3ALQA

Crystal structure of tnf-tnfr2 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
141
Chain Sequence
SDMPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFSGQGCPSTHVLLTHTISRIAVSYQTPVNLLSAIRSPCQANPWYEPIYLGGVFQLEPGDRLSAEINRPDYLDFAESGQVYFGIIAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor
publication title Solution of the Structure of the TNF-TNFR2 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 21
structure length 141
sequence length 149
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00229 TNF TNF(Tumour Necrosis Factor) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3alqA00
3FC0A 1KD7A 4QQLA 3B93A 3V56A 1JH5A 4MXWB 2Q8OA 2Q1MA 4QQ2A 4TWTA 2RJLA 1JTZX 4G3YC 3K51A 4KGGA 3IT8A 2QE3A 2WNUA 1OQDA 4NN0A 1TNRA 1U5XA 1WCKA 2JG9A 1DG6A 1RJ8A 4E4SA 1PK6A 2WNUC 4OUSA 1D2QA 3TWIA 2ZPXA 1PK6C 5KWRA 4QQPA 4HT1T 4E4DX 1GR3A 1DU3D 3URFA 5TSWA 1C28A 2Z5WA 4QPYA 4KGQA 2WNUB 1D4VB 1OQEA 1RJ7A 1PK6B 5KC5A 2TNFA 4MSVA 2JG8A 4OULA 2WNVA 2AZ5A 5KC6A 2ZJCA 3MI8A 1U5YA 1S55A 1XU2A 4DOUA 1XU1A 1U5ZA 2JG9C 4QQOA 2RJKA 1O91A 4DB5A 3TYJA 2QDNA 5L19A 4KG8A 4EN0A 3ALQA 5CIRA 2O0OA 3QBQA 1C3HA 2JG9B 2R30A 4D7YA 4MXWA 1OSGA 4OUMA 1KXGA 2JG8C 2X29A 4RSUA 1ALYA 2WNVC 5BNQA 2E7AA 3QD6A 4N90A 3B9IA 2R32A 3ME2A 1TNFA 3LKJA 2JG8B 3L9JT 2OIIA 3K48A 4J6GA 4F3JA 2RE9A 2WNVB 2HEVF 2KA3A 3WD5A 4MXVA 2R6QA 2HEYF 2TUNA 1I9RA 4QQHA 1A8MA 5L36A 3AB0A 1IQAA 1D0GA 2HEWF 3B94A 4GIQA 5HBAA 4TSVA 4G4FA
chains in the Genus database with same CATH superfamily
5D1IA 3O12A 1TE1B 4DUVA 2DU1A 4UAPA 3F2ZA 5I0TA 3VDAA 1GOFA 3MLKA 3WDTA 3ZFEB 3S5AA 1PX4A 1K5JA 5A3MA 2ZX1A 1LEDA 4PLOA 1HIXA 1ULOA 3BYWA 1SPPA 3RMYA 1OF4A 4LBQB 4FQZA 1O8PA 1YNAA 5F9TA 1AX1A 1OBNA 1AL0G 4EYUA 3VBHA 3K4AA 1DGRA 5KR7A 2QNKA 2WT1A 1F4HA 1OOPA 4AHWA 2JDHA 4XJ8A 1ZVFA 2ZPXA 5GLWA 3OY8A 1OC1A 4UBHA 1UPSA 4QT6A 5IVCA 5F7UA 5L7OB 4I0WB 3O1RA 2Y26A 4WM8C 3OBAA 1EY2A 2GMEA 4Y1VA 5C9AA 4KGQA 4FFFA 5J37A 4AWDA 3TRSB 1VBB2 2NN8A 4HN0A 2B39A 3HD8B 5FXVA 4YRDA 3HJRA 4ONUA 3WW3A 5FY5A 2HWF3 3MI8A 3OPWA 4ZPIA 1VBC2 5DZEA 5FZ3A 2BTVC 3AFKA 2WDBA 3IDCB 1C8M3 1RUC1 4RR3A 4TLGA 3CHXA 1CAUA 4MH0E 2J1EA 5FZ1A 4FPHA 4BB3A 3JD72 4IW3A 5FY4A 3ZN6A 1MS1A 4NVPA 1P8JA 4HONA 4ZZ5A 5EJ1B 3USSA 1QJY3 3VD9A 2HBTA 4QPIA 2HLEA 5L9RA 3U78A 1YI9A 3D6EA 3EBRA 1AYN3 3LPFA 5L73A 2R30A 2W2IA 1ENSA 3EMRA 4AHXA 3K77A 4D3WA 3B9CA 5T50A 3BCWA 1N3PA 1S0GA 1JU4A 3ZVXA 1RUI1 1SLCA 3I2IA 4PDWC 3KZ4C 3OSDA 2Q4SA 3MFCA 3Q8FA 2HWB1 1ODNA 4QX1A 4RSUA 1WCUA 4QX3A 1VPHA 1RUG3 1LHWA 1FATA 1MS0A 2A1XA 5LY1A 2JKXA 4NMIA 2OVUA 5EQUA 5C70A 5CFCB 5T52A 3V0BA 3OBZA 3TOJA 1O4TA 4H3WA 3SHRA 1V00A 4RS5A 4BH9A 1R093 3PUAA 2EICA 2HWE1 3OYWA 4IV1C 4C0BA 3W9AA 1GU3A 1NCRC 3FX3A 1KDMA 2R043 2ZX0A 1FMD1 1LTEA 1V9U3 2JENA 2NQYA 1OLME 5A33A 3R4UA 5FPXA 1TEIA 4KWUA 3UKNA 4AQTA 4XJUA 5HPOA 2VAUA 3N3HA 2PAMA 2CL2A 2YZ4A 5KBFA 1ZZ6A 4N43C 2C1FA 2ZBJA 4IEXA 1KDKA 2ET1A 2XLFA 2JDKA 4OHVA 1QJX1 3ZXGA 3W21A 2WS91 5JMCA 3ZYRA 4FPEA 5EV7A 3ZMNA 2QFEA 5EYXA 5CFDA 4A45A 1W2UA 5DUUA 3SCHA 2PFWA 3KV5A 4CZSA 1CJPA 3MGUA 4Z82A 3NV4A 4KH9A 1LGCA 3KT1A 1UQXA 2EIDA 2YG0A 1H8TA 1RVF3 4AL9A 3WX5A 4DIQA 1KS5A 5F8PA 3IT8A 3T1MA 3UKTA 1UZYA 4FOVA 5DAVA 4NPRA 4E27A 2DVAA 3DXTA 1MQTC 1JS9A 2CYFA 1W8FA 3A7QA 1BVP1 4NHYA 1UNBA 4KWJA 4FPFA 4AI0A 1R1A3 2LW8A 4B29A 3LZZA 5FZOA 1A6CA 1NZIA 3LIHA 3I2OA 1PGL1 3FE5A 1RUF2 2QQOA 3VBSA 1PVXA 2GMMA 3ZXEA 1JW6A 3U07A 2PQSA 3LE0A 3MF9A 2FDGA 4XQ4A 1LULA 5IK8A 4Z07A 1WD4A 1CWPA 5C5TA 5C4WA 4XETA 5HV0A 3ZMOA 3ZKUA 2D3SA 3S7IA 3THTA 2NMNA 2YU1A 4WM8B 3RYKA 3INAA 3RYRA 1AHSA 2KR2A 3O7OA 3N36A 3HN1A 4OMDA 3U14A 3ZXFA 3GZEA 1KS4A 3TN92 3C7OA 1XU1A 3LPGA 2B42B 4XUQA 2VD7A 4XXPA 1RMU1 2A71A 4QXCA 5DAPA 5IFTA 5FJHA 4K8RB 2K9ZA 3HMYA 1N1TA 4UXAA 4DB5A 4ZHNA 4YGDA 3DEMA 5BV6A 4E8CA 2XBO2 4HBNA 4NIIA 4AOCA 1D4M1 1MS8A 5L19A 4I0AA 2BGCA 2XHNA 2RMU1 2XXZA 4XTPA 5DG1A 4JDMA 4ASLA 4EZHA 1TMF2 2J22A 3JU9A 4OUEA 4XUOA 2VUCA 2R063 4E2GA 2VULA 1AR81 3WP4A 2BBVA 3BPSA 4L99A 1LESA 1H9WA 2RDSA 4EROA 2WA4A 1QEXA 2C0ZA 4XCAA 1Q5OA 1WLWA 4OCTA 3SEPA 4TLFA 1LENA 3LB9A 2RJ2A 5FZFA 3S57A 1DF0A 4LO7A 4ZXEA 4DEVA 4OZOA 1WCDJ 1WA4A 2G9GA 4PDWB 3UJOA 2UWAA 4W8JA 3I2FA 1QDOA 1VAMA 2W87A 3RGBA 3WQ1A 2LROA 3TNQA 3S5QA 2G9ZA 2Y8KA 4FPJA 1OLMA 5FMDA 1AVBA 1ZBE1 3WT3A 1X8EA 3AVRA 1VRH3 5JOYA 3SCFA 3SXWA 2OX0A 5LRRA 2E53A 1NA1C 1ZRIA 4A44A 3WUDA 2YBSA 3C7HA 3M7AA 4LBQD 1R082 2PHRA 3AJZA 5LK5A 4QDQA 1GV9A 2AYHA 4BIOA 1WCQA 3NQHA 1W8NA 4U2AA 4LO4B 4IV1B 3LSDA 5EJZB 5GALA 1QOOA 4XPVA 1NCRB 2ES3A 4IV3A 4KI5M 1V6MA 2P3JA 2ZEXA 3AYEA 1IG0A 2BOJA 2TBVA 1KD7A 1NQJA 4BPZA 1YFWA 2V73A 1LB2A 2ZHNA 3GZAA 2JDZA 5FOBB 4PF1A 2A6WA 4TYSA 5C8CA 2VG9A 1WMEA 4N43B 4YW2A 5H9QA 4Y22A 2R16A 3MIBA 4NIAA 1UWWA 3B7MA 4OHZA 3SH3A 3THDA 3WHTA 1W8WA 5FR3A 1EUTA 3H3UA 4FOYA 4YLZA 1JMUB 3WG1A 1XNBA 1G9CA 2D6MA 4YZ3A 4BQ1A 2EVXA 1V6IA 2RG4A 4R9CA 1JYWA 4GB31 4LHNA 3ACGA 3MEPA 5FYMA 2E6VA 4YARA 3USUA 2D98A 5FPLA 3LA2A 1RJ8A 4QXBA 1PK6A 2VBDA 3OJBA 3NWKA 3TWIA 4D6QA 1QDCA 1WBLA 1VBB1 5JUVA 1W04A 1DP0A 2X05A 5CKNA 1U12A 