3OEAA

Crystal structure of the q121e mutants of c.polysaccharolyticus cbm16-1 bound to cellopentaose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
146
structure length
146
Chain Sequence
SHMVNMVSNPGFEDGLDSWQDWQQDMSAVPEAAHNGALGLKIGGGKAAGGGQDIPLKPNTTYILGAWAKFDSKPAGTFDVVVQYHLKDANNTYVQHILNFNETDWTYKQLLFTTPDVFGSTPELALWKGDTSKANLYVDDVYLVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational insights into the roles of amino acid residues in ligand binding for two closely related family 16 carbohydrate binding modules.
pubmed doi rcsb
source organism Caldanaerobius polysaccharolyticus
molecule tags Hydrolase
molecule keywords S-layer associated multidomain endoglucanase
total genus 28
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3oeaA00
3OB8A 3A23A 3CDZB 1O59A 4ZXEA 3NRUA 4GWJA 1OF4A 1KGYA 3DYPA 4XUOA 1UZ0A 2Y64A 3DECA 3VD3A 3ABZA 4A6OA 3FHAA 1UMIA 2ZEXA 2QBXA 3HNBM 4QX1A 3DYOA 1OT5A 2JKXA 4BK5A 5IYYA 2WAAA 2ORZA 2ORXA 3T2QA 1SG3A 2E31A 5JXIA 1UXXX 2W95A 4P00B 3UETA 3FN9A 4BDVB 2J1RA 2JE8A 1NKGA 1UMHA 3IB3A 4QB6A 4QB2A 1P8JA 4KMQA 3OGVA 1K42A 2VL4A 2YFUA 2RVAA 2WZEA 3T0AA 3WNPA 2KD7A 2XOMA 4M4RA 2VZQA 4L0PA 1XNTA 4W50A 2ZEZA 3CZUA 4A41A 2EICA 4XUQA 1H6YA 4QDQA 2VOTA 4CUAA 2VZPA 4A44A 5JXJA 4PQQA 3C7EA 3A7QA 4CVUA 3ACGA 2E26A 3LPGA 2ZXQA 3WF3A 4CU9A 1CZVA 1UYZA 3D3AA 3CQOA 2HLEA 3LQCA 1IQDC 2JDAA 3WNKA 2W91A 2CDOA 3GM8A 2QQJA 1US2A 4JKKA 1GOFA 3GGLA 2V72A 5EJ1B 1D7PM 1K3IA 4CUBA 3F2ZA 1US3A 2Y6KA 1JI6A 3I3DA 2BERA 3OG2A 4GWIA 1RYYA 2W94A 3P1IA 1UX7A 4AG4A 3J7HA 4CUCA 2C26A 5FUIA 3I2GA 4LQRA 2BGPA 2C4XA 5LA2A 1XPWA 3T2OA 2VCCA 3SEPA 5CYYA 3NJXA 2J22A 2YG0A 1PX4A 2YB7A 2QQOA 1F4HA 2VMCA 2VCBA 2WO1A 2Y6GA 1TVGA 2WO2A 1UYYA 4OMDA 4CU6A 1DLCA 2VMDA 4JHZA 4TTGA 4M4PA 1OF3A 2VZSA 2X09A 1W8OA 3OEBA 3I2FA 2J1UA 5JXHA 4GZ9A 4DXRA 1UY0A 1NX9A 2QQLA 3C7FA 3MO4A 2RV9A 3PUHA 3E1F1 3I2KA 4QX0A 3K4DA 3HPNA 1UY4A 1ULOA 4BXSV 3JXSA 2VCAA 4MOAA 4DXSA 2VR4A 4JX0A 3WSOA 3WF0A 5DQ0A 3FHQA 3P6BA 3PUIA 5EIYB 3I2JA 4LHSA 5B4XA 2ZEWA 2EIDA 3WNLA 3WEZA 2RJ2A 4ZZ8A 2C9KA 2E33A 5G04L 1L7QA 1EUUA 3C7GA 1W9WA 2JD9A 3VDAA 4AAXA 3CZJA 1W8NA 1UY3A 3LE0A 2DDUA 3T08A 2VC9A 2VZOA 4TXWA 1UXZA 1J83A 1T2XA 1O8SA 1JYWA 1EUTA 4ARYA 4E8DA 5J1XA 3C8XA 3OGSA 4OYUA 3I2HA 4MGQA 2VZRA 2J1EA 1LNSA 4YPJA 4XURA 5I0DA 3AC0A 2QQIA 2V4VA 1L7RA 2WABA 3WQBA 3HNYM 2WUHA 2WQ8A 2E32A 1UWWA 4ZZ5A 3K4ZA 1K12A 5EJZB 4FI9A 3VD5A 1TG7A 4QX2A 3C7OA 2J1AA 1PX3A 4MGSA 3IAPA 4PF1A 3ACFA 1GU3A 3CKHA 5HPOA 2WYSA 3WNNA 4W4ZA 3GDBA 4CU7A 4LPLA 2W1WA 5IFPA 4KWUA 4QPWA 1ULPA 3UNPA 1W0NA 2ZEYA 1OD3A 2R7EB 5A1AA 2VZ3A 5LA0A 3I2IA 