3OEAA

Crystal structure of the q121e mutants of c.polysaccharolyticus cbm16-1 bound to cellopentaose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
146
structure length
146
Chain Sequence
b'SHMVNMVSNPGFEDGLDSWQDWQQDMSAVPEAAHNGALGLKIGGGKAAGGGQDIPLKPNTTYILGAWAKFDSKPAGTFDVVVQYHLKDANNTYVQHILNFNETDWTYKQLLFTTPDVFGSTPELALWKGDTSKANLYVDDVYLVEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-layer associated multidomain endoglucanase
publication title Mutational insights into the roles of amino acid residues in ligand binding for two closely related family 16 carbohydrate binding modules.
pubmed doi rcsb
source organism Caldanaerobius polysaccharolyticus
molecule tags Hydrolase
total genus 28
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3oeaA00
1NKGA 1JZ4A 1PMHX 4A6OA 3T2QA 1JYVA 1JYXA 3VDAA 1OF4A 4XUTA 3DYMA 4GZ9A 2BGOA 4MO3M 4ARYA 3F2ZA 4XUNA 2QQJA 3T09A 5EIYB 4IUGA 1UWWA 2VO5A 2VZ1A 3A7QA 1JZ5A 2E31A 1PX4A 2C4XA 4BK4A 1L7QA 3A23A 3MV11 4QAWA 3EB7A 3GXUA 1JZ2A 1R64A 3NQHA 1MPXA 5JR2A 1F4HA 3C7HA 4CUBA 2DCJA 3WF0A 1UXXX 2VZ3A 1GOGA 5A1AA 4JX0A 2X09A 4KI5M 2W91A 4A42A 5IYYA 3CDZB 3T08A 3C7GA 2Y64A 2J7MA 4PQQA 1TG7A 2EIDA 4ZZ8A 1JZ8A 1JZ6A 4YPJA 3PUIA 1SG3A 1GU3A 2QQNA 1OH4A 2VM9A 2E33A 3C7OA 3HN3A 2YC4A 4E8CA 4GWIA 2VZQA 2Z4FA 5JUVA 4FI9A 1NX9A 1UX7A 4BDVB 2VMFA 2V5DA 1UYZA 3T0BA 2DDUA 2ZXQA 4LPLA 2WO3A 1CZSA 1H6YA 1KGYA 3HEIA 3K77A 2RJ2A 2JE8A 3NRUA 2BERA 2V4VA 1XNAA 5DQ0A 2QQKA 3LEKA 5JXHA 2VZRA 2ORXA 3ECQA 2W95A 4M4RA 4P5YA 3K75B 3LEIA 1J83A 3MV01 3VD3A 5IHRA 2CDOA 2Y6HA 3PUHA 4QX1A 3D3AA 2EICA 4OYUA 1KEXA 3WNOA 5JXGA 4QX2A 4DXRA 4LHSA 1P8JA 5IFTA 2RV9A 3ETPA 3U37A 1JU4A 2WN3A 2VZTA 4UOJA 3ABZA 2VMDA 1ULOA 3LQCA 3IAQA 3OB8A 1O59A 1PMJX 3ACGA 2B4KA 4A3ZA 5I0DA 3LPGA 1UY4A 2ORZA 5JXJA 2W94A 2WYSA 5LCWL 3OGSA 2VCCA 3HJRA 2VZUA 3P1IA 4L0PA 3WF2A 5DPNA 1GNYA 3OGVA 4A41A 1UMIA 1L7RA 3FHAA 2QBXA 4UAPA 4A45A 1JU3A 3IB3A 3LPFA 4Z2AA 5JMOA 4DEQA 4MOAA 4W4ZA 1K45A 3T2OA 5HPOA 2XONA 5FUIA 3GDBA 3GGLA 2W1UA 4M4PA 2XOMA 4ZY9A 1OT5A 3ACIA 2WDBA 5EJZB 4D8MA 2W47A 2VTFA 3WNNA 2ZEXA 1K3IA 2QQMA 2WZEA 2WABA 4MGSA 3WQBA 1DP0A 4OUEA 5LA0A 1UY0A 1W99A 2VOTA 1JYNA 4QX3A 1ULPA 5DMYA 2YB7A 2EIBA 2WAAA 5EJ1B 4CU6A 4JKMA 2Y6KA 1IQDC 3BN6A 1UY3A 3C8XA 1XPWA 3W5NA 1O8SA 2VL4A 1DLCA 3K4DA 3WNMA 2VMCA 3DECA 4QDQA 1XC6A 3A21A 2W3JA 1NUKA 2PQSA 2VMEA 3DYPA 3I2IA 5B4NA 4RN5A 3K4ZA 2OKXA 4DUWA 4P00B 4ET7A 1UXZA 2VZPA 4DUVA 3FN9A 3CIHA 3IIIA 1W8NA 3OEAA 1T2XA 3CMGA 3VD5A 4UI9L 5F7UA 3T0DA 3MUY1 4QX0A 3THDA 3SKJE 4DXSA 1UYYA 4CVUA 3W5MA 1JHJA 3MBWA 2W92A 5C70A 3I3BA 1OF3A 2DCKA 4BJ0A 2XHNA 4XUQA 2W5FA 2X05A 2CDPA 2E32A 1CX1A 3IAPA 3JXSA 1NAEA 1JYWA 3C7EA 2LS6A 3NJVA 4MADA 1JZ3A 4DUXA 4GWJA 2WO2A 1OD3A 2VQTA 3CZUA 2RVAA 3HPNA 4W8JA 1CZTA 5B4XA 1HN1A 3I97A 4XZUG 3NNGA 2VR4A 3BGAA 2J1SA 4A4AA 3EYPA 5DN2A 1W9SA 2E26A 1J84A 1UYXA 3CZJA 3I3DA 4CU7A 2QQOA 3FHQA 2LW8A 2QQIA 4TTGA 1SDDB 2L9LA 2WO1A 4OMDA 3C7FA 2J1EA 3IDAA 1US3A 3SKVA 3FL7A 1PX3A 1K12A 4CUAA 1JZ7A 1UZ0A 1I5PA 3HNBM 2BGPA 3ACHA 2R7EB 4CUCA 4A44A 2VC9A 1US2A 1W8OA 2J1UA 2VCAA 2YC2A 2YFZA 2WZ8A 2J22A 3NJXA 4DEVA 2ZEZA 2HYXA 4KMQA 4XUOA 1GOHA 2VCBA 3T0AA 3UNPA 2Y6LA 2VZVA 1BHGA 2VZSA 1GUIA 4TXWA 1D7PM 1W9WA 2W1QA 3UESA 3VD7A 3ZM8A 4JKKA 5G04L 3LEGA 3DYOA 3HNYM 2XQXA 3SEPA 2QQLA 2WUHA 2Y8KA 3VD4A 3WNPA 1W9TA 1UY2A 4ZZ5A 3AC0A 2VQUA 1CIYA 3E1F1 5IFPA 4BXSV 1GQPA 2W46A 4QDSA 3WF4A 1JI6A 3I2KA 3I2FA 2BZDA 3I3EA 4PT6A 2WQ8A 4P08A 4E8DA 2V72A 3LE0A 5HXMA 1K42A 4LQRA 1YQ2A 3I2JA 3SEEA 3A22A 4JKLA 3VDBA 4CU9A 2W1SA 3I2HA 2ZEWA 3WEZA 3P6BA 1UY1A 1TVGA 1EUTA 2J1RA 4XUPA 2YFUA 4QB1A 2W1WA 3J7HA 4ARXA 4OMCA 5C71A 3CKHA 4QPWA 2WN2A 4XURA 1WKYA 3OBAA 1EUUA 4CU8A 3HOBA 2BBAA 2JDAA 1XNTA 3ACFA 2Y6GA 4QDRA 2KD7A 2J1TA 1H6XA 1UMHA 2YG0A 1CZVA 5JXIA 4QB6A 4KWUA 4D0QA 5LA1A 2VZOA 3WNLA 2Y6JA 4W50A 5G05L 1GMMA 3T2PA 2JKXA 2ZEYA 3OEBA 2HLEA 1WCQA 3MUZ1 4LKSA 3WNKA 3OGRA 4RYDA 2EIEA 3WSOA 1F4AA 4ZXEA 3WF1A 2WBKA 5J1XA 4DXTA 3UETA 2J1AA 1SHWB 3MO4A 2W9XA 3K46A 4OZOA 4BK5A 3THCA 5CZKA 5C7GA 1GOFA 2VJXA 2X10A 2W87A 3WF3A 4HG6B 3GM8A 3VD9A 2J1VA 3CQOA 4AG4A 1O8PA 1LNSA 1DYOA 5IJRA 2JD9A 3OG2A 5LA2A 1W0NA 4PF1A 4XVHA 2ID4A 3I2GA 2WAOA 5CYYA 4QB2A 2C9KA 4P02B 3VDCA 1RYYA 4JHZA 4MGQA 3K4AA 3HNMA 2B9VA 2C26A 4AAXA
chains in the Genus database with same CATH superfamily
1DYKA 3RRDA 3QOPA 4DOUA 1JYVA 2Y6FA 1HW5A 4RQPA 2DWRA 3WDXA 1XE7A 2NZ9A 5FYSA 3VKNA 4XUTA 1H0BA 4LHKA 4YGBA 2BGOA 3B3QE 4MO3M 1BXHA 5FUPA 5T5LA 4NPRA 3T09A 3C2UA 4LIUA 5BNNB 3JUUA 4IV3A 5CADA 2PLV1 3SCHA 3BI3A 4IUGA 1XJAA 4XBNA 1H1AA 3L2YA 3GJAA 1AVBA 2D98A 2VZ1A 4HK8A 1AYN1 1NZCA 1A8DA 4XQDA 3A7QA 2WNUC 1YHFA 3F95A 4C0BA 4BK4A 1L7QA 2QQWA 2MPFA 3WLUA 4BQ1A 5J37A 2H0BA 2R32A 4FQZA 3N35A 5FYTA 1GR3A 5EXOA 2PAMA 4TLFA 5GKAC 3VGIA 4CUBA 3IBMA 2DCJA 3Q8AA 2PHWA 3NNJA 4LKDA 3SCFA 3WF0A 4Q4W2 5CKNA 4OI4A 4Y3OA 2QVSB 5FP9A 4CSWA 1JOJA 1Q8OA 2BWAA 1ZBE2 4KI5M 5FYHA 4UXAA 3DXTA 3NO8A 4XZPA 1OUXA 3T08A 2JE9A 1W39A 3C7GA 5FY7A 2WT0A 4PQQA 1TG7A 1S2EA 3OCPA 1XNBA 2GMPA 1H2NA 1JZ6A 1VBC1 1UKGA 1VRH1 4YPJA 1BBT1 1DCSA 4Q0SA 2JG9B 2OUHA 4CP9B 3UT0A 1ENSA 1QQP3 2AGSA 2Y0OA 4GAZA 2BU9A 4MVTA 5FP7A 5J09A 5DUWA 3WT3A 5FMOL 4XIOA 3C7OA 3VBHA 4E8CA 2GDFA 3ZR6A 3ZXLA 2VZQA 2XXZA 2Z4FA 2JIJA 2ZHLA 5CU1A 1R1A1 1Q8PA 3OYWA 1T6BX 5JSOA 2I07B 5F5CA 1WD3A 5F39A 2R061 2GC2A 3KCYA 4QKFA 5E8AA 4BDVB 2VMFA 2V5DA 5I93A 3JD71 2EAAA 1GZCA 1WUVA 4JGYC 2DDUA 1ND2A 1ALYA 4COVA 3WDVA 2Q8EA 5JI9A 1BEV2 1X8MA 4XDPA 3ZKYA 1CZSA 2VQAA 1SLCA 1RJ8A 1NT0A 3ZXFA 4CEWC 1EAH2 1JZ2A 3VL8A 4PCRA 5HCBA 3R0RA 5FZAA 1PHMA 3N9PA 2IXCA 5A3NA 5A7QA 3D6EA 4A6SA 4LMFA 3ECQA 3ITQA 1C1LA 1X50A 4FQ4A 1H2MA 4P5YA 3RZZA 5FV3A 1J83A 1FNYA 4IEXA 3UK9A 2BPA2 3WHUA 5JOZA 4Q4V3 5FP8A 5A6XA 4PBOA 2Y6HA 2ZGPA 2JKBA 1QU0A 5GZCA 2NYYA 5KXDA 2EICA 2IXLA 4OYUA 3V0BA 1ZRFA 1RMU3 2K46A 3BPSA 3WNOA 3NAPA 3SH3A 3MHZA 4BMEA 1U5XA 2RV9A 3ETPA 3T1LA 5T50A 4NIHA 2FCTA 1LAJA 1CR7A 1IG0A 4B4QA 1H4HA 2P3IA 1EPWA 1IKQA 3ABZA 4HKLA 4BWOA 1F2NA 3LOIA 2Q8CA 5IVCA 4BMBA 2E6VA 4RL7A 3IAQA 2MHFA 5FOBB 2C0ZA 4FFIA 1PGW1 4RR3A 1A8MA 4DNYA 2VVEA 4LBQB 1LCLA 1IS3A 2B4KA 3JB4C 4YYOA 4M3CA 1ZRIA 5FYZA 1BKZA 2FDGA 1IPSA 5F6KA 3FBYA 4LOTA 1YNAA 2AENA 2HWE2 1I6XA 5BXXA 2ORZA 4D94A 4EWEA 2WYSA 1XNKA 4FOQA 4NHLA 4MXVA 4HETA 3HQRA 3WG4A 1ZRCA 1GP6A 3AP9A 4CEYC 4RA0A 1RUG2 3B94A 3ETQA 4XQ4A 4WVMB 3JQXA 4ZONA 5GZEA 4O65A 5J48A 5KHJA 5DPNA 1GNYA 2XMLA 1PVC2 3ORJA 1UMIA 1D2SA 5F5QA 2QBXA 2TNFA 1OA2A 5CEHA 2ZGRA 4I30A 3T4VA 1GWKA 4XC9A 5I8TA 5JMOA 1FPN2 1T6GC 1X36A 4J1WA 3WW2A 1BMV1 3MIFA 2QDRA 3IT8A 3WP3A 1Q43A 1RUD3 3ZX7A 4R9AA 2ZX4A 2R073 4ZS2A 4AHWA 3O1TA 1AL0G 3S7EA 5LW9A 1NA1C 3N9LA 4QXHA 2W47A 3KV5A 4QU1A 3NV4A 4FTSA 4COZA 4AEDB 2UYAA 3WX5A 2YROA 2GN3A 3OJBA 4FPYA 1Q56A 4Q4Y3 2WABA 1WLTA 4AGGA 2RS53 3AP7A 3OPWA 4Q4V1 4XF4A 1DP0A 3WQBA 3ZFEB 3N7JA 2SLIA 4B1MA 4QGLA 2AH2A 4GKYA 1PNFA 2AEZA 4PF5A 3ES4A 3POIA 4IEWA 1W99A 2ZKNA 5H9SA 4AFMA 5T3NA 5FAXA 1RMU1 2QNKA 2VQ0A 4LA2A 1ND3A 5FYMA 4AFAA 1OA4A 5DMYA 1O3QA 3JCIA 3P3NA 4CA9A 1Q8VA 1O3TA 1NXD1 1SLIA 3R4UA 4HKOA 3UJQA 3BOPA 1VPHA 1AXZA 2YV8A 1UY3A 1ONAA 1UNBA 4XCAA 5I0UA 3RPQA 2D3PA 2ZX3A 4YZ5A 1GP4A 1O8SA 2VL4A 1DLCA 4YGDA 1MEC1 4QDQA 1TQ5A 2IWGB 3K3OA 3ZYGA 3NKGA 4WVVA 4BZ4A 2DUOA 4WM8A 4HZFA 3DYPA 1Y9MA 5F32A 3AYCA 4EN8B 3HN1A 3VBOA 4NMIA 4LHNA 1VBC2 1ZZ7A 2FD8A 1VRH2 2RHPA 2VZPA 4J1XA 3CIHA 3ZXEA 2XJRA 1BBT2 5A1LA 5FYYA 3B01A 3WDWA 2DURA 5K7PA 4R9DA 3MZHA 1T2XA 3CMGA 5C8CA 1UU6A 4UI9L 3ZXJA 4AK3A 4N7UA 3T0DA 3MUY1 3THDA 4FOVA 4YFZA 2DU1A 4YVSC 4CDQA 2W92A 1CAXA 2XJVA 4L8QA 1R1A2 1RHI2 2MEV3 4E9KA 2YBPA 5JIUA 1HN0A 5LK5A 5FZ6A 4DY5A 2DCKA 3ROUA 5FZ4A 2TEPA 2XHNA 1DQ1A 4DMIA 2W5FA 1WCUA 2YGMA 2X05A 1RUD1 1VMJA 4B4RA 2E32A 2EAKA 3IAPA 3GZUC 1CPMA 1NAEA 1QXRA 3JXSA 1J1LA 4ZU5A 1NCRC 1TME3 2R071 1SLBA 4HN1A 4MADA 1FX5A 1PGSA 4YM0A 4CRQA 4XFGA 2WO2A 3GF6A 2PHUA 4K8FA 4YW3A 3ME2A 2Q0AA 5DZEA 1OLME 3GBGA 3AKSA 4Q4X3 1QJX1 1SCRA 4XZUG 3BGAA 4QPGB 1SACA 2ZHNA 3FE5A 3CJIB 2RS51 5C3QA 3RZMA 3U4XA 1Y9QA 2E26A 2WNVB 4E27A 3CZJA 3I3DA 4IDZA 2P3JA 1N3QA 2NMOA 4LBKA 3RQ0A 4MGTA 2Q4SA 4XXAA 1BK0A 3OGGA 4R9BA 5SV5A 2BNNA 2ENRA 5IK7A 1W6PA 3MIEA 4AVSA 2WO1A 1AL23 3IDAA 1ZZBA 4KL1A 3GZAA 3SMHA 3ZN6B 4RFT0 5EFUA 5F3IA 1AR93 2JG8A 1I5PA 4WZFA 1PGW2 1W28A 2OA2A 4A44A 1V6OA 2WIIB 1O3RA 3PMSA 3J8F3 3NV3A 3OPZA 1US2A 2J1UA 1H2KA 5K0UC 2P6HA 4CZSA 1ULCA 2VCAA 3BCWA 5JDBA 2VECA 5KC6A 3TEXA 5CAZA 2AYHA 4XJ9A 4CDUC 1NE4A 2LUWA 2WJSA 2J22A 1K5MA 2IXIA 1COV3 3MICA 3RZGA 1I9RA 4LO8A 4Y26A 4FPOB 5FZGA 1AX0A 1QQP2 2HYXA 2WNEA 1R093 2JDYA 1IS5A 4C90A 1GOHA 4OULA 2VCBA 5K9YA 1DGWA 4MXWB 1DQ2A 1UU4A 1VBB3 2UYBA 2E7TA 1BHGA 3NNMA 5FZFA 2VZSA 1GUIA 2MEV1 2ARBA 1W9WA 2ZGUA 2BBVA 2D7FA 3LFIA 5L7OB 3WP6A 1BMV2 5FQ0B 4HPKB 3ZSLA 3PIJA 1FAYA 4H14A 3I59A 1QOOA 1XU2A 3OUJA 5KHKA 3HNYM 5F8PA 1TME1 2X5IA 4IV1A 5C4WB 4N90A 4Q0PA 3WNPA 2VUCA 4ZZ5A 2ZOEB 3H8RA 1UD1A 5JOWA 1UO9A 5JVVA 2XG3A 1QY4A 5K4LA 4IEYA 2R1BA 4PHZA 3E1F1 2JDKA 4WM7C 5FZIA 1NQJA 1E5IA 1ULFA 1X9TA 2ATFA 4QDSA 4XEZA 3BOWA 3B93A 3WF4A 3POJA 3RGBA 3IDCB 2VPVA 1OOPC 1QJU3 3LA2A 5FZ0A 3QH7A 1RMU2 3PJQA 3DPRC 4MHRA 2D44A 1F31A 4TYSA 3MIHA 1BJQA 1CWPA 1JOBA 4ISRA 1ZA4A 3SC7X 1HRI3 4ASKA 5HXMA 1VALA 1YQ2A 3A22A 4B1LA 4CCDA 4LBNA 4MGKE 5CFCC 3UGGA 2D6LX 5FBJA 1LENA 3VDBA 4C1WA 3R4SA 4ES9A 3MF9A 3IKWA 1AR91 4IE6A 4ASLA 5HI0A 2EF6A 3POWA 4EN9B 1WWYA 5FCCA 1YJLA 4QD2A 5FZ3A 4KWJA 1MVEA 1DYPA 1MS4A 4GALA 1GZ9A 3VBRA 2V5YA 2VOXA 2P37A 2RE9A 1X9PA 4KG8A 2J1RA 2HBUA 4Y22B 1XXNA 4QXCA 5B2GB 4NVPA 4PQ9A 1KDMA 3CKHA 4YG0A 1D2QA 3VKOA 2FCUA 3OBAA 2ILMA 5F5AA 2VH9A 4AEJA 3AYDA 2E7AA 1BK1A 1NCRB 1RUI3 1UU5A 4AHXA 4G9SB 4IW3A 1PGL2 1XSQA 2Q1ZB 2PTMA 2ZBJA 1QJY3 1VBB1 2DFCA 3ACFA 4JGZA 5DG2A 1LOEA 4PBPA 3H1WA 3PVBB 1DGRA 4L92A 4QX8A 4IE5A 2VNVA 1OVSA 1ZNPA 2D6NA 4AVAA 3W20A 3AMHA 3SQOA 3MF6A 2FQPA 5FOJB 1UMHA 3NL1A 3B02A 4PJYA 1RUD2 1XYOA 1ZZ9A 3DV8A 5FXXA 1DGWX 5JXIA 5F2WA 2R072 4D0QA 1SLAA 3WNLA 4N53C 1HJFA 4I0WB 4W50A 1SBFA 4L97A 5FJHA 1H8TA 3ZOIA 2V4AA 2ZEYA 5KHHA 4I0BA 3HIFA 1SFNA 3BTYA 3MUZ1 2ET7A 2P17A 2I2SA 4Q4Y2 1W6NB 5BNPB 1VRBA 4I0AA 3H0OA 1RUJ3 3ZFGA 5IVBA 2RS52 2PHXA 5BPXA 3IM0A 2EIEA 4Y5TA 3WCRA 3WSOA 3WF1A 3PVEA 1VAKA 2QUOA 4LO7A 3BUCA 4UFLA 5J1XA 1QJU1 4LBOA 3HBZA 4GMP3 2I74A 5FPAA 1GLHA 1KITA 5C8WA 1HV1A 3ZYHA 4N9HA 2D3RA 4Q0UA 2JICA 3WY6A 1Z0HA 4AFDA 1QHDA 2DV9A 3LZZA 4OZOA 5L19A 1HRI1 4ITCA 3UV9A 1AR62 3THCA 2D6MA 1C57A 5C7GA 2RM23 2RR11 4YZ1A 2E7QA 