5CFDB

Crystal structure of dtt treated human cardiovirus safv-3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
232
structure length
232
Chain Sequence
SPFPVTVREHAGTFFSTTPDTTVPVYGNTISTPFDYMCGEFTDLLSLCKIPTFLGNLDSNKKRIPYFSATNSTPATPLVTYQVTLSCSCMANSMLAAVARNFNQYRGSLNYLFVFTGSAMTKGKFLISYTPPGAGEPKTLDQAMQATYAIWDLGLNSSYNFTVPFISPTHYRQTSYNTPTITSVDGWLTVWQLTPLTYPLGVPNDSHILTLVSGGDDFTLRMPVTFTKYVPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structure and Genome Release Mechanism of the Human Cardiovirus Saffold Virus 3.
pubmed doi rcsb
source organism Saffold virus
total genus 37
structure length 232
sequence length 232
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5cfdB00
1ZBA2 1AR92 4IV1A 1TME3 1VBA1 5BNPC 1VAKA 1BBT3 1VBD2 1X33A 1PO21 1MQTB 1ND3B 1D4M2 5BNOC 4CDXA 1AR72 1AYM1 2FZ1A 2VQ0A 1RUF1 4CDQC 4AEDB 1NA1A 1COV3 1PO11 4N43B 4YVWC 4FSJA 3J8F2 1QQP3 1PVC1 4FTSA 1FMD1 1QJY3 5L7OA 1RUI1 4Y4YA 1AR63 2X5IC 1AYN3 1HRI1 1RVF3 2HWE1 5ABJC 1WCDJ 4PDWA 3FBMA 2WWSA 4Q4X3 4CDWA 1EV13 1ND2C 1HRV2 3VDDB 3NAPC 1VBC3 5CFDB 1IHMA 4RQPB 1RUJ2 4WM7C 3ZFEC 5C8CA 1RUE3 3JBG3 2XPJA 1RUG2 4GH4A 3VBRB 1FOD3 4IV3C 1OOPC 1QJU3 4Q4W2 4IV1B 1AR91 2BPA2 3JD73 3ZFGC 1Z7S3 2RS51 4CDUC 4JGYC 4JGZB 4CDXB 5BNNC 4WM8A 1AR71 1TMF3 2RM23 2BBVA 2X5IA 2HWF3 2HWC2 1VB2A 2R043 1C8M1 1NA1B 1R092 1M06G 3VBFA 3J8F1 3NAPA 4N53A 1AR83 4Y5Z0 1RUC2 1RMU3 2XBO3 1MQTA 5L7OB 1AYM2 4Q4Y2 1R083 1FPN3 4GB33 1AL22 4BCUA 1VRH1 1ZBE3 3LOBA 4AEDA 1AL0G 3VBHC 3VBUC 1ZBA3 1PO12 1CD3G 4CDWB 5BNPB 5K0UC 1SMVA 4Z92B 3ZFGA 1VB4A 1VBD3 1R1A2 1PVC2 3ZFFC 5C9AC 1VBB3 1DDLA 1D4M3 3TN91 5C8CB 2MEV2 1RUI2 4GH4B 1PIV1 1RUG1 1QJX1 5FOJB 5FMOS 1ASJ2 1CJDA 1PGL2 4RR3C 5CFCC 1BBT1 1HX6A 5CFDA 1GFF2 4WM8B 1VBE3 2HWB3 2X5IB 5AC92 1AUYA 1HXS3 5J96B 3VBRA 2WZR3 2R063 3VBHA 3VBUA 1R091 3VBFB 1MEC2 2R072 1ND2B 3VBOA 1HRV3 3NAPB 4N53B 1NOVA 1RUC1 2RS52 4CEYA 1NCRA 1RUJ3 4JGZA 4YVSA 3CJIC 4Q4Y1 4RHV3 1V9U3 1OHFA 1OOPB 1AL21 1NCQA 1C8M2 2BUKA 1AR61 2ZAHA 4Q4W3 1AYN1 2PLV3 5ACA3 5LK7B 5FMOL 3ZFGB 4CEWC 2HWD2 4GMP1 5C4WC 1R1A1 1BEV1 5CFCA 4JGYB 1EV11 5D8AC 2MEV1 1K5MC 1VBC1 3DPRC 1ASJ1 1RUH2 1VRH2 4Q4V1 2FZ2A 1PGL1 1VBA3 3JB8A 5BNPA 1PO23 1B35C 1RHI2 1RUD1 2TBVA 4LLFA 3JD71 2RS12 1Z7S1 5JZGC 4QPIC 3TN92 5BNOA 3HAGA 4RFT0 5DDJ2 5AC91 2WFF3 1PIV2 1RUF3 1QJX2 1TMF1 4CDQA 4NWWA 3JB4C 3VBHB 3VBUB 1EAH1 4QPGC 1MEC1 5K0UB 4YVWA 2R071 1F8VA 4FTBA 3VBOB 4RS5C 5C9AB 1PVC3 4CEYB 1NCRB 1FMD3 1BBT2 1RUI3 4YVSB 1AR81 1POV1 1ND3C 1HQNA 2QQPA 1NCQB 1HRI3 2HWE3 5ABJA 2RS33 2HWD1 1COV2 1ND2A 4N43C 4RR3B 5GKAC 5CFCB 3ZXAC 4WM7A 3ZFEA 2RMU1 5J98B 4IV3A 1OOPA 1RUH1 1AR62 2WS91 4QPGA 1AYN2 2IZWA 1AR93 4SBVA 1RVF2 1BEV2 1RHI1 2RS53 4CDUA 1EV12 4JGYA 2RS11 5BNOB 5BNNA 3CJIB 2RR11 1AR73 5A32B 2WLPA 5DDJ1 1VBC2 4RQPC 1C8M3 4CDQB 1VBE1 4NWVA 3JBG2 4Q4V2 1H8TC 4YVWB 1FOD2 2ZZQA 4CEWB 1QJU2 5C4WB 2GH8A 3J8F3 1BMV2 4IV1C 1TME1 5A33B 1RUD2 3JD72 1Z7S2 4CDXC 1TMF2 2HWF2 4RHV1 5ABJB 1EAH2 1PGW1 5K0UA 1NA1C 1COV1 2PLV1 5ACA1 3ZFFA 1A6CA 5C9AA 4QPIB 4WM7B 3ZFEB 1QQP1 1AR82 3S6PA 1RMU2 1PIV3 1RUG3 4IV3B 1QJY1 5L7OC 1H8TA 4QPGB 1FPN2 4GB32 1RVF1 4RS5B 1QJZA 3VBSC 4PDWC 4Q4X1 4CDUB 4CDWC 4RR3A 5BNNB 1VBB2 2RMU2 2HWC3 1E57A 5C8CC 1RUE1 1X36A 2GSYA 2WFF1 3JBG1 1R093 2WS92 4GH4C 1FOD1 1RB8G 1QJU1 1BMV1 1C8NA 1W39A 1RUC3 4FTEA 4GMP0 2RR12 1AYM3 3CJIA 4Q4Y3 5A32A 1AL23 4WM8C 1VBE2 2RM21 2HWB2 2HWF1 2R041 1HXS2 1PO13 2WZR2 2R062 4CEWA 4GMP3 5C4WA 3VBSA 1R1A3 2BFUS 3VBFC 3ZFFB 1BEV3 2RS31 1TME2 5A33A 5D8AA 2MEV3 4N53C 1K5MA 1NG0A 1RMU1 2XBO1 1MQTC 3DPRA 1ASJ3 1H8TB 1R081 4Q4V3 4RHV2 1FPN1 1NY72 1V9U2 4GB31 1PGW2 1ZBE1 4AEDC 1ZBA1 2PLV2 5ACA2 1B35A 1RUD3 5JZGA 4QPIA 1VBD1 1QQP2 1VBB1 5AC93 1D4M1 1QJY2 2DF7A 1EAH3 1MEC3 1POV0 2R073 4RS5A 4Q4X2 1VBA2 2ZTNA 3IDEA 1PO22 2BFUL 1POV3 3VDDC 1ND3A 5CFDC 2HWB1 1RUE2 2WFF2 1HXS1 1RUF2 3VBRC 2WZR1 2R061 2HWD3 3VBSB 4PDWB 4N43A 1OPOA 5D8AB 3VBOC 1HRV1 1K5MB 2RMU3 4CEYC 1NCRC 1FMD2 3DPRB 1RUJ1 4JGZC 4YVSC 1RUH3 2RM22 1VRH3 4EJRA 2WS93 2R042 1NY71 1V9U1 1NCQC 1HRI2 4Q4W1 2HWE2 1B35B 3M8LA 1RHI3 2RS32 5JZGB 2RS13 3TN93 1F2NA 2RR13 3VDDA 5DDJ3 2XBO2 4RQPA 1QJX3 2HWC1 1R082 2Y26A 1ZBE2
chains in the Genus database with same CATH superfamily
1AR92 5CZKA 4IV1A 1APNA 3GM8A 1SLLA 5BNPC 2BYVE 2JENA 4ITCA 2Y6LA 5B4XA 4QKDA 2W08A 2RDSA 4OLLA 2FCUA 5A70A 2B8MA 3BUCA 3IPVA 3ZXJA 4AR2A 1AR72 1AYM1 1S0CA 4GAZA 4CP9B 2ZCWA 3OD0A 4YM3A 3H50A 2YU2A 2VQ0A 3Q8EA 2XLAA 2JICA 1W9SA 4XDQA 2LALA 5I0DA 5F32A 5A3NA 2WAOA 2FHRA 4MGTA 3A21A 5FWJA 4QHBA 5FZOB 3ZIXA 1BZWA 3EO6A 4FBFA 2PN5A 2QJVA 1QQP3 4ZS3A 3P3NA 5FK8A 3S5QA 4FTSA 3MW2A 2AENA 2P4EA 2VMIA 4CCMA 1QJY3 5E6HA 3LIGA 1UOJA 4RYDA 4JCKA 3FJSA 2IUWA 1HRI1 3D0JA 3O0VA 1QXPA 4M3CF 2OW4A 1WCDJ 3IDAA 1O6UA 2UWCA 3HMYA 4ZZ8A 1B09A 3IMMA 4ASKA 2Y0OA 2WQZC 1CZVA 4FOVA 2CNAA 2HLEA 3NAPC 4OMDA 4AEMA 5T5JA 2ZHKA 1IHMA 1RUJ2 4TYSA 2O8OA 4XJ8A 1OF4A 1AVBA 3JBG3 2H6CA 4FOQA 3I3MA 1JS9A 4LBQB 2WC2A 4IV3C 2JEMA 4FPFA 5HBAA 5E16A 3D6EA 2VY0A 1UX6A 1JOPA 4BQ1A 2QKDA 1HQWA 1W99A 1XB9A 2PHWA 4QGLA 3TB0A 4PIZA 1JU3A 4KGGA 