1UYXA 1JZ2A 2QQNA 1JU3A 1GNYA 2DCKA 5CZKA 3WF2A 4DUWA 2Y8KA 5JR2A 1SDDB 1JZ5A 3THDA 2V5DA 2EIBA 1OH4A 1JYXA 4IUGA 4ZY9A 3VD7A 4A42A 4Z2AA 2QQKA 3W5MA 3GXUA 3UESA 1DP0A 1J84A 3C7HA 1UY1A 1W99A 3T2PA 3ETPA 4P5YA 3WF4A 4W8JA 2W1QA 5C7GA 3WNMA 1WKYA 2CDPA 3SKVA 3HEIA 5DMYA 2EIEA 1I5PA 2J7MA 3K75B 3A21A 3THCA 2WN2A 3MUZ1 2B4KA 1GMMA 3IAQA 4A45A 5JXGA 2J1VA 4D0QA 1R64A 1JYVA 1YQ2A 1JZ6A 3HNMA 2YFZA 1BHGA 3FL7A 3I3BA 1DYOA 4PT6A 1JZ4A 4QAWA 2W92A 3DYMA 2QQMA 4RYDA 2DCJA 2VM9A 3MV11 2WBKA 1NAEA 3OGRA 4QB1A 1WCQA 2Y6JA 3NJVA 4XUTA 4JKMA 5IFTA 3WNOA 4UI9L 4P08A 2BBAA 1W9SA 2VJXA 2W46A 5B4NA 3HOBA 3HN3A 1CIYA 2W9XA 4DUXA 3EB7A 1JHJA 2BGOA 2YC2A 4CU8A 3U37A 5IJRA 3SEEA 4XUNA 2ID4A 4MO3M 4E8CA 1CZTA 5C70A 5DN2A 1MPXA 3ZM8A 4QX3A 1PMJX 4HG6B 3T0BA 1XNAA 1CX1A 2LS6A 2W47A 3K4AA 5G05L 2X05A 4P02B 3LEKA 3VD9A 1GUIA 3WF1A 2HYXA 2WO3A 3W5NA 1GOHA 3LEGA 4OUEA 2WN3A 1GOGA 2W1SA 3I97A 1JYNA 4A4AA 3A22A 1JZ7A 1PMHX 5JMOA 3MBWA 2XHNA 2VTFA 3ECQA 3K77A 4UAPA 3VD4A 4DUVA 3VDBA 3ACHA 4LKSA 2BZDA 3NNGA 4XVHA 5LCWL 2VZUA 3IDAA 4DEVA 1GQPA 2VO5A 3SKJE 1KEXA 2X10A 2B9VA 3MV01 4JKLA 5HXMA 3BN6A 5C71A 3I3EA 3MUY1 3NQHA 2XQXA 1HN1A 2W3JA 2WDBA 4XZUG 4QDRA 3T0DA 2LW8A 2J1TA 2WZ8A 2WAOA 1W9TA 5F7UA 4BK4A 4RN5A 3K46A 4XUPA 1XC6A 4QDSA 1UY2A 1K45A 2L9LA 3ACIA 2Y6LA 2J1SA 2YC4A 5DPNA 2VZ1A 3VDCA 1JZ3A 2Z4FA 1JZ8A 4A3ZA 2W5FA 2VZTA 3HJRA 4ARXA 4MADA 4UOJA 2OKXA 2VMEA 3LPFA 5JUVA 3IIIA 3LEIA 2PQSA 1JU4A 4OMCA 3EYPA 4D8MA 3CMGA 4OZOA 5IHRA 5LA1A 2VQUA 4KI5M 1NUKA 4DXTA 2VMFA 3OBAA 2VQTA 2Y6HA 2W87A 4DEQA 1CZSA 2W1UA 1O8PA 2XONA 3OEAA 3T09A 4BJ0A 1H6XA 3BGAA 1SHWB 4ET7A 2VZVA 1F4AA 3CIHA
chains in the Genus database with same CATH superfamily
2WQ4A 3DUIA 2G9ZA 3LDBA 3MLLA 2OQ7A 1GR3A 3NRUA 4GWJA 3ZLIA 3RI9A 2VVEA 4LMFA 4XUOA 3Q8BA 4N53B 4XPVA 4XCAA 2D97A 4I02A 1KDKA 5FJKA 4M0HA 1W28A 1W6NB 4A6OA 2PA7A 3FHAA 5I0TA 3ZIXA 2P3IA 5I91A 1S2KA 4CEWA 1YQ8A 2A1XA 2JKXA 4FPOB 1LHOA 4E4SA 4FAHA 2XUMA 2QCSB 3TN92 1LHNA 2ORZA 4BB3A 1AYN1 3JD72 4YGEA 1RUD1 2EA7A 2E7TA 2VOVA 3CO2A 4BDVB 3ZFGA 2JE8A 3NV1A 1OUXA 1NKGA 3NNLA 4LJHA 5IVCA 4DMIA 4LBKA 1NLRA 3POBA 1P8JA 4QB6A 1HX6A 4QB2A 1RUD2 2D43A 4Z92B 3DXTA 2HH9A 2VH9A 3VBRB 2Q1FA 1VRH3 1K42A 4NAOA 2YUEA 4QM9A 1YHFA 3FX3A 1AXKA 2PELA 2RVAA 2WZEA 4L9BA 5FY4A 4UW4A 2KR2A 2XOMA 1J3PA 1VBB1 2A6ZA 1ZZBA 5IATA 4Q4Y1 1VALA 2AEZA 3P3NA 5FYIA 3VLBB 2HWD1 1S0BA 2VZQA 1O5LA 3D0JA 1COV1 2OX0A 1XNTA 3HVDA 2R072 1C5HA 2Q1MA 3PHMA 2WZR3 4W50A 4BXFA 1MS4A 4C0BA 1VBC1 4ITCA 4AI0A 2G9FA 3AK0A 1NLSA 2HWF2 1YFXA 3NO8A 3HD8B 4WM8B 3VZJA 4LR4A 4LIUA 5LZ6A 4CUAA 4CEYC 3NSTA 2HWF1 1CGPA 2BV4A 4I01A 4Y4YA 