2C9KA 3VZJA 1VB4A 5FLHA 3SLIA 1AYM2 1YQ8A 5FY0A 4FP3A 2GMPA 1JOJA 2ZGMA 1MQTB 4LLOA 1XSRA 1BYHA 1UD1A 3OGSA 4Q0PA 4XJ9A 4PF5A 3O1SA 1CPMA 3N35A 3G7DA 4K8FA 1W9SA 4OHWA 2P2KA 5EWSA 1K5MA 1NT0A 3RJ2X 5CEHA 3T3YA 5FPUA 3RZHA 3E97A 2W39A 4LOTA 4CP2A 2J1TA 3UESA 5JXHA 3NSTA 1W9YA 5T5JA 4ARYA 1US2A 2YU2A 4BHPA 3JBG1 1VBA2 4JGZA 2JG9C 2PLV1 4JDOA 3PLQA 4FTBA 2VZRA 5CISA 1UIJA 5T54A 4DQAA 3LFMA 3AKTA 4BA6A 1NY72 1GZCA 1W99A 3TYJA 1KRIA 1GP4A 1H9PA 1RUC3 5FZ6A 4CXXA 1S4CA 4K1YA 1POV1 1QNWA 3AC0A 3VBFC 1AL22 1H4GA 2O0OA 3QBQA 1C3HA 2PYTA 1XXNA 2X10A 4PT6A 5KHJA 3KCCA 4NAOA 4Q0UA 1CQ9A 1VBE1 3H0OA 4YVWC 3POGA 1GQPA 1C5HA 2XUEA 4N90A 2R1DA 1DQ5A 2DVDA 2D6PA 5DDJ1 1FX5A 2HWB3 4JHTA 3VB9A 1EAH1 4BXFA 5JZGC 5DZGA 3HQUA 4R52A 2IXHA 2XKPA 5JR2A 2BU9A 5K8SA 3L9JT 5CB7A 1OLRA 4LHLA 2AR6A 2YUEA 4NO4A 5CZKA 1FAYA 1R1ZA 3ZFGA 4Q4Y1 4CCMA 3HT1A 3LA3A 5F5QA 2HWE3 3RPQA 1JHNA 5E6HA 4IDZA 4IESA 4K20A 2VZOA 1XBFA 1FMD3 3NRUA 5A6YA 4QXHA 2NM1A 1NA1B 5GLVA 1QNYA 3AKRA 4AHZA 4GKXA 1OHFA 1SFYA 2VXJA 3BU0A 4UFJA 1W2OA 2XL7A 4CXYA 4G4FA 3FC0A 1AF9A 1N1SA 2DV9A 3K2OA 2XJRA 4MXWB 4R4ZA 5GM0A 4NJ4A 4ZZ8A 1RUJ1 2VNGA 4JKKA 2YV8A 3TEZA 5F39A 1QJX3 5JOXA 1IS5A 1ONAA 2JJ6A 2WS93 4TWTA 2RJLA 3IDBB 4C1WA 3MZHA 2FZ2A 2UYAA 3WF1A 5BNPA 5GZGA 1RC6A 1QXRA 4KGGA 5LB6A 1AR61 1YIFA 5FKCA 3MIEA 5C3RA 2WNUA 1ULDA 1OH4A 3DYMA 5IAVA 4DUXA 4OUSA 1XE7A 1MZEA 3LEMA 1W6PB 5L9BA 4FFGA 1PO22 3WQBA 1OT5A 1TVGA 1X9PA 4M4RA 3KT4A 3HNBM 3N9MA 4GWNA 1RUH2 1YCIA 2SLIA 3NJVA 2Y6FA 5FYCA 4MSVA 4UFIA 2WO7A 2VXRA 1QF3A 2F4PA 1OA2A 3WV6A 4ZKTB 4META 2QDRA 2YBKA 1VMFA 2YGLA 4COUA 5LEJA 2BEOA 2ZGRA 4M3CB 4Y4RA 5KC6A 3AP7A 3LA7A 2GN7A 2LRPA 3WG3A 3J7HA 4FT8A 3VLBB 5JIAA 3VDDC 4BM8A 5LEKA 1TMF1 2EALA 2VW1A 3J8F2 4ET7A 4JQRA 4K21A 4RHV1 2ZTNA 3HNMA 2LS6A 4XURA 1V6JA 2P5BA 3CJIA 4H7MA 1UW8A 4UI9L 4YVSC 4AGGA 3W5NA 2QDNA 2ZHLA 3IWZA 1ENXA 3GBGA 3BODA 2XDVA 3BB6A 1UAIA 3O0VA 3VHNA 1RMU3 2ERFA 4EN0A 4LKDA 4A42A 2JG9B 2MNGA 5FZ4A 5JXJA 2WINB 1LOAA 2VMHA 2Q0AA 4XDOA 3WHUA 1D4M3 1N1YA 2RMU3 3K75B 1ZRRA 5FIXA 3VL9A 3DUIA 2JG8C 3VBFB 4FBFA 1AR83 1W2NA 4W6XA 1WLDA 5T5LA 3QD6A 2XQXA 1TME2 1LOGA 3VKLA 1CPNA 2Y6KA 1R081 4DXSA 2WQ4A 4P9WA 4Q4W1 1HRI2 1POV0 2ATFA 3BN6A 4MGYE 1AX2A 4YVWB 5FZIA 4BWOA 4MUVA 2C6SA 1J83A 2GH2A 2ZEWA 3RI8A 2CDPA 3ACFA 3T4VA 1NE4A 1GANA 1HB3A 1YHFA 3WNMA 1BLZA 3EQEA 1N3QA 2D6LX 2DUPA 4MHRA 4QM9A 5JZGB 2CY6A 3E5QA 1KJLA 5JOZA 2TUNA 4LT5A 3KMHA 2GZWA 3U37A 1X82A 1QIQA 2WSUA 4P9YA 5A70A 2EIEA 4EWAA 1UL9A 1WLTA 5A3TA 1ZBA2 2Q30A 5KHHA 1PM4A 4GJYA 2ZGLA 3NAPC 4AEMA 1WUVA 4LKEA 4RL7A 1DQ0A 5GZDA 1T6BX 4QPGC 3HOBA 3W20A 1XQNA 1S0IA 2DCYA 4AAPA 2Q8OA 3CIHA 4FOWA 1RUOA 2D5HA 5G04L 5FY1A 1RL3A 2JWPA 1C1LA 1DQ6A 3R4DB 5GLZA 4Q0SA 3AM2A 3TAYA 4AR2A 5A80A 1S0JA 4C1XA 4CEYC 2DUOA 3I59B 1PZ9A 2B45X 2I07B 4H2AA 2WFPA 2VOWA 3D3AA 1W28A 3OTFA 1OQDA 1TNRA 1WCKA 1PGW2 2RM22 1UX6A 1W3VA 3RRDA 2R7EB 1A34A 5HXVA 4GB33 5FYVA 4LBJA 1QJFA 3VBUC 2D97A 1BHGA 5C3SA 3AZWA 4IEPA 2IFWA 2JB8A 1S0CA 1GMMA 4OYUA 4P9LA 4GULA 3URFA 4V2WA 4AEDA 3NV3A 4BQ5A 1VBB3 3HEIA 4PDWA 2CAUA 3RYPA 3SITA 5JCTA 4U36A 3WNKA 4BLIA 1D0HA 1LGNA 2LTNA 1WW4A 4XTMA 5FZ7A 4ZXKA 3C7FA 2JE8A 5A7SA 3V64A 1UOBA 4JGYB 1J3RA 4YGEA 2A75A 3DL3A 1PM7A 3VBOC 1WZXA 1O59A 1U5ZA 3W5MA 5JAXA 1O91A 5FYBA 2ARXA 4IV1A 5FMBA 2VH9A 2ADDA 3D8CA 2QQPA 4J1WA 3VV1A 3JBG3 1O8SA 5AC91 2PLV3 3VDDB 1SLLA 2A5ZA 4P02B 2WAAA 2PMWB 4Y20B 3VGIA 2AEZA 4QHBA 2ZACA 3SC7X 1V6LA 4AI1A 1IPKA 1Y9MA 1LHVA 4YVSB 1BK1A 1POV3 2VO5A 3BGAA 3PUHA 4N43A 5F3IA 2VZUA 5H9PA 3ZFFC 4FPYA 2DURA 4RYDA 1AR92 2YROA 1VBE3 1GNZA 4CDWA 5FOJB 1UZVA 2B4KA 1ZRCA 2PAKA 1QH7A 1JZ8A 1KFXL 3AX4A 5F3EA 1PVC2 2JG8B 3AP5A 1WBFA 2D43A 2ZGUA 2NPIA 2ZCWA 3C8XA 2WO2A 5FP3A 2J1VA 4N9IA 3P5BA 5DDJ3 1EAH3 4A3XA 1W39A 1XNKA 1VALA 3RJRA 3KF3A 5FPAA 5F5IA 1OH3A 4CU6A 1PNFA 2F6BA 1ZX5A 5F6LB 5J96B 2OS2A 5IJRA 4XBLA 5LRSA 2VOKA 4IE4A 1MQTA 1A8MA 4Q4Y3 1FOD2 1BEV1 4AQSA 1XPWA 1YYNA 3O5SA 4WVMB 3POBA 3RWNA 4QWNA 1G9FA 2A6VA 1FNYA 2I2SA 2VBPA 3J7NA 4CCEA 3HQXA 4NHKA 5CKMA 4CCLA 5FYIA 5FXWA 2OZJA 4A4AA 1PGSA 3NVCA 4Q4X2 3FUOA 3WP5A 2VQAA 3UNPA 4OMCA 4E8DA 2XG3A 4EN9B 3BIEA 2GALA 3MLLA 4LO5B 4M3CE 4IEVA 5FZGA 3WR0A 4CPBD 1QQP2 2WN3A 3NAPB 4DXRA 5AFBA 4YM3A 4QB1A 3WP6A 1HV0A 1RUJ3 2BVVA 2VTXA 1OURA 4QPGB 4GALA 1E5SA 2WO3A 1S0BA 1MVQA 2OPKA 2BGOA 4CCKA 2EXJA 1YJLA 3U10A 3OBRA 1VBD1 4ES9A 4YW6A 1AR63 4CEYB 3H50A 3JZVA 2DYCA 1XC6A 4FOQA 3FUQA 1RUE1 1RTVA 3ZOIA 1GR3A 5JWPA 1DU3D 5LWBA 1MS9A 1BBT2 1YEWA 2FQPA 4LR4A 1IKQA 4HVOA 1APNA 3TB0A 3BTYA 1GNHA 2MEV2 5EXOA 2W1SA 2VQUA 4I30A 4XYXA 5F5CA 3VBUB 3J8F1 3LIGA 1NLRA 4UF0B 2BVBA 3NV2A 2ILMA 1LOCA 3U4XA 2WFF1 3GNEA 5E88A 4QKDA 3I8TA 2ZJCA 5JSOA 3PMEA 4TZDA 3Q8AA 1U5YA 1UYPA 2OZ6A 2VNRA 4HXCA 1ULCA 1DZQA 1XYNA 4URTA 4R9AA 1CZVA 2XR4A 3PHMA 3ZXDA 1DFQA 2YC0A 4JX0A 2HWD1 5I0DA 1Q3EA 5BUVA 2JDAA 3CF6E 1RUD2 1Q8SA 1N3OA 4Z2AA 3EB7A 4F83A 1TMF3 1ZM1A 4A3ZA 1NA1A 2L9LA 2FD8A 4RHV3 4NWVA 1H2KA 4KG8A 4HK9A 4ITCA 5FZAA 3VBOB 1NX9A 1OF3A 2VPVA 3M3QA 2Q5TA 4B7KA 4URAA 4MXWA 1D2SA 5DN2A 1CESA 3OD0A 5CADA 5CYYA 3RVHA 3VZKA 