3R6SA 5I0RA 5GM0A 2PHRA 3BPSA 3NSTA 5C3SA 3ZFGC 5KC6A 1Z7S3 3O0XA 4XFHA 3SKJE 2O0OA 2V72A 4FT8A 3OEAA 3VZMA 3M3CA 4RSUA 4CDXB 5GLTA 1MS5A 2V4VA 4EV0A 1TMF3 4P9GA 3I2OA 3GBWA 1UD1A 3AM2A 4EWEA 2R043 2DBIA 3ES4A 4V2VA 5FZGA 4BQ4A 1MACA 3IB3A 2OZ6A 3V0AA 3BTXA 5JXGA 1UU6A 3CZJA 1NA1B 5L9BA 2QFEA 1Q8SA 2RHPA 3ZN4A 1RITA 3EQEA 1LESA 2W87A 3B9CA 4XIKA 2MPFA 3ZSMA 1ULGA 4J1WA 3ECQA 3J8F1 4Y5Z0 1J83A 1U0AA 4HK9A 5DZGA 4FAHA 4NIIA 5L7OB 1I1EA 5EP9A 3U1XA 5FZBA 3VL8A 3VKOA 4JRAA 4Z82A 3VGIA 1RGSA 3APBA 4Y1YA 1XNDA 4L99A 4BB3A 1BKZA 1HDKA 1CD3G 1SLTA 1DGRA 3PVEA 2OA2A 1PM4A 4Q29A 3LEMA 2E31A 1VBD3 1YQ8A 1ACCA 3MF6A 4U36A 4HZFA 1LCLA 4I01A 3LA7A 5A3MA 3PVOA 1D4M3 2A6YA 1UKGA 2PYTA 3NO8A 4N8MA 3THDA 5C8CB 3MLJA 5FJHA 4AEJA 5FMOS 5HCFA 1ASJ2 1UMHA 3WQ1A 4OHYA 1OBNA 5I0TA 1OD5A 4JKMA 1X7NA 4YG3A 5FBZA 1KS4A 2RJLA 5F39A 2W0XA 2ZZJA 1QDOA 4JHZA 3DKWA 5FZ8A 5CG8A 1PGL2 4XBLA 3VN4A 4BIOA 5L36A 1KDKA 2GMPA 1VLNA 4J1XA 2H0VA 2ZGQA 1WLTA 2X53S 4XC9A 1O4YA 4AFMA 5CFCC 3C2UA 4FQZA 3KV5A 4WM8B 3SLIA 3KB5A 2HWB3 4YM2A 2IXCA 5AC92 4G4FA 5J96B 1N1VA 1JU4A 1G9BA 3VBRA 4BZ4A 1QNYA 4Q0UA 4UI9L 1R091 2NZ9A 3DXTA 4HONA 4E27A 2FD8A 1NQDA 1V6LA 2WSUA 5C3OA 5CBLA 4Y20A 3PURA 4GXLA 4XQ4A 4LE3A 5GZEA 4EZHA 4N53B 3MPPG 1RXGA 2Y8KA 1Y3TA 3ETQA 1RUC1 4MGSA 1NCRA 1V6KA 5C3RA 5GZDA 4XF9A 3W5NA 3CJIC 4MADA 1WW5A 4HPKB 2CYFA 1V9U3 4BMBA 5DAWA 1HKDA 1AL21 1OOPB 1C8M2 2OUHA 2RG4A 3H7JA 3QH7A 4O7XA 1AR61 2ZAHA 1TNRA 1D7PM 1W8FA 1FV3A 1W06A 3HBZA 3VHPA 3WZ1A 5LK7B 4MLOA 5B2GB 4MOAA 1KJRA 3J26N 3HVDA 3WD5A 3NNLA 1EY2A 3HT2A 1O7FA 1GU3A 4JGYB 4FCAA 1EV11 2OVUA 1NYWA 2P3IA 3N4MA 1H1AA 4XETA 3L2YA 2PTMA 5FZ3A 3T2QA 3SITA 5FDBA 4CTEA 1HV0A 3DPRC 2V5YA 4XFFA 3WR0A 4CUCA 5IFTA 1LULA 5FTTC 5IVVA 2DVFA 1VRH2 4Q4V1 2FZ2A 3EHKA 2YPDA 3K46A 5FY4A 1YFUA 1O8SA 2C5DA 2WL1A 5BNPA 1UL9A 2PHUA 3FLPA 1EPZA 2QQJA 1GV9A 1SFYA 1BQPA 1B35C 2C9KA 1H8VA 2TBVA 3JD71 3PHMA 1C57A 3AK0A 5JZGC 3KT4A 4QPIC 4E4HA 3HAGA 3LAGA 1RJ7A 3MLLA 5EV7A 1RUF3 2Z4FA 5L9VA 4NWWA 1TVGA 2UYAA 1GOHA 3AP9A 5I0SA 5K0UB 1MEC1 3ZN6B 3OD4A 2YHJA 2QZ2A 1W6QB 1MPXA 3VHRA 3MV11 3KQRA 1NAEA 4KQ7A 4MZUA 2GDFA 1PVC3 2R0HA 4AHYA 4CEYB 3MLKA 5KXDA 1XE0A 4XMIA 4IL7A 1A3KA 5FZ7A 5F3GA 3ZOIA 1CESA 1RUI3 4YVSB 1AR81 1CAVA 1JHNA 1W6OB 2ZHMA 2QQPA 2IXHA 3T30A 4BHPA 2F4PA 4NPMA 4YW1A 5CVRA 4V1PA 1XBFA 2UWAA 2JX9A 3R4SA 3T2OA 2XLGA 3KCXA 3OBRA 2XJVA 1A8DA 5C5TA 1COV2 5FK7A 4DY5A 2HH9A 2XUMA 3MFAA 4I2OA 2WA4A 1D0GA 2GP3A 2B46X 1PZ7A 2EIBA 3UK9A 2VH9A 2Y0IA 4GD4A 2RMU1 1FX5A 1SCSA 3GNEA 3T09A 2EXHA 2ARXA 4IV3A 1KXGA 3MIGA 4XFIA 5GLUA 5LA2A 4FOWA 5FY9A 3GCXA 2C6SA 1WCKA 4QPGA 1AYN2 3WDUA 4CU8A 2A75A 3ZO0B 3LPGA 2JDMA 2DCTA 2WNVA 3LDRA 3AKTA 2PHXA 1LENA 1RHI1 2RS53 3BCWA 2RS11 5BNOB 1V70A 1JYTA 2RR11 2GNMA 2ZGMA 3B7MA 5ERLA 3UETA 4QX3A 1I5PA 2JG9C 1G9FA 1XRUA 5F5QA 1VBE1 1VMFA 1UYYA 1W2AX 2DUPA 5LEJA 2R16A 1DGLA 1E5RA 2X05A 4UW3A 4B7EA 2VZSA 3HIFA 5A3OA 2JDUA 4BXSV 1QJU2 1L7LA 3KM5A 5F6LB 1BMV2 3K2OA 4DEQA 2L9LA 1RUD2 4D6SA 3RYKA 1SACA 3LPFA 1OA3A 1UQXA 1KFUL 2GZWA 2UY8A 1XOYA 4N90A 1VAMA 2JDZA 2VAUA 4CDXC 4QMAA 1UOFA 5IVCA 1H2KA 3D8CA 2ID4A 4RHV1 1EAH2 4LEJA 4XOGA 3CQOA 2QQKA 3RZHA 2DDUA 2GC3A 1NA1C 1G7YA 5FZAA 1A34A 4YGCA 2PLV1 2ZGKA 4QU2A 1UY1A 2VECA 5JVVA 1XC6A 2XJUA 2RJ2A 3N7LA 1Q43A 5I8YA 2JB4A 2R1DA 2YC2A 4CCNA 2DV9A 4LKEA 3VZKA 1QQP1 3MFCA 4FPCA 4XFCA 3HNMA 2BNMA 3S6PA 5JOZA 3LEIA 1NX9A 1MZFA 4IEVA 3KZ4C 3I59A 1QJY1 5L7OC 2DFBA 2KM2A 3IAPA 2VBDA 3J7HA 2VPVA 3LD8A 4XHXA 3RGBA 3UT0A 5A6YA 1H8TA 1UF2C 3NV3A 4N7UA 1AXZA 2FCVA 3ACHA 5BUVA 2K0GA 2MNGA 3ABZA 3HN1A 5DZEA 4XAAA 4BMEA 5JWPA 4CDUB 1MVQA 2CGNA 3MUZ1 2JDKA 4A41A 5DAPA 5BNNB 2YXSA 3T0DA 4KWKA 4Y1VA 4QXHA 2OX0A 5FPBA 1G8WA 4YNIA 5C8CC 2BZDA 3JBG1 1X36A 2GSYA 2WFF1 3A22A 3VZJA 3WW2A 2QTWB 2WS92 3AMMA 1WUVA 4GWNA 2VZOA 2VUCA 2WR9A 4Y1XA 4AAPA 3KWVA 1RB8G 1GKBA 1SLBA 5IYYA 4QAWA 1C8NA 5SV5A 1XE8A 2XQXA 1N3OA 2F4LA 5KHJA 1WLWA 3OGJA 2CTVA 5JR2A 1U12A 1C4RA 1Z0HA 1DHKB 1GYKA 3MUY1 1SG3A 2XVKA 2F17A 1AYM3 2YZ4A 3CJIA 4XFAA 4BJ0A 3ACFA 5A32A 4AW7A 5FQ0A 3LFIA 1CAWB 1SDWA 1YRZA 3IWZA 2EAKA 2XHNA 4WM8C 5KWRA 3BTAA 2R041 1HXS2 2W68A 2D44A 4YM1A 2R062 5FYIA 2QDRA 1JZ5A 1L7RA 2QQNA 4KU7A 3AP5A 5LA9A 4X6QB 1FNYA 1R1A3 2BFUS 4META 3VBSA 4IGPA 3W20A 3ZFFB 2RS31 4XYXA 5L9RA 3U37A 4Q0QA 4CCLA 1YFXA 1WCUA 2YPJA 5FZKA 5A33A 2ZAAA 4QQOA 1JZ4A 1STMA 4N53C 3H1MA 2WWJA 3DPRA 5LBEA 1OXCA 4LHSA 3LEGA 4Z2WA 2W5FA 1F31A 1W04A 4FFFA 4KH9A 2Q8DA 4C1WA 1AX1A 2BOIA 5EWSA 3U4XA 1ENQA 1OFNA 3FX3A 3KT7A 5FZ0A 4MX3A 4DQAA 3INAA 5FZ6A 1CAUB 1B35A 1NLRA 1NXMA 3KGLA 5JZGA 4QPIA 1KS5A 1VBD1 4D6RA 3ZSLA 1QHDA 3NNGA 3CF6E 3SCFA 4AGVA 5HCHA 2D5HA 1PM7A 4Y26A 4CPBD 1D4M1 2GN3A 3V0BA 3POEA 4HG6B 3I8TA 4TTGA 4MH0E 1WW4A 1AF9A 2VM9A 1POV0 3AB0A 1V6NA 4JDNA 3RZJA 4PF1A 1UMIA 3UESA 2X09A 1YIFA 4XCAA 2OQ7A 4V2WA 5F3EA 4CCOA 4DMIA 3ES1A 1DQ2A 1O4TA 4QKFA 5BY5A 2BGCA 4P9JA 1F35A 3O1TA 1POV3 3KV6A 3WV6A 5HI0A 2ZKNA 2J1TA 3G6JB 2BRTA 2LW8A 2A71A 2HWB1 5LATA 5K9YA 4CP9A 2QQMA 3HPNA 3SMHA 1ZNPA 4LA2A 1N1SA 4OI4A 1OI6A 3Q8BA 1GZWB 2HWD3 4MG2A 4A4AA 5DAQA 2W46A 3E5UA 