3OEAA

Crystal structure of the q121e mutants of c.polysaccharolyticus cbm16-1 bound to cellopentaose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
146
structure length
146
Chain Sequence
SHMVNMVSNPGFEDGLDSWQDWQQDMSAVPEAAHNGALGLKIGGGKAAGGGQDIPLKPNTTYILGAWAKFDSKPAGTFDVVVQYHLKDANNTYVQHILNFNETDWTYKQLLFTTPDVFGSTPELALWKGDTSKANLYVDDVYLVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords S-layer associated multidomain endoglucanase
publication title Mutational insights into the roles of amino acid residues in ligand binding for two closely related family 16 carbohydrate binding modules.
pubmed doi rcsb
source organism Caldanaerobius polysaccharolyticus
total genus 28
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3oeaA00
2VZ3A 3I2GA 2WYSA 3HNMA 2Y6LA 1GMMA 2VMDA 2PQSA 5LA0A 1DYOA 3MV01 2QQJA 2Y64A 2CDPA 2LW8A 1XNTA 2QQOA 3NNGA 2BERA 4QAWA 1LNSA 3K77A 4XUQA 2W1SA 1UY1A 1L7RA 3MUZ1 1O59A 4GWIA 4QB2A 3LQCA 2J1VA 3CKHA 2J1UA 1PMJX 3HNYM 3THCA 4CU9A 2YFZA 1XNAA 4P08A 4P5YA 3ACFA 3T0BA 3CZUA 2VMFA 1UY2A 3OG2A 4D0QA 5DPNA 1NKGA 4CU6A 2YFUA 1RYYA 3VDBA 2X10A 3OBAA 5EJ1B 5JR2A 1K3IA 3ETPA 1P8JA 5I0DA 3D3AA 4DXSA 2VZ1A 2QQKA 4W4ZA 4ARXA 3UNPA 2VCBA 1K45A 2ZEXA 1CX1A 2DCJA 3I2KA 3ABZA 2XONA 2QQIA 2VMCA 4D8MA 2RV9A 5JXGA 1JZ2A 1IQDC 4BK5A 5IFTA 3K4AA 1L7QA 2W9XA 4RN5A 1O8SA 3HN3A 1SHWB 2WBKA 4ZZ8A 2YC4A 3DECA 4M4RA 4MGQA 2Y6HA 3T2OA 2VO5A 2WAAA 3CMGA 2WDBA 1GOFA 4CUCA 5G05L 1NAEA 3WNMA 2RVAA 4A44A 3EYPA 4UAPA 3NRUA 2ORZA 1D7PM 2J22A 2E33A 3WNPA 3DYMA 1UY4A 2WZ8A 4OMCA 2W87A 3DYOA 4JHZA 4HG6B 3ACHA 3VD3A 1SDDB 3WF0A 1GUIA 1W8NA 3SKJE 2V5DA 3FHQA 3ACIA 3OGVA 1UXZA 5JMOA 3UESA 2ZEYA 3WF1A 1K42A 4IUGA 1XC6A 1YQ2A 3NJXA 4QDSA 3W5NA 3NJVA 1GOGA 4Z2AA 2WN2A 5LCWL 4ARYA 3WNLA 3IAPA 4XUPA 4JX0A 1GOHA 3A7QA 1PMHX 2VL4A 2JKXA 3LPFA 4PT6A 4E8DA 3BGAA 2RJ2A 1F4HA 3WF3A 3IDAA 1JYWA 2E26A 3LEIA 3K46A 2QQLA 1H6XA 1F4AA 2HYXA 3SEPA 4XZUG 3I3EA 2WO2A 1UYZA 4DUWA 3WNNA 1UYXA 3GDBA 4AG4A 3I97A 5IHRA 4MGSA 1US2A 5JUVA 2VCAA 3JXSA 2J1RA 5EJZB 2V72A 2DCKA 4BXSV 2J7MA 3ZM8A 2VC9A 2W3JA 3HJRA 4LKSA 4GWJA 2W1WA 2W5FA 1JI6A 1WCQA 2WQ8A 2JDAA 2Y8KA 3C7EA 4QPWA 3HEIA 3I2IA 4KMQA 1JZ7A 4KI5M 2Z4FA 1JZ6A 1XPWA 5C71A 3LEKA 2XQXA 3WNKA 4CU7A 4OUEA 2QQMA 3IAQA 1JZ5A 3W5MA 5DMYA 1OF3A 2LS6A 4A41A 3A23A 1JU4A 4MOAA 4JKLA 2VZQA 1O8PA 2E31A 3I2HA 4XVHA 1GU3A 2W1QA 5CYYA 2JE8A 5IYYA 5EIYB 4PQQA 3VD4A 2HLEA 5LA1A 3WSOA 4BJ0A 2ID4A 2WO3A 2VZUA 2ZXQA 4DEVA 3C7GA 2C26A 2BBAA 1BHGA 4UOJA 2VZSA 2XHNA 4LPLA 3C7HA 4XURA 1JHJA 4AAXA 1UMHA 2VZRA 4DUVA 5A1AA 5G04L 2EIBA 4A3ZA 2W94A 3U37A 1UYYA 1EUTA 5DN2A 2B4KA 2VZTA 4OMDA 5FUIA 3FL7A 2WZEA 2VQUA 2ZEZA 3AC0A 3K75B 2XOMA 4P02B 2VCCA 1K12A 2CDOA 2Y6GA 3T2PA 1J84A 3GXUA 5F7UA 1JYXA 4ZY9A 2J1SA 3PUIA 2VOTA 3LPGA 3DYPA 4XUOA 1T2XA 2VTFA 1MPXA 5CZKA 3FHAA 3T08A 1ULPA 3C7OA 4CUAA 4TXWA 3PUHA 1J83A 2W1UA 3F2ZA 1EUUA 2R7EB 2WAOA 3IIIA 1W0NA 3BN6A 1WKYA 3T2QA 5IJRA 2YC2A 4ZXEA 4CVUA 2EICA 1I5PA 4DUXA 4QX0A 4MADA 1GQPA 4FI9A 2C9KA 4RYDA 4W8JA 3J7HA 1UZ0A 5B4XA 5C7GA 3MV11 1UY3A 3A21A 4W50A 3EB7A 1JYVA 1OF4A 3UETA 3I2JA 1TVGA 4MO3M 1UX7A 2W92A 2YB7A 4A6OA 1OH4A 4QB1A 1CZVA 4PF1A 4ET7A 1JU3A 3GGLA 4YPJA 4JKKA 2VMEA 5JXHA 1KGYA 2C4XA 2WUHA 4OYUA 3LEGA 4CUBA 1GNYA 3CDZB 3WQBA 2W46A 5JXIA 4M4PA 1W9SA 3A22A 4QB6A 4A45A 1JZ3A 2X09A 2YG0A 1PX3A 3OEBA 3SKVA 4LHSA 4TTGA 3VD7A 4XUTA 1ULOA 3VD5A 2V4VA 3P6BA 2BGOA 2VR4A 3K4DA 4A4AA 3I3DA 2JD9A 3CZJA 4QDRA 1OT5A 5HPOA 4ZZ5A 5B4NA 1JZ8A 2EIEA 3I2FA 2ZEWA 1JZ4A 3VD9A 2WABA 2VM9A 4OZOA 3THDA 1TG7A 3SEEA 2WO1A 3MBWA 3MUY1 3C7FA 3LE0A 2W47A 4P00B 4BDVB 3IB3A 3CIHA 4DEQA 4DXTA 4JKMA 3OB8A 1R64A 3CQOA 1US3A 2E32A 1CZSA 3HNBM 1NUKA 4LQRA 3MO4A 2VJXA 4KWUA 4XUNA 3WEZA 5DQ0A 2X05A 3WNOA 3FN9A 1UY0A 4GZ9A 2EIDA 2QBXA 2DDUA 2VZOA 3HOBA 1W9TA 1UMIA 2WN3A 1NX9A 1OD3A 1W8OA 2VZPA 5LA2A 1H6YA 3ECQA 1SG3A 1CZTA 2ORXA 3I3BA 1HN1A 2W95A 2W91A 5HXMA 1W99A 2VQTA 3VDCA 5IFPA 2J1EA 2Y6KA 3T09A 3OGSA 4DXRA 3C8XA 5J1XA 3VDAA 2B9VA 2BGPA 3HPNA 3WF2A 2VZVA 3GM8A 3OEAA 4QX1A 1UXXX 3T0AA 5C70A 3K4ZA 2KD7A 3E1F1 1UWWA 2QQNA 5JXJA 4UI9L 4QX3A 3OGRA 4L0PA 1DLCA 2J1TA 3ACGA 1JYNA 4E8CA 2Y6JA 4BK4A 1DP0A 2L9LA 1PX4A 2J1AA 2OKXA 3P1IA 1KEXA 4QDQA 3T0DA 4A42A 1W9WA 3WF4A 4QX2A 2BZDA 1CIYA 3NQHA 4CU8A
chains in the Genus database with same CATH superfamily
3PMSA 3M1HA 4DPNA 3K3NA 4LO5B 2VZ3A 4MXWA 4XCAA 3AKPA 2JWPA 4XHBA 1AX2A 2WNVB 2E63A 1A3KA 3WD5A 1LHOA 1VALA 3B01A 2YPJA 2KXLA 5FZDA 1NCQA 5EP9A 4LBJA 5FFOC 3J8F1 1H8TA 5LA0A 1W8FA 1DYOA 2QQJA 1OBNA 3OBZA 2LTNA 1LRHA 2PHLA 3POBA 3UT0A 1YQ6A 1DQ6A 4FTSA 1R1A1 1XNTA 5APAA 4QU1A 3EJKA 3J9SA 2B7YA 2PAEA 1Q56A 1W8ZA 1W3VA 3NNGA 1JMUB 3AKSA 1KDMA 2FMDA 1AJKA 1LNSA 2HWD2 1EP0A 2QKDA 2VULA 1OUSA 3HBKA 2W1SA 4TWTA 2JDUA 3RMXA 2R32A 5L7OB 1VLNA 1YIPA 1S0IA 3LQCA 3LCPA 4O9EA 2E9QA 2J1VA 2JG9A 3CKHA 4I0BA 1RITA 2J1UA 3BCWA 5FOJB 5K0UB 5ISLA 3H8RA 3O1VA 3THCA 3OY8A 2YFZA 2HWE2 2DWRA 2MEV1 3B02A 3T0BA 4Q4Y2 5BNNB 3CLPA 4B1LA 2V09A 3E6DA 1ZM1A 5EFUA 1Z7S1 3WVJA 2R6QA 1LCLA 4IEQA 2ZGLA 4YM0A 5DPNA 4FFHA 4AHYA 3VDBA 2X10A 3OBAA 2JG8B 3EHKA 3WDTA 5DUXA 4RR3B 5EJ1B 4HK9A 3OOXA 2WFF1 4RR3C 4EV0A 2VUCA 2OT7A 3T3YA 4E4HA 1J3QA 1QIQA 2VZ1A 1BQPA 2GALA 2WIIB 4HPKB 5FZ0A 3ZPOA 4O65A 2GP3A 4XZPA 4FPEA 4Q4Y1 1CESA 2OA2A 3A0NA 3PIJA 3LKJA 1O5LA 3UNPA 4YZ4A 1W39A 2JICA 1JHNA 3M3EA 4QD2A 4XFGA 1K45A 2V4AA 3H42B 4JCKA 2DCJA 3IMMA 4CP9B 1HRI1 5FZ7A 1CX1A 3VN4A 1AXKA 2BVBA 2VBPA 4LA3A 1CD3G 2XONA 2QQIA 4IDZA 2W52A 1V9U3 2D3SA 2VMCA 1ASJ3 1C57A 3FUQA 4CA9A 2GSYA 2VH9A 1H1IA 4IW3A 5FYUA 4CDQB 1X50A 5FYCA 5IFTA 4CDQC 3ZXGA 4B8EA 4I0WB 5C3QA 4YW4A 5GJ6A 3OD4A 1SHWB 2WBKA 1OVPA 2OW4A 2XMLA 3BODA 5FZ6A 1ZREA 2YC4A 4AEMA 5CU1A 5LB6A 5JMCA 2Z69A 2PAKA 3BTAA 1DQ1A 4FTEA 2VNOA 3JD73 1YUDA 4F3JA 5DZFA 3V56A 3NRUA 4V2VA 3ZN6B 5LCWL 2J22A 1W8UA 1DZTA 2G9FA 2HWB3 1EPWA 1O4YA 3DYMA 2AENA 3GBFA 1AL22 1UY4A 2KM2A 4PCRA 3KQ4B 2WZ8A 4XBLA 3N7JA 1KFUL 1XYPA 2VUJA 2NM1A 1N47A 1QF3A 4AEJA 1IS6A 4YZ3A 4GXLA 3VHRA 1W06A 1RUI2 3KWVA 4N53B 4YYOA 4HKLA 1SDDB 2IVIB 2XKPA 1GUIA 3SKJE 3J4UH 5HV0A 5EWSA 4CDUC 4K8FA 2DUQA 4WVWA 3ZFGB 2UYAA 3FHQA 3OGVA 1RHI3 2WO7A 4OHWA 5CNAA 1AL21 3LFMA 3UESA 4A7ZA 5C8CC 5JMOA 5FO9B 3WF1A 1XU1A 1RJ7A 1DCSA 3ZYRA 1K42A 5A7OA 5A80A 5ABJA 3NJXA 2XLGA 1AR93 4BQ3A 3AZZA 2CWSA 3W5NA 2BU9A 1RUI1 4RHV3 4FFGA 1JUIA 1QXJA 4FQ4A 3VBHC 3WNLA 3QACA 3IZOA 5DAWA 1RB8G 4NPRA 1YI9A 3KLSA 2ZHKA 1DFQA 5BNPC 5FYIA 4YNIA 1RUF2 4YG3A 2EIGA 4IE4A 4Q4W1 2RJ2A 4KU8A 4H7MA 1CAVA 5LATA 1S1AA 3IDAA 4HVRA 4D69A 1JYWA 2JIJA 2XBO3 1SFPA 2PLV1 5H9PA 1RUOA 2G9GA 4QWNA 3SEPA 2UU8A 4XZUG 5JIAA 4AF9A 1RINA 4AI9A 3S5AA 1PGW2 4MGZE 4DRVA 1WLWA 2F4PA 1X36A 4LIUA 3I49A 4FPFA 1AYN2 4Y4YA 5DG1A 2Q8EA 3HN1A 4AQ2A 4MGSA 4J1WA 4QMAA 2VCAA 5J96B 4I01A 1OOPA 1SFYA 2YGMA 2ARXA 3ZIWA 5FRAA 2J1RA 3N9NA 1LKNA 5EJZB 1PO23 3N9PA 1O4TA 4BXSV 1RXFA 5C3PA 3AYDA 5F5CA 4TYSA 1V6KA 2AZ5A 1Q3EA 2R042 3QH7A 1A6CA 2IXJA 2W3JA 5C9AB 4S2HA 1TME3 4CCNA 1RUH1 1RUE1 2PFWA 4OUMA 4FPJA 4K40A 4XCBA 2W1WA 4FT8A 1LEDA 1D2QA 1AR82 5FP7A 1RMU1 3LSDA 1RL3A 2AEZA 5GLWA 4P9IA 2JDAA 4WZFA 3ZYJB 5FP8A 2Q8OA 1V00A 4IE7A 1HB3A 1FMD1 4X8PA 5LA9A 1XPWA 3CEWA 2LALA 2GC2A 4BQ2A 4HXCA 5C71A 4CU7A 2QQMA 1ND2C 4CDWA 1Z0HA 4E2GA 4EZ4A 5AC91 3UK9A 3VV1A 1JZ5A 3OPWA 4R8HA 1AR81 2A6WA 2ZABA 1OFNA 2WRAA 1NQDA 4BLIA 4E2QA 1ZZ9A 4Y24A 3JCIA 3WP4A 3ES4A 1WWYA 5F5QA 4MOAA 3ZKYA 3OSDA 4AZZA 1FT9A 4QHBA 1O8PA 3RZHA 5FY5A 4AVAA 5L9VA 3AP9A 1X82A 2JE8A 1EPZA 3POJA 4IE5A 5L36A 2EVXA 3VD4A 2BUKA 3WCSA 3WSOA 1CAWA 4QKBA 1O91A 2VZUA 3MIDA 4ZONA 5FBJA 5J09A 1UKRA 4DEVA 2RM22 1HJFA 5FZCA 2DVBA 2HEVF 3KCXA 3VBUC 3ILNA 4UOJA 1O3QA 1NA1A 4A3XA 1WD3A 1BBT3 4BQ1A 4Q2FA 4UFMA 4AQSA 4DUVA 5FZIA 4NR1A 5GZEA 1ZRCA 5CKMA 4A3ZA 1NXMA 1RUD2 3DXUA 4TLGA 4AI8A 5FUIA 3DEMA 3ZSKA 3QCWA 3I54A 3Q9OA 1C8M3 2RM21 2DCYA 4LNVA 5HCBA 4COUA 1D0GA 2A6ZA 5FAXA 1SDWA 1AF9A 5FMBA 1PIV3 2E7TA 3P3NA 3DL3A 3V64A 4EWDA 4BCUA 3GXUA 2WS91 3W9AA 2J1SA 1W6PB 3J7NA 1GP5A 1RUD1 2D6LX 1CAUB 1RVF1 4YM2A 3O1MA 1VRH3 4GA9A 1RUJ2 4IV3B 4XXPA 5B2GB 4XIKA 1YIFA 3DYPA 1XXNA 3VDDB 4JV4A 4TN7A 2ZS6B 1MPXA 5IVCA 2DF7A 5IVVA 4Z92B 3KCCA 4CCEA 3N7MA 2VUDA 4NMIA 5A3LA 3AP4A 4TXWA 3O5SA 4COVA 3IIIA 3ZDVA 2LRPA 1CPNA 3NSTA 5KHGA 1VMFA 2ZGKA 5IJRA 4XMIA 1H1MA 5C33A 1RUJ1 1OPOA 4K20A 1GZTA 2XJUA 1WLCA 3U11A 3WLUA 4V1PA 4WM7A 3EBRA 1NCQC 4AFBA 4EN8B 4MADA 1H8TC 3OPZA 4Y5SA 1GQPA 3ZN4A 3WG2A 3ZSEA 3POSA 4AVSA 1UY3A 4Y22A 3J8F3 4B4QA 2BGCA 3EB7A 1JYVA 1OF4A 4HLTA 1TVGA 4WVVA 2W92A 1HB1A 2CTVA 3NVCA 4NUBA 3HVDA 4IV1B 4UBGA 3U4SA 2ILMA 3NWKA 2QQVA 1R083 1OH4A 1W6QB 4YGBA 2JG9C 2RS33 2FDHA 1CZVA 2D6PA 1LJ7A 1Y4WA 3R0RA 4Y1XA 4PF1A 3QOPA 4PLOA 4CPBA 1V6OA 2RDNA 3H1YA 2QVSB 5FYMA 3MF6A 5KHHA 2BV4A 2VMEA 1N3OA 4AQTA 1RIRA 5JXHA 5LEJA 3ZVXA 2YC0A 1LENA 3UKTA 2YPDA 3PTRB 1G9CA 1YQCA 2O1QA 4NHMA 2MEV3 1CJPA 3N9OA 2WLPA 4LR4A 5JPMB 5GZDA 1Z7S3 3AVSA 2OZJA 4M4PA 4YW6A 2XQRA 4F83A 1L3JA 1ZA4A 4RA0A 5IVYA 4IETA 4URAA 5FREA 2Q1FA 2FDFA 1C1LA 4RS5B 1O4ZA 1UU6A 4EN7B 4HN1A 4MZUA 2WNVA 4OI1A 2WFF3 3SKVA 3TB0A 4NHYA 3VD7A 4JGZB 5FZBA 2V5YA 5DDJ2 4YW5A 2PAMA 4CXYA 5DZEA 2ZX3A 3ZMOA 3VGIA 1TNRA 1W2TA 1UZYA 2YHJA 5C8WA 1UIKA 1U5XA 4FOVA 2WNUB 3AP5A 4PBOA 4DS0A 3D8CA 4KWJA 2GNTA 1GICA 1HRI3 1OT5A 1QJY1 2AYHA 3PL0A 5DXDA 4D94A 1CPMA 1LOBA 1JZ8A 3I2FA 5JIUA 2WT2A 5L7OA 3PVBB 4GB32 3VD9A 1LHUA 3MIEA 5DDJ1 1VBB2 3VKOA 3H8OA 3RQ0A 5K0UA 3SEEA 1YFYA 4HVOA 3ZX7A 5JPNB 2J42A 3FJSA 4ZU7A 3RYKA 5BNNA 4FPOB 4BQXA 1S0GA 2W47A 5FCCA 3PJQA 4FOWA 4XJUA 4Y1YA 1F8VA 3MEPA 4JZRA 5FR3A 3ZDSA 4DXTA 4GKXA 4W6WA 3IIAA 2QNKA 1R64A 2JG8A 4GB31 4LBKA 4YGCA 5GZCA 4GKYA 1UCXA 3GCXA 4RR3A 1VBB1 3Q8EA 1NUKA 1AR72 4Z1VA 1MS3A 3M70A 4HPKA 4L8QA 2TEPA 4KWUA 4XFBA 3VKFC 5BY5A 1LHVA 2X05A 4NIIA 2HWF1 2XKOA 2PHWA 1Q5OA 3BVCA 4LOSA 2D3PA 3KVAA 1QXPA 4AI2A 3W20A 3NAPA 4CCDA 4A2UA 4ISRA 4HN0A 1QOSA 2VZOA 3AZWA 4OUSA 1OXCA 3USUB 3KT4A 4CP9A 1AR62 5T5JA 3SCFA 1WCUA 4AVTA 5IK7A 3O1RA 1NX9A 1FOD3 3GZUC 1W8OA 1AR71 5KXCA 4DNYA 1H6YA 4AGRA 1UZZA 4CDQA 4WBBA 5JLVA 3I3BA 5FV3A 1HN1A 3EO6A 1H2LA 3ME2A 5ABJC 5HXMA 2R0FA 5J7MA 1Y43B 2FDGA 1K5MB 4AEKA 1K5MC 1VB4A 3RYRA 1LOGA 4AEDB 1YXWA 5IFPA 4R9AA 3ZXLA 3BTZA 2J1EA 3HQUA 1AR61 1I5ZA 1C3HA 1LGCA 2W39A 2HKXA 3OGSA 4M0NA 5ACA2 2B39A 3C8XA 2RMU3 3VKMA 3MZHA 1QNWA 2DV9A 3PUQA 2B9VA 5KC6A 3J26N 1PK6B 4OI4A 3ZYIB 3H1WA 4I2OA 3HPNA 3RI9A 4N9IA 4C0HA 4NPLA 2Q4SA 3ZN6A 1UXXX 5A7NA 2OQ6A 3AJZA 1KS4A 5C5TA 1YFUA 1ZNPA 3CBNA 4M01A 2W2IA 4Q4W3 2KD7A 1ALYA 