2ARCA 3ITQA 2R072 2X29A 1DLLA 4K3UA 4LPLA 5A7PA 3ILRA 4UFMA 2FBEA 3PURA 3NJXA 4UW6A 4XCBA 4XDQA 5KXEA 1IZ3A 5A7OA 5FYZA 2J1SA 3ZYPA 3QOPA 3APBA 2XLAA 3D82A 2VOTA 1W06A 1UIKA 3O1MA 1N1VA 1KGYA 4S2DA 4CP1A 1TNFA 3LKJA 4YZ4A 2BPA2 1NCQA 3KV9A 4J6GA 3RZZA 4LO8A 1WW6A 1R083 2ARAA 3LQCA 3PU8A 3ZFFB 4XE9A 2FDHA 4Q4W3 1DYPA 5ACA2 1MEC2 5D21A 1GZWB 3J9SA 3KV6A 2CTVA 3WF0A 1CVNA 4CUAA 3E1F1 2JD4A 5L7OA 2BFUS 2W1UA 1VE0A 4ISRA 5C7GA 1GWLA 1C4RA 3DGTA 3OEBA 2FZ1A 4HLTA 2I74A 1EPZA 3MF6A 3N7MA 1IGOA 2P3KA 2B9UA 4WM7C 3MIDA 2RV9A 4LHKA 5FREA 4XFHA 4CTEA 5B4NA 3TNPB 3WCRA 1LCLA 1OPMA 3N9PA 4FPOB 5HBAA 1HLCA 3VZLA 5FZBA 3ATGA 1JOBA 2VQ0A 2BWCA 1PMJX 2YPDA 1OKQA 3ENRA 4NROA 2DVGA 2VVDA 4PI0A 3UETA 2Y33A 1YC61 1BK0A 4E4HA 1JXNA 1ZA7A 1ACCA 3FL7A 1PGW1 3ZR5A 4KU7A 5LA0A 1CX1A 1AX0A 4A2UA 4Z92B 1VMJA 1BXHA 3KHBA 4QPWA 2BYVE 3F95A 3KGLA 4XJAA 1SZBA 1GOHA 1GBGA 4J25A 1GYKA 2X5IA 4NOTA 1U5XA 2JG9A 3T2TA 1Y7BA 4OQ8A 1GUIA 4YNIA 2VM9A 3I4IA 2WL1A 3LDKA 2WLQA 4ZY9A 4AF9A 4BQWA 3AKQA 5DABA 4YW4A 3ZLIA 4E4DX 2Q1FA 4LK7A 3VBFA 2GNBA 1ND3C 5HCHA 1HQNA 2WJSA 2GU9A 2DTWA 2Z5WA 4KQ7A 4B4RA 4BXSV 5IFPA 1JZ5A 3NL1A 2XONA 4DUWA 1R64A 1UOGA 1YRZA 2BOIA 3VD4A 1YXWA 5IVBA 4QHZA 3RI9A 4DPNA 4NIDA 4XIOA 3WVJA 2JICA 4P14A 2YGMA 4HZFA 2VOVA 1PO12 4H14A 4NPMA 3S30A 1OLQA 1ND2C 2YMZA 2ZXQA 1MS4A 1G9DA 3QLQA 4DS0A 1H1IA 5FYSA 2KM2A 3ZN4A 4WVWA 1RHI2 1A78A 2VC9A 2RJKA 1ZA4A 4CEWC 4XF4A 1WMXA 4DO0A 1LU2A 4P9GA 3POJA 1W6QA 3LSEA 1KQRA 2JEMA 2ZGSA 3I2JA 1H1AA 5FBZA 3I2DA 3E5XA 1W9FA 1Z78A 2XJTA 3ZN5A 1LAJA 1K12A 2P1BA 3QCWA 2QCSB 1W9TA 3ALQA 2CGOA 4XFBA 4OI2A 1AR91 5KXDA 4RGAA 2RR12 1J3QA 2Q8CA 2PHDA 5FFOC 5AC93 3BTZA 3ZKYA 1UXXX 4JCKA 2WAOA 4RQPC 1O3SA 3DKQA 4GA9A 1PVC1 3VBRC 4NRMA 1S2EA 4MYEA 4BQ4A 3H1WA 1ALYA 1LU1A 5FUIA 5BNQA 3WDUA 1O3RA 5FCCA 1EV12 2ID4A 2W9XA 2Y6JA 2HWC1 2CGPA 2Q8EA 3VDCA 1ZNPA 4IQPA 1AR72 3MYXA 4AGRA 3H7YA 1M4WA 4CDXA 3K48A 4W65A 4ZS3A 1GP6A 1IG3A 2HEVF 2RE9A 3DN7A 3IM0A 1FOD1 2ZS6B 2IXLA 4DRVA 5F3CA 2ZAAA 2VVFA 1H2MA 1GOGA 5ANNA 2R6QA 3AJYA 4OVEA 3M3EA 2RDRA 5FLIA 1CAWA 3IAQA 1B35C 2ZEZA 3S7EA 5J1XA 3ZR6A 4OHXA 1D0GA 3AKPA 4XFIA 5JLVA 1SMVA 5F5AA 3KWVA 4DZGA 4JAAA 3T0DA 2ZEYA 4JRLA 2QJVA 2ZZQA 3FHIB 1BEV3 3GM8A 2J1UA 5HCAA 2H0BA 3LDRA 1D7PM 4Q4V1 4WM7B 2FDJA 1WW5A 3N7LA 3ETQA 4Y5TA 2WZPP 3VHRA 1TZOA 1WMFA 2VZ1A 2Q1MA 3CZJA 3B5LB 2WZR1 3WNNA 2DBIA 4LBLA 5CKQA 2A6ZA 2DTYA 1O5UA 2XOMA 3K51A 3WDVA 3AYAA 3E6CC 2YY1A 5KHIA 3RFRA 2PHWA 1BBT1 1RXGA 4Y20A 4LTAA 1JYIA 4GH4A 3MV01 1GNYA 1YUDA 2MEV1 5F6KA 5FAXA 3IPVA 2HWF2 4LK6A 3VBHC 3BOWA 4E4SA 2B5HA 1D2QA 3SEEA 1J58A 4YVSA 4I0BA 1JYVA 3IZOA 5FP8A 4E2SA 1OOPC 2ARBA 3ETPA 4I3GA 1YQCA 2OA2A 2R0FA 2AUYA 1C8M2 4AVTA 3WNPA 1ZZ9A 3AFGA 4O7XA 3HIFA 5FZCA 4AVAA 2ETEA 1VBD3 4JKLA 4L92A 4GMP1 1OVPA 4QPYA 1QJY2 2PHXA 3ZPOA 1PZ8A 5I0UA 3ZSKA 1RUE3 5C9AC 1VLNA 1RJ7A 3ZM8A 1I6XA 1CAVA 2CWSA 5I8YA 4Y26A 3WEZA 2OYZA 1AYN2 2JG8A 1RUD1 1DIWA 2VMIA 3OOXA 4COVA 1ND3B 1V6OA 3NO8A 2W46A 3GJAA 3GDBA 2AZ5A 4Q27A 3UL2A 2AC1A 4XQDA 3J7MA 4NRQA 2FDFA 5E16A 1DDLA 1JODA 1I3HA 1W6MA 2WFF3 3EJKA 4YG3A 2XPJA 3VHOA 2VZPA 4QQOA 3PNAA 4KMQA 1RUG2 3IIAA 4EJRA 1LOFC 4AI9A 1AZDA 4N7IA 1JYCA 5L9VA 1ND2B 2HWD3 4IGOA 2BUKA 2W52A 4BK4A 1IS3A 1VBC1 2IVIB 4QU1A 3ZPYA 1R092 3WNLA 2ZAHA 5C5UA 5FZ0A 3UKVA 4ISQA 3OGJA 4D7YA 4CEWB 2LM3A 3NMBA 1AJOA 3D0JA 3POSA 3SH4A 3ZDSA 3PVEA 3JD71 1UO9A 4OUMA 2R042 5CBLA 3O1TA 4YG6A 1V9U2 3N9NA 3TEWA 4C0HA 2WN2A 2VCMA 1RINA 4CDQA 1UYZA 1XYPA 1XRUA 2WNVC 2ZGOA 3NAPA 4ORFA 5K0UA 4WVVA 3UGHA 4D7TA 3VDBA 3I3MA 1CIWA 1LOEA 4HL0A 4NHLA 4QPGA 5IT6A 4I2OA 1QWRA 2W91A 3VKMA 4R4XA 1COV2 4RQPB 2W92A 3VBRB 3VZOA 3ZSJA 2DCKA 2X53S 4Y33A 2MHFA 4F3JA 2OIIA 1IS4A 1HXS2 3MO4A 2ZA9A 4YM1A 5A7NA 1V70A 5FJKA 4YZ2A 4CE8A 2D6KA 1NXD1 2O8OA 2VMCA 4WBBA 2JE9A 4PQQA 4QX2A 4FO9A 2KXLA 2ZGQA 4H7LA 4W50A 3SCGA 4B3NA 1QXPA 3ZSMA 1W6NB 2FDIA 1FI2A 1I9RA 5JR7B 3ZFEA 4QGMA 4WZCA 1RVF2 3H9AA 3NNGA 4MZUA 5I0RA 1F5FA 3MV11 1NYWA 3VBUA 1POQA 1Z7S2 2P37A 2NYYA 5FZMA 4LBQA 1RUI3 1BMV2 5FWEA 1YQ6A 4YGBA 5A32B 1L3JA 4YFZA 4IEWA 3AP4A 1H4HA 4JTNA 5FQ0B 3WINE 4HPKB 1JN2P 1R1A2 1J59A 1B35B 1LR5A 2ZOEB 3I97A 4GZ9A 4LNVA 1ZZBA 5CFDC 3SNMA 4Z8BA 3CU7A 4LULA 3LDBA 4GWIA 4LE4A 1US3A 2VE1A 4BU2A 4GQ7A 3ZYJB 1Z0HA 3IB3A 3B3QE 3ZXKA 1PNGA 1YIPA 5DAXA 2GP3A 1Y4WA 5BXXA 3ZSLA 4CRQA 4DY5A 1NLSA 2OPWA 3MW3A 5FY8A 3LOIA 1ST8A 1SBDA 4HN1A 4NE9A 3CKHA 1SLIA 3S6PA 3RG0A 1SPPB 3LAGA 5CU1A 2BWAA 2IXCA 3MUZ1 3J4UH 5I8TA 3VBHB 1AJKA 2WKKA 4BJ0A 1QOSA 4XFAA 4CUCA 3CMGA 5FUNA 3U4SA 5T5OA 2FCUA 1UU4A 1OOPB 2LALA 1DGWX 1UZWA 4LBOA 2W95A 4ATFA 5C4WC 3OY8B 1MZ6A 2RS32 2TNFA 1CAXB 4AGVA 4JQTA 4OULA 3UV9A 2R062 3T2QA 1RUF1 2BP6A 3ZFFA 1CX4A 5IVFA 1NZCA 1QMJA 4PJYA 5JI9A 2JDNA 3EYPA 4MGQA 1XNCA 3RZGA 5C9AB 1UF2C 5DQ0A 2CV6A 1GWKA 4LITA 3T0BA 1W8OA 4J1XA 3T09A 3WSOA 1Q8QA 3OCPA 4QB6A 4GMP0 1EP0A 4LJHA 1HQWA 3SKJE 2VY0A 4HVQA 4FPLA 5FMCA 4B1MA 3A22A 5GLTA 1RIRA 2BNOA 4HK8A 4DXTA 1NG0A 3IDEA 4FXKB 5IK7A 4FPCA 1EV11 3KHCA 1UMZA 1W0PA 4MLOA 1VP6A 4JGYC 5CFCA 4QGLA 2PHUA 3TN91 1VRH2 1UY4A 2HBUA 3L2YA 4XABA 1G9BA 