1A 1W90A 1OUXA 1C5HA 4Y20B 2Q8OA 5CFCB 1VBA1 3VKOA 2Z2SB 2MEV2 4XFBA 1HV1A 3FLRA 1CAUB 2G19A 5FRAA 2Y6KA 3I59A 5FBJA 3ZXEA 3VL9A 4QXKA 1JMUB 5LASA 4EJRA 1QMJA 2YB7A 5JAXA 3ZSEA 5I0UA 1AYM2 4XCBA 3KVAA 1MQTB 4CEWB 3L9JT 2JE9A 2VBBA 1L7LA 3VLBB 2ZGRA 4YLZA 1XU2A 4WM8C 1OSGA 4XFCA 2VZPA 1K5MC 1KDMA 1ZZCA 1FYUA 4YPJA 2VC9A 4BQ4A 4Y4YA 3X29B 4AR2A 2B45X 4I01A 5JMOA 3BU7A 4FTBA 2EICA 1S0EA 4NHKA 2LRPA 4FPEA 2VH9A 5A70A 4AI2A 1TE1B 4GMP0 1YIPA 3PUHA 3M70A 4EV0A 5CEHA 4AQ2A 3GXUA 2RS31 4PHZA 4XW3A 1EAH3 3J8F3 1FX5A 2BERA 3RZHA 5GM0A 2DVGA 2DUPA 3RI8A 4IEOA 1UPIA 4XFGA 1QJU3 4YSFA 4A44A 4E4SA 1LHNA 3H3UA 2WRAA 2FDGA 4P9JA 3RYKA 4LHLA 4CCLA 5E16A 1RUJ2 1LOFA 3WDTA 3U10A 2B9UA 3C7GA 4XJUA 4BJ0A 1OBNA 1AX1A 3AKPA 1DDLA 1QJZA 3ES4A 3WP3A 2HBTA 3VBHC 3PUAA 4MVTA 4QHZA 3HOBA 4QXHA 4WM7B 5CKMA 3ECQA 1MS8A 3UGFA 2WZ8A 3ITQA 1ASJ1 1MS4A 2R073 3OYWB 4R9CA 2VGDA 4FPFA 5K7PA 1GWLA 4CCCA 1IPJA 1C8NA 4AVBA 1QXRA 3T30A 1UY2A 1W0OA 4QKDA 3VBRC 1SBDA 1PIV2 1Z7S3 5DZGA 5FZCA 5LBEA 4L11A 1W9FA 2Y6FA 3ZFFB 1AR63 1XNTA 3A7QA 1YCIA 2YFUA 3IM0A 2J1AA 2V09A 4AI8A 2A70A 1FXZA 1LOGA 4Z8BA 1QWRA 3PU3A 4CDWB 2B9VA 2FMYA 3B69A 2O8QA 3GYDA 2MNGA 4P9YA 3U75A 1G9BA 2QQPA 3KT4A 5JMCA 5BUVA 2WO1A 1XYPA 1SZBA 4FPOB 1BQPA 1S1AA 2VXJA 4UFJA 5FXVA 4BB3A 1W06A 5BNQA 1MS0A 5L7OB 1JUHA 3CIHA 5FREA 1ULPA 4J6GA 2HKXA 5LCWL 3IBMA 4C91A 2VZVA 5LY2A 2RR13 4H14A 1OA2A 2W1QA 4Y4RA 5T52A 4INDA 4OI1A 5JOWA 1JYIA 4OMCA 5FY1A 3M2MA 3ZMOA 3ZYBA 1ALYA 2WA4A 2VNOA 5IVBA 3TEYA 2K0GA 2IZWA 3LFIA 3NQHA 3R4SA 1UYXA 2WLQA 4XF9A 4XETA 2BBVA 1UX6A 1BMV1 2VMHA 4K40A 1LRHA 2IVIB 5D8AB 3ZPOA 4Q4V3 5ACA3 1T6GC 1V00A 2YPJA 2C0ZA 1QXJA 3NVCA 4Y3OA 3SKJE 5FPZA 3FMGA 5D21A 2WNUA 3RG0A 4IGPA 1NA1B 1LOFC 4Q0VA 5B4NA 1ULGA 5HCAA 2X09A 4RHV3 1H1IA 1RVF2 3OBZA 5A1AA 4QGLA 1JZ4A 2R061 3S6PA 3VD5A 1LB2A 2BNOA 2X5IA 2BJSA 3A0NA 4JRAA 3ZM8A 2PLV2 5J3UA 3ZXAC 2P3IA 4BXFA 3C7OA 4P9LA 5BPXA 2W46A 3VKFC 2KXLA 5FR3A 4FOVA 1COV3 5FCCA 2Z4FA 3VDDA 3PHMA 1H8TA 1EP0A 3K77A 5FP8A 1H30A 2WUHA 4W8JA 2QQMA 3RZMA 1ZM1A 3HQRA 2YU2A 4ONUA 5GKAC 2XBO2 3VHOA 2HWE3 1RUD1 2H6BA 2YMZA 2V4AA 1V9U1 1C8M1 3APBA 3QCWA 4FCAA 4KWLA 1RUF1 4ZS3A 5FZDA 1W9SA 2RE9A 3NJXA 5F5QA 4QPIA 1DFQA 4H7LA 1R1A1 3KGZA 2BOJA 3MIHA 4LKEA 4Q1RA 5DABA 3ZSLA 2R16A 1FV2A 2VQUA 5CVRA 5FIXA 4OHYA 3CNAA 4OHWA 4R4ZA 4XOGA 1MZ5A 4CPBD 3VBFA 5HCBA 3QH7A 5I91A 2FCUA 1TNFA 3AL6A 4Y1ZA 5DQ0A 3JCIA 2RMU1 4S2DA 1G9DA 1T6BX 2BV4A 2P4EA 3W5NA 4X8PA 5FZ6A 2GN3A 3Q8EA 3AP9A 3LEKA 2NP0A 1WZXA 3R6SA 1ULFA 1DGLA 1WCUA 2OYZA 3ZYJB 1AJOA 2PHLA 3B7MA 3FN9A 4IERA 1V70A 3CZUA 4PQ9A 2EF6A 2J1TA 5HCFA 2K9ZA 1H1AA 2EXKA 3HBZA 1F15A 2BVBA 2A71A 1DCSA 3ZXGA 3DPRA 4A7KA 3FFZA 3LPGA 1RUNA 1XQNA 4UW5A 3VDBA 4JGYB 5L9VA 2RJKA 2DUOA 2ENRA 3MW3A 4YARA 5KXDA 3LEMA 3I2KA 3LB9A 2C9AA 2GNTA 2YC0A 2XL7A 3UGGA 1ZBE3 1FMD3 3WQ1A 2WNUC 5JI7A 4ZS2A 2LW8A 5FYVA 4Q8KA 1EAH1 1TME3 3JU9A 2IXLA 2W92A 5BNOB 2ZGSA 2EIDA 1LESA 3LF7A 2E7TA 2ZHMA 5E1RA 3AYDA 2BGOA 2R30A 2Q1ZB 3I8TA 4LBQD 1QJU1 2PHTA 5DN2A 5AC91 2WABA 4IEWA 5H9PA 2X5IC 2B46X 4PIXA 2W3JA 3WDUA 3WP4A 1QH6A 1RL3A 3SC7X 2DDUA 1IG3A 2VMIA 1VB2A 2WWJA 3VBUB 5C71A 4S2FA 4PDWA 5A1LA 3P3NA 4MHUA 4UFKA 2CV6A 3VDDC 2PXJA 1X9TA 3J7LA 1H8TC 2QQUA 3QLQA 3ZIWA 1STMA 4UOJA 4YZ5A 1JBCA 1VRH2 4K1YA 4ATEA 1RUC3 3UJOA 2WT0A 4M3CA 1JZ2A 4BMBA 2E32A 5JR2A 2CY6A 3K2OA 1YQ5A 1RUG3 