4LORA 5CNAA 5K0UC 4I09A 2VULA 3IDCB 2ZGNA 1OPMA 5HXVA 1KJRA 1FYUA 2OUHA 2DYCA 1AUYA 3CQOA 4K9SA 1PVXA 4FOVA 4I3GA 4YARA 4JTNA 1LGNA 3NMBA 1N47A 2A6XA 2QQJA 2VXRA 3GM8A 1O3RA 2FDHA 3MIFA 3T1MA 1LGBA 3POJA 5J09A 2VQAA 5C9AA 1VBE1 4L97A 1N3PA 3I54A 3I59A 3JUUA 3OJBA 4RL7A 5IAXA 4X6RB 2JIJA 2VPVA 1HRI1 2BERA 3OG2A 1QQP3 3POWA 4LTAA 3KV6A 4QU1A 2VW0A 4IV1A 4Z07A 1O91A 1RUE3 1YUDA 4GWIA 4JGZA 1RYYA 3CJIC 5EJ3A 1UZVA 2WA4A 2AR6A 2P2KA 2O1QA 3J7HA 1ZREA 4Q27A 2VVFA 1ENQA 1CESA 2C26A 3PJQA 1NZCA 1QJU1 5A33B 3I2GA 1FPN2 4RS5B 4JCKA 4AFDA 2WNEA 2WL1A 1OQEA 4HVOA 1SBDA 1VB2A 2WT2A 4YVWC 4B4QA 1NCQB 1GP5A 3FBYA 2A3YA 1UU6A 5A7QA 4C91A 4AI2A 1QQP2 1POV3 2QQOA 2RS33 5FZ3A 4RGGA 3N7MA 4YZ3A 5T5OA 4ZU5A 1DGLA 2WNVA 2WO2A 3H8RA 1W6OB 1D4M1 3ZOIA 1Q3EA 1J58A 1H9PA 4QM8A 5A7NA 3PL0A 3HAGA 1YYNA 1NE4A 4JGYC 4RHV3 1VIWB 1J3QA 4AEMA 4B7KA 1DLLA 2BDRA 2EXHA 1W8OA 2X09A 4QWNA 4LEJA 1F5FA 4O9GA 5JXHA 2B7YA 4GZ9A 4Q4X2 1PNFA 1PZ9A 5FPZA 3ZX7A 4XJ8A 1YI7A 3BALA 4HPKB 1WCUA 4UBHA 4Q1PA 4DQAA 2JKBA 1WCKA 3I2KA 4R9CA 4UBGA 5EP9A 1SLIA 1S0IA 3ZSLA 2JIGA 5BUVA 5ACA1 4YM2A 3RSJA 3TBDA 3DF0A 3E5XA 1RHI3 3JQXA 3NKTA 4PLNA 3VB9A 4BXSV 4EV0A 3PURA 1UQXA 1OVSA 2D6LX 3KZ4C 3MIGA 4JX0A 3USUA 5DQ0A 4CCMA 3O5SA 3PUIA 4OFGA 1QIQA 3AB0A 1WW6A 1JOJA 2HWC2 2AH2A 1F8VA 1LOFA 1WW4A 3WNLA 2GMPA 1S0EA 4YVWB 3QH6A 3KSCA 5H9QA 2W39A 2DVAA 5IVYA 3ZXLA 1DZRA 1BEV1 2C9KA 1V00A 4FCAA 4GA9A 4YFZA 3RG0A 1FMD1 1HB1A 1YNAA 1RVF2 3CJIA 1VBB3 2X29A 1D4VB 4QXBA 4XACA 4A7ZA 5JPMB 1W6PB 2IXJA 3WVJA 3T2TA 3MIBA 4XTMA 3VDAA 4AAXA 2EXIA 5FZ0A 5FUNA 1YCIA 3OBZA 5A32A 1H1IA 2ETEA 3JB8A 3MF9A 5JAXA 3HMYA 2A71A 5A7OA 2VOXA 4ASLA 1G9BA 3T08A 2GP5A 4O61A 3H8XA 1HB2A 1PGSA 4JZRA 4DZGA 1T2XA 4WVMA 2DFCA 4AEKA 2DUPA 4HFSA 4E8DA 5J1XA 3THPA 2FZ2A 3H42B 5C33A 3VV1A 3C8XA 2VY0A 1ZBA1 3NAPA 5FMOL 1QJY3 3I2HA 4NRQA 3UGHA 1W0OA 4UFIA 1R093 2VZRA 2W68A 2ZBJA 4BM8A 2J1EA 3KT7A 1LNSA 2W08A 5FPLA 5GLVA 4Q2FA 5FY9A 5C5UA 2QQIA 4LE4A 1G7YA 1CONA 2ZOEB 1L7RA 1S0CA 1BVP1 2IVIB 2DWRA 3K3NA 2B39A 4YWAA 2E6VA 3HNYM 3U10A 4BLIA 4AGGA 3RMYA 5FPAA 4XJZA 5FWJA 5KR7A 4WM8C 5A7PA 4ZZ5A 3O14A 4I2OA 1D4M3 1OVPA 2RMU1 4M01A 4W65A 2G1MA 3VD5A 2QQUA 2GNTA 4FQ4A 1AXZA 3SH5A 1K5MA 5FXWA 2HWD2 1PGL2 2VXJA 4Q4Y2 1QJU3 2RMU2 1DZQA 2E9QA 3I59B 1GBGA 1PX3A 3JD73 4MGSA 4QU2A 1F5JA 3ACFA 4QD2A 4QGNA 4U36A 4OI0A 5IVEA 1GU3A 4PJYA 4QKNA 4XMAA 1PZ7A 5L9BA 1WD4A 3VBRC 3WUDA 3WNNA 2Y34A 3GBGA 1V6KA 4QXKA 3AX4A 3N9NA 5FZGA 3RRDA 1XYOA 4IE5A 5KHHA 3ZN6A 2W1WA 4P5HA 5FZOB 4FOYA 2HWE2 3X29B 1Y3TA 2R7EB 3BPSA 4HONA 4J6GA 1W3VA 3TN91 3GYDA 3VGIA 5CFCA 1JZ2A 2BFUL 2JXAA 2JB8A 2QQNA 1V9U3 3S6PA 