3A4UA 3ZN6B 2ENRA 2J42A 3NKGA 4IERA 1XE0A 2XBO1 4IE0A 2PQQA 1HW5A 4L9BA 4UW5A 5AVPA 5FRAA 3SKVA 3AKSA 2NMOA 4MG2A 3IMMA 1VAVA 4DXZA 1PVC3 5FKBA 4WVZA 2ZZJA 2O8QA 5FV3A 4IGPA 4PIYA 3WF4A 5C33A 5IATA 1TQ5A 4CYDA 2VTXJ 3GBFA 1NAEA 2VZTA 2HWC3 4AFBA 4LO6B 1OFNA 2WNVB 1E57A 2YC2A 3PUIA 4BISA 2KA3A 1SLAA 2BGPA 4LE3A 1F8VA 1AXYA 3IN9A 1C8NA 1J3PA 3NNMA 2P3IA 2EXKA 2VVEA 3LGRA 1NLQA 3POIA 2X09A 4OZXA 4QHOA 4LA2A 5D8AC 1UN1A 1FOD3 5A7WB 2E9QA 3CZUA 1E5RA 2B7YA 2BQPA 1SDDB 2AEYA 3ZSEA 3V0BB 3FFZA 3OYWB 4NIHA 4HG6B 3RNSA 1STMA 3B94A 4QAWA 1WW7A 5F2WA 3UYJA 5IK5A 1ZREA 4CUBA 1QGLA 4HSLA 3WY6A 5C8WA 3ZYGA 3R4SA 2IVJA 2XVGA 4EWDA 2QZ2A 2DUQA 1X50A 5FK8A 5B4XA 2K2SA 4XZPA 3AP9A 2Y64A 3JB8A 4D6RA 5M0TA 1W3XA 5IAXA 2DFCA 1V0AA 1OVSA 2HKXA 4PCRA 5LA1A 3TEYA 5FPBA 4Q4V3 4UW4A 5JPNB 4BMBA 1W90A 3I3DA 5IVVA 2A3WA 1DQ1A 1T6GC 4E4ZA 1ZBE3 2WZR3 3MHZA 5LK7B 5E8AA 3D0SA 3FJSA 3PJQA 5CFDB 1QJY1 4UT5A 2VUAA 5T55A 3WF3A 3OUJA 4XFGA 1UOJA 4YM0A 4KNCA 1PK6C 5C3QA 1G9AA 4WM8A 5EP9A 5AVAA 2VZ3A 2MEV3 1UKRA 2A70A 1ULGA 1JYNA 3WDWA 4LHSA 1C28A 1SLTA 4L11A 4EN8B 3AP6A 1GP5A 2W08A 5FMOS 3AYCA 1FPN2 1OQEA 2VZVA 3K3NA 4QX0A 2D3PA 1OPOA 1C5IA 4GMP3 5JSRA 1GQHA 2XL9A 4XACA 3WG4A 1AYM1 3M3CA 3JUUA 2E7TA 4NHMA 1JU3A 1ZZ7A 2QQLA 1Q8PA 5C4WB 1DQ2A 4EN7B 1IKPA 2ZX2A 3GGLA 4JKMA 4B4PA 1SG3A 4P9JA 1AR62 3HWJA 4JGZC 1VJ2A 1IQDC 2X8KA 2XWBB 2HWB2 4I02A 1MZFA 1YLLA 2Q1ZB 4KBZA 4W6WA 2VGDA 3BVCA 1H0BA 1BCXA 1WMDA 1IOAA 4CCDA 1W8UA 4JDNA 1IHMA 2VOXA 4IE6A 2W1QA 5CIRA 4YZ1A 1VBA1 2JE7A 1COV1 1OSGA 2G1MA 4WM7A 1VBC3 2UU8A 1ZRFA 1LRHA 4C8DA 1L7RA 3ACLA 2HWE2 2Y38A 2CHHA 1NY71 1SEFA 1OA4A 4DEQA 1HXS1 3M2MA 5LBCA 2IC1A 3MW4A 4EV0A 3DYOA 1VB2A 2VZQA 2Y6GA 3AXEA 3JD73 2XJVA 4C90A 1AL21 1FMD2 2V4VA 3B9IA 2YHJA 5A1AA 3S0MA 5FZHA 4OQ9A 2GC3A 3MDPA 5KHKA 2MPFA 2W3JA 4FVVA 1AXKA 5LASA 4LUMA 5JSPA 3IAPA 5IW0A 4QMAA 1JUIA 1WA6X 1NCRA 5LBEA 3K46A 4E9KA 3O14A 1Z7S1 5FYUA 4CCOA 2P6CA 4XJWA 5B2GB 2RS52 5LCWL 1PHMA 1QJX2 3ECQA 3V0AB 3VD5A 3KQ4B 1HB4A 1H8VA 3ZFGC 2WS92 2R1BA 1NXMA 1UMHA 1C1FA 3U1XA 4QQHA 4QX5A 4YZ5A 2WNEA 1GICA 5CG9A 1J1TA 2ZGPA 4P9XA 5LA2A 5A3NA 1NKGA 1W0NA 5LBFA 2JECA 5D8AB 4M00A 4B4QA 4FAHA 1DHKB 2WZ8A 3OUIA 1ND3A 3UGGA 3PIJA 1UZ0A 4XUPA 4IEUA 1UZZA 2D6OX 5FPVA 3ST7A 3VUOA 3MPPG 5F32A 4CU7A 4X8NA 2IUWA 4FFIA 5FP7A 2WC2A 2BV4A 2IXIA 2JD9A 1FNZA 4MV2A 2D5FA 3DV8A 4BYYA 4MOAA 5C3OA 5FYHA 1IPSA 3DCQA 3FFQA 4QQ2A 4K7JA 2GNMA 5JDBA 1PIV2 4YYOA 5LA9A 5CAZA 1JTZX 3POFA 4XBNA 1PGL2 2J1AA 4LA3A 4G3YC 3IMNA 4XBQA 3M8LA 3DKWA 5BNPC 1MPXA 2DVFA 1QJU2 3FLRA 1J84A 1F15A 2QQIA 3NNLA 3WW4A 4L8QA 4Y22B 2D6NA 2BZDA 2WNUC 1W8TA 3C7EA 4HANA 4IXLA 1WCSA 4S2FA 2RS31 1H6XA 1MR5A 2WRAA 2Y0IA 4CXWA 2Z42A 1HRV2 4TXWA 2O1QA 4AI3A 4BQYA 1E5IA 1KJRA 3GCXA 2RHPA 1CGPA 1JYTA 3KB5A 4QGNA 4DINB 2A7AA 3OD4A 4CU8A 4XHXA 5J09A 1PK6B 1RMU2 5LATA 2FDKA 3VBRA 4HMZA 2WNOA 2WQZC 3PDQA 5KC5A 4GD4A 1K3IA 1YO8A 4F8AA 1K45A 4N7UA 4CA9A 1PO21 3ASIA 5J98B 4UFHA 3CJXA 1QJEA 3O1PA 2RMU2 5IYYA 2QBXA 3GZTB 3WW2A 2WABA 1RUH1 2VMDA 1RUF3 2VR4A 4DOUA 1AR82 4FI9A 2PELA 3WOGA 1W6NA 2JDUA 4OFGA 2Q8DA 2Z4FA 4LBKA 4S2GA 2GC2A 5F2SA 4XAEA 4HFSA 1GZ9A 3CJIC 2O14A 3I2GA 3KQRA 2PTMA 1FXZA 5FYTA 4BCUA 1W0OA 2IWGB 1F9KA 1SBEA 1N47A 1VRBA 3H1YA 2CGNA 3M1HA 5IVJA 2EIGA 1LODA 2XWJB 1PZ7A 2JX9A 4HPKA 4JGZB 3ACIA 2YFZA 3ELNA 4RFRB 3WZ1A 5E89A 1EV13 1GZTA 4N53C 2BRTA 5A7QA 4UBGA 3ILFA 3O0WA 3TN93 5K7PA 4NPLA 1X7NA 1S2KA 2HH9A 4O9GA 2A3YA 2BJSA 2WWUA 3VKNA 4AFDA 2WQ8A 4FPKA 2XGXA 2GC0A 1Q8OA 2XBO3 4MX3A 4XXAA 4Q8LA 3MFAA 3PMSA 4XEZA 5IK4A 3T30A 5A3OA 5K9YA 3AMNA 3BU7A 3ROUA 2EIBA 3I2KA 1G86A 3LF7A 3SMHA 3MIHA 1CONA 4AVBA 5BNOC 2GN3A 3LEKA 3T0AA 1PX3A 4YW1A 1TME1 4Y1ZA 4EE2A 4Q5OA 3AZYA 4YW3A 2UY9A 2H0VA 4LBNA 3HBZA 5EZWA 3ZYBA 3CBNA 3OBTA 4GKYA 1LKNA 1HRI1 3GBWA 4L97A 4UYBA 5JXGA 1XSQA 3BALA 3ZXLA 4AVSA 3ZXAC 4AEJA 2RDNA 3AMHA 5LZ6A 2JKBA 5EHDA 5BNNC 1CJDA 4GAZA 1CAXA 4GIQA 5CG8A 2Y0OA 1SBFA 3ZFGB 3ABZA 2C5DA 3RDIA 3B00A 1OFSA 1QU0A 2JIGA 4NAMA 4GB32 4QQLA 3U0ZA 3OG2A 2BERA 3AL5A 3CDZB 2QUOA 3I7DA 3O1UA 4K1ZA 1LHNA 3AL6A 1SFNA 1AUYA 3GHNA 1BKZA 4O65A 1LECA 1W6PA 1ZBA1 1XNTA 4PIZA 3R0RA 3EHKA 5FO7B 2XH6A 5ABJC 4TN7A 4ZU5A 2XHKA 4CPBA 3HNYM 4Q29A 4EN6B 1FPN1 1LOFA 4DRRA 2NP0A 3CLPA 3MICA 3HBKA 3AZVA 3RZJA 4HT1T 1C57A 4LQRA 4M3CA 5HI0A 4D8MA 5BNPB 4OHYA 4AZZA 5TSWA 4Q1PA 2UURA 1QHDA 2GNDA 4YG0A 1Q8VA 2WNUB 2Z2SB 4AEDC 1JZ6A 4COYA 2RM21 2IFRA 4XFCA 3JB4C 3JBG2 1ASJ2 1E5HA 2PLV2 1VR3A 4QB2A 1H2LA 1WLCA 1H30A 4JVAA 1IS6A 2JB4A 3AZZA 2WNVA 5JI7A 1OA3A 1QXJA 4GWJA 2W5FA 1YFYA 5DAWA 3KLSA 1UKGA 3MIFA 3D4KA 2EXHA 5IVYA 1UMIA 3ZYIB 5JXIA 5KXCA 4JV4A 2V5DA 2HYXA 1JYXA 1S55A 3CQOA 3THPA 1BZWA 2J7MA 2ZGNA 4IEOA 2VUJA 3PL0A 2E31A 5A7WA 3ORJA 1AYM3 1NOVA 2DVBA 3H3LA 4HKWA 3P3PA 4D7SA 1VBE2 3AXDA 4BQ2A 3H8XA 5D2AA 4P5YA 3HPNA 4QM8A 5EJ3A 4CP9B 1YQ2A 3ES1A 2E63A 3QACA 4LIUA 4O61A 4UOJA 1SACA 5DDJ2 1EAH2 2OT7A 2V09A 3DF0A 4MGZE 2C4XA 5K4LA 4F7ZA 3MUY1 3I3QA 1HB1A 2WT2A 4YVWA 4LMFA 3MBWA 3CJIB 4JRAA 4PBOA 4COZA 5DPNA 1VBA3 2DCJA 1COV3 2E33A 3SQOA 4Q4Y2 4FCAA 5JZGA 3A0KA 4XIKA 2RS51 2XJUA 