2YGLA 5IYYA 1OMIA 5I8TA 1SLCA 2X05A 3T2TA 1Z78A 3B02A 1ND3A 2R071 3N7MA 4DXTA 3RJRA 1OOPB 2Z79A 4I02A 3H3ZA 2A7AA 3BUCA 3B3QE 4DIQA 4LBLA 2V72A 1UAIA 1PNGA 2VCCA 3CHXA 3LSEA 1OLQA 2D6KA 2ZMLA 3T1LA 3DYPA 1Z7S1 1KITA 2I2SA 3VBFC 4E4DX 2UU8A 3SH5A 1WCSA 2VAUA 3POSA 1EV12 1V6MA 3B93A 3NV3A 4Q4W2 3ZFGB 4B8EA 5FO9B 1AR61 5E8AA 4L9BA 2PHXA 5GLTA 5I0DA 5JLVA 3GBWA 2YDEA 1Q8VA 1KGYA 4AEDB 4YFWA 3AB0A 5EJZB 3LQCA 5JR7B 1H9WA 4N9HA 3BGAA 4N7UA 5ABJA 1QNWA 1RHI2 2WL1A 2XG3A 3OY8A 4GWMA 4PIYA 1BYHA 4BQ1A 5F5AA 3RZLA 4QKFA 5CU1A 3AP6A 4KBZA 1AR81 1JW6A 2W5FA 1WW6A 4LITA 2D44A 4M0HA 5J98B 1AR72 2WQZC 3RNSA 2ZHNA 4Q0SA 2RR11 2NMOA 3BPZA 3FUQA 2D5FA 4TLFA 2VBDA 2WA3A 2OT7A 2B8MA 2G9ZA 1PZ9A 1UU4A 1TNRA 2D3PA 4QB2A 1GQPA 1WW7A 2RVAA 5GALA 1PK6A 2XJUA 3GM8A 4C1WA 2A6ZA 1RYYA 5C33A 4AE2A 1X50A 2ZA9A 4DOUA 4XYXA 3GHMA 5DG1A 3FBYA 5IUQA 2YROA 4GZ9A 3TRSB 3RYRA 4YZ2A 5GZCA 4CU8A 3MIGA 4Q4V1 2XJSA 5ACA1 1FPN3 4D0QA 1XE7A 3FLTA 2ET1A 3O0WA 3DXUA 5EPAA 1RITA 2GALA 3H1MA 4HL0A 4WM8B 1K5MB 1RUI2 4Y24A 3WW4A 4CCKA 4DUVA 2DFBA 1WD3A 4PDWC 3AZXA 4WVMA 4P9XA 4RHV1 3CJXA 3FJSA 4XE9A 5FK8A 1XYOA 5JWPA 2D7FA 1O4YA 4JAAA 3AZWA 2ZEZA 1YYNA 3R0RA 2NN8A 1QJY3 4LE4A 3NAPA 5CISA 1TMF2 2X8KA 4CUBA 1RIRA 1XBFA 2WIIB 3LIGA 1QHDA 2DYCA 4GA9A 1TZOA 2LALA 4NIDA 3OYWA 3MLLA 4XAEA 4LHSA 3ON7A 1O5LA 5H9QA 4PF1A 5I93A 1ND3C 3BKZA 1HQWA 1HJFA 1YWKA 1COV1 4P14A 3RSJA 3K46A 1OLMA 2DFCA 1DYOA 3FX3A 2PYTA 4DFSA 3AXEA 2HWE1 3SCGA 4QPGA 1JI6A 1BBT2 5FPAA 5CKNA 3ZFEB 1GV9A 4G3YC 1R083 3VBHB 1YFXA 5DUXA 1D4M2 2FDKA 4X8NA 3KHCA 2GC3A 3CJIC 4YGCA 5KHHA 2PA7A 1BJQA 4DQAA 2VVDA 4XUOA 3UV9A 2GC2A 4CA9A 4DXZA 5ABJC 2RM23 4HVRA 1U5XA 4CP9A 2J42A 2TEPA 4AHZA 4D94A 5IVFA 5I0RA 3V0BB 4P9GA 4V2WA 1UXZA 2HWB1 3NV4A 4JX0A 2ZJCA 3WDXA 4GAZA 1UMZA 2ERFA 3VBRB 2VR4A 4YW3A 4DY3A 2WDBA 1BCXA 1HIXA 3N36A 5LBCA 3WF2A 2VW1A 1UU5A 2R1BA 3ACGA 3LA2A 2JDKA 4PLOA 1PVC3 1PK6C 1W2AX 2MPFA 1ZRRA 5LRSA 4FPYA 4DY5A 1D0GA 4Z2WA 1OF4A 3I59B 3MV01 3VD9A 1QKQA 3JQWA 2VQ0A 5FPXA 3MW4A 5JXHA 1BK1A 2W1UA 2R7EB 4UFIA 1ONAA 5GLVA 5FJKA 3PLQA 1DQ6A 4FPGA 2HH9A 1S4CA 3HMYA 3M4FA 2P3YA 1FMD1 4QPYA 1NA1A 5IVEA 4YZ1A 3VZKA 1TME1 1PM7A 2B4KA 1T2XA 1F8VA 4IETA 1W2TA 2FDHA 2ZX3A 4HLTA 1X8EA 3U14A 2YFZA 3NAPC 4AGVA 2RS53 1A78A 1SHWB 3C3VA 3DECA 4L99A 1NLQA 4NPLA 5EIYB 1ZRFA 1S2EA 4QDSA 4E2QA 3OOXA 1WCDJ 1KXGA 5C5UA 3IIIA 4MADA 2AR6A 3AP7A 4N53A 2GN7A 4E2GA 4FOWA 4KH9A 2P5BA 2HJIA 3GZTB 1RUC1 4BLJA 1OD5A 3CU7A 2Y0IA 4XJZA 2WZR3 5FWEA 1UF2C 4P02B 1ULOA 5CKQA 5FO8B 4AI0A 3GGLA 4JCKA 3ELNA 3JBG3 4QPGC 2GSYA 4OMDA 3VKMA 2NYYA 4I2OA 4Z1VA 3ME2A 2GNDA 2RDQA 3OUHA 4KWUA 3H8XA 4B7EA 1PX3A 1W6MA 2BW8A 4O9EA 4OUEA 4Q0PA 4F3JA 4KG0A 1XPWA 3SMHA 3OUIA 3DL3A 4A3XA 4LTAA 3ZMNA 4B4RA 2C5DA 2VW0A 3KCCA 4LR4A 2WINB 1SLAA 5FUPA 3O14A 5FZMA 1LHUA 1JU4A 3S5QA 4KGGA 5FZ3A 2VZ1A 5BXXA 1W3VA 3FBMA 1NT0A 5FPLA 4XHXA 1EY2A 2GZWA 2W2IA 4CYDA 5EYYA 1MS5A 2XPJA 4EN0A 4U2AA 4MH0E 2OA2A 2VPVA 2VNRA 5T5JA 4GB32 1YNAA 3RWKX 2R49A 3LDRA 3UT0A 3H9AA 4PF5A 1GZTA 2V5DA 4FSJA 3IT8A 1BEV1 1J1TA 1NG0A 3EXUA 4AK3A 2Y6JA 4KG8A 1XC6A 2JIGA 3LIHA 1HB3A 2VG9A 4FO9A 3PUIA 2V73A 1UO9A 2DVAA 4K21A 1JS9A 3H50A 1QIQA 4QGNA 3WCSA 3OGRA 3PL0A 1FOD1 1HRV3 2IXCA 2Q5TA 1WMFA 3B5LB 4URTA 5T5PA 4CP2A 3PVOA 1PGL1 2YGMA 2PAMA 4HKWA 4RQPA 3JB4C 3KMHA 3AKSA 2XXZA 4MG2A 4GIQA 1GR3A 3TB0A 3AZZA 2F6BA 4QX0A 