3MHZA 1IGOA 1JU3A 2D93A 3A0KA 2DCKA 5CZKA 1VBC3 2GN3A 3ILFA 1R1ZA 3ZN4A 5IVJA 3I49A 4DOUA 1XYPA 1QJX3 2XJSA 1MZEA 2LALA 1ZRFA 1OH4A 2WRAA 1CAXA 4S2HA 4BPZA 4HN1A 2X5IC 4IUGA 4Z2AA 4A42A 3VBSB 1ZYBA 2XUEA 4H7MA 3QCWA 5AC93 4V2WA 3FMGA 4CE8A 2E7AA 3C7HA 3NAPC 3ETPA 3FC0A 1PZ8A 5C7GA 1CX4A 2CAUA 4YYOA 4KBZA 2XVGA 4OHWA 3VBUB 3VL8A 5DMYA 4RS5C 3ZXGA 2EIEA 1YC61 2RR12 4QX8A 4BZ4A 1UX6A 4G4FA 4NE9A 2E7QA 2P3KA 3A21A 1BYHA 1TME1 3MUZ1 1TEIA 5FAXA 1AL22 1RIRA 1C5IA 2PMWB 3U4SA 1LHVA 1QWRA 4RQPA 2JDMA 2RM23 3PTRB 4A45A 2QZ3A 3O1MA 2J1VA 3MPPG 1YQ2A 1FPN3 5DUVA 3I3BA 2DURA 2CU5A 5FYYA 2F4PA 4PT6A 2WS92 2IXLA 2W92A 2QQMA 2UURA 4I0BA 5EHDA 3H8UA 5C4WA 3KQRA 5A3PA 3ILNA 3NL1A 1C1FA 3MIEA 4XXPA 3ZXAC 4IXLA 3OGRA 4QB1A 2WA3A 1UPSA 4LOTA 1WCQA 5FZ4A 1QJZA 1C57A 3KWVA 4Y26A 5F3GA 1ND2B 2D3SA 4Y3OA 3WNOA 4KL1A 5FOJB 1YEWA 4BQ1A 3POSA 2VJXA 2W52A 4CPBA 4OQ9A 5B4NA 5F37A 3W9AA 1CIYA 1VLNA 2ATFA 4DUXA 4CDQB 3ZYGA 3FE5A 5BXXA 1KS5A 1DYKA 3UYJA 2OQ6A 3W59A 4CU8A 1CAVB 2VBPA 4H7LA 3GF6A 3BYWA 5FO9B 2XKOA 4XUNA 2ID4A 1W6QA 2XL7A 3NNFA 1ZVFA 2MHFA 4K8FA 4E8CA 5KHJA 2BW8A 3WHTA 1HRV3 4PI0A 1N1SA 4RR3C 5FQ0A 1FOD1 2R041 1SACA 3AJZA 3DKWA 3WP3A 1RC6A 1N3QA 5F2SA 3BOPA 1QJY2 2VUDA 4IEZA 1PMJX 2HWE1 2ARXA 1WGPA 1ZZ8A 1ZRIA 2JG9A 4LOSA 4MXVA 4B8EA 4HG6B 4MG2A 1RUG2 1ZBE1 1DGWA 2RHPA 2R1DA 4LXLA 3SISA 3CLPA 1CX1A 2LS6A 4MXWB 2D3RA 4XJUA 3RS6A 1QMJA 1EYBA 4MX3A 2QKDA 1U12A 2A75A 2Q8CA 4FT8A 5JOZA 2ZX1A 3AKPA 5C9AB 4H14A 4Z2WA 1WLTA 3HBZA 2BNOA 1WLWA 3LCPA 2A70A 4HZFA 4A4AA 4RGKA 4JGYA 1UAIA 1YIFA 3KB5A 2NZ9A 5DUUA 1BK0A 1UF2C 3VKFC 1LRHA 2FHRA 4OHXA 2Q4SA 2PAKA 1NY71 3ZVXA 2NN8A 4GWNA 2WSVA 3VD4A 2O14A 3ZN5A 4XDOA 5LEKA 1GZWA 3DPRB 2C1FA 2WS93 3J7MA 5FTTC 4LITA 1J1LA 1QJU2 4QHBA 4UT5A 5FY7A 4LKSA 3TRSB 5C5TA 2XHKA 3WG3A 1BKZA 1PGL1 2XBO3 3WW3A 2IXCA 4UXAA 4GULA 4LKFA 5F5AA 3IWZA 4YLZA 2LROA 2X10A 3VHOA 3WOGA 4K20A 2JG8A 3N9QA 3NVCA 3I3EA 1OKOA 3MUY1 2AGSA 4S2DA 5L9VA 3LDRA 5ABJA 1AR81 2WDBA 2Z5WA 1EP0A 2UYBA 4M3CE 4QDRA 3LGRA 4N43C 5FY5A 4OCTA 2NLRA 3T0DA 1UD1A 4FSJA 3KHBA 1H8TA 2RS32 2WZ8A 4D3WA 2ILMA 4F7ZA 4AEDA 4C1WA 1RMU1 2OVUA 3S7IA 4CSWA 5AC92 3ZSJA 1OQ1A 1QJX1 4HVRA 2ZX3A 4JQRA 4IEQA 2GC3A 4ATFA 4YG3A 1WCDJ 4BQWA 2YC4A 1SLBA 2VZ1A 4N9HA 4OUSA 4LLFA 4HVQA 5CG9A 3KS7A 4L92A 1H4HA 2Z4FA 5K8SA 3NWKA 3I2OA 3FFZA 3USSA 4UFKA 1PO13 1HJFA 1RB8G 3SITA 3TEYA 5EZWA 2FD8A 2VMEA 3RZHA 3LPFA 1COV2 3LEIA 3UV9A 1JU4A 2D6MA 1OA4A 3ALQA 5GZDA 5FK8A 5IHRA 5LA1A 3RDIA 3ZFFB 1OURA 3ZSKA 4YNIA 1NUKA 3GJBA 2VMFA 2PQQA 5FZLA 3LSDA 5DDJ2 2VQTA 1X50A 3RNSA 2JDHA 4Y20A 4IEXA 4FPKA 5GLUA 1OHFA 3VBFC 5KXBA 1VBE3 1RUG1 4HT1T 