3WNLA 3AFGA 5C6CA 3LKJA 5BV6A 2W1UA 3OF1A 5D8AB 3RVHA 4FOYA 2VZPA 1VIWB 1DQ4A 1SLIA 4DZGA 4CEYC 2B5HA 1NE6A 3FBYA 4PCRA 4BQXA 3ENRA 2O14A 1F5JA 4JGZC 4B1LA 4YVSC 1RUH3 4FXKB 4HOOA 2RM22 3ZM8A 1CX4A 5FZMA 4QM9A 5FUPA 4QX2A 3BPZA 3WY6A 1NY71 1V9U1 1REDA 4YM0A 1ULOA 1HRI2 3CEWA 4AI3A 2BJSA 3O1MA 2E33A 2GC0A 2Y64A 2WQ4A 4HKWA 4XF3A 2RV9A 2WUHA 5E1RA 1W8OA 2XHKA 3TBDA 2DURA 4IE5A 4M3CE 1YLLA 5HCAA 1KFXL 1V6MA 1DGRN 3IIAA 4QQ2A 4AQ6A 2XBO2 2JG9A 4LTAA 1JZ3A 3I2IA 2WT1A 4LBOA 3AZYA 5A6QA 1ZVFA 1R082 2E26A 3GHMA 3FUQA 5GLZA 3ZXEA 4MXWB 3PTYA 1OA4A 4A42A 4XAEA 1V6OA 3FHIB 4R8HA 2NP0A 4FP3A 3WQBA 2HKXA 2GMEA 3MIFA 5FZLA 5FZFA 1TME3 1LNSA 3NV4A 2WRAA 3E5QA 4LHLA 4L97A 1CN1A 2W1SA 1X33A 2XKPA 3ZIWA 1MQTB 2TEPA 1I6XA 1XSQA 4M4RA 1QJFA 4A7KA 2JDAA 1BK0A 4IEXA 4K8FA 1Q56A 5JR7B 1UY0A 1VMHA 4ATEA 4CDXA 5BNOC 2FZ1A 2J22A 1W9TA 3AVSA 2XKOA 4UF0B 4YG0A 4AVTA 4BYYA 1RUF1 1XSRA 2ZX4A 3ACLA 4NHKA 2LS6A 1W3XA 4AEDB 1NA1A 4M3CB 1FNZA 1LOGA 1PO11 2BV4A 1S0JA 2J1AA 1UZWA 3JCIA 3NJXA 3K3NA 4W6WA 3IAQA 2G9FA 3E1F1 1SPPB 2LUWA 3SXWA 3J8F2 4AI0A 5A6XA 1PVC1 3CKHA 2RE9A 4D3WA 3S7EA 1POQA 1NZCA 5CNAA 2PHTA 1CGPA 3WDYA 2P37A 4DEVA 1RUI1 5IK4A 5L7OA 1CJPA 1OKOA 1AR63 1QY4A 4I3GA 4XE9A 2VR4A 2WA3A 1S0EA 2VMCA 3ZXDA 4DUVA 4MSVA 1RVF3 2WT0A 2E32A 2VCBA 3DGTA 4TLGA 1W3VA 4GWJA 3PL0A 3M3EA 5CIRA 5FYMA 3J7MA 3VKLA 1OLRA 2F6BA 1EV13 2D5FA 2XJPA 3ILFA 3J4UH 5DQ0A 3U07A 3W9AA 1G86A 5LA1A 3FE5A 1ND2C 3VDDB 4QU1A 2FMDA 4OHVA 1Y9MA 5FKBA 5CFDB 4RQPB 2WO1A 5H9PA 3AL6A 3M1HA 2O1QA 3FLRA 4YLZA 4ZPIA 5C8CA 2XPJA 1W90A 2A7AA 3DYMA 3R4UA 4XXPA 4CUBA 1FOD3 2N7GA 1AZDA 3FUOA 3FWEA 4QXCA 3UKTA 5CKNA 4QHOA 3ZXGA 1UAIA 1GWLA 2VVEA 3FHAA 1XXNA 3GALA 3LB9A 3EYPA 2BPA2 2IXJA 4AXOA 3JD73 2C9AA 4EROA 3M3IA 4FFIA 4ET7A 2AYHA 2JKXA 2RS51 4I0WB 4CDUC 1J1LA 4BQYA 5DG2A 1GQHA 4IGOA 5EJ1B 3IMNA 5BNNC 4WM8A 5JSOA 2BBVA 3OUIA 1LU1A 1ZA4A 4AYUA 2HWC2 2K2SA 1BJQA 4PI0A 4MHRA 1YC61 4AFDA 3V65A 2C4XA 5LY2A 4MGZE 2W3JA 1R092 1T6GC 3NNFA 4HVOA 4IEUA 1M06G 2PAMA 2ZKLA 3UKNA 1W0OA 4MGQA 3RMYA 4M01A 4FPHA 1YJLA 3UV9A 4C90A 4N53A 1AR83 5JAXA 1RUC2 1RMU3 2PELA 3TRSB 3TOJA 5FY5A 3UGHA 2BDRA 3EBRA 4ZU7A 1ZRCA 3B02A 1LJ7A 3WDWA 4QXKA 1VAVA 2GAUA 4YW6A 5C7GA 5JMOA 4XACA 4HPKA 1FPN3 2ET7A 4L9BA 2E51A 4NE9A 1YCIA 4GB33 1AL22 3OB8A 3ZYRA 4BCUA 3LOBA 1ZBE3 3ZSEA 3SH5A 1S55A 2ZMNA 3LWCA 4WBBA 2E63A 4J25A 2PAKA 1J3QA 2Q5TA 1CAXB 1SHWB 1VB4A 1Y43B 1K3IA 4HFSA 4AQ2A 1QGLA 2RJKA 4QKNA 4EN6B 3ZFFC 5C9AC 3EXUA 1HJGA 1NE4A 1PGSA 1ZYBA 2YMZA 2XDVA 2R30A 3Q8CA 4K1YA 3TN91 5A1FA 2W1WA 3ZKYA 3AXEA 5F1RA 1PK6B 2DTYA 4OQ8A 2ZX0A 2G1MA 4XZUG 4Q5OA 1DQ6A 3WP3A 2WYFA 3W21A 1H1MA 4WVMB 1SDDB 4B1MA 4X8PA 4XUOA 3NV1A 5FYCA 4LK7A 1OC1A 1SEFA 1V6IA 3JQXA 5CKMA 5JSPA 2DVDA 1HV1A 5HXMA 1AHSA 2RDNA 5L19A 1QMJA 3RYRA 1PNGA 3ZYPA 1BBT1 4UFIA 5FY7A 4YPJA 1PX3A 1UZYA 1VBE3 5G04L 2X5IB 1AUYA 5F2WA 2XR4A 1GNZA 2WZR3 3AKSA 4WV8A 3WQ0A 1AX0A 3H3LA 2AUYA 2BVBA 1MEC2 4IGQA 4XTPA 3MEPA 3ST7A 4XF1A 3ZN6A 3B5LB 1JHJA 1ST8A 4BIFA 4ZY9A 1W6QA 1JOJA 3BB6A 4PLNA 1ZZBA 1WKYA 3OJBA 1S0DA 3AFKA 1EYBA 1OMIA 1NOVA 3OGSA 4LO5B 4BWOA 4CEYA 2BGPA 2G4IA 1UPSA 2GC2A 3ZYHA 1RUJ3 1LB2A 4JGZA 2W94A 5F6KA 4DINB 4YVSA 4FPKA 3N9OA 5DG1A 4RHV3 4AQTA 4LHNA 1OHFA 4DXZA 3R0RA 4NJ4A 4H55A 1LOAA 4LUMA 2CDPA 5KBFA 3RJRA 1PMJX 2PLV3 3SC7X 4LULA 1E5HA 5CEHA 2QNKA 1LODA 4CEWC 1ZREA 2QQIA 5C4WC 1R1A1 2A6WA 5HCBA 1NT0A 4XFGA 2VXJA 1JTZX 1YIPA 2B42B 4H7LA 5D8AC 5HV0A 4NIDA 1WW6A 3KLSA 3U0ZA 3BIWE 4IW3A 1VBC1 3A4UA 2ETEA 2B45X 1WGPA 3OY8B 1H1IA 3O1UA 1VBA3 3JB8A 5FIXA 2CV6A 2OPKA 5EHDA 5A7PA 4BM8A 3C3VA 4PBPA 2J1SA 4ZHNA 4IEPA 4ATFA 3J7LA 3MI8A 4C0HA 4CA9A 1RHI2 2CWMA 1CX1A 2ZGNA 4LLFA 4XDPA 2RS12 5BNOA 2FDHA 4QPYA 2JG8B 1IG0A 2Q4SA 3WF2A 4YARA 2HBTA 5T54A 1OF3A 4DXRA 2IVJA 2WFF3 2DBNA 1PIV2 2AGSA 2BNNA 2ZXQA 3B01A 1QJX2 3A7QA 5IVYA 3JB4C 4QHZA 4UFHA 1MS9A 3VBHB 1DFQA 3VBUB 1HIXA 4WVWA 5GZCA 1ODNA 4QPGC 5LK5A 3VZLA 3FMGA 3O14A 2NQYA 3VD4A 2ZGOA 5D2AA 2C24A 3ZYJB 4FTBA 3VBOB 2O8QA 2DTWA 4Q1PA 2WNVC 3NKTA 1LHVA 3WF4A 3MIBA 5JOXA 1EUTA 1H6YA 2Y60A 1ZRRA 2Q0AA 1OA2A 1WMFA 1POV1 3I3QA 4GA9A 2ZEWA 3UGGA 5DAXA 1NCQB 4AFAA 3RZZA 2Q8CA 3MDPA 2HWE3 1YJKA 3KF5A 4DPNA 2JE8A 2VULA 3IM0A 1C1LA 2JE9A 4NHXA 1IZ3A 2RS33 4CZSA 2VCMA 2HWD1 2WLQA 1FI2A 1ND2A 2E9QA 4RR3B 4UOJA 5GKAC 1BLZA 1ZZCA 2BBAA 2TNFA 5A7QA 5CAZA 1G6NA 4N7IA 5J98B 4GWIA 1REEA 3VDAA 1KRIA 4O65A 3U75A 4HLTA 1J59A 3P3PA 3POIA 1RUH1 3PUAA 2WNUC 4NAOA 4PQ9A 4ZU4A 3JXSA 3BVCA 1ZRDA 1KDMA 3AKPA 3D3AA 3PTRB 3WG4A 5BYNA 4G9SB 1OUSA 1UN1A 3S7IA 1O59A 3O7OA 3PUHA 4KU8A 1OLMA 1JMUB 1BEV2 4CDUA 4PLOA 1XU1A 1Y4WA 5BNNA 5F9TA 4MGKE 4MHUA 4HMZA 4Y33A 1RC6A 1I3HA 3M3OA 3LEKA 4IERA 2PQQA 3A0NA 4COUA 4RQPC 1C8M3 5A6ZA 3CJXA 4NROA 4NWVA 1ODMA 3O1OA 3JBG2 3WXPA 1H8TC 2JKBA 4QB1A 4YVWB 5C8WA 1G9AA 2DCJA 2CGOA 2WWUA 3ACIA 1U5ZA 1X82A 2J1UA 1CIWA 4YZ5A 3TEWA 2JDHA 3S30A 2FDFA 4ES9A 2Z42A 1TME1 1W28A 2JIJA 3WCRA 2WNEA 5A1LA 1Z7S2 4CRQA 2VOWA 4TLFA 2QQVA 5I91A 4Q0SA 4QB2A 4IESA 3EMRA 2NLRA 4XHBA 1W8UA 3LE0A 3DF0A 1CAWA 4AE2A 5A3UA 1TMF2 5FJKA 1WMEA 2BW8A 2YB7A 5FFOC 4YZ4A 1K5JA 1YI9A 