1SFPA 5EZWA 3TN92 2EIEA 1Y9GA 4Y1XA 2IVJA 3DV8A 5FJHA 1YI9A 2HWC2 2A3WA 2KD7A 1YC61 3LA3A 5DPNA 3VKLA 3E5XA 3MW2A 2QFEA 4ISRA 2A5ZA 1GKBA 1EPZA 3MLKA 1GZWA 5L9RA 3PJQA 5F37A 3UJQA 5F6KA 4NN0A 4N53C 1FNZA 1PO21 1Q8SA 3I7DA 3PMSA 3IKWA 3MBWA 2GP5A 2BTVC 1HN1A 4NROA 1QJY1 5LEJA 1NX9A 5DDJ2 5EP9A 2BRTA 5CIRA 2CAUA 2DF7A 2WNUB 1RUOA 1CZTA 3N7KA 1VPHA 1WBFA 2Q8CA 1JOJA 3WG2A 4Q0QA 1AL22 3BTAA 2XUEA 4H7MA 2ARCA 2WZPP 1BVP1 1GANA 2XHKA 3UK9A 5LW9A 5I0SA 2JD4A 3M7AA 1HXS2 3POFA 5HPOA 1DP0A 2OZ6A 4UBHA 2GC0A 2X5IB 4OUSA 1ZA4A 2E7AA 1FAYA 4YRDA 5C4WA 4LA3A 4GQ7A 3WF3A 1MACA 1O4TA 2SLIA 1YFYA 1WCKA 2DTYA 2ET7A 1ASJ3 1D0HA 1C57A 1QU0A 1BZWA 3B01A 2VTFA 4KQ7A 1AR93 1RJ8A 1UPSA 3KQ4B 3VDDB 4CP0A 1TEIA 1H8TB 4ZU5A 2P3JA 5AVPA 4FTSA 4UFMA 1PGW1 4IQPA 4NRQA 2DU1A 2A6XA 4PJYA 2JEMA 5KWRA 1W6QA 2JDNA 1SFYA 2BU9A 1ENXA 3UKVA 2Q8EA 4D6QA 1Q5OA 5FZ7A 3WHUA 3PVBB 1W04A 3J7HA 2WO2A 2PHRA 1OFSA 4QB6A 2RS12 1QEXA 3TEXA 2D97A 4BA6A 5C3QA 3PURA 3C7FA 1GZCA 4RR3C 3VBFB 4H3WA 2JECA 1CIYA 5FPUA 2CL2A 4HG6B 4RQPC 3NO8A 1PVC1 2EXHA 3LA7A 3S7IA 5IVVA 3W9AA 1IG0A 1JZ7A 2VOVA 4LPLA 3Q8FA 3AZYA 4XJ9A 3RZKA 1NUKA 4PLMA 3K48A 1OKOA 3RRDA 5F8PA 4N90A 2E7QA 4LUKA 4BMEA 3CEWA 2HLEA 1VBB3 1F4AA 5JSRA 2ES3A 3I2HA 1QQP2 1VBD2 2WLPA 4WM8A 4XDPA 5FPVA 5FZ9A 1WLDA 4IUGA 5FUNA 4W6WA 4ITCA 3IDBB 1VBE2 4ARYA 1H2KA 3V65A 4K1ZA 3LKJA 3KT1A 4MGTA 2XVLA 3USUA 2VOWA 2E63A 3GCWA 2F17A 5J48A 1XE0A 2ETEA 1PHMA 1W03A 2VUDA 2YXSA 2RS51 4FT8A 3C7EA 4LUMA 1UL9A 1W8WA 1GUIA 1YRZA 2VL4A 2YC2A 1UYZA 4LK6A 4HANA 1LKNA 4Q0UA 1LGBA 1VE0A 3DF0A 4D6RA 1SMVA 1YQCA 3N7JA 4JTNA 1VMFA 2XQXA 1XNBA 5C4WC 1DZTA 4CSWA 3L2YA 4HOOA 1YLLA 5J7MA 2WZR1 4MGSA 2XKPA 2W87A 1H9PA 4PT6A 5EFUA 3PIGA 4HONA 2IFRA 1SFNA 3EMRA 1ZBA2 3ZFEA 1WLCA 3KZ4C 3M3CA 2RV9A 3J26N 3OPWA 4Y5TA 5DAVA 5FXWA 2H6CA 4W6XA 1J59A 5FPBA 2Y0OA 3NV2A 4M3CB 2A6WA 1V9U3 1NE6A 1YQ8A 1OC1A 3NW4A 1OQEA 1CX1A 5FZGA 1ND3B 4JGZB 5EJ3A 3V0BA 4AGGA 1H1MA 1MZEA 2VMGA 1A8DA 2ZTNA 1HLCA 1E5SA 2WYFA 4LO8A 5LBBA 3W21A 4FQ4A 1A6CA 3U4SA 3Q8AA 2R0HA 4CXWA 1AYM1 2RMU3 1R092 4NPRA 3WNNA 4Y5Z0 2RDRA 4Q29A 5IT6A 5IVCA 1RGSA 3HT1A 3GZAA 3KVBA 1WMXA 2ZGTA 3PJYA 4IGQA 2Z5WA 1RUH3 1NY71 3IB3A 4LHNA 3CJIB 1CAXA 2J1VA 3PNAA 4DNYA 1O6UA 4HN0A 5K4LA 3ENRA 1HRV1 3OY8B 5ABJB 5E88A 4WBBA 4O65A 3K51A 5IAXA 2PHUA 3WVJA 4BQ3A 5KBFA 4K8FA 4RGGA 1VAVA 3QOPA 3O1UA 2WBKA 4YG6A 5FZIA 3ACHA 4I30A 4L0PA 2WAAA 3VZLA 2QDRA 1B09A 1N3OA 5GZDA 1BVVA 4CVUA 1MS3A 1XYNA 4LKDA 4D3WA 1ZRDA 1PK6B 1UZVA 2VBPA 4HT1T 4QMAA 4B1MA 1C3HA 4KWKA 5GZFA 4PI2A 4AYUA 3ZXJA 4AVVA 1JZ5A 3I2IA 3KV4A 1JYXA 4OULA 1GICA 2OS2A 1VBA2 1QJEA 1JH5A 2XLFA 3USSA 2YBPA 5AC93 2MHFA 1RUE2 2VECA 1G9CA 2E33A 3AL5A 4NO4A 4XJ8A 5C5TA 1DF0A 1DGWA 2OQ7A 2ZMKA 1HRI2 1U5ZA 1UY1A 1V6KA 3KV6A 5J36A 3BTXA 2R1DA 1XU1A 5IFPA 4NAOA 1XRUA 4RYDA 2VMEA 1JYTA 3D4KA 1UKRA 2QQNA 4NE9A 3ZKUA 2Y6LA 3IMMA 4WVMB 5FMCA 3ZFEC 5FMOS 5IATA 3BN6A 2Y38A 3TYJA 4AVSA 1D4VB 2P34A 1LCLA 2ZACA 1VR3A 3AJYA 5IJRA 3WZ1A 1QOTA 1QF3A 1UOBA 4IV1A 3NAPB 4GJYA 4L8QA 1SCRA 3DCQA 4LIUA 5I0TA 2OX0A 1PIV1 3AMHA 3TOJA 1DGWX 5IVJA 5JIUA 5CFDA 4BK5A 4DZGA 4M3CF 2EIBA 3BYWA 4MV2A 1V6OA 3DKWA 1AR91 5FZLA 3NJVA 4AHXA 3HQXA 4OVEA 2RS32 2VUCA 4XJWA 5A7QA 3ZXLA 4YNIA 2CAVA 5FY0A 4AGRA 1Y4WA 1HQLA 1F35A 1V6JA 5FYSA 2WS93 1QOOA 2J1EA 3JD73 4XC9A 3QH6A 1NLRA 1OI6A 3B94A 1RHI3 2HWD3 1DG6A 4BYYA 