5DMYA 4MGTA 4YW5A 2PHTA 1HXS3 2FCTA 2RS12 2HJIA 4BIFA 3O1VA 5JIUA 4N53B 3T2OA 4CDWC 2YPJA 4PI2A 1AL23 2CU5A 2OUHA 4IEQA 4M01A 5GZEA 3O0XA 1W2AX 2DCZA 3KV4A 3TBDA 4AYUA 2D44A 4H55A 2FHRA 3EXUA 3G6JB 4XF9A 4CDUC 4DFSA 1OKOA 1JHJA 2WYFA 2ZX4A 3DPRC 3KVAA 4CCNA 2UWBA 3LEGA 1Z7S3 4XF1A 2VUDA 1RUJ2 1FT9A 4XUNA 5E1RA 2ZKNA 5H9RA 3VD7A 5CA6A 3CNAA 3Q8BA 5L36A 5BNOB 5BYNA 5FO9B 4FTEA 2C26A 2ZMLA 3AYDA 1PIV1 3B01A 4TSVA 4YGCA 3PJYA 5I0SA 3CL1A 3V56A 4BOWA 3B93A 1SQ4A 3I59A 5FPZA 4OI4A 4ZS2A 2QQNA 1JH5A 2FMYA 4A7YA 1AXZA 1DBNA 3PUSA 1LGBA 1Q43A 4Y5SA 4Y24A 5HCBA 1O3TA 3NV1A 1QJU1 1L7LA 2D40A 1UX7A 3LCPA 4P08A 5DUVA 5BNNB 3LOBA 2G19A 3N9QA 2G9FA 4XDPA 4A41A 2VW2A 2YDEA 1UCXA 3BUCA 5LW9A 5BY5A 1HRV1 3N9OA 4Q4X1 2GSYA 3BTAA 5FUPA 5DUWA 4JZRA 4NN0A 4EWEA 1UPIA 1DG6A 5I8SA 1MACA 1OQ1A 5DG2A 5I93A 1REEA 1QQP1 2VQTA 3M4FA 2H6BA 4DMIA 3DYPA 2VECA 5IUQA 2G4IA 2DCTA 5ABJB 2TEPA 4LKSA 2PHFA 1XYOA 2XLGA 3KT7A 4JGYA 4NHXA 4HETA 4R9BA 2E7QA 1DYKA 1B09A 2RS33 4PQ9A 1F35A 4ASMB 4Y3OA 4RHV2 5J36A 4KU8A 4D6SA 1I5ZA 5SV5A 4RGGA 2B8MA 1WWYA 1A3KA 4S2HA 1HB2A 1NQDA 4MO3M 1JBCA 1DZRA 3VDDA 4AEDB 2R0HA 5FZDA 3BTXA 3C2UA 3R6SA 3ZIXA 3UT0A 1GFF2 3V0AA 4B1LA 2IZWA 1PO23 1W6OB 4FTSA 2IXJA 4PBPA 3P3NA 5ANQA 3KCYA 3LWCA 1RUH3 4AQ6A 3N9LA 4E2QA 4FAGA 2AENA 3AMQA 2QZ3A 5D8AA 3KS7A 2GC1A 5SV8A 4AVVA 5EPAA 2W47A 2WR9A 2WA3A 1MS3A 4Q4W2 1QJZA 3FHQA 1F31A 2C9AA 1OD3A 1KFUL 1UY1A 4YW7A 4Q8KA 5GLUA 3MLJA 5GZFA 3OGVA 1NE6A 2Y34A 3RZKA 1O3QA 3J8F3 2VL4A 2JXAA 1O5LA 5T5PA 3PTRB 1RXFA 5CVRA 2E7AA 3ES4A 4IETA 4WZFA 5A3WA 1W8ZA 4IEZA 4NIGA 3KF5A 1H1MA 5I91A 2GP5A 3N4MA 1UU5A 1T2XA 2D93A 1DYOA 5C3PA 4RR3C 3J26N 2PA7A 3D5OA 4D69A 1XNDA 1SCRA 2KD7A 4P00B 4Y1XA 4WVMA 2R071 1NCQC 4QPIC 1X8MA 2QKDA 4RA0A 4QXKA 2K46A 2XUMA 3P6BA 2DFBA 1LHUA 2VCBA 4CDWB 5JPMB 3RZLA 2CAVA 4ARXA 1OMIA 1UYYA 2WWSA 2YB7A 2CDOA 3T1LA 4X6RB 2D3RA 2JDMA 2W94A 4XAAA 4GXLA 4MGIE 2JDYA 1TME3 4BMEA 3V65A 1IQAA 4JC1A 3BIWE 1ZZ8A 2E51A 2W1WA 3GF6A 3P1IA 2YYOA 3ZO0B 4CDUB 1HRI3 5ACA1 1MEC1 2UYBA 3DPRB 4HOOA 4L2NA 3WDXA 3UK9A 4B8EA 4C91A 2CSGA 4XJZA 4ZU4A 1WGPA 3Q8EA 5APAA 3H8RA 1EPWA 1OD5A 3IDAA 4QKFA 2F17A 4K40A 5FMOL 1DGLA 4R9DA 4CP0A 1GKBA 2VMEA 1SLBA 3MIGA 4RS5C 4YSFA 4AFMA 3NKTA 1DGWA 3RZMA 3PIGA 5EYYA 4CEYA 5DUXA 1WD3A 5GKAC 3H8OA 4LEJA 2B9VA 4O9EA 5A3PA 5A6QA 5FTTC 1CIYA 4CSWA 3WLUA 3A0NA 2LUWA 2A73B 1ZBA3 3HAGA 2RVAA 2BW8A 3I54A 3HVDA 4XC9A 2X5IC 3JCIA 4AXOA 2QQUA 4UF0A 1ASJ1 3OGGA 2OQ6A 3UGFA 3C3VA 5IWFA 1GWMA 5DXDA 4FP2A 1DZTA 4CU9A 1ULPA 1UY0A 3BI3A 4XMAA 1FPN3 4Z1VA 3SH5A 4A7KA 3AZXA 1V6KA 2A6XA 3VHPA 4K9SA 1MVEA 1U5IA 2HYKA 2WYSA 4LORA 1YWKA 3JXSA 3BPZA 2YC4A 3VN4A 1LNSA 1OUXA 4XOGA 1EYBA 3I49A 1REDA 2B46X 2RM23 2DWRA 1HN0A 3KVBA 5AC92 2QQVA 3KM5A 4A6OA 1H8TC 2ZABA 3PTYA 1H6YA 1JZ4A 2Z79A 1CR7A 1CZSA 3NNJA 3VBOA 3B02A 3C7GA 4X8PA 5GZCA 4IE7A 5DZFA 3E6BA 2W0XA 3T4HB 2H6CA 4MVTA 4AVCA 5FP9A 2YBPA 1X9TA 5AFEA 5EIYB 2XMLA 1W9WA 3N7JA 2VCCA 3RQ0A 2ZHKA 1H2NA 3B69A 2QTWB 3FMGA 4Y4YA 1PO11 1XJAA 2ZGKA 4BZ4A 3VBSC 2Y6LA 5FY9A 3X29B 1G7YA 1QY4A 4XMIA 5HV4A 1CN1A 5FP4A 2VNVA 3RMXA 3RS6A 3ACHA 1RHI1 3KSCA 2RS11 3NJZA 3SISA 3DECA 4ES8A 2BNMA 3WCSA 2VTFA 1QH6A 2P17A 2WBKA 3WG2A 1NUKA 2EA7A 2WWJA 3H8UA 4FSJA 4QDRA 2BNNA 5A6XA 2WT0A 1GZWA 2EAKA 2FMDA 1KEXA 4QKNA 4A7ZA 2PN5A 4XQWA 1Y9GA 3KD4A 1TG7A 2R32A 2RR11 4BQ3A 4I01A 1JOPA 2BBAA 5A3UA 4MGKE 3N7KA 5ISLA 3FLPA 1M06G 1SFPA 2BDRA 4XF0A 1ENQA 5FO8B 1DQ4A 1BEV2 2RS53 5F3GA 3BKZA 3ZYHA 1MS5A 1UOFA 3U75A 2YFUA 4CDXC 1S0FA 1XB9A 1YI7A 2SBAA 4XFFA 2WIIB 1JZ7A 2HEYF 5GJ6A 2XVKA 4ASKA 3OUHA 3CO2A 4RR3B 1S0EA 1CAUB 1S1AA 2RDQA 2WZEA 5JOWA 4EQVA 4IE5A 1AR71 3UJQA 2E26A 1NCQB 1ODMA 5FDBA 4QPIB 1AR93 3O1OA 3ZYFA 1X33A 1W03A 3BOPA 5F1RA 2HEWF 4MADA 2E32A 2NLRA 3WXPA 1RB8G 2DU0A 4BE3A 3M3OA 1K42A 2ORZA 4A6SA 1QOTA 2XKOA 3VD3A 2GH8A 5FXZA 1PIV3 1Y3TA 4PIXA 1O7FA 1FYUA 4IEYA 4WV8A 5C71A 1VBD2 1O4ZA 5JVVA 3GZUC 2F4LA 4V1PA 4Y1UA 3E6DA 2CNAA 3PUQA 1QJU3 4UFKA 1RUE2 2P34A 4EZ4A 4M0HA 2WSVA 1YFXA 2WO1A 1VIWB 2ZMNA 4CP9A 5FK7A 1YJKA 2QE3A 4DNYA 5LY2A 2VZSA 3H1MA 2VBBA 4XILA 4RS5B 1CD3G 5F37A 2XJSA 2OW4A 3Q9OA 3OGRA 4RD7A 3WW1A 1HRV3 4LLFA 2W68A 4GH4C 5FZ8A 4KWLA 4Q4X3 2WFF2 5KWRA 3K3OA 4IV3C 5IHRA 4FFHA 2XQRA 4I3PA 1X36A 4QD2A 3H42B 1IPJA 2V72A 5A33B 1S0DA 1GLHA 1QQP3 2CWMA 2X5IB 2P6HA 1FV3A 3ON7A 5FWJA 1O6UA 5C6CA 1D4VB 4LOSA 4M3CF 2HWD2 1ULFA 2HWF1 5FZLA 1UY2A 5C8CC 3FBMA 4QKBA 3A23A 4N53A 5EFUA 3NJYA 1BQPA 1PMIA 1UYXA 4GJZA 1MZ5A 1C8M1 4Z2WA 3FWEA 5A6ZA 5FXXA 4P5HA 3E5UA 5J7MA 3VKFC 3GALA 3THCA 2ADEA 4AEKA 1HN1A 3LEIA 5IVEA 2DDUA 2ZHMA 1GQGA 4RGKA 2AGSA 5T3NA 3HN3A 3PVNA 4RN5A 1BBT3 2VCAA 1AYN1 4Q1RA 3ZIWA 2WLPA 3NNFA 4FPGA 4Q26A 1H8TB 4XHBA 5BNOA 3I2HA 4BQXA 3RSJA 1W05A 2EF6A 1BVVA 2V5YA 3POYA 4UWDA 1ULEA 3FZ3A 1WKYA 3JQWA 1HV1A 1RUC2 3R05A 4AW7A 5JMOA 5KXBA 1XNAA 3VL8A 1Q56A 3FBYA 3H7JA 4M0NA 4QX8A 1FV2A 1KXGA 1RUG1 5FZOB 1DCSA 4ZU7A 1W6QB 3OF1A 4Y1YA 3VKOA 3ZX7A 3VBSB 5BNNA 4GWMA 3WNXA 4OI0A 4MGSA 1K5MC 4KBBA 1LOBA 1QKQA 1R091 1RUD3 3GJBA 2GAUA 4CDQC 3LD8A 2AACA 1I5PA 5K0UC 3ME2A 4PLMA 1RUI2 1GSLA 3K4DA 