1QMJA 4ORFA 4HG6B 4R4XA 5GZDA 4Q0QA 2JENA 2XL7A 3CQOA 4HONA 1O8PA 4OQ9A 1LNSA 4CDWA 3S6PA 5L9VA 2XQRA 3I3QA 4LKEA 3OG2A 2LALA 1LODA 3HT2A 3J7MA 1OURA 3OTFA 3I2GA 4Z92B 4AI2A 4D7YA 1DU3D 4GKXA 4KG0A 2KXLA 3GNEA 4EN0A 4AXOA 4P02B 4FXKB 1W2NA 1HIXA 1PZ8A 3VBSB 4BB3A 4K7JA 3PNAA 1NY72 3SH5A 2ADEA 5A7WA 4MGQA 1RUOA 1RUI1 3I7DA 1W8HA 4Y20B 1GSLA 1RVF3 4QQOA 3JQWA 1W3VA 1W2TA 4MSVA 3HNMA 3LIHA 3HR9A 5APAA 4OHYA 1CAWB 4IE0A 2FZ1A 3PU3A 2DU0A 2IVIB 2MEV2 1XE0A 2XR4A 4QPIA 4CXYA 4A6OA 2ZMNA 3INAA 2A6YA 3A0KA 3VBUA 5BNQA 3AK0A 4WM7B 1JYXA 1KFUL 2A6ZA 1OF4A 4GH4B 3WR0A 1JYIA 4IEPA 2ZX1A 1TME2 3ZFFB 3M3IA 5EIYB 2CAVA 1PK6B 3FJSA 4XF1A 5CISA 2GNDA 1WCKA 2HYKA 3H1MA 4CDXC 4RS5C 4Q29A 3WVJA 5BNNC 4Q4X2 4UW6A 4N7IA 2E31A 3FLTA 2C4XA 4AVBA 2WNOA 3RI8A 3UKNA 1RUJ1 4RQPB 4XF0A 4HBNA 1RUH3 5HCHA 4GMP0 3AVRA 4BISA 4HSJA 2Z42A 3C7HA 4GMP1 1UXXX 5L9BA 3TRSB 2VZ3A 4BQ4A 1VP6A 4QKBA 4JX0A 4YZ3A 1EV12 2W91A 4A42A 1UZYA 4XBLA 4XFCA 3AZXA 5IYYA 3CBNA 4XW3A 3BYWA 1AL22 1AYM3 2GP5A 2K0GA 4UBHA 2RM21 1NE6A 4ZXKA 1D0HA 3AFGA 4EE2A 1ZRDA 1C8M3 3DL3A 3Q9OA 1RJ7A 4DZGA 3PUIA 3POSA 1AR92 4C1XA 1WCSA 5A33A 1O91A 1OH4A 1QIQA 4KH9A 1WW5A 4D7SA 3PVNA 2E33A 4OLLA 4CPBD 3J8F2 4YW5A 4AFBA 2PYTA 2WL1A 3H8OA 1W6MA 4GWIA 3H3ZA 5JUVA 4NWWA 4N8MA 4Y4YA 1MS3A 4FI9A 4B4PA 1N3PA 1COV2 1UYZA 3AP6A 2ZXQA 2P3KA 3AP4A 1HLCA 3MW2A 4L11A 3U07A 3LB9A 1R092 4JCKA 2K9ZA 3DF0A 2V73A 3K77A 1VBB2 2JE8A 3VLBB 4AW7A 3Q8EA 1PZ9A 2D5FA 5EP9A 2BERA 2V4VA 4XF9A 1XNAA 2AACA 2PLV3 3KV9A 3VBHB 5A3MA 3RZJA 1ZZ6A 1FATA 3ZXAC 5JXHA 4MUVA 3OYWB 3G7DA 5KXBA 3K75B 1AYN3 1ZBA3 2QQUA 4JHTA 5CFDC 2JE7A 2PHLA 4YSFA 4JRLA 5IHRA 3GBFA 5D8AA 2CDOA 1Q8SA 1B35A 1EYBA 2H6BA 3D3AA 3POGA 3KM5A 2BNOA 5F2SA 1Y9GA 3GCXA 1KEXA 5F5IA 2P6CA 2WFPA 4QX2A 5T54A 1D4M1 1P8JA 4AZZA 4QKNA 2H0VA 4MYEA 1JU4A 3ZMNA 4URAA 4AFCA 1RUH1 1OFNA 1Z7S3 1ULOA 4XFAA 2WZR3 3WUDA 4IESA 4LT5A 3OBTA 1J59A 4CDUA 1KJLA 1QJU2 3LQCA 1OSGA 1S0JA 4WVZA 1VBA3 4U2AA 1AR81 3AB0A 1PMJX 3ACGA 1H9WA 1STMA 3OUHA 1W06A 3VDDA 3TEYA 5A32A 1A3KA 1CAUA 1HRI2 3S0MA 3QLQA 4JDNA 3O0XA 4EZ4A 1AYM1 1D0GA 1UY4A 1DQ6A 5BNOC 1MQTA 4AGVA 2FDHA 3B69A 3HBKA 3OGSA 4DXZA 1LTEA 3FMGA 3HJRA 5A7OA 2R063 1VR3A 2ZAHA 1GQHA 3JD73 4WZCA 1FNZA 2RS31 3WF2A 1FMD1 3H8UA 5A7SA 1HXS1 4RR3B 5HV0A 4A41A 1MS1A 1L7RA 1O4YA 1W05A 1Q5OA 1O5UA 4M3CB 5AC93 4UBGA 4NIIA 2ZGQA 4B3NA 2YBKA 3IB3A 4BYYA 2AREA 2G9FA 4LO4B 2ZAAA 3ZXGA 2PHFA 5FDBA 5C33A 1F15A 1APNA 1UL9A 2D5HA 2JEMA 1DDLA 3GDBA 2UURA 1V6JA 2W1UA 3ILRA 1IPJA 4LKFA 4XXPA 2XOMA 4QKDA 1YO8A 3LDRA 1C4RA 1QJY2 3HT1A 3TEWA 5AFEA 4CDXB 4RS5B 2XB6C 2DFBA 4LR4A 3O1MA 1WCDJ 4L9BA 4V2WA 5IVFA 4Z2WA 2VUAA 3J4UH 3N4MA 2E63A 2ZEXA 1AX2A 4HVQA 1K3IA 3RI9A 3ZPYA 4ASMB 1XYNA 1ZBA1 2WZEA 3H1YA 3RWKX 3USUB 4YVWA 4PDWA 3OF1A 4FAGA 2B42B 3WHTA 1OPOA 1GV9A 4AEDC 1MS0A 1W6OB 3W58A 2ZZQA 4COYA 5LA0A 5FP4A 1CVNA 1UY0A 2VOTA 1RXFA 3O0WA 2ZTNA 2B7YA 1JYNA 1TEIA 2OZ6A 4I02A 4QX3A 3ZFEC 2EIBA 3H3LA 5FJKA 1GNZA 2JD4A 4NAOA 1A34A 4XQWA 3J26N 1CQ9A 5EJ1B 4CU6A 4JKMA 5LZ6A 3FLRA 3H42B 1RUJ2 2IUWA 1Z7S1 2Y6KA 3NW4A 1IQDC 4L99A 1ZX5A 2UWBA 3ZYRA 2WZR1 3C8XA 1CONA 1XPWA 4N9IA 3GYDA 3WG1A 1VBA1 3K4DA 3QH6A 4NO4A 4XABA 1DZTA 1OA3A 2WWUA 3DECA 1J3PA 5F6LB 5FXZA 3VZOA 2W3JA 2F6BA 3VL9A 5LA9A 2DYCA 2R043 4MG2A 4GWNA 4OI2A 1KDKA 1ULEA 3RYPA 3ZYFA 3GHMA 1IGOA 3I2IA 2A70A 1AHSA 2QQPA 2RM22 3NNLA 3R05A 4JDOA 4NIGA 4FPHA 3KZ4C 4P00B 2GN7A 4ET7A 2XH6A 5L36A 1DF0A 3POBA 1LOFC 3ZDVA 2XL9A 3FN9A 5C9AA 1W8NA 2FMDA 5FY9A 1REDA 2WZPP 3DKWA 5JR7B 4QT6A 3UL2A 3VD5A 3NJYA 4BQXA 2ADDA 2VVDA 2O0OA 5CKQA 3SKJE 4CVUA 2WA4A 1JHJA 3MBWA 1U5ZA 3RMYA 5AC91 1SPPB 1OF3A 1UPIA 4WM8B 1VBE3 1BQPA 1VB2A 2B46X 5CFDB 4IE4A 3VBOB 4R4ZA 2YU2A 3O5SA 2A7AA 2CDPA 4XFFA 1RVF2 5A3OA 2DVBA 3RDIA 4OZXA 2YDEA 3FC0A 2LS6A 4E2GA 3NJVA 1OVPA 3B5LB 4DUXA 3RJRA 4UFJA 2OX0A 1ST8A 4UFMA 5FO7B 2VMHA 3VUOA 4FTEA 4A3XA 4W8JA 1WA6X 1YFWA 3UJOA 2GH8A 5B4XA 3AL5A 4CDQB 3KV4A 3H7JA 3FUOA 2WINB 3NNGA 3VKMA 2R0HA 1YLLA 2YZ4A 3EYPA 4K21A 3SLIA 4PIZA 4EWAA 4URTA 2UU8A 5DN2A 2ZMKA 1R081 3E6BA 3NV1A 2FCVA 1KRIA 1YFYA 3VBFA 1LB2A 4E4DX 1TMF1 3OUIA 2BOJA 1D4VB 2Z69A 1UYXA 3S57A 2BWCA 1XB9A 4O7XA 2WA3A 4QPGC 2QKDA 4Y5SA 3CJIC 3LEMA 2GAUA 2BRTA 2QQOA 2WNVC 4X8PA 5L73A 4UFIA 5DXDA 5HCAA 5FMDA 4TTGA 1MEC3 3CU7A 4BXFA 5BNOB 5AFBA 5FZOA 4X8NA 4XFHA 5DUUA 2L9LA 4OI1A 1OI6A 2NM1A 1RUH2 2X29A 1US3A 4FXGB 1ZRRA 3SKVA 3JBG3 5DZGA 2KA3A 3CLPA 4N43A 2ARXA 5FY8A 2E9QA 3PLQA 1UZ0A 4AL9A 3HNBM 4EJRA 3ACHA 4YRDA 3AMPA 3WD5A 2IXKA 4KU7A 4CXWA 2R041 1Q8QA 3AKTA 1AYM2 1DZRA 2R49A 3KSCA 2YFZA 4Q0VA 1C8M2 1W6PB 3PHMA 5LK7B 2WZ8A 1RITA 5FWJA 4DIQA 1BLZA 2VAUA 4V2VA 2CAUA 3E5XA 5EJ3A 1IQAA 2ZMLA 5JZGA 3LD8A 4ZPIA 1W2AX 4IE7A 5CG9A 1HQLA 1LRHA 3G6JB 1AJKA 3E6DA 2JG8B 1PIV3 1QEXA 2XHKA 1S55A 1X8EA 4B7KA 2VZVA 5GM0A 4TXWA 1D7PM 1LOGA 1UMZA 2XJUA 4H55A 1VBE1 2C1FA 1NCQC 2K2SA 4NPMA 4CXXA 3UESA 3VD7A 5I0RA 1FYUA 5FZEA 1CIWA 2D6KA 2PAKA 3EBRA 5LBBA 5G04L 2KR2A 3U0ZA 1QJX3 2PHRA 1BVVA 4FO9A 5M0TA 5H9RA 4XAEA 5J7MA 5L7OC 3W21A 2XQXA 4U36A 2QQLA 2WUHA 3SEPA 3U75A 3KS7A 2Y8KA 3UGHA 2WLPA 1JYTA 2PLV2 1HB3A 4Q27A 2WS93 1GICA 3AC0A 5C4WC 2BFUS 2VQUA 4RGGA 4YNIA 1AYN2 1ZBA2 1UPSA 4CPBA 5IATA 1W9FA 3DN7A 1LEDA 3EHKA 3USSA 3AZWA 5ABJC 5FYCA 3TNQA 2W46A 4NR1A 1U5IA 4Y33A 1OH3A 5I8YA 3I59B 3MIDA 3I2KA 2EA7A 4IEVA 2X5IB 3SITA 5H9QA 4COWA 3KF3A 3ZSKA 4IV1B 2BZDA 3I3EA 3LCPA 3U4SA 5C6CA 4H7LA 4PT6A 4XOGA 4LBMA 4P08A 4E4ZA 3AYEA 5TSWA 3ZYBA 3E5UA 4XDOA 4GA9A 4LQRA 3I2JA 2JG9A 1Z7S2 1UZVA 2ES3A 4IGQA 3RMXA 5ACA3 5FPZA 3JBG1 5KR7A 4OHXA 3JU9A 1ULGA 4GIQA 3KGLA 2DBNA 2Z2SB 2XWBB 4HMZA 1VBA2 1ZVFA 4BQWA 1JTZX 5ISLA 3P6BA 4XF3A 3ALQA 1W90A 2YXSA 1EUTA 2YFUA 1GP5A 4QB1A 2W1WA 2XLGA 1BZWA 5IVVA 2FDKA 1GFF2 4ARXA 4AGRA 4EN7B 5LBCA 3THTA 2WN2A 1EY2A 3E97A 2VBPA 1H1IA 4NHKA 1WKYA 4XURA 4XMIA 2R062 1FT9A 3KVAA 2QCSB 3KQRA 3L2HA 3NNFA 2WR9A 2XUEA 3JD72 5DAQA 3M3EA 1QJZA 3HOBA 4WVWA 3MDPA 1OMIA 1FI2A 1PIV1 1Y4WA 3M70A 1XNTA 1YFUA 4JTNA 4QQLA 1G6NA 1LGBA 4KQ7A 5L9RA 2ZGSA 4DO0A 5F3CA 1NZIA 4CE8A 1XBFA 1VAMA 3VZLA 4ZKTB 4QDRA 3CEWA 4BA6A 5AC92 4P9GA 4HFSA 1H4GA 1Q3EA 2YMZA 1BVP1 3ACLA 2V09A 2YG0A 4NE9A 5IAXA 1CZVA 3ASIA 4JV4A 1JW6A 4CCJA 2BDRA 4QB6A 5I0SA 4IEQA 2Q5TA 2Y6JA 5JI7A 2O1QA 1KFXL 4QXKA 5G05L 1PZ7A 2ERFA 1GMMA 4XYXA 1RUC1 2EXIA 2JKXA 2VBDA 2EXJA 2WS91 1G9AA 1YC61 4JGZB 3N9NA 2QZ2A 1WCQA 3I8TA 5FZCA 1U5YA 5SV8A 1HQWA 3WNKA 5FMBA 4HVOA 3LWCA 1F4AA 4ZXEA 4J25A 3EO6A 3MI8A 3VZMA 5FPVA 5BNPC 4FVVA 1DHKB 2ZJCA 2OYZA 4QWNA 5BV6A 3I49A 2UY9A 4BU2A 1W0PA 3K46A 1H8TB 1LOBA 2GSYA 3DCQA 3ZKUA 2QTWB 3WG2A 1FV3A 1HB4A 1CGPA 1SBEA 5ACA1 1GOFA 2VJXA 4F3JA 3WINE 4UF0B 5K8SA 3RVHA 3AFKA 3VD9A 3ZFGB 3WCSA 2OT7A 4YM1A 1G8WA 1V6LA 5IJRA 2VG9A 4LA3A 2W2IA 2B5HA 5LA2A 2VCMA 4PF1A 2R042 4CP2A 4DPNA 3HWJA 5C5TA 5LY1A 1QOTA 1NCQB 1M4WA 3MPBA 1H1MA 1LU1A 1ZZ8A 4AI9A 5H9PA 1JOPA 1AR71 2ZCWA 1YXWA 1M06G 1RYYA 2ZX0A 4M01A 4TWTA 3URFA 1ZA7A 5J98B 4JHZA 3K4AA 2GZWA 2SBAA 4FPFA 1GZWA 3ZSJA 5F3GA 2WNUA 4C8DA 3VBSC 3BALA 4QX7A 2DCZA 2G9GA 4W6XA 2CSGA 1UKRA 2OQ6A 3W9AA 1XQNA 4AAXA 5LRRA 1YI9A 1JZ4A 1G9CA 2ZHKA 3LKJA 1VBE2 5GLWA 3T2QA 4LXLA 5KWRA 1KD7A 1C1FA 1O5LA 2PAEA 3OGJA 1PNGA 5ABJB 3IMNA 2Y34A 5KBFA 2VXRA 3DYMA 4ARYA 2ZGKA 3F2ZA 1POV0 5D2AA 4ATFA 2QQJA 4FSJA 5A7WB 5ERLA 2VMIA 3VB9A 4GH4C 4Q4V2 5KXCA 3N3HA 1POV1 2A6XA 1GYKA 4I3GA 2VO5A 3GBWA 3FFZA 3ZFFC 3LIGA 3O7OA 4TSVA 5GLTA 3V0AB 2QZ3A 1PK6C 5D1IA 4AVVA 1QJFA 1LULA 3VBUB 3LDKA 3A23A 4QAWA 2HKXA 2ZZJA 3IN9A 5CVRA 2F17A 2WQ4A 2XJTA 4WV8A 1AZDA 3O1SA 1MPXA 2RR13 1SMVA 1XOYA 1F4HA 3POFA 4RQPC 1OD5A 1JS9A 5IUQA 4A7ZA 1GOGA 2FDJA 5A1AA 1MEC2 1XE8A 4JGYA 3KVBA 4FPEA 4O61A 2NP0A 4BIOA 1WW7A 3ZYIB 1PMIA 4P9IA 2BEOA 4IV3C 4K9SA 2Y64A 4ZZ8A 1WMXA 3JBG2 1TZOA 2XJPA 3LSEA 2IC1A 4CEWA 4H7MA 3TN93 4Y1UA 1WMEA 1GU3A 4AYUA 2QQNA 4FPKA 1QJEA 4LEJA 4LORA 1DFQA 1MS5A 2VM9A 1ODMA 3OBZA 2CGPA 4QHZA 5E89A 1OQEA 3PDQA 3TBDA 1HRV1 5JPMB 3AJYA 2XKOA 2PN5A 3HN3A 2DCYA 3EMRA 4QGNA 5T5PA 4DINB 4XJZA 4Q1PA 3B00A 4MX3A 3AZYA 2YHJA 4F8AA 2YUEA 1NX9A 1LHOA 1UX7A 3BTZA 2DVFA 2VNGA 2HWF3 3BODA 2RG4A 3T0BA 3K48A 1LECA 3O1OA 4LPLA 1NLQA 3JB8A 5A70A 1PIV2 1H6YA 1UZWA 2XKPA 5A33B 1ZM1A 3ZVXA 3K51A 3NRUA 2JJ6A 5DQ0A 5FP3A 5LEJA 2QQKA 3LEKA 2Q1FA 2DUPA 2ORXA 2P2KA 5C3OA 3NSTA 2W95A 2AEYA 2ZGMA 3LEIA 4M4RA 5FPUA 1QJX2 3VBHC 4YG3A 5FZHA 3VD3A 4YW6A 4XILA 3KCXA 5GLZA 4UW5A 2XDVA 2NMNA 3NJZA 4XTMA 1WW6A 3O1VA 5FKBA 4CTEA 4P9LA 4AAPA 5DZFA 1ND2C 3ENRA 3WP5A 2B9UA 4BQ3A 4DXRA 5IFTA 4CEYA 3GJBA 2CGNA 2DVAA 2EXHA 1W8ZA 4Q8LA 3AVSA 5AVAA 4O9GA 4XMAA 5T52A 4LK6A 2WN3A 4UOJA 4X6QB 4CCLA 4XETA 1W8UA 5T55A 2VMDA 4LBJA 4H3WA 3W59A 2EXKA 1NYWA 1O59A 4MGZE 3KQ4B 2PXJA 4V1PA 4F83A 5E1RA 5EPAA 1RXGA 4A2UA 4MHUA 4RD7A 1H30A 2N7GA 3AKPA 3FBMA 2ZA9A 1ULDA 1V00A 1CAVB 4JC1A 2D6PA 2BOIA 1XRUA 2YYOA 3KHCA 2GU9A 5ACA2 2W94A 1YQ5A 3M8LA 4GWMA 1LGNA 5LCWL 4QQHA 1RINA 1NA1A 2VCCA 3NAPC 2A71A 3TN91 4YZ2A 4X6RB 1IPKA 4A7KA 3KV6A 4OUMA 3P1IA 3RYKA 1LHNA 1YYNA 1HB1A 4P9WA 3U14A 3OY8B 2BFUL 1JBCA 2EALA 3IIAA 3OGVA 4BHPA 3HQXA 3E6CC 3FHAA 1LU2A 1HQNA 4UAPA 5A32B 2RDSA 1CAUB 1JU3A 3LPFA 4PIYA 4P9XA 4RR3C 2OUJA 1FOD3 2QJVA 4NHMA 2Z5WA 5FZ9A 5FXWA 2HWF1 5GJ6A 3PTRB 4W4ZA 4CCMA 4CP0A 4DEQA 2LM3A 1K45A 4XJAA 5HPOA 3WOGA 2YPDA 3GGLA 4M4PA 4LULA 1V9U3 4CCNA 2FDIA 2PMWB 2JDZA 3WDTA 2VMGA 1GNHA 2WDBA 3ACIA 1QXJA 4D8MA 4HVRA 1UQXA 2HWD3 5IK8A 2BVBA 1PO23 1G86A 5FZKA 3TAYA 3WNNA 3EXUA 4XFIA 2QQMA 3MW3A 4QPYA 1D4M3 4BPZA 3PUSA 1IHMA 2Q1MA 2DCTA 1TNFA 4S2HA 5F1RA 1OLQA 1URXA 3FHIB 2IZWA 4ZU7A 2P34A 1DG6A 4EN6B 2JDUA 2FDFA 1EPZA 5LY2A 2A6VA 2GALA 1WA4A 4PI0A 1ULPA 4META 2WAAA 1AR83 3Q8FA 3X29B 4IV3B 3H8XA 5FZ7A 2QQVA 3FFQA 4FT8A 4FOWA 4YW1A 4IL7A 4LJHA 4DRRA 2FZ2A 5FRAA 3MPPG 1JUHA 5FREA 3B7MA 4ES8A 4UYBA 2D40A 4ONUA 4Y1XA 5A1FA 1WD4A 3BN6A 2EIGA 2JDNA 2OQ7A 2FMYA 3UKTA 1SFYA 4YVWB 4PDWB 5HXVA 4YVSA 4Q4W1 4XACA 1PM4A 1W6QA 2BGCA 4FP2A 4NN0A 2FBEA 1GBGA 4J6GA 2VMCA 3LA3A 4Y22A 2BV4A 3U78A 1SLLA 1NUKA 2BQPA 4BM8A 2VTXJ 5FZ1A 4LOSA 1OKOA 1Z78A 3WQ0A 2UWAA 2PQSA 2DVDA 2RS33 2UY8A 1FMD3 2VMEA 1HXS3 1N1TA 4RN5A 3K4ZA 3ZSMA 5FLHA 1NCRA 4DUWA 4AVTA 1SFPA 1UXZA 5A3UA 2WT2A 2GNMA 4PLMA 3TWIA 1ND3C 5FTTC 4AR2A 1V6NA 4HANA 4OHWA 4NROA 2VGDA 1AXKA 3BU0A 3LF7A 3NVCA 1S0EA 1UYYA 2ZGOA 1OUSA 1RUF3 2VOKA 3ZSEA 1DQ4A 3I3BA 4FFHA 4IGPA 4C91A 1S2BA 3WDUA 4NWVA 1SEFA 5KC5A 2CTVA 1QH7A 2CHHA 1UOBA 1FOD1 5IK4A 3WW1A 2JDMA 3O14A 1BEV1 4HKWA 2O8QA 2JB8A 1OFSA 4WM8C 1CX1A 4R8HA 4EWDA 1V9U1 1JMUB 4NRPA 4BIFA 2QDNA 1JZ3A 3VBOC 4MLOA 