3AYAA 3N9QA 4QPGB 4DRRA 4P9IA 3ORJA 3W5MA 1WKYA 2JENA 4XBLA 1N3QA 2DTWA 5DUVA 1GFF2 4OI4A 2Y60A 5A3LA 2WNVA 4E8CA 1JODA 5KC6A 5FQ0A 5E89A 3VDAA 4ZHNA 1GWMA 2OXBA 4Q4X3 2VZRA 2PAKA 1VMJA 2O1QA 4CP9B 5HI0A 2WQ8A 5A7NA 4LULA 5A7SA 1AR83 4ATFA 2J1RA 4RL7A 2JG9B 2WN3A 4JDMA 4NWWA 3EHKA 5JVVA 1MEC3 5T55A 3SEPA 1S0BA 3A23A 3MLJA 3OGVA 5JSPA 2P1BA 2EIGA 4L92A 2ZGKA 2R32A 3VBSA 1VBB1 1GLHA 3MF9A 3VB9A 3AYCA 1LOAA 1ACCA 4QQLA 4XFFA 4XMAA 4FPCA 4XMIA 3THDA 3UKNA 4EN9B 2ZX4A 2OUHA 3ZX7A 3BOPA 1EUTA 3BOWA 3K4ZA 3HN3A 5FMBA 1WWYA 5JXJA 5KHKA 1QXPA 3BI3A 3DYOA 1M4WA 4KL1A 3G6JB 5C3RA 3ZN4A 1X36A 3AZVA 2DVFA 3B9CA 5HBAA 2VUAA 3RYPA 2W68A 2JDPA 3BODA 4YM2A 5IWFA 4AQSA 1QNYA 3NKTA 2GH8A 4AG4A 5GLWA 4FBFA 1LU1A 1NQJA 4R9AA 5IK7A 4FTEA 4IV1C 4QB1A 4IV3A 2JB4A 5FY9A 1SLTA 3AFGA 1ZRIA 1W99A 4FAGA 4HVQA 1HN0A 2ZZJA 2XBO1 1N1VA 5CFDC 1KD7A 5SV8A 3WW1A 1IPSA 5LK5A 1SCSA 5DMYA 3V64A 3WV6A 3ZYGA 2JDUA 4N53B 3KHBA 1AXZA 3ASIA 4JKLA 1JYNA 4BH9A 3WNMA 4YWAA 2AREA 4CE8A 2QQOA 3POJA 3AKQA 2DCJA 1UKGA 4FFFA 3A4UA 4CDQA 2UY9A 4WZFA 5BNNA 5JUVA 4XBQA 4GWIA 3THPA 2ZX1A 5GLUA 4AEMA 2JJ6A 3H1WA 3DYMA 4XUTA 3OD0A 5A80A 3BTZA 2JDZA 1W6MB 3OSDA 4TWTA 5B4XA 2Y8KA 4BIFA 1AYN3 4YW6A 1Q8OA 3I97A 3MIBA 2WNVC 3ACFA 1RMU3 4NUBA 3NNMA 4AVAA 1XOYA 4AHYA 3ETPA 4CCEA 3EO6A 4LKSA 3WW3A 3N7LA 4XDQA 4XQ4A 2G1MA 2HWB3 3ZO0B 1N1TA 2JICA 5KHJA 3CL1A 1JTZX 1RUH1 3ZDSA 2WQ4A 4RN5A 3ZN6A 2JDHA 2DCTA 4TLGA 1LOEA 3I2DA 3OTFA 4DXSA 3VBSC 4CUGA 1I5PA 2GDFA 3AJZA 2DURA 1VRBA 2A1XA 4AOCA 3ALQA 2UYAA 3UGHA 1RUD2 4UBGA 3SLIA 1C8M2 1DU3D 2GMPA 1PMIA 1RUF2 1JXNA 2VTXJ 2W91A 5FP7A 2Q8DA 1GOFA 4JC1A 4RR3B 1R1A2 2PFWA 2W08A 3H8UA 2CYFA 5F3IA 3J4UH 4RQPB 1UOFA 4BQ2A 5A3PA 3RWNA 2XDVA 5FBZA 2WYSA 4RSUA 3T0AA 4W4ZA 4KNCA 1OUSA 2BPA2 3AVSA 2CDPA 3AX4A 1AXKA 4FFIA 4AHWA 1JOBA 1X8MA 5EXOA 1L3JA 2EVXA 4PIZA 3VZJA 1W0NA 3D6EA 3O1MA 1SLLA 4GWJA 3AP4A 4IV3C 1VAKA 3GNEA 4XXPA 4ZU4A 4COYA 5FDBA 1HB4A 2C4XA 3WG3A 3WOGA 1W8HA 1DQ4A 1GZWB 3FLPA 2NQYA 4QU1A 3FC0A 3T2OA 3ZXDA 2D98A 2E31A 4XIKA 4HVOA 1REFA 2E51A 1V6LA 3U07A 2NPIA 3D8CA 2ADEA 5M0TA 4XUPA 3WDYA 5GZGA 2WFF3 4LLOA 4DMIA 3I3BA 4CDQC 2JDMA 1VBC3 5BNNC 1HB2A 3WD5A 5A32A 4K8RB 4YM3A 3VL8A 3POGA 2VVEA 4XTPA 5F7UA 1EUUA 4JGZA 1AF9A 2HEVF 4DO0A 3NNLA 4FVVA 3WR0A 3T4VA 5FLIA 4XUNA 5C3OA 2D40A 5LZ6A 1EAH2 2QNKA 3AYEA 2Q1MA 3J8F2 2E26A 5FFOC 5C4WB 3ZYHA 2WS91 1GWKA 3C2UA 1QJFA 3JD71 1QJU2 1GNHA 4MLOA 5LATA 2HWD1 1RHI1 1OH3A 1Y7BA 3OEAA 4NMIA 3SH4A 1LAJA 2LROA 2WWSA 3N4MA 4J1WA 1E5IA 4JHZA 4KU8A 4R9BA 3LSDA 4LBJA 5LRRA 4IEYA 2B5HA 1UYPA 3CJIA 4YGEA 4EROA 3O1SA 3HVDA 3U1XA 2JG8A 1W6QB 1LHWA 3A22A 5CADA 4JKKA 5JZGA 3WINE 4Q4X1 3W20A 1BEV3 2XWBB 1RXFA 3AMPA 1MZ6A 1O91A 2AYHA 4NJ4A 3UETA 1W6NA 4E8DA 2QCSB 4CU7A 1S0CA 2AC1A 1DQ1A 1GYKA 1UMHA 3TWIA 4XQWA 2R072 3H8OA 1FOD3 5L9BA 1MEC1 1J1LA 2K2SA 4CPBA 1LTEA 2ZPXA 2UWCA 5EJ1B 4QX2A 1UZYA 4P08A 4RFRB 1H2MA 3V56A 1HX6A 5JOXA 2GH2A 3GZUC 2GMMA 3QD6A 1PO13 1Z7S2 4W65A 1XB9A 4ZONA 3HJRA 4BIOA 1AR62 2Q0AA 4XCAA 1PMJX 3MFAA 4IW3A 3K3NA 4MSVA 3TBDA 4A4AA 4UF0B 2W1WA 4Q27A 3S5AA 2XJTA 4LK7A 5D2AA 2FCVA 4R4XA 3PTRB 4FPKA 1A34A 3MDPA 1ODNA 5FZEA 2ZGUA 1W2NA 5LEKA 5FZOB 1PO23 2GP3A 4NHLA 1HXS3 4S2GA 3USUB 4MO3M 3WF1A 1PMHX 1MS9A 4COUA 3PU8A 1CR7A 1LJ7A 1WLTA 3B9IA 2RR12 3D5OA 4N9IA 4Y5SA 4SLIA 3O12A 3I4IA 4CEYA 5A7WA 1CVNA 3MPBA 2XGXA 3WQ0A 2V5YA 2BBAA 3IDEA 2ZEXA 2R043 1MR5A 1O7FA 3OGJA 4IE7A 2AUYA 4JGZC 3WP5A 5FZBA 3EJKA 1QOSA 5GLZA 2P6CA 4LBQA 4X6QB 4B1LA 1UQXA 3T09A 1OKQA 1UW8A 3R05A 4W6YA 5FYCA 4K7JA 3VKNA 4IEXA 2XKOA 4ZY9A 4LMFA 4QKNA 2X53S 4BQYA 4I0AA 1K45A 1I6XA 1QJX3 4Q4V2 3PVNA 5EV7A 1WA6X 5ACA2 1REDA 1O3RA 4LBMA 2A6YA 2VU9A 2RS13 2VNVA 4HK9A 3DGTA 1LENA 2W1SA 1AYN1 3IAQA 2ZAAA 4W50A 4J25A 4K6BA 4RHV2 2JG8C 2EXJA 1RMU1 4P5HA