3S0MA 4S2GA 5LY1A 4P08A 5FXXA 1C3HA 5L73A 3VDCA 2QQLA 5ACA1 3ZFFA 1A6CA 3N7MA 5C9AA 5IVFA 1JXNA 4HXCA 4WM7B 1HN0A 3MW3A 4QX1A 4OULA 1X8EA 2P3JA 1RUG3 3AZXA 5C5UA 4I30A 2ZPXA 4QGNA 1RL3A 1LGBA 4DY3A 2XONA 3GJAA 3UNPA 2XVLA 4YW3A 1RVF1 4R4XA 4RS5B 1QJZA 1VMJA 2HEVF 4IEOA 4OQ9A 4CCDA 4D7YA 3VBSC 4PDWC 4XJ9A 2AC1A 2VNGA 3AMNA 4NVPA 3O12A 4DB5A 2VW1A 4IEZA 3IZOA 3FZ3A 2VBBA 3LGRA 3ZVXA 4E2QA 1K45A 1E57A 1O5LA 1U5XA 2VMHA 3URFA 4X6RB 1JZ7A 5I8TA 1PK6C 2AEZA 1FOD1 4ZONA 5FYBA 1LGCA 2CWSA 3ZKUA 2AREA 4F3JA 2LM3A 2BWCA 1LU2A 2VTXA 5FPZA 3ILNA 3NJVA 1CVNA 3IKWA 1ULPA 1W39A 4W6XA 5LZ6A 5T5OA 1EPWA 3ZR6A 4J6GA 1IPSA 1RUOA 4YGEA 3NQHA 3ZN5A 4Q4Y3 1QXJA 2H6BA 4XJWA 5JPMB 5IUQA 2A6ZA 4XVHA 2HWB2 2D6OX 3VL9A 4C91A 3KQ4B 5F7UA 1PO13 2CAUA 5A7NA 2R49A 1W6PA 4IE0A 4CEWA 3DKQA 2HJIA 2AACA 5C4WA 1LHOA 4XF0A 3FLTA 3QH6A 2BTVC 5ANQA 3I54A 3DYPA 5D8AA 3M4FA 2MEV3 3B93A 4Q0PA 2R32A 2PQSA 1RMU1 2QZ3A 4URAA 2J1RA 2ZS6B 2ZGSA 4UBHA 2BP6A 4BLJA 1L3JA 1VP6A 1X8MA 2JXAA 3KMHA 3ZSJA 4B29A 5A7WB 4YGBA 5F5AA 2A3YA 1FPN1 4RL7A 1NY72 1V9U2 1JN2P 4GB31 2BQPA 1PGW2 4Y5TA 3H3ZA 5IHRA 1ZBE1 2VCCA 2H0BA 5KR7A 1XNAA 3OGRA 5FXZA 4AVAA 1RUD3 4YFWA 1C1FA 3RQ0A 4WZCA 4JVAA 3PJQA 1O4ZA 1JZ2A 3WQ7A 2EF6A 1UYPA 1VR3A 2A1XA 4IEYA 5JMCA 3RZKA 4IEQA 4HSJA 4HL0A 5IT6A 1BVVA 4RGGA 1EAH3 3VV1A 4KWJA 4Q8LA 1OH3A 5FAXA 2PHFA 4M0NA 2R073 4MXWA 4CU9A 1FAYA 2OYZA 2A3XA 2XL9A 2ZGUA 3PJYA 5FYHA 4Q4X2 2IFRA 2WYSA 3LA3A 4JV4A 2WO3A 3IDEA 2ZA9A 5FPUA 2FDGA 5BNQA 5EXOA 5J3UA 1CPMA 1GSLA 3POFA 2BGOA 2VNOA 2ZGLA 2VC9A 3BOPA 4UF0A 1RUE2 1MVEA 3LFMA 1RUF2 1SFNA 2Y6GA 2WZR1 2FBEA 3GJBA 4XFBA 5A3TA 2A6VA 1AJOA 1ZX5A 2FQPA 2Y6JA 1ENRA 4M3CA 5I8SA 3ALQA 1DGWX 4W65A 5FREA 4IE7A 4YG6A 4P9XA 1OPOA 3D82A 4EN8B 1JZ8A 3KS7A 1SPPA 3WNMA 3WUDA 3Q9OA 3VBOC 1C5HA 1OLME 4NIGA 3C7EA 1K5MB 1ULFA 5EIYB 3ELNA 1RUJ1 1LHUA 2EA7A 5C70A 4HVRA 2WNUA 4M0HA 4YGDA 4IXLA 3VZOA 2WS93 1MZ5A 1NCQC 2GU9A 1GOFA 3OUJA 5TSWA 4BQ5A 3WG1A 1W0NA 3T1LA 3QBQA 3M8LA 1PVXA 5IJRA 3PMSA 4AVSA 4B3NA 5DZFA 5LWBA 5IK7A 1WA4A 2VQUA 3TN93 1XNCA 1F2NA 4OHZA 4BH9A 2KR2A 3P5BA 3VDDA 5DDJ3 4AFCA 1TE1B 2B7YA 4OI0A 4RQPA 3VKNA 5FZEA 1ULCA 1JYVA 5FRAA 3K77A 5A80A 5J48A 3ATGA 3K4AA 1LRHA 1OVSA 4C0BA 3BU0A 5IK5A 5CADA 3AYAA 4NPRA 5EZWA 2XWBB 3LOIA 4KWLA 3O1VA 1W03A 1M4WA 4CUAA 1ZBA2 5DUWA 3PVNA 2XOMA 2XJRA 3CHXA 4LBLA 1VBA1 4SLIA 1N1YA 1PMIA 1VAKA 1BBT3 2EXKA 2X8KA 3CBNA 3MBWA 2NMOA 3M2MA 4Q1RA 2VXRA 1QDCA 1ENXA 1U5YA 2Y6FA 3NKGA 4YZ2A 1DYKA 3VUOA 2P6HA 2ZBJA 4N43B 4YVWC 3VD3A 1UXXX 5FY8A 4FSJA 1QXRA 3KGZA 3WF0A 2JE7A 2VD7A 4FAGA 2XMLA 4QDQA 3I2GA 2B39A 3H8XA 1GWKA 5FP8A 3UJOA 1S2BA 4NR1A 4LUKA 3D0SA 4B4PA 3C8XA 4PJYA 5FZIA 3ZX7A 4QX0A 1GP5A 5FBJA 3TAYA 5JOYA 3POGA 5EYYA 1W6MA 1H9WA 2HWE1 4XJUA 3WLUA 4NRPA 3LIHA 2SBAA 4PDWA 3FBMA 2ZEYA 1CAXA 3M7AA 4GKXA 5FP3A 3MZHA 2XWJB 1FYUA 1HRV2 1OQDA 2DCZA 3F95A 3H9AA 1TEIA 3I2JA 5H9RA 1VBC3 3L9JT 2V09A 5LASA 1NUKA 4WM7C 1CWPA 2D7FA 4TWTA 4QD2A 1QKQA 1XYNA 5J7MA 1W8WA 1PK6A 1WMDA 5DN2A 2JIGA 4LHKA 2CGPA 3VBRB 4GKYA 5FP7A 1PNFA 1H6XA 4EZ4A 4AWDA 1OOPC 4LMFA 2WN2A 4XF4A 2EAAA 4WVMA 4Q4W2 1IG3A 4Y1UA 4UAPA 1GANA 1IKPA 3MPBA 5T52A 3POYA 5LA0A 1S0GA 3I2HA 2VW0A 3B69A 3KVAA 5IAXA 1W05A 1OVPA 4K1ZA 2D97A 1S4CA 2WINB 3USUB 4D6QA 1O5UA 2Q8EA 4JGYC 4A45A 1XYOA 1GUIA 2XQRA 3MW4A 4L0PA 4HBNA 3CDZB 1E5SA 2G9GA 3BYWA 1QJEA 2RM23 4LBNA 4N9HA 5A7SA 1SLAA 2X5IA 2HWF3 3MV01 3W5MA 4QM8A 1YUDA 1C8M1 4LR4A 3HT1A 2IXKA 1H2MA 5FZ1A 3WDTA 4IDZA 4JTOA 1DQ5A 1CQ9A 2OPWA 5F2SA 4GQ7A 3PUIA 1SBDA 1CR7A 4LBMA 3HWJA 4ZS2A 2CHHA 3ETPA 5IAVA 2QDNA 4KG8A 4RD7A 1JYWA 2K46A 2XBO3 3WNXA 4JTNA 4E8DA 2D6KA 4YW5A 1OUXA 4FO9A 3I3BA 3WDVA 4NRQA 3B00A 3MIHA 1AYM2 4FPYA 1GP6A 1R083 3KHCA 4NHMA 2D6NA 5GJ6A 5F5IA 1S0FA 1F5FA 4XILA 1PHMA 1VRH1 4CCCA 1WA6X 2VZ3A 1AL0G 4QT6A 5AVAA 3U14A 3OSDA 5FZOA 4CDWB 5BNPB 4LO6B 5K0UC 1SMVA 3UYJA 2VMFA 2YROA 3TNPB 1Y9QA 2DUOA 3Q8AA 2BOJA 3N7JA 1R1A2 4AHZA 1O3RA 1VBB3 1H0BA 5F5CA 4LKSA 1GLHA 1DG6A 3KD4A 4YWAA 4HN1A 4AI1A 1V0AA 1F4HA 4H3WA 4GH4B 2X10A 1RUG1 2UU8A 1LOEA 2XLFA 3LSDA 4ZU5A 2ZHNA 3MYXA 1GMMA 2CSGA 4QDRA 5FXVA 3PMEA 1IGOA 4BK4A 3H7YA 1UY3A 4L2NA 3WP5A 4YZ1A 4QQPA 2QQWA 4QX8A 4A44A 3N9QA 5FYYA 2Z69A 3HJRA 5FZ4A 4HVQA 3AVRA 2D6MA 4KGQA 2YC0A 5JI7A 1CAVB 1Q3EA 1NLQA 2ZJCA 1OQ1A 3NL1A 3GZTB 2HYXA 2CY6A 3NWKA 2G9ZA 2ZX3A 5DUUA 1GR3A 4LBQA 2FMYA 3VBHA 3VBUA 2W52A 4JKLA 2XGXA 3VBFB 5FPXA 4MYEA 3AC0A 1OQEA 2OQ6A 4Q2FA 1ZM1A 2W95A 4H14A 3VBOA 3NAPB 1WW7A 3NV2A 1OH4A 4CP1A 4I0AA 5C71A 5J1XA 2EXJA 4CYDA 1H2NA 2OZJA 4MV2A 4NIAA 1UCXA 3FFZA 1BYHA 1KEXA 3BALA 4R9CA 4Y3OA 4Q4Y1 4AZZA 4EWAA 4LO4B 3WDXA 3RPQA 2D93A 1NCQA 5FCCA 3N36A 1KD7A 4CXWA 4RGKA 2E7QA 1LOBA 1AYN1 1GP4A 2NPIA 1GWMA 5LW9A 5IK8A 4OUMA 1A8MA 5ACA3 2HYKA 1UMZA 3ZFGB 1Z78A 4N9IA 2HWD2 1DDLA 3QCWA 4IEWA 4CCKA 3HN3A 2VCAA 4S2HA 2Z5WA 1US3A 1WLDA 5FO9B 1TZOA 2MEV1 2D40A 5DUVA 2PA7A 1K5MC 3K4DA 5CG9A 5J36A 3IIIA 1RXFA 4ZZ5A 2BNOA 4FPLA 1RUH2 3RFRA 4ASMB 2QBXA 1UIKA 3S5AA 2OXBA 2VG9A 2BEOA 3WG2A 2ZEXA 1R1ZA 3AJYA 3KV9A 4I3PA 2BWAA 3KV4A 3QACA 4ZXEA 1PO23 3IDCB 3K51A 4GJYA 1RUD1 5EJZB 4NPLA 4AVCA 