1W6OB 3E1F1 4QPYA 3WDYA 2Y6FA 2V73A 3JB4C 3M3CA 4IEVA 5C6CA 3R05A 4QQPA 1POQA 5JXJA 2PLV3 1YO8A 3Q8BA 2J1TA 2D93A 4I0AA 1RC6A 2D6KA 2F17A 5ACA1 3VZJA 2RDQA 1QNYA 4MX3A 1RUG3 4YM3A 4FPLA 4KGGA 3ST7A 4MHRA 3RJRA 4IGQA 2QZ2A 1MS1A 3FFQA 1OOPC 2RR13 3DF0A 4N53A 4Y33A 1OPMA 3T0DA 2XXZA 3VZKA 1WA6X 2IZWA 3ON7A 5CG8A 5IVJA 2SBAA 1HB4A 2DUPA 3ZFGA 4LMFA 2X53S 1UD1A 3ILFA 4XAEA 2EXIA 2R16A 4Q1PA 5C8CA 1ZBA3 3D82A 3WINE 4IGPA 1MZFA 4P9JA 3NQHA 5HCFA 4DO0A 4CU8A 4N7IA 1HRV3 1JOPA 1FX5A 4OHZA 3T2TA 3VZOA 4CEWB 2I45A 1UN1A 5T55A 1S0DA 2WYSA 1SFNA 4LULA 1GSLA 1RUH3 1RUE3 1XOYA 1O3TA 3I4IA 4HZFA 2Y6LA 3O12A 5F5AA 3ZYPA 3LAGA 1GMMA 3UJQA 3HIFA 1ULCA 3VL9A 5FPUA 2VMDA 1RMU3 4OULA 2JDYA 5FZHA 5FO7B 1ODNA 5F6KA 4P9GA 4NVPA 5C3SA 1ST8A 1XYNA 4PIXA 4XFAA 4CDWC 4BZ4A 3POGA 3NV3A 1FMD3 3WUDA 4L92A 2GNDA 3WW2A 1GWMA 4FBFA 1UY1A 5T5PA 3MUZ1 5AC93 1O59A 1CJDA 4AL9A 1PZ7A 1VBE2 4B4PA 1HLCA 2VPVA 4QX7A 1PMJX 5FPBA 3WNXA 1V70A 4AWDA 2DU0A 2WSUA 1XNAA 1X8MA 4P08A 5EPAA 4Y5TA 3CZUA 3I7DA 2PHDA 2VMFA 4IERA 2CWMA 1UY2A 1O3RA 3OG2A 5A33B 1SLAA 3DN7A 4BQ4A 3U0ZA 5FY1A 2QZ3A 4CU6A 5JSPA 5KBFA 3LGRA 5A6XA 4OQ8A 1NA1C 1U0AA 1FV2A 4LO6B 3AZVA 1VBE1 5C9AA 4C0BA 4LHNA 3AMNA 5A7WB 3LWCA 3SCGA 3HMYA 3T1MA 1C1FA 1XBFA 1L7LA 3M3OA 3VB9A 4BWOA 4W4ZA 1WW5A 1LOFA 2D5FA 3H7YA 3I8TA 4PIYA 4GULA 2AUYA 2JB4A 4LHLA 1ENQA 2VMGA 1U5ZA 4HSJA 4C1WA 4HVQA 1D0HA 4IGOA 2RV9A 1A34A 5I0DA 3VBOB 2CV6A 2VMIA 3VBOC 1L7QA 3KGZA 4P9LA 4TLFA 1N3PA 3G7DA 2WS93 4RN5A 2OYZA 2BQPA 1MEC2 3AP7A 4ZZ8A 4DOUA 3KMHA 1RVF3 3GCWA 3UGHA 1GBGA 1LHWA 2DCZA 4YZ5A 1UIJA 5FWJA 5BNOB 2AH2A 1PVC2 3ZPYA 3CMGA 2UURA 2RS52 1GOFA 1PNFA 2WDBA 5G05L 4QM8A 1IZ3A 1NXD1 2RVAA 3WNMA 1BEV3 3EYPA 4UAPA 4XOGA 2GMMA 4LE4A 3RVHA 3RFRA 1T6GC 4ZU4A 5A3OA 4B1MA 5FYHA 2IXCA 1HXS2 4WM7C 1UW8A 1W2AX 5KR7A 5FMDA 1YC61 5JR7B 3SMHA 2G4IA 3I3QA 1EAH3 1GR3A 1IHMA 1IKQA 4FOQA 1QJZA 4GMP0 1PVC1 5FBZA 3DYOA 4NHXA 1C8M2 4Y1VA 2ET1A 2GP5A 2JB8A 2VNRA 3ACHA 4OFGA 4BIFA 2OQ7A 4R9DA 2XUMA 1LGNA 3QH6A 1S4CA 1W8NA 4XFCA 2V5DA 3UYJA 4COZA 3ACIA 4UFKA 1HXS1 4LBLA 1HQLA 2ZEYA 1U12A 5I91A 4YFZA 1W6PA 4BE3A 1WLTA 3LDBA 2YZ4A 3H3LA 1CAUA 5A3TA 3AFKA 2YGLA 4IV3A 2EXHA 2ADDA 3VDDA 2B5HA 2DTYA 1DIWA 1WGPA 1GOGA 2BNMA 2Q5TA 4CE8A 1OD5A 1SQ4A 1K5JA 4LOTA 1SBFA 2BRTA 3RZKA 3IAPA 2Y0OA 1UPIA 1UX6A 4Y4RA 4AVCA 1W03A 3AYEA 1BK0A 1FATA 2VL4A 4QXCA 1S0EA 3D0SA 1YEWA 3R4UA 3AXEA 3WF3A 4ATEA 2CYFA 2WNVC 1RUC1 3LEIA 4XYXA 3OUIA 1H6XA 2YYOA 3FFZA 3ILRA 1QQP3 2IC1A 3I3EA 2LUWA 4GD4A 5FZLA 3V0BB 5AVPA 2NLRA 2WO2A 2Y38A 4HT1T 1JYCA 1E5HA 4Z07A 4DZGA 1NE4A 3TN91 1QXRA 4Q4X2 4K7JA 4AG4A 3M3QA 3I97A 4XFIA 4BA6A 5IAXA 4F7ZA 1UQXA 2WKKA 1US2A 3SC7X 4WZCA 4P14A 2HEWF 1UOFA 5F2SA 3JXSA 5FZ1A 1UYPA 2GNBA 2E7QA 2XHKA 4IV1A 5L7OC 3RJ2X 3IBMA 1WD4A 4AW7A 2RS12 1LESA 1W6QA 1QJY3 1OC1A 5LZ6A 4QPGB 1W6NB 4XACA 3ZXDA 4EROA 2BP6A 4XE9A 2H6CA 5K0UC 4YVWB 5LASA 5F1RA 4QGMA 4GWJA 5EQUA 3CJIB 5FXWA 2XL9A 2DVFA 4FFFA 5BNNC 1JI6A 2XJTA 3AJYA 4CXXA 2PYTA 4EE2A 3C2UA 4ZPIA 2X8KA 5GM0A 3K2OA 2HWD1 4AHZA 3OPTA 3HEIA 4N43B 2JG8C 1XSQA 3AX4A 2RS11 2XGXA 5F3CA 1JXNA 1POV1 4AVBA 1ONAA 2ZKNA 1BMV2 3TBDA 1LU2A 2HWE1 3IAQA 5AFEA 4UW4A 4RS5A 3PLQA 3W5MA 3WP5A 5F6LB 1WCDJ 1QWRA 3MIBA 4MH0E 2EAKA 5HCAA 5DMYA 3O1OA 1MZ6A 3NAPB 2VY0A 4JGZA 4W6YA 3NAPC 3POEA 1OF3A 3D0JA 4A41A 3AZXA 2HEYF 3A23A 1VBC2 2HWF3 5FY0A 3LDKA 3TWIA 4JKLA 2VZQA 1IOAA 2E31A 3I2HA 3ZXJA 2Q30A 1GU3A 2IXIA 1D4M3 2W1QA 2WNUA 5FYSA 2ENRA 5A7SA 1SZBA 3O1TA 3FHIB 2WNOA 1BMV1 4I30A 4D6RA 5EIYB 5FDBA 4DXZA 1UMZA 4NHKA 1GWLA 4Q0SA 1FV3A 3QLQA 2K46A 2ZZQA 5LA1A 5EZWA 5DAVA 2WO3A 3I3MA 2YBPA 3IM0A 1S0CA 3TNPB 4QGLA 3C7GA 5LW9A 4GH4B 4XBQA 1VBC1 1B35B 2XHNA 2WC2A 1KRIA 5KHKA 4XURA 2WT0A 1JHJA 3GBWA 1OURA 4PI0A 4YVSB 4NWVA 3O1PA 3RZGA 4LKDA 3SH3A 2QTWB 3U37A 3WDUA 5CFDB 1OUXA 5DN2A 1X33A 4KH9A 3OBRA 4PJYA 2WZEA 4WV8A 1LR5A 3ETQA 2VCCA 1HW5A 5GLZA 4KBZA 5GLVA 2P37A 3D4KA 1A8MA 5T54A 5KWRA 4QPIB 5C4WB 5FYZA 1LGBA 5C4WC 3NKGA 5FPVA 4WVZA 3ZYFA 4CUGA 1JYXA 4MG2A 4XF9A 3VBSB 3WQ0A 3AKQA 3FBYA 1AX1A 5FKCA 5A7PA 3NMBA 4DY3A 2CGOA 2VOTA 2XR4A 3LPGA 4N53C 3VHOA 2BJSA 4AGGA 1RJ8A 1ENSA 3USUA 3JUUA 4FCAA 3RYPA 2QDRA 3ZFGC 3FHAA 3T08A 3C7OA 1PGL2 2BWCA 3JQXA 4AE2A 1BVVA 1WBFA 5CVRA 2A70A 4V2WA 2CL2A 1Q8OA 1JTZX 3F2ZA 4BOWA 2R7EB 4BYYA 1K5MA 4ZS2A 2HBTA 3BN6A 2P6HA 3SQOA 4AEDA 3NL1A 5FJKA 4NOTA 3VUOA 4HBNA 4LUMA 1ULEA 1I5PA 2BOJA 4LK7A 3WW4A 1R092 1HQWA 1YFXA 1TMF3 2VOXA 3Q8AA 4DRRA 1QEXA 4RYDA 1SLTA 4W8JA 5C3RA 3WX5A 1PK6A 3F95A 1QGLA 1PGL1 4BM8A 5C7GA 3CF6E 3AM2A 3MV11 1T6BX 1S55A 1ACCA 5FYVA 3WT3A 1UOGA 2R062 5FZ8A 3UETA 3J7LA 4WVMB 1IPKA 4MO3M 1UX7A 1W6OA 2BDRA 3RZZA 2YB7A 4XXAA 4A6OA 4ES8A 3HBZA 4GJZA 2P5BA 1ULFA 1AVBA 3VBRB 2R0HA 1UKGA 3AFGA 1RUF1 2ARBA 1JU3A 3GGLA 3GZTB 4YPJA 3VHPA 2A3XA 2R073 4JKKA 4AOCA 1XYOA 3M3IA 1G9BA 2ZX4A 4NRMA 1HX6A 1ZYBA 1PO13 2D98A 2ZBJA 4FVVA 5K4LA 5K8SA 4Q8KA 2JDPA 2K2SA 3NO8A 1QHDA 2RHPA 1JUHA 3LEGA 5L9BA 3X29B 5KC5A 1PGW1 4JDMA 3RZJA 3TEZA 1GNYA 2GN7A 3P5BA 3WQBA 5J3UA 1ZBE2 2MHFA 2W46A 4P9XA 3WP6A 1RUNA 5FWEA 1W9SA 5C9AC 1AYN1 4QB6A 2IXHA 4A45A 1VBD3 5GALA 4XDQA 1FNZA 4CEWA 1J58A 4O61A 3N3HA 1E57A 4KL1A 1IKPA 2NP0A 3C3VA 1WBLA 5L9RA 1NE6A 1XSRA 2WYFA 2C5DA 1LOFC 2D6NA 2NZ9A 3ENRA 3SNMA 2ZKLA 3WW3A 4MGKE 3OUHA 4B29A 3WP3A 3DGTA 4H2AA 4R4XA 3BI3A 1OSGA 1GNHA 5JZGB 4ZXKA 5JZGC 4KNCA 2BGOA 2R041 2VR4A 3PUSA 5JSRA 5F5IA 2ZHNA 3I3DA 4D3WA 1LODA 1VMJA 3DXTA 2XH6A 3LDRA 2VVEA 5E88A 4COYA 2FDKA 2JD9A 3RI8A 4YFWA 5HPOA 1MVEA 4ZZ5A 1W9YA 2EIEA 4K1ZA 4YW2A 5B4NA 5J48A 2XB6C 3FLTA 3QD6A 1NOVA 1F35A 2ZEWA 4PBPA 4OI2A 2WABA 3U75A 4OZOA 1JOJA 1IG3A 5I8SA 3UGFA 1IQAA 3ZR6A 2Z2SB 3H8UA 5CA6A 5CADA 1UZVA 2ZMKA 3H9AA 1YWKA 1TG7A 2QUOA 1DF0A 4CP1A 1E5RA 1ZZBA 2WO1A 4PLMA 5FPXA 3MUY1 4BLJA 1LOEA 4M00A 4XMAA 4GMP3 5I93A 2WINB 4P00B 1OH3A 5FZMA 1DGWX 4URTA 2AACA 4BIOA 5A33A 5CFCB 4XW3A 5A3PA 4S2FA 2Y0IA 2YU1A 1WMDA 3M4FA 3SHRA 3WHUA 3MIFA 1G86A 3JZVA 4NE9A 1SLLA 2E32A 1CZSA 1EV13 4NJ4A 3BYWA 3JBG2 5GKAC 5A7WA 2OPWA 2A3YA 4XUNA 1BJQA 1YFWA 1KFXL 1MS0A 2C9AA 2VW2A 2XDVA 3EMRA 3NKTA 1COV2 2WZR2 4GWMA 4LJHA 4QKDA 3WNOA 1UY0A 4GZ9A 3DPRB 3ZMNA 3K51A 3DPRC 3ZSJA 2D97A 4Y1UA 4AQ6A 5FXVA 1GKBA 2DDUA 2OUJA 3N9LA 1V6IA 1W9TA 2JDNA 3KCYA 5IAVA 3J7MA 1XQNA 2G9ZA 4AGVA 1PHMA 5LA2A 1KD7A 4L2NA 3DV8A 5E1RA 3VBOA 2ORXA 4KWLA 1VBA3 3WOGA 1XNDA 1IPSA 2IUWA 3N36A 1COV1 2WZR1 4OHXA 5I0TA 1AYM2 2VW0A 4I09A 3BIWE 4LBQB 3APBA 4IV3C 3BB6A 2DVGA 3KV5A 3L9JT 3VDDC 5I8TA 2ZMLA 3ZFEB 1QU0A 2WFPA 4QXBA 3GJAA 3T09A 3U07A 1Y9MA 5BNOA 4CCLA 5J1XA 1OKOA 4XEZA 5E8AA 3WF2A 3MIHA 2VZVA 1QJX2 5FY7A 2VXJA 4OCTA 3GM8A 2P3KA 4DQAA 2OUHA 3OEAA 4F8AA 4QX1A 3KHCA 1MS4A 2JENA 1W8WA 1XB9A 2HWC2 5LBEA 4CXWA 2PN5A 5C70A 3MICA 3S7IA 1H2MA 3WZ1A 4O9GA 3AMHA 4Q4V2 5FZOB 4SBVA 5CB7A 1FAYA 1RUC3 2GH8A 1ZRFA 1DLCA 3ACGA 4IEPA 4L99A 1V6NA 1QJU2 1XU2A 1TEIA 5A70A 2XG3A 4S2DA 4N8MA 4XDOA 2ZGTA 1DP0A 1R1ZA 4Y20B 4YM1A 1QJX1 3W58A 4XAAA 3TN93 5F9TA 2ADEA 1R1A3 3CL1A 4Z8BA 3SH4A 2HWC1 3IDBB 3W59A 1W9WA 4IV1C 1F5JA 3N7LA 1D2SA 3RRDA 4P9WA 1FPN2 4PQ9A 2A73B 3P3PA 3TEYA 4Q4V1 4QXKA 4MGYE 3ZXKA 1APNA 3AZYA 4INDA 5A1LA 1UNBA 5IWFA 1UU5A 3I2GA 1DLLA 4IE0A 3HNMA 1PZ9A 1V6MA 3ZO0B 2YBSA 1VAKA 3LA2A 4NO4A 4N90A 2PQSA 4QM9A 5EYYA 1FPN1 2OS2A 2HWD3 1VP6A 5FZ4A 1OKQA 1SLCA 1GZWB 3LA3A 3POIA 2DBIA 2LW8A 5T3NA 2QQOA 4RS5C 5LK5A 3B94A 4JQTA 5KXDA 5CAZA 4QAWA 5GLUA 4QKNA 4ASLA 1CWPA 1X7NA 1VMHA 4CCKA 1NZIA 4JGZC 3K77A 4XUQA 5F3IA 2HWE3 2VD7A 3V0BA 3ZLIA 2XPJA 2DFCA 4Q4Y3 4CCCA 1J1LA 2VBDA 4Q0PA 4CZSA 2B8MA 3AKRA 4PIZA 2D40A 2WNUC 3HNYM 2PA7A 4Q29A 2RDSA 4RQPB 4IEXA 5LRRA 1HDKA 5JOWA 3IMNA 4LBOA 3E97A 2QCSB 2PMWB 5F32A 2D7FA 4D0QA 4B4RA 1X8EA 3HT1A 5LBBA 1GFF2 1NKGA 1OLMA 1ZA7A 1OLQA 3LOBA 2W68A 4QPGA 1W6NA 4MGTA 2Y26A 4A7YA 5JR2A 4YVWA 1K3IA 2UY9A 1P8JA 3ETPA 3GBGA 2P2KA 5FOBB 4JTNA 1HKDA 3O0WA 1ND3B 5FZGA 3VL8A 4B3NA 4DXSA 3CJIA 2QQKA 2BEOA 1Q43A 5KXBA 1QKQA 5SV8A 1Q8VA 3PVOA 4UT5A 2D3RA 4CEYA 3LF7A 2GDFA 2WNEA 1OI6A 4META 4N43A 2HJIA 3WDWA 1OA3A 5F37A 1VB2A 1S2BA 2FCVA 1N1VA 3BTYA 3OYWB 3ORJA 1G9FA 3CU7A 2FD8A 3KV9A 2F6BA 3B9CA 3KS7A 1JZ2A 1EYBA 1S2KA 3RDIA 4BK5A 5JDBA 5CBLA 1HN0A 3K4AA 5FZFA 3IN9A 1CVNA 5FZ9A 3VBFB 4CDXB 1F9KA 4IXLA 2W0XA 2W9XA 1PGSA 1V9U2 4IEYA 5F8PA 1ASJ2 1O8SA 2IFWA 1TNFA 2G1MA 5T52A 3TAYA 4PDWB 4LE3A 1IG0A 4JRAA 4Q0UA 2ZMNA 2EXKA 4EYUA 4M4RA 1GP4A 4MGQA 4XJZA 2GNMA 5H9RA 4M0HA 2VO5A 2WAAA 4CUCA 1AL23 1NAEA 4E4SA 4LBQD 4MV2A 1KDKA 2ORZA 1D7PM 3KT1A 4AEDC 3ZKUA 1DQ2A 4GH4A 3G6JB 1OA2A 2E33A 3WDXA 4UFLA 1ASJ1 1B35A 4K9SA 3JD72 1G7YA 4J25A 1RUI3 2GC3A 2TBVA 4YVSA 5JOZA 1QOOA 4IL7A 1W2OA 1W8HA 1E5SA 4OMCA 3K3OA 1WW4A 1PK6C 1SCRA 3HR9A 5CFDA 2Q1ZB 4LO4B 2HWB2 2PHFA 4LHKA 2ZX1A 3MW3A 4HG6B 3B7MA 3POWA 4UFJA 3WXPA 3VD3A 4XABA 2VGDA 1EY2A 3WF0A 3FZ3A 5D8AB 3ZOIA 3ZXFA 5JOYA 5D8AC 5FPLA 4BHPA 4QPIA 5C4WA 4K3UA 5FMOS 5JI7A 4BQYA 4U36A 5A6YA 2BWAA 4FSJA 1MS9A 1YRZA 2ZZJA 3VBSA 3RGBA 2PTMA 4JTOA 3ZFFB 1XC6A 2A6VA 1QJFA 2IWGB 2JKBA 4OQ9A 2BFUS 2HWB1 4QDSA 1WW6A 3WQ1A 1RHI2 2MPFA 4IESA 3VHNA 4L97A 1JW6A 4X6RB 3VZLA 5GZFA 1RUF3 3MDPA 1HJGA 3R6SA 4CP2A 2DU1A 1GYKA 2GZWA 2ZAAA 5DAXA 1ODMA 5FYBA 1WZXA 4ARYA 2X29A 1AR92 2A7AA 2DURA 4IEZA 1DGWA 4K1YA 4JX0A 4ES9A 2P6CA 2KR2A 4DB5A 1H4HA 3OTFA 4RHV2 1JODA 4E4ZA 4X6QB 4A6SA 1UZWA 3GHMA 3KT7A 4E8DA 4CEWC 1OQDA 2WA3A 3BGAA 5LY1A 2WL1A 3I2OA 1XE8A 1AYN3 4UFIA 1W6MB 5IUQA 1WLDA 3K46A 2QQLA 2HYXA 3IWZA 1G9DA 3U1XA 4WM8B 1UYZA 1J1TA 4DUWA 5J37A 3WNNA 2UWCA 4WM8C 1UYXA 2JX9A 3GDBA 4MSVA 5FZAA 1AR91 5GZGA 5M0TA 2BVVA 2XBO2 3KQRA 4JQRA 5IHRA 4BU2A 5BXXA 3KF5A 4RHV1 1KQRA 5JUVA 2VNGA 4D7YA 2R043 4WVMA 4KG8A 3H8XA 2RDRA 5FXZA 2V72A 3ITQA 5IVFA 2H0VA 4YLZA 4OHYA 1HB2A 1AR83 4KG0A 1LHNA 4GJYA 1YLLA 1AHSA 4HK8A 2VC9A 3HJRA 3VBRA 1WUVA 5JOXA 1V6LA 2X5IB 4LKSA 2X5IC 2XBO1 1PNGA 1PO22 1S0BA 3GYDA 3B3QE 3POYA 5DAQA 2AREA 2PELA 3I59B 5LY2A 4ZU5A 2WQ8A 4P9YA 2DUOA 5IATA 1WW7A 3IPVB 1G9AA 4HSLA 5FJHA 2Z79A 5L73A 3C7EA 1TME2 5A32B 1QDCA 1YCIA 1ZRRA 3I2IA 1VR3A 4KMQA 3TNQA 3H0OA 3TOJA 4OVEA 2FZ2A 1TZOA 1AUYA 1Y9GA 4EN0A 4LO7A 3Q8CA 2VQ0A 3WNKA 3NJYA 2VNVA 1H8VA 2VMHA 3LD8A 1I9RA 1PO21 4YG0A 5FP9A 2ZHLA 3LEMA 3WG3A 2R49A 4CRQA 3AL6A 1UL9A 2EALA 1X9PA 3RS6A 5JZGA 1JU4A 2P3IA 5E6HA 5JCTA 5FMCA 3MFCA 3NV1A 4XVHA 5CYYA 5IYYA 2RM23 4XF1A 1NLRA 4CTEA 5TSWA 3N35A 2P1BA 4DIQA 3GZAA 1DZRA 4M3CB 4SLIA 3S30A 2VW1A 4NIDA 4D7SA 1BKZA 2WA4A 1UOBA 2QQPA 2ID4A 5EYXA 4LXLA 1AXZA 1YYNA 1SMVA 2JIGA 2NPIA 2AEYA 5DAPA 3L2YA 2GU9A 1JH5A 2C26A 3S0MA 1RUD3 1BHGA 4MYEA 