chains in the Genus database with same CATH topology
3INAA 2BWAA 4RFT0 3VZNA 3WLUA 3RPQA 4B4QA 3IN9A 5FMOL 4HFSA 3V0AA 5A33A 5IK5A 1W0PA 2JG9A 3SISA 2FQPA 3FHIB 4AFCA 2P3KA 4UXAA 1LHOA 1COV2 5BY5A 3M3QA 2HWF3 1WMDA 1AUYA 1PNFA 1QQP3 2VUJA 5KXCA 3LZZA 4BPZA 3ATGA 1O5UA 2HWE2 2OZJA 4GKYA 1IPKA 1NXD1 4YZ4A 4AEJA 1VBE3 4QHBA 3MIDA 5JDBA 1CAXB 4COZA 2XVKA 4QT6A 5FOBB 1YO8A 1NOVA 2IXKA 2GC1A 1S0JA 2D5HA 1MVQA 1SBEA 1GBGA 1QY4A 4YW2A 2QUOA 4AXOA 3NJZA 5I8YA 3ROUA 3M3IA 4I0WB 1CPNA 3EBRA 1I9RA 1DYPA 4CEYC 3NWKA 2Z69A 2ZS6B 3MI8A 4GXLA 4JRLA 4EN6B 5B2GB 3AFKA 1NCQA 4QGMA 3FZ3A 1ENQA 2VULA 4A2UA 4FXGB 3URFA 1EPWA 2WFF1 1F31A 1VBC1 2FZ1A 2YHJA 3S30A 5T54A 3G7DA 1ZBE2 1FMD2 4K9SA 1CGPA 4IV1B 1ULEA 2C1FA 1S2KA 1TME2 4YGBA 4Q4Y3 1LOCA 3E5UA 1LGCA 4WVWA 5CFDB 3T1MA 4N43A 1R093 4YVSC 1ZYBA 2MEV3 3NKGA 1D2QA 4NHMA 2JG9C 1DZRA 1WW5A 2D6NA 3RQ0A 4D7TA 2ILMA 2OIIA 1AYM3 1PGSA 3MIFA 4LE3A 1AVBA 1H2NA 2GU9A 2ZGOA 2D3SA 2BWCA 2QDNA 3HT2A 3KT7A 4XTMA 1RUC2 4CTEA 1SBFA 4LO5B 2AH2A 2PAEA 4JTOA 5A3MA 1RUG2 4ES8A 2NM1A 1H8VA 2ZGPA 2YYOA 3AMQA 2ZHLA 4WZCA 3VZOA 2WNVB 3TN91 5FQ0B 4RR3A 4HSJA 1F5JA 2D6OX 3WP6A 3W58A 1VP6A 4MGIE 4HN1A 4CZSA 1S55A 1PO11 4GKXA 2OW4A 4YG0A 1ZZBA 4AQ6A 1LEDA 1KS4A 4RS5A 3ILFA 4L97A 5L73A 3VBSB 1HRI3 2DCKA 4AVCA 3JQXA 1RUJ3 3POYA 1SACA 1IS3A 1NZCA 3RJ2X 1Y9QA 3E6BA 1NCQC 1HXS1 1CAVB 1I1EA 4YFZA 4K3UA 1AJKA 1F9KA 1RB8G 2DWRA 2EALA 4MGKE 3ACLA 2R041 3JB8A 2A73B 4EWDA 2XLAA 1C5IA 4IV3B 1PIV3 1N47A 4N43C 1QJX1 3D0SA 1FPN2 1GSLA 2WSUA 2Q4SA 3WT3A 3E6CC 1S0DA 1VJ2A 3D82A 3WXPA 1N3PA 2RS11 1CPMA 3MYXA 5HXVA 4CDQB 3OGGA 5BNNB 4Y22A 1OQ1A 1J3RA 1DQ2A 4ASMB 5C6CA 3S0MA 1U12A 2CWMA 1D2SA 1QJY2 4V1PA 4E9KA 1KQRA 1ZNPA 2PHFA 4Z82A 1J3QA 4UW6A 3HD8B 2HWF1 2RHPA 1POV3 1CESA 1ZRCA 2D93A 1QQP1 1VBD1 4B7KA 1S2BA 1DQ0A 1IS6A 1CN1A 3ZN6B 4I0BA 1VBE1 3CO2A 4CDXA 4RS5C 3OCPA 3VBOA 3MEPA 1PZ8A 1CD3G 1R082 2ZABA 3SH3A 4F8AA 2D6PA 4YM1A 4OI0A 3TNPB 3WY6A 1RVF3 2RM22 4FPHA 1FNYA 5CNAA 5IK8A 3ES1A 3MICA 4NWVA 3SCFA 2PLV3 3WW2A 2R0FA 1AXYA 1NYWA 4AFDA 4HK8A 3VV1A 2EXJA 1UZZA 1IKPA 1PVC2 2D6MA 1ZBA1 1W6PA 4LHKA 2TNFA 4ISQA 5AVAA 4LO4B 3UL2A 3WDVA 2XBO3 4LBOA 1FT9A 4I3GA 1W6OA 2O8OA 4WVVA 1WW4A 4HPKA 4MGZE 1DIWA 1MZFA 1U5YA 3H7YA 1AX0A 5AFEA 3GHNA 4CDUA 4FQZA 4PCRA 2A75A 1S0FA 2NLRA 5H9RA 4Q4Y1 1S0IA 5A32B 5T3NA 4OHXA 1R091 3VZMA 2MEV1 2RS52 1KRIA 4X6RB 3U0ZA 4OZXA 5FTTC 3CLPA 1G8WA 4JDOA 4AI3A 4XF3A 2W39A 3RMYA 1Q8QA 1N1SA 3FWEA 3KSCA 4A7YA 4KBBA 2IWGB 2OUJA 3KD4A 2ZGMA 4I3PA 4Q1PA 2FHRA 2WZR2 1DYKA 1CJDA 3JBG2 1CAWB 1HW5A 2XJVA 1QDOA 4CDXC 2FMDA 2JG8B 4LLFA 4AQTA 5JZGB 1ND2A 3VBOC 3H0OA 1W6NB 4EN7B 2VQAA 4IEVA 2E53A 2I45A 3RI9A 5K0UB 1LU2A 4LEJA 1RUE1 3ZIXA 1C28A 1HRI1 3ILNA 1YHFA 3HN1A 3WUDA 1RUJ1 3KLSA 5BV6A 1J58A 4G9SB 2P37A 4BZ4A 2AGSA 4Y26A 3PMEA 4D7SA 4JVAA 1DBNA 1VRH3 2QZ2A 2YY1A 4H55A 1NY72 1O4ZA 1QH7A 3H7JA 4D7YA 3JZVA 4FOYA 5FOJB 3KB5A 1HRV2 2XLGA 4AI1A 2DU0A 4OI2A 2WC2A 