5J3UA 1RUNA 2EAAA 2VU9A 2XVLA 2R041 4FXGB 4RFT0 3M3IA 4NWWA 3WP3A 1JZ3A 2P3YA 1U0AA 1V9U1 2XJPA 4P9IA 4COWA 4Y5Z0 3PU3A 1SDWA 2ORXA 1L7QA 4BK5A 1Y9QA 2DBNA 4D0QA 4X6QB 1DGRN 1EUUA 3A21A 4UW3A 5ABJA 4CUGA 3T08A 3AMPA 2BFUL 3FHAA 2R073 2VJXA 3L2HA 2P4EA 3Q8CA 1DLCA 1LEMA 3EO6A 3GXUA 2UY8A 2QQMA 3WDYA 4KG0A 5G05L 4CDXB 3AB0A 3H3ZA 2GNTA 1SHWB 3ZFEC 3MPBA 1G8WA 4JHZA 5CNAA 3CEWA 4LUKA 1ENRA 1HJFA 3MW2A 3QH7A 4SLIA 2FCVA 3OPTA 1I1EA 4CCCA 3FN9A 2OUJA 5HCFA 4YM2A 5FZKA 1O4YA 4AG4A 2VW0A 4HSJA 4LKFA 3AMMA 5ACA3 1MEC3 1CAWB 4NUBA 3OEAA 1RVF1 1UY3A 3GYDA 4FQ4A 1SCSA 1W6OA 2ZKLA 3VZMA 3PVBB 1BMV1 2YXSA 4KWKA 4NRPA 4QX7A 4SBVA 1VAKA 5A1LA 2XJQA 4V2VA 1F2NA 5L7OC 1R1A1 4MHUA 2AREA 1KITA 5FY7A 3GHMA 1HQLA 1HJGA 1URXA 2ZX3A 4W6YA 1RYYA 3KCXA 3TEXA 2QQKA 3W58A 4OLLA 5FLJA 2VNOA 3ZXJA 4QQPA 4AFCA 4AI2A 1OUSA 1UU6A 3WQ0A 5A1FA 1YFUA 1V6NA 1RITA 4AE2A 3AK0A 3HR9A 1JI6A 1ASJ3 4K6BA 1Y43B 2ZMKA 3HQRA 2OQ7A 4XZUG 2OKXA 4AHYA 4CCJA 5KHGA 4GH4B 3HT2A 1HX6A 3IPVB 4ZONA 4XVHA 4IV3B 4DY3A 2XB6C 2Y60A 2C24A 2N7GA 3POWA 3U11A 4AK3A 4AI8A 1BJQA 4NR1A 3OB8A 3WUCA 1ND2A 1YQ5A 4IGQA 4L0PA 1PMHX 4LIVA 2ZGTA 3W59A 1VMHA 2I45A 4R8HA 4CVUA 4LXLA 5C8CB 3KGZA 4KL1A 1XU2A 4CEWA 1G6NA 2QQWA 5FYYA 2QVSB 4OI1A 4INDA 2VMFA 4YPJA 1CAVB 1W2TA 2PHLA 2WUHA 1HDKA 2NZ9A 4N8MA 3M70A 3I3EA 4IUGA 3T2PA 2ET7A 2R061 3AVSA 4LBMA 4YWAA 4ATEA 1LJ7A 5J48A 3DXUA 2PXJA 4PLNA 2Z69A 5ERLA 3K4ZA 4CDUA 5BPXA 4AAXA 4G9SB 3DPRA 5A3LA 2HWC2 1OXCA 1W6MB 3POEA 1XE8A 2UWCA 2OXBA 3USUB 4XW3A 3J7LA 4AFAA 1F5JA 4RQPA 4D94A 1PO13 2IXKA 1OI6A 1REFA 5CFCC 4TTGA 1ZYBA 3FLTA 2J1RA 5FZ9A 2AH2A 3GCWA 1JUHA 4B7EA 4HVRA 1D4M2 4HKOA 3NW4A 4XUTA 3WF2A 1RHI3 4N9HA 2RS13 4W4ZA 4UFLA 5FZEA 3VZNA 2JDPA 4JTOA 2GDFA 3IBMA 5LBBA 4YFWA 4QDSA 5H9SA 1CZTA 1VRH1 4XF3A 2EXIA 4Q2FA 5DAQA 4HKLA 2JIJA 4M4PA 1F4AA 1ZRDA 3IKWA 3WQ7A 2Y6HA 1UXZA 1K5MB 1JZ2A 2RR13 3WD5A 5HXMA 4CDQB 4MXVA 2DF7A 4Q0VA 5A32A 4QU2A 3RWKX 5K0UB 1RGSA 1XOYA 2PAEA 2R49A 3PVOA 1A8DA 3ZDVA 4BDVB 2QQJA 4BLJA 5FQ0A 2VMGA 4AQ2A 3ILNA 3OPZA 1B35A 1LHOA 4Q4V2 5FBJA 4I09A 2A3XA 3QH6A 3IIIA 1J1LA 1ZBE2 2D7FA 2V4AA 2WZR2 4IL7A 1S2BA 4Q0QA 3I3BA 2A6YA 3JQXA 1ZZCA 4PHZA 1AR73 1W8HA 3LFIA 1HKDA 3WNOA 2K0GA
chains in the Genus database with same CATH topology
5D1IA 3O12A 1TE1B 2DU1A 5I0TA 3WDTA 3ZFEB 3MLKA 5A3MA 2ZX1A 1LEDA 4PLOA 1HIXA 3RMYA 4LBQB 4FQZA 1YNAA 5F9TA 1AX1A 1AL0G 3VBHA 1DGRA 2QNKA 2WT1A 1OOPA 4AHWA 4XJ8A 1ZVFA 2ZPXA 5GLWA 3OY8A 4UBHA 1UPSA 4QT6A 5L7OB 4I0WB 2Y26A 4WM8C 1EY2A 2GMEA 4Y1VA 5C9AA 4KGQA 5J37A 4AWDA 3TRSB 1VBB2 2NN8A 4HN0A 2B39A 3HD8B 4YRDA 4ONUA 3WW3A 2HWF3 3MI8A 1VBC2 5DZEA 2BTVC 3AFKA 3IDCB 1C8M3 1RUC1 4RR3A 1CAUA 4MH0E 4FPHA 3JD72 3ZN6A 1MS1A 4NVPA 3USSA 1QJY3 4QPIA 1YI9A 3D6EA 3EBRA 1AYN3 5L73A 2R30A 1ENSA 4AHXA 4D3WA 3B9CA 5T50A 3BCWA 1N3PA 1S0GA 3ZVXA 1RUI1 1SLCA 4PDWC 3KZ4C 2Q4SA 3MFCA 2HWB1 4RSUA 1RUG3 1LHWA 1FATA 1MS0A 5CFCB 2OVUA 5T52A 3V0BA 3TOJA 1O4TA 4H3WA 3SHRA 1V00A 4RS5A 4BH9A 1R093 2HWE1 3OYWA 4IV1C 4C0BA 3W9AA 1NCRC 3FX3A 1KDMA 2R043 2ZX0A 1FMD1 1LTEA 1V9U3 2JENA 2NQYA 5A33A 3R4UA 5FPXA 1TEIA 3UKNA 4AQTA 4XJUA 3N3HA 2PAMA 2CL2A 2YZ4A 5KBFA 1ZZ6A 4N43C 2C1FA 2ZBJA 4IEXA 1KDKA 2ET1A 2XLFA 4OHVA 1QJX1 3ZXGA 2WS91 5JMCA 3ZYRA 4FPEA 5EV7A 3ZMNA 2QFEA 5EYXA 5CFDA 1W2UA 5DUUA 3SCHA 2PFWA 4CZSA 1CJPA 3MGUA 4Z82A 3NV4A 4KH9A 1LGCA 3KT1A 1H8TA 1RVF3 3WX5A 1KS5A 3IT8A 3T1MA 3UKTA 1UZYA 4FOVA 4NPRA 4E27A 2DVAA 1MQTC 2CYFA 1BVP1 4KWJA 4FPFA 4AI0A 1R1A3 4B29A 3LZZA 1A6CA 1PGL1 3FE5A 1RUF2 3VBSA 1PVXA 2GMMA 3ZXEA 1JW6A 3U07A 3MF9A 4XQ4A 1LULA 5IK8A 4Z07A 1WD4A 5C4WA 4XETA 3ZMOA 2D3SA 3S7IA 3THTA 2NMNA 4WM8B 3RYKA 3INAA 3RYRA 1AHSA 3O7OA 3N36A 3HN1A 3ZXFA 3TN92 1KS4A 1XU1A 2B42B 4XXPA 1RMU1 2A71A 2K9ZA 3HMYA 1N1TA 4UXAA 4DB5A 4YGDA 5BV6A 2XBO2 4HBNA 1D4M1 1MS8A 5L19A 4I0AA 2BGCA 4ASLA 2RMU1 5DG1A 4XTPA 4JDMA 1TMF2 3JU9A 2R063 4E2GA 2VULA 1AR81 3WP4A 2BBVA 4L99A 1LESA 1H9WA 4EROA 2WA4A 2C0ZA 1Q5OA 1WLWA 4TLFA 1LENA 3LB9A 1DF0A 4LO7A 1WCDJ 1WA4A 2G9GA 4PDWB 3UJOA 2UWAA 1QDOA 1VAMA 3WQ1A 3TNQA 4FPJA 1AVBA 1ZBE1 3WT3A 1X8EA 1VRH3 5JOYA 3SCFA 3SXWA 5LRRA 2E53A 1NA1C 3WUDA 4LBQD 3M7AA 1R082 2PHRA 3AJZA 5LK5A 1GV9A 2AYHA 4BIOA 4U2AA 4LO4B 4IV1B 3LSDA 5GALA 1QOOA 4XPVA 1NCRB 2ES3A 4IV3A 1V6MA 2P3JA 3AYEA 2TBVA 1KD7A 1NQJA 4BPZA 1YFWA 2V73A 1LB2A 2ZHNA 3GZAA 2JDZA 5FOBB 2A6WA 4TYSA 5C8CA 2VG9A 1WMEA 4N43B 4YW2A 5H9QA 4Y22A 2R16A 3MIBA 4OHZA 3B7MA 3SH3A 3WHTA 3H3UA 4YLZA 4FOYA 3WG1A 1XNBA 1G9CA 2D6MA 4YZ3A 4BQ1A 2EVXA 1V6IA 4R9CA 4GB31 4LHNA 3MEPA 2E6VA 4YARA 3USUA 2D98A 3LA2A 1RJ8A 1PK6A 3OJBA 3NWKA 3TWIA 1QDCA 1WBLA 1VBB1 1U12A 3VZJA 1VB4A 5FLHA 3SLIA 1AYM2 4FP3A 2GMPA 1JOJA 2ZGMA 1MQTB 4LLOA 1BYHA 1UD1A 4Q0PA 4XJ9A 4PF5A 1CPMA 3N35A 3G7DA 4K8FA 4OHWA 2P2KA 5EWSA 1K5MA 3RJ2X 3E97A 2W39A 4CP2A 3NSTA 5T5JA 4BHPA 3JBG1 1VBA2 4JGZA 2JG9C 2PLV1 4JDOA 3PLQA 4FTBA 1UIJA 5T54A 4DQAA 3AKTA 4BA6A 1NY72 1GZCA 3TYJA 1KRIA 1H9PA 1RUC3 4K1YA 1POV1 1QNWA 3VBFC 1AL22 1H4GA 2O0OA 3QBQA 1C3HA 2PYTA 1XXNA 5KHJA 3KCCA 4Q0UA 1CQ9A 1VBE1 3H0OA 4YVWC 1C5HA 4N90A 2R1DA 1DQ5A 2DVDA 2D6PA 