4GWJA 3QBQA 4XHXA 1ND2B 2VQTA 3MFCA 2A75A 2HWD1 5FLJA 3WNXA 2DF7A 4FP3A 5A6YA 1SCSA 1WMDA 1PO21 1DQ0A 1XNCA 3D82A 4Z82A 1HN1A 5FY1A 3WV6A 1N3OA 3I97A 5C8CC 1OQ1A 2VR4A 4AI1A 2J1SA 4A4AA 1G7YA 4Z8BA 1O3SA 4LE4A 1QWRA 2VNRA 3IPVA 4CDQC 4YLZA 1J84A 1OLRA 4BLIA 5K0UA 3AXDA 4FAHA 5FY4A 2YGLA 3PUAA 3ZLIA 1UCXA 1AX1A 4CU7A 3FHQA 1LOCA 1VMHA 2QQIA 5D21A 1A6CA 4K6BA 3D0JA 1SDDB 4Y1YA 5BYNA 4OMDA 3V0BB 4CCOA 2J1EA 1RUE3 3NWKA 3VZNA 3NAPB 1DQ5A 1SBDA 1K12A 1IKPA 4I09A 4CUAA 2RR12 4MV2A 3HAGA 3O0VA 5KHGA 4NHYA 5EV7A 5FYUA 2JWPA 1KJRA 2BGPA 4Q5OA 4CUCA 2BP6A 3VV1A 2LTNA 3RS6A 5T5JA 1G9BA 4LE3A 3AZVA 3PJYA 4K3UA 2P1BA 1W8OA 2Y60A 1KXGA 4YG6A 4D3WA 4LO6B 3BTAA 1JHNA 4EROA 4JAAA 5FZOB 4LBQD 3UKVA 4LLOA 1MS9A 2VOWA 1N1VA 2CYFA 3NJXA 3TN92 1RC6A 5GLVA 5DAVA 4Y1VA 1C5HA 5FUNA 4N43B 5A3TA 5I0TA 3OBRA 2VU9A 3M7AA 1PVC1 4FPLA 1RUI2 1YQ6A 2ZHMA 4WM7A 4XUOA 3MW4A 1RHI3 1RUF1 2Y6LA 4GH4A 5LBFA 4EV0A 4AHZA 2JG8C 4S2FA 3NMBA 4DS0A 3AKQA 4UFHA 5I8SA 1OOPA 3CF6E 4JKKA 3RNSA 1E57A 2GC0A 3N7LA 5T5OA 3DPRA 3NV2A 4E2SA 1UIKA 1RGSA 1DIWA 1CJPA 2RJKA 4ZU4A 5DDJ3 2JX9A 1R083 1WLWA 3BIWE 1W9TA 1K5MC 1TMF3 1UY2A 4Q1RA 3ZR5A 2W0XA 2WSUA 5CFCA 5HCFA 1VBD3 2HWB3 1JYCA 3ZYJB 1X33A 1O4ZA 4Y4RA 3MLKA 1J1TA 1GQPA 2OZJA 4QGMA 1MZFA 3CO2A 5LB6A 4XHBA 4QM9A 4M0NA 5FMCA 3I2FA 4S2DA 3KLSA 5CKMA 2P5BA 1GQGA 2HJIA 2WQ8A 3H7YA 4SLIA 4BLJA 2UWCA 3M3QA 2CV6A 3LE0A 1K42A 2X5IC 3J7LA 3SEEA 3L9JT 1RUE1 4IV1C 4JKLA 2G19A 3BTXA 1ND3B 3V65A 1O6UA 2ZGTA 5FZLA 3D4KA 3AYAA 5A7PA 3VHRA 2PELA 4CU9A 1WLDA 1PM7A 1GKBA 2HEWF 2Y33A 1ASJ3 1SQ4A 2OW4A 4YWAA 3RFRA 3MLJA 4Y24A 4E4SA 1TVGA 2H6CA 1LJ7A 5JOYA 2PHTA 3Q8BA 5A6ZA 2D97A 2YY1A 4XUPA 1NG0A 5JLVA 2D43A 4M0HA 3J7HA 4GJZA 5I91A 2G1MA 4LTAA 4OMCA 3I54A 3SCGA 5GZFA 4N53A 2JIGA 4QPWA 2R30A 1WZXA 2B45X 4CYDA 1DLLA 4DFSA 2DTWA 1KS4A 3SNMA 5FO8B 3IWZA 1B09A 3POYA 5A80A 1YQ8A 1RHI1 4IQPA 1VLNA 1BYHA 1ZYBA 2WT1A 2Y6GA 3ATGA 3SXWA 2AUYA 1N47A 2WSVA 2X8KA 4CP1A 5C8CB 3KHBA 5KXEA 3P5BA 3TYJA 2RMU3 1FOD2 2HWC3 1IS4A 2G4IA 4EZHA 3JZVA 2D93A 4AQ6A 3VBRC 1N1YA 1CAXB 1X7NA 4HLTA 4KWLA 5C5UA 1TNRA 1V9U2 5DDJ1 2WLQA 1U12A 3J7NA 5BY5A 2VZOA 3ZIWA 2CWSA 1W8WA 1F35A 1OQDA 4A7YA 2YPJA 2HWD2 1TE1B 3M2MA 4LITA 5IVYA 1O7FA 3AM2A 1PO22 4KNCA 2HLEA 1VBD1 2A73B 2HWB1 4XE9A 2JECA 1W03A 3PMEA 5J36A 5CG8A 3ZYPA 1J3QA 4LKSA 5JPNB 1D4M2 2C6SA 4FCAA 3OGRA 3UGFA 4AQ2A 4JGZC 3PURA 5FYIA 3B9IA 4Q8KA 3RZHA 4FTBA 2WBKA 3CNAA 1MACA 2Y0IA 4DXTA 3RZLA 2VW2A 3UETA 2J1AA 1E5RA 3MO4A 2W9XA 1RB8G 1AR82 3VZKA 4D6RA 3KT7A 3ZN5A 1OC1A 2ZPXA 5DG1A 3TB0A 2BTVC 4L2NA 4K20A 4OCTA 2VBBA 5HBAA 1CESA 1VMFA 3VHOA 1F5FA 2C9AA 2X10A 2XGXA 2YU1A 3PL0A 5JIAA 4AWDA 1H8TC 3S30A 5LEKA 3GM8A 1OXCA 4NPLA 2J1VA 1W0OA 1VIWB 2VE1A 4AG4A 1X82A 1HV0A 1ASJ1 1DYOA 4IERA 5FIXA 2ZGNA 2JD9A 4R9CA 3KWVA 4XJUA 1KQRA 3OD0A 3I4IA 3ZFGC 1RUNA 4KGGA 2D6OX 2ID4A 2RS32 1FMD2 1HXS2 2WAOA 5JMCA 2IFWA 2VTXA 5CYYA 4QB2A 2GH2A 1LESA 2DTYA 2C9KA 2Q8OA 3BB6A 1Y43B 3VDCA 1VJ2A 3PTYA 4RFRB 5A6QA 1QQP1 5FK8A 2CU5A 3H50A 1I1EA 4CDXA 1REEA 4RS5A 5BNNA 5ANQA 1YIPA 1LOAA 1C3HA 5JAXA 3N36A 1K5MB 3VN4A 2XVLA 3EJKA 1RUF2 3AMQA 4ZS3A 1POQA 2VVFA 3USUA 1NKGA 5AVPA 4CDWC 1PMHX 1AUYA 5JCTA 3CL1A 2RMU1 2HWC1 2JB4A 1W6OA 4HL0A 4AI8A 1RUC3 1KS5A 4MH0E 4RGAA 3VDAA 3LA7A 4YM3A 4SBVA 3WQ7A 1R1ZA 4GZ9A 2A3XA 3WXPA 4JQTA 3ELNA 4XUNA 4HOOA 5CNAA 4B29A 2DVGA 1JN2P 3O1UA 2XVKA 3AX4A 1GZWB 2WNUB 4Z07A 5EZWA 4XPVA 1UWWA 5LRSA 2F4PA 4FPJA 2A6WA 5EHDA 1C5IA 1W8TA 1JZ5A 3KD4A 1PX4A 1ENRA 4FPGA 2RDNA 5CIRA 3MV11 5JSRA 1L7LA 5BUVA 3EB7A 3GXUA 4P5HA 1R64A 3A0NA 2OS2A 3FWEA 3NQHA 4QPIC 3MFAA 4HN0A 4JVAA 5CB7A 4KU8A 4CP9A 3AZZA 1UN1A 4E2QA 1S0IA 3VBUC 4B7EA 2WZR2 1JODA 1LHWA 2AR6A 2AC1A 3GALA 3ZXDA 2XJQA 3ZDSA 4D69A 3OOXA 2RS13 1UOFA 2BYVE 4QX5A 4AF9A 2X09A 1AR63 1GANA 2OPWA 2NLRA 3CDZB 3IMMA 1UIJA 5DUXA 1RUE2 2CNAA 2J7MA 2EIDA 1CPNA 3ILFA 2YC0A 1JZ8A 4IEOA 4AE2A 5A3LA 4K40A 4K8RB 1IS6A 1SG3A 4G3YC 1V6IA 1UX6A 5E16A 1AR73 2P3YA 4YW4A 2DBIA 4YZ4A 4DQAA 4R52A 1SPPA 2OIIA 4CU8A 2W08A 3KGZA 1HX6A 1MZEA 1VAVA 2YC4A 3RSJA 2NN8A 2OXBA 1V0AA 5CFDA 3ZN4A 4JGYB 3A4UA 1C8NA 3T1MA 2CGOA 2WKKA 2XBO3 2R6QA 1WBFA 3VBRB 1OKQA 1LEMA 4XAAA 4HK9A 3I2DA 5FZ8A 4CEWB 1PGL1 1NXMA 2ZX2A 3V64A 2WO3A 1ODNA 3HVDA 5J3UA 4LHLA 5FO9B 3H3UA 4I2OA 2PQQA 1HDKA 1YQCA 3QD6A 1KGYA 1QOSA 3HEIA 3BU7A 1SDWA 2RJ2A 3POEA 1S0DA 3IDEA 4BOWA 1YEWA 1XSRA 3LDBA 5DAXA 3KMHA 1POV3 4AVCA 4TZDA 4K1YA 2VZRA 3TNPB 1S2KA 5J96B 1S1AA 1UOGA 4GB33 3MV01 4FPCA 4RGKA 2IXJA 2WRAA 4W65A 5DDJ2 4Q26A 2VOVA 3AP5A 3PUHA 4GJYA 1R082 4QX1A 4WBBA 5LASA 5BNOA 4QMAA 4LBQA 5LWBA 1LKNA 3VZJA 1TMF2 4OI0A 2B39A 1JH5A 4GXLA 3T2TA 1ZZCA 2A3WA 1VBD2 2HWB2 4Q4Y1 5JXGA 4W6YA 4LHSA 2C24A 1GWLA 3FUQA 2IVJA 2XWJB 4AEMA 5FY5A 3U37A 5FWEA 3MGUA 2BUKA 2VZTA 4CCEA 2CY6A 4BQYA 1G9DA 4P9JA 4WVMA 4EYUA 3LGRA 2W52A 1XU1A 1MS8A 1SZBA 2LROA 1RL3A 3OB8A 1VE0A 4FFGA 4DB5A 1EV13 1UF2C 1YI7A 4NJ4A 2NQYA 2RS11 4FFFA 4A3ZA 1AR61 1ZREA 2ARAA 1F9KA 5I0DA 3PIGA 2GMMA 5E88A 5D8AC 4IXLA 1B35C 3LPGA 1WGPA 4KBZA 1HRV3 4CEYB 5JXJA 3P3PA 1J3RA 1PO13 2GC1A 2VD7A 2O8OA 1OHFA 1YUDA 4INDA 5FYBA 5FBZA 5ANNA 1YWKA 2VZUA 1ASJ2 1QH6A 3T4HB 4RHV3 4L0PA 3K2OA 4NAMA 3MLLA 3FX3A 4AQSA 3M3OA 4CDWB 3LFMA 3OPTA 4QHOA 3WG3A 4AEDA 2VUDA 1JUIA 4A45A 2XBO1 2A3YA 4K1ZA 1NY71 4GULA 4OFGA 4Z2AA 4G4FA 4MOAA 3VDDC 5IWFA 1QGLA 3ZFEA 3T2OA 2XONA 5FUIA 1NA1B 3LSDA 3RJ2X 4P14A 1MQTC 1XNDA 2OPKA 4JTOA 4ZY9A 1OT5A 1WBLA 2B8MA 5EJZB 2E53A 3I3MA 2PHDA 4IGOA 2VTFA 4PI2A 1V6KA 4LLFA 2RMU2 2HWC2 4DY3A 3N9OA 3AXEA 5FPLA 1YFXA 4GB31 1IZ3A 4QPIB 1W04A 4MGSA 1SLTA 4JQRA 4QM8A 3RG0A 3M3CA 2JDPA 4QU2A 1QF3A 4OUEA 3VHNA 2BJSA 1NLRA 5F9TA 2QFEA 2XJSA 3QCWA 2IXHA 2Y26A 5CBLA 4AEKA 4Q4X1 1WMFA 3LAGA 1LOFA 1S0GA 2GC3A 2YB7A 1UYPA 4M00A 4TN7A 2BVVA 1AF9A 1NLSA 5DUVA 3S7IA 5IK5A 4NOTA 2VW1A 2TBVA 2ET1A 3W5NA 3FZ3A 4XJWA 3B9CA 4KBBA 4YM2A 3WNMA 3BIEA 1EV11 1XC6A 2VY0A 3A21A 4AOCA 4YVWC 4PDWC 4UT5A 2TUNA 1AXYA 4MGYE 1AL21 3ZPOA 2D3SA 1H8VA 1U0AA 2HH9A 4COUA 5B4NA 2WFF3 1CX4A 2OKXA 1PO11 2IFRA 2E51A 3C3VA 1K5JA 3UYJA 3D0SA 1W3XA 3PUQA 1J58A 4I3PA 1I3HA 3DEMA 4S2GA 3IIIA 3QACA 4XCBA 4BCUA 3APBA 3GHNA 4RHV1 4YVSB 3J8F1 3OEAA 1W6QB 3HQUA 2ZACA 4NHXA 5F7UA 4QX0A 4DXSA 1YCIA 2W68A 4PLOA 3W5MA 2W39A 3WZ1A 5C70A 4H2AA 1COV1 4FBFA 1O4TA 4QPGA 2Q30A 1W8FA 3CJIA 4BJ0A 1W6MB 3TEZA 2WNVA 4E4HA 4XUQA 1R091 4LK7A 2VUJA 2Y38A 1RIRA 2KM2A 4GQ7A 3C7EA 4BQ2A 4TLGA 2XUMA 3T30A 5FXVA 5FR3A 1OD3A 3D5OA 2A1XA 3ES1A 2OVUA 3AL6A 2YBSA 3Q8CA 4BH9A 5C9AC 1F8VA 3CZUA 2RVAA 3HPNA 2Q8DA 1CZTA 1ENXA 5C3SA 3BKZA 5FMOS 1RUC2 3WQ1A 1WW4A 2WS92 3MIGA 3ZN6A 5IT6A 1YJKA 1LR5A 2GNTA 4OUSA 3LOBA 3MEPA 2XPJA 1QKQA 1W9SA 3MIBA 4NIAA 2PFWA 2VNOA 2I45A 5FPXA 5FK7A 5A3PA 4Q4W3 3ZMOA 2LW8A 5D8AB 3SISA 4UF0A 1ZBE3 1B35B 4YW7A 4RSUA 5F37A 4LBLA 5F3EA 3C7FA 3HMYA 5CA6A 3FL7A 5EYYA 5IW0A 1PX3A 4QQ2A 2WQZC 1JZ7A 3IPVB 4OHVA 1UW8A 2PA7A 1NCQA 1V70A 1CD3G 5K0UB 2R7EB 2X53S 2RS12 3RYRA 4CUGA 4MXWA 2P4EA 1QNWA 3E5QA 2VC9A 4XTPA 3T3YA 4D7TA 4CDUB 3O12A 3VBFC 4AQTA 1W9YA 2R0FA 2WFF1 3WW3A 4MZUA 5L7OA 2YC2A 5FQ0A 4HPKA 3S5QA 1E5HA 3VDDB 4OQ8A 3V56A 2GMEA 2DUQA 2ZKLA 2Z79A 4DEVA 1AR72 2FHRA 3GCWA 2ZEZA 4ZHNA 1MQTB 3KT1A 3WUCA 4C0HA 1A78A 5C4WA 1IOAA 1BEV3 1EP0A 1OBNA 4AI0A 1S4CA 2EVXA 1LHVA 4KMQA 4GD4A 1S0FA 4YW2A 1V6MA 2QE3A 3T0AA 5ABJA 1EAH3 2WWJA 4HXCA 4N43C 3UNPA 2GP3A 3S5AA 2BW8A 2WC2A 5IAVA 1HJGA 2W1QA 2XBO2 2XLFA 1WLCA 5DABA 3ZM8A 4OHZA 4LNVA 1RTVA 4IEZA 1JYWA 1BCXA 1E5SA 2ZS6B 1OLMA 3DKQA 3DYOA 3LEGA 3TOJA 4NIDA 5EQUA 1QJY1 5C3RA 1DZQA 3CHXA 3V0AA 3KB5A 2J42A 2AZ5A 3VD4A 3N9QA 3M1HA 4B8EA 5JZGC 4O9EA 3VHPA 4YFWA 3MYXA 3I2OA 4UFKA 2A5ZA 1HB2A 1XYPA 3AMMA 1CIYA 1DBNA 4GB32 5E6HA 1W2OA 5HV4A 1HKDA 1OOPB 4MGIE 5IFPA 4XBQA 4BXSV 1G9FA 4PLNA 3GZEA 3GZTB 1C28A 4ISQA 5DAPA 2F4LA 3DPRB 3IZOA 4CCKA 1JI6A 1QDOA 1F5JA 2ZGLA 1ACCA 5FYVA 3NKTA 3KF5A 4ATEA 5CFCB 1ZBE1 3DXUA 5JR2A 1MR5A 4E8DA 2RJLA 2V72A 4IEUA 4BQ5A 1ENQA 2HWE3 5FY0A 1JXNA 3O1RA 3ILNA 5A3WA 2R1DA 3ZO0B 3THPA 3KT4A 3H9AA 3IDBB 4I01A 3R6SA 1NQDA 2W1SA 3I2HA 4JRAA 2ZEWA 1RUG3 3WEZA 1N1SA 4M3CF 2CWMA 2G9ZA 1DGRN 1GWMA 1UY1A 4XDQA 1Y3TA 2WYFA 2ZABA 1FV2A 5DAWA 1PVC3 5GALA 2BNMA 1HRV2 2C5DA 5LBEA 3ZIXA 1PO12 1UZZA 4KGQA 4M3CE 3HD8B 5C71A 1NOVA 4UW4A 2XVGA 1FPN3 4QHBA 5IVEA 1YIFA 4NRQA 1LGCA 2JXAA 4RHV2 1EUUA 2HEYF 3ON7A 4AHYA 4LUKA 2JG9C 4P9YA 4XFBA 4Y1ZA 2BBAA 2JDAA 5FZDA 3N9MA 5FKCA 3N7MA 3U10A 5C9AB 3K3NA 1MZ5A 1EAH1 1Y7BA 4XJ8A 4W6WA 3ST7A 2XLAA 2KD7A 4F7ZA 4FOYA 1S0BA 1GZTA 2J1TA 4YGEA 1W6NA 4DRVA 5BNPA 1UOJA 3FLPA 1VB4A 4PIXA 1H6XA 3WP4A 4Z1VA 5IVJA 5FZBA 1RVF1 3EQEA 4N53B 4Q2FA 3WDYA 2RDQA 4KWUA 5LA1A 3AJZA 4D6SA 2MNGA 5LATA 3OD4A 3T2PA 3U1XA 3SHRA 3OEBA 4HSLA 1I5ZA 2JDHA 1DGLA 3M4FA 3CJXA 4DUVA 2LRPA 2RDRA 2CL2A 3WW4A 4QXBA 1AJOA 1QXPA 4LIVA 4RYDA 4QQPA 5FPBA 4JZRA 4YGCA 3O1PA 1CN1A 1PVXA 1L3JA 5KHIA 3SH4A 1CAVA 2O14A 5JOXA 1QDCA 5FLIA 3RZKA 2WO7A 4BE3A 2R16A 1SHWB 1S0CA 3VBFB 2VULA 4HT1T 4Y5Z0 4XIKA 2ETEA 4BK5A 3DGTA 2HWE1 3U11A 4LUMA 5CZKA 3J9SA 3VBSA 2HEVF 5JSPA 2W87A 3WF3A 2GNBA 2HBTA 3OY8A 1VBC3 1W2UA 2NPIA 1VRH3 4Y20A 4CCCA 3KCCA 4YARA 3PU8A 1BBT3 4UW3A 1MZ6A 3VKLA 1RUG1 1IG3A 3D8CA 4IETA 4UWDA 5FZMA 4AI3A 1W0NA 3PVOA 3BPZA 1CAWA 1H9PA 3DUIA 4KWKA 4OVEA 4XVHA 3AKRA 1FXZA 5JWPA 3R4DB 1CJDA 2VXJA 5GLUA 3VKFC 4D6QA 1C8M1 1OPMA 3OSDA 2WFF2 5FFOC 1H2LA 1R1A3 1UAIA 1QNYA 4NRMA 2VW0A 1FPN1 3AMNA 1MVQA 1LHUA 1YRZA 5A7NA 5GZGA 3RWNA 2ARCA 3ZFFA 4NUBA 2HWF2 5EYXA 3ZXKA 5C3PA 1PK6A 1REFA 3N7KA 2B9VA 5EWSA 3BVCA 2C26A 5JZGB 2WWSA 4LO5B 4EQVA 4JDMA
chains in the Genus database with same CATH topology