1QY4A 1AJOA 1STMA 2VZSA 2B42B 4LPLA 3U78A 3C7HA 4LKFA 3UKNA 4AAXA 1UMHA 2VZRA 5F3GA 5A1AA 3THPA 5BNOC 5G04L 2EIBA 1O6UA 1F15A 5EHDA 2YUEA 4R52A 1EUTA 5CFCA 1BBT2 1YJKA 3AP6A 2D44A 3AK0A 4OMDA 4FFIA 1TQ5A 2P34A 2WJSA 3HAGA 4N9HA 1KS5A 4AFAA 3BIEA 1MEC1 3AC0A 3EXUA 2XOMA 3K75B 2XLAA 1K12A 2CDOA 3UL2A 1QOTA 3T2PA 1RUJ3 4PLNA 5J36A 5F7UA 1DYPA 4AYUA 3NNLA 2RS51 1SEFA 1DG6A 1G6NA 1NY72 2RE9A 4DY5A 3DPRA 2A5ZA 2YROA 5C5UA 2C1FA 3PUIA 5IK8A 1PIV2 1WMXA 4ZS3A 1C28A 4NAMA 4XUOA 1T2XA 2OIIA 5FYYA 1YQ5A 5CZKA 1YHFA 5HBAA 1ULPA 1C4RA 4I3PA 3SLIA 3UKVA 1VRH2 1MACA 5DZGA 2GC1A 2Q8CA 2D5HA 2ZGMA 3KB5A 4AHWA 5CISA 4Z2WA 1C8M1 3IDEA 1EUUA 1NY71 1W0NA 4LBQA 2FDIA 5LK7B 4LORA 5FY4A 1JN2P 4EWAA 1PIV1 2BNOA 3AKTA 4UWDA 4ZXEA 3ZFEA 4BMBA 1BK1A 2A6YA 1DDLA 1XE0A 2OXBA 4FO9A 4QQOA 4B7KA 2P17A 2P4EA 2C9KA 1IGOA 1I1EA 1UZ0A 5IW0A 1CIWA 3THTA 2YXSA 4E27A 4W50A 2VBBA 4RGKA 4AXOA 3FE5A 4JGYB 2HYKA 5ERLA 3I2JA 1JYIA 4CCJA 4FOYA 3W21A 2GMPA 5E89A 2W08A 5FZOA 3MIGA 4L9BA 4FPKA 3J8F2 1VIWB 3IKWA 3PIGA 2FQPA 3GALA 3N4MA 3EQEA 5DUWA 2UYBA 4QQLA 1HQNA 3H7JA 4Y20A 4HMZA 1FI2A 3ZYGA 4X8NA 1W2NA 1ZX5A 2EF6A 1KGYA 1R082 2PHTA 3FX3A 3ROUA 4FPCA 2I74A 2RS32 5FLIA 2E7AA 4E2SA 2YBKA 4HANA 1N1TA 4XC9A 3CDZB 3PU8A 4QPGC 5JXIA 2QE3A 3CNAA 5ANQA 1PZ8A 3V0AA 3KD4A 4YVWC 4BQ5A 4Q4X1 1JZ3A 2X09A 5DDJ3 2CGNA 3CJIC 1CONA 4UW5A 5A6QA 2MEV2 3KHBA 4QQHA 2YG0A 4TSVA 1PX3A 3OEBA 4YSFA 4G9SB 4CEYB 4LHSA 1Z7S2 4UYBA 3VKNA 1R081 4CEYC 3ES1A 5T5LA 4D7TA 2VECA 1QH7A 2RS31 5FY8A 1ULOA 4N43C 2VVDA 3CO2A 3OGGA 1XE7A 5BYNA 5L19A 4UF0B 5T5OA 1GZWA 2WFF2 4GB33 1YQ8A 1FYUA 3RPQA 4XBNA 1XNKA 1REDA 5H9QA 1VBB3 5JI9A 2FBEA 4QDRA 5FMOL 4DMIA 3BPSA 3AXDA 1JZ4A 5FK7A 4AFDA 2VM9A 1IPJA 1HV1A 1H2NA 1DQ0A 2BFUL 1HRI2 5D2AA 4RQPA 1NLQA 2MNGA 3GF6A 1MS8A 2XWBB 1H9WA 2QQWA 2DVAA 3C7FA 2DYCA 3LE0A 1WA4A 2ZA9A 4YW3A 2XWJB 1BXHA 1H1AA 1POV0 4FAGA 3IB3A 4XQDA 1AR73 1A8DA 4Y3OA 5CEHA 3HWJA 1BYHA 1Q8PA 2PHRA 4ITCA 3OB8A 2VOVA 3CQOA 3PJYA 4GH4C 2CNAA 2DTWA 5JSOA 2BBVA 2XL7A 3MI8A 1B35C 4NWWA 4CYDA 1H30A 2ZX2A 2CAVA 4LUKA 1ND3A 4LQRA 2VJXA 4KBBA 4YVSC 4K6BA 3U14A 5DQ0A 1W9FA 1AR63 2ZACA 3LA7A 1C8NA 3FN9A 4JAAA 5CFDC 3MHZA 2P3YA 5FQ0B 3HQRA 3T30A 4ATFA 4JDOA 2EIDA 4NPMA 3AYAA 5KXEA 2A3WA 4Q0QA 5SV5A 5I0RA 1UPSA 2VCMA 2QBXA 4R9CA 1JYTA 1H0BA 3OYWA 2WN3A 5CIRA 4QPIC 3URFA 2JDZA 2E51A 1OD3A 5FZKA 3E5QA 1MS5A 2FDJA 2YY1A 4Y5Z0 2JDMA 1SG3A 3ECQA 3VBSC 5AVAA 3VBFA 2W91A 4NAOA 4CDXA 5ACA3 3N9MA 3R4SA 5HV4A 2ZGRA 1FOD2 2P3JA 3KV6A 4PDWA 3VDCA 1KXGA 2ZGPA 3U10A 3PNAA 3RZMA 3OUJA 4YGEA 1VJ2A 1C5IA 1U5YA 2VOWA 1A78A 2BW8A 4NRQA 1CAXB 4KU7A 3VDAA 3FLRA 1OMIA 4MHUA 4PI2A 2EA7A 2O8QA 1FOD1 2RMU2 1UWWA 2QQNA 3O0XA 3INAA 1MQTB 2BOIA 2CU5A 3RWNA 4CDUB 1MQTC 3OGRA 4LITA 2LM3A 4L0PA 5LBFA 1JYNA 4E8CA 5DABA 5D21A 2PXJA 3ZXAC 4Q4W2 4BK4A 3UGGA 4COWA 4CPBD 1SPPB 2L9LA 3ELNA 2J1AA 4R9BA 3P1IA 1KEXA 2PLV2 1ZZ6A 5D8AA 1W28A 2H0BA 4A42A 3NNJA 1Y9QA 1NCRB 2RMU1 2PHXA 1NCRC 1RGSA 1RUG2 4MUVA 4MGIE 1JBCA 3SXWA 3HT2A 1R091 4H14A 3VBHB 1I3HA 2RR12 4LO8A 5BNPB 3VBRC 1V0AA 3ZFFA 1DBNA 4HL0A 4KGQA 3B00A 5FKBA 2ERFA 1RTVA 1ZBA2 2R061 4QXHA 1ZZCA 4G3YC 3AVRA 4LLOA 2BPA2 4AI0A 4C1XA 4NHLA 3ZSMA 1HRV2 3MLJA 3VZNA 1RUG1 4TZDA 1ULDA 3MV01 3OGJA 3S5QA 2Y64A 4XJ9A 2CDPA 2RR11 4YWAA 1RUH2 1RUE2 1W3XA 4GQ7A 1VBE3 4MVTA 3OD0A 1W6MA 3O7OA 4RD7A 1RMU2 2BERA 2JECA 3NW4A 4XQWA 4YGDA 1JS9A 3O1SA 1ZBA1 3WDVA 3BALA 2FCTA 5A3WA 3ZR5A 5LWBA 1L7RA 4NROA 4WM8A 3A0KA 2ZJCA 1FXZA 3H3ZA 2GAUA 4FPYA 4GWIA 4QB2A 1HRV1 2DBNA 1W2UA 1ZBE1 3BKZA 1FMD2 1UOJA 1WMEA 2KA3A 3WHTA 4CU9A 4P5YA 3ACFA 1MZ5A 4UBHA 5AC92 1AL0G 1OLRA 1CN1A 2QQUA 1LTEA 1NG0A 5HCHA 2OPKA 3QBQA 3WUCA 4EJRA 1ZRDA 4B7EA 1DQ4A 3BU0A 2ZGSA 1PMIA 2B46X 2YFUA 1RYYA 5HXVA 3RZLA 5I8YA 2ZGQA 2G19A 1ENRA 1GWKA 1HV0A 2BTVC 4XILA 2X5IA 3LFIA 3NJZA 1CR7A 4UW3A 3D3AA 4ORFA 1ND2B 3I59A 1RXGA 5I0SA 3ASIA 2WT1A 3MLLA 2XJSA 3IPVA 4ARXA 5CFCC 5JAXA 2UWAA 2EXJA 3DKQA 4H55A 5A3MA 4QHZA 3VZMA 5A32A 2RG4A 2VCBA 2O0OA 3R4DB 2ZEXA 4LBNA 4M3CF 5F3EA 5F2WA 3I2KA 3ABZA 2JDHA 3ALQA 1PM7A 4D8MA 1MEC3 2NYYA 2HH9A 2OZ6A 4J1XA 1IQDC 2IFRA 3POFA 5JXGA 3E6CC 1E5IA 2A6XA 3ZSLA 2WSVA 3VLBB 4LBMA 1BLZA 2D6MA 5H9SA 1O3SA 4QX8A 1V6JA 2IXKA 3KGLA 3TRSB 4D6SA 1PVC3 4EZHA 3VBUB 3HN3A 2RS53 4RFT0 2WZPP 2ZHMA 3AMMA 2CAUA 4I3GA 5LEKA 5CG9A 3DECA 2FHRA 3JBG1 5D1IA 2ZTNA 2Y6HA 4JDNA 3T2OA 4M3CA 4XTMA 2WS92 4CCOA 2A1XA 1HXS3 4UW6A 2WWJA 3BPZA 4L11A 4AR2A 1GP6A 1RVF2 4OZXA 4XPVA 4A44A 2QJVA 3WV6A 4FTBA 5FYTA 3IDCB 3WNPA 4FP2A 3FWEA 5FPZA 3ZFEC 5I0UA 2UWBA 1J3PA 1ENXA 4QQ2A 4H7LA 1BEV2 3PDQA 2PHUA 1F5FA 2ZX0A 4XF4A 2W87A 1LOCA 1NZCA 3B69A 5JVVA 2Q8DA 3V65A 3WG4A 3KZ4C 1CGPA 4JHZA 1AYM1 1J3RA 4AK3A 1OHFA 3MF9A 2VTXJ 4GWNA 4Q5OA 1EAH2 3OBTA 3SISA 1GQHA 4Q8LA 2R1DA 5FY9A 4H3WA 4EN6B 2UY8A 3PVEA 1M06G 1UXZA 3BU7A 3FBMA 1MR5A 2O14A 1BEV1 2AGSA 5CKNA 1QDOA 2JEMA 4IUGA 3RG0A 4RGAA 5FXXA 5EV7A 1YQ2A 2XJVA 4LIVA 4NN0A 1NT0A 4MXWB 2YU2A 4ONUA 3NJVA 4MLOA 1LOAA 5A6ZA 3HQXA 4Z2AA 1EAH1 2WN2A 4EQVA 2D6OX 3LIHA 2WWUA 1XNBA 1NCQB 2OVUA 3A4UA 3NNFA 4XHXA 5A3NA 3S57A 1H8TB 4XUPA 2TNFA 2RJLA 1GOHA 3DCQA 3MLKA 3WG1A 1QJU1 1DZQA 3A7QA 1PMHX 2JKXA 3LPFA 4PT6A 1W04A 1ZZ7A 1F4HA 5A1FA 1DU3D 2B45X 3S6PA 1ULGA 3GNEA 3M7AA 2E26A 4Q4X3 4QX5A 2WWSA 2XJQA 1F4AA 2VTXA 4I02A 3WY6A 4YZ2A 3WCRA 1SACA 3SH5A 4YW1A 1W90A 2JG9B 2Z42A 4BQWA 3DKWA 2RS13 2YDEA 3OY8B 1QQP2 3SITA 4AI3A 1POV3 3GJBA 5FLHA 4ASMB 1QJEA 4BMEA 1YJLA 2JE7A 1SLBA 4JGYA 2DCTA 5GLTA 3USSA 2H6BA 1KITA 1VE0A 3WW1A 2K0GA 1DYKA 2VG9A 4LEJA 1GQGA 1N1YA 2DCKA 1XJAA 1D4VB 1HIXA 2XVGA 4FP3A 2VVFA 2J7MA 3RWKX 3ZIXA 4JHTA 3ZM8A 5FTTC 4K21A 4RQPC 3WR0A 1UU4A 4AI1A 3ZYHA 1Y7BA 4PF5A 2XLFA 1B09A 2W5FA 5DUUA 3RSJA 4C91A 1QQP1 1XRUA 1WCQA 1QJY2 3PVNA 1GZ9A 4XJAA 5BUVA 1H4GA 3ZYBA 1M4WA 5EXOA 3FUOA 3O0VA 2Y8KA 4IEWA 4QPWA 4XF0A 3UJOA 4HKOA 3BTXA 3ATGA 4OHVA 1N1SA 3E5XA 3N9QA 3PTYA 1JZ7A 2NMNA 3BUCA 5AFBA 4KI5M 2Z4FA 1J59A 1JZ6A 1ZVFA 4LT5A 3JB8A 1ND3C 3S7EA 3KM5A 3LEKA 1WCSA 2XQXA 3L2HA 4YARA 4OUEA 1W0OA 1VBC3 2JXAA 2E53A 4BB3A 1DQ5A 2VU9A 4J6GA 4AAPA 4YG6A 4R4ZA 3LZZA 2LS6A 4JVAA 1X9TA 3BOWA 2O8OA 4EWEA 1DGLA 4RL7A 2LROA 3MGUA 4UF0A 2GMEA 1AX0A 1F31A 4HKWA 5FP4A 5LBCA 3B9IA 1BZWA 2D43A 2VXRA 1Q8SA 2PQQA 2WLQA 3FLPA 4PQQA 4QKFA 5FZ3A 4M3CE 3O1UA 2HWF2 2HLEA 3VBFC 4BJ0A 3UV9A 4CDXC 3IT8A 5IVEA 3RNSA 4AVVA 1D4M2 2ZXQA 4Q27A 5A7QA 1SLIA 1DGRN 1GNZA 1OFSA 1VAVA 3CJXA 2VOKA 2BBAA 2ZGUA 3Q8FA 4PDWC 3T1LA 2FZ1A 2Y33A 5FP3A 2WQZC 2Z5WA 4XIOA 4MXVA 3D6EA 4IEUA 4D6QA 1F2NA 2SLIA 2W94A 1G8WA 1UYYA 2XJRA 2C6SA 2B4KA 2VZTA 3FL7A 3K48A 4FXKB 1V9U1 2VQUA 1D4M1 2ZEZA 5ANNA 4LK6A 4P02B 1ZZ8A 3RMYA 4ISQA 3FMGA 2Y6GA 4HETA 3V0AB 1REEA 1IS5A 5IVBA 2IXLA 2FMYA 5IK5A 1J84A 4YRDA 5FUNA 4XETA 4ZY9A 5T50A 2XVKA 3WQ7A 5FQ0A 4IEOA 4ASKA 1N3QA 5ABJB 3HD8B 1I6XA 4OI0A 1OQ1A 4S2GA 2ARAA 2VTFA 1S2EA 3TYJA 2VQAA 3JD71 4W6XA 1LULA 3AL5A 2VE1A 4CUAA 3NV4A 2C0ZA 3ZFFC 4NIGA 3PUHA 1J83A 2W1UA 5K7PA 1GV9A 2WAOA 1R093 2XUEA 2ZAHA 4KWKA 4LKEA 1CAVB 2ET7A 5FPAA 4EN9B 1WKYA 3T2QA 2Y60A 1YI7A 1GZCA 2YC2A 2FCUA 4HONA 5E16A 1W0PA 4CVUA 2EICA 3H1MA 4DUXA 1O7FA 3I2DA 4QX0A 1S0JA 2R063 4FI9A 4OLLA 2IVJA 1AZDA 4CP0A 1KJRA 1CAXA 5FO8B 4NIHA 2VAUA 3J7HA 4GAZA 4U2AA 5B4XA 3AMPA 3GZEA 3A21A 5F39A 5IK4A 2E6VA 2GH2A 1XNCA 3PMEA 1RHI1 1OOPB 2ZGOA 1OQEA 4Y26A 1TMF2 1WMFA 1SCSA 4CCMA 4O7XA 2ZCWA 5K9YA 1Z78A 4CDUA 1MQTA 2VUAA 1BVP1 5KHJA 4QT6A 4QB1A 4BH9A 2NN8A 3PURA 1FNYA 5FIXA 2QFEA 5C3OA 4ET7A 2I2SA 1SPPA 1Q8QA 1ZBE3 1LAJA 4Y1ZA 4Q1RA 4DFSA 1URXA 2AR6A 2C4XA 3U4XA 2WUHA 4OYUA 1NCRA 1TMF1 1UO9A 1OLME 2DFBA 3KSCA 1SBDA 2ZGNA 1GANA 2ES3A 4Z82A 3VBHA 4CUBA 4AHXA 2R072 1BCXA 1LECA 5BNPA 3A22A 1PO12 3KF3A 3AYCA 5FLJA 2I07B 3DUIA 4HOOA 1UF2C 2NMOA 4AFMA 4TTGA 1MVQA 4JC1A 3CHXA 4CDWB 1H9PA 2WR9A 4GIQA 3NNMA 4FQZA 5FUPA 4FXGB 2BYVE 1C5HA 4HFSA 5FK8A 1VBD2 2OX0A 4XUTA 4LA2A 3VD5A 2V4VA 1REFA 2ETEA 2N7GA 3P6BA 2R071 2R30A 5BPXA 3K4DA 3MPPG 4A4AA 1PO11 2C24A 2GN3A 3H3UA 2NQYA 1Y3TA 2AC1A 3CZJA 5BNQA 1W8TA 5A3UA 3ZXEA 1CAWB 3LSEA 1YNAA 4XFFA 4QU2A 1WCKA 1TME1 4RSUA 4YW7A 1VBD1 3THDA 2QDNA 4A7KA 1H2KA 4YZ1A 1NA1B 2A75A 1UAIA 2XJPA 2YMZA 2R1BA 1DHKB 1NLSA 3MBWA 1SBEA 2CSGA 3TEWA 3M8LA 4BDVB 4C8DA 4DINB 1TE1B 3JBG3 4Q0VA 3LIGA 3CIHA 4DEQA 3AMQA 4JKMA 4IE6A 4N7UA 1COV3 1US3A 2WZR3 3E5UA 3MYXA 4PHZA 1KJLA 1NQJA 2DVDA 2JJ6A 1MZEA 2K9ZA 2ZOEB 3HNBM 3M2MA 1O5UA 2EAAA 1U5IA 2CY6A 4LTAA 2JD4A 3LB9A 3MO4A 5CKQA 3ZN5A 4QGNA 5JWPA 1ND2A 3E6BA 1CX4A 2YV8A 4XDPA 4E4DX 3B93A 5KHIA 3WEZA 3KV4A 5BV6A 5EJ3A 5DUVA 4QHOA 1IS3A 5FZEA 2Q1MA 3KVBA 1EV12 4UXAA 5C8CB 4RFRB 1W05A 3H50A 3B5LB 3HOBA 3ACLA 1UMIA 4GMP1 1AYM3 3BOPA 4W65A 1DGRA 1OVSA 2VZPA 3JQWA 4FPGA 1CZTA 2W95A 1BBT1 2ARCA 3MW2A 3NV2A 5DG2A 1EV11 5HI0A 1W99A 2XVLA 3T4VA 1OA4A 1PVXA 2VQTA 3VBUA 2HBUA 3OJBA 4XJWA 1QJX3 3TEXA 2Y6KA 1VRBA 4UFHA 1VBA2 4IQPA 4WM7B 1VAMA 3OF1A 1LB2A 1GLHA 3GHNA 2HWC3 3D5OA 4JRLA 4DXRA 3T4HB 2CGPA 1VPHA 2TUNA 4LLFA 2GC0A 3MPBA 2BGPA 4XTPA 4CSWA 4XF3A 2CHHA 2JE9A 4BPZA 4E9KA 4Q4V3 4Y22B 4FAHA 2ZPXA 4KQ7A 1QMJA 4GALA 1QJU3 3AB0A 1CQ9A 4K8RB 3T0AA 4BISA 3K4ZA 4P5HA 3O14A 1LEMA 2B9UA 4NIAA 4ZHNA 3PHMA 3PUAA 4Q26A 4UI9L 4QX3A 1VBA1 2RJKA 3LOIA 3OCPA 2F4LA 5J98B 2A71A 2WQ4A 1VRH1 3FC0A 1QH6A 4C90A 4XFHA 2BNNA 2Y34A 1FPN3 2Y6JA 3JU9A 1LU1A 1S0FA 1NYWA 3MW4A 4BXFA 1PM4A 1PX4A 4JGYC 2OKXA 4XJ8A 1RUC2 4QDQA 3PU3A 3MFAA 1AXYA 4G4FA 4AFCA 5LRSA 2Q0AA 3WF4A 5IT6A 4QX2A 4XQ4A 3SCHA 4ZKTB 3VKLA 2BZDA 3N7KA 4RGGA 2JDKA 3TN92 1CIYA 1JOBA 4NRPA 1R1A2 4FPHA 1ZRIA 1IS4A 2ATFA
chains in the Genus database with same CATH topology