5JPNB 3T2TA 4JAAA 3N35A 4M00A 2RVAA 1W6NB 5FZHA 4AHXA 4QDSA 4FFHA 3X29B 1YYNA 1D0HA 2VZRA 4OI1A 1H4GA 4CSWA 2LTNA 2XH6A 1EAH1 4M4PA 2Q30A 3B3QE 1W2UA 4YVWA 2R071 3H8RA 3ZXKA 2E6VA 4E4ZA 1S2EA 1HN1A 2ZACA 4D8MA 1LHWA 2WDBA 1FMD3 1URXA 3AMHA 3O0WA 1ZZ6A 1J84A 3N9PA 4Y4RA 2DYCA 5AFEA 3E6CC 3SCGA 2NN8A 4IE6A 3P6BA 5APAA 3I59B 1WLCA 1IQAA 4UW4A 2ZGRA 4A7ZA 1QIQA 3CIHA 4HKOA 3T0AA 4AF9A 2GP5A 5A3LA 1YO8A 2WN3A 1QOSA 3CZUA 4IUGA 4CCJA 4C1XA 2P5BA 2VTXJ 1DQ0A 4N43C 5CFCB 1NXD1 1AXKA 1DF0A 4MO3M 1X9TA 3KF3A 4S2FA 5FO7B 3ZXAC 3BI3A 3M3QA 2XG3A 1X50A 1IS3A 4WM7A 3HQRA 5C33A 1UOBA 1DIWA 4K40A 4ASLA 3AMPA 3IN9A 2J42A 5HV4A 2Y6KA 5KC5A 1OOPA 2YFUA 4C8DA 1AR62 2WS91 4EQVA 1RIRA 2IZWA 1AR93 1SFPA 5GZGA 1S2KA 5DXDA 1RVF2 1NZIA 5T5PA 4CXYA 1VE0A 2V73A 2VZTA 1EV12 2R1BA 4JGYA 2VMGA 3CJIB 4QWNA 1UZZA 1AR73 4XUNA 3THPA 2SLIA 3EJKA 2WLPA 4NOTA 5DDJ1 1Q8QA 5A32B 3PU3A 4YW2A 3RNSA 4CDQB 5FLJA 4CCEA 2LRPA 4Q4V2 1LR5A 1G9CA 1FOD2 2VVFA 2ZZQA 4FQ4A 3RJ2X 3HR9A 4BQ2A 1F4AA 1T2XA 1Y9GA 4P9YA 4PBOA 1AX2A 2GH8A 2PFWA 2VZVA 1W2OA 3K4ZA 3WUCA 5ISLA 2P6CA 4Z1VA 1KGYA 2YBPA 5A33B 1CIYA 4XEZA 3JD72 4DRVA 1HB4A 2WIIB 3ILRA 4RN5A 1I9RA 3RRDA 3N7KA 2VMDA 4TSVA 4BOWA 3E6DA 4FI9A 3O1PA 1H9PA 3H3UA 5ABJB 4BA6A 1YNAA 2ATFA 2BVVA 4AI2A 5K0UA 2VMEA 4BU2A 3LZZA 2EALA 2DCYA 4PF5A 1H2LA 5JI9A 2RDRA 2W91A 4QX7A 5IATA 4QPIB 1QF3A 5CYYA 3POBA 5A3PA 3ZFEB 2QVSB 5JXJA 1AR82 1DZQA 2W92A 1RMU2 1W6OA 3HNBM 2VGDA 1PIV3 1DLCA 4XURA 3V0BB 1WZXA 2WJSA 3IT8A 4I02A 4P5YA 3AXDA 3IBMA 1GNHA 4NHLA 4QPWA 4COWA 5A7WA 2XB6C 5IVBA 1FPN2 2B9UA 2ARCA 4GB32 1UKRA 4BE3A 2W39A 1UU5A 4IE4A 4L8QA 4DXTA 3H0OA 5DAVA 2UYBA 4BDVB 2KXLA 3FN9A 4CDWC 3KCYA 3I2DA 1W2TA 4A3ZA 4YRDA 4AOCA 1ZZ7A 1I5ZA 2K9ZA 4BXFA 2RMU2 5IVJA 1OT5A 4XIOA 3ZXFA 4DIQA 2YV8A 1DBNA 5E8AA 1QH6A 5EPAA 1KITA 4GH4C 5C3QA 5M0TA 5T55A 4DOUA 2GNBA 1CPNA 3WF1A 1TQ5A 3AKRA 4BQWA 3RSJA 3VD5A 1BCXA 3PIGA 1Q8VA 2Y6HA 4JX0A 3GDBA 2JD9A 4CU6A 4XUQA 4GMP0 4CU7A 2RR12 4XUTA 3RI8A 3AZVA 4X8NA 3SISA 1PZ8A 1VBE2 1YEWA 2RM21 5CISA 1OFSA 2HWF1 4JKKA 4OCTA 4P9IA 1HQLA 3AJZA 1UIJA 3CL1A 5JLVA 2WZR2 3C7GA 4MUVA 1EP0A 2P34A 4GMP3 1MZEA 3NW4A 3VBFC 1BEV3 2IC1A 4UFKA 1LOCA 3SH3A 1LEMA 3ZPOA 1J1TA 1REFA 3HNYM 4PHZA 4E8CA 1K5MA 1NG0A 2JG9B 2XBO1 1MQTC 2A3WA 4EE2A 4COVA 2GALA 1V00A 4TN7A 1ASJ3 1YQ2A 3GXUA 3OTFA 4CP0A 1R081 3WW3A 1V6JA 4RHV2 5FPAA 2ERFA 1C5IA 3WF3A 4K3UA 3W58A 4AEDC 1PMHX 2PLV2 3AZZA 1ZA7A 4Y22B 4JC1A 4F7ZA 5KXCA 1Q5OA 4K9SA 4WVVA 5FPLA 1QQP2 3E97A 3UJQA 2ARAA 1VBB1 2BERA 1YFWA 5AC93 5F3IA 4ARYA 5ANNA 4ES8A 2UY9A 4PT6A 1QJY2 3OEBA 3WT3A 3ZDSA 2VE1A 3D5OA 1UU4A 5FLHA 1WD4A 2YGMA 2W9XA 4XDOA 4XBQA 4R9AA 1MS4A 4G3YC 4LBJA 2I07B 3PDQA 2HEWF 3N3HA 1DU3D 1VBA2 4KI5M 4D7SA 4L11A 5LCWL 5D21A 5A1AA 4PQQA 5CB7A 3WW4A 5KHGA 3VDDC 4XPVA 1R64A 5CFDC 3BGAA 4INDA 5JOWA 2EIGA 2WFF2 4PIXA 5FUNA 5KHIA 1LGNA 4XUPA 5HXVA 2Q8OA 2AH2A 1ZRIA 3ZYGA 2J1EA 4LKFA 4N43A 3TEXA 5JCTA 1HB1A 4JZRA 3PU8A 4CVUA 4EN7B 1RYYA 4AGGA 3PIJA 1UYZA 2W47A 2VZ1A 4LIUA 1LOFC 3N9NA 3CNAA 1NKGA 2PXJA 1EUUA 2DU1A 3PUSA 1YWKA 3RG0A 2VU9A 4W8JA 2ILMA 2DVBA 5T5LA 3RZGA 1VRH3 4EJRA 2JDNA 4LXLA 2R042 3T3YA 2WO7A 1XQNA 3G7DA 1XPWA 1MR5A 2DVAA 2YC4A 4GULA 4LQRA 5CA6A 1NQJA 2HWE2 4ORFA 5CU1A 2VJXA 3OYWB 2Z79A 2W2IA 3K48A 1HB3A 2RS32 4F83A 5LB6A 2WO2A 4FPEA 4RA0A 3GZEA 4I09A 5EFUA 3RWKX 1QOOA 1LHNA 1GBGA 4MXVA 3T4VA 2HWC1 3OUHA 2JJ6A 2R6QA 2Y26A 3NNMA 4HKLA 1SBFA 4GJZA 4XJZA 2E53A 5DUXA 3WSOA 2FDKA 1JUIA 1YXWA 5IW0A 1CAUA 3DXUA 3KT1A 4AVBA 5FP9A 4AQSA 3ASIA 1OKQA 1VBD2 3USUA 1PO21 3ZDVA 3VKMA 1ND3B 3LSEA 1QH7A 1XNTA 1D4M2 5JXHA 4YFZA 1IS4A 1T6BX 2EIDA 3H1YA 3LDBA 1SBEA 4LO7A 5LBFA 2YDEA 4CDQC 3BOWA 3I2KA 2A70A 4UXAA 1COV3 2YU1A 1XJAA 4S2DA 4H7MA 5FYTA 1AJKA 1X9PA 4AI8A 4HT1T 4OMCA 3ZYIB 4HETA 2GMMA 4GIQA 2R7EB 1LAJA 3K75B 3OOXA 4OHXA 4RFRB 1CONA 1FMD1 1DYOA 1JUHA 2ADEA 4YYOA 4Q26A 3P1IA 4Y4YA 4P02B 2JWPA 4A7YA 2X5IC 1DLLA 4UYBA 3BODA 5FUIA 1AYN3 4ONUA 4KBZA 3WNKA 1A78A 1W8HA 1W9WA 3AMQA 5K4LA 2YG0A 1SLCA 2D3PA 4JQRA 1K42A 4FPJA 4L92A 4DO0A 5ABJC 1GZWA 2IXLA 1WCQA 3A0KA 3AL5A 4ZKTB 4Q4X3 2WWSA 4CDWA 2WT2A 3POJA 2VZQA 1FV2A 3WNPA 4A6SA 5I93A 1GQPA 4LJHA 5GLVA 2YBKA 3DECA 2QQOA 4WVZA 1JH5A 2EICA 2ENRA 5HPOA 2DCKA 2ZGPA 3U11A 3SEEA 5FXWA 3ACGA 3ZFEC 4KMQA 1YI7A 2WQ8A 2ZMKA 3QD6A 3SQOA 3V56A 1RUE3 4EYUA 5K8SA 1RUG2 4GH4A 2B9VA 3F2ZA 2KD7A 4LA3A 1QJU3 1UZVA 2JDYA 3B9IA 2GH2A 4NUBA 4XMAA 3POWA 1ZRFA 4IV1B 1AR91 1W9YA 5KXEA 4A6OA 1S0IA 3BN6A 4KL1A 4LNVA 2D98A 4E9KA 2YFZA 3MO4A 1O8PA 2KA3A 4OHWA 5E88A 2ARBA 4JGZB 4QGMA 3LDKA 3IPVB 1DGWA 5EQUA 2E7TA 1AR71 1VB2A 2P17A 2Q1ZB 4AEKA 1MS8A 2OT7A 3SCHA 5EJ3A 3NNJA 4QQLA 4TZDA 4GWMA 1N1TA 4XJAA 1CZTA 1FXZA 4QQHA 1FT9A 3FHQA 3VBFA 3ZLIA 1OLQA 3MGUA 3N9LA 2VUAA 3OPZA 4YSFA 3OCPA 2D6LX 1S1AA 1UWWA 3NAPA 3BKZA 1DZRA 5FY1A 5F3CA 1MQTA 3T1MA 3OG2A 5FZCA 4Y1ZA 4NHYA 4UFMA 3U10A 3MIDA 3O1RA 1WWYA 2V5DA 2JG8C 3NJYA 4Q4Y2 4FVVA 5FP4A 5A3WA 2B4KA 5H9SA 4Z2AA 4BPZA 3ZPYA 4WZFA 4AEDA 4O9EA 3VBHC 3UGFA 3VBUC 1ZBA3 1PO12 4P14A 4BQ3A 4DUWA 1Y7BA 2VTFA 1NLSA 4Z92B 4XBNA 2LROA 2Q1FA 3ZFGA 4AFBA 4JRLA 3Q8FA 5T50A 1PVC2 