1NKGA 1JZ4A 1PMHX 4A6OA 3T2QA 1JYVA 1JYXA 3VDAA 1OF4A 4XUTA 3DYMA 4GZ9A 2BGOA 4MO3M 4ARYA 3F2ZA 4XUNA 2QQJA 3T09A 5EIYB 4IUGA 1UWWA 2VO5A 2VZ1A 3A7QA 1JZ5A 2E31A 1PX4A 2C4XA 4BK4A 1L7QA 3A23A 3MV11 4QAWA 3EB7A 3GXUA 1JZ2A 1R64A 3NQHA 1MPXA 5JR2A 1F4HA 3C7HA 4CUBA 2DCJA 3WF0A 1UXXX 2VZ3A 1GOGA 5A1AA 4JX0A 2X09A 4KI5M 2W91A 4A42A 5IYYA 3CDZB 3T08A 3C7GA 2Y64A 2J7MA 4PQQA 1TG7A 2EIDA 4ZZ8A 1JZ8A 1JZ6A 4YPJA 3PUIA 1SG3A 1GU3A 2QQNA 1OH4A 2VM9A 2E33A 3C7OA 3HN3A 2YC4A 4E8CA 4GWIA 2VZQA 2Z4FA 5JUVA 4FI9A 1NX9A 1UX7A 4BDVB 2VMFA 2V5DA 1UYZA 3T0BA 2DDUA 2ZXQA 4LPLA 2WO3A 1CZSA 1H6YA 1KGYA 3HEIA 3K77A 2RJ2A 2JE8A 3NRUA 2BERA 2V4VA 1XNAA 5DQ0A 2QQKA 3LEKA 5JXHA 2VZRA 2ORXA 3ECQA 2W95A 4M4RA 4P5YA 3K75B 3LEIA 1J83A 3MV01 3VD3A 5IHRA 2CDOA 2Y6HA 3PUHA 4QX1A 3D3AA 2EICA 4OYUA 1KEXA 3WNOA 5JXGA 4QX2A 4DXRA 4LHSA 1P8JA 5IFTA 2RV9A 3ETPA 3U37A 1JU4A 2WN3A 2VZTA 4UOJA 3ABZA 2VMDA 1ULOA 3LQCA 3IAQA 3OB8A 1O59A 1PMJX 3ACGA 2B4KA 4A3ZA 5I0DA 3LPGA 1UY4A 2ORZA 5JXJA 2W94A 2WYSA 5LCWL 3OGSA 2VCCA 3HJRA 2VZUA 3P1IA 4L0PA 3WF2A 5DPNA 1GNYA 3OGVA 4A41A 1UMIA 1L7RA 3FHAA 2QBXA 4UAPA 4A45A 1JU3A 3IB3A 3LPFA 4Z2AA 5JMOA 4DEQA 4MOAA 4W4ZA 1K45A 3T2OA 5HPOA 2XONA 5FUIA 3GDBA 3GGLA 2W1UA 4M4PA 2XOMA 4ZY9A 1OT5A 3ACIA 2WDBA 5EJZB 4D8MA 2W47A 2VTFA 3WNNA 2ZEXA 1K3IA 2QQMA 2WZEA 2WABA 4MGSA 3WQBA 1DP0A 4OUEA 5LA0A 1UY0A 1W99A 2VOTA 1JYNA 4QX3A 1ULPA 5DMYA 2YB7A 2EIBA 2WAAA 5EJ1B 4CU6A 4JKMA 2Y6KA 1IQDC 3BN6A 1UY3A 3C8XA 1XPWA 3W5NA 1O8SA 2VL4A 1DLCA 3K4DA 3WNMA 2VMCA 3DECA 4QDQA 1XC6A 3A21A 2W3JA 1NUKA 2PQSA 2VMEA 3DYPA 3I2IA 5B4NA 4RN5A 3K4ZA 2OKXA 4DUWA 4P00B 4ET7A 1UXZA 2VZPA 4DUVA 3FN9A 3CIHA 3IIIA 1W8NA 3OEAA 1T2XA 3CMGA 3VD5A 4UI9L 5F7UA 3T0DA 3MUY1 4QX0A 3THDA 3SKJE 4DXSA 1UYYA 4CVUA 3W5MA 1JHJA 3MBWA 2W92A 5C70A 3I3BA 1OF3A 2DCKA 4BJ0A 2XHNA 4XUQA 2W5FA 2X05A 2CDPA 2E32A 1CX1A 3IAPA 3JXSA 1NAEA 1JYWA 3C7EA 2LS6A 3NJVA 4MADA 1JZ3A 4DUXA 4GWJA 2WO2A 1OD3A 2VQTA 3CZUA 2RVAA 3HPNA 4W8JA 1CZTA 5B4XA 1HN1A 3I97A 4XZUG 3NNGA 2VR4A 3BGAA 2J1SA 4A4AA 3EYPA 5DN2A 1W9SA 2E26A 1J84A 1UYXA 3CZJA 3I3DA 4CU7A 2QQOA 3FHQA 2LW8A 2QQIA 4TTGA 1SDDB 2L9LA 2WO1A 4OMDA 3C7FA 2J1EA 3IDAA 1US3A 3SKVA 3FL7A 1PX3A 1K12A 4CUAA 1JZ7A 1UZ0A 1I5PA 3HNBM 2BGPA 3ACHA 2R7EB 4CUCA 4A44A 2VC9A 1US2A 1W8OA 2J1UA 2VCAA 2YC2A 2YFZA 2WZ8A 2J22A 3NJXA 4DEVA 2ZEZA 2HYXA 4KMQA 4XUOA 1GOHA 2VCBA 3T0AA 3UNPA 2Y6LA 2VZVA 1BHGA 2VZSA 1GUIA 4TXWA 1D7PM 1W9WA 2W1QA 3UESA 3VD7A 3ZM8A 4JKKA 5G04L 3LEGA 3DYOA 3HNYM 2XQXA 3SEPA 2QQLA 2WUHA 2Y8KA 3VD4A 3WNPA 1W9TA 1UY2A 4ZZ5A 3AC0A 2VQUA 1CIYA 3E1F1 5IFPA 4BXSV 1GQPA 2W46A 4QDSA 3WF4A 1JI6A 3I2KA 3I2FA 2BZDA 3I3EA 4PT6A 2WQ8A 4P08A 4E8DA 2V72A 3LE0A 5HXMA 1K42A 4LQRA 1YQ2A 3I2JA 3SEEA 3A22A 4JKLA 3VDBA 4CU9A 2W1SA 3I2HA 2ZEWA 3WEZA 3P6BA 1UY1A 1TVGA 1EUTA 2J1RA 4XUPA 2YFUA 4QB1A 2W1WA 3J7HA 4ARXA 4OMCA 5C71A 3CKHA 4QPWA 2WN2A 4XURA 1WKYA 3OBAA 1EUUA 4CU8A 3HOBA 2BBAA 2JDAA 1XNTA 3ACFA 2Y6GA 4QDRA 2KD7A 2J1TA 1H6XA 1UMHA 2YG0A 1CZVA 5JXIA 4QB6A 4KWUA 4D0QA 5LA1A 2VZOA 3WNLA 2Y6JA 4W50A 5G05L 1GMMA 3T2PA 2JKXA 2ZEYA 3OEBA 2HLEA 1WCQA 3MUZ1 4LKSA 3WNKA 3OGRA 4RYDA 2EIEA 3WSOA 1F4AA 4ZXEA 3WF1A 2WBKA 5J1XA 4DXTA 3UETA 2J1AA 1SHWB 3MO4A 2W9XA 3K46A 4OZOA 4BK5A 3THCA 5CZKA 5C7GA 1GOFA 2VJXA 2X10A 2W87A 3WF3A 4HG6B 3GM8A 3VD9A 2J1VA 3CQOA 4AG4A 1O8PA 1LNSA 1DYOA 5IJRA 2JD9A 3OG2A 5LA2A 1W0NA 4PF1A 4XVHA 2ID4A 3I2GA 2WAOA 5CYYA 4QB2A 2C9KA 4P02B 3VDCA 1RYYA 4JHZA 4MGQA 3K4AA 3HNMA 2B9VA 2C26A 4AAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NKG A;  1JZ4 A;  1PMH X;  4A6O A;  3T2Q A;  1JYV A;  1JYX A;  3VDA A;  1OF4 A;  4XUT A;  3DYM A;  4GZ9 A;  2BGO A;  4MO3 M;  4ARY A;  3F2Z A;  4XUN A;  2QQJ A;  3T09 A;  5EIY B;  4IUG A;  1UWW A;  2VO5 A;  2VZ1 A;  3A7Q A;  1JZ5 A;  2E31 A;  1PX4 A;  2C4X A;  4BK4 A;  1L7Q A;  3A23 A;  3MV1 1;  4QAW A;  3EB7 A;  3GXU A;  1JZ2 A;  1R64 A;  3NQH A;  1MPX A;  5JR2 A;  1F4H A;  3C7H A;  4CUB A;  2DCJ A;  3WF0 A;  1UXX X;  2VZ3 A;  1GOG A;  5A1A A;  4JX0 A;  2X09 A;  4KI5 M;  2W91 A;  4A42 A;  5IYY A;  3CDZ B;  3T08 A;  3C7G A;  2Y64 A;  2J7M A;  4PQQ A;  1TG7 A;  2EID A;  4ZZ8 A;  1JZ8 A;  1JZ6 A;  4YPJ A;  3PUI A;  1SG3 A;  1GU3 A;  2QQN A;  1OH4 A;  2VM9 A;  2E33 A;  3C7O A;  3HN3 A;  2YC4 A;  4E8C A;  4GWI A;  2VZQ A;  2Z4F A;  5JUV A;  4FI9 A;  1NX9 A;  1UX7 A;  4BDV B;  2VMF A;  2V5D A;  1UYZ A;  3T0B A;  2DDU A;  2ZXQ A;  4LPL A;  2WO3 A;  1CZS A;  1H6Y A;  1KGY A;  3HEI A;  3K77 A;  2RJ2 A;  2JE8 A;  3NRU A;  2BER A;  2V4V A;  1XNA A;  5DQ0 A;  2QQK A;  3LEK A;  5JXH A;  2VZR A;  2ORX A;  3ECQ A;  2W95 A;  4M4R A;  4P5Y A;  3K75 B;  3LEI A;  1J83 A;  3MV0 1;  3VD3 A;  5IHR A;  2CDO A;  2Y6H A;  3PUH A;  4QX1 A;  3D3A A;  2EIC A;  4OYU A;  1KEX A;  3WNO A;  5JXG A;  4QX2 A;  4DXR A;  4LHS A;  1P8J A;  5IFT A;  2RV9 A;  3ETP A;  3U37 A;  1JU4 A;  2WN3 A;  2VZT A;  4UOJ A;  3ABZ A;  2VMD A;  1ULO A;  3LQC A;  3IAQ A;  3OB8 A;  1O59 A;  1PMJ X;  3ACG A;  2B4K A;  4A3Z A;  5I0D A;  3LPG A;  1UY4 A;  2ORZ A;  5JXJ A;  2W94 A;  2WYS A;  5LCW L;  3OGS A;  2VCC A;  3HJR A;  2VZU A;  3P1I A;  4L0P A;  3WF2 A;  5DPN A;  1GNY A;  3OGV A;  4A41 A;  1UMI A;  1L7R A;  3FHA A;  2QBX A;  4UAP A;  4A45 A;  1JU3 A;  3IB3 A;  3LPF A;  4Z2A A;  5JMO A;  4DEQ A;  4MOA A;  4W4Z A;  1K45 A;  3T2O A;  5HPO A;  2XON A;  5FUI A;  3GDB A;  3GGL A;  2W1U A;  4M4P A;  2XOM A;  4ZY9 A;  1OT5 A;  3ACI A;  2WDB A;  5EJZ B;  4D8M A;  2W47 A;  2VTF A;  3WNN A;  2ZEX A;  1K3I A;  2QQM A;  2WZE A;  2WAB A;  4MGS A;  3WQB A;  1DP0 A;  4OUE A;  5LA0 A;  1UY0 A;  1W99 A;  2VOT A;  1JYN A;  4QX3 A;  1ULP A;  5DMY A;  2YB7 A;  2EIB A;  2WAA A;  5EJ1 B;  4CU6 A;  4JKM A;  2Y6K A;  1IQD C;  3BN6 A;  1UY3 A;  3C8X A;  1XPW A;  3W5N A;  1O8S A;  2VL4 A;  1DLC A;  3K4D A;  3WNM A;  2VMC A;  3DEC A;  4QDQ A;  1XC6 A;  3A21 A;  2W3J A;  1NUK A;  2PQS A;  2VME A;  3DYP A;  3I2I A;  5B4N A;  4RN5 A;  3K4Z A;  2OKX A;  4DUW A;  4P00 B;  4ET7 A;  1UXZ A;  2VZP A;  4DUV A;  3FN9 A;  3CIH A;  3III A;  1W8N A;  3OEA A;  1T2X A;  3CMG A;  3VD5 A;  4UI9 L;  5F7U A;  3T0D A;  3MUY 1;  4QX0 A;  3THD A;  3SKJ E;  4DXS A;  1UYY A;  4CVU A;  3W5M A;  1JHJ A;  3MBW A;  2W92 A;  5C70 A;  3I3B A;  1OF3 A;  2DCK A;  4BJ0 A;  2XHN A;  4XUQ A;  2W5F A;  2X05 A;  2CDP A;  2E32 A;  1CX1 A;  3IAP A;  3JXS A;  1NAE A;  1JYW A;  3C7E A;  2LS6 A;  3NJV A;  4MAD A;  1JZ3 A;  4DUX A;  4GWJ A;  2WO2 A;  1OD3 A;  2VQT A;  3CZU A;  2RVA A;  3HPN A;  4W8J A;  1CZT A;  5B4X A;  1HN1 A;  3I97 A;  4XZU G;  3NNG A;  2VR4 A;  3BGA A;  2J1S A;  4A4A A;  3EYP A;  5DN2 A;  1W9S A;  2E26 A;  1J84 A;  1UYX A;  3CZJ A;  3I3D A;  4CU7 A;  2QQO A;  3FHQ A;  2LW8 A;  2QQI A;  4TTG A;  1SDD B;  2L9L A;  2WO1 A;  4OMD A;  3C7F A;  2J1E A;  3IDA A;  1US3 A;  3SKV A;  3FL7 A;  1PX3 A;  1K12 A;  4CUA A;  1JZ7 A;  1UZ0 A;  1I5P A;  3HNB M;  2BGP A;  3ACH A;  2R7E B;  4CUC A;  4A44 A;  2VC9 A;  1US2 A;  1W8O A;  2J1U A;  2VCA A;  2YC2 A;  2YFZ A;  2WZ8 A;  2J22 A;  3NJX A;  4DEV A;  2ZEZ A;  2HYX A;  4KMQ A;  4XUO A;  1GOH A;  2VCB A;  3T0A A;  3UNP A;  2Y6L A;  2VZV A;  1BHG A;  2VZS A;  1GUI A;  4TXW A;  1D7P M;  1W9W A;  2W1Q A;  3UES A;  3VD7 A;  3ZM8 A;  4JKK A;  5G04 L;  3LEG A;  3DYO A;  3HNY M;  2XQX A;  3SEP A;  2QQL A;  2WUH A;  2Y8K A;  3VD4 A;  3WNP A;  1W9T A;  1UY2 A;  4ZZ5 A;  3AC0 A;  2VQU A;  1CIY A;  3E1F 1;  5IFP A;  4BXS V;  1GQP A;  2W46 A;  4QDS A;  3WF4 A;  1JI6 A;  3I2K A;  3I2F A;  2BZD A;  3I3E A;  4PT6 A;  2WQ8 A;  4P08 A;  4E8D A;  2V72 A;  3LE0 A;  5HXM A;  1K42 A;  4LQR A;  1YQ2 A;  3I2J A;  3SEE A;  3A22 A;  4JKL A;  3VDB A;  4CU9 A;  2W1S A;  3I2H A;  2ZEW A;  3WEZ A;  3P6B A;  1UY1 A;  1TVG A;  1EUT A;  2J1R A;  4XUP A;  2YFU A;  4QB1 A;  2W1W A;  3J7H A;  4ARX A;  4OMC A;  5C71 A;  3CKH A;  4QPW A;  2WN2 A;  4XUR A;  1WKY A;  3OBA A;  1EUU A;  4CU8 A;  3HOB A;  2BBA A;  2JDA A;  1XNT A;  3ACF A;  2Y6G A;  4QDR A;  2KD7 A;  2J1T A;  1H6X A;  1UMH A;  2YG0 A;  1CZV A;  5JXI A;  4QB6 A;  4KWU A;  4D0Q A;  5LA1 A;  2VZO A;  3WNL A;  2Y6J A;  4W50 A;  5G05 L;  1GMM A;  3T2P A;  2JKX A;  2ZEY A;  3OEB A;  2HLE A;  1WCQ A;  3MUZ 1;  4LKS A;  3WNK A;  3OGR A;  4RYD A;  2EIE A;  3WSO A;  1F4A A;  4ZXE A;  3WF1 A;  2WBK A;  5J1X A;  4DXT A;  3UET A;  2J1A A;  1SHW B;  3MO4 A;  2W9X A;  3K46 A;  4OZO A;  4BK5 A;  3THC A;  5CZK A;  5C7G A;  1GOF A;  2VJX A;  2X10 A;  2W87 A;  3WF3 A;  4HG6 B;  3GM8 A;  3VD9 A;  2J1V A;  3CQO A;  4AG4 A;  1O8P A;  1LNS A;  1DYO A;  5IJR A;  2JD9 A;  3OG2 A;  5LA2 A;  1W0N A;  4PF1 A;  4XVH A;  2ID4 A;  3I2G A;  2WAO A;  5CYY A;  4QB2 A;  2C9K A;  4P02 B;  3VDC A;  1RYY A;  4JHZ A;  4MGQ A;  3K4A A;  3HNM A;  2B9V A;  2C26 A;  4AAX A; 
#chains in the Genus database with same CATH topology
 1DYK A;  3RRD A;  3QOP A;  4DOU A;  1JYV A;  2Y6F A;  1HW5 A;  4RQP A;  2DWR A;  3WDX A;  1XE7 A;  2NZ9 A;  5FYS A;  3VKN A;  4XUT A;  1H0B A;  4LHK A;  4YGB A;  2BGO A;  3B3Q E;  4MO3 M;  1BXH A;  5FUP A;  5T5L A;  4NPR A;  3T09 A;  3C2U A;  4LIU A;  5BNN B;  3JUU A;  4IV3 A;  5CAD A;  2PLV 1;  3SCH A;  3BI3 A;  4IUG A;  1XJA A;  4XBN A;  1H1A A;  3L2Y A;  3GJA A;  1AVB A;  2D98 A;  2VZ1 A;  4HK8 A;  1AYN 1;  1NZC A;  1A8D A;  4XQD A;  3A7Q A;  2WNU C;  1YHF A;  3F95 A;  4C0B A;  4BK4 A;  1L7Q A;  2QQW A;  2MPF A;  3WLU A;  4BQ1 A;  5J37 A;  2H0B A;  2R32 A;  4FQZ A;  3N35 A;  5FYT A;  1GR3 A;  5EXO A;  2PAM A;  4TLF A;  5GKA C;  3VGI A;  4CUB A;  3IBM A;  2DCJ A;  3Q8A A;  2PHW A;  3NNJ A;  4LKD A;  3SCF A;  3WF0 A;  4Q4W 2;  5CKN A;  4OI4 A;  4Y3O A;  2QVS B;  5FP9 A;  4CSW A;  1JOJ A;  1Q8O A;  2BWA A;  1ZBE 2;  4KI5 M;  5FYH A;  4UXA A;  3DXT A;  3NO8 A;  4XZP A;  1OUX A;  3T08 A;  2JE9 A;  1W39 A;  3C7G A;  5FY7 A;  2WT0 A;  4PQQ A;  1TG7 A;  1S2E A;  3OCP A;  1XNB A;  2GMP A;  1H2N A;  1JZ6 A;  1VBC 1;  1UKG A;  1VRH 1;  4YPJ A;  1BBT 1;  1DCS A;  4Q0S A;  2JG9 B;  2OUH A;  4CP9 B;  3UT0 A;  1ENS A;  1QQP 3;  2AGS A;  2Y0O A;  4GAZ A;  2BU9 A;  4MVT A;  5FP7 A;  5J09 A;  5DUW A;  3WT3 A;  5FMO L;  4XIO A;  3C7O A;  3VBH A;  4E8C A;  2GDF A;  3ZR6 A;  3ZXL A;  2VZQ A;  2XXZ A;  2Z4F A;  2JIJ A;  2ZHL A;  5CU1 A;  1R1A 1;  1Q8P A;  3OYW A;  1T6B X;  5JSO A;  2I07 B;  5F5C A;  1WD3 A;  5F39 A;  2R06 1;  2GC2 A;  3KCY A;  4QKF A;  5E8A A;  4BDV B;  2VMF A;  2V5D A;  5I93 A;  3JD7 1;  2EAA A;  1GZC A;  1WUV A;  4JGY C;  2DDU A;  1ND2 A;  1ALY A;  4COV A;  3WDV A;  2Q8E A;  5JI9 A;  1BEV 2;  1X8M A;  4XDP A;  3ZKY A;  1CZS A;  2VQA A;  1SLC A;  1RJ8 A;  1NT0 A;  3ZXF A;  4CEW C;  1EAH 2;  1JZ2 A;  3VL8 A;  4PCR A;  5HCB A;  3R0R A;  5FZA A;  1PHM A;  3N9P A;  2IXC A;  5A3N A;  5A7Q A;  3D6E A;  4A6S A;  4LMF A;  3ECQ A;  3ITQ A;  1C1L A;  1X50 A;  4FQ4 A;  1H2M A;  4P5Y A;  3RZZ A;  5FV3 A;  1J83 A;  1FNY A;  4IEX A;  3UK9 A;  2BPA 2;  3WHU A;  5JOZ A;  4Q4V 3;  5FP8 A;  5A6X A;  4PBO A;  2Y6H A;  2ZGP A;  2JKB A;  1QU0 A;  5GZC A;  2NYY A;  5KXD A;  2EIC A;  2IXL A;  4OYU A;  3V0B A;  1ZRF A;  1RMU 3;  2K46 A;  3BPS A;  3WNO A;  3NAP A;  3SH3 A;  3MHZ A;  4BME A;  1U5X A;  2RV9 A;  3ETP A;  3T1L A;  5T50 A;  4NIH A;  2FCT A;  1LAJ A;  1CR7 A;  1IG0 A;  4B4Q A;  1H4H A;  2P3I A;  1EPW A;  1IKQ A;  3ABZ A;  4HKL A;  4BWO A;  1F2N A;  3LOI A;  2Q8C A;  5IVC A;  4BMB A;  2E6V A;  4RL7 A;  3IAQ A;  2MHF