2VZ3A 3I2GA 2WYSA 3HNMA 2Y6LA 1GMMA 2VMDA 2PQSA 5LA0A 1DYOA 3MV01 2QQJA 2Y64A 2CDPA 2LW8A 1XNTA 2QQOA 3NNGA 2BERA 4QAWA 1LNSA 3K77A 4XUQA 2W1SA 1UY1A 1L7RA 3MUZ1 1O59A 4GWIA 4QB2A 3LQCA 2J1VA 3CKHA 2J1UA 1PMJX 3HNYM 3THCA 4CU9A 2YFZA 1XNAA 4P08A 4P5YA 3ACFA 3T0BA 3CZUA 2VMFA 1UY2A 3OG2A 4D0QA 5DPNA 1NKGA 4CU6A 2YFUA 1RYYA 3VDBA 2X10A 3OBAA 5EJ1B 5JR2A 1K3IA 3ETPA 1P8JA 5I0DA 3D3AA 4DXSA 2VZ1A 2QQKA 4W4ZA 4ARXA 3UNPA 2VCBA 1K45A 2ZEXA 1CX1A 2DCJA 3I2KA 3ABZA 2XONA 2QQIA 2VMCA 4D8MA 2RV9A 5JXGA 1JZ2A 1IQDC 4BK5A 5IFTA 3K4AA 1L7QA 2W9XA 4RN5A 1O8SA 3HN3A 1SHWB 2WBKA 4ZZ8A 2YC4A 3DECA 4M4RA 4MGQA 2Y6HA 3T2OA 2VO5A 2WAAA 3CMGA 2WDBA 1GOFA 4CUCA 5G05L 1NAEA 3WNMA 2RVAA 4A44A 3EYPA 4UAPA 3NRUA 2ORZA 1D7PM 2J22A 2E33A 3WNPA 3DYMA 1UY4A 2WZ8A 4OMCA 2W87A 3DYOA 4JHZA 4HG6B 3ACHA 3VD3A 1SDDB 3WF0A 1GUIA 1W8NA 3SKJE 2V5DA 3FHQA 3ACIA 3OGVA 1UXZA 5JMOA 3UESA 2ZEYA 3WF1A 1K42A 4IUGA 1XC6A 1YQ2A 3NJXA 4QDSA 3W5NA 3NJVA 1GOGA 4Z2AA 2WN2A 5LCWL 4ARYA 3WNLA 3IAPA 4XUPA 4JX0A 1GOHA 3A7QA 1PMHX 2VL4A 2JKXA 3LPFA 4PT6A 4E8DA 3BGAA 2RJ2A 1F4HA 3WF3A 3IDAA 1JYWA 2E26A 3LEIA 3K46A 2QQLA 1H6XA 1F4AA 2HYXA 3SEPA 4XZUG 3I3EA 2WO2A 1UYZA 4DUWA 3WNNA 1UYXA 3GDBA 4AG4A 3I97A 5IHRA 4MGSA 1US2A 5JUVA 2VCAA 3JXSA 2J1RA 5EJZB 2V72A 2DCKA 4BXSV 2J7MA 3ZM8A 2VC9A 2W3JA 3HJRA 4LKSA 4GWJA 2W1WA 2W5FA 1JI6A 1WCQA 2WQ8A 2JDAA 2Y8KA 3C7EA 4QPWA 3HEIA 3I2IA 4KMQA 1JZ7A 4KI5M 2Z4FA 1JZ6A 1XPWA 5C71A 3LEKA 2XQXA 3WNKA 4CU7A 4OUEA 2QQMA 3IAQA 1JZ5A 3W5MA 5DMYA 1OF3A 2LS6A 4A41A 3A23A 1JU4A 4MOAA 4JKLA 2VZQA 1O8PA 2E31A 3I2HA 4XVHA 1GU3A 2W1QA 5CYYA 2JE8A 5IYYA 5EIYB 4PQQA 3VD4A 2HLEA 5LA1A 3WSOA 4BJ0A 2ID4A 2WO3A 2VZUA 2ZXQA 4DEVA 3C7GA 2C26A 2BBAA 1BHGA 4UOJA 2VZSA 2XHNA 4LPLA 3C7HA 4XURA 1JHJA 4AAXA 1UMHA 2VZRA 4DUVA 5A1AA 5G04L 2EIBA 4A3ZA 2W94A 3U37A 1UYYA 1EUTA 5DN2A 2B4KA 2VZTA 4OMDA 5FUIA 3FL7A 2WZEA 2VQUA 2ZEZA 3AC0A 3K75B 2XOMA 4P02B 2VCCA 1K12A 2CDOA 2Y6GA 3T2PA 1J84A 3GXUA 5F7UA 1JYXA 4ZY9A 2J1SA 3PUIA 2VOTA 3LPGA 3DYPA 4XUOA 1T2XA 2VTFA 1MPXA 5CZKA 3FHAA 3T08A 1ULPA 3C7OA 4CUAA 4TXWA 3PUHA 1J83A 2W1UA 3F2ZA 1EUUA 2R7EB 2WAOA 3IIIA 1W0NA 3BN6A 1WKYA 3T2QA 5IJRA 2YC2A 4ZXEA 4CVUA 2EICA 1I5PA 4DUXA 4QX0A 4MADA 1GQPA 4FI9A 2C9KA 4RYDA 4W8JA 3J7HA 1UZ0A 5B4XA 5C7GA 3MV11 1UY3A 3A21A 4W50A 3EB7A 1JYVA 1OF4A 3UETA 3I2JA 1TVGA 4MO3M 1UX7A 2W92A 2YB7A 4A6OA 1OH4A 4QB1A 1CZVA 4PF1A 4ET7A 1JU3A 3GGLA 4YPJA 4JKKA 2VMEA 5JXHA 1KGYA 2C4XA 2WUHA 4OYUA 3LEGA 4CUBA 1GNYA 3CDZB 3WQBA 2W46A 5JXIA 4M4PA 1W9SA 3A22A 4QB6A 4A45A 1JZ3A 2X09A 2YG0A 1PX3A 3OEBA 3SKVA 4LHSA 4TTGA 3VD7A 4XUTA 1ULOA 3VD5A 2V4VA 3P6BA 2BGOA 2VR4A 3K4DA 4A4AA 3I3DA 2JD9A 3CZJA 4QDRA 1OT5A 5HPOA 4ZZ5A 5B4NA 1JZ8A 2EIEA 3I2FA 2ZEWA 1JZ4A 3VD9A 2WABA 2VM9A 4OZOA 3THDA 1TG7A 3SEEA 2WO1A 3MBWA 3MUY1 3C7FA 3LE0A 2W47A 4P00B 4BDVB 3IB3A 3CIHA 4DEQA 4DXTA 4JKMA 3OB8A 1R64A 3CQOA 1US3A 2E32A 1CZSA 3HNBM 1NUKA 4LQRA 3MO4A 2VJXA 4KWUA 4XUNA 3WEZA 5DQ0A 2X05A 3WNOA 3FN9A 1UY0A 4GZ9A 2EIDA 2QBXA 2DDUA 2VZOA 3HOBA 1W9TA 1UMIA 2WN3A 1NX9A 1OD3A 1W8OA 2VZPA 5LA2A 1H6YA 3ECQA 1SG3A 1CZTA 2ORXA 3I3BA 1HN1A 2W95A 2W91A 5HXMA 1W99A 2VQTA 3VDCA 5IFPA 2J1EA 2Y6KA 3T09A 3OGSA 4DXRA 3C8XA 5J1XA 3VDAA 2B9VA 2BGPA 3HPNA 3WF2A 2VZVA 3GM8A 3OEAA 4QX1A 1UXXX 3T0AA 5C70A 3K4ZA 2KD7A 3E1F1 1UWWA 2QQNA 5JXJA 4UI9L 4QX3A 3OGRA 4L0PA 1DLCA 2J1TA 3ACGA 1JYNA 4E8CA 2Y6JA 4BK4A 1DP0A 2L9LA 1PX4A 2J1AA 2OKXA 3P1IA 1KEXA 4QDQA 3T0DA 4A42A 1W9WA 3WF4A 4QX2A 2BZDA 1CIYA 3NQHA 4CU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZ3 A;  3I2G A;  2WYS A;  3HNM A;  2Y6L A;  1GMM A;  2VMD A;  2PQS A;  5LA0 A;  1DYO A;  3MV0 1;  2QQJ A;  2Y64 A;  2CDP A;  2LW8 A;  1XNT A;  2QQO A;  3NNG A;  2BER A;  4QAW A;  1LNS A;  3K77 A;  4XUQ A;  2W1S A;  1UY1 A;  1L7R A;  3MUZ 1;  1O59 A;  4GWI A;  4QB2 A;  3LQC A;  2J1V A;  3CKH A;  2J1U A;  1PMJ X;  3HNY M;  3THC A;  4CU9 A;  2YFZ A;  1XNA A;  4P08 A;  4P5Y A;  3ACF A;  3T0B A;  3CZU A;  2VMF A;  1UY2 A;  3OG2 A;  4D0Q A;  5DPN A;  1NKG A;  4CU6 A;  2YFU A;  1RYY A;  3VDB A;  2X10 A;  3OBA A;  5EJ1 B;  5JR2 A;  1K3I A;  3ETP A;  1P8J A;  5I0D A;  3D3A A;  4DXS A;  2VZ1 A;  2QQK A;  4W4Z A;  4ARX A;  3UNP A;  2VCB A;  1K45 A;  2ZEX A;  1CX1 A;  2DCJ A;  3I2K A;  3ABZ A;  2XON A;  2QQI A;  2VMC A;  4D8M A;  2RV9 A;  5JXG A;  1JZ2 A;  1IQD C;  4BK5 A;  5IFT A;  3K4A A;  1L7Q A;  2W9X A;  4RN5 A;  1O8S A;  3HN3 A;  1SHW B;  2WBK A;  4ZZ8 A;  2YC4 A;  3DEC A;  4M4R A;  4MGQ A;  2Y6H A;  3T2O A;  2VO5 A;  2WAA A;  3CMG A;  2WDB A;  1GOF A;  4CUC A;  5G05 L;  1NAE A;  3WNM A;  2RVA A;  4A44 A;  3EYP A;  4UAP A;  3NRU A;  2ORZ A;  1D7P M;  2J22 A;  2E33 A;  3WNP A;  3DYM A;  1UY4 A;  2WZ8 A;  4OMC A;  2W87 A;  3DYO A;  4JHZ A;  4HG6 B;  3ACH A;  3VD3 A;  1SDD B;  3WF0 A;  1GUI A;  1W8N A;  3SKJ E;  2V5D A;  3FHQ A;  3ACI A;  3OGV A;  1UXZ A;  5JMO A;  3UES A;  2ZEY A;  3WF1 A;  1K42 A;  4IUG A;  1XC6 A;  1YQ2 A;  3NJX A;  4QDS A;  3W5N A;  3NJV A;  1GOG A;  4Z2A A;  2WN2 A;  5LCW L;  4ARY A;  3WNL A;  3IAP A;  4XUP A;  4JX0 A;  1GOH A;  3A7Q A;  1PMH X;  2VL4 A;  2JKX A;  3LPF A;  4PT6 A;  4E8D A;  3BGA A;  2RJ2 A;  1F4H A;  3WF3 A;  3IDA A;  1JYW A;  2E26 A;  3LEI A;  3K46 A;  2QQL A;  1H6X A;  1F4A A;  2HYX A;  3SEP A;  4XZU G;  3I3E A;  2WO2 A;  1UYZ A;  4DUW A;  3WNN A;  1UYX A;  3GDB A;  4AG4 A;  3I97 A;  5IHR A;  4MGS A;  1US2 A;  5JUV A;  2VCA A;  3JXS A;  2J1R A;  5EJZ B;  2V72 A;  2DCK A;  4BXS V;  2J7M A;  3ZM8 A;  2VC9 A;  2W3J A;  3HJR A;  4LKS A;  4GWJ A;  2W1W A;  2W5F A;  1JI6 A;  1WCQ A;  2WQ8 A;  2JDA A;  2Y8K A;  3C7E A;  4QPW A;  3HEI A;  3I2I A;  4KMQ A;  1JZ7 A;  4KI5 M;  2Z4F A;  1JZ6 A;  1XPW A;  5C71 A;  3LEK A;  2XQX A;  3WNK A;  4CU7 A;  4OUE A;  2QQM A;  3IAQ A;  1JZ5 A;  3W5M A;  5DMY A;  1OF3 A;  2LS6 A;  4A41 A;  3A23 A;  1JU4 A;  4MOA A;  4JKL A;  2VZQ A;  1O8P A;  2E31 A;  3I2H A;  4XVH A;  1GU3 A;  2W1Q A;  5CYY A;  2JE8 A;  5IYY A;  5EIY B;  4PQQ A;  3VD4 A;  2HLE A;  5LA1 A;  3WSO A;  4BJ0 A;  2ID4 A;  2WO3 A;  2VZU A;  2ZXQ A;  4DEV A;  3C7G A;  2C26 A;  2BBA A;  1BHG A;  4UOJ A;  2VZS A;  2XHN A;  4LPL A;  3C7H A;  4XUR A;  1JHJ A;  4AAX A;  1UMH A;  2VZR A;  4DUV A;  5A1A A;  5G04 L;  2EIB A;  4A3Z A;  2W94 A;  3U37 A;  1UYY A;  1EUT A;  5DN2 A;  2B4K A;  2VZT A;  4OMD A;  5FUI A;  3FL7 A;  2WZE A;  2VQU A;  2ZEZ A;  3AC0 A;  3K75 B;  2XOM A;  4P02 B;  2VCC A;  1K12 A;  2CDO A;  2Y6G A;  3T2P A;  1J84 A;  3GXU A;  5F7U A;  1JYX A;  4ZY9 A;  2J1S A;  3PUI A;  2VOT A;  3LPG A;  3DYP A;  4XUO A;  1T2X A;  2VTF A;  1MPX A;  5CZK A;  3FHA A;  3T08 A;  1ULP A;  3C7O A;  4CUA A;  4TXW A;  3PUH A;  1J83 A;  2W1U A;  3F2Z A;  1EUU A;  2R7E B;  2WAO A;  3III A;  1W0N A;  3BN6 A;  1WKY A;  3T2Q A;  5IJR A;  2YC2 A;  4ZXE A;  4CVU A;  2EIC A;  1I5P A;  4DUX A;  4QX0 A;  4MAD A;  1GQP A;  4FI9 A;  2C9K A;  4RYD A;  4W8J A;  3J7H A;  1UZ0 A;  5B4X A;  5C7G A;  3MV1 1;  1UY3 A;  3A21 A;  4W50 A;  3EB7 A;  1JYV A;  1OF4 A;  3UET A;  3I2J A;  1TVG A;  4MO3 M;  1UX7 A;  2W92 A;  2YB7 A;  4A6O A;  1OH4 A;  4QB1 A;  1CZV A;  4PF1 A;  4ET7 A;  1JU3 A;  3GGL A;  4YPJ A;  4JKK A;  2VME A;  5JXH A;  1KGY A;  2C4X A;  2WUH A;  4OYU A;  3LEG A;  4CUB A;  1GNY A;  3CDZ B;  3WQB A;  2W46 A;  5JXI A;  4M4P A;  1W9S A;  3A22 A;  4QB6 A;  4A45 A;  1JZ3 A;  2X09 A;  2YG0 A;  1PX3 A;  3OEB A;  3SKV A;  4LHS A;  4TTG A;  3VD7 A;  4XUT A;  1ULO A;  3VD5 A;  2V4V A;  3P6B A;  2BGO A;  2VR4 A;  3K4D A;  4A4A A;  3I3D A;  2JD9 A;  3CZJ A;  4QDR A;  1OT5 A;  5HPO A;  4ZZ5 A;  5B4N A;  1JZ8 A;  2EIE A;  3I2F A;  2ZEW A;  1JZ4 A;  3VD9 A;  2WAB A;  2VM9 A;  4OZO A;  3THD A;  1TG7 A;  3SEE A;  2WO1 A;  3MBW A;  3MUY 1;  3C7F A;  3LE0 A;  2W47 A;  4P00 B;  4BDV B;  3IB3 A;  3CIH A;  4DEQ A;  4DXT A;  4JKM A;  3OB8 A;  1R64 A;  3CQO A;  1US3 A;  2E32 A;  1CZS A;  3HNB M;  1NUK A;  4LQR A;  3MO4 A;  2VJX A;  4KWU A;  4XUN A;  3WEZ A;  5DQ0 A;  2X05 A;  3WNO A;  3FN9 A;  1UY0 A;  4GZ9 A;  2EID A;  2QBX A;  2DDU A;  2VZO A;  3HOB A;  1W9T A;  1UMI A;  2WN3 A;  1NX9 A;  1OD3 A;  1W8O A;  2VZP A;  5LA2 A;  1H6Y A;  3ECQ A;  1SG3 A;  1CZT A;  2ORX A;  3I3B A;  1HN1 A;  2W95 A;  2W91 A;  5HXM A;  1W99 A;  2VQT A;  3VDC A;  5IFP A;  2J1E A;  2Y6K A;  3T09 A;  3OGS A;  4DXR A;  3C8X A;  5J1X A;  3VDA A;  2B9V A;  2BGP A;  3HPN A;  3WF2 A;  2VZV A;  3GM8 A;  3OEA A;  4QX1 A;  1UXX X;  3T0A A;  5C70 A;  3K4Z A;  2KD7 A;  3E1F 1;  1UWW A;  2QQN A;  5JXJ A;  4UI9 L;  4QX3 A;  3OGR A;  4L0P A;  1DLC A;  2J1T A;  3ACG A;  1JYN A;  4E8C A;  2Y6J A;  4BK4 A;  1DP0 A;  2L9L A;  1PX4 A;  2J1A A;  2OKX A;  3P1I A;  1KEX A;  4QDQ A;  3T0D A;  4A42 A;  1W9W A;  3WF4 A;  4QX2 A;  2BZD A;  1CIY A;  3NQH A;  4CU8 A; 
#chains in the Genus database with same CATH topology
 3PMS A;  3M1H A;  4DPN A;  3K3N A;  4LO5 B;  2VZ3 A;  4MXW A;  4XCA A;  3AKP A;  2JWP A;  4XHB A;  1AX2 A;  2WNV B;  2E63 A;  1A3K A;  3WD5 A;  1LHO A;  1VAL A;  3B01 A;  2YPJ A;  2KXL A;  5FZD A;  1NCQ A;  5EP9 A;  4LBJ A;  5FFO C;  3J8F 1;  1H8T A;  5LA0 A;  1W8F A;  1DYO A;  2QQJ A;  1OBN A;  3OBZ A;  2LTN A;  1LRH A;  2PHL A;  3POB A;  3UT0 A;  1YQ6 A;  1DQ6 A;  4FTS A;  1R1A 1;  1XNT A;  5APA A;  4QU1 A;  3EJK A;  3J9S A;  2B7Y A;  2PAE A;  1Q56 A;  1W8Z A;  1W3V A;  3NNG A;  1JMU B;  3AKS A;  1KDM A;  2FMD A;  1AJK A;  1LNS A;  2HWD 2;  1EP0 A;  2QKD A;  2VUL A;  1OUS A;  3HBK A;  2W1S A;  4TWT A;  2JDU A;  3RMX A;  2R32 A;  5L7O B;  1VLN A;  1YIP A;  1S0I A;  3LQC A;  3LCP A;  4O9E A;  2E9Q A;  2J1V A;  2JG9 A;  3CKH A;  4I0B A;  1RIT A;  2J1U A;  3BCW A;  5FOJ B;  5K0U B;  5ISL A;  3H8R A;  3O1V A;  3THC A;  3OY8 A;  2YFZ A;  2HWE 2;  2DWR A;  2MEV 1;  3B02 A;  3T0B A;  4Q4Y 2;  5BNN B;  3CLP A;  4B1L A;  2V09 A;  3E6D A;  1ZM1 A;  5EFU A;  1Z7S 1;  3WVJ A;  2R6Q A;  1LCL A;  4IEQ A;  2ZGL A;  4YM0 A;  5DPN A;  4FFH A;  4AHY A;  3VDB A;  2X10 A;  3OBA A;  2JG8 B;  3EHK A;  3WDT A;  5DUX A;  4RR3 B;  5EJ1 B;  4HK9 A;  3OOX A;  2WFF 1;  4RR3 C;  4EV0 A;  2VUC A;  2OT7 A;  3T3Y A;  4E4H A;  1J3Q A;  1QIQ A;  2VZ1 A;  1BQP A;  2GAL A;  2WII B;  4HPK B;  5FZ0 A;  3ZPO A;  4O65 A;  2GP3 A;  4XZP A;  4FPE A;  4Q4Y 1;  1CES A;  2OA2 A;  3A0N A;  3PIJ A;  3LKJ A;  1O5L A;  3UNP A;  4YZ4 A;  1W39 A;  2JIC A;  1JHN A;  3M3E A;  4QD2 A;  4XFG A;  1K45 A;  2V4A A;  3H42 B;  4JCK A;  2DCJ A;  3IMM A;  4CP9 B;  1HRI 1;  5FZ7 A;  1CX1 A;  3VN4 A;  1AXK A;  2BVB A;  2VBP A;  4LA3 A;  1CD3 G;  2XON A;  2QQI A;  4IDZ A;  2W52 A;  1V9U 3;  2D3S A;  2VMC A;  1ASJ 3;  1C57 A;  3FUQ A;  4CA9 A;  2GSY A;  2VH9 A;  1H1I A;  4IW3 A;  5FYU A;  4CDQ B;  1X50 A;  5FYC A;  5IFT A;  4CDQ C;  3ZXG A;  4B8E A;  4I0W B;  5C3Q A;  4YW4 A;  5GJ6 A;  3OD4 A;  1SHW B;  2WBK A;  1OVP A;  2OW4 A;  2XML A;  3BOD A;  5FZ6 A;  1ZRE A;  2YC4 A;  4AEM A;  5CU1 A;  5LB6 A;  5JMC A;  2Z69 A;  2PAK A;  3BTA A;  1DQ1 A;  4FTE A;  2VNO A;  3JD7 3;  1YUD A;  4F3J A;  5DZF A;  3V56 A;  3NRU A;  4V2V A;  3ZN6 B;  5LCW L;  2J22 A;  1W8U A;  1DZT A;  2G9F A;  2HWB 3;  1EPW A;  1O4Y A;  3DYM A;  2AEN A;  3GBF A;  1AL2 2;  1UY4 A;  2KM2 A;  4PCR A;  3KQ4 B;  2WZ8 A;  4XBL A;  3N7J A;  1KFU L;  1XYP A;  2VUJ A;  2NM1 A;  1N47 A;  1QF3 A;  4AEJ A;  1IS6 A;  4YZ3 A;  4GXL A;  3VHR A;  1W06 A;  1RUI 2;  3KWV A;  4N53 B;  4YYO A;  4HKL A;  1SDD B;  2IVI B;  2XKP