2Q0AA 2ARCA 1DQ6A 3H7JA 4CDUC 1O8PA 3ZKYA 3M3CA 3QOPA 2SBAA 2ARAA 4IE7A 4DINB 2B45X 1COV3 4YGDA 3FWEA 4RFT0 2PAMA 1RVF1 2MPFA 3MLJA 5FZ8A 3L9JT 4X8NA 3RZKA 1XRUA 3PMEA 1RUF1 4LHKA 5A32B 1RMU3 3RZLA 4EN6B 5A6ZA 1F4AA 4YSFA 4EWAA 5A6QA 4YW3A 3ZIWA 1ULEA 1D4M2 4A3XA 3OB8A 2A73B 3BI3A 1RUH2 3A23A 1YQ6A 1VMHA 3CDZB 1BVVA 3ZPOA 1OF4A 3JBG3 1RUG3 3DYPA 4BIFA 5BNNB 1LOAA 1MZFA 2GC1A 2Y64A 3DECA 3ASIA 2WWJA 1IQAA 2EVXA 3NKGA 1JH5A 1UMIA 5C8CC 2QBXA 1ND3A 2RS13 3DYOA 3E5UA 4QGMA 5FP9A 4BK5A 1Q8VA 2JDZA 1C28A 4QPGB 2ORXA 3T2QA 4YZ1A 2E31A 4QPGA 5JXIA 2GN7A 3T30A 4P00B 3AVRA 3FN9A 1HRI3 4HETA 2J1RA 4Y22B 1RUH3 3IB3A 2MNGA 4YVSA 4B3NA 1VAVA 4IGPA 1R1A2 4TSVA 4ISRA 1FI2A 3POGA 4Q4X3 5FYSA 5LASA 5CG8A 1ZRCA 5C3QA 4UW6A 2VL4A 5J7MA 1SBFA 3T0AA 5FZEA 1QXRA 1PVC1 4XYXA 2IWGB 5EYYA 3UGFA 1UOBA 2D6PA 2GZWA 1SBEA 1OBNA 2QQVA 2R042 4AHYA 3APBA 4DXZA 4A41A 5KXEA 3RWKX 5JZGA 5C3RA 4V1PA 2AUYA 4D69A 1G86A 4W6YA 4GD4A 3KD4A 3IDEA 3SLIA 1PNGA 2VOTA 1MVQA 5JXJA 2WO7A 4PQQA 5I8YA 3C7EA 4XJ9A 3OCPA 4ES9A 1VE0A 4JV4A 3ACGA 4CVUA 3NAPB 5A3TA 4PIXA 5CADA 3BCWA 1NCQA 4YG0A 1GNHA 1UYZA 1CPNA 1YFWA 4UYBA 1TNFA 1D2QA 4JDMA 2WNVC 4UFMA 3VBSC 1IQDC 4AGVA 4DRVA 2R043 1PIV3 5IW0A 3ZKUA 1FT9A 2C6SA 1HRI2 1Y9GA 1GFF2 4XBNA 5F5CA 4FPCA 4CUBA 1PK6C 3WX5A 5CVRA 1W8HA 2RM22 1US3A 4KG0A 4NN0A 5C3OA 4LA3A 4BQYA 1YFYA 5I8SA 3LKJA 3N9PA 5GALA 2XVLA 1DQ4A 1ZRDA 1MS5A 1JN2P 2HYKA 5KXCA 2W94A 1TMF1 4Y1ZA 1XOYA 1FPN1 3H3LA 2JDYA 4NRMA 1GWMA 3IDBB 3CEWA 4YM1A 4CUCA 3H1WA 5C8CA 1W90A 1ENRA 2GDFA 1CJDA 1RUF3 2OIIA 3M3OA 3ON7A 5FUIA 4LQRA 2GALA 1W8TA 2WC2A 4IEPA 1U5ZA 2YHJA 5LRRA 3T2OA 3MW2A 1NCRC 4D7YA 4ASKA 4NIAA 5FMOS 1FV3A 3ZN6B 4Y33A 2VMCA 2VCBA 4XW3A 3BU0A 2RG4A 1XE8A 3ZYIB 2JDPA 2DF7A 3SCHA 2VOWA 3FUQA 2ZTNA 2DCYA 3MIDA 4TTGA 5T55A 2VZSA 1JODA 4CCLA 1DBNA 3ZR5A 4GJYA 3I2FA 4XTPA 1OLMA 1DGWX 2YYOA 1A3KA 1RMU2 1IKQA 4LUKA 4DXRA 3U75A 3CBNA 5EV7A 4YW4A 2D40A 2F6BA 5JZGC 4LO4B 1YJKA 5FUPA 3ZYBA 4NR1A 3PTYA 2TNFA 3ZFGB 1TQ5A 1SDWA 5FZKA 4CDXA 4LULA 3BODA 1NXMA 1OKQA 3FZ3A 4COWA 4EN0A 3U4XA 4QX0A 2JD4A 3ZXDA 1QNYA 5DDJ3 5FIXA 3LIHA 5FMBA 1J59A 1QGLA 4QQOA 3WDVA 2EAKA 1UNBA 2QDRA 3JXSA 4JDOA 5K9YA 3ES1A 2VR4A 4U2AA 3WSOA 3HQRA 3FHQA 4UW5A 3T1LA 2KXLA 1X7NA 3MYXA 5FO8B 3I2JA 1DQ0A 1JYCA 2RDQA 3LEMA 4ZU4A 2BFUS 5B4XA 5L19A 2ZEWA 3WW4A 5BPXA 5FREA 4MXWA 1Y9MA 1XNBA 2VUAA 1V6JA 2RJ2A 2Y26A 5D8AC 4QPIC 3TWIA 1F31A 4XDQA 1TE1B 4E2GA 1EUUA 3IMMA 5CB7A 2AACA 3M3QA 5CEHA 2A7AA 2WYFA 1VBD3 4LE3A 3AP4A 2JD9A 2W0XA 2NQYA 4L2NA 3DGTA 4Q0UA 3AKTA 2MEV3 2VECA 4IEUA 5BYNA 1W8NA 4XFGA 3LE0A 4MGKE 2ZACA 1HJGA 4JGZB 4WZCA 4OQ8A 2J42A 2QQWA 2VC9A 