3ZYFA 1WCSA 2CU5A 1GICA 3JUUA 4LK6A 2MEV2 1UO9A 1RUI2 4PI2A 3RMXA 2D43A 2YBSA 3HOBA 5F8PA 3TNQA 4KNCA 1PIV1 3H1WA 1JYCA 1QJX1 5FOJB 4DRRA 5KHKA 3PUQA 4P5HA 1CJDA 2OKXA 1UZ0A 3IDBB 4E4DX 4TXWA 4NAMA 5JIUA 2XVGA 1GZ9A 1WD3A 4CE8A 1UYXA 2QE3A 3T08A 3R05A 5JUVA 1O3SA 2IFWA 4RR3C 4BISA 3GCWA 5FMBA 1HX6A 1WBFA 5CFDA 5T3NA 1GFF2 3RS6A 4LBQD 3WEZA 1W6NA 1O3TA 4AVVA 1HXS3 3TWIA 3V0AB 4Y24A 4I0BA 4UT5A 5FOBB 5DMYA 2R063 1DP0A 3RYPA 5LBBA 1XE7A 1TG7A 1G9DA 1F9KA 2DUQA 3ZSKA 5J09A 3J9SA 4YW7A 2R072 5DABA 4NIHA 5GALA 4XW3A 1ND2B 4LORA 4YW4A 1HRV3 1LOFA 1BVP1 4HK8A 2RS52 1YHFA 5KXBA 3GZUC 1UW8A 3CO2A 2NM1A 2QQUA 4R9DA 2CDOA 2XJTA 5FLIA 4MGYE 4COZA 2BUKA 2IXIA 4FPGA 2XUEA 4Q4W3 4PIYA 3SH4A 2Y34A 3SEPA 1DQ1A 3TYJA 3AX4A 2P2KA 5FMOL 1XNKA 3CLPA 4GMP1 3FFQA 2HEYF 5JXIA 2I45A 3LF7A 1BEV1 5D1IA 3J7NA 5CFCA 3VD7A 5K7PA 3R4DB 1WBLA 1ULDA 2DFCA 4FXGB 3AP4A 3ZR5A 1IS5A 2YUEA 3WOGA 1VRBA 3GBFA 1RTVA 5LEKA 4LKDA 1QU0A 4LBKA 5FKCA 4R52A 3VDBA 1W8TA 1ASJ1 3LCPA 1H30A 1HLCA 3KHBA 4P9WA 1PGL1 2ES3A 4NMIA 3I4IA 4DFSA 3BIEA 2C0ZA 2DVGA 2VW2A 5BXXA 3AYCA 4FPOB 4Q0VA 4D94A 1ALYA 4W50A 1IPKA 3MHZA 1W9FA 2ZGTA 2OIIA 1Z7S1 1WMXA 2Y38A 3ITQA 3TN92 3RWNA 2HBUA 5DPNA 3W59A 4RFT0 2VUDA 5DDJ2 2XJQA 5BPXA 4MGIE 5AC91 4OI2A 3VLBB 4E2GA 5FMDA 1UNBA 1TMF1 2Q1MA 4CDQA 3E6BA 1JYXA 5E89A 1QOTA 1KQRA 1CZSA 2GC1A 2VO5A 2ZMLA 4XTMA 3RI9A 3U4SA 1N3PA 3GZAA 4PLMA 2WKKA 4Y20B 1F8VA 4A2UA 4R9BA 2P1BA 4RS5C 5C9AB 4AGRA 2G19A 3I97A 4YZ3A 1NCRB 3HQUA 4DS0A 5FMCA 2PHDA 3NRUA 1LTEA 1BBT2 3WNOA 5IFPA 4XQDA 3SHRA 2GNTA 3WP4A 2WNOA 2ORZA 1ND3C 1HQNA 3GHNA 2R0FA 2ZABA 3PVBB 4B7KA 1HRI3 1O3QA 3HEIA 2VQTA 2FCTA 4XABA 5ABJA 2D3RA 2VQAA 3UL2A 3VKFC 1L7QA 2P3KA 2VVDA 3I3EA 3JZVA 4K20A 1VALA 2XXZA 2I2SA 1H4HA 1LEDA 2CL2A 1D2SA 3ZFEA 3CMGA 1GOGA 3RDIA 4LLOA 3TEZA 3DL3A 4DXSA 5IWFA 3MF9A 3OPWA 4B4QA 4B4RA 2CAVA 4EWDA 1FATA 4LITA 1GZCA 1GZTA 3ON7A 4HN0A 4AG4A 4W4ZA 3M70A 1ULEA 3I2FA 1LECA 4SBVA 1UXZA 3OBAA 3VZNA 1VJ2A 3T2PA 1W8NA 2ZEZA 4KG0A 3T4HB 1DCSA 3UKVA 5FYVA 1YQCA 5LBCA 2ZX1A 2Z2SB 5IVEA 3THTA 1VBC2 2TUNA 4K21A 1US2A 3WHUA 2VBPA 2GN7A 2JD4A 3JQWA 5JIAA 2VNRA 2YY1A 1W6PB 4COYA 3C7OA 3OY8A 4O9GA 4CEWB 2J1VA 1K12A 2WZ8A 3N9MA 3NVCA 5C4WB 2EIEA 3J8F3 3BTYA 5F37A 3I3DA 4IV1C 5LRSA 4LT5A 3PNAA 1C28A 1JI6A 5FWEA 3USSA 3I49A 5JDBA 2JG8A 4P9LA 1UPIA 1HJFA 4Z07A 2FDIA 4QX5A 1MZ6A 4OYUA 3DCQA 2IVIB 2EXIA 2DWRA 3DYOA 3O5SA 2HWF2 1ZZ8A 3CU7A 4D69A 1VPHA 4UBGA 1JYNA 2AEYA 1PGW1 2W1QA 3ORJA 5FV3A 3WCSA 1QEXA 3WP6A 4CUGA 3VD9A 1COV1 4FFGA 1QNWA 1N3QA 4JDOA 1F15A 4OUEA 3POSA 1TNFA 4K8RB 5FYZA 2GNDA 3JU9A 4LIVA 4NO4A 4AK3A 3KSCA 4HANA 4KWUA 3WNNA 1XYPA 3FL7A 3VB9A 3VHOA 4E4SA 4ISRA 5AVPA 2A5ZA 4IV3B 3NMBA 2VNVA 1RJ8A 3EB7A 4OVEA 4QPGB 3U78A 4D0QA 4ISQA 5EYXA 4DNYA 5FPVA 5GZFA 4LPLA 2A6XA 3OGVA 4XZPA 2WNVB 5I0UA 2C1FA 4UW5A 5KHHA 1HW5A 4Q4X1 4XCBA 1OSGA 2VOXA 4RR3A 4Y22A 3I7DA 2VOKA 4Q27A 5A7OA 4RGAA 2XL7A 4K7JA 4LOTA 5J37A 1VBB2 2D3SA 2Y33A 4QXBA 2HWC3 4O61A 4ARXA 2ZOEB 2AR6A 2ADDA 4GZ9A 4E2SA 4OFGA 4XQWA 1RUE1 3QLQA 3LQCA 1R093 1JZ6A 1PZ9A 1E5IA 2XJSA 1QWRA 4P00B 1QJU1 1UY4A 1BMV1 1ONAA 4CXXA 1SCRA 2ZHLA 3AZWA 1RUC3 2X29A 3OBTA 3ZMOA 2WAAA 2EVXA 4ZXKA 4Y5SA 1GNYA 4QB6A 3ZYBA 4FTEA 5H9QA 4F8AA 1IKQA 1UOGA 1AL23 1UY2A 2WNUB 4UFJA 1D2QA 4CP2A 3NJZA 2DU0A 3GF6A 4UFLA 1RUNA 3OBZA 2WZPP 2A73B 3KVBA 4BLIA 1U5IA 5LRRA 1AXYA 2WBKA 4B8EA 1JOBA 1J3PA 2VOVA 4JDMA 4OZXA 3SNMA 2BU9A 2PHLA 2E7AA 2FDJA 3T0BA 1TME2 4GALA 4QKBA 1BXHA 1W8ZA 3C7HA 1PX4A 3A23A 2UWBA 5FR3A 4HSLA 1JODA 3RZLA 2D6PA 3B94A 3WHTA 2NYYA 1H8TB 2YGLA 4Q4V3 1DZTA 1XU2A 3H8UA 4MVTA 1LKNA 4OUSA 4A3XA 4Z8BA 4LE4A 3OPTA 2NMNA 2WZEA 1GQGA 4AL9A 3RZMA 3K3OA 3H8OA 1ZBA1 4AHWA 2YYOA 3OYWA 4FP2A 4IQPA 5ACA2 2OUJA 1Q8PA 4LOSA 1J58A 5C3PA 2PAEA 1W0PA 2VOTA 4UW6A 1P8JA 1MS0A 4AI9A 5AFBA 3GGLA 1DYPA 3ME2A 2DF7A 3V64A 1OD3A 3DUIA 4JHTA 1OURA 3HD8B 4EN9B 4CPBA 4OZOA 1IS6A 1ENSA 3GBGA 1D4VB 3LA2A 1MEC3 5G05L 2V4AA 4XXAA 4UWDA 4JQTA 1UX7A 3H42B 4RS5A 5FYUA 4NN0A 3C7FA 5FO8B 2VUJA 4BK5A 4EN0A 1KJLA 1O91A 1JW6A 1ZZ9A 2ZTNA 1MS3A 1PO22 2BFUL 3AP6A 3FC0A 3WVJA 1ND3A 1YQ5A 2WABA 3AYDA 3HQXA 4NRMA 5FQ0B 5JSRA 4IETA 4K6BA 2C26A 4H2AA 3TEYA 1HXS1 1BHGA 1OPMA 3ZXLA 5B4NA 2VL4A 3VBRC 2P3YA 2R061 3ROUA 1W6MB 1IOAA 3WX5A 3VBSB 4PDWB 2QCSB 4DUXA 4W6YA 3DEMA 4URTA 4AAXA 3MIEA 3WINE 3OGGA 3E5XA 3DV8A 1HRV1 2J7MA 4Q8KA 1JYIA 1SQ4A 5SV8A 2RMU3 3DN7A 1NCRC 1FMD2 3QOPA 3D4KA 1RINA 1XNBA 1YQ6A 3DPRB 3PLQA 1IQDC 5FY0A 5GLWA 2PMWB 3AYEA 5FZ9A 2ORXA 2I74A 1Q8OA 2JB8A 2QUOA 4LO8A 2IWGB 3THCA 1N47A 1S0BA 2MHFA 3BU7A 4Q4W1 5CKQA 3O1SA 2ET1A 3VHNA 1MS1A 4U2AA 1BK1A 2UURA 1B35B 3MICA 1J3RA 1RHI3 1YFYA 3SKVA 4D7TA 3BTZA 5JZGB 3AP7A 3ZMNA 2RS13 1SZBA 2RR13 1IPJA 3WW1A 2JECA 3KCCA 2OS2A 4R4ZA 1QJX3 3S57A 1W2NA 2WSVA 5FYSA 3HBKA 2VZUA 2RDQA 5FZDA 2WFPA 3WG3A 1HB2A 2ZX2A 2JDPA 3GYDA 4KBBA 3AKQA 1ZBE2 1JBCA 2AZ5A 3L2HA
chains in the Genus database with same CATH topology