2B42B 2ZAHA 2P17A 1RC6A 4XFIA 4CDUC 3LOBA 4R9DA 5KHIA 4CEYB 2OVUA 2VVFA 1DGRN 3IMNA 1FV3A 1EV13 4LA2A 4Q4W3 3MFCA 4IEQA 4LBKA 3ZVXA 5K9YA 5CG8A 3MGUA 3O5SA 4PBPA 5JI9A 5T5OA 4LBQB 2IXHA 4IEZA 1B35C 1NE4A 4IEPA 4AFBA 3CF6E 1QGLA 2JKBA 4HKOA 3OD4A 1G86A 1TQ5A 1W39A 2HEYF 5L36A 1AR73 4AW7A 3J9SA 1UU6A 1LODA 5JOYA 5DXDA 1IZ3A 1ND2C 4YVSB 2DVBA 1POV1 4AFAA 1Q3EA 5A33B 4KU7A 3V0AB 4YVWA 3ZYPA 2BYVE 1VLNA 1ASJ2 2HYKA 3WNXA 2WSVA 4QM8A 2TUNA 1AR92 2BNNA 1WA4A 1HKDA 2VOXA 2ZHKA 4A7ZA 5JPNB 1RUI3 2HEWF 4N7IA 3AMMA 3ZN5A 1ENSA 5KHGA 1RVF1 5AFBA 2WFPA 1DHKB 1CAVA 4OHVA 4JQRA 4XZPA 3ZSKA 1TMF3 1OLRA 3ZSJA 3EQEA 2PLV1 4L2NA 1C1LA 3WG1A 1XNKA 2D43A 2UWBA 3QBQA 3GF6A 2R6QA 3GBGA 4Q2FA 4I09A 4Q8LA 3LCPA 1Q8PA 1E57A 4FP2A 2CGOA 2GAUA 3LOIA 3NSTA 1BBT3 4OFGA 1RJ7A 1VBB2 2Z42A 1PVXA 2QZ3A 1NCQB 1D4M3 4AF9A 1BMV2 4O9GA 2JXAA 3IIAA 2DCZA 1CONA 1OPMA 2WNEA 4Y1VA 5DG2A 4COWA 4YGDA 3IPVA 1OA3A 4RGAA 1REEA 1Q56A 1ZZ8A 5LK7B 2ZKNA 4HZFA 1J3PA 1Y3TA 4XEZA 2R062 5L19A 4LT5A 4N43B 4IL7A 2EA7A 3N35A 4M01A 5BNPA 3WX5A 4YVWC 1WGPA 2I07B 3LGRA 3OJBA 4WVZA 2VY0A 2B7YA 1XE8A 2DCYA 1KDKA 3VHPA 2UY8A 2LTNA 1GZ9A 1OA4A 1W2UA 5F9TA 3MZHA 3U4XA 2PELA 5EYXA 4LNVA 1V9U2 5I8SA 4M00A 2EAAA 4QD2A 4XPVA 2PQQA 3WDWA 1URXA 3O0VA 3SNMA 4GH4A 4NOTA 5HCAA 4HETA 4ZKTB 1Z0HA 1CX4A 2AENA 1JHNA 1IQAA 1FATA 2D3RA 2RMU2 3GALA 1O3SA 5C9AA 4RS5B 3JUUA 2IFWA 1VRH1 4OHZA 4DS0A 1XNCA 5GZEA 1RUH2 2NZ9A 3SXWA 1AHSA 5JOZA 1YFWA 4R8HA 3WG4A 1QDCA 1UD1A 5FAXA 3HIFA 3SHRA 5C8CA 3J8F1 4QU2A 5KC5A 4DB5A 1IKQA 1V6IA 1U5IA 1RTVA 1C4RA 3I54A 4BE3A 4XF4A 1EV11 4Q4W1 2Q30A 3FUOA 4XQDA 1HQNA 2IXIA 4ASLA 5CA6A 3WQ7A 1KFUL 1Y43B 4QQOA 2RJLA 3AXDA 2GNBA 4MXWA 1XNDA 4GB33 1HV0A 1SEFA 2EAKA 4YZ3A 4TYSA 5DZFA 5AC92 2VXRA 1PZ7A 5TSWA 4QM9A 3VHRA 1ZZ6A 2GMEA 3RDIA 1LHVA 5BNPC 5JZGC 1LOBA 1YUDA 1OFNA 4YG3A 4F83A 2D6LX 4K20A 1AR71 2XWJB 1POV0 2A3XA 3KQRA 3RZZA 1CAWA 3OF1A 4XBNA 5C8WA 4HMZA 4QPIC 4Y22B 4D69A 3SCHA 4B3NA 3BALA 4UW4A 4JV4A 4LBNA 2H0BA 2P2KA 2BGCA 1G9FA 1NXMA 3AK0A 3N3HA 4Y20A 1MVEA 3TN93 5CFCA 2BUKA 1OQDA 5K0UA 4Q26A 2HWC3 1CAUA 1DGRA 1O3TA 4GH4C 2ZMNA 5SV5A 2A3YA 4BM8A 1YJKA 3A0KA 2WS92 1RUI1 3JD72 4FOQA 1CQ9A 1MQTA 4CEWA 3R4DB 2HWD2 4BCUA 1ZZ7A 5CAZA 4CDXB 5C9AC 5KXEA 2XJRA 2F4PA 5H9SA 2W0XA 4HSLA 3VBOB 1NCRB 5DDJ3 3DPRC 1TMF1 2QE3A 3WHTA 1AL23 1X7NA 5BYNA 2VW2A 4Q4X2 4PLNA 3THTA 4Z92B 1AR82 5CG9A 1YJLA 3M8LA 4XIOA 5C8CC 2ZGNA 2XB6C 1APNA 3RMXA 1LR5A 3BB6A 2O0OA 3E97A 1MEC2 2BFUS 2JE7A 1AX2A 1BBT1 2ZOEB 5J09A 3R4UA 2WT2A 3ST7A 1W6PB 4Y1UA 1YXWA 4GMP3 1I3HA 1D4M1 3VGIA 3AKTA 4FAHA 4ORFA 3OPZA 1JN2P 1W6OB 3E6DA 3L2HA 1V6NA 4HPKB 4XFAA 4WM7A 1H2LA 4XFHA 1CJPA 4QQ2A 4CDUB 1G7YA 3NL1A 3ETQA 4YVSA 2KA3A 5CB7A 4CP1A 3SITA 2VNGA 4KGQA 1KS5A 2W52A 1B35B 3TAYA 3S7EA 3KM5A 4META 5CFCC 3ZFFA 4RD7A 5K0UC 2ZGQA 3PTYA 4ES9A 2ZZQA 1C1FA 4CDWA 4E2SA 1VBD3 3KCYA 3DUIA 1IS4A 3BIWE 4QX5A 4CEWC 1MQTC 1NQDA 1H0BA 2TBVA 5L7OA 1G9AA 1IS5A 3ZPYA 3U11A 2ZCWA 4S2HA 2JX9A 5IK4A 2G4IA 1ND2B 1Q43A 1AYN2 5JCTA 4EWAA 1RMU2 1NLSA 1ZZ9A 3LWCA 4E27A 2BVVA 5FO7B 4HBNA 2BEOA 1WMEA 3AP5A 2HWB2 4KWJA 1XXNA 2XH6A 4IESA 2BNMA 3MF6A 5D8AA 3OBRA 1ZBA3 3ZYIB 2ATFA 3E5QA 3AMNA 1WUVA 1ZBE1 2IC1A 1F2NA 2CTVA 2NMNA 3RS6A 4Y1YA 4DRVA 4AEKA 1X33A 2Y26A 3WCRA 4BLIA 5DUUA 2XUMA 1LGNA 4MZUA 1UIKA 2LM3A 4AFMA 4B29A 1R1ZA 2ARXA 4MX3A 2PHDA 5J37A 4WM7C 3ZXKA 1SLBA 