3R4UA 4E27A 3J26N 1JYWA 2R0HA 3D0SA 1BBT1 1T6BX 1E57A 1VRH1 3MI8A 4FP2A 3OGSA 1JOPA 2D3PA 4GH4A 4OZXA 4XF9A 3DEMA 5FPBA 3MICA 1F9KA 4RA0A 4CEYA 2ZHKA 1SCRA 4MGQA 2V73A 4DY5A 3JCIA 4GXLA 3SH3A 3UK9A 4CYDA 1NA1C 5L73A 1DQ2A 1ZBA2 3RPQA 5GZCA 5I0DA 2H6BA 3AC0A 3H50A 4MUVA 1AR61 5E88A 5CFCC 5IVBA 1ZZ9A 5LBBA 3TEWA 1KXGA 3B01A 2TUNA 3WQBA 3OBRA 3FLRA 1JYIA 3ZSMA 2WFF2 1N1YA 4B4RA 2EALA 2A6WA 5GJ6A 4MV2A 3DKQA 3EJKA 4C1XA 1QH6A 3MEPA 1S0JA 2VW2A 1SFNA 3KVAA 4AOCA 2VCMA 3K3OA 3OPZA 1C8M1 5I0RA 1DQ5A 2QTWB 3IIAA 1UL9A 5JWPA 3POYA 4PF1A 1CIWA 4Y5SA 5I8TA 5GZGA 1MR5A 2QZ2A 2ZHNA 1DF0A 4HANA 3BIEA 2P5BA 2YPDA 4J1XA 2CY6A 2ZHMA 3V56A 5KBFA 5JVVA 1AYM1 4B4PA 1W0NA 2G4IA 3KV9A 2ZGUA 1OD3A 2VW1A 4Q5OA 1MQTB 2C5DA 4XFCA 1LOEA 4OI2A 1MQTA 1YXWA 4Q1RA 1ZNPA 3PVEA 3GZEA 3M1HA 4AQ6A 2NYYA 1LEDA 4WBBA 4CPBD 2DVFA 1OFSA 1URXA 1AR91 3JBG1 4P9YA 4N53A 3VKMA 4XF3A 4XXAA 3TOJA 4RQPC 3WF2A 3D8CA 3ZO0B 3ETQA 3PJYA 4DUWA 2DUQA 2JICA 1LECA 1GQHA 5KC5A 1I1EA 1TZOA 3OUJA 2VOKA 4DY3A 1NZIA 1KS4A 3VBOC 5FDBA 2PTMA 2BP6A 4FFFA 3AMNA 2EIBA 4XQWA 2CV6A 5FMCA 3DL3A 5I0SA 1W9FA 1APNA 1UMZA 5DZEA 5IWFA 4DIQA 2GC0A 5T54A 2RS51 5A6YA 1IPJA 2QQKA 2BVBA 4AVBA 1FV2A 5FP4A 3W5MA 1NY72 5FYBA 4QQLA 4GH4C 3VDDB 5DDJ1 1UY1A 3WP4A 5L7OC 1RITA 4Q8LA 1OOPC 1MS9A 4P5YA 4P9XA 3GBFA 5JLVA 4YW2A 2W1QA 3IKWA 3IN9A 4BH9A 3SKVA 1CR7A 3HEIA 5FJHA 3ZFEA 4XF0A 5F9TA 5FLJA 2WT1A 3RGBA 4QQHA 3RQ0A 3MFCA 1RHI2 1DYPA 5JPNB 1W2TA 2J7MA 5FP7A 1JYTA 3ZYRA 3RWNA 3ZDVA 2RS53 5FYCA 5A3UA 2LRPA 1NQJA 2I74A 4A6SA 2VNRA 5T5LA 3H3UA 4AYUA 2JX9A 3E97A 4NIGA 3OY8B 2VUJA 3I8TA 3M4FA 2JG8B 3HT2A 2TBVA 3WDTA 1UKRA 1LOFC 3G6JB 2HEVF 3HN1A 1MVEA 4CXYA 1U0AA 2G9GA 2ZGOA 2HEYF 3BPZA 4LBLA 4YGCA 1W6QB 2YFZA 3I3QA 4QX5A 3FL7A 4LBQD 4WM7B 1DYOA 1GNZA 4D7TA 3Q8CA 4YW6A 4QKDA 5APAA 2AC1A 4Y1VA 5IK4A 1EPWA 1AVBA 3LOBA 2WBKA 1X36A 2O0OA 1NAEA 2PAEA 1VBA1 4XBQA 5LY2A 4K7JA 2FDGA 1MACA 3S0MA 3AYCA 4V2VA 2Y6JA 3NJVA 1EAH1 4GB33 4L8QA 4RGAA 4XEZA 4XUTA 3I3MA 4XAEA 1W2AX 4AF9A 5IFTA 1O3SA 1HIXA 3VBUA 2A6VA 1S0GA 2WINB 5GLTA 2BBAA 1ONAA 1SZBA 2D7FA 3KV4A 3PIJA 5F5QA 3O0WA 2FMDA 4W6WA 4N53C 5JSPA 2W9XA 2P34A 3KGZA 1JHJA 3ZYFA 3FUOA 2XJQA 2BGOA 4Y4RA 3U37A 5CISA 2ZHLA 3WP5A 3AFGA 5EYXA 1QDOA 3TN93 4NMIA 2NMNA 5BV6A 3ZM8A 2R063 4DRRA 5F6LB 4M0NA 5IAVA 4NIHA 4QT6A 2WFPA 3IPVA 1QJEA 3PDQA 3KMHA 1UKGA 2XPJA 2FMYA 3P5BA 1QU0A 2BNNA 4BLJA 4LHLA 4IETA 4ONUA 3N3HA 3AZWA 4S2GA 1IKPA 1JTZX 3O1UA 3T0BA 4I0WB 4XMIA 3N4MA 2Q8EA 5CBLA 1RUF2 5A3WA 4XBLA 1RUNA 2JB4A 4YVWA 1VMJA 5FP3A 4FQZA 3WLUA 1RL3A 5G05L 2X05A 2WNUA 1VBA3 1W06A 1HB3A 2ZKNA 1DFQA 1GUIA 4HBNA 4OVEA 2RR11 3VD9A 1JXNA 