A;  5FOB B;  2C0Z A;  4FFI A;  1PGW 1;  4RR3 A;  1A8M A;  4DNY A;  2VVE A;  4LBQ B;  1LCL A;  1IS3 A;  2B4K A;  3JB4 C;  4YYO A;  4M3C A;  1ZRI A;  5FYZ A;  1BKZ A;  2FDG A;  1IPS A;  5F6K A;  3FBY A;  4LOT A;  1YNA A;  2AEN A;  2HWE 2;  1I6X A;  5BXX A;  2ORZ A;  4D94 A;  4EWE A;  2WYS A;  1XNK A;  4FOQ A;  4NHL A;  4MXV A;  4HET A;  3HQR A;  3WG4 A;  1ZRC A;  1GP6 A;  3AP9 A;  4CEY C;  4RA0 A;  1RUG 2;  3B94 A;  3ETQ A;  4XQ4 A;  4WVM B;  3JQX A;  4ZON A;  5GZE A;  4O65 A;  5J48 A;  5KHJ A;  5DPN A;  1GNY A;  2XML A;  1PVC 2;  3ORJ A;  1UMI A;  1D2S A;  5F5Q A;  2QBX A;  2TNF A;  1OA2 A;  5CEH A;  2ZGR A;  4I30 A;  3T4V A;  1GWK A;  4XC9 A;  5I8T A;  5JMO A;  1FPN 2;  1T6G C;  1X36 A;  4J1W A;  3WW2 A;  1BMV 1;  3MIF A;  2QDR A;  3IT8 A;  3WP3 A;  1Q43 A;  1RUD 3;  3ZX7 A;  4R9A A;  2ZX4 A;  2R07 3;  4ZS2 A;  4AHW A;  3O1T A;  1AL0 G;  3S7E A;  5LW9 A;  1NA1 C;  3N9L A;  4QXH A;  2W47 A;  3KV5 A;  4QU1 A;  3NV4 A;  4FTS A;  4COZ A;  4AED B;  2UYA A;  3WX5 A;  2YRO A;  2GN3 A;  3OJB A;  4FPY A;  1Q56 A;  4Q4Y 3;  2WAB A;  1WLT A;  4AGG A;  2RS5 3;  3AP7 A;  3OPW A;  4Q4V 1;  4XF4 A;  1DP0 A;  3WQB A;  3ZFE B;  3N7J A;  2SLI A;  4B1M A;  4QGL A;  2AH2 A;  4GKY A;  1PNF A;  2AEZ A;  4PF5 A;  3ES4 A;  3POI A;  4IEW A;  1W99 A;  2ZKN A;  5H9S A;  4AFM A;  5T3N A;  5FAX A;  1RMU 1;  2QNK A;  2VQ0 A;  4LA2 A;  1ND3 A;  5FYM A;  4AFA A;  1OA4 A;  5DMY A;  1O3Q A;  3JCI A;  3P3N A;  4CA9 A;  1Q8V A;  1O3T A;  1NXD 1;  1SLI A;  3R4U A;  4HKO A;  3UJQ A;  3BOP A;  1VPH A;  1AXZ A;  2YV8 A;  1UY3 A;  1ONA A;  1UNB A;  4XCA A;  5I0U A;  3RPQ A;  2D3P A;  2ZX3 A;  4YZ5 A;  1GP4 A;  1O8S A;  2VL4 A;  1DLC A;  4YGD A;  1MEC 1;  4QDQ A;  1TQ5 A;  2IWG B;  3K3O A;  3ZYG A;  3NKG A;  4WVV A;  4BZ4 A;  2DUO A;  4WM8 A;  4HZF A;  3DYP A;  1Y9M A;  5F32 A;  3AYC A;  4EN8 B;  3HN1 A;  3VBO A;  4NMI A;  4LHN A;  1VBC 2;  1ZZ7 A;  2FD8 A;  1VRH 2;  2RHP A;  2VZP A;  4J1X A;  3CIH A;  3ZXE A;  2XJR A;  1BBT 2;  5A1L A;  5FYY A;  3B01 A;  3WDW A;  2DUR A;  5K7P A;  4R9D A;  3MZH A;  1T2X A;  3CMG A;  5C8C A;  1UU6 A;  4UI9 L;  3ZXJ A;  4AK3 A;  4N7U A;  3T0D A;  3MUY 1;  3THD A;  4FOV A;  4YFZ A;  2DU1 A;  4YVS C;  4CDQ A;  2W92 A;  1CAX A;  2XJV A;  4L8Q A;  1R1A 2;  1RHI 2;  2MEV 3;  4E9K A;  2YBP A;  5JIU A;  1HN0 A;  5LK5 A;  5FZ6 A;  4DY5 A;  2DCK A;  3ROU A;  5FZ4 A;  2TEP A;  2XHN A;  1DQ1 A;  4DMI A;  2W5F A;  1WCU A;  2YGM A;  2X05 A;  1RUD 1;  1VMJ A;  4B4R A;  2E32 A;  2EAK A;  3IAP A;  3GZU C;  1CPM A;  1NAE A;  1QXR A;  3JXS A;  1J1L A;  4ZU5 A;  1NCR C;  1TME 3;  2R07 1;  1SLB A;  4HN1 A;  4MAD A;  1FX5 A;  1PGS A;  4YM0 A;  4CRQ A;  4XFG A;  2WO2 A;  3GF6 A;  2PHU A;  4K8F A;  4YW3 A;  3ME2 A;  2Q0A A;  5DZE A;  1OLM E;  3GBG A;  3AKS A;  4Q4X 3;  1QJX 1;  1SCR A;  4XZU G;  3BGA A;  4QPG B;  1SAC A;  2ZHN A;  3FE5 A;  3CJI B;  2RS5 1;  5C3Q A;  3RZM A;  3U4X A;  1Y9Q A;  2E26 A;  2WNV B;  4E27 A;  3CZJ A;  3I3D A;  4IDZ A;  2P3J A;  1N3Q A;  2NMO A;  4LBK A;  3RQ0 A;  4MGT A;  2Q4S A;  4XXA A;  1BK0 A;  3OGG A;  4R9B A;  5SV5 A;  2BNN A;  2ENR A;  5IK7 A;  1W6P A;  3MIE A;  4AVS A;  2WO1 A;  1AL2 3;  3IDA A;  1ZZB A;  4KL1 A;  3GZA A;  3SMH A;  3ZN6 B;  4RFT 0;  5EFU A;  5F3I A;  1AR9 3;  2JG8 A;  1I5P A;  4WZF A;  1PGW 2;  1W28 A;  2OA2 A;  4A44 A;  1V6O A;  2WII B;  1O3R A;  3PMS A;  3J8F 3;  3NV3 A;  3OPZ A;  1US2 A;  2J1U A;  1H2K A;  5K0U C;  2P6H A;  4CZS A;  1ULC A;  2VCA A;  3BCW A;  5JDB A;  2VEC A;  5KC6 A;  3TEX A;  5CAZ A;  2AYH A;  4XJ9 A;  4CDU C;  1NE4 A;  2LUW A;  2WJS A;  2J22 A;  1K5M A;  2IXI A;  1COV 3;  3MIC A;  3RZG A;  1I9R A;  4LO8 A;  4Y26 A;  4FPO B;  5FZG A;  1AX0 A;  1QQP 2;  2HYX A;  2WNE A;  1R09 3;  2JDY A;  1IS5 A;  4C90 A;  1GOH A;  4OUL A;  2VCB A;  5K9Y A;  1DGW A;  4MXW B;  1DQ2 A;  1UU4 A;  1VBB 3;  2UYB A;  2E7T A;  1BHG A;  3NNM A;  5FZF A;  2VZS A;  1GUI A;  2MEV 1;  2ARB A;  1W9W A;  2ZGU A;  2BBV A;  2D7F A;  3LFI A;  5L7O B;  3WP6 A;  1BMV 2;  5FQ0 B;  4HPK B;  3ZSL A;  3PIJ A;  1FAY A;  4H14 A;  3I59 A;  1QOO A;  1XU2 A;  3OUJ A;  5KHK A;  3HNY M;  5F8P A;  1TME 1;  2X5I A;  4IV1 A;  5C4W B;  4N90 A;  4Q0P A;  3WNP A;  2VUC A;  4ZZ5 A;  2ZOE B;  3H8R A;  1UD1 A;  5JOW A;  1UO9 A;  5JVV A;  2XG3 A;  1QY4 A;  5K4L A;  4IEY A;  2R1B A;  4PHZ A;  3E1F 1;  2JDK A;  4WM7 C;  5FZI A;  1NQJ A;  1E5I A;  1ULF A;  1X9T A;  2ATF A;  4QDS A;  4XEZ A;  3BOW A;  3B93 A;  3WF4 A;  3POJ A;  3RGB A;  3IDC B;  2VPV A;  1OOP C;  1QJU 3;  3LA2 A;  5FZ0 A;  3QH7 A;  1RMU 2;  3PJQ A;  3DPR C;  4MHR A;  2D44 A;  1F31 A;  4TYS A;  3MIH A;  1BJQ A;  1CWP A;  1JOB A;  4ISR A;  1ZA4 A;  3SC7 X;  1HRI 3;  4ASK A;  5HXM A;  1VAL A;  1YQ2 A;  3A22 A;  4B1L A;  4CCD A;  4LBN A;  4MGK E;  5CFC C;  3UGG A;  2D6L X;  5FBJ A;  1LEN A;  3VDB A;  4C1W A;  3R4S A;  4ES9 A;  3MF9 A;  3IKW A;  1AR9 1;  4IE6 A;  4ASL A;  5HI0 A;  2EF6 A;  3POW A;  4EN9 B;  1WWY A;  5FCC A;  1YJL A;  4QD2 A;  5FZ3 A;  4KWJ A;  1MVE A;  1DYP A;  1MS4 A;  4GAL A;  1GZ9 A;  3VBR A;  2V5Y A;  2VOX A;  2P37 A;  2RE9 A;  1X9P A;  4KG8 A;  2J1R A;  2HBU A;  4Y22 B;  1XXN A;  4QXC A;  5B2G B;  4NVP A;  4PQ9 A;  1KDM A;  3CKH A;  4YG0 A;  1D2Q A;  3VKO A;  2FCU A;  3OBA A;  2ILM A;  5F5A A;  2VH9 A;  4AEJ A;  3AYD A;  2E7A A;  1BK1 A;  1NCR B;  1RUI 3;  1UU5 A;  4AHX A;  4G9S B;  4IW3 A;  1PGL 2;  1XSQ A;  2Q1Z B;  2PTM A;  2ZBJ A;  1QJY 3;  1VBB 1;  2DFC A;  3ACF A;  4JGZ A;  5DG2 A;  1LOE A;  4PBP A;  3H1W A;  3PVB B;  1DGR A;  4L92 A;  4QX8 A;  4IE5 A;  2VNV A;  1OVS A;  1ZNP A;  2D6N A;  4AVA A;  3W20 A;  3AMH A;  3SQO A;  3MF6 A;  2FQP A;  5FOJ B;  1UMH A;  3NL1 A;  3B02 A;  4PJY A;  1RUD 2;  1XYO A;  1ZZ9 A;  3DV8 A;  5FXX A;  1DGW X;  5JXI A;  5F2W A;  2R07 2;  4D0Q A;  1SLA A;  3WNL A;  4N53 C;  1HJF A;  4I0W B;  4W50 A;  1SBF A;  4L97 A;  5FJH A;  1H8T A;  3ZOI A;  2V4A A;  2ZEY A;  5KHH A;  4I0B A;  3HIF A;  1SFN A;  3BTY A;  3MUZ 1;  2ET7 A;  2P17 A;  2I2S A;  4Q4Y 2;  1W6N B;  5BNP B;  1VRB A;  4I0A A;  3H0O A;  1RUJ 3;  3ZFG A;  5IVB A;  2RS5 2;  2PHX A;  5BPX A;  3IM0 A;  2EIE A;  4Y5T A;  3WCR A;  3WSO A;  3WF1 A;  3PVE A;  1VAK A;  2QUO A;  4LO7 A;  3BUC A;  4UFL A;  5J1X A;  1QJU 1;  4LBO A;  3HBZ A;  4GMP 3;  2I74 A;  5FPA A;  1GLH A;  1KIT A;  5C8W A;  1HV1 A;  3ZYH A;  4N9H A;  2D3R A;  4Q0U A;  2JIC A;  3WY6 A;  1Z0H A;  4AFD A;  1QHD A;  2DV9 A;  3LZZ A;  4OZO A;  5L19 A;  1HRI 1;  4ITC A;  3UV9 A;  1AR6 2;  3THC A;  2D6M A;  1C57 A;  5C7G A;  2RM2 3;  2RR1 1;  4YZ1 A;  2E7Q A;  1QMJ A;  4ORF A;  4HG6 B;  4R4X A;  5GZD A;  4Q0Q A;  2JEN A;  2XL7 A;  3CQO A;  4HON A;  1O8P A;  4OQ9 A;  1LNS A;  4CDW A;  3S6P A;  5L9V A;  2XQR A;  3I3Q A;  4LKE A;  3OG2 A;  2LAL A;  1LOD A;  3HT2 A;  3J7M A;  1OUR A;  3OTF A;  3I2G A;  4Z92 B;  4AI2 A;  4D7Y A;  1DU3 D;  4GKX A;  4KG0 A;  2KXL A;  3GNE A;  4EN0 A;  4AXO A;  4P02 B;  4FXK B;  1W2N A;  1HIX A;  1PZ8 A;  3VBS B;  4BB3 A;  4K7J A;  3PNA A;  1NY7 2;  3SH5 A;  2ADE A;  5A7W A;  4MGQ A;  1RUO A;  1RUI 1;  3I7D A;  1W8H A;  4Y20 B;  1GSL A;  1RVF 3;  4QQO A;  3JQW A;  1W3V A;  1W2T A;  4MSV A;  3HNM A;  3LIH A;  3HR9 A;  5APA A;  4OHY A;  1CAW B;  4IE0 A;  2FZ1 A;  3PU3 A;  2DU0 A;  2IVI B;  2MEV 2;  1XE0 A;  2XR4 A;  4QPI A;  4CXY A;  4A6O A;  2ZMN A;  3INA A;  2A6Y A;  3A0K A;  3VBU A;  5BNQ A;  3AK0 A;  4WM7 B;  1JYX A;  1KFU L;  2A6Z A;  1OF4 A;  4GH4 B;  3WR0 A;  1JYI A;  4IEP A;  2ZX1 A;  1TME 2;  3ZFF B;  3M3I A;  5EIY B;  2CAV A;  1PK6 B;  3FJS A;  4XF1 A;  5CIS A;  2GND A;  1WCK A;  2HYK A;  3H1M A;  4CDX C;  4RS5 C;  4Q29 A;  3WVJ A;  5BNN C;  4Q4X 2;  4UW6 A;  4N7I A;  2E31 A;  3FLT A;  2C4X A;  4AVB A;  2WNO A;  3RI8 A;  3UKN A;  1RUJ 1;  4RQP B;  4XF0 A;  4HBN A;  1RUH 3;  5HCH A;  4GMP 0;  3AVR A;  4BIS A;  4HSJ A;  2Z42 A;  3C7H A;  4GMP 1;  1UXX X;  5L9B A;  3TRS B;  2VZ3 A;  4BQ4 A;  1VP6 A;  4QKB A;  4JX0 A;  4YZ3 A;  1EV1 2;  2W91 A;  4A42 A;  1UZY A;  4XBL A;  4XFC A;  3AZX A;  5IYY A;  3CBN A;  4XW3 A;  3BYW A;  1AL2 2;  1AYM 3;  2GP5 A;  2K0G A;  4UBH A;  2RM2 1;  1NE6 A;  4ZXK A;  1D0H A;  3AFG A;  4EE2 A;  1ZRD A;  1C8M 3;  3DL3 A;  3Q9O A;  1RJ7 A;  4DZG A;  3PUI A;  3POS A;  1AR9 2;  4C1X A;  1WCS A;  5A33 A;  1O91 A;  1OH4 A;  1QIQ A;  4KH9 A;  1WW5 A;  4D7S A;  3PVN A;  2E33 A;  4OLL A;  4CPB D;  3J8F 2;  4YW5 A;  4AFB A;  2PYT A;  2WL1 A;  3H8O A;  1W6M A;  4GWI A;  3H3Z A;  5JUV A;  4NWW A;  4N8M A;  4Y4Y A;  1MS3 A;  4FI9 A;  4B4P A;  1N3P A;  1COV 2;  1UYZ A;  3AP6 A;  2ZXQ A;  2P3K A;  3AP4 A;  1HLC A;  3MW2 A;  4L11 A;  3U07 A;  3LB9 A;  1R09 2;  4JCK A;  2K9Z A;  3DF0 A;  2V73 A;  3K77 A;  1VBB 2;  2JE8 A;  3VLB B;  4AW7 A;  3Q8E A;  1PZ9 A;  2D5F A;  5EP9 A;  2BER A;  2V4V A;  4XF9 A;  1XNA A;  2AAC A;  2PLV 3;  3KV9 A;  3VBH B;  5A3M A;  3RZJ A;  1ZZ6 A;  1FAT A;  3ZXA C;  5JXH A;  4MUV A;  3OYW B;  3G7D A;  5KXB A;  3K75 B;  1AYN 3;  1ZBA 3;  2QQU A;  4JHT A;  5CFD C;  2JE7 A;  2PHL A;  4YSF A;  4JRL A;  5IHR A;  3GBF A;  5D8A A;  2CDO A;  1Q8S A;  1B35 A;  1EYB A;  2H6B A;  3D3A A;  3POG A;  3KM5 A;  2BNO A;  5F2S A;  1Y9G A;  3GCX A;  1KEX A;  5F5I A;  2P6C A;  2WFP A;  4QX2 A;  5T54 A;  1D4M 1;  1P8J A;  4AZZ A;  4QKN A;  2H0V A;  4MYE A;  1JU4 A;  3ZMN A;  4URA A;  4AFC A;  1RUH 1;  1OFN A;  1Z7S 3;  1ULO A;  4XFA A;  2WZR 3;  3WUD A;  4IES A;  4LT5 A;  3OBT A;  1J59 A;  4CDU A;  1KJL A;  1QJU 2;  3LQC A;  1OSG A;  1S0J A;  4WVZ A;  1VBA 3;  4U2A A;  1AR8 1;  3AB0 A;  1PMJ X;  3ACG A;  1H9W A;  1STM A;  3OUH A;  1W06 A;  3VDD A;  3TEY A;  5A32 A;  1A3K A;  1CAU A;  1HRI 2;  3S0M A;  3QLQ A;  4JDN A;  3O0X A;  4EZ4 A;  1AYM 1;  1D0G A;  1UY4 A;  1DQ6 A;  5BNO C;  1MQT A;  4AGV A;  2FDH A;  3B69 A;  3HBK A;  3OGS A;  4DXZ A;  1LTE A;  3FMG A;  3HJR A;  5A7O A;  2R06 3;  1VR3 A;  2ZAH A;  1GQH A;  3JD7 3;  4WZC A;  1FNZ A;  2RS3 1;  3WF2 A;  1FMD 1;  3H8U A;  5A7S A;  1HXS 1;  4RR3 B;  5HV0 A;  4A41 A;  1MS1 A;  1L7R A;  1O4Y A;  1W05 A;  1Q5O A;  1O5U A;  4M3C B;  5AC9 3;  4UBG A;  4NII A;  2ZGQ A;  4B3N A;  2YBK A;  3IB3 A;  4BYY A;  2ARE A;  2G9F A;  4LO4 B;  2ZAA A;  3ZXG A;  2PHF A;  5FDB A;  5C33 A;  1F15 A;  1APN A;  1UL9 A;  2D5H A;  2JEM A;  1DDL A;  3GDB A;  2UUR A;  1V6J A;  2W1U A;  3ILR A;  1IPJ A;  4LKF A;  4XXP A;  2XOM A;  4QKD A;  1YO8 A;  3LDR A;  1C4R A;  1QJY 2;  3HT1 A;  3TEW A;  5AFE