4M3CE 3PVEA 4WV8A 3O0XA 1YIFA 2YUEA 2UWAA 4GB31 3HR9A 2CNAA 2UURA 1JUIA 1U0AA 4U36A 1LULA 2PN5A 4MGYE 3D0JA 5F6LB 3DN7A 1BXHA 1GQGA 4HKLA 3KS7A 3UKTA 1RUG1 2LUWA 3ZFFC 1DZQA 2CWSA 3Q9OA 4DINB 2ZKLA 2DV9A 1GQHA 4G4FA 4XF1A 1ZVFA 4CDWC 1JYCA 2WT1A 2WFF2 2N7GA 5FLHA 1VBC2 2XJQA 4CRQA 3M3EA 1LECA 5L7OC 1M06G 1DLLA 1KJLA 3LAGA 4XF0A 3HAGA 2HWC1 1H4HA 2G9FA 5DUWA 4DPNA 1ZREA 4YVWB 2H0VA 4NVPA 2ZX2A 3HWJA 1UIJA 1VBA3 1FI2A 5EWSA 1VAMA 2CGPA 1RUE3 1UN1A 4Z07A 3MIEA 4SBVA 5FLJA 1IOAA 5DDJ1 1WD4A 3IDCB 5D8AC 4JGYA 3TNQA 1AL21 2QJVA 1BEV2 1SLIA 5JPMB 2WJSA 4C0BA 1LEMA 2DUQA 1NA1C 1ULCA 4TZDA 3O7OA 5BNOA 1UCXA 4E4ZA 1S0GA 4OUMA 1OHFA 5T5LA 3BCWA 1FOD2 4BOWA 2XJPA 4PBOA 1PGL2 1ENRA 1FPN1 1YFUA 4YW1A 2RS33 3M1HA 4J1XA 4EN8B 4ZU7A 4P9WA 2QVSB 1PO12 3VBUA 4GMP1 1N1YA 3ZXFA 4MXVA 2SBAA 1ZX5A 3VN4A 5F1RA 4NR1A 1BKZA 4JDNA 4IXLA 4F7ZA 2PTMA 4FXKB 2FZ2A 1WBLA 2B39A 1RINA 2XVGA 1OOPA 1PO22 4LO6B 4C1XA 2GNMA 2ZGLA 1SDWA 1AZDA 1CIWA 3IPVB 3OBTA 3VHNA 2XL9A 4XHBA 3ZFGA 4QQHA 4OLLA 2R042 1VALA 3FE5A 3QACA 3ILRA 5K8SA 1R081 5BNPB 2WKKA 2DVDA 2E9QA 4AEDA 4BWOA 1H4GA 4C90A 3KGLA 1O3QA 3WUCA 2AZ5A 4YW4A 1QJX2 2RM21 3P3PA 2BQPA 3IWZA 4TSVA 1I5ZA 3VUOA 4QPIB 4UW3A 1DQ5A 1VIWB 1ULDA 4MUVA 2PHWA 1PGW2 1NCRA 2IXJA 2KM2A 2A6VA 1YI7A 3H1YA 2YV8A 3ZYRA 2E6VA 3MPPG 4EWEA 4JGYC 3AKRA 1MS1A 4AWDA 2VOKA 3KCXA 2EXIA 4R52A 5BNOC 2FBEA 4GH4B 4B4PA 5GJ6A 2ZX0A 1A8MA 5J96B 2UYBA 2HWF2 4XXAA 1IHMA 5C9AB 5KXBA 4ZXKA 1GNZA 1K5MA 5T50A 3VBUC 4MYEA 3DPRB 1WLWA 2ARBA 1A3KA 3B00A 4YM0A 3M3OA 2QKDA 3FFQA 4XILA 3GBFA 1F5FA 4M0NA 5C8CB 2I74A 2R063 4RA0A 5JSOA 4COVA 4C0HA 1OOPC 3AM2A 1IGOA 1EYBA 4GALA 4FP3A 1KJRA 3W59A 4IEUA 1X82A 1G6NA 4GWNA 1B35A 5JIAA 4FPLA 3ZSMA 2ZBJA 2YZ4A 1HDKA 3ZFGC 4MXWB 4PDWB 3JBG1 2G9GA 1AL0G 2X29A 5DZEA 4QQPA 4FPJA 2BFUL 3VBHA 1OPOA 4XJAA 1SQ4A 4AEDC 2CGNA 1RUD3 4BHPA 1C8M3 1RUF3 4GULA 2OPKA 5CBLA 1VB4A 4LO7A 1R1A3 1NCRC 5D1IA 1KFXL 4YW5A 4AVTA 3VBRA 4Q4Y2 3POWA 3NV1A 4Y20B 1C5HA 2Q8OA 5CFCB 1VBA1 3VKOA 2Z2SB 2MEV2 4XFBA 1HV1A 3FLRA 1CAUB 5FRAA 3I59A 3ZXEA 3VL9A 4QXKA 4EJRA 1QMJA 5JAXA 3ZSEA 5I0UA 1AYM2 4CEWB 1MQTB 3L9JT 2JE9A 3VLBB 2ZGRA 4YLZA 1XU2A 4WM8C 1OSGA 4XFCA 1K5MC 1KDMA 1ZZCA 1FYUA 4FTBA 4Y4YA 3X29B 2B45X 4I01A 3BU7A 1S0EA 4NHKA 4FPEA 2VH9A 4AI2A 1TE1B 4GMP0 1YIPA 3M70A 4EV0A 4AQ2A 2RS31 4XW3A 1EAH3 3J8F3 1FX5A 5GM0A 2DVGA 2DUPA 3RI8A 4IEOA 1UPIA 4XFGA 1QJU3 4YSFA 4E4SA 1LHNA 3H3UA 4P9JA 3RYKA 4LHLA 5E16A 1RUJ2 1LOFA 3WDTA 3U10A 2B9UA 4XJUA 1DDLA 3AKPA 1AX1A 1QJZA 3ES4A 3WP3A 3VBHC 4MVTA 4WM7B 3ECQA 1MS8A 3OYWB 1ASJ1 1MS4A 2R073 4R9CA 2VGDA 4FPFA 5K7PA 1IPJA 1C8NA 4AVBA 1QXRA 1W0OA 3VBRC 1SBDA 1PIV2 1Z7S3 5DZGA 4L11A 3ZFFB 1AR63 1YCIA 3IM0A 2V09A 4AI8A 2A70A 1FXZA 1LOGA 4Z8BA 1QWRA 4CDWB 2FMYA 3B69A 2O8QA 3GYDA 2MNGA 4P9YA 2QQPA 1G9BA 3KT4A 5JMCA 5BUVA 1XYPA 4FPOB 1BQPA 1S1AA 5BNQA 1MS0A 5L7OB 1JUHA 5FREA 4J6GA 2HKXA 3IBMA 4C91A 2RR13 4H14A 1OA2A 5T52A 4INDA 4OI1A 5JOWA 1JYIA 3M2MA 3ZMOA 1ALYA 2WA4A 2VNOA 2K0GA 2IZWA 3R4SA 2WLQA 4XF9A 4XETA 1BMV1 1UX6A 2VMHA 4K40A 1LRHA 5D8AB 4Q4V3 5ACA3 1T6GC 1V00A 2YPJA 2C0ZA 1QXJA 3NVCA 5FPZA 3FMGA 2WNUA 3RG0A 1NA1B 1LOFC 4Q0VA 1ULGA 4RHV3 1H1IA 1RVF2 4QGLA 2R061 3S6PA 1LB2A 2BNOA 2X5IA 3A0NA 4JRAA 2PLV2 5J3UA 3ZXAC 2P3IA 4P9LA 5BPXA 3VKFC 2KXLA 4FOVA 1COV3 5FCCA 3VDDA 3PHMA 1H8TA 1EP0A 1H30A 1ZM1A 4ONUA 5GKAC 2XBO2 3VHOA 