1GOHA 1JS9A 3MGUA 5ABJC 2AENA 4HXCA 2QDNA 4KWJA 1LESA 2GH8A 4LO7A 3WDYA 4BQXA 1G9CA 4OUEA 2WN3A 3I97A 1VBD2 1CAVA 3PIGA 3AYAA 1AR73 5JMOA 3MBWA 3V65A 5A7WB 4KWLA 1VMFA 1L3JA 2ADDA 4CCEA 3ZXEA 4XHXA 1YQ5A 2XHNA 2HWB2 2VTFA 3ECQA 3O0VA 3K77A 3THTA 1ND3B 3T3YA 5HCAA 5EXOA 2P6CA 4NIIA 2ZPXA 4KWKA 2D5FA 3GHMA 1B09A 1LENA 3DXUA 1EY2A 5IVFA 3O1RA 5D1IA 2PHWA 4RHV1 1IG0A 3VDBA 5BNNA 5T50A 2GP3A 4CXXA 1VPHA 4XVHA 4BYYA 1OLRA 2VZUA 3IDAA 4O9EA 4FPLA 1QOTA 2A6YA 2VO5A 4Q4W3 3RYKA 1YWKA 4MHRA 3QBQA 1LOBA 4COVA 5HXMA 2WR9A 5K7PA 1MS3A 5F2WA 4W6XA 2XQXA 4TZDA 1AR63 1HN1A 2YBSA 2W3JA 4ZXKA 3BUCA 1VBD1 4QMAA 1OA2A 1U5XA 4Y24A 5F39A 1WW7A 2WAOA 5FYVA 5F7UA 4AI3A 4AHZA 5CFDC 1KRIA 1H9WA 1K5MB 1HLCA 5DAQA 5D8AA 3K46A 4O7XA 4MYEA 4KG8A 1UN1A 1BXHA 4NHYA 2Z2SB 3N35A 2ES3A 4IV1C 5FMDA 2PHTA 3NNJA 2YBKA 1A6CA 4YGBA 4TLGA 5SV8A 1W8WA 1NOVA 1A8DA 3VDCA 2TEPA 4TLFA 2XLGA 2R061 3AFKA 4Q26A 4UWDA 4Y5TA 1JZ8A 4G3YC 4ARXA 3HJRA 2V5YA 5BNPC 4LK7A 1GWKA 2VBDA 4XAAA 4A2UA 4UOJA 5A70A 2DVBA 4AW7A 1G9DA 3IIIA 2P3JA 4K40A 2BYVE 3EYPA 3SXWA 4GB32 4XFIA 2ZGTA 1XXNA 1DHKB 1MEC1 1RGSA 3IT8A 2F4LA 1D2SA 4DXTA 1F15A 2VVDA 2OPKA 3KT1A 4URTA 3V0BB 1I6XA 2NP0A 2W87A 5FOBB 1QH7A 4DEQA 4BOWA 1HDKA 1OXCA 3ELNA 1AR72 1B35C 5JOYA 3A0NA 4I0AA 5HCFA 3WG1A 3OEAA 4GWMA 3EMRA 1PO21 1YJLA 1NYWA 1WBFA 2Q30A 2RDSA 3BGAA 4BJ0A 2ZMLA 3WHUA 2VE1A 1UOGA 4ES8A 4IEOA 1A78A 3K2OA 4NWWA 5CA6A 5F3IA 2JENA 3AKQA 5DAVA 4FPFA 2VNOA 3N9MA 4RR3A 1VRBA 2QVSB 3ST7A 3GZUC 1O59A 4WM7C 1UZ0A 1H30A 1HXS1 1MEC2 3WDXA 1GWLA 4CCCA 3ME2A 3VD3A 1VRH2 3DCQA 1O5UA 3A4UA 3ABZA 4PCRA 4NWVA 4AVTA 4YFWA 3SHRA 3HNBM 3KGLA 4QX1A 1AL23 4COUA 4KNCA 1OT5A 2H0VA 4CP9B 1PMIA 3ILRA 5IYYA 5CAZA 1SG3A 1V6LA 1H2NA 1WD3A 2EXKA 1UXXX 2W95A 3C2UA 3SH4A 4BCUA 3OTFA 4FTBA 4HK8A 1LU2A 2QQPA 1ND2A 2BWAA 2ZS6B 2B46X 3H7YA 4Y1YA 5I0UA 3VBSA 3WV6A 3O1VA 2XJTA 3OGVA 4URAA 2XH6A 3BVCA 1OOPB 2YFUA 2K9ZA 1EPZA 5FZIA 2OXBA 3TAYA 5FYZA 3WNPA 1EV12 2P17A 5J98B 2E63A 4IESA 4M4RA 2JDNA 2F17A 4JRAA 2DVDA 4WVMB 2FZ1A 4XQ4A 3KCYA 2VU9A 3GHNA 5GZFA 4LK6A 4CDXB 1GANA 1Q8SA 1KD7A 3CZUA 5BY5A 3ATGA 3LA2A 2I07B 4XUQA 1PIV2 5FY0A 1N1VA 2PYTA 5FBJA 4K8RB 1W05A 4LBJA 5FCCA 3B9IA 3AM2A 2DUOA 1AX1A 4Y5Z0 1OSGA 3CL1A 2EXJA 4RQPB 4F3JA 1W6OA 1H2LA 2VZPA 3MPBA 4INDA 3WG2A 4A44A 4EYUA 1MZ5A 1UU5A 4XFAA 3ZFEC 1SFYA 1EV13 1PHMA 2DCZA 3A7QA 2E26A 4NHLA 3WF3A 2YPJA 2ZXQA 3JQWA 4CU9A 1CZVA 3Q8AA 5IT6A 3D3AA 1R1A1 2HLEA 2VMIA 3LFMA 4JDNA 3LQCA 4BQ5A 4LBMA 2BTVC 2JDAA 3RZGA 1BMV1 1JUHA 1US2A 3ZMNA 4HSLA 1GOFA 3RVHA 5LEJA 3GGLA 2V72A 3H1MA 4GALA 2VTXA 3RFRA 5FKBA 3LZZA 3EXUA 1K3IA 4NHKA 4NAMA 4GKXA 4R8HA 1ZX5A 