A;  1GUI A;  3SKJ E;  3J4U H;  5HV0 A;  5EWS A;  4CDU C;  4K8F A;  2DUQ A;  4WVW A;  3ZFG B;  2UYA A;  3FHQ A;  3OGV A;  1RHI 3;  2WO7 A;  4OHW A;  5CNA A;  1AL2 1;  3LFM A;  3UES A;  4A7Z A;  5C8C C;  5JMO A;  5FO9 B;  3WF1 A;  1XU1 A;  1RJ7 A;  1DCS A;  3ZYR A;  1K42 A;  5A7O A;  5A80 A;  5ABJ A;  3NJX A;  2XLG A;  1AR9 3;  4BQ3 A;  3AZZ A;  2CWS A;  3W5N A;  2BU9 A;  1RUI 1;  4RHV 3;  4FFG A;  1JUI A;  1QXJ A;  4FQ4 A;  3VBH C;  3WNL A;  3QAC A;  3IZO A;  5DAW A;  1RB8 G;  4NPR A;  1YI9 A;  3KLS A;  2ZHK A;  1DFQ A;  5BNP C;  5FYI A;  4YNI A;  1RUF 2;  4YG3 A;  2EIG A;  4IE4 A;  4Q4W 1;  2RJ2 A;  4KU8 A;  4H7M A;  1CAV A;  5LAT A;  1S1A A;  3IDA A;  4HVR A;  4D69 A;  1JYW A;  2JIJ A;  2XBO 3;  1SFP A;  2PLV 1;  5H9P A;  1RUO A;  2G9G A;  4QWN A;  3SEP A;  2UU8 A;  4XZU G;  5JIA A;  4AF9 A;  1RIN A;  4AI9 A;  3S5A A;  1PGW 2;  4MGZ E;  4DRV A;  1WLW A;  2F4P A;  1X36 A;  4LIU A;  3I49 A;  4FPF A;  1AYN 2;  4Y4Y A;  5DG1 A;  2Q8E A;  3HN1 A;  4AQ2 A;  4MGS A;  4J1W A;  4QMA A;  2VCA A;  5J96 B;  4I01 A;  1OOP A;  1SFY A;  2YGM A;  2ARX A;  3ZIW A;  5FRA A;  2J1R A;  3N9N A;  1LKN A;  5EJZ B;  1PO2 3;  3N9P A;  1O4T A;  4BXS V;  1RXF A;  5C3P A;  3AYD A;  5F5C A;  4TYS A;  1V6K A;  2AZ5 A;  1Q3E A;  2R04 2;  3QH7 A;  1A6C A;  2IXJ A;  2W3J A;  5C9A B;  4S2H A;  1TME 3;  4CCN A;  1RUH 1;  1RUE 1;  2PFW A;  4OUM A;  4FPJ A;  4K40 A;  4XCB A;  2W1W A;  4FT8 A;  1LED A;  1D2Q A;  1AR8 2;  5FP7 A;  1RMU 1;  3LSD A;  1RL3 A;  2AEZ A;  5GLW A;  4P9I A;  2JDA A;  4WZF A;  3ZYJ B;  5FP8 A;  2Q8O A;  1V00 A;  4IE7 A;  1HB3 A;  1FMD 1;  4X8P A;  5LA9 A;  1XPW A;  3CEW A;  2LAL A;  2GC2 A;  4BQ2 A;  4HXC A;  5C71 A;  4CU7 A;  2QQM A;  1ND2 C;  4CDW A;  1Z0H A;  4E2G A;  4EZ4 A;  5AC9 1;  3UK9 A;  3VV1 A;  1JZ5 A;  3OPW A;  4R8H A;  1AR8 1;  2A6W A;  2ZAB A;  1OFN A;  2WRA A;  1NQD A;  4BLI A;  4E2Q A;  1ZZ9 A;  4Y24 A;  3JCI A;  3WP4 A;  3ES4 A;  1WWY A;  5F5Q A;  4MOA A;  3ZKY A;  3OSD A;  4AZZ A;  1FT9 A;  4QHB A;  1O8P A;  3RZH A;  5FY5 A;  4AVA A;  5L9V A;  3AP9 A;  1X82 A;  2JE8 A;  1EPZ A;  3POJ A;  4IE5 A;  5L36 A;  2EVX A;  3VD4 A;  2BUK A;  3WCS A;  3WSO A;  1CAW A;  4QKB A;  1O91 A;  2VZU A;  3MID A;  4ZON A;  5FBJ A;  5J09 A;  1UKR A;  4DEV A;  2RM2 2;  1HJF A;  5FZC A;  2DVB A;  2HEV F;  3KCX A;  3VBU C;  3ILN A;  4UOJ A;  1O3Q A;  1NA1 A;  4A3X A;  1WD3 A;  1BBT 3;  4BQ1 A;  4Q2F A;  4UFM A;  4AQS A;  4DUV A;  5FZI A;  4NR1 A;  5GZE A;  1ZRC A;  5CKM A;  4A3Z A;  1NXM A;  1RUD 2;  3DXU A;  4TLG A;  4AI8 A;  5FUI A;  3DEM A;  3ZSK A;  3QCW A;  3I54 A;  3Q9O A;  1C8M 3;  2RM2 1;  2DCY A;  4LNV A;  5HCB A;  4COU A;  1D0G A;  2A6Z A;  5FAX A;  1SDW A;  1AF9 A;  5FMB A;  1PIV 3;  2E7T A;  3P3N A;  3DL3 A;  3V64 A;  4EWD A;  4BCU A;  3GXU A;  2WS9 1;  3W9A A;  2J1S A;  1W6P B;  3J7N A;  1GP5 A;  1RUD 1;  2D6L X;  1CAU B;  1RVF 1;  4YM2 A;  3O1M A;  1VRH 3;  4GA9 A;  1RUJ 2;  4IV3 B;  4XXP A;  5B2G B;  4XIK A;  1YIF A;  3DYP A;  1XXN A;  3VDD B;  4JV4 A;  4TN7 A;  2ZS6 B;  1MPX A;  5IVC A;  2DF7 A;  5IVV A;  4Z92 B;  3KCC A;  4CCE A;  3N7M A;  2VUD A;  4NMI A;  5A3L A;  3AP4 A;  4TXW A;  3O5S A;  4COV A;  3III A;  3ZDV A;  2LRP A;  1CPN A;  3NST A;  5KHG A;  1VMF A;  2ZGK A;  5IJR A;  4XMI A;  1H1M A;  5C33 A;  1RUJ 1;  1OPO A;  4K20 A;  1GZT A;  2XJU A;  1WLC A;  3U11 A;  3WLU A;  4V1P A;  4WM7 A;  3EBR A;  1NCQ C;  4AFB A;  4EN8 B;  4MAD A;  1H8T C;  3OPZ A;  4Y5S A;  1GQP A;  3ZN4 A;  3WG2 A;  3ZSE A;  3POS A;  4AVS A;  1UY3 A;  4Y22 A;  3J8F 3;  4B4Q A;  2BGC A;  3EB7 A;  1JYV A;  1OF4 A;  4HLT A;  1TVG A;  4WVV A;  2W92 A;  1HB1 A;  2CTV A;  3NVC A;  4NUB A;  3HVD A;  4IV1 B;  4UBG A;  3U4S A;  2ILM A;  3NWK A;  2QQV A;  1R08 3;  1OH4 A;  1W6Q B;  4YGB A;  2JG9 C;  2RS3 3;  2FDH A;  1CZV A;  2D6P A;  1LJ7 A;  1Y4W A;  3R0R A;  4Y1X A;  4PF1 A;  3QOP A;  4PLO A;  4CPB A;  1V6O A;  2RDN A;  3H1Y A;  2QVS B;  5FYM A;  3MF6 A;  5KHH A;  2BV4 A;  2VME A;  1N3O A;  4AQT A;  1RIR A;  5JXH A;  5LEJ A;  3ZVX A;  2YC0 A;  1LEN A;  3UKT A;  2YPD A;  3PTR B;  1G9C A;  1YQC A;  2O1Q A;  4NHM A;  2MEV 3;  1CJP A;  3N9O A;  2WLP A;  4LR4 A;  5JPM B;  5GZD A;  1Z7S 3;  3AVS A;  2OZJ A;  4M4P A;  4YW6 A;  2XQR A;  4F83 A;  1L3J A;  1ZA4 A;  4RA0 A;  5IVY A;  4IET A;  4URA A;  5FRE A;  2Q1F A;  2FDF A;  1C1L A;  4RS5 B;  1O4Z A;  1UU6 A;  4EN7 B;  4HN1 A;  4MZU A;  2WNV A;  4OI1 A;  2WFF 3;  3SKV A;  3TB0 A;  4NHY A;  3VD7 A;  4JGZ B;  5FZB A;  2V5Y A;  5DDJ 2;  4YW5 A;  2PAM A;  4CXY A;  5DZE A;  2ZX3 A;  3ZMO A;  3VGI A;  1TNR A;  1W2T A;  1UZY A;  2YHJ A;  5C8W A;  1UIK A;  1U5X A;  4FOV A;  2WNU B;  3AP5 A;  4PBO A;  4DS0 A;  3D8C A;  4KWJ A;  2GNT A;  1GIC A;  1HRI 3;  1OT5 A;  1QJY 1;  2AYH A;  3PL0 A;  5DXD A;  4D94 A;  1CPM A;  1LOB A;  1JZ8 A;  3I2F A;  5JIU A;  2WT2 A;  5L7O A;  3PVB B;  4GB3 2;  3VD9 A;  1LHU A;  3MIE A;  5DDJ 1;  1VBB 2;  3VKO A;  3H8O A;  3RQ0 A;  5K0U A;  3SEE A;  1YFY A;  4HVO A;  3ZX7 A;  5JPN B;  2J42 A;  3FJS A;  4ZU7 A;  3RYK A;  5BNN A;  4FPO B;  4BQX A;  1S0G A;  2W47 A;  5FCC A;  3PJQ A;  4FOW A;  4XJU A;  4Y1Y A;  1F8V A;  3MEP A;  4JZR A;  5FR3 A;  3ZDS A;  4DXT A;  4GKX A;  4W6W A;  3IIA A;  2QNK A;  1R64 A;  2JG8 A;  4GB3 1;  4LBK A;  4YGC A;  5GZC A;  4GKY A;  1UCX A;  3GCX A;  4RR3 A;  1VBB 1;  3Q8E A;  1NUK A;  1AR7 2;  4Z1V A;  1MS3 A;  3M70 A;  4HPK A;  4L8Q A;  2TEP A;  4KWU A;  4XFB A;  3VKF C;  5BY5 A;  1LHV A;  2X05 A;  4NII A;  2HWF 1;  2XKO A;  2PHW A;  1Q5O A;  3BVC A;  4LOS A;  2D3P A;  3KVA A;  1QXP A;  4AI2 A;  3W20 A;  3NAP A;  4CCD A;  4A2U A;  4ISR A;  4HN0 A;  1QOS A;  2VZO A;  3AZW A;  4OUS A;  1OXC A;  3USU B;  3KT4 A;  4CP9 A;  1AR6 2;  5T5J A;  3SCF A;  1WCU A;  4AVT A;  5IK7 A;  3O1R A;  1NX9 A;  1FOD 3;  3GZU C;  1W8O A;  1AR7 1;  5KXC A;  4DNY A;  1H6Y A;  4AGR A;  1UZZ A;  4CDQ A;  4WBB A;  5JLV A;  3I3B A;  5FV3 A;  1HN1 A;  3EO6 A;  1H2L A;  3ME2 A;  5ABJ C;  5HXM A;  2R0F A;  5J7M A;  1Y43 B;  2FDG A;  1K5M B;  4AEK A;  1K5M C;  1VB4 A;  3RYR A;  1LOG A;  4AED B;  1YXW A;  5IFP A;  4R9A A;  3ZXL A;  3BTZ A;  2J1E A;  3HQU A;  1AR6 1;  1I5Z A;  1C3H A;  1LGC A;  2W39 A;  2HKX A;  3OGS A;  4M0N A;  5ACA 2;  2B39 A;  3C8X A;  2RMU 3;  3VKM A;  3MZH A;  1QNW A;  2DV9 A;  3PUQ A;  2B9V A;  5KC6 A;  3J26 N;  1PK6 B;  4OI4 A;  3ZYI B;  3H1W A;  4I2O A;  3HPN A;  3RI9 A;  4N9I A;  4C0H A;  4NPL A;  2Q4S A;  3ZN6 A;  1UXX X;  5A7N A;  2OQ6 A;  3AJZ A;  1KS4 A;  5C5T A;  1YFU A;  1ZNP A;  3CBN A;  4M01 A;  2W2I A;  4Q4W 3;  2KD7 A;  1ALY A;  1W6O B;  3E1F 1;  4QPY A;  3WDY A;  2Y6F A;  2V73 A;  3JB4 C;  3M3C A;  4IEV A;  5C6C A;  3R05 A;  4QQP A;  1POQ A;  5JXJ A;  2PLV 3;  1YO8 A;  3Q8B A;  2J1T A;  2D93 A;  4I0A A;  1RC6 A;  2D6K A;  2F17 A;  5ACA 1;  3VZJ A;  2RDQ A;  1QNY A;  4MX3 A;  1RUG 3;  4YM3 A;  4FPL A;  4KGG A;  3ST7 A;  4MHR A;  3RJR A;  4IGQ A;  2QZ2 A;  1MS1 A;  3FFQ A;  1OOP C;  2RR1 3;  3DF0 A;  4N53 A;  4Y33 A;  1OPM A;  3T0D A;  2XXZ A;  3VZK A;  1WA6 X;  2IZW A;  3ON7 A;  5CG8 A;  5IVJ A;  2SBA A;  1HB4 A;  2DUP A;  3ZFG A;  4LMF A;  2X53 S;  1UD1 A;  3ILF A;  4XAE A;  2EXI A;  2R16 A;  4Q1P A;  5C8C A;  1ZBA 3;  3D82 A;  3WIN E;  4IGP A;  1MZF A;  4P9J A;  3NQH A;  5HCF A;  4DO0 A;  4CU8 A;  4N7I A;  1HRV 3;  1JOP A;  1FX5 A;  4OHZ A;  3T2T A;  3VZO A;  4CEW B;  2I45 A;  1UN1 A;  5T55 A;  1S0D A;  2WYS A;  1SFN A;  4LUL A;  1GSL A;  1RUH 3;  1RUE 3;  1XOY A;  1O3T A;  3I4I A;  4HZF A;  2Y6L A;  3O12 A;  5F5A A;  3ZYP A;  3LAG A;  1GMM A;  3UJQ A;  3HIF A;  1ULC A;  3VL9 A;  5FPU A;  2VMD A;  1RMU 3;  4OUL A;  2JDY A;  5FZH A;  5FO7 B;  1ODN A;  5F6K A;  4P9G A;  4NVP A;  5C3S A;  1ST8 A;  1XYN A;  4PIX A;  4XFA A;  4CDW C;  4BZ4 A;  3POG A;  3NV3 A;  1FMD 3;  3WUD A;  4L92 A;  2GND A;  3WW2 A;  1GWM A;  4FBF A;  1UY1 A;  5T5P A;  3MUZ 1;  5AC9 3;  1O59 A;  1CJD A;  4AL9 A;  1PZ7 A;  1VBE 2;  4B4P A;  1HLC A;  2VPV A;  4QX7 A;  1PMJ X;  5FPB A;  3WNX A;  1V70 A;  4AWD A;  2DU0 A;  2WSU A;  1XNA A;  1X8M A;  4P08 A;  5EPA A;  4Y5T A;  3CZU A;  3I7D A;  2PHD A;  2VMF A;  4IER A;  2CWM A;  1UY2 A;  1O3R A;  3OG2 A;  5A33 B;  1SLA A;  3DN7 A;  4BQ4 A;  3U0Z A;  5FY1 A;  2QZ3 A;  4CU6 A;  5JSP A;  5KBF A;  3LGR A;  5A6X A;  4OQ8 A;  1NA1 C;  1U0A A;  1FV2 A;  4LO6 B;  3AZV A;  1VBE 1;  5C9A A;  4C0B A;  4LHN A;  3AMN A;  5A7W B;  3LWC A;  3SCG A;  3HMY A;  3T1M A;  1C1F A;  1XBF A;  1L7L A;  3M3O A;  3VB9 A;  4BWO A;  4W4Z A;  1WW5 A;  1LOF A;  2D5F A;  3H7Y A;  3I8T A;  4PIY A;  4GUL A;  2AUY A;  2JB4 A;  4LHL A;  1ENQ A;  2VMG A;  1U5Z A;  4HSJ A;  4C1W A;  4HVQ A;  1D0H A;  4IGO A;  2RV9 A;  1A34 A;  5I0D A;  3VBO B;  2CV6 A;  2VMI A;  3VBO C;  1L7Q A;  3KGZ A;  4P9L A;  4TLF A;  1N3P A;  3G7D A;  2WS9 3;  4RN5 A;  2OYZ A;  2BQP A;  1MEC 2;  3AP7 A;  4ZZ8 A;  4DOU A;  3KMH A;  1RVF 3;  3GCW A;  3UGH A;  1GBG A;  1LHW A;  2DCZ A;  4YZ5 A;  1UIJ A;  5FWJ A;  5BNO B;  2AH2 A;  1PVC 2;  3ZPY A;  3CMG A;  2UUR A;  2RS5 2;  1GOF A;  1PNF A;  2WDB A;  5G05 L;  4QM8 A;  1IZ3 A;  1NXD 1;  2RVA A;  3WNM A;  1BEV 3;  3EYP A;  4UAP A;  4XOG A;  2GMM A;  4LE4 A;  3RVH A;  3RFR A;  1T6G C;  4ZU4 A;  5A3O A;  4B1M A;  5FYH A;  2IXC A;  1HXS 2;  4WM7 C;  1UW8 A;  1W2A X;  5KR7 A;  5FMD A;  1YC6 1;  5JR7 B;  3SMH A;  2G4I A;  3I3Q A;  1EAH 3;  1GR3 A;  1IHM A;  1IKQ A;  4FOQ A;  1QJZ A;  4GMP 0;  1PVC 1;  5FBZ A;  3DYO A;  4NHX A;  1C8M 2;  4Y1V A;  2ET1 A;  2GP5 A;  2JB8 A;  2VNR A;  3ACH A;  4OFG A;  4BIF A;  2OQ7 A;  4R9D A;  2XUM A;  1LGN A;  3QH6 A;  1S4C A;  1W8N A;  4XFC A;  2V5D A;  3UYJ A;  4COZ A;  3ACI A;  4UFK A;  1HXS 1;  4LBL A;  1HQL A;  2ZEY A;  1U12 A;  5I91 A;  4YFZ A;  1W6P A;  4BE3 A;  1WLT A;  3LDB A;  2YZ4 A;  3H3L A;  1CAU A;  5A3T A;  3AFK A;  2YGL A;  4IV3 A;  2EXH A;  2ADD A;  3VDD A;  2B5H A;  2DTY A;  1DIW A;  1WGP A;  1GOG A;  2BNM A;  2Q5T A;  4CE8 A;  1OD5 A;  1SQ4 A;  1K5J A;  4LOT A;  1SBF A;  2BRT A;  3RZK A;  3IAP A;  2Y0O A;  1UPI A;  1UX6 A;  4Y4R A;  4AVC A;  1W03 A;  3AYE A;  1BK0 A;  1FAT A;  2VL4 A;  4QXC A;  1S0E A;  3D0S A;  1YEW A;  3R4U A;  3AXE A;  3WF3 A;  4ATE A;  2CYF A;  2WNV C;  1RUC 1;  3LEI A;  4XYX A;  3OUI A;  1H6X A;  2YYO A;  3FFZ A;  3ILR A;  1QQP 3;  2IC1 A;  3I3E A;  2LUW A;  4GD4 A;  5FZL A;  3V0B B;  5AVP A;  2NLR A;  2WO2 A;  2Y38 A;  4HT1 T;  1JYC A;  1E5H A;  4Z07 