2HWE3 1RUD1 2H6BA 2YMZA 3APBA 1V9U1 1C8M1 3QCWA 4FCAA 4KWLA 1RUF1 2RE9A 5F5QA 4QPIA 1DFQA 4H7LA 1R1A1 3KGZA 3MIHA 4Q1RA 3ZSLA 2R16A 1FV2A 5CVRA 4OHYA 3CNAA 4OHWA 4R4ZA 4XOGA 1MZ5A 3VBFA 5HCBA 3QH7A 5I91A 1TNFA 4Y1ZA 3JCIA 2RMU1 4S2DA 1G9DA 4X8PA 2GN3A 2NP0A 3AP9A 3R6SA 1ULFA 1DGLA 2OYZA 3ZYJB 1AJOA 2PHLA 3B7MA 4IERA 1V70A 4PQ9A 2EF6A 5HCFA 2K9ZA 1H1AA 2EXKA 3HBZA 2BVBA 2A71A 3ZXGA 3DPRA 4A7KA 3FFZA 1RUNA 1XQNA 4UW5A 4JGYB 2RJKA 2DUOA 2ENRA 3MW3A 4YARA 5KXDA 3LB9A 2C9AA 2YC0A 2GNTA 2XL7A 1ZBE3 1FMD3 3WQ1A 2WNUC 5JI7A 4Q8KA 1EAH1 1TME3 3JU9A 2IXLA 5BNOB 2ZGSA 1LESA 2E7TA 2ZHMA 5E1RA 3AYDA 2R30A 3I8TA 2Q1ZB 4LBQD 1QJU1 2PHTA 5AC91 4IEWA 5H9PA 2X5IC 2B46X 4PIXA 3WDUA 3WP4A 1QH6A 1RL3A 2VMIA 1VB2A 3VBUB 4S2FA 4PDWA 3P3NA 2CV6A 3VDDC 4YZ5A 1H8TC 3QLQA 3ZIWA 1JBCA 1VRH2 4K1YA 4ATEA 1RUC3 3UJOA 2WT0A 4M3CA 4BMBA 2CY6A 1RUG3 2YGLA 1OMIA 5I8TA 1SLCA 3T2TA 1Z78A 3B02A 1ND3A 2R071 3N7MA 3RJRA 1OOPB 2Z79A 4I02A 3H3ZA 2A7AA 3B3QE 4LBLA 1UAIA 1PNGA 3LSEA 1OLQA 2D6KA 2ZMLA 3T1LA 3VBFC 1Z7S1 1KITA 2I2SA 4E4DX 2UU8A 3SH5A 1WCSA 3POSA 3ZFGB 1EV12 1V6MA 3B93A 3NV3A 4Q4W2 4B8EA 5FO9B 1AR61 5E8AA 4L9BA 2PHXA 5GLTA 5JLVA 3GBWA 2YDEA 1Q8VA 4AEDB 4YFWA 3AB0A 5JR7B 1H9WA 4N9HA 4N7UA 5ABJA 1QNWA 1RHI2 2WL1A 2XG3A 3OY8A 4GWMA 4PIYA 1BYHA 4BQ1A 5CU1A 3AP6A 1AR81 1JW6A 1WW6A 2D44A 4M0HA 5J98B 1AR72 2WQZC 3RNSA 2ZHNA 4Q0SA 2RR11 2NMOA 3BPZA 3FUQA 2D5FA 4TLFA 2WA3A 2B8MA 1PZ9A 1UU4A 1TNRA 2D3PA 1WW7A 5GALA 4C1WA 1PK6A 2XJUA 2A6ZA 5C33A 4AE2A 1X50A 2ZA9A 4DOUA 4XYXA 3GHMA 5DG1A 3FBYA 5IUQA 2YROA 3TRSB 3RYRA 4YZ2A 5GZCA 3MIGA 4Q4V1 2XJSA 5ACA1 1FPN3 1XE7A 3FLTA 2ET1A 3O0WA 1RITA 2GALA 3H1MA 4HL0A 4WM8B 1K5MB 1RUI2 4Y24A 3WW4A 2DFBA 1WD3A 4PDWC 3AZXA 4WVMA 4P9XA 4RHV1 3CJXA 3FJSA 4XE9A 5JWPA 1XYOA 2D7FA 1O4YA 4JAAA 3AZWA 1YYNA 3R0RA 2NN8A 1QJY3 4LE4A 3NAPA 1TMF2 2X8KA 1RIRA 2WIIB 1QHDA 2DYCA 4GA9A 2LALA 3OYWA 3MLLA 5I93A 5H9QA 1O5LA 1ND3C 1HQWA 1YWKA 1COV1 4P14A 3RSJA 2DFCA 3FX3A 2PYTA 4DFSA 3AXEA 2HWE1 3SCGA 4QPGA 1BBT2 3ZFEB 1GV9A 4G3YC 1R083 3VBHB 1YFXA 5DUXA 1D4M2 4X8NA 2GC3A 3CJIC 4YGCA 5KHHA 2PA7A 1BJQA 4DQAA 2VVDA 3UV9A 2GC2A 4DXZA 5ABJC 2RM23 4HVRA 1U5XA 4AHZA 2TEPA 4D94A 5I0RA 3V0BB 4P9GA 3NV4A 2HWB1 2ZJCA 3WDXA 1UMZA 2ERFA 3VBRB 4YW3A 4DY3A 3N36A 1BCXA 1HIXA 2VW1A 1UU5A 2R1BA 3LA2A 4PLOA 1PVC3 1PK6C 2MPFA 5LRSA 1ZRRA 4FPYA 4DY5A 1D0GA 4Z2WA 3I59B 1QKQA 3JQWA 2VQ0A 5FPXA 3MW4A 1BK1A 5GLVA 1ONAA 3PLQA 1DQ6A 4FPGA 3HMYA 3M4FA 4YYOA 4QPYA 1FMD1 1NA1A 4YZ1A 3VZKA 1TME1 1PM7A 1F8VA 4IETA 2ZX3A 4HLTA 1X8EA 3NAPC 4AGVA 2RS53 1A78A 3C3VA 4L99A 1ZRFA 4E2QA 1WCDJ 1KXGA 2AR6A 3AP7A 4N53A 2GN7A 4E2GA 4FOWA 4KH9A 2HJIA 3GZTB 1RUC1 4BLJA 1OD5A 3CU7A 2Y0IA 4XJZA 2WZR3 5FO8B 1UF2C 4AI0A 4JCKA 3ELNA 3JBG3 4QPGC 2GSYA 4I2OA 3VKMA 2NYYA 4Z1VA 3ME2A 2GNDA 4B7EA 1W6MA 2BW8A 4O9EA 4Q0PA 4F3JA 4KG0A 3SMHA 3DL3A 4A3XA 4LTAA 3ZMNA 4B4RA 2C5DA 2VW0A 3KCCA 4LR4A 2WINB 1SLAA 3O14A 1LHUA 4KGGA 5BXXA 3FBMA 4CYDA 4XHXA 1EY2A 2GZWA 5EYYA 1MS5A 2XPJA 4EN0A 4U2AA 4MH0E 2OA2A 2VPVA 2VNRA 5T5JA 4GB32 1YNAA 2R49A 3H9AA 4PF5A 4FSJA 3IT8A 1BEV1 1J1TA 1NG0A 3EXUA 4AK3A 4KG8A 4FO9A 2VG9A 2V73A 2DVAA 4K21A 3H50A 4QGNA 3WCSA 1FOD1 1HRV3 2IXCA 2Q5TA 1WMFA 3B5LB 4URTA 5T5PA 4CP2A 3PVOA 1PGL1 2YGMA 2PAMA 4HKWA 4RQPA 3JB4C 3KMHA 3AKSA 4GIQA 1GR3A 3TB0A 3AZZA 2F6BA 5EZWA 3TN92 4Y1XA 3DV8A 1YI9A 2HWC2 2A3WA 3LA3A