A;  4CDX B;  4RS5 B;  2XB6 C;  2DFB A;  4LR4 A;  3O1M A;  1WCD J;  4L9B A;  4V2W A;  5IVF A;  4Z2W A;  2VUA A;  3J4U H;  3N4M A;  2E63 A;  2ZEX A;  1AX2 A;  4HVQ A;  1K3I A;  3RI9 A;  3ZPY A;  4ASM B;  1XYN A;  1ZBA 1;  2WZE A;  3H1Y A;  3RWK X;  3USU B;  4YVW A;  4PDW A;  3OF1 A;  4FAG A;  2B42 B;  3WHT A;  1OPO A;  1GV9 A;  4AED C;  1MS0 A;  1W6O B;  3W58 A;  2ZZQ A;  4COY A;  5LA0 A;  5FP4 A;  1CVN A;  1UY0 A;  2VOT A;  1RXF A;  3O0W A;  2ZTN A;  2B7Y A;  1JYN A;  1TEI A;  2OZ6 A;  4I02 A;  4QX3 A;  3ZFE C;  2EIB A;  3H3L A;  5FJK A;  1GNZ A;  2JD4 A;  4NAO A;  1A34 A;  4XQW A;  3J26 N;  1CQ9 A;  5EJ1 B;  4CU6 A;  4JKM A;  5LZ6 A;  3FLR A;  3H42 B;  1RUJ 2;  2IUW A;  1Z7S 1;  2Y6K A;  3NW4 A;  1IQD C;  4L99 A;  1ZX5 A;  2UWB A;  3ZYR A;  2WZR 1;  3C8X A;  1CON A;  1XPW A;  4N9I A;  3GYD A;  3WG1 A;  1VBA 1;  3K4D A;  3QH6 A;  4NO4 A;  4XAB A;  1DZT A;  1OA3 A;  2WWU A;  3DEC A;  1J3P A;  5F6L B;  5FXZ A;  3VZO A;  2W3J A;  2F6B A;  3VL9 A;  5LA9 A;  2DYC A;  2R04 3;  4MG2 A;  4GWN A;  4OI2 A;  1KDK A;  1ULE A;  3RYP A;  3ZYF A;  3GHM A;  1IGO A;  3I2I A;  2A70 A;  1AHS A;  2QQP A;  2RM2 2;  3NNL A;  3R05 A;  4JDO A;  4NIG A;  4FPH A;  3KZ4 C;  4P00 B;  2GN7 A;  4ET7 A;  2XH6 A;  5L36 A;  1DF0 A;  3POB A;  1LOF C;  3ZDV A;  2XL9 A;  3FN9 A;  5C9A A;  1W8N A;  2FMD A;  5FY9 A;  1RED A;  2WZP P;  3DKW A;  5JR7 B;  4QT6 A;  3UL2 A;  3VD5 A;  3NJY A;  4BQX A;  2ADD A;  2VVD A;  2O0O A;  5CKQ A;  3SKJ E;  4CVU A;  2WA4 A;  1JHJ A;  3MBW A;  1U5Z A;  3RMY A;  5AC9 1;  1SPP B;  1OF3 A;  1UPI A;  4WM8 B;  1VBE 3;  1BQP A;  1VB2 A;  2B46 X;  5CFD B;  4IE4 A;  3VBO B;  4R4Z A;  2YU2 A;  3O5S A;  2A7A A;  2CDP A;  4XFF A;  1RVF 2;  5A3O A;  2DVB A;  3RDI A;  4OZX A;  2YDE A;  3FC0 A;  2LS6 A;  4E2G A;  3NJV A;  1OVP A;  3B5L B;  4DUX A;  3RJR A;  4UFJ A;  2OX0 A;  1ST8 A;  4UFM A;  5FO7 B;  2VMH A;  3VUO A;  4FTE A;  4A3X A;  4W8J A;  1WA6 X;  1YFW A;  3UJO A;  2GH8 A;  5B4X A;  3AL5 A;  4CDQ B;  3KV4 A;  3H7J A;  3FUO A;  2WIN B;  3NNG A;  3VKM A;  2R0H A;  1YLL A;  2YZ4 A;  3EYP A;  4K21 A;  3SLI A;  4PIZ A;  4EWA A;  4URT A;  2UU8 A;  5DN2 A;  2ZMK A;  1R08 1;  3E6B A;  3NV1 A;  2FCV A;  1KRI A;  1YFY A;  3VBF A;  1LB2 A;  4E4D X;  1TMF 1;  3OUI A;  2BOJ A;  1D4V B;  2Z69 A;  1UYX A;  3S57 A;  2BWC A;  1XB9 A;  4O7X A;  2WA3 A;  4QPG C;  2QKD A;  4Y5S A;  3CJI C;  3LEM A;  2GAU A;  2BRT A;  2QQO A;  2WNV C;  4X8P A;  5L73 A;  4UFI A;  5DXD A;  5HCA A;  5FMD A;  4TTG A;  1MEC 3;  3CU7 A;  4BXF A;  5BNO B;  5AFB A;  5FZO A;  4X8N A;  4XFH A;  5DUU A;  2L9L A;  4OI1 A;  1OI6 A;  2NM1 A;  1RUH 2;  2X29 A;  1US3 A;  4FXG B;  1ZRR A;  3SKV A;  3JBG 3;  5DZG A;  2KA3 A;  3CLP A;  4N43 A;  2ARX A;  5FY8 A;  2E9Q A;  3PLQ A;  1UZ0 A;  4AL9 A;  3HNB M;  4EJR A;  3ACH A;  4YRD A;  3AMP A;  3WD5 A;  2IXK A;  4KU7 A;  4CXW A;  2R04 1;  1Q8Q A;  3AKT A;  1AYM 2;  1DZR A;  2R49 A;  3KSC A;  2YFZ A;  4Q0V A;  1C8M 2;  1W6P B;  3PHM A;  5LK7 B;  2WZ8 A;  1RIT A;  5FWJ A;  4DIQ A;  1BLZ A;  2VAU A;  4V2V A;  2CAU A;  3E5X A;  5EJ3 A;  1IQA A;  2ZML A;  5JZG A;  3LD8 A;  4ZPI A;  1W2A X;  4IE7 A;  5CG9 A;  1HQL A;  1LRH A;  3G6J B;  1AJK A;  3E6D A;  2JG8 B;  1PIV 3;  1QEX A;  2XHK A;  1S55 A;  1X8E A;  4B7K A;  2VZV A;  5GM0 A;  4TXW A;  1D7P M;  1LOG A;  1UMZ A;  2XJU A;  4H55 A;  1VBE 1;  2C1F A;  1NCQ C;  2K2S A;  4NPM A;  4CXX A;  3UES A;  3VD7 A;  5I0R A;  1FYU A;  5FZE A;  1CIW A;  2D6K A;  2PAK A;  3EBR A;  5LBB A;  5G04 L;  2KR2 A;  3U0Z A;  1QJX 3;  2PHR A;  1BVV A;  4FO9 A;  5M0T A;  5H9R A;  4XAE A;  5J7M A;  5L7O C;  3W21 A;  2XQX A;  4U36 A;  2QQL A;  2WUH A;  3SEP A;  3U75 A;  3KS7 A;  2Y8K A;  3UGH A;  2WLP A;  1JYT A;  2PLV 2;  1HB3 A;  4Q27 A;  2WS9 3;  1GIC A;  3AC0 A;  5C4W C;  2BFU S;  2VQU A;  4RGG A;  4YNI A;  1AYN 2;  1ZBA 2;  1UPS A;  4CPB A;  5IAT A;  1W9F A;  3DN7 A;  1LED A;  3EHK A;  3USS A;  3AZW A;  5ABJ C;  5FYC A;  3TNQ A;  2W46 A;  4NR1 A;  1U5I A;  4Y33 A;  1OH3 A;  5I8Y A;  3I59 B;  3MID A;  3I2K A;  2EA7 A;  4IEV A;  2X5I B;  3SIT A;  5H9Q A;  4COW A;  3KF3 A;  3ZSK A;  4IV1 B;  2BZD A;  3I3E A;  3LCP A;  3U4S A;  5C6C A;  4H7L A;  4PT6 A;  4XOG A;  4LBM A;  4P08 A;  4E4Z A;  3AYE A;  5TSW A;  3ZYB A;  3E5U A;  4XDO A;  4GA9 A;  4LQR A;  3I2J A;  2JG9 A;  1Z7S 2;  1UZV A;  2ES3 A;  4IGQ A;  3RMX A;  5ACA 3;  5FPZ A;  3JBG 1;  5KR7 A;  4OHX A;  3JU9 A;  1ULG A;  4GIQ A;  3KGL A;  2DBN A;  2Z2S B;  2XWB B;  4HMZ A;  1VBA 2;  1ZVF A;  4BQW A;  1JTZ X;  5ISL A;  3P6B A;  4XF3 A;  3ALQ A;  1W90 A;  2YXS A;  1EUT A;  2YFU A;  1GP5 A;  4QB1 A;  2W1W A;  2XLG A;  1BZW A;  5IVV A;  2FDK A;  1GFF 2;  4ARX A;  4AGR A;  4EN7 B;  5LBC A;  3THT A;  2WN2 A;  1EY2 A;  3E97 A;  2VBP A;  1H1I A;  4NHK A;  1WKY A;  4XUR A;  4XMI A;  2R06 2;  1FT9 A;  3KVA A;  2QCS B;  3KQR A;  3L2H A;  3NNF A;  2WR9 A;  2XUE A;  3JD7 2;  5DAQ A;  3M3E A;  1QJZ A;  3HOB A;  4WVW A;  3MDP A;  1OMI A;  1FI2 A;  1PIV 1;  1Y4W A;  3M70 A;  1XNT A;  1YFU A;  4JTN A;  4QQL A;  1G6N A;  1LGB A;  4KQ7 A;  5L9R A;  2ZGS A;  4DO0 A;  5F3C A;  1NZI A;  4CE8 A;  1XBF A;  1VAM A;  3VZL A;  4ZKT B;  4QDR A;  3CEW A;  4BA6 A;  5AC9 2;  4P9G A;  4HFS A;  1H4G A;  1Q3E A;  2YMZ A;  1BVP 1;  3ACL A;  2V09 A;  2YG0 A;  4NE9 A;  5IAX A;  1CZV A;  3ASI A;  4JV4 A;  1JW6 A;  4CCJ A;  2BDR A;  4QB6 A;  5I0S A;  4IEQ A;  2Q5T A;  2Y6J A;  5JI7 A;  2O1Q A;  1KFX L;  4QXK A;  5G05 L;  1PZ7 A;  2ERF A;  1GMM A;  4XYX A;  1RUC 1;  2EXI A;  2JKX A;  2VBD A;  2EXJ A;  2WS9 1;  1G9A A;  1YC6 1;  4JGZ B;  3N9N A;  2QZ2 A;  1WCQ A;  3I8T A;  5FZC A;  1U5Y A;  5SV8 A;  1HQW A;  3WNK A;  5FMB A;  4HVO A;  3LWC A;  1F4A A;  4ZXE A;  4J25 A;  3EO6 A;  3MI8 A;  3VZM A;  5FPV A;  5BNP C;  4FVV A;  1DHK B;  2ZJC A;  2OYZ A;  4QWN A;  5BV6 A;  3I49 A;  2UY9 A;  4BU2 A;  1W0P A;  3K46 A;  1H8T B;  1LOB A;  2GSY A;  3DCQ A;  3ZKU A;  2QTW B;  3WG2 A;  1FV3 A;  1HB4 A;  1CGP A;  1SBE A;  5ACA 1;  1GOF A;  2VJX A;  4F3J A;  3WIN E;  4UF0 B;  5K8S A;  3RVH A;  3AFK A;  3VD9 A;  3ZFG B;  3WCS A;  2OT7 A;  4YM1 A;  1G8W A;  1V6L A;  5IJR A;  2VG9 A;  4LA3 A;  2W2I A;  2B5H A;  5LA2 A;  2VCM A;  4PF1 A;  2R04 2;  4CP2 A;  4DPN A;  3HWJ A;  5C5T A;  5LY1 A;  1QOT A;  1NCQ B;  1M4W A;  3MPB A;  1H1M A;  1LU1 A;  1ZZ8 A;  4AI9 A;  5H9P A;  1JOP A;  1AR7 1;  2ZCW A;  1YXW A;  1M06 G;  1RYY A;  2ZX0 A;  4M01 A;  4TWT A;  3URF A;  1ZA7 A;  5J98 B;  4JHZ A;  3K4A A;  2GZW A;  2SBA A;  4FPF A;  1GZW A;  3ZSJ A;  5F3G A;  2WNU A;  4C8D A;  3VBS C;  3BAL A;  4QX7 A;  2DCZ A;  2G9G A;  4W6X A;  2CSG A;  1UKR A;  2OQ6 A;  3W9A A;  1XQN A;  4AAX A;  5LRR A;  1YI9 A;  1JZ4 A;  1G9C A;  2ZHK A;  3LKJ A;  1VBE 2;  5GLW A;  3T2Q A;  4LXL A;  5KWR A;  1KD7 A;  1C1F A;  1O5L A;  2PAE A;  3OGJ A;  1PNG A;  5ABJ B;  3IMN A;  2Y34 A;  5KBF A;  2VXR A;  3DYM A;  4ARY A;  2ZGK A;  3F2Z A;  1POV 0;  5D2A A;  4ATF A;  2QQJ A;  4FSJ A;  5A7W B;  5ERL A;  2VMI A;  3VB9 A;  4GH4 C;  4Q4V 2;  5KXC A;  3N3H A;  1POV 1;  2A6X A;  1GYK A;  4I3G A;  2VO5 A;  3GBW A;  3FFZ A;  3ZFF C;  3LIG A;  3O7O A;  4TSV A;  5GLT A;  3V0A B;  2QZ3 A;  1PK6 C;  5D1I A;  4AVV A;  1QJF A;  1LUL A;  3VBU B;  3LDK A;  3A23 A;  4QAW A;  2HKX A;  2ZZJ A;  3IN9 A;  5CVR A;  2F17 A;  2WQ4 A;  2XJT A;  4WV8 A;  1AZD A;  3O1S A;  1MPX A;  2RR1 3;  1SMV A;  1XOY A;  1F4H A;  3POF A;  4RQP C;  1OD5 A;  1JS9 A;  5IUQ A;  4A7Z A;  1GOG A;  2FDJ A;  5A1A A;  1MEC 2;  1XE8 A;  4JGY A;  3KVB A;  4FPE A;  4O61 A;  2NP0 A;  4BIO A;  1WW7 A;  3ZYI B;  1PMI A;  4P9I A;  2BEO A;  4IV3 C;  4K9S A;  2Y64 A;  4ZZ8 A;  1WMX A;  3JBG 2;  1TZO A;  2XJP A;  3LSE A;  2IC1 A;  4CEW A;  4H7M A;  3TN9 3;  4Y1U A;  1WME A;  1GU3 A;  4AYU A;  2QQN A;  4FPK A;  1QJE A;  4LEJ A;  4LOR A;  1DFQ A;  1MS5 A;  2VM9 A;  1ODM A;  3OBZ A;  2CGP A;  4QHZ A;  5E89 A;  1OQE A;  3PDQ A;  3TBD A;  1HRV 1;  5JPM B;  3AJY A;  2XKO A;  2PN5 A;  3HN3 A;  2DCY A;  3EMR A;  4QGN A;  5T5P A;  4DIN B;  4XJZ A;  4Q1P A;  3B00 A;  4MX3 A;  3AZY A;  2YHJ A;  4F8A A;  2YUE A;  1NX9 A;  1LHO A;  1UX7 A;  3BTZ A;  2DVF A;  2VNG A;  2HWF 3;  3BOD A;  2RG4 A;  3T0B A;  3K48 A;  1LEC A;  3O1O A;  4LPL A;  1NLQ A;  3JB8 A;  5A70 A;  1PIV 2;  1H6Y A;  1UZW A;  2XKP A;  5A33 B;  1ZM1 A;  3ZVX A;  3K51 A;  3NRU A;  2JJ6 A;  5DQ0 A;  5FP3 A;  5LEJ A;  2QQK A;  3LEK A;  2Q1F A;  2DUP A;  2ORX A;  2P2K A;  5C3O A;  3NST A;  2W95 A;  2AEY A;  2ZGM A;  3LEI A;  4M4R A;  5FPU A;  1QJX 2;  3VBH C;  4YG3 A;  5FZH A;  3VD3 A;  4YW6 A;  4XIL A;  3KCX A;  5GLZ A;  4UW5 A;  2XDV A;  2NMN A;  3NJZ A;  4XTM A;  1WW6 A;  3O1V A;  5FKB A;  4CTE A;  4P9L A;  4AAP A;  5DZF A;  1ND2 C;  3ENR A;  3WP5 A;  2B9U A;  4BQ3 A;  4DXR A;  5IFT A;  4CEY A;  3GJB A;  2CGN A;  2DVA A;  2EXH A;  1W8Z A;  4Q8L A;  3AVS A;  5AVA A;  4O9G A;  4XMA A;  5T52 A;  4LK6 A;  2WN3 A;  4UOJ A;  4X6Q B;  4CCL A;  4XET A;  1W8U A;  5T55 A;  2VMD A;  4LBJ A;  4H3W A;  3W59 A;  2EXK A;  1NYW A;  1O59 A;  4MGZ E;  3KQ4 B;  2PXJ A;  4V1P A;  4F83 A;  5E1R A;  5EPA A;  1RXG A;  4A2U A;  4MHU A;  4RD7 A;  1H30 A;  2N7G A;  3AKP A;  3FBM A;  2ZA9 A;  1ULD A;  1V00 A;  1CAV B;  4JC1 A;  2D6P A;  2BOI A;  1XRU A;  2YYO A;  3KHC A;  2GU9 A;  5ACA 2;  2W94 A;  1YQ5 A;  3M8L A;  4GWM A;  1LGN A;  5LCW L;  4QQH A;  1RIN A;  1NA1 A;  2VCC A;  3NAP C;  2A71 A;  3TN9 1;  4YZ2 A;  4X6R B;  1IPK A;  4A7K A;  3KV6 A;  4OUM A;  3P1I A;  3RYK A;  1LHN A;  1YYN A;  1HB1 A;  4P9W A;  3U14 A;  3OY8 B;  2BFU L;  1JBC A;  2EAL A;  3IIA A;  3OGV A;  4BHP A;  3HQX A;  3E6C C;  3FHA A;  1LU2 A;  1HQN A;  4UAP A;  5A32 B;  2RDS A;  1CAU B;  1JU3 A;  3LPF A;  4PIY A;  4P9X A;  4RR3 C;  2OUJ A;  1FOD 3;  2QJV A;  4NHM A;  2Z5W A;  5FZ9 A;  5FXW A;  2HWF 1;  5GJ6 A;  3PTR B;  4W4Z A;  4CCM A;  4CP0 A;  4DEQ A;  2LM3 A;  1K45 A;  4XJA A;  5HPO A;  3WOG A;  2YPD A;  3GGL A;  4M4P A;  4LUL A;  1V9U 3;  4CCN A;  2FDI A;  2PMW B;  2JDZ A;  3WDT A;  2VMG A;  1GNH A;  2WDB A;  3ACI A;  1QXJ A;  4D8M A;  4HVR A;  1UQX A;  2HWD 3;  5IK8 A;  2BVB A;  1PO2 3;  1G86 A;  5FZK A;  3TAY A;  3WNN A;  3EXU A;  4XFI A;  2QQM A;  3MW3 A;  4QPY A;  1D4M 3;  4BPZ A;  3PUS A;  1IHM A;  2Q1M A;  2DCT A;  1TNF A;  4S2H A;  5F1R A;  1OLQ A;  1URX A;  3FHI B;  2IZW A;  4ZU7 A;  2P34 A;  1DG6 A;  4EN6 B;  2JDU A;  2FDF A;  1EPZ A;  5LY2 A;  2A6V A;  2GAL A;  1WA4 A;  