1AR92 4IV1A 1APNA 5BNPC 1SLLA 2BYVE 2JENA 4ITCA 2W08A 4OLLA 2B8MA 3IPVA 3ZXJA 1AR72 1AYM1 1S0CA 2ZCWA 3OD0A 4YM3A 3H50A 2VQ0A 2XLAA 2JICA 4XDQA 2LALA 2FHRA 4QHBA 3ZIXA 1BZWA 3EO6A 4FBFA 2PN5A 2QJVA 1QQP3 3P3NA 4FTSA 3MW2A 2AENA 2VMIA 1QJY3 4JCKA 3FJSA 1HRI1 3D0JA 3O0VA 1QXPA 4M3CF 2OW4A 1WCDJ 2UWCA 3HMYA 1B09A 2Y0OA 2WQZC 4FOVA 2CNAA 3NAPC 4AEMA 5T5JA 2ZHKA 1IHMA 1RUJ2 4TYSA 2O8OA 4XJ8A 1AVBA 3JBG3 2H6CA 4FOQA 4LBQB 2WC2A 4IV3C 2JEMA 4FPFA 5HBAA 5E16A 3D6EA 2VY0A 1UX6A 4BQ1A 2QKDA 1HQWA 4QGLA 2PHWA 3TB0A 4PIZA 4KGGA 5I0RA 3R6SA 5GM0A 2PHRA 3NSTA 3ZFGC 5KC6A 1Z7S3 3O0XA 4XFHA 2O0OA 4FT8A 3VZMA 3M3CA 4RSUA 4CDXB 5GLTA 1MS5A 4EV0A 1TMF3 4P9GA 3GBWA 1UD1A 3AM2A 4EWEA 2R043 3ES4A 5CBLA 1MACA 3V0AA 2OZ6A 1UU6A 1NA1B 2QFEA 1Q8SA 2RHPA 3ZN4A 1RITA 3EQEA 1LESA 3B9CA 4XIKA 2MPFA 3ZSMA 1ULGA 4J1WA 3ECQA 3J8F1 4Y5Z0 1U0AA 4HK9A 5DZGA 4FAHA 1I1EA 5L7OB 3VL8A 3VKOA 4JRAA 4Z82A 3VGIA 1RGSA 3APBA 4Y1YA 1XNDA 4L99A 1BKZA 1HDKA 1CD3G 1SLTA 1DGRA 3PVEA 2OA2A 4Q29A 1VBD3 3MF6A 4U36A 4HZFA 1LCLA 4I01A 3LA7A 5A3MA 3PVOA 1D4M3 2A6YA 1UKGA 2PYTA 3NO8A 5C8CB 3MLJA 4AEJA 5FMOS 5HCFA 1ASJ2 3WQ1A 4OHYA 5I0TA 1OD5A 4YG3A 1X7NA 5FBZA 1KS4A 2RJLA 2W0XA 2ZZJA 1QDOA 5CG8A 3DKWA 1PGL2 4XBLA 3VN4A 4BIOA 5L36A 1KDKA 2GMPA 1VLNA 4J1XA 2H0VA 2ZGQA 1WLTA 2X53S 1O4YA 4AFMA 5CFCC 3C2UA 4FQZA 4WM8B 3SLIA 3KB5A 2HWB3 4YM2A 2IXCA 5AC92 4G4FA 5J96B 1N1VA 1G9BA 3VBRA 4BZ4A 1QNYA 4Q0UA 1R091 2NZ9A 4E27A 1NQDA 1V6LA 2WSUA 4Y20A 4GXLA 4XQ4A 5GZEA 4LE3A 4N53B 3MPPG 1Y3TA 3ETQA 1RUC1 1NCRA 1V6KA 5GZDA 4XF9A 3CJIC 1WW5A 4HPKB 2CYFA 1V9U3 4BMBA 1HKDA 1AL21 1OOPB 1C8M2 2OUHA 3H7JA 3QH7A 1AR61 2ZAHA 1TNRA 1FV3A 3HBZA 3VHPA 3WZ1A 5LK7B 4MLOA 5B2GB 3WD5A 1KJRA 3J26N 1EY2A 3HT2A 1O7FA 4JGYB 4FCAA 1EV11 2OVUA 1NYWA 2P3IA 3N4MA 1H1AA 4XETA 3L2YA 2PTMA 3SITA 5FDBA 4CTEA 1HV0A 3DPRC 2V5YA 4XFFA 3WR0A 1LULA 5FTTC 2DVFA 1VRH2 4Q4V1 2FZ2A 3EHKA 1YFUA 2C5DA 2WL1A 5BNPA 1UL9A 2PHUA 3FLPA 1EPZA 1GV9A 1SFYA 1BQPA 1B35C 1H8VA 2TBVA 3JD71 3PHMA 1C57A 3AK0A 5JZGC 3KT4A 4QPIC 3HAGA 3LAGA 1RJ7A 3MLLA 5EV7A 1RUF3 4NWWA 2UYAA 3AP9A 5I0SA 5K0UB 1MEC1 3ZN6B 3OD4A 2YHJA 2QZ2A 1W6QB 3VHRA 3KQRA 4KQ7A 4MZUA 2GDFA 1PVC3 2R0HA 4AHYA 4CEYB 3MLKA 5KXDA 4XMIA 4IL7A 1A3KA 1CESA 1RUI3 4YVSB 1AR81 1CAVA 1JHNA 1W6OB 2ZHMA 2QQPA 2IXHA 4BHPA 2F4PA 4YW1A 5CVRA 4V1PA 2UWAA 3R4SA 2JX9A 2XLGA 3KCXA 3OBRA 2XJVA 1A8DA 1COV2 4DY5A 2XUMA 3MFAA 4I2OA 2WA4A 1D0GA 2B46X 1PZ7A 2VH9A 2Y0IA 2RMU1 1FX5A 1SCSA 3GNEA 2EXHA 2ARXA 4IV3A 1KXGA 3MIGA 4XFIA 5GLUA 4FOWA 1WCKA 4QPGA 1AYN2 3WDUA 2A75A 3ZO0B 2DCTA 2WNVA 3AKTA 2PHXA 1LENA 1RHI1 2RS53 3BCWA 2RS11 5BNOB 1V70A 2RR11 2GNMA 2ZGMA 3B7MA 2JG9C 1G9FA 1XRUA 5F5QA 1VBE1 2DUPA 5LEJA 2R16A 1DGLA 4UW3A 4B7EA 3HIFA 1QJU2 3KM5A 5F6LB 1BMV2 1RUD2 3RYKA 1SACA 1OA3A 2GZWA 1KFUL 2UY8A 4N90A 1VAMA 2JDZA 4CDXC 4QMAA 1H2KA 3D8CA 4RHV1 1EAH2 4LEJA 4XOGA 2GC3A 1NA1C 1G7YA 4YGCA 2PLV1 2ZGKA 4QU2A 2VECA 5JVVA 2XJUA 3N7LA 1Q43A 5I8YA 2R1DA 2DV9A 3VZKA 1QQP1 3MFCA 4FPCA 4XFCA 3S6PA 2BNMA 5JOZA 1MZFA 4IEVA 3KZ4C 3I59A 1QJY1 5L7OC 2DFBA 2KM2A 4XHXA 2VPVA 1H8TA 1UF2C 3NV3A 4N7UA 1AXZA 5BUVA 2K0GA 2MNGA 3HN1A 5DZEA 4BMEA 5JWPA 4CDUB 1MVQA 2CGNA 5BNNB 2YXSA 4KWKA 4Y1VA 1G8WA 4YNIA 5C8CC 3JBG1 1X36A 2GSYA 2WFF1 3VZJA 3WW2A 2WS92 3AMMA 1WUVA 4GWNA 1RB8G 4Y1XA 1GKBA 1SLBA 5SV5A 1C8NA 1XE8A 1N3OA 5KHJA 1WLWA 3OGJA 2CTVA 1U12A 1C4RA 1Z0HA 1DHKB 1GYKA 2XVKA 4XFAA 3CJIA 1AYM3 2YZ4A 5A32A 4AW7A 5FQ0A 1CAWB 1SDWA 1YRZA 3IWZA 2EAKA 4WM8C 5KWRA 3BTAA 2R041 1HXS2 2W68A 2D44A 4YM1A 2R062 2QDRA 4KU7A 3AP5A 4X6QB 1FNYA 1R1A3 2BFUS 4META 3VBSA 3ZFFB 2RS31 4XYXA 4Q0QA 1YFXA 2YPJA 5A33A 2ZAAA 4QQOA 4N53C 3H1MA 3DPRA 4Z2WA 1F31A 4KH9A 4C1WA 1AX1A 5EWSA 3U4XA 1ENQA 1OFNA 3FX3A 3KT7A 4MX3A 4DQAA 3INAA 1CAUB 1B35A 1NLRA 1NXMA 3KGLA 5JZGA 4QPIA 1KS5A 1VBD1 3ZSLA 1QHDA 3SCFA 3CF6E 4AGVA 2D5HA 1PM7A 4Y26A 1D4M1 2GN3A 3V0BA 3I8TA 4MH0E 1WW4A 1AF9A 1POV0 3AB0A 1V6NA 4JDNA 1YIFA 4DMIA 3ES1A 1DQ2A 1O4TA 5BY5A 2BGCA 4P9JA 1POV3 3WV6A 5HI0A 2ZKNA 3G6JB 5K9YA 2A71A 2HWB1 3SMHA 1ZNPA 4LA2A 1N1SA 4OI4A 1OI6A 1GZWB 2HWD3 3E5UA 3AFGA 5C6CA 3LKJA 5BV6A 3OF1A 5D8AB 4FOYA 1VIWB 1DQ4A 1SLIA 4DZGA 4CEYC 2B5HA 1NE6A 3FBYA 4PCRA 3ENRA 1F5JA 4JGZC 4YVSC 1RUH3 4FXKB 2RM22 1CX4A 4QM9A 3WY6A 3BPZA 1NY71 1V9U1 1REDA 4YM0A 3CEWA 1HRI2 4AI3A 2GC0A 2WQ4A 4HKWA 4XF3A 5E1RA 2XHKA 3TBDA 2DURA 4M3CE 1YLLA 5HCAA 1KFXL 1V6MA 1DGRN 3IIAA 4QQ2A 4AQ6A 2XBO2 2JG9A 4LTAA 2WT1A 4LBOA 3AZYA 1ZVFA 1R082 3GHMA 3FUQA 5GLZA 3ZXEA 4MXWB 3PTYA 1OA4A 1V6OA 3FHIB 4R8HA 2NP0A 4FP3A 2HKXA 2GMEA 3MIFA 1TME3 3NV4A 3E5QA 4LHLA 4L97A 1CN1A 1X33A 2XKPA 3ZIWA 1MQTB 2TEPA 1I6XA 4A7KA 4IEXA 4K8FA 5BNOC 1Q56A 5JR7B 4ATEA 4CDXA 2FZ1A 2XKOA 4YG0A 4AVTA 4BYYA 1RUF1 2ZX4A 3ACLA 4NHKA 4AEDB 1NA1A 4M3CB 1FNZA 1LOGA 1PO11 3JCIA 1S0JA 4W6WA 2G9FA 2LUWA 3SXWA 3J8F2 4AI0A 1PVC1 2RE9A 4D3WA 3S7EA 1NZCA 5CNAA 2PHTA 1CGPA 3WDYA 2P37A 5L7OA 1RUI1 5IK4A 1CJPA 1AR63 1QY4A 4I3GA 4XE9A 2WA3A 1S0EA 3ZXDA 4MSVA 1RVF3 2WT0A 3DGTA 5CIRA 3M3EA 3VKLA 1OLRA 2F6BA 1EV13 2D5FA 2XJPA 3ILFA 3J4UH 3U07A 3W9AA 1G86A 3FE5A 1ND2C 3VDDB 2FMDA 4OHVA 5CFDB 4RQPB 5H9PA 3M1HA 2O1QA 3FLRA 4YLZA 5C8CA 2XPJA 2A7AA 3R4UA 4XXPA 1FOD3 2N7GA 1AZDA 3FUOA 3FWEA 3UKTA 3ZXGA 1UAIA 3GALA 2VVEA 1XXNA 3LB9A 2BPA2 2IXJA 4AXOA 