A;  4DZG A;  1NE4 A;  3TN9 1;  1QXR A;  4Q4X 2;  4K7J A;  4AG4 A;  3M3Q A;  3I97 A;  4XFI A;  4BA6 A;  5IAX A;  4F7Z A;  1UQX A;  2WKK A;  1US2 A;  3SC7 X;  4WZC A;  4P14 A;  2HEW F;  1UOF A;  5F2S A;  3JXS A;  5FZ1 A;  1UYP A;  2GNB A;  2E7Q A;  2XHK A;  4IV1 A;  5L7O C;  3RJ2 X;  3IBM A;  1WD4 A;  4AW7 A;  2RS1 2;  1LES A;  1W6Q A;  1QJY 3;  1OC1 A;  5LZ6 A;  4QPG B;  1W6N B;  4XAC A;  3ZXD A;  4ERO A;  2BP6 A;  4XE9 A;  2H6C A;  5K0U C;  4YVW B;  5LAS A;  5F1R A;  4QGM A;  4GWJ A;  5EQU A;  3CJI B;  5FXW A;  2XL9 A;  2DVF A;  4FFF A;  5BNN C;  1JI6 A;  2XJT A;  3AJY A;  4CXX A;  2PYT A;  4EE2 A;  3C2U A;  4ZPI A;  2X8K A;  5GM0 A;  3K2O A;  2HWD 1;  4AHZ A;  3OPT A;  3HEI A;  4N43 B;  2JG8 C;  1XSQ A;  3AX4 A;  2RS1 1;  2XGX A;  5F3C A;  1JXN A;  1POV 1;  4AVB A;  1ONA A;  2ZKN A;  1BMV 2;  3TBD A;  1LU2 A;  2HWE 1;  3IAQ A;  5AFE A;  4UW4 A;  4RS5 A;  3PLQ A;  3W5M A;  3WP5 A;  5F6L B;  1WCD J;  1QWR A;  3MIB A;  4MH0 E;  2EAK A;  5HCA A;  5DMY A;  3O1O A;  1MZ6 A;  3NAP B;  2VY0 A;  4JGZ A;  4W6Y A;  3NAP C;  3POE A;  1OF3 A;  3D0J A;  4A41 A;  3AZX A;  2HEY F;  3A23 A;  1VBC 2;  2HWF 3;  5FY0 A;  3LDK A;  3TWI A;  4JKL A;  2VZQ A;  1IOA A;  2E31 A;  3I2H A;  3ZXJ A;  2Q30 A;  1GU3 A;  2IXI A;  1D4M 3;  2W1Q A;  2WNU A;  5FYS A;  2ENR A;  5A7S A;  1SZB A;  3O1T A;  3FHI B;  2WNO A;  1BMV 1;  4I30 A;  4D6R A;  5EIY B;  5FDB A;  4DXZ A;  1UMZ A;  4NHK A;  1GWL A;  4Q0S A;  1FV3 A;  3QLQ A;  2K46 A;  2ZZQ A;  5LA1 A;  5EZW A;  5DAV A;  2WO3 A;  3I3M A;  2YBP A;  3IM0 A;  1S0C A;  3TNP B;  4QGL A;  3C7G A;  5LW9 A;  4GH4 B;  4XBQ A;  1VBC 1;  1B35 B;  2XHN A;  2WC2 A;  1KRI A;  5KHK A;  4XUR A;  2WT0 A;  1JHJ A;  3GBW A;  1OUR A;  4PI0 A;  4YVS B;  4NWV A;  3O1P A;  3RZG A;  4LKD A;  3SH3 A;  2QTW B;  3U37 A;  3WDU A;  5CFD B;  1OUX A;  5DN2 A;  1X33 A;  4KH9 A;  3OBR A;  4PJY A;  2WZE A;  4WV8 A;  1LR5 A;  3ETQ A;  2VCC A;  1HW5 A;  5GLZ A;  4KBZ A;  5GLV A;  2P37 A;  3D4K A;  1A8M A;  5T54 A;  5KWR A;  4QPI B;  5C4W B;  5FYZ A;  1LGB A;  5C4W C;  3NKG A;  5FPV A;  4WVZ A;  3ZYF A;  4CUG A;  1JYX A;  4MG2 A;  4XF9 A;  3VBS B;  3WQ0 A;  3AKQ A;  3FBY A;  1AX1 A;  5FKC A;  5A7P A;  3NMB A;  4DY3 A;  2CGO A;  2VOT A;  2XR4 A;  3LPG A;  4N53 C;  3VHO A;  2BJS A;  4AGG A;  1RJ8 A;  1ENS A;  3USU A;  3JUU A;  4FCA A;  3RYP A;  2QDR A;  3ZFG C;  3FHA A;  3T08 A;  3C7O A;  1PGL 2;  2BWC A;  3JQX A;  4AE2 A;  1BVV A;  1WBF A;  5CVR A;  2A70 A;  4V2W A;  2CL2 A;  1Q8O A;  1JTZ X;  3F2Z A;  4BOW A;  2R7E B;  4BYY A;  1K5M A;  4ZS2 A;  2HBT A;  3BN6 A;  2P6H A;  3SQO A;  4AED A;  3NL1 A;  5FJK A;  4NOT A;  3VUO A;  4HBN A;  4LUM A;  1ULE A;  1I5P A;  2BOJ A;  4LK7 A;  3WW4 A;  1R09 2;  1HQW A;  1YFX A;  1TMF 3;  2VOX A;  3Q8A A;  4DRR A;  1QEX A;  4RYD A;  1SLT A;  4W8J A;  5C3R A;  3WX5 A;  1PK6 A;  3F95 A;  1QGL A;  1PGL 1;  4BM8 A;  5C7G A;  3CF6 E;  3AM2 A;  3MV1 1;  1T6B X;  1S55 A;  1ACC A;  5FYV A;  3WT3 A;  1UOG A;  2R06 2;  5FZ8 A;  3UET A;  3J7L A;  4WVM B;  1IPK A;  4MO3 M;  1UX7 A;  1W6O A;  2BDR A;  3RZZ A;  2YB7 A;  4XXA A;  4A6O A;  4ES8 A;  3HBZ A;  4GJZ A;  2P5B A;  1ULF A;  1AVB A;  3VBR B;  2R0H A;  1UKG A;  3AFG A;  1RUF 1;  2ARB A;  1JU3 A;  3GGL A;  3GZT B;  4YPJ A;  3VHP A;  2A3X A;  2R07 3;  4JKK A;  4AOC A;  1XYO A;  3M3I A;  1G9B A;  2ZX4 A;  4NRM A;  1HX6 A;  1ZYB A;  1PO1 3;  2D98 A;  2ZBJ A;  4FVV A;  5K4L A;  5K8S A;  4Q8K A;  2JDP A;  2K2S A;  3NO8 A;  1QHD A;  2RHP A;  1JUH A;  3LEG A;  5L9B A;  3X29 B;  5KC5 A;  1PGW 1;  4JDM A;  3RZJ A;  3TEZ A;  1GNY A;  2GN7 A;  3P5B A;  3WQB A;  5J3U A;  1ZBE 2;  2MHF A;  2W46 A;  4P9X A;  3WP6 A;  1RUN A;  5FWE A;  1W9S A;  5C9A C;  1AYN 1;  4QB6 A;  2IXH A;  4A45 A;  1VBD 3;  5GAL A;  4XDQ A;  1FNZ A;  4CEW A;  1J58 A;  4O61 A;  3N3H A;  1E57 A;  4KL1 A;  1IKP A;  2NP0 A;  3C3V A;  1WBL A;  5L9R A;  1NE6 A;  1XSR A;  2WYF A;  2C5D A;  1LOF C;  2D6N A;  2NZ9 A;  3ENR A;  3SNM A;  2ZKL A;  3WW3 A;  4MGK E;  3OUH A;  4B29 A;  3WP3 A;  3DGT A;  4H2A A;  4R4X A;  3BI3 A;  1OSG A;  1GNH A;  5JZG B;  4ZXK A;  5JZG C;  4KNC A;  2BGO A;  2R04 1;  2VR4 A;  3PUS A;  5JSR A;  5F5I A;  2ZHN A;  3I3D A;  4D3W A;  1LOD A;  1VMJ A;  3DXT A;  2XH6 A;  3LDR A;  2VVE A;  5E88 A;  4COY A;  2FDK A;  2JD9 A;  3RI8 A;  4YFW A;  5HPO A;  1MVE A;  4ZZ5 A;  1W9Y A;  2EIE A;  4K1Z A;  4YW2 A;  5B4N A;  5J48 A;  2XB6 C;  3FLT A;  3QD6 A;  1NOV A;  1F35 A;  2ZEW A;  4PBP A;  4OI2 A;  2WAB A;  3U75 A;  4OZO A;  1JOJ A;  1IG3 A;  5I8S A;  3UGF A;  1IQA A;  3ZR6 A;  2Z2S B;  3H8U A;  5CA6 A;  5CAD A;  1UZV A;  2ZMK A;  3H9A A;  1YWK A;  1TG7 A;  2QUO A;  1DF0 A;  4CP1 A;  1E5R A;  1ZZB A;  2WO1 A;  4PLM A;  5FPX A;  3MUY 1;  4BLJ A;  1LOE A;  4M00 A;  4XMA A;  4GMP 3;  5I93 A;  2WIN B;  4P00 B;  1OH3 A;  5FZM A;  1DGW X;  4URT A;  2AAC A;  4BIO A;  5A33 A;  5CFC B;  4XW3 A;  5A3P A;  4S2F A;  2Y0I A;  2YU1 A;  1WMD A;  3M4F A;  3SHR A;  3WHU A;  3MIF A;  1G86 A;  3JZV A;  4NE9 A;  1SLL A;  2E32 A;  1CZS A;  1EV1 3;  4NJ4 A;  3BYW A;  3JBG 2;  5GKA C;  5A7W A;  2OPW A;  2A3Y A;  4XUN A;  1BJQ A;  1YFW A;  1KFX L;  1MS0 A;  2C9A A;  2VW2 A;  2XDV A;  3EMR A;  3NKT A;  1COV 2;  2WZR 2;  4GWM A;  4LJH A;  4QKD A;  3WNO A;  1UY0 A;  4GZ9 A;  3DPR B;  3ZMN A;  3K51 A;  3DPR C;  3ZSJ A;  2D97 A;  4Y1U A;  4AQ6 A;  5FXV A;  1GKB A;  2DDU A;  2OUJ A;  3N9L A;  1V6I A;  1W9T A;  2JDN A;  3KCY A;  5IAV A;  3J7M A;  1XQN A;  2G9Z A;  4AGV A;  1PHM A;  5LA2 A;  1KD7 A;  4L2N A;  3DV8 A;  5E1R A;  3VBO A;  2ORX A;  4KWL A;  1VBA 3;  3WOG A;  1XND A;  1IPS A;  2IUW A;  3N36 A;  1COV 1;  2WZR 1;  4OHX A;  5I0T A;  1AYM 2;  2VW0 A;  4I09 A;  3BIW E;  4LBQ B;  3APB A;  4IV3 C;  3BB6 A;  2DVG A;  3KV5 A;  3L9J T;  3VDD C;  5I8T A;  2ZML A;  3ZFE B;  1QU0 A;  2WFP A;  4QXB A;  3GJA A;  3T09 A;  3U07 A;  1Y9M A;  5BNO A;  4CCL A;  5J1X A;  1OKO A;  4XEZ A;  5E8A A;  3WF2 A;  3MIH A;  2VZV A;  1QJX 2;  5FY7 A;  2VXJ A;  4OCT A;  3GM8 A;  2P3K A;  4DQA A;  2OUH A;  3OEA A;  4F8A A;  4QX1 A;  3KHC A;  1MS4 A;  2JEN A;  1W8W A;  1XB9 A;  2HWC 2;  5LBE A;  4CXW A;  2PN5 A;  5C70 A;  3MIC A;  3S7I A;  1H2M A;  3WZ1 A;  4O9G A;  3AMH A;  4Q4V 2;  5FZO B;  4SBV A;  5CB7 A;  1FAY A;  1RUC 3;  2GH8 A;  1ZRF A;  1DLC A;  3ACG A;  4IEP A;  4L99 A;  1V6N A;  1QJU 2;  1XU2 A;  1TEI A;  5A70 A;  2XG3 A;  4S2D A;  4N8M A;  4XDO A;  2ZGT A;  1DP0 A;  1R1Z A;  4Y20 B;  4YM1 A;  1QJX 1;  3W58 A;  4XAA A;  3TN9 3;  5F9T A;  2ADE A;  1R1A 3;  3CL1 A;  4Z8B A;  3SH4 A;  2HWC 1;  3IDB B;  3W59 A;  1W9W A;  4IV1 C;  1F5J A;  3N7L A;  1D2S A;  3RRD A;  4P9W A;  1FPN 2;  4PQ9 A;  2A73 B;  3P3P A;  3TEY A;  4Q4V 1;  4QXK A;  4MGY E;  3ZXK A;  1APN A;  3AZY A;  4IND A;  5A1L A;  1UNB A;  5IWF A;  1UU5 A;  3I2G A;  1DLL A;  4IE0 A;  3HNM A;  1PZ9 A;  1V6M A;  3ZO0 B;  2YBS A;  1VAK A;  3LA2 A;  4NO4 A;  4N90 A;  2PQS A;  4QM9 A;  5EYY A;  1FPN 1;  2OS2 A;  2HWD 3;  1VP6 A;  5FZ4 A;  1OKQ A;  1SLC A;  1GZW B;  3LA3 A;  3POI A;  2DBI A;  2LW8 A;  5T3N A;  2QQO A;  4RS5 C;  5LK5 A;  3B94 A;  4JQT A;  5KXD A;  5CAZ A;  4QAW A;  5GLU A;  4QKN A;  4ASL A;  1CWP A;  1X7N A;  1VMH A;  4CCK A;  1NZI A;  4JGZ C;  3K77 A;  4XUQ A;  5F3I A;  2HWE 3;  2VD7 A;  3V0B A;  3ZLI A;  2XPJ A;  2DFC A;  4Q4Y 3;  4CCC A;  1J1L A;  2VBD A;  4Q0P A;  4CZS A;  2B8M A;  3AKR A;  4PIZ A;  2D40 A;  2WNU C;  3HNY M;  2PA7 A;  4Q29 A;  2RDS A;  4RQP B;  4IEX A;  5LRR A;  1HDK A;  5JOW A;  3IMN A;  4LBO A;  3E97 A;  2QCS B;  2PMW B;  5F32 A;  2D7F A;  4D0Q A;  4B4R A;  1X8E A;  3HT1 A;  5LBB A;  1GFF 2;  1NKG A;  1OLM A;  1ZA7 A;  1OLQ A;  3LOB A;  2W68 A;  4QPG A;  1W6N A;  4MGT A;  2Y26 A;  4A7Y A;  5JR2 A;  4YVW A;  1K3I A;  2UY9 A;  1P8J A;  3ETP A;  3GBG A;  2P2K A;  5FOB B;  4JTN A;  1HKD A;  3O0W A;  1ND3 B;  5FZG A;  3VL8 A;  4B3N A;  4DXS A;  3CJI A;  2QQK A;  2BEO A;  1Q43 A;  5KXB A;  1QKQ A;  5SV8 A;  1Q8V A;  3PVO A;  4UT5 A;  2D3R A;  4CEY A;  3LF7 A;  2GDF A;  2WNE A;  1OI6 A;  4MET A;  4N43 A;  2HJI A;  3WDW A;  1OA3 A;  5F37 A;  1VB2 A;  1S2B A;  2FCV A;  1N1V A;  3BTY A;  3OYW B;  3ORJ A;  1G9F A;  3CU7 A;  2FD8 A;  3KV9 A;  2F6B A;  3B9C A;  3KS7 A;  1JZ2 A;  1EYB A;  1S2K A;  3RDI A;  4BK5 A;  5JDB A;  5CBL A;  1HN0 A;  3K4A A;  5FZF A;  3IN9 A;  1CVN A;  5FZ9 A;  3VBF B;  4CDX B;  1F9K A;  4IXL A;  2W0X A;  2W9X A;  1PGS A;  1V9U 2;  4IEY A;  5F8P A;  1ASJ 2;  1O8S A;  2IFW A;  1TNF A;  2G1M A;  5T52 A;  3TAY A;  4PDW B;  4LE3 A;  1IG0 A;  4JRA A;  4Q0U A;  2ZMN A;  2EXK A;  4EYU A;  4M4R A;  1GP4 A;  4MGQ A;  4XJZ A;  2GNM A;  5H9R A;  4M0H A;  2VO5 A;  2WAA A;  4CUC A;  1AL2 3;  1NAE A;  4E4S A;  4LBQ D;  4MV2 A;  1KDK A;  2ORZ A;  1D7P M;  3KT1 A;  4AED C;  3ZKU A;  1DQ2 A;  4GH4 A;  3G6J B;  1OA2 A;  2E33 A;  3WDX A;  4UFL A;  1ASJ 1;  1B35 A;  4K9S A;  3JD7 2;  1G7Y A;  4J25 A;  1RUI 3;  2GC3 A;  2TBV A;  4YVS A;  5JOZ A;  1QOO A;  4IL7 A;  1W2O A;  1W8H A;  1E5S A;  4OMC A;  3K3O A;  1WW4 A;  1PK6 C;  1SCR A;  3HR9 A;  5CFD A;  2Q1Z B;  4LO4 B;  2HWB 2;  2PHF A;  4LHK A;  2ZX1 A;  3MW3 A;  4HG6 B;  3B7M A;  3POW A;  4UFJ A;  3WXP A;  3VD3 A;  4XAB A;  2VGD A;  1EY2 A;  3WF0 A;  3FZ3 A;  5D8A B;  3ZOI A;  3ZXF A;  5JOY A;  5D8A C;  5FPL A;  4BHP A;  4QPI A;  5C4W A;  4K3U A;  5FMO S;  5JI7 A;  4BQY A;  4U36 A;  5A6Y A;  2BWA A;  4FSJ A;  1MS9 A;  1YRZ A;  2ZZJ A;  3VBS A;  3RGB A;  2PTM A;  4JTO A;  3ZFF B;  1XC6 A;  2A6V A;  1QJF A;  2IWG B;  2JKB A;  4OQ9 A;  2BFU S;  2HWB 1;  4QDS A;  1WW6 A;  3WQ1 A;  1RHI 2;  2MPF A;  4IES A;  3VHN A;  4L97 A;  1JW6 A;  4X6R B;  3VZL A;  5GZF A;  1RUF 3;  3MDP A;  1HJG A;  3R6S A;  4CP2 A;  2DU1 A;  1GYK A;  2GZW A;  2ZAA A;  5DAX A;  1ODM A;  5FYB A;  1WZX A;  4ARY A;  2X29 A;  1AR9 2;  2A7A A;  2DUR A;  4IEZ A;  1DGW A;  4K1Y A;  4JX0 A;  4ES9 A;  2P6C A;  2KR2 A;  4DB5 A;  1H4H A;  3OTF A;  4RHV 2;  1JOD A;  4E4Z A;  4X6Q B;  4A6S A;  1UZW A;  3GHM A;  3KT7 A;  4E8D A;  4CEW C;  1OQD A;  2WA3 A;  3BGA A;  5LY1 A;  2WL1 A;  3I2O A;  1XE8 A;  1AYN 3;  4UFI A;  1W6M B;  5IUQ A;  1WLD A;  3K46 A;  2QQL A;  2HYX A;  3IWZ A;  1G9D A;  3U1X A;  4WM8 B;  1UYZ A;  1J1T A;  4DUW A;  5J37 A;  3WNN A;  2UWC A;  4WM8 C;  1UYX A;  2JX9 A;  3GDB A;  4MSV A;  5FZA A;  1AR9 1;  5GZG A;  5M0T A;  2BVV A;  2XBO 2;  3KQR A;  4JQR A;  5IHR A;  4BU2 A;  5BXX A;  3KF5 A;  4RHV 