4PI0 A;  1ULP A;  4MET A;  2WAA A;  1AR8 3;  3Q8F A;  3X29 B;  4IV3 B;  3H8X A;  5FZ7 A;  2QQV A;  3FFQ A;  4FT8 A;  4FOW A;  4YW1 A;  4IL7 A;  4LJH A;  4DRR A;  2FZ2 A;  5FRA A;  3MPP G;  1JUH A;  5FRE A;  3B7M A;  4ES8 A;  4UYB A;  2D40 A;  4ONU A;  4Y1X A;  5A1F A;  1WD4 A;  3BN6 A;  2EIG A;  2JDN A;  2OQ7 A;  2FMY A;  3UKT A;  1SFY A;  4YVW B;  4PDW B;  5HXV A;  4YVS A;  4Q4W 1;  4XAC A;  1PM4 A;  1W6Q A;  2BGC A;  4FP2 A;  4NN0 A;  2FBE A;  1GBG A;  4J6G A;  2VMC A;  3LA3 A;  4Y22 A;  2BV4 A;  3U78 A;  1SLL A;  1NUK A;  2BQP A;  4BM8 A;  2VTX J;  5FZ1 A;  4LOS A;  1OKO A;  1Z78 A;  3WQ0 A;  2UWA A;  2PQS A;  2DVD A;  2RS3 3;  2UY8 A;  1FMD 3;  2VME A;  1HXS 3;  1N1T A;  4RN5 A;  3K4Z A;  3ZSM A;  5FLH A;  1NCR A;  4DUW A;  4AVT A;  1SFP A;  1UXZ A;  5A3U A;  2WT2 A;  2GNM A;  4PLM A;  3TWI A;  1ND3 C;  5FTT C;  4AR2 A;  1V6N A;  4HAN A;  4OHW A;  4NRO A;  2VGD A;  1AXK A;  3BU0 A;  3LF7 A;  3NVC A;  1S0E A;  1UYY A;  2ZGO A;  1OUS A;  1RUF 3;  2VOK A;  3ZSE A;  1DQ4 A;  3I3B A;  4FFH A;  4IGP A;  4C91 A;  1S2B A;  3WDU A;  4NWV A;  1SEF A;  5KC5 A;  2CTV A;  1QH7 A;  2CHH A;  1UOB A;  1FOD 1;  5IK4 A;  3WW1 A;  2JDM A;  3O14 A;  1BEV 1;  4HKW A;  2O8Q A;  2JB8 A;  1OFS A;  4WM8 C;  1CX1 A;  4R8H A;  4EWD A;  1V9U 1;  1JMU B;  4NRP A;  4BIF A;  2QDN A;  1JZ3 A;  3VBO C;  4MLO A;  4GWJ A;  3QBQ A;  4XHX A;  1ND2 B;  2VQT A;  3MFC A;  2A75 A;  2HWD 1;  5FLJ A;  3WNX A;  2DF7 A;  4FP3 A;  5A6Y A;  1SCS A;  1WMD A;  1PO2 1;  1DQ0 A;  1XNC A;  3D82 A;  4Z82 A;  1HN1 A;  5FY1 A;  3WV6 A;  1N3O A;  3I97 A;  5C8C C;  1OQ1 A;  2VR4 A;  4AI1 A;  2J1S A;  4A4A A;  1G7Y A;  4Z8B A;  1O3S A;  4LE4 A;  1QWR A;  2VNR A;  3IPV A;  4CDQ C;  4YLZ A;  1J84 A;  1OLR A;  4BLI A;  5K0U A;  3AXD A;  4FAH A;  5FY4 A;  2YGL A;  3PUA A;  3ZLI A;  1UCX A;  1AX1 A;  4CU7 A;  3FHQ A;  1LOC A;  1VMH A;  2QQI A;  5D21 A;  1A6C A;  4K6B A;  3D0J A;  1SDD B;  4Y1Y A;  5BYN A;  4OMD A;  3V0B B;  4CCO A;  2J1E A;  1RUE 3;  3NWK A;  3VZN A;  3NAP B;  1DQ5 A;  1SBD A;  1K12 A;  1IKP A;  4I09 A;  4CUA A;  2RR1 2;  4MV2 A;  3HAG A;  3O0V A;  5KHG A;  4NHY A;  5EV7 A;  5FYU A;  2JWP A;  1KJR A;  2BGP A;  4Q5O A;  4CUC A;  2BP6 A;  3VV1 A;  2LTN A;  3RS6 A;  5T5J A;  1G9B A;  4LE3 A;  3AZV A;  3PJY A;  4K3U A;  2P1B A;  1W8O A;  2Y60 A;  1KXG A;  4YG6 A;  4D3W A;  4LO6 B;  3BTA A;  1JHN A;  4ERO A;  4JAA A;  5FZO B;  4LBQ D;  3UKV A;  4LLO A;  1MS9 A;  2VOW A;  1N1V A;  2CYF A;  3NJX A;  3TN9 2;  1RC6 A;  5GLV A;  5DAV A;  4Y1V A;  1C5H A;  5FUN A;  4N43 B;  5A3T A;  5I0T A;  3OBR A;  2VU9 A;  3M7A A;  1PVC 1;  4FPL A;  1RUI 2;  1YQ6 A;  2ZHM A;  4WM7 A;  4XUO A;  3MW4 A;  1RHI 3;  1RUF 1;  2Y6L A;  4GH4 A;  5LBF A;  4EV0 A;  4AHZ A;  2JG8 C;  4S2F A;  3NMB A;  4DS0 A;  3AKQ A;  4UFH A;  5I8S A;  1OOP A;  3CF6 E;  4JKK A;  3RNS A;  1E57 A;  2GC0 A;  3N7L A;  5T5O A;  3DPR A;  3NV2 A;  4E2S A;  1UIK A;  1RGS A;  1DIW A;  1CJP A;  2RJK A;  4ZU4 A;  5DDJ 3;  2JX9 A;  1R08 3;  1WLW A;  3BIW E;  1W9T A;  1K5M C;  1TMF 3;  1UY2 A;  4Q1R A;  3ZR5 A;  2W0X A;  2WSU A;  5CFC A;  5HCF A;  1VBD 3;  2HWB 3;  1JYC A;  3ZYJ B;  1X33 A;  1O4Z A;  4Y4R A;  3MLK A;  1J1T A;  1GQP A;  2OZJ A;  4QGM A;  1MZF A;  3CO2 A;  5LB6 A;  4XHB A;  4QM9 A;  4M0N A;  5FMC A;  3I2F A;  4S2D A;  3KLS A;  5CKM A;  2P5B A;  1GQG A;  2HJI A;  2WQ8 A;  3H7Y A;  4SLI A;  4BLJ A;  2UWC A;  3M3Q A;  2CV6 A;  3LE0 A;  1K42 A;  2X5I C;  3J7L A;  3SEE A;  3L9J T;  1RUE 1;  4IV1 C;  4JKL A;  2G19 A;  3BTX A;  1ND3 B;  3V65 A;  1O6U A;  2ZGT A;  5FZL A;  3D4K A;  3AYA A;  5A7P A;  3VHR A;  2PEL A;  4CU9 A;  1WLD A;  1PM7 A;  1GKB A;  2HEW F;  2Y33 A;  1ASJ 3;  1SQ4 A;  2OW4 A;  4YWA A;  3RFR A;  3MLJ A;  4Y24 A;  4E4S A;  1TVG A;  2H6C A;  1LJ7 A;  5JOY A;  2PHT A;  3Q8B A;  5A6Z A;  2D97 A;  2YY1 A;  4XUP A;  1NG0 A;  5JLV A;  2D43 A;  4M0H A;  3J7H A;  4GJZ A;  5I91 A;  2G1M A;  4LTA A;  4OMC A;  3I54 A;  3SCG A;  5GZF A;  4N53 A;  2JIG A;  4QPW A;  2R30 A;  1WZX A;  2B45 X;  4CYD A;  1DLL A;  4DFS A;  2DTW A;  1KS4 A;  3SNM A;  5FO8 B;  3IWZ A;  1B09 A;  3POY A;  5A80 A;  1YQ8 A;  1RHI 1;  4IQP A;  1VLN A;  1BYH A;  1ZYB A;  2WT1 A;  2Y6G A;  3ATG A;  3SXW A;  2AUY A;  1N47 A;  2WSV A;  2X8K A;  4CP1 A;  5C8C B;  3KHB A;  5KXE A;  3P5B A;  3TYJ A;  2RMU 3;  1FOD 2;  2HWC 3;  1IS4 A;  2G4I A;  4EZH A;  3JZV A;  2D93 A;  4AQ6 A;  3VBR C;  1N1Y A;  1CAX B;  1X7N A;  4HLT A;  4KWL A;  5C5U A;  1TNR A;  1V9U 2;  5DDJ 1;  2WLQ A;  1U12 A;  3J7N A;  5BY5 A;  2VZO A;  3ZIW A;  2CWS A;  1W8W A;  1F35 A;  1OQD A;  4A7Y A;  2YPJ A;  2HWD 2;  1TE1 B;  3M2M A;  4LIT A;  5IVY A;  1O7F A;  3AM2 A;  1PO2 2;  4KNC A;  2HLE A;  1VBD 1;  2A73 B;  2HWB 1;  4XE9 A;  2JEC A;  1W03 A;  3PME A;  5J36 A;  5CG8 A;  3ZYP A;  1J3Q A;  4LKS A;  5JPN B;  1D4M 2;  2C6S A;  4FCA A;  3OGR A;  3UGF A;  4AQ2 A;  4JGZ C;  3PUR A;  5FYI A;  3B9I A;  4Q8K A;  3RZH A;  4FTB A;  2WBK A;  3CNA A;  1MAC A;  2Y0I A;  4DXT A;  3RZL A;  2VW2 A;  3UET A;  2J1A A;  1E5R A;  3MO4 A;  2W9X A;  1RB8 G;  1AR8 2;  3VZK A;  4D6R A;  3KT7 A;  3ZN5 A;  1OC1 A;  2ZPX A;  5DG1 A;  3TB0 A;  2BTV C;  4L2N A;  4K20 A;  4OCT A;  2VBB A;  5HBA A;  1CES A;  1VMF A;  3VHO A;  1F5F A;  2C9A A;  2X10 A;  2XGX A;  2YU1 A;  3PL0 A;  5JIA A;  4AWD A;  1H8T C;  3S30 A;  5LEK A;  3GM8 A;  1OXC A;  4NPL A;  2J1V A;  1W0O A;  1VIW B;  2VE1 A;  4AG4 A;  1X82 A;  1HV0 A;  1ASJ 1;  1DYO A;  4IER A;  5FIX A;  2ZGN A;  2JD9 A;  4R9C A;  3KWV A;  4XJU A;  1KQR A;  3OD0 A;  3I4I A;  3ZFG C;  1RUN A;  4KGG A;  2D6O X;  2ID4 A;  2RS3 2;  1FMD 2;  1HXS 2;  2WAO A;  5JMC A;  2IFW A;  2VTX A;  5CYY A;  4QB2 A;  2GH2 A;  1LES A;  2DTY A;  2C9K A;  2Q8O A;  3BB6 A;  1Y43 B;  3VDC A;  1VJ2 A;  3PTY A;  4RFR B;  5A6Q A;  1QQP 1;  5FK8 A;  2CU5 A;  3H50 A;  1I1E A;  4CDX A;  1REE A;  4RS5 A;  5BNN A;  5ANQ A;  1YIP A;  1LOA A;  1C3H A;  5JAX A;  3N36 A;  1K5M B;  3VN4 A;  2XVL A;  3EJK A;  1RUF 2;  3AMQ A;  4ZS3 A;  1POQ A;  2VVF A;  3USU A;  1NKG A;  5AVP A;  4CDW C;  1PMH X;  1AUY A;  5JCT A;  3CL1 A;  2RMU 1;  2HWC 1;  2JB4 A;  1W6O A;  4HL0 A;  4AI8 A;  1RUC 3;  1KS5 A;  4MH0 E;  4RGA A;  3VDA A;  3LA7 A;  4YM3 A;  4SBV A;  3WQ7 A;  1R1Z A;  4GZ9 A;  2A3X A;  3WXP A;  4JQT A;  3ELN A;  4XUN A;  4HOO A;  5CNA A;  4B29 A;  2DVG A;  1JN2 P;  3O1U A;  2XVK A;  3AX4 A;  1GZW B;  2WNU B;  4Z07 A;  5EZW A;  4XPV A;  1UWW A;  5LRS A;  2F4P A;  4FPJ A;  2A6W A;  5EHD A;  1C5I A;  1W8T A;  1JZ5 A;  3KD4 A;  1PX4 A;  1ENR A;  4FPG A;  2RDN A;  5CIR A;  3MV1 1;  5JSR A;  1L7L A;  5BUV A;  3EB7 A;  3GXU A;  4P5H A;  1R64 A;  3A0N A;  2OS2 A;  3FWE A;  3NQH A;  4QPI C;  3MFA A;  4HN0 A;  4JVA A;  5CB7 A;  4KU8 A;  4CP9 A;  3AZZ A;  1UN1 A;  4E2Q A;  1S0I A;  3VBU C;  4B7E A;  2WZR 2;  1JOD A;  1LHW A;  2AR6 A;  2AC1 A;  3GAL A;  3ZXD A;  2XJQ A;  3ZDS A;  4D69 A;  3OOX A;  2RS1 3;  1UOF A;  2BYV E;  4QX5 A;  4AF9 A;  2X09 A;  1AR6 3;  1GAN A;  2OPW A;  2NLR A;  3CDZ B;  3IMM A;  1UIJ A;  5DUX A;  1RUE 2;  2CNA A;  2J7M A;  2EID A;  1CPN A;  3ILF A;  2YC0 A;  1JZ8 A;  4IEO A;  4AE2 A;  5A3L A;  4K40 A;  4K8R B;  1IS6 A;  1SG3 A;  4G3Y C;  1V6I A;  1UX6 A;  5E16 A;  1AR7 3;  2P3Y A;  4YW4 A;  2DBI A;  4YZ4 A;  4DQA A;  4R52 A;  1SPP A;  2OII A;  4CU8 A;  2W08 A;  3KGZ A;  1HX6 A;  1MZE A;  1VAV A;  2YC4 A;  3RSJ A;  2NN8 A;  2OXB A;  1V0A A;  5CFD A;  3ZN4 A;  4JGY B;  3A4U A;  1C8N A;  3T1M A;  2CGO A;  2WKK A;  2XBO 3;  2R6Q A;  1WBF A;  3VBR B;  1OKQ A;  1LEM A;  4XAA A;  4HK9 A;  3I2D A;  5FZ8 A;  4CEW B;  1PGL 1;  1NXM A;  2ZX2 A;  3V64 A;  2WO3 A;  1ODN A;  3HVD A;  5J3U A;  4LHL A;  5FO9 B;  3H3U A;  4I2O A;  2PQQ A;  1HDK A;  1YQC A;  3QD6 A;  1KGY A;  1QOS A;  3HEI A;  3BU7 A;  1SDW A;  2RJ2 A;  3POE A;  1S0D A;  3IDE A;  4BOW A;  1YEW A;  1XSR A;  3LDB A;  5DAX A;  3KMH A;  1POV 3;  4AVC A;  4TZD A;  4K1Y A;  2VZR A;  3TNP B;  1S2K A;  5J96 B;  1S1A A;  1UOG A;  4GB3 3;  3MV0 1;  4FPC A;  4RGK A;  2IXJ A;  2WRA A;  4W65 A;  5DDJ 2;  4Q26 A;  2VOV A;  3AP5 A;  3PUH A;  4GJY A;  1R08 2;  4QX1 A;  4WBB A;  5LAS A;  5BNO A;  4QMA A;  4LBQ A;  5LWB A;  1LKN A;  3VZJ A;  1TMF 2;  4OI0 A;  2B39 A;  1JH5 A;  4GXL A;  3T2T A;  1ZZC A;  2A3W A;  1VBD 2;  2HWB 2;  4Q4Y 1;  5JXG A;  4W6Y A;  4LHS A;  2C24 A;  1GWL A;  3FUQ A;  2IVJ A;  2XWJ B;  4AEM A;  5FY5 A;  3U37 A;  5FWE A;  3MGU A;  2BUK A;  2VZT A;  4CCE A;  2CY6 A;  4BQY A;  1G9D A;  4P9J A;  4WVM A;  4EYU A;  3LGR A;  2W52 A;  1XU1 A;  1MS8 A;  1SZB A;  2LRO A;  1RL3 A;  3OB8 A;  1VE0 A;  4FFG A;  4DB5 A;  1EV1 3;  1UF2 C;  1YI7 A;  4NJ4 A;  2NQY A;  2RS1 1;  4FFF A;  4A3Z A;  1AR6 1;  1ZRE A;  2ARA A;  1F9K A;  5I0D A;  3PIG A;  2GMM A;  5E88 A;  5D8A C;  4IXL A;  1B35 C;  3LPG A;  1WGP A;  4KBZ A;  1HRV 3;  4CEY B;  5JXJ A;  3P3P A;  1J3R A;  1PO1 3;  2GC1 A;  2VD7 A;  2O8O A;  1OHF A;  1YUD A;  4IND A;  5FYB A;  5FBZ A;  5ANN A;  1YWK A;  2VZU A;  1ASJ 2;  1QH6 A;  3T4H B;  4RHV 3;  4L0P A;  3K2O A;  4NAM A;  3MLL A;  3FX3 A;  4AQS A;  3M3O A;  4CDW B;  3LFM A;  3OPT A;  4QHO A;  3WG3 A;  4AED A;  2VUD A;  1JUI A;  4A45 A;  2XBO 1;  2A3Y A;  4K1Z A;  1NY7 1;  4GUL A;  4OFG A;  4Z2A A;  4G4F A;  4MOA A;  3VDD C;  5IWF A;  1QGL A;  3ZFE A;  3T2O A;  2XON A;  5FUI A;  1NA1 B;  3LSD A;  3RJ2 X;  4P14 A;  1MQT C;  1XND A;  2OPK A;  4JTO A;  4ZY9 A;  1OT5 A;  1WBL A;  2B8M A;  5EJZ B;  2E53 A;  3I3M A;  2PHD A;  4IGO A;  2VTF A;  4PI2 A;  1V6K A;  4LLF A;  2RMU 2;  2HWC 2;  4DY3 A;  3N9O A;  3AXE A;  5FPL A;  1YFX A;  4GB3 1;  1IZ3 A;  4QPI B;  1W04 A;  4MGS A;  1SLT A;  4JQR A;  4QM8 A;  3RG0 A;  3M3C A;  2JDP A;  4QU2 A;  1QF3 A;  4OUE A;  3VHN A;  2BJS A;  1NLR A;  5F9T A;  2QFE A;  2XJS A;  3QCW A;  2IXH A;  2Y26 A;  5CBL A;  4AEK A;  4Q4X 1;  1WMF A;  3LAG A;  1LOF A;  1S0G A;  2GC3 A;  2YB7 A;  1UYP A;  4M00 A;  4TN7 A;  2BVV A;  1AF9 A;  1NLS A;  5DUV A;  3S7I A;  5IK5 A;  4NOT A;  2VW1 A;  2TBV A;  2ET1 A;  3W5N A;  3FZ3 A;  4XJW A;  3B9C A;  4KBB A;  4YM2 A;  3WNM A;  3BIE A;  1EV1 1;  1XC6 A;  2VY0 A;  3A21 A;  4AOC A;  4YVW C;  4PDW C;  4UT5 A;  2TUN A;  1AXY A;  4MGY E;  1AL2 1;  3ZPO A;  2D3S A;  1H8V A;  1U0A A;  2HH9 A;  4COU A;  5B4N A;  2WFF 3;  1CX4 A;  2OKX A;  1PO1 1;  2IFR A;  2E51 A;  3C3V A;  1K5J A;  3UYJ A;  3D0S A;  1W3X A;  3PUQ A;  1J58 A;  4I3P A;  1I3H A;  3DEM A;  4S2G