3JD73 2C9AA 4EROA 3M3IA 2AYHA 2RS51 4I0WB 4CDUC 1J1LA 5DG2A 1GQHA 3IMNA 5BNNC 4WM8A 5JSOA 2BBVA 1LU1A 1ZA4A 4AYUA 2HWC2 2K2SA 1BJQA 4AFDA 3V65A 4MGZE 1R092 1T6GC 1M06G 4HVOA 4IEUA 2PAMA 2ZKLA 3UKNA 1W0OA 3RMYA 4M01A 4FPHA 1YJLA 3UV9A 4C90A 4N53A 1AR83 5JAXA 1RUC2 1RMU3 2PELA 3TRSB 3TOJA 4ZU7A 3EBRA 1ZRCA 3B02A 1LJ7A 3WDWA 4QXKA 1VAVA 2GAUA 4HPKA 1FPN3 2ET7A 4L9BA 2E51A 1YCIA 4GB33 1AL22 3ZYRA 4BCUA 3LOBA 1ZBE3 3ZSEA 3SH5A 1S55A 2ZMNA 3LWCA 4WBBA 2E63A 2PAKA 1J3QA 2Q5TA 1CAXB 1VB4A 1Y43B 4HFSA 4AQ2A 1QGLA 2RJKA 4EN6B 3ZFFC 5C9AC 3EXUA 1NE4A 1PGSA 1ZYBA 2YMZA 1DDLA 2R30A 4K1YA 3TN91 3AXEA 5F1RA 1PK6B 2DTYA 2ZX0A 1DQ6A 3WP3A 1H1MA 4WVMB 4X8PA 3NV1A 1V6IA 1SEFA 3JQXA 5JSPA 2DVDA 1HV1A 1AHSA 5L19A 1QMJA 3RYRA 1PNGA 3ZYPA 1BBT1 1UZYA 1VBE3 2X5IB 1AUYA 1GNZA 2WZR3 3AKSA 4WV8A 3WQ0A 1AX0A 2AUYA 2BVBA 1MEC2 4XTPA 3ST7A 3MEPA 3ZN6A 4XF1A 3B5LB 4BIFA 1W6QA 1JOJA 3BB6A 4PLNA 1ZZBA 3OJBA 1S0DA 3AFKA 1EYBA 1OMIA 1NOVA 4LO5B 4BWOA 4CEYA 2G4IA 2GC2A 1UPSA 1RUJ3 1LB2A 4JGZA 5F6KA 4DINB 4YVSA 4FPKA 5DG1A 4RHV3 4AQTA 4LHNA 1OHFA 4DXZA 3R0RA 4H55A 1LOAA 4LUMA 5KBFA 3RJRA 2PLV3 4LULA 4CEWC 2QNKA 1LODA 1ZREA 5C4WC 1R1A1 2A6WA 5HCBA 4XFGA 1JTZX 1YIPA 2B42B 4H7LA 5D8AC 1WW6A 3KLSA 3U0ZA 3BIWE 1VBC1 3A4UA 2ETEA 2B45X 1WGPA 3OY8B 1H1IA 1VBA3 3JB8A 2CV6A 2OPKA 4BM8A 3C3VA 4PBPA 4IEPA 4ATFA 3MI8A 4C0HA 1RHI2 2CWMA 2ZGNA 4LLFA 2RS12 5BNOA 4QPYA 2JG8B 2Q4SA 4YARA 5T54A 2WFF3 1PIV2 2AGSA 2BNNA 3B01A 1QJX2 3JB4C 1MS9A 3VBHB 1DFQA 3VBUB 1HIXA 4WVWA 5GZCA 5LK5A 4QPGC 3VZLA 3FMGA 3O14A 2NQYA 2ZGOA 3ZYJB 4FTBA 3VBOB 2O8QA 2DTWA 4Q1PA 2WNVC 3NKTA 1LHVA 5JOXA 3MIBA 1ZRRA 2Q0AA 1OA2A 1WMFA 1POV1 4GA9A 1NCQB 4AFAA 3RZZA 3MDPA 2HWE3 1YJKA 4DPNA 2VULA 3IM0A 1C1LA 2JE9A 1IZ3A 2RS33 4CZSA 2HWD1 2WLQA 1FI2A 1ND2A 2E9QA 4RR3B 5GKAC 1ZZCA 2TNFA 5CAZA 1G6NA 4N7IA 5J98B 1REEA 1KRIA 4HLTA 1J59A 3P3PA 1RUH1 2WNUC 4PQ9A 4ZU4A 1ZRDA 1KDMA 3AKPA 3WG4A 5BYNA 4G9SB 3S7IA 1UN1A 3O7OA 4KU8A 1BEV2 4CDUA 4PLOA 1XU1A 5BNNA 5F9TA 4MGKE 4HMZA 1RC6A 1I3HA 3M3OA 4IERA 2PQQA 3A0NA 4COUA 4RQPC 1C8M3 3CJXA 4NWVA 3JBG2 3WXPA 1H8TC 2JKBA 4YVWB 5C8WA 1G9AA 2DCJA 2CGOA 1U5ZA 1X82A 4YZ5A 1CIWA 3S30A 4ES9A 2Z42A 1TME1 3WCRA 2WNEA 1Z7S2 4CRQA 2VOWA 4TLFA 5I91A 4Q0SA 4IESA 2NLRA 4XHBA 3DF0A 1CAWA 4AE2A 1TMF2 1WMEA 2BW8A 5FFOC 4YZ4A 3S0MA 1YI9A 4S2GA 1C3HA 5L73A 5ACA1 3ZFFA 1A6CA 3N7MA 5C9AA 1JXNA 4WM7B 3MW3A 4OULA 1X8EA 2P3JA 1RUG3 3AZXA 4I30A 2ZPXA 4QGNA 1RL3A 1LGBA 4DY3A 2XVLA 4YW3A 1RVF1 4R4XA 4RS5B 1QJZA 2HEVF 4IEOA 4D7YA 3VBSC 4PDWC 4XJ9A 2VNGA 3AMNA 4NVPA 3O12A 4DB5A 2VW1A 4IEZA 3FZ3A 3LGRA 4E2QA 1E57A 1O5LA 1U5XA 2VMHA 3URFA 4X6RB 5I8TA 1PK6C 1FOD1 1LGCA 2CWSA 4F3JA 2AREA 2LM3A 2BWCA 1LU2A 5FPZA 3ILNA 1CVNA 3IKWA 1W39A 4W6XA 5T5OA 1EPWA 4J6GA 1RUOA 4YGEA 3ZN5A 4Q4Y3 1QXJA 2H6BA 4XJWA 5JPMB 5IUQA 2A6ZA 2HWB2 2D6OX 3VL9A 4C91A 1PO13 2CAUA 2R49A 1W6PA 4CEWA 2HJIA 5C4WA 1LHOA 4XF0A 3FLTA 3QH6A 2BTVC 3I54A 5D8AA 3M4FA 2MEV3 3B93A 4Q0PA 2R32A 1RMU1 2QZ3A 2ZS6B 2ZGSA 4UBHA 4BLJA 1L3JA 1VP6A 1X8MA 2JXAA 3KMHA 3ZSJA 4B29A 4YGBA 2A3YA 1FPN1 4RL7A 1NY72 1V9U2 1JN2P 4GB31 2BQPA 1PGW2 3H3ZA 1ZBE1 2H0BA 4AVAA 1RUD3 4YFWA 1C1FA 3RQ0A 4WZCA 4JVAA 3PJQA 1O4ZA 3WQ7A 2EF6A 1VR3A 4IEYA 5JMCA 4IEQA 4HSJA 4HL0A 5IT6A 1BVVA 4RGGA 1EAH3 3VV1A 4KWJA 4Q8LA 5FAXA 2PHFA 4M0NA 2R073 4MXWA 1FAYA 2OYZA 2A3XA 2XL9A 2ZGUA 3PJYA 4Q4X2 2IFRA 3LA3A 4JV4A 3IDEA 2ZA9A 5BNQA 5EXOA 5J3UA 1CPMA 1GSLA 2VNOA 2ZGLA 3BOPA 1RUE2 1MVEA 1RUF2 1SFNA 2WZR1 2FBEA 4XFBA 2A6VA 1AJOA 1ZX5A 2FQPA 4M3CA 1ENRA 5I8SA 3ALQA 1DGWX 4W65A 5FREA 4EN8B 4YG6A 4P9XA 1OPOA 3D82A 3KS7A 3WUDA 3Q9OA 3VBOC 1C5HA 1K5MB 1ULFA 3ELNA 1RUJ1 1LHUA 2EA7A 4HVRA 2WNUA 4M0HA 4YGDA 4IXLA 3VZOA 2WS93 1MZ5A 1NCQC 2GU9A 5TSWA 3WG1A 3T1LA 3QBQA 3M8LA 1PVXA 3PMSA 4AVSA 4B3NA 5DZFA 5IK7A 1WA4A 3TN93 1XNCA 1F2NA 4OHZA 4BH9A 3VDDA 5DDJ3 4AFCA 1TE1B 2B7YA 4OI0A 4RQPA 3VKNA 1ULCA 5FRAA 5J48A 3ATGA 1LRHA 4C0BA 5IK5A 5CADA 3AYAA 4NPRA 5EZWA 2XWBB 3LOIA 4KWLA 1M4WA 1ZBA2 5DUWA 3PVNA 2XJRA 4SLIA 4LBLA 1VBA1 1N1YA 1PMIA 1VAKA 1BBT3 2EXKA 2X8KA 2NMOA 3M2MA 4Q1RA 2VXRA 1QDCA 1ENXA 1U5YA 3NKGA 4YZ2A 1DYKA 3VUOA 2ZBJA 4N43B 4YVWC 4FSJA 1QXRA 3KGZA 2JE7A 4FAGA 2B39A 3UJOA 1S2BA 4NR1A 4LUKA 3D0SA 4B4PA 4PJYA 3ZX7A 3TAYA 5JOYA 5EYYA 1W6MA 1H9WA 2HWE1 4XJUA 3WLUA 2SBAA 4PDWA 3FBMA 1CAXA 3M7AA 4GKXA 3MZHA 2XWJB 1FYUA 1HRV2 1OQDA 2DCZA 3H9AA 5H9RA 1TEIA 3ZVXA 1VBC3 3L9JT 2V09A 4WM7C 2D7FA 4TWTA 4QD2A 1QKQA 1XYNA 5J7MA 1PK6A 1WMDA 2CGPA 4LHKA 3VBRB 4GKYA 1PNFA 4AWDA 1OOPC 4XF4A 2EAAA 4WVMA 4Q4W2 4Y1UA 1GANA 1IKPA 3MPBA 5T52A 3POYA 1S0GA 2VW0A 3B69A 4K1ZA 3USUB 2D97A 2WINB 1O5UA 4JGYC 1XYOA 3MW4A 4HBNA 4N9HA 2G9GA 4LBNA 2RM23 2X5IA 1SLAA 2HWF3 4QM8A 1YUDA 1C8M1 4LR4A 3HT1A 2IXKA 1H2MA 3WDTA 4JTOA 1DQ5A 1CQ9A 4GQ7A 1SBDA 1CR7A 4LBMA 3HWJA 2QDNA 4KG8A 4RD7A 2XBO3 3WNXA 4JTNA 2D6KA 4YW5A 4FO9A 3WDVA 3B00A 3MIHA 1AYM2 4FPYA 1R083 4NHMA 2D6NA 5GJ6A 1S0FA 1F5FA 4XILA 1PHMA 1VRH1 1AL0G 4QT6A 5AVAA 4CDWB 5BNPB 5K0UC 4LO6B 1SMVA 2YROA 3TNPB 1Y9QA 2DUOA 4AHZA 3N7JA 1R1A2 1O3RA 1VBB3 1H0BA 1GLHA 1DG6A 3KD4A 4AI1A 4HN1A 4H3WA 4GH4B 1RUG1