1;  1KQR A;  5JUV A;  2VNG A;  4D7Y A;  2R04 3;  4WVM A;  4KG8 A;  3H8X A;  2RDR A;  5FXZ A;  2V72 A;  3ITQ A;  5IVF A;  2H0V A;  4YLZ A;  4OHY A;  1HB2 A;  1AR8 3;  4KG0 A;  1LHN A;  4GJY A;  1YLL A;  1AHS A;  4HK8 A;  2VC9 A;  3HJR A;  3VBR A;  1WUV A;  5JOX A;  1V6L A;  2X5I B;  4LKS A;  2X5I C;  2XBO 1;  1PNG A;  1PO2 2;  1S0B A;  3GYD A;  3B3Q E;  3POY A;  5DAQ A;  2ARE A;  2PEL A;  3I59 B;  5LY2 A;  4ZU5 A;  2WQ8 A;  4P9Y A;  2DUO A;  5IAT A;  1WW7 A;  3IPV B;  1G9A A;  4HSL A;  5FJH A;  2Z79 A;  5L73 A;  3C7E A;  1TME 2;  5A32 B;  1QDC A;  1YCI A;  1ZRR A;  3I2I A;  1VR3 A;  4KMQ A;  3TNQ A;  3H0O A;  3TOJ A;  4OVE A;  2FZ2 A;  1TZO A;  1AUY A;  1Y9G A;  4EN0 A;  4LO7 A;  3Q8C A;  2VQ0 A;  3WNK A;  3NJY A;  2VNV A;  1H8V A;  2VMH A;  3LD8 A;  1I9R A;  1PO2 1;  4YG0 A;  5FP9 A;  2ZHL A;  3LEM A;  3WG3 A;  2R49 A;  4CRQ A;  3AL6 A;  1UL9 A;  2EAL A;  1X9P A;  3RS6 A;  5JZG A;  1JU4 A;  2P3I A;  5E6H A;  5JCT A;  5FMC A;  3MFC A;  3NV1 A;  4XVH A;  5CYY A;  5IYY A;  2RM2 3;  4XF1 A;  1NLR A;  4CTE A;  5TSW A;  3N35 A;  2P1B A;  4DIQ A;  3GZA A;  1DZR A;  4M3C B;  4SLI A;  3S30 A;  2VW1 A;  4NID A;  4D7S A;  1BKZ A;  2WA4 A;  1UOB A;  2QQP A;  2ID4 A;  5EYX A;  4LXL A;  1AXZ A;  1YYN A;  1SMV A;  2JIG A;  2NPI A;  2AEY A;  5DAP A;  3L2Y A;  2GU9 A;  1JH5 A;  2C26 A;  3S0M A;  1RUD 3;  1BHG A;  4MYE A;  1QY4 A;  1AJO A;  1STM A;  2VZS A;  2B42 B;  4LPL A;  3U78 A;  3C7H A;  4LKF A;  3UKN A;  4AAX A;  1UMH A;  2VZR A;  5F3G A;  5A1A A;  3THP A;  5BNO C;  5G04 L;  2EIB A;  1O6U A;  1F15 A;  5EHD A;  2YUE A;  4R52 A;  1EUT A;  5CFC A;  1BBT 2;  1YJK A;  3AP6 A;  2D44 A;  3AK0 A;  4OMD A;  4FFI A;  1TQ5 A;  2P34 A;  2WJS A;  3HAG A;  4N9H A;  1KS5 A;  4AFA A;  3BIE A;  1MEC 1;  3AC0 A;  3EXU A;  2XOM A;  3K75 B;  2XLA A;  1K12 A;  2CDO A;  3UL2 A;  1QOT A;  3T2P A;  1RUJ 3;  4PLN A;  5J36 A;  5F7U A;  1DYP A;  4AYU A;  3NNL A;  2RS5 1;  1SEF A;  1DG6 A;  1G6N A;  1NY7 2;  2RE9 A;  4DY5 A;  3DPR A;  2A5Z A;  2YRO A;  5C5U A;  2C1F A;  3PUI A;  5IK8 A;  1PIV 2;  1WMX A;  4ZS3 A;  1C28 A;  4NAM A;  4XUO A;  1T2X A;  2OII A;  5FYY A;  1YQ5 A;  5CZK A;  1YHF A;  5HBA A;  1ULP A;  1C4R A;  4I3P A;  3SLI A;  3UKV A;  1VRH 2;  1MAC A;  5DZG A;  2GC1 A;  2Q8C A;  2D5H A;  2ZGM A;  3KB5 A;  4AHW A;  5CIS A;  4Z2W A;  1C8M 1;  3IDE A;  1EUU A;  1NY7 1;  1W0N A;  4LBQ A;  2FDI A;  5LK7 B;  4LOR A;  5FY4 A;  1JN2 P;  4EWA A;  1PIV 1;  2BNO A;  3AKT A;  4UWD A;  4ZXE A;  3ZFE A;  4BMB A;  1BK1 A;  2A6Y A;  1DDL A;  1XE0 A;  2OXB A;  4FO9 A;  4QQO A;  4B7K A;  2P17 A;  2P4E A;  2C9K A;  1IGO A;  1I1E A;  1UZ0 A;  5IW0 A;  1CIW A;  3THT A;  2YXS A;  4E27 A;  4W50 A;  2VBB A;  4RGK A;  4AXO A;  3FE5 A;  4JGY B;  2HYK A;  5ERL A;  3I2J A;  1JYI A;  4CCJ A;  4FOY A;  3W21 A;  2GMP A;  5E89 A;  2W08 A;  5FZO A;  3MIG A;  4L9B A;  4FPK A;  3J8F 2;  1VIW B;  3IKW A;  3PIG A;  2FQP A;  3GAL A;  3N4M A;  3EQE A;  5DUW A;  2UYB A;  4QQL A;  1HQN A;  3H7J A;  4Y20 A;  4HMZ A;  1FI2 A;  3ZYG A;  4X8N A;  1W2N A;  1ZX5 A;  2EF6 A;  1KGY A;  1R08 2;  2PHT A;  3FX3 A;  3ROU A;  4FPC A;  2I74 A;  2RS3 2;  5FLI A;  2E7A A;  4E2S A;  2YBK A;  4HAN A;  1N1T A;  4XC9 A;  3CDZ B;  3PU8 A;  4QPG C;  5JXI A;  2QE3 A;  3CNA A;  5ANQ A;  1PZ8 A;  3V0A A;  3KD4 A;  4YVW C;  4BQ5 A;  4Q4X 1;  1JZ3 A;  2X09 A;  5DDJ 3;  2CGN A;  3CJI C;  1CON A;  4UW5 A;  5A6Q A;  2MEV 2;  3KHB A;  4QQH A;  2YG0 A;  4TSV A;  1PX3 A;  3OEB A;  4YSF A;  4G9S B;  4CEY B;  4LHS A;  1Z7S 2;  4UYB A;  3VKN A;  1R08 1;  4CEY C;  3ES1 A;  5T5L A;  4D7T A;  2VEC A;  1QH7 A;  2RS3 1;  5FY8 A;  1ULO A;  4N43 C;  2VVD A;  3CO2 A;  3OGG A;  1XE7 A;  5BYN A;  5L19 A;  4UF0 B;  5T5O A;  1GZW A;  2WFF 2;  4GB3 3;  1YQ8 A;  1FYU A;  3RPQ A;  4XBN A;  1XNK A;  1RED A;  5H9Q A;  1VBB 3;  5JI9 A;  2FBE A;  4QDR A;  5FMO L;  4DMI A;  3BPS A;  3AXD A;  1JZ4 A;  5FK7 A;  4AFD A;  2VM9 A;  1IPJ A;  1HV1 A;  1H2N A;  1DQ0 A;  2BFU L;  1HRI 2;  5D2A A;  4RQP A;  1NLQ A;  2MNG A;  3GF6 A;  1MS8 A;  2XWB B;  1H9W A;  2QQW A;  2DVA A;  3C7F A;  2DYC A;  3LE0 A;  1WA4 A;  2ZA9 A;  4YW3 A;  2XWJ B;  1BXH A;  1H1A A;  1POV 0;  4FAG A;  3IB3 A;  4XQD A;  1AR7 3;  1A8D A;  4Y3O A;  5CEH A;  3HWJ A;  1BYH A;  1Q8P A;  2PHR A;  4ITC A;  3OB8 A;  2VOV A;  3CQO A;  3PJY A;  4GH4 C;  2CNA A;  2DTW A;  5JSO A;  2BBV A;  2XL7 A;  3MI8 A;  1B35 C;  4NWW A;  4CYD A;  1H30 A;  2ZX2 A;  2CAV A;  4LUK A;  1ND3 A;  4LQR A;  2VJX A;  4KBB A;  4YVS C;  4K6B A;  3U14 A;  5DQ0 A;  1W9F A;  1AR6 3;  2ZAC A;  3LA7 A;  1C8N A;  3FN9 A;  4JAA A;  5CFD C;  3MHZ A;  2P3Y A;  5FQ0 B;  3HQR A;  3T30 A;  4ATF A;  4JDO A;  2EID A;  4NPM A;  3AYA A;  5KXE A;  2A3W A;  4Q0Q A;  5SV5 A;  5I0R A;  1UPS A;  2VCM A;  2QBX A;  4R9C A;  1JYT A;  1H0B A;  3OYW A;  2WN3 A;  5CIR A;  4QPI C;  3URF A;  2JDZ A;  2E51 A;  1OD3 A;  5FZK A;  3E5Q A;  1MS5 A;  2FDJ A;  2YY1 A;  4Y5Z 0;  2JDM A;  1SG3 A;  3ECQ A;  3VBS C;  5AVA A;  3VBF A;  2W91 A;  4NAO A;  4CDX A;  5ACA 3;  3N9M A;  3R4S A;  5HV4 A;  2ZGR A;  1FOD 2;  2P3J A;  3KV6 A;  4PDW A;  3VDC A;  1KXG A;  2ZGP A;  3U10 A;  3PNA A;  3RZM A;  3OUJ A;  4YGE A;  1VJ2 A;  1C5I A;  1U5Y A;  2VOW A;  1A78 A;  2BW8 A;  4NRQ A;  1CAX B;  4KU7 A;  3VDA A;  3FLR A;  1OMI A;  4MHU A;  4PI2 A;  2EA7 A;  2O8Q A;  1FOD 1;  2RMU 2;  1UWW A;  2QQN A;  3O0X A;  3INA A;  1MQT B;  2BOI A;  2CU5 A;  3RWN A;  4CDU B;  1MQT C;  3OGR A;  4LIT A;  2LM3 A;  4L0P A;  5LBF A;  1JYN A;  4E8C A;  5DAB A;  5D21 A;  2PXJ A;  3ZXA C;  4Q4W 2;  4BK4 A;  3UGG A;  4COW A;  4CPB D;  1SPP B;  2L9L A;  3ELN A;  2J1A A;  4R9B A;  3P1I A;  1KEX A;  2PLV 2;  1ZZ6 A;  5D8A A;  1W28 A;  2H0B A;  4A42 A;  3NNJ A;  1Y9Q A;  1NCR B;  2RMU 1;  2PHX A;  1NCR C;  1RGS A;  1RUG 2;  4MUV A;  4MGI E;  1JBC A;  3SXW A;  3HT2 A;  1R09 1;  4H14 A;  3VBH B;  1I3H A;  2RR1 2;  4LO8 A;  5BNP B;  3VBR C;  1V0A A;  3ZFF A;  1DBN A;  4HL0 A;  4KGQ A;  3B00 A;  5FKB A;  2ERF A;  1RTV A;  1ZBA 2;  2R06 1;  4QXH A;  1ZZC A;  4G3Y C;  3AVR A;  4LLO A;  2BPA 2;  4AI0 A;  4C1X A;  4NHL A;  3ZSM A;  1HRV 2;  3MLJ A;  3VZN A;  1RUG 1;  4TZD A;  1ULD A;  3MV0 1;  3OGJ A;  3S5Q A;  2Y64 A;  4XJ9 A;  2CDP A;  2RR1 1;  4YWA A;  1RUH 2;  1RUE 2;  1W3X A;  4GQ7 A;  1VBE 3;  4MVT A;  3OD0 A;  1W6M A;  3O7O A;  4RD7 A;  1RMU 2;  2BER A;  2JEC A;  3NW4 A;  4XQW A;  4YGD A;  1JS9 A;  3O1S A;  1ZBA 1;  3WDV A;  3BAL A;  2FCT A;  5A3W A;  3ZR5 A;  5LWB A;  1L7R A;  4NRO A;  4WM8 A;  3A0K A;  2ZJC A;  1FXZ A;  3H3Z A;  2GAU A;  4FPY A;  4GWI A;  4QB2 A;  1HRV 1;  2DBN A;  1W2U A;  1ZBE 1;  3BKZ A;  1FMD 2;  1UOJ A;  1WME A;  2KA3 A;  3WHT A;  4CU9 A;  4P5Y A;  3ACF A;  1MZ5 A;  4UBH A;  5AC9 2;  1AL0 G;  1OLR A;  1CN1 A;  2QQU A;  1LTE A;  1NG0 A;  5HCH A;  2OPK A;  3QBQ A;  3WUC A;  4EJR A;  1ZRD A;  4B7E A;  1DQ4 A;  3BU0 A;  2ZGS A;  1PMI A;  2B46 X;  2YFU A;  1RYY A;  5HXV A;  3RZL A;  5I8Y A;  2ZGQ A;  2G19 A;  1ENR A;  1GWK A;  1HV0 A;  2BTV C;  4XIL A;  2X5I A;  3LFI A;  3NJZ A;  1CR7 A;  4UW3 A;  3D3A A;  4ORF A;  1ND2 B;  3I59 A;  1RXG A;  5I0S A;  3ASI A;  2WT1 A;  3MLL A;  2XJS A;  3IPV A;  4ARX A;  5CFC C;  5JAX A;  2UWA A;  2EXJ A;  3DKQ A;  4H55 A;  5A3M A;  4QHZ A;  3VZM A;  5A32 A;  2RG4 A;  2VCB A;  2O0O A;  3R4D B;  2ZEX A;  4LBN A;  4M3C F;  5F3E A;  5F2W A;  3I2K A;  3ABZ A;  2JDH A;  3ALQ A;  1PM7 A;  4D8M A;  1MEC 3;  2NYY A;  2HH9 A;  2OZ6 A;  4J1X A;  1IQD C;  2IFR A;  3POF A;  5JXG A;  3E6C C;  1E5I A;  2A6X A;  3ZSL A;  2WSV A;  3VLB B;  4LBM A;  1BLZ A;  2D6M A;  5H9S A;  1O3S A;  4QX8 A;  1V6J A;  2IXK A;  3KGL A;  3TRS B;  4D6S A;  1PVC 3;  4EZH A;  3VBU B;  3HN3 A;  2RS5 3;  4RFT 0;  2WZP P;  2ZHM A;  3AMM A;  2CAU A;  4I3G A;  5LEK A;  5CG9 A;  3DEC A;  2FHR A;  3JBG 1;  5D1I A;  2ZTN A;  2Y6H A;  4JDN A;  3T2O A;  4M3C A;  4XTM A;  2WS9 2;  4CCO A;  2A1X A;  1HXS 3;  4UW6 A;  2WWJ A;  3BPZ A;  4L11 A;  4AR2 A;  1GP6 A;  1RVF 2;  4OZX A;  4XPV A;  4A44 A;  2QJV A;  3WV6 A;  4FTB A;  5FYT A;  3IDC B;  3WNP A;  4FP2 A;  3FWE A;  5FPZ A;  3ZFE C;  5I0U A;  2UWB A;  1J3P A;  1ENX A;  4QQ2 A;  4H7L A;  1BEV 2;  3PDQ A;  2PHU A;  1F5F A;  2ZX0 A;  4XF4 A;  2W87 A;  1LOC A;  1NZC A;  3B69 A;  5JVV A;  2Q8D A;  3V65 A;  3WG4 A;  3KZ4 C;  1CGP A;  4JHZ A;  1AYM 1;  1J3R A;  4AK3 A;  1OHF A;  3MF9 A;  2VTX J;  4GWN A;  4Q5O A;  1EAH 2;  3OBT A;  3SIS A;  1GQH A;  4Q8L A;  2R1D A;  5FY9 A;  4H3W A;  4EN6 B;  2UY8 A;  3PVE A;  1M06 G;  1UXZ A;  3BU7 A;  3FBM A;  1MR5 A;  2O14 A;  1BEV 1;  2AGS A;  5CKN A;  1QDO A;  2JEM A;  4IUG A;  3RG0 A;  4RGA A;  5FXX A;  5EV7 A;  1YQ2 A;  2XJV A;  4LIV A;  4NN0 A;  1NT0 A;  4MXW B;  2YU2 A;  4ONU A;  3NJV A;  4MLO A;  1LOA A;  5A6Z A;  3HQX A;  4Z2A A;  1EAH 1;  2WN2 A;  4EQV A;  2D6O X;  3LIH A;  2WWU A;  1XNB A;  1NCQ B;  2OVU A;  3A4U A;  3NNF A;  4XHX A;  5A3N A;  3S57 A;  1H8T B;  4XUP A;  2TNF A;  2RJL A;  1GOH A;  3DCQ A;  3MLK A;  3WG1 A;  1QJU 1;  1DZQ A;  3A7Q A;  1PMH X;  2JKX A;  3LPF A;  4PT6 A;  1W04 A;  1ZZ7 A;  1F4H A;  5A1F A;  1DU3 D;  2B45 X;  3S6P A;  1ULG A;  3GNE A;  3M7A A;  2E26 A;  4Q4X 3;  4QX5 A;  2WWS A;  2XJQ A;  1F4A A;  2VTX A;  4I02 A;  3WY6 A;  4YZ2 A;  3WCR A;  1SAC A;  3SH5 A;  4YW1 A;  1W90 A;  2JG9 B;  2Z42 A;  4BQW A;  3DKW A;  2RS1 3;  2YDE A;  3OY8 B;  1QQP 2;  3SIT A;  4AI3 A;  1POV 3;  3GJB A;  5FLH A;  4ASM B;  1QJE A;  4BME A;  1YJL A;  2JE7 A;  1SLB A;  4JGY A;  2DCT A;  5GLT A;  3USS A;  2H6B A;  1KIT A;  1VE0 A;  3WW1 A;  2K0G A;  1DYK A;  2VG9 A;  4LEJ A;  1GQG A;  1N1Y A;  2DCK A;  1XJA A;  1D4V B;  1HIX A;  2XVG A;  4FP3 A;  2VVF A;  2J7M A;  3RWK X;  3ZIX A;  4JHT A;  3ZM8 A;  5FTT C;  4K21 A;  4RQP C;  3WR0 A;  1UU4 A;  4AI1 A;  3ZYH A;  1Y7B A;  4PF5 A;  2XLF A;  1B09 A;  2W5F A;  5DUU A;  3RSJ A;  4C91 A;  1QQP 1;  1XRU A;  1WCQ A;  1QJY 2;  3PVN A;  1GZ9 A;  4XJA A;  5BUV A;  1H4G A;  3ZYB A;  1M4W A;  5EXO A;  3FUO A;  3O0V A;  2Y8K A;  4IEW A;  4QPW A;  4XF0 A;  3UJO A;  4HKO A;  3BTX A;  3ATG A;  4OHV A;  1N1S A;  3E5X A;  3N9Q A;  3PTY A;  1JZ7 A;  2NMN A;  3BUC A;  5AFB A;  4KI5 M;  2Z4F A;  1J59 A;  1JZ6 A;  1ZVF A;  4LT5 A;  3JB8 A;  1ND3 C;  3S7E A;  3KM5 A;  3LEK A;  1WCS A;  2XQX A;  3L2H A;  4YAR A;  4OUE A;  1W0O A;  1VBC 3;  2JXA A;  2E53 A;  4BB3 A;  1DQ5 A;  2VU9 A;  4J6G A;  4AAP A;  4YG6 A;  4R4Z A;  3LZZ A;  2LS6 A;  4JVA A;  1X9T A;  3BOW A;  2O8O A;  4EWE A;  1DGL A;  4RL7 A;  2LRO A;  3MGU A;  4UF0 A;  2GME A;  1AX0 A;  1F31 A;  4HKW A;  5FP4 A;  5LBC A;  3B9I A;  1BZW A;  2D43 A;  2VXR A;  1Q8S A;  2PQQ A;  2WLQ A;  3FLP A;  4PQQ A;  4QKF A;  5FZ3 A;  4M3C E;  3O1U A;  2HWF 2;  2HLE A;  3VBF C;  4BJ0 A;  3UV9 A;  4CDX C;  3IT8 A;  5IVE A;  3RNS A;  4AVV A;  1D4M 2;  2ZXQ A;  4Q27 A;  5A7Q A;  1SLI A;  1DGR N;  1GNZ A;  1OFS A;  1VAV A;  3CJX A;  2VOK A;  2BBA A;  2ZGU A;  3Q8F A;  4PDW C;  3T1L A;  2FZ1 A;  2Y33 A;  5FP3 A;  2WQZ C;  2Z5W A;  4XIO A;  4MXV A;  3D6E A;  4IEU A;  4D6Q A;  1F2N A;  2SLI A;  2W94 A;  1G8W A;  1UYY A;  2XJR A;  2C6S A;  2B4K A;  2VZT A;  3FL7 A;  3K48 A;  4FXK B;  1V9U 1;  2VQU A;  1D4M 1;  2ZEZ A;  5ANN A;  4LK6 A;  4P02 B;  1ZZ8 A;  3RMY A;  4ISQ A;  3FMG A;  2Y6G A;  4HET A;  3V0A B;  1REE A;  1IS5 A;  5IVB A;  2IXL A;  2FMY A;  5IK5 A;  1J84 A;  4YRD A;  5FUN A;  4XET A;  4ZY9 A;  5T50 A;  2XVK A;  3WQ7 A;  5FQ0 A;  4IEO A;  4ASK A;  1N3Q A;  5ABJ B;  3HD8 B;  1I6X A;  4OI0 A;  1OQ1 A;  4S2G A;  2ARA A;  2VTF A;  1S2E A;  3TYJ A;  2VQA A;  3JD7 1;  4W6X A;  1LUL A;  3AL5 A;  2VE1 A;  4CUA A;  3NV4 A;  2C0Z A;  3ZFF C;  4NIG A;  3PUH A;  1J83 A;  2W1U A;  5K7P A;  1GV9 A;  2WAO A;  1R09 3;  2XUE A;  2ZAH A;  4KWK A;  4LKE A;  1CAV B;  2ET7 A;  5FPA A;  4EN9 B;  1WKY A;  3T2Q A;  2Y60 A;  1YI7 A;  1GZC A;  2YC2 A;  2FCU A;  4HON A;  5E16 A;  1W0P A;  4CVU A;  2EIC A;  3H1M A;  4DUX A;  1O7F A;  3I2D A;  4QX0 A;  1S0J A;  2R06 3;  4FI9 A;  4OLL A;  2IVJ A;  1AZD A;  4CP0 A;  1KJR A;  1CAX A;  5FO8 B;  4NIH A;  2VAU A;  3J7H A;  4GAZ A;  4U2A A;  5B4X A;  3AMP A;  3GZE A;  3A21 A;  5F39 A;  5IK4 A;  2E6V A;  2GH2 A;  1XNC A;  3PME A;  1RHI 1;  1OOP B;  2ZGO A;  1OQE A;  4Y26 A;  1TMF 2;  1WMF A;  1SCS A;  4CCM A;  4O7X A;  2ZCW A;  5K9Y A;  1Z78 A;  4CDU A;  1MQT A;  2VUA A;  1BVP 1;  5KHJ A;  4QT6 A;  4QB1 A;  4BH9 A;  2NN8 A;  3PUR A;  1FNY A;  5FIX A;  2QFE A;  5C3O A;  4ET7 A;  2I2S A;  1SPP A;  1Q8Q A;  1ZBE 3;  1LAJ A;  4Y1Z A;  4Q1R A;  4DFS A;  1URX A;  2AR6 A;  2C4X A;  3U4X A;  2WUH A;  4OYU A;  1NCR A;  1TMF 1;  1UO9 A;  1OLM E;  2DFB A;  3KSC A;  1SBD A;  2ZGN A;  1GAN A;  2ES3 A;  4Z82 A;  3VBH A;  4CUB A;  4AHX A;  2R07 2;  1BCX A;  1LEC A;  5BNP A;  3A22 A;  1PO1 2;  3KF3 A;  3AYC A;  5FLJ A;  2I07 B;  3DUI A;  4HOO A;  1UF2 C;  2NMO A;  4AFM A;  4TTG A;  1MVQ A;  4JC1 A;  3CHX A;  4CDW B;  1H9P A;  2WR9 A;  4GIQ A;  3NNM A;  4FQZ A;  5FUP A;  4FXG B;  2BYV E;  1C5H A;  4HFS A;  5FK8 A;  1VBD 2;  2OX0 A;  4XUT A;  4LA2 A;  3VD5 A;  2V4V A;  1REF A;  2ETE A;  2N7G A;  3P6B A;  2R07 1;  2R30 A;  5BPX A;  3K4D A;  3MPP G;  4A4A A;  1PO1 1;  2C24 A;  2GN3 A;  3H3U A;  2NQY A;  1Y3T A;  2AC1 A;  3CZJ A;  5BNQ A;  1W8T A;  5A3U A;  3ZXE A;  1CAW B;  3LSE A;  1YNA A;  4XFF A;  4QU2 A;  1WCK A;  1TME 1;  4RSU A;  4YW7 A;  1VBD 1;  3THD A;  2QDN A;  4A7K A;  1H2K A;  4YZ1 A;  1NA1 B;  2A75 A;  1UAI A;  2XJP A;  2YMZ A;  2R1B A;  1DHK B;  1NLS A;  3MBW A;  1SBE A;  2CSG A;  3TEW A;  3M8L A;  4BDV B;  4C8D A;  4DIN B;  1TE1 B;  3JBG 3;  4Q0V A;  3LIG A;  3CIH A;  4DEQ A;  3AMQ A;  4JKM A;  4IE6 A;  4N7U A;  1COV 3;  1US3 A;  2WZR 3;  3E5U A;  3MYX A;  4PHZ A;  1KJL A;  1NQJ A;  2DVD A;  2JJ6 A;  1MZE A;  2K9Z A;  2ZOE B;  3HNB M;  3M2M A;  1O5U A;  2EAA A;  1U5I A;  2CY6 A;  4LTA A;  2JD4 A;  3LB9 A;  3MO4 A;  5CKQ A;  3ZN5 A;  4QGN A;  5JWP A;  1ND2 A;  3E6B A;  1CX4 A;  2YV8 A;  4XDP A;  4E4D X;  3B93 A;  5KHI A;  3WEZ A;  3KV4 A;  5BV6 A;  5EJ3 A;  5DUV A;  4QHO A;  1IS3 A;  5FZE A;  2Q1M A;  3KVB A;  1EV1 2;  4UXA A;  5C8C B;  4RFR B;  1W05 A;  3H50 A;  3B5L B;  3HOB A;  3ACL A;  1UMI A;  4GMP 1;  1AYM 3;  3BOP A;  4W65 A;  1DGR A;  1OVS A;  2VZP A;  3JQW A;  4FPG A;  1CZT A;  2W95 A;  1BBT 1;  2ARC A;  3MW2 A;  3NV2 A;  5DG2 A;  1EV1 1;  5HI0 A;  1W99 A;  2XVL A;  3T4V A;  1OA4 A;  1PVX A;  2VQT A;  3VBU A;  2HBU A;  3OJB A;  4XJW A;  1QJX 3;  3TEX A;  2Y6K A;  1VRB A;  4UFH A;  1VBA 2;  4IQP A;  4WM7 B;  1VAM A;  3OF1 A;  1LB2 A;  1GLH A;  3GHN A;  2HWC 3;  3D5O A;  4JRL A;  4DXR A;  3T4H B;  2CGP A;  1VPH A;  2TUN A;  4LLF A;  2GC0 A;  3MPB A;  2BGP A;  4XTP A;  4CSW A;  4XF3 A;  2CHH A;  2JE9 A;  4BPZ A;  4E9K A;  4Q4V 3;  4Y22 B;  4FAH A;  2ZPX A;  4KQ7 A;  1QMJ A;  4GAL A;  1QJU 3;  3AB0 A;  1CQ9 A;  4K8R B;  3T0A A;  4BIS A;  3K4Z A;  4P5H A;  3O14 A;  1LEM A;  2B9U A;  4NIA A;  4ZHN A;  3PHM A;  3PUA A;  4Q26 A;  4UI9 L;  4QX3 A;  1VBA 1;  2RJK A;  3LOI A;  3OCP A;  2F4L A;  5J98 B;  2A71 A;  2WQ4 A;  1VRH 1;  3FC0 A;  1QH6 A;  4C90 A;  4XFH A;  2BNN A;  2Y34 A;  1FPN 3;  2Y6J A;  3JU9 A;  1LU1 A;  1S0F A;  1NYW A;  3MW4 A;  4BXF A;  1PM4 A;  1PX4 A;  4JGY C;  2OKX A;  4XJ8 A;  1RUC 2;  4QDQ A;  3PU3 A;  3MFA A;  1AXY A;  4G4F A;  4AFC A;  5LRS A;  2Q0A A;  3WF4 A;  5IT6 A;  4QX2 A;  4XQ4 A;  3SCH A;  4ZKT B;  3VKL A;  2BZD A;  3N7K A;  4RGG A;  2JDK A;  3TN9 2;  1CIY A;  1JOB A;  4NRP A;  1R1A 2;  4FPH A;  1ZRI A;  1IS4 A;  2ATF A; 
#chains in the Genus database with same CATH homology
 2VZ3 A;  3I2G A;  2WYS A;  3HNM A;  2Y6L A;  1GMM A;  2VMD A;  2PQS A;  5LA0 A;  1DYO A;  3MV0 1;  2QQJ A;  2Y64 A;  2CDP A;  2LW8 A;  1XNT A;  2QQO A;  3NNG A;  2BER A;  4QAW A;  1LNS A;  3K77 A;  4XUQ A;  2W1S A;  1UY1 A;  1L7R A;  3MUZ 1;  1O59 A;  4GWI A;  4QB2 A;  3LQC A;  2J1V A;  3CKH A;  2J1U A;  1PMJ X;  3HNY M;  3THC A;  4CU9 A;  2YFZ A;  1XNA A;  4P08 A;  4P5Y A;  3ACF A;  3T0B A;  3CZU A;  2VMF A;  1UY2 A;  3OG2 A;  4D0Q A;  5DPN A;  1NKG A;  4CU6 A;  2YFU A;  1RYY A;  3VDB A;  2X10 A;  3OBA A;  5EJ1 B;  5JR2 A;  1K3I A;  3ETP A;  1P8J A;  5I0D A;  3D3A A;  4DXS A;  2VZ1 A;  2QQK A;  4W4Z A;  4ARX A;  3UNP A;  2VCB A;  1K45 A;  2ZEX A;  1CX1 A;  2DCJ A;  3I2K A;  3ABZ A;  2XON A;  2QQI A;  2VMC A;  4D8M A;  2RV9 A;  5JXG A;  1JZ2 A;  1IQD C;  4BK5 A;  5IFT A;  3K4A A;  1L7Q A;  2W9X A;  4RN5 A;  1O8S A;  3HN3 A;  1SHW B;  2WBK A;  4ZZ8 A;  2YC4 A;  3DEC A;  4M4R A;  4MGQ A;  2Y6H A;  3T2O A;  2VO5 A;  2WAA A;  3CMG A;  2WDB A;  1GOF A;  4CUC A;  5G05 L;  1NAE A;  3WNM A;  2RVA A;  4A44 A;  3EYP A;  4UAP A;  3NRU A;  2ORZ A;  1D7P M;  2J22 A;  2E33 A;  3WNP A;  3DYM A;  1UY4 A;  2WZ8 A;  4OMC A;  2W87 A;  3DYO A;  4JHZ A;  4HG6 B;  3ACH A;  3VD3 A;  1SDD B;  3WF0 A;  1GUI A;  1W8N A;  3SKJ E;  2V5D A;  3FHQ A;  3ACI A;  3OGV A;  1UXZ A;  5JMO A;  3UES A;  2ZEY A;  3WF1 A;  1K42 A;  4IUG A;  1XC6 A;  1YQ2 A;  3NJX A;  4QDS A;  3W5N A;  3NJV A;  1GOG A;  4Z2A A;  2WN2 A;  5LCW L;  4ARY A;  3WNL A;  3IAP A;  4XUP A;  4JX0 A;  1GOH A;  3A7Q A;  1PMH X;  2VL4 A;  2JKX A;  3LPF A;  4PT6 A;  4E8D A;  3BGA A;  2RJ2 A;  1F4H A;  3WF3 A;  3IDA A;  1JYW A;  2E26 A;  3LEI A;  3K46 A;  2QQL A;  1H6X A;  1F4A A;  2HYX A;  3SEP A;  4XZU G;  3I3E A;  2WO2 A;  1UYZ A;  4DUW A;  3WNN A;  1UYX A;  3GDB A;  4AG4 A;  3I97 A;  5IHR A;  4MGS A;  1US2 A;  5JUV A;  2VCA A;  3JXS A;  2J1R A;  5EJZ B;  2V72 A;  2DCK A;  4BXS V;  2J7M A;  3ZM8 A;  2VC9 A;  2W3J A;  3HJR A;  4LKS A;  4GWJ A;  2W1W A;  2W5F A;  1JI6 A;  1WCQ A;  2WQ8 A;  2JDA A;  2Y8K A;  3C7E A;  4QPW A;  3HEI A;  3I2I A;  4KMQ A;  1JZ7 A;  4KI5 M;  2Z4F A;  1JZ6 A;  1XPW A;  5C71 A;  3LEK A;  2XQX A;  3WNK A;  4CU7 A;  4OUE A;  2QQM A;  3IAQ A;  1JZ5 A;  3W5M A;  5DMY A;  1OF3 A;  2LS6 A;  4A41 A;  3A23 A;  1JU4 A;  4MOA A;  4JKL A;  2VZQ A;  1O8P A;  2E31 A;  3I2H A;  4XVH A;  1GU3 A;  2W1Q A;  5CYY A;  2JE8 A;  5IYY A;  5EIY B;  4PQQ A;  3VD4 A;  2HLE A;  5LA1 A;  3WSO A;  4BJ0 A;  2ID4 A;  2WO3 A;  2VZU A;  2ZXQ A;  4DEV A;  3C7G A;  2C26 A;  2BBA A;  1BHG A;  4UOJ A;  2VZS A;  2XHN A;  4LPL A;  3C7H A;  4XUR A;  1JHJ A;  4AAX A;  1UMH A;  2VZR A;  4DUV A;  5A1A A;  5G04 L;  2EIB A;  4A3Z A;  2W94 A;  3U37 A;  1UYY A;  1EUT A;  5DN2 A;  2B4K A;  2VZT A;  4OMD A;  5FUI A;  3FL7 A;  2WZE A;  2VQU A;  2ZEZ A;  3AC0 A;  3K75 B;  2XOM A;  4P02 B;  2VCC A;  1K12 A;  2CDO A;  2Y6G A;  3T2P A;  1J84 A;  3GXU A;  5F7U A;  1JYX A;  4ZY9 A;  2J1S A;  3PUI A;  2VOT A;  3LPG A;  3DYP A;  4XUO A;  1T2X A;  2VTF A;  1MPX A;  5CZK A;  3FHA A;  3T08 A;  1ULP A;  3C7O A;  4CUA A;  4TXW A;  3PUH A;  1J83 A;  2W1U A;  3F2Z A;  1EUU A;  2R7E B;  2WAO A;  3III A;  1W0N A;  3BN6 A;  1WKY A;  3T2Q A;  5IJR A;  2YC2 A;  4ZXE A;  4CVU A;  2EIC A;  1I5P A;  4DUX A;  4QX0 A;  4MAD A;  1GQP A;  4FI9 A;  2C9K A;  4RYD A;  4W8J A;  3J7H A;  1UZ0 A;  5B4X A;  5C7G A;  3MV1 1;  1UY3 A;  3A21 A;  4W50 A;  3EB7 A;  1JYV A;  1OF4 A;  3UET A;  3I2J A;  1TVG A;  4MO3 M;  1UX7 A;  2W92 A;  2YB7 A;  4A6O A;  1OH4 A;  4QB1 A;  1CZV A;  4PF1 A;  4ET7 A;  1JU3 A;  3GGL A;  4YPJ A;  4JKK A;  2VME A;  5JXH A;  1KGY A;  2C4X A;  2WUH A;  4OYU A;  3LEG A;  4CUB A;  1GNY A;  3CDZ B;  3WQB A;  2W46 A;  5JXI A;  4M4P A;  1W9S A;  3A22 A;  4QB6 A;  4A45 A;  1JZ3 A;  2X09 A;  2YG0 A;  1PX3 A;  3OEB A;  3SKV A;  4LHS A;  4TTG A;  3VD7 A;  4XUT A;  1ULO A;  3VD5 A;  2V4V A;  3P6B A;  2BGO A;  2VR4 A;  3K4D A;  4A4A A;  3I3D A;  2JD9 A;  3CZJ A;  4QDR A;  1OT5 A;  5HPO A;  4ZZ5 A;  5B4N A;  1JZ8 A;  2EIE A;  3I2F A;  2ZEW A;  1JZ4 A;  3VD9 A;  2WAB A;  2VM9 A;  4OZO A;  3THD A;  1TG7 A;  3SEE A;  2WO1 A;  3MBW A;  3MUY 1;  3C7F A;  3LE0 A;  2W47 A;  4P00 B;  4BDV B;  3IB3 A;  3CIH A;  4DEQ A;  4DXT A;  4JKM A;  3OB8 A;  1R64 A;  3CQO A;  1US3 A;  2E32 A;  1CZS A;  3HNB M;  1NUK A;  4LQR A;  3MO4 A;  2VJX A;  4KWU A;  4XUN A;  3WEZ A;  5DQ0 A;  2X05 A;  3WNO A;  3FN9 A;  1UY0 A;  4GZ9 A;  2EID A;  2QBX A;  2DDU A;  2VZO A;  3HOB A;  1W9T A;  1UMI A;  2WN3 A;  1NX9 A;  1OD3 A;  1W8O A;  2VZP A;  5LA2 A;  1H6Y A;  3ECQ A;  1SG3 A;  1CZT A;  2ORX A;  3I3B A;  1HN1 A;  2W95 A;  2W91 A;  5HXM A;  1W99 A;  2VQT A;  3VDC A;  5IFP A;  2J1E A;  2Y6K A;  3T09 A;  3OGS A;  4DXR A;  3C8X A;  5J1X A;  3VDA A;  2B9V A;  2BGP A;  3HPN A;  3WF2 A;  2VZV A;  3GM8 A;  3OEA A;  4QX1 A;  1UXX X;  3T0A A;  5C70 A;  3K4Z A;  2KD7 A;  3E1F 1;  1UWW A;  2QQN A;  5JXJ A;  4UI9 L;  4QX3 A;  3OGR A;  4L0P A;  1DLC A;  2J1T A;  3ACG A;  1JYN A;  4E8C A;  2Y6J A;  4BK4 A;  1DP0 A;  2L9L A;  1PX4 A;  2J1A A;  2OKX A;  3P1I A;  1KEX A;  4QDQ A;  3T0D A;  4A42 A;  1W9W A;  3WF4 A;  4QX2 A;  2BZD A;  1CIY A;  3NQH A;  4CU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...