5DDJ1 1FX5A 2HWB3 1EAH1 5JZGC 5DZGA 4R52A 2IXHA 2XKPA 5K8SA 3L9JT 5CB7A 1OLRA 4LHLA 2AR6A 2YUEA 4NO4A 1FAYA 1R1ZA 3ZFGA 4Q4Y1 3HT1A 3LA3A 5F5QA 2HWE3 3RPQA 1JHNA 4IESA 4K20A 1FMD3 5GLVA 2NM1A 1NA1B 1QNYA 3AKRA 4AHZA 4GKXA 1OHFA 1SFYA 2XL7A 4G4FA 3FC0A 1AF9A 1N1SA 2DV9A 4MXWB 2XJRA 5GM0A 4R4ZA 1RUJ1 2VNGA 2YV8A 1QJX3 5JOXA 1IS5A 1ONAA 2JJ6A 2WS93 4TWTA 2RJLA 3IDBB 4C1WA 3MZHA 2FZ2A 2UYAA 5BNPA 5GZGA 1RC6A 1QXRA 4KGGA 1AR61 1YIFA 3MIEA 2WNUA 1ULDA 4OUSA 1XE7A 1MZEA 1W6PB 1PO22 3KT4A 4GWNA 1RUH2 1YCIA 2SLIA 4MSVA 2VXRA 1QF3A 2F4PA 1OA2A 3WV6A 4META 2QDRA 2YGLA 4COUA 5LEJA 2BEOA 2ZGRA 4M3CB 5KC6A 3AP7A 3LA7A 2GN7A 3WG3A 4FT8A 3VLBB 5JIAA 3VDDC 4BM8A 5LEKA 1TMF1 2EALA 2VW1A 3J8F2 4JQRA 4K21A 4RHV1 2ZTNA 1V6JA 3CJIA 4H7MA 1UW8A 4YVSC 4AGGA 2QDNA 2ZHLA 3IWZA 1ENXA 3GBGA 3BODA 3O0VA 3BB6A 1UAIA 3VHNA 1RMU3 2ERFA 4EN0A 2JG9B 2MNGA 2WINB 1LOAA 2VMHA 2Q0AA 3WHUA 1D4M3 1N1YA 2RMU3 1ZRRA 3VL9A 3DUIA 2JG8C 3VBFB 4FBFA 1AR83 4W6XA 1WLDA 5T5LA 3QD6A 1TME2 1LOGA 3VKLA 1CPNA 1R081 2WQ4A 4P9WA 4Q4W1 1HRI2 1POV0 2ATFA 4MGYE 4YVWB 1AX2A 4BWOA 4MUVA 2GH2A 3RI8A 1NE4A 1GANA 1YHFA 3EQEA 1N3QA 2D6LX 2DUPA 4QM9A 5JZGB 2CY6A 3E5QA 1KJLA 5JOZA 2TUNA 4LT5A 3KMHA 2GZWA 1X82A 2WSUA 4P9YA 4EWAA 1UL9A 1WLTA 1ZBA2 2Q30A 5KHHA 2ZGLA 3NAPC 4AEMA 1WUVA 4RL7A 5GZDA 1DQ0A 4QPGC 1XQNA 1S0IA 2DCYA 2Q8OA 4FOWA 1RUOA 2D5HA 1RL3A 3R4DB 1C1LA 1DQ6A 5GLZA 3TAYA 4Q0SA 3AM2A 1S0JA 4C1XA 4CEYC 2DUOA 3I59B 1PZ9A 2B45X 2I07B 2WFPA 2VOWA 3OTFA 1OQDA 1TNRA 1WCKA 1PGW2 2RM22 1UX6A 3RRDA 5HXVA 4GB33 4LBJA 3VBUC 2D97A 3AZWA 4IEPA 2IFWA 1S0CA 4P9LA 4GULA 3URFA 4AEDA 3NV3A 1VBB3 4PDWA 2CAUA 3RYPA 3SITA 5JCTA 4U36A 4BLIA 1D0HA 1LGNA 2LTNA 1WW4A 4XTMA 4ZXKA 3V64A 4JGYB 1J3RA 4YGEA 2A75A 3DL3A 1PM7A 3VBOC 1U5ZA 5JAXA 1O91A 2ARXA 4IV1A 2VH9A 3D8CA 2QQPA 4J1WA 3VV1A 3JBG3 5AC91 2PLV3 3VDDB 1SLLA 2A5ZA 4Y20B 3VGIA 4QHBA 2ZACA 1V6LA 4AI1A 1IPKA 1LHVA 4YVSB 1BK1A 1POV3 4N43A 5H9PA 3ZFFC 4FPYA 2DURA 1AR92 2YROA 1VBE3 1GNZA 4CDWA 5FOJB 1ZRCA 2PAKA 1QH7A 1KFXL 3AX4A 1PVC2 2JG8B 3AP5A 1WBFA 2D43A 2ZGUA 2NPIA 2ZCWA 4N9IA 5DDJ3 1EAH3 4A3XA 1W39A 1XNKA 1VALA 3RJRA 1PNFA 2F6BA 1ZX5A 5F6LB 5J96B 4XBLA 5LRSA 2VOKA 1MQTA 1A8MA 4Q4Y3 1FOD2 1BEV1 4AQSA 4WVMB 1YYNA 3O5SA 3RWNA 1G9FA 2A6VA 1FNYA 2I2SA 3HQXA 4NHKA 2OZJA 1PGSA 3NVCA 4Q4X2 3FUOA 3WP5A 2VQAA 2XG3A 4EN9B 2GALA 3MLLA 4LO5B 4M3CE 4IEVA 3WR0A 5AFBA 1QQP2 3NAPB 4YM3A 3WP6A 1HV0A 1RUJ3 2BVVA 4QPGB 4GALA 1S0BA 1MVQA 2OPKA 2EXJA 1YJLA 3U10A 3OBRA 1VBD1 1AR63 4CEYB 3H50A 3JZVA 2DYCA 4FOQA 3FUQA 1RUE1 1RTVA 1GR3A 5JWPA 1DU3D 1MS9A 1BBT2 2FQPA 4LR4A 1IKQA 4HVOA 1APNA 3TB0A 1GNHA 2MEV2 5EXOA 4I30A 4XYXA 3VBUB 3J8F1 1NLRA 2BVBA 3NV2A 2ILMA 1LOCA 3U4XA 2WFF1 3GNEA 5E88A 3I8TA 2ZJCA 5JSOA 3PMEA 4TZDA 1U5YA 2OZ6A 2VNRA 1ULCA 1DZQA 1XYNA 4URTA 4R9AA 3PHMA 3ZXDA 1DFQA 2YC0A 2HWD1 1Q3EA 5BUVA 3CF6E 1RUD2 1Q8SA 1N3OA 4F83A 1TMF3 1ZM1A 1NA1A 4RHV3 4NWVA 1H2KA 4KG8A 4HK9A 4ITCA 3VBOB 2VPVA 3M3QA 2Q5TA 4B7KA 4MXWA 1D2SA 1CESA 3OD0A 5CADA 3VZKA 2R072 2X29A 1DLLA 4K3UA 3ILRA 2FBEA 4UW6A 4XDQA 5KXEA 1IZ3A 3ZYPA 3QOPA 3APBA 2XLAA 3D82A 1UIKA 1N1VA 4CP1A 4S2DA 1TNFA 3LKJA 4YZ4A 2BPA2 1NCQA 4J6GA 3RZZA 4LO8A 1WW6A 1R083 3ZFFB 4XE9A 4Q4W3 1DYPA 5ACA2 1MEC2 1GZWB 3J9SA 2CTVA 1CVNA 2JD4A 2BFUS 4ISRA 3DGTA 1C4RA 2FZ1A 4HLTA 2I74A 1EPZA 3MF6A 3N7MA 1IGOA 2P3KA 2B9UA 4WM7C 3MIDA 4LHKA 5FREA 4XFHA 4CTEA 3TNPB 3WCRA 1LCLA 1OPMA 4FPOB 5HBAA 1HLCA 3VZLA 3ATGA 2VQ0A 2BWCA 3ENRA 1OKQA 2DVGA 2VVDA 1JXNA 1PGW1 4KU7A 1AX0A 4A2UA 4Z92B 1BXHA 2BYVE 3KGLA 4XJAA 1GBGA 1GYKA 2X5IA 4NOTA 1U5XA 2JG9A 3T2TA 1Y7BA 4YNIA 3I4IA 2WL1A 4AF9A 2WLQA 3AKQA 4YW4A 4E4DX 3VBFA 2GNBA 1ND3C 1HQNA 2WJSA 2DTWA 2GU9A 2Z5WA 4KQ7A 4B4RA 3NL1A 1YRZA 1YXWA 3RI9A 4DPNA 4XIOA 3WVJA 2JICA 4P14A 2YGMA 4HZFA 2VOVA 1PO12 4H14A 3S30A 1OLQA 1ND2C 2YMZA 1MS4A 1G9DA 3QLQA 4DS0A 1H1IA 2KM2A 3ZN4A 4WVWA 1RHI2 1A78A 2RJKA 1ZA4A 4CEWC 4XF4A 1LU2A 4P9GA 1W6QA 3LSEA 1KQRA 2JEMA 2ZGSA 1H1AA 5FBZA 3I2DA 3E5XA 1Z78A 2XJTA 3ZN5A 3QCWA 2QCSB 3ALQA 2CGOA 4XFBA 4OI2A 1AR91 5KXDA 4RGAA 2RR12 1J3QA 2PHDA 5FFOC 5AC93 4JCKA 4RQPC 1O3SA 4GA9A 1PVC1 3VBRC 4MYEA 3H1WA 1ALYA 1LU1A 1O3RA 5BNQA 3WDUA 5FCCA 1EV12 2HWC1 2CGPA 1ZNPA 4IQPA 1AR72 3MYXA 4AGRA 3H7YA 1M4WA 4CDXA 3K48A 4W65A 2RE9A 3DN7A 2HEVF 3IM0A 1FOD1 2ZS6B 2IXLA 4DRVA 2ZAAA 2VVFA 1H2MA 2R6QA 3AJYA 4OVEA 3M3EA 5FLIA 1CAWA 1B35C 3S7EA 4OHXA 1D0GA 3AKPA 4XFIA 5JLVA 1SMVA 4DZGA 4JAAA 4JRLA 2QJVA 2ZZQA 3FHIB 1BEV3 5HCAA 2H0BA 4Q4V1 4WM7B 3N7LA 1WW5A 2WZPP 3ETQA 3VHRA 1WMFA 2Q1MA 3B5LB 2WZR1 4LBLA 2A6ZA 2DTYA 1O5UA 3K51A 3WDVA 3AYAA 3E6CC 2YY1A 5KHIA 2PHWA 1BBT1 4Y20A 4LTAA 1JYIA 4GH4A 1YUDA 2MEV1 5F6KA 5FAXA 3IPVA 2HWF2 3VBHC 4E4SA 3BOWA 2B5HA 1D2QA 1J58A 4YVSA 4I0BA 4E2SA 1OOPC 2ARBA 4I3GA 2OA2A 2R0FA 2AUYA 1C8M2 4AVTA 1ZZ9A 3AFGA 3HIFA 4AVAA 2ETEA 1VBD3 4L92A 4GMP1 4QPYA 1QJY2 2PHXA 1PZ8A 5I0UA 3ZSKA 1RUE3 5C9AC 1VLNA 1RJ7A 1I6XA 1CAVA 2CWSA 5I8YA 4Y26A 2OYZA 1AYN2 2JG8A 1RUD1 1DIWA 2VMIA 4COVA 1ND3B 1V6OA 3NO8A 2AZ5A 4Q27A 3UL2A 4XQDA 5E16A 1DDLA 1I3HA 1W6MA 2WFF3 3EJKA 4YG3A 2XPJA 3VHOA 4QQOA 3PNAA 1RUG2 3IIAA 4EJRA 1LOFC 1AZDA 4N7IA 1JYCA 1ND2B 2HWD3 2BUKA 2W52A 1IS3A 1VBC1 3ZPYA 1R092 2ZAHA 3UKVA 4ISQA 3OGJA 4D7YA 4CEWB 2LM3A 3POSA 1AJOA 3D0JA 3SH4A 3ZDSA 3PVEA 3JD71 4OUMA 2R042 5CBLA 4YG6A 1V9U2 4C0HA 1RINA 4CDQA 2WNVC 1XYPA 1XRUA 2ZGOA 3NAPA 4ORFA 4D7TA 5K0UA 4WVVA 1LOEA 1CIWA 4HL0A 4NHLA 4QPGA 5IT6A 4I2OA 1QWRA 3VKMA 4R4XA 1COV2 4RQPB 3VBRB 3VZOA 3ZSJA 2DCKA 2X53S 2MHFA 4F3JA 2OIIA 1IS4A 1HXS2 2ZA9A 4YM1A 1V70A 4YZ2A 2D6KA 1NXD1 2O8OA 4WBBA 2JE9A 4FO9A 2KXLA 2ZGQA 4H7LA 3SCGA 4B3NA 1QXPA 3ZSMA 1W6NB 1FI2A 1I9RA 5JR7B 3ZFEA 4QGMA 4WZCA 1RVF2 3H9AA 4MZUA 5I0RA 1F5FA 3VBUA 1NYWA 1Z7S2 2P37A 2NYYA 4LBQA 1RUI3 1BMV2 4YGBA 5A32B 1L3JA 4YFZA 4IEWA 3AP4A 1H4HA 4JTNA 5FQ0B 3WINE 4HPKB 1JN2P 1R1A2 1J59A 1B35B 1LR5A 2ZOEB 4LNVA 1ZZBA 5CFDC 3SNMA 4Z8BA 3CU7A 4LULA 4LE4A 4GQ7A 3ZYJB 1Z0HA 3ZXKA 3B3QE 5L7OA 1PNGA 1YIPA 5BXXA 3ZSLA 4DY5A 4CRQA 1NLSA 3MW3A 3LOIA 1SBDA 4HN1A 1SLIA 3S6PA 3RG0A 3LAGA 5CU1A 2BWAA 2IXCA 3J4UH 5I8TA 3VBHB 1AJKA 2WKKA 1QOSA 4XFAA 5T5OA 1UU4A 1OOPB 2LALA 1DGWX 4LBOA 4ATFA 5C4WC 3OY8B 1MZ6A 2RS32 2TNFA 1CAXB 4AGVA 4OULA 3UV9A 2R062 1RUF1 3ZFFA 1CX4A 1NZCA 1QMJA 4PJYA 5JI9A 1XNCA 5C9AB 1UF2C 2CV6A 4J1XA 1Q8QA 3OCPA 4GMP0 1EP0A 1HQWA 2VY0A 4HVQA 4FPLA 5GLTA 1RIRA 2BNOA 4HK8A 1NG0A 3IDEA 4FXKB 5IK7A 4FPCA 1EV11 1UMZA 1W0PA 4MLOA 1VP6A 4JGYC 5CFCA 4QGLA 2PHUA 3TN91 1VRH2 3L2YA 1G9BA 3A4UA 3ZN6B 2ENRA 3NKGA 4IERA 5FRAA 2XBO1 4L9BA 2PQQA 1HW5A 4UW5A 5AVPA 3AKSA 2NMOA 1VAVA 4DXZA 1PVC3 4WVZA 2ZZJA 2O8QA 4PIYA 5C33A 1TQ5A 4CYDA 3GBFA 2HWC3 4AFBA 4LO6B 1OFNA 2WNVB 1E57A 4ES9A 2KA3A 1SLAA 4LE3A 1F8VA 1AXYA 3IN9A 1C8NA 1J3PA 4ZKTB 2P3IA 2EXKA 2VVEA 3LGRA 4OZXA 4LA2A 5D8AC 1UN1A 1FOD3 2E9QA 2B7YA 2BQPA 3V0BB 3ZSEA 3FFZA 3OYWB 3RNSA 3B94A 1WW7A 5IK5A 1ZREA 1QGLA 4HSLA 3WY6A 5C8WA 3ZYGA 3R4SA 2XVGA 4EWDA 2QZ2A 2DUQA 1X50A 2K2SA 4XZPA 3AP9A 3JB8A 2DFCA 4PCRA 2HKXA 4Q4V3 4UW4A 5JPNB 4BMBA 2A3WA 1DQ1A 1T6GC 4E4ZA 1ZBE3 2WZR3 5LK7B 5E8AA 3D0SA 3FJSA 3PJQA 5CFDB 1QJY1 2VUAA 5T55A 4XFGA 4YM0A 4KNCA 1PK6C 1G9AA 4WM8A 5AVAA 2MEV3 1UKRA 2A70A 1ULGA 3WDWA 1C28A 1SLTA 4L11A 4EN8B 3AP6A 2W08A 5FMOS 3AYCA 1FPN2 1OQEA 5JSRA 2D3PA 1OPOA 1C5IA 4GMP3 1GQHA 2XL9A 3WG4A 1AYM1 3M3CA 3JUUA 2E7TA 4NHMA 1ZZ7A 1Q8PA 5C4WB 1DQ2A 4EN7B 1IKPA 2ZX2A 4B4PA 4P9JA 3HWJA 4JGZC 1VJ2A 2X8KA 2XWBB 2HWB2 4I02A 1MZFA 1YLLA 2Q1ZB 4W6WA 2VGDA 1H0BA 1BCXA 1WMDA 1IOAA 4JDNA 1IHMA 2VOXA 5CIRA 4YZ1A 1VBA1 2JE7A 1COV1 1OSGA 4WM7A 1ZRFA 1VBC3 2UU8A 1LRHA 3ACLA 2HWE2 2Y38A 1NY71 1SEFA 1OA4A 1HXS1 3M2MA 4EV0A 2IC1A 3MW4A 1VB2A 3AXEA 3JD73 2XJVA 4C90A 1AL21 1FMD2 3B9IA 2YHJA 3S0MA 2GC3A 3MDPA 5KHKA 2MPFA 4FVVA 1AXKA 4LUMA 5JSPA 4QMAA 1JUIA 1NCRA 4E9KA 3O14A 1Z7S1 4XJWA 5B2GB 2RS52 1PHMA 1QJX2 3ECQA 3V0AB 3ZFGC 1H8VA 2WS92 2R1BA 1NXMA 1C1FA 4QQHA 4QX5A 4YZ5A 2WNEA 1GICA 5CG9A 1J1TA 2ZGPA 4P9XA 2JECA 5D8AB 4M00A 4B4QA 4FAHA 1DHKB 1ND3A 4IEUA 1UZZA 2D6OX 3VUOA 3ST7A 3MPPG 4X8NA 2WC2A 2IXIA 4MV2A 4BYYA 1FNZA 2D5FA 3DV8A 3FFQA 4QQ2A 4K7JA 2GNMA 5JDBA 1PIV2 4YYOA 5CAZA 1JTZX 1PGL2 4XBNA 4LA3A 4G3YC 3IMNA 4XBQA 3M8LA 3DKWA 5BNPC 2DVFA 1QJU2 3FLRA 3WW4A 4L8QA 4Y22B 2D6NA 2WNUC 4HANA 4IXLA 1WCSA 4S2FA 2RS31 1MR5A 2Y0IA 2Z42A 1HRV2 2O1QA 4AI3A 1CGPA 1KJRA 2RHPA 3KB5A 4QGNA 4DINB 2A7AA 3OD4A 4XHXA 5J09A 1PK6B 1RMU2 3VBRA 4HMZA 2WQZC 5KC5A 1YO8A 4F8AA 4N7UA 1PO21 3ASIA 5J98B 3CJXA 2RMU2 3GZTB 3WW2A 1RUH1 1RUF3 4DOUA 1AR82 3WOGA 2PELA 1W6NA 4OFGA 4LBKA 4S2GA 2GC2A 4HFSA 1GZ9A 3CJIC 3KQRA 2PTMA 1FXZA 4BCUA 2IWGB 1W0OA 1F9KA 1SBEA 1N47A 3H1YA 2CGNA 3M1HA 2EIGA 1LODA 2XWJB 1PZ7A 2JX9A 4HPKA 4JGZB 3ELNA 3WZ1A 5E89A 1EV13 4N53C 4UBGA 3ILFA 3O0WA 3TN93 5K7PA 1X7NA 1S2KA 4O9GA 2A3YA 3VKNA 4AFDA 4FPKA 2XGXA 2GC0A 1Q8OA 2XBO3 4MX3A 4XXAA 4Q8LA 3MFAA 3PMSA 4XEZA 5IK4A 5K9YA 3AMNA 3BU7A 3ROUA 1G86A 3SMHA 3MIHA 1CONA 4AVBA 5BNOC 2GN3A 4YW1A 1TME1 4Y1ZA 4YW3A 3AZYA 2UY9A 2H0VA 4LBNA 3HBZA 5EZWA 3OBTA 4GKYA 1LKNA 1HRI1 3GBWA 4L97A 3BALA 3ZXLA 4AVSA 3ZXAC 4AEJA 3AMHA 2JKBA 5BNNC 1CJDA 5CG8A 1CAXA 4GIQA 2Y0OA 1SBFA 3ZFGB 2C5DA 3RDIA 3B00A 1OFSA 1QU0A 4QQLA 3U0ZA 4GB32 2QUOA 3I7DA 4K1ZA 1LHNA 1SFNA 1AUYA 3GHNA 1BKZA 1LECA 1W6PA 1ZBA1 4PIZA 3R0RA 3EHKA 5FO7B 2XH6A 5ABJC 4ZU5A 2XHKA 4Q29A 4EN6B 1FPN1 1LOFA 4DRRA 2NP0A 3CLPA 3MICA 3AZVA 4HT1T 1C57A 5HI0A 4M3CA 4OHYA 5BNPB 5TSWA 4Q1PA 2UURA 1QHDA 2GNDA 4YG0A 1Q8VA 2WNUB 2Z2SB 4AEDC 4COYA 2RM21 2IFRA 4XFCA 3JB4C 3JBG2 1ASJ2 2PLV2 1VR3A 1H2LA 1WLCA 1H30A 4JVAA 1IS6A 5JI7A 3AZZA 2WNVA 1OA3A 1QXJA 1YFYA 3KLSA 1UKGA 3MIFA 3D4KA 2EXHA 3ZYIB 5KXCA 4JV4A 1S55A 3THPA 1BZWA 2ZGNA 4IEOA 2VUJA 1AYM3 1NOVA 2DVBA 4HKWA 3P3PA 4D7SA 1VBE2 3AXDA 4QM8A 5EJ3A 3ES1A 2E63A 3QACA 1SACA 5DDJ2 1EAH2 2V09A 3DF0A 4MGZE 4F7ZA 2WT2A 4YVWA 3CJIB 4JRAA 4PBOA 4COZA 1VBA3 2DCJA 1COV3 4Q4Y2 4FCAA 5JZGA 3A0KA 4XIKA 2RS51 2XJUA 4YW5A 2PHTA 1HXS3 2RS12 2HJIA 4BIFA 5JIUA 4N53B 4CDWC 2YPJA 1AL23 4IEQA 2OUHA 4M01A 5GZEA 3O0XA 2DCZA 3TBDA 4AYUA 2D44A 4H55A 2FHRA 3EXUA 3G6JB 4XF9A 4CDUC 4DFSA 3DPRC 2ZX4A 2UWBA 1Z7S3 4XF1A 1RUJ2 1FT9A 5E1RA 5H9RA 2ZKNA 5CA6A 3CNAA 5L36A 5BNOB 5BYNA 5FO9B 4FTEA 2ZMLA 3AYDA 1PIV1