A;  3III A;  3QAC A;  4XCB A;  4BCU A;  3APB A;  3GHN A;  4RHV 1;  4YVS B;  3J8F 1;  3OEA A;  1W6Q B;  3HQU A;  2ZAC A;  4NHX A;  5F7U A;  4QX0 A;  4DXS A;  1YCI A;  2W68 A;  4PLO A;  3W5M A;  2W39 A;  3WZ1 A;  5C70 A;  4H2A A;  1COV 1;  4FBF A;  1O4T A;  4QPG A;  2Q30 A;  1W8F A;  3CJI A;  4BJ0 A;  1W6M B;  3TEZ A;  2WNV A;  4E4H A;  4XUQ A;  1R09 1;  4LK7 A;  2VUJ A;  2Y38 A;  1RIR A;  2KM2 A;  4GQ7 A;  3C7E A;  4BQ2 A;  4TLG A;  2XUM A;  3T30 A;  5FXV A;  5FR3 A;  1OD3 A;  3D5O A;  2A1X A;  3ES1 A;  2OVU A;  3AL6 A;  2YBS A;  3Q8C A;  4BH9 A;  5C9A C;  1F8V A;  3CZU A;  2RVA A;  3HPN A;  2Q8D A;  1CZT A;  1ENX A;  5C3S A;  3BKZ A;  5FMO S;  1RUC 2;  3WQ1 A;  1WW4 A;  2WS9 2;  3MIG A;  3ZN6 A;  5IT6 A;  1YJK A;  1LR5 A;  2GNT A;  4OUS A;  3LOB A;  3MEP A;  2XPJ A;  1QKQ A;  1W9S A;  3MIB A;  4NIA A;  2PFW A;  2VNO A;  2I45 A;  5FPX A;  5FK7 A;  5A3P A;  4Q4W 3;  3ZMO A;  2LW8 A;  5D8A B;  3SIS A;  4UF0 A;  1ZBE 3;  1B35 B;  4YW7 A;  4RSU A;  5F37 A;  4LBL A;  5F3E A;  3C7F A;  3HMY A;  5CA6 A;  3FL7 A;  5EYY A;  5IW0 A;  1PX3 A;  4QQ2 A;  2WQZ C;  1JZ7 A;  3IPV B;  4OHV A;  1UW8 A;  2PA7 A;  1NCQ A;  1V70 A;  1CD3 G;  5K0U B;  2R7E B;  2X53 S;  2RS1 2;  3RYR A;  4CUG A;  4MXW A;  2P4E A;  1QNW A;  3E5Q A;  2VC9 A;  4XTP A;  3T3Y A;  4D7T A;  4CDU B;  3O12 A;  3VBF C;  4AQT A;  1W9Y A;  2R0F A;  2WFF 1;  3WW3 A;  4MZU A;  5L7O A;  2YC2 A;  5FQ0 A;  4HPK A;  3S5Q A;  1E5H A;  3VDD B;  4OQ8 A;  3V56 A;  2GME A;  2DUQ A;  2ZKL A;  2Z79 A;  4DEV A;  1AR7 2;  2FHR A;  3GCW A;  2ZEZ A;  4ZHN A;  1MQT B;  3KT1 A;  3WUC A;  4C0H A;  1A78 A;  5C4W A;  1IOA A;  1BEV 3;  1EP0 A;  1OBN A;  4AI0 A;  1S4C A;  2EVX A;  1LHV A;  4KMQ A;  4GD4 A;  1S0F A;  4YW2 A;  1V6M A;  2QE3 A;  3T0A A;  5ABJ A;  1EAH 3;  2WWJ A;  4HXC A;  4N43 C;  3UNP A;  2GP3 A;  3S5A A;  2BW8 A;  2WC2 A;  5IAV A;  1HJG A;  2W1Q A;  2XBO 2;  2XLF A;  1WLC A;  5DAB A;  3ZM8 A;  4OHZ A;  4LNV A;  1RTV A;  4IEZ A;  1JYW A;  1BCX A;  1E5S A;  2ZS6 B;  1OLM A;  3DKQ A;  3DYO A;  3LEG A;  3TOJ A;  4NID A;  5EQU A;  1QJY 1;  5C3R A;  1DZQ A;  3CHX A;  3V0A A;  3KB5 A;  2J42 A;  2AZ5 A;  3VD4 A;  3N9Q A;  3M1H A;  4B8E A;  5JZG C;  4O9E A;  3VHP A;  4YFW A;  3MYX A;  3I2O A;  4UFK A;  2A5Z A;  1HB2 A;  1XYP A;  3AMM A;  1CIY A;  1DBN A;  4GB3 2;  5E6H A;  1W2O A;  5HV4 A;  1HKD A;  1OOP B;  4MGI E;  5IFP A;  4XBQ A;  4BXS V;  1G9F A;  4PLN A;  3GZE A;  3GZT B;  1C28 A;  4ISQ A;  5DAP A;  2F4L A;  3DPR B;  3IZO A;  4CCK A;  1JI6 A;  1QDO A;  1F5J A;  2ZGL A;  1ACC A;  5FYV A;  3NKT A;  3KF5 A;  4ATE A;  5CFC B;  1ZBE 1;  3DXU A;  5JR2 A;  1MR5 A;  4E8D A;  2RJL A;  2V72 A;  4IEU A;  4BQ5 A;  1ENQ A;  2HWE 3;  5FY0 A;  1JXN A;  3O1R A;  3ILN A;  5A3W A;  2R1D A;  3ZO0 B;  3THP A;  3KT4 A;  3H9A A;  3IDB B;  4I01 A;  3R6S A;  1NQD A;  2W1S A;  3I2H A;  4JRA A;  2ZEW A;  1RUG 3;  3WEZ A;  1N1S A;  4M3C F;  2CWM A;  2G9Z A;  1DGR N;  1GWM A;  1UY1 A;  4XDQ A;  1Y3T A;  2WYF A;  2ZAB A;  1FV2 A;  5DAW A;  1PVC 3;  5GAL A;  2BNM A;  1HRV 2;  2C5D A;  5LBE A;  3ZIX A;  1PO1 2;  1UZZ A;  4KGQ A;  4M3C E;  3HD8 B;  5C71 A;  1NOV A;  4UW4 A;  2XVG A;  1FPN 3;  4QHB A;  5IVE A;  1YIF A;  4NRQ A;  1LGC A;  2JXA A;  4RHV 2;  1EUU A;  2HEY F;  3ON7 A;  4AHY A;  4LUK A;  2JG9 C;  4P9Y A;  4XFB A;  4Y1Z A;  2BBA A;  2JDA A;  5FZD A;  3N9M A;  5FKC A;  3N7M A;  3U10 A;  5C9A B;  3K3N A;  1MZ5 A;  1EAH 1;  1Y7B A;  4XJ8 A;  4W6W A;  3ST7 A;  2XLA A;  2KD7 A;  4F7Z A;  4FOY A;  1S0B A;  1GZT A;  2J1T A;  4YGE A;  1W6N A;  4DRV A;  5BNP A;  1UOJ A;  3FLP A;  1VB4 A;  4PIX A;  1H6X A;  3WP4 A;  4Z1V A;  5IVJ A;  5FZB A;  1RVF 1;  3EQE A;  4N53 B;  4Q2F A;  3WDY A;  2RDQ A;  4KWU A;  5LA1 A;  3AJZ A;  4D6S A;  2MNG A;  5LAT A;  3OD4 A;  3T2P A;  3U1X A;  3SHR A;  3OEB A;  4HSL A;  1I5Z A;  2JDH A;  1DGL A;  3M4F A;  3CJX A;  4DUV A;  2LRP A;  2RDR A;  2CL2 A;  3WW4 A;  4QXB A;  1AJO A;  1QXP A;  4LIV A;  4RYD A;  4QQP A;  5FPB A;  4JZR A;  4YGC A;  3O1P A;  1CN1 A;  1PVX A;  1L3J A;  5KHI A;  3SH4 A;  1CAV A;  2O14 A;  5JOX A;  1QDC A;  5FLI A;  3RZK A;  2WO7 A;  4BE3 A;  2R16 A;  1SHW B;  1S0C A;  3VBF B;  2VUL A;  4HT1 T;  4Y5Z 0;  4XIK A;  2ETE A;  4BK5 A;  3DGT A;  2HWE 1;  3U11 A;  4LUM A;  5CZK A;  3J9S A;  3VBS A;  2HEV F;  5JSP A;  2W87 A;  3WF3 A;  2GNB A;  2HBT A;  3OY8 A;  1VBC 3;  1W2U A;  2NPI A;  1VRH 3;  4Y20 A;  4CCC A;  3KCC A;  4YAR A;  3PU8 A;  1BBT 3;  4UW3 A;  1MZ6 A;  3VKL A;  1RUG 1;  1IG3 A;  3D8C A;  4IET A;  4UWD A;  5FZM A;  4AI3 A;  1W0N A;  3PVO A;  3BPZ A;  1CAW A;  1H9P A;  3DUI A;  4KWK A;  4OVE A;  4XVH A;  3AKR A;  1FXZ A;  5JWP A;  3R4D B;  1CJD A;  2VXJ A;  5GLU A;  3VKF C;  4D6Q A;  1C8M 1;  1OPM A;  3OSD A;  2WFF 2;  5FFO C;  1H2L A;  1R1A 3;  1UAI A;  1QNY A;  4NRM A;  2VW0 A;  1FPN 1;  3AMN A;  1MVQ A;  1LHU A;  1YRZ A;  5A7N A;  5GZG A;  3RWN A;  2ARC A;  3ZFF A;  4NUB A;  2HWF 2;  5EYX A;  3ZXK A;  5C3P A;  1PK6 A;  1REF A;  3N7K A;  2B9V A;  5EWS A;  3BVC A;  2C26 A;  5JZG B;  2WWS A;  4LO5 B;  4EQV A;  4JDM A; 
#chains in the Genus database with same CATH homology
 1NKG A;  1JZ4 A;  1PMH X;  4A6O A;  3T2Q A;  1JYV A;  1JYX A;  3VDA A;  1OF4 A;  4XUT A;  3DYM A;  4GZ9 A;  2BGO A;  4MO3 M;  4ARY A;  3F2Z A;  4XUN A;  2QQJ A;  3T09 A;  5EIY B;  4IUG A;  1UWW A;  2VO5 A;  2VZ1 A;  3A7Q A;  1JZ5 A;  2E31 A;  1PX4 A;  2C4X A;  4BK4 A;  1L7Q A;  3A23 A;  3MV1 1;  4QAW A;  3EB7 A;  3GXU A;  1JZ2 A;  1R64 A;  3NQH A;  1MPX A;  5JR2 A;  1F4H A;  3C7H A;  4CUB A;  2DCJ A;  3WF0 A;  1UXX X;  2VZ3 A;  1GOG A;  5A1A A;  4JX0 A;  2X09 A;  4KI5 M;  2W91 A;  4A42 A;  5IYY A;  3CDZ B;  3T08 A;  3C7G A;  2Y64 A;  2J7M A;  4PQQ A;  1TG7 A;  2EID A;  4ZZ8 A;  1JZ8 A;  1JZ6 A;  4YPJ A;  3PUI A;  1SG3 A;  1GU3 A;  2QQN A;  1OH4 A;  2VM9 A;  2E33 A;  3C7O A;  3HN3 A;  2YC4 A;  4E8C A;  4GWI A;  2VZQ A;  2Z4F A;  5JUV A;  4FI9 A;  1NX9 A;  1UX7 A;  4BDV B;  2VMF A;  2V5D A;  1UYZ A;  3T0B A;  2DDU A;  2ZXQ A;  4LPL A;  2WO3 A;  1CZS A;  1H6Y A;  1KGY A;  3HEI A;  3K77 A;  2RJ2 A;  2JE8 A;  3NRU A;  2BER A;  2V4V A;  1XNA A;  5DQ0 A;  2QQK A;  3LEK A;  5JXH A;  2VZR A;  2ORX A;  3ECQ A;  2W95 A;  4M4R A;  4P5Y A;  3K75 B;  3LEI A;  1J83 A;  3MV0 1;  3VD3 A;  5IHR A;  2CDO A;  2Y6H A;  3PUH A;  4QX1 A;  3D3A A;  2EIC A;  4OYU A;  1KEX A;  3WNO A;  5JXG A;  4QX2 A;  4DXR A;  4LHS A;  1P8J A;  5IFT A;  2RV9 A;  3ETP A;  3U37 A;  1JU4 A;  2WN3 A;  2VZT A;  4UOJ A;  3ABZ A;  2VMD A;  1ULO A;  3LQC A;  3IAQ A;  3OB8 A;  1O59 A;  1PMJ X;  3ACG A;  2B4K A;  4A3Z A;  5I0D A;  3LPG A;  1UY4 A;  2ORZ A;  5JXJ A;  2W94 A;  2WYS A;  5LCW L;  3OGS A;  2VCC A;  3HJR A;  2VZU A;  3P1I A;  4L0P A;  3WF2 A;  5DPN A;  1GNY A;  3OGV A;  4A41 A;  1UMI A;  1L7R A;  3FHA A;  2QBX A;  4UAP A;  4A45 A;  1JU3 A;  3IB3 A;  3LPF A;  4Z2A A;  5JMO A;  4DEQ A;  4MOA A;  4W4Z A;  1K45 A;  3T2O A;  5HPO A;  2XON A;  5FUI A;  3GDB A;  3GGL A;  2W1U A;  4M4P A;  2XOM A;  4ZY9 A;  1OT5 A;  3ACI A;  2WDB A;  5EJZ B;  4D8M A;  2W47 A;  2VTF A;  3WNN A;  2ZEX A;  1K3I A;  2QQM A;  2WZE A;  2WAB A;  4MGS A;  3WQB A;  1DP0 A;  4OUE A;  5LA0 A;  1UY0 A;  1W99 A;  2VOT A;  1JYN A;  4QX3 A;  1ULP A;  5DMY A;  2YB7 A;  2EIB A;  2WAA A;  5EJ1 B;  4CU6 A;  4JKM A;  2Y6K A;  1IQD C;  3BN6 A;  1UY3 A;  3C8X A;  1XPW A;  3W5N A;  1O8S A;  2VL4 A;  1DLC A;  3K4D A;  3WNM A;  2VMC A;  3DEC A;  4QDQ A;  1XC6 A;  3A21 A;  2W3J A;  1NUK A;  2PQS A;  2VME A;  3DYP A;  3I2I A;  5B4N A;  4RN5 A;  3K4Z A;  2OKX A;  4DUW A;  4P00 B;  4ET7 A;  1UXZ A;  2VZP A;  4DUV A;  3FN9 A;  3CIH A;  3III A;  1W8N A;  3OEA A;  1T2X A;  3CMG A;  3VD5 A;  4UI9 L;  5F7U A;  3T0D A;  3MUY 1;  4QX0 A;  3THD A;  3SKJ E;  4DXS A;  1UYY A;  4CVU A;  3W5M A;  1JHJ A;  3MBW A;  2W92 A;  5C70 A;  3I3B A;  1OF3 A;  2DCK A;  4BJ0 A;  2XHN A;  4XUQ A;  2W5F A;  2X05 A;  2CDP A;  2E32 A;  1CX1 A;  3IAP A;  3JXS A;  1NAE A;  1JYW A;  3C7E A;  2LS6 A;  3NJV A;  4MAD A;  1JZ3 A;  4DUX A;  4GWJ A;  2WO2 A;  1OD3 A;  2VQT A;  3CZU A;  2RVA A;  3HPN A;  4W8J A;  1CZT A;  5B4X A;  1HN1 A;  3I97 A;  4XZU G;  3NNG A;  2VR4 A;  3BGA A;  2J1S A;  4A4A A;  3EYP A;  5DN2 A;  1W9S A;  2E26 A;  1J84 A;  1UYX A;  3CZJ A;  3I3D A;  4CU7 A;  2QQO A;  3FHQ A;  2LW8 A;  2QQI A;  4TTG A;  1SDD B;  2L9L A;  2WO1 A;  4OMD A;  3C7F A;  2J1E A;  3IDA A;  1US3 A;  3SKV A;  3FL7 A;  1PX3 A;  1K12 A;  4CUA A;  1JZ7 A;  1UZ0 A;  1I5P A;  3HNB M;  2BGP A;  3ACH A;  2R7E B;  4CUC A;  4A44 A;  2VC9 A;  1US2 A;  1W8O A;  2J1U A;  2VCA A;  2YC2 A;  2YFZ A;  2WZ8 A;  2J22 A;  3NJX A;  4DEV A;  2ZEZ A;  2HYX A;  4KMQ A;  4XUO A;  1GOH A;  2VCB A;  3T0A A;  3UNP A;  2Y6L A;  2VZV A;  1BHG A;  2VZS A;  1GUI A;  4TXW A;  1D7P M;  1W9W A;  2W1Q A;  3UES A;  3VD7 A;  3ZM8 A;  4JKK A;  5G04 L;  3LEG A;  3DYO A;  3HNY M;  2XQX A;  3SEP A;  2QQL A;  2WUH A;  2Y8K A;  3VD4 A;  3WNP A;  1W9T A;  1UY2 A;  4ZZ5 A;  3AC0 A;  2VQU A;  1CIY A;  3E1F 1;  5IFP A;  4BXS V;  1GQP A;  2W46 A;  4QDS A;  3WF4 A;  1JI6 A;  3I2K A;  3I2F A;  2BZD A;  3I3E A;  4PT6 A;  2WQ8 A;  4P08 A;  4E8D A;  2V72 A;  3LE0 A;  5HXM A;  1K42 A;  4LQR A;  1YQ2 A;  3I2J A;  3SEE A;  3A22 A;  4JKL A;  3VDB A;  4CU9 A;  2W1S A;  3I2H A;  2ZEW A;  3WEZ A;  3P6B A;  1UY1 A;  1TVG A;  1EUT A;  2J1R A;  4XUP A;  2YFU A;  4QB1 A;  2W1W A;  3J7H A;  4ARX A;  4OMC A;  5C71 A;  3CKH A;  4QPW A;  2WN2 A;  4XUR A;  1WKY A;  3OBA A;  1EUU A;  4CU8 A;  3HOB A;  2BBA A;  2JDA A;  1XNT A;  3ACF A;  2Y6G A;  4QDR A;  2KD7 A;  2J1T A;  1H6X A;  1UMH A;  2YG0 A;  1CZV A;  5JXI A;  4QB6 A;  4KWU A;  4D0Q A;  5LA1 A;  2VZO A;  3WNL A;  2Y6J A;  4W50 A;  5G05 L;  1GMM A;  3T2P A;  2JKX A;  2ZEY A;  3OEB A;  2HLE A;  1WCQ A;  3MUZ 1;  4LKS A;  3WNK A;  3OGR A;  4RYD A;  2EIE A;  3WSO A;  1F4A A;  4ZXE A;  3WF1 A;  2WBK A;  5J1X A;  4DXT A;  3UET A;  2J1A A;  1SHW B;  3MO4 A;  2W9X A;  3K46 A;  4OZO A;  4BK5 A;  3THC A;  5CZK A;  5C7G A;  1GOF A;  2VJX A;  2X10 A;  2W87 A;  3WF3 A;  4HG6 B;  3GM8 A;  3VD9 A;  2J1V A;  3CQO A;  4AG4 A;  1O8P A;  1LNS A;  1DYO A;  5IJR A;  2JD9 A;  3OG2 A;  5LA2 A;  1W0N A;  4PF1 A;  4XVH A;  2ID4 A;  3I2G A;  2WAO A;  5CYY A;  4QB2 A;  2C9K A;  4P02 B;  3VDC A;  1RYY A;  4JHZ A;  4MGQ A;  3K4A A;  3HNM A;  2B9V A;  2C26 A;  4AAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...