3F2ZA 4AEDC 2R30A 2Y6KA 1JI6A 1WLCA 2RJKA 4EJRA 3O0XA 1BEV2 2K0GA 3K51A 1E5RA 1ZZ7A 5FP8A 5FZHA 2OS2A 4AVCA 4NROA 1HQLA 1VBA2 3KCXA 3AP7A 3P1IA 1NG0A 2A3WA 5H9PA 4AG4A 5F3CA 2FDKA 4OHZA 3DV8A 5FYMA 3VZOA 2ENRA 2XKPA 4AAPA 1XQNA 2BGPA 2C4XA 1S2EA 2FQPA 3MIHA 3MZHA 2XLAA 1AR62 1XPWA 2VCCA 4NPLA 5FRAA 2NM1A 2WIIB 2YY1A 5GLWA 1W6NA 1Z7S3 3NJXA 2YG0A 1ZBA3 3LB9A 2BOJA 3H8OA 3S7EA 4PDWC 1ZZCA 4YVSC 4IE0A 1NXD1 4FPEA 4L11A 1NA1B 1TMF3 5JR7B 1REDA 5A3NA 3R4SA 4JAAA 4CTEA 2Z69A 1ULGA 3KQ4B 4QPYA 3WP6A 1LOGA 1DLCA 1AX2A 2BU9A 2R0FA 3FHIB 4Q0PA 4Q4V2 4JHZA 3NJYA 4UW3A 1V6IA 4AI1A 2PHXA 3MLKA 5DXDA 1OF3A 1QF3A 2DBNA 3BTXA 3OEBA 3SCGA 5DZFA 1CPMA 3FLPA 4K1YA 3D82A 2DU1A 2UYAA 1DGRN 4P9IA 3CU7A 1LHUA 5E6HA 4JGZC 3OUHA 3RZZA 1UY0A 1W03A 1AR83 1NX9A 4CDWA 1RUOA 4XFHA 2D44A 5I93A 2QQLA 3GNEA 3C7FA 3QACA 4NPMA 5D21A 5K4LA 4BIOA 5J36A 5IK5A 2RV9A 2WZR1 3PUHA 3E1F1 2W2IA 5FPVA 1PGW2 1RUE1 4FP3A 4PI2A 4ZS2A 3E6DA 1EAH2 4XZPA 5GM0A 4EE2A 3KF3A 4I3PA 1E5SA 5F3EA 3HPNA 1UY4A 5D8AB 2PLV3 3J7NA 2VCAA 5LK7B 3BB6A 2XBO2 4YM0A 1HKDA 5ISLA 4GQ7A 4XCBA 3USUB 3WF0A 3ZXFA 1W9YA 1ZA4A 5HBAA 3P6BA 1NE6A 1PIV1 3ZFFA 1SLAA 1QOOA 3GZAA 2DCTA 4YVSB 4LBNA 3WY6A 5JI9A 1SPPA 4R4XA 1GV9A 1QDCA 1I9RA 2RS52 3PLQA 4PIYA 3BTYA 4K1ZA 1AZDA 5FXZA 4ZZ8A 1X33A 4ORFA 1MZ6A 4XETA 5F5IA 2ARBA 2ZGKA 5G04L 4AEJA 1QXPA 5EPAA 4FPGA 3C7GA 4TN7A 1GYKA 2OPWA 1ZZ6A 3U07A 1UOJA 1Z78A 2OW4A 3CZJA 4OULA 3U14A 4IV3B 1CWPA 2H0BA 4QXCA 4MHUA 5JZGB 3TB0A 5A80A 4X6QB 4LIVA 2YBPA 1SLLA 1REFA 2ZGSA 2R1BA 1GQGA 4KGGA 4UF0A 4AEDB 5J48A 4PDWA 3POIA 1UXZA 1J83A 1VB4A 1O8SA 5BNOC 1X8EA 3LA7A 3HQXA 4EQVA 4F8AA 5FPXA 4EZHA 3S30A 4OYUA 5DABA 4XQDA 2HWC1 1H8TC 5FZ7A 1LAJA 4NHXA 2CGNA 4Q4W2 1XSRA 2UWCA 1E5HA 3KLSA 2QNKA 2XVKA 4XURA 1W39A 2Q8OA 1HRV2 3RI8A 2V4VA 5ERLA 1BK1A 1FNZA 2IC1A 3LIGA 4IGOA 3WD5A 3NJZA 1M4WA 2WABA 5GKAC 4ZONA 2BNMA 2WQ8A 3JBG2 1H4GA 2E32A 1IPKA 1Q43A 3B00A 4FXGB 4QGLA 3VN4A 3ZXJA 1UWWA 1NLQA 3K4ZA 2K46A 5FXXA 3D4KA 4MGTA 2XB6C 1LGCA 1VP6A 4FI9A 5HV0A 3NNMA 1PGW1 4CDXC 4QX2A 4BQ3A 1C3HA 3C7OA 4N8MA 1RUI1 1CD3G 3WDWA 3TNQA 1S2BA 4F83A 1VR3A 2WS91 4JHTA 1LR5A 2LTNA 5FR3A 1HV1A 3OF1A 1ZBE3 3KVBA 3E6BA 4XOGA 1PK6B 2X53S 3CKHA 5HPOA 3O1TA 2C0ZA 1Z7S2 1H8VA 1PO12 4LBQA 4LPLA 5A3OA 1XU2A 3J7LA 4LLOA 4QPWA 1MEC3 1ULPA 1Y7BA 5T5JA 2ZGMA 1NCRA 2VQ0A 4JQTA 1HRV1 3GALA 1ST8A 3ROUA 2VZ3A 5LY1A 3H3ZA 4RS5A 1PO22 3M70A 1UYXA 1AYM2 1RHI1 1F2NA 2A3XA 3AMPA 2UY9A 5FFOC 2QJVA 3VBHA 5C6CA 2XL9A 2PN5A 1BEV3 4GMP3 4Y20B 3AP9A 3IPVB 4EN8B 5ACA2 5JR2A 1SDDB 1LODA 4WVZA 3J8F2 1CJPA 5H9SA 3UJOA 1QY4A 5FPUA 1C8M2 2UU8A 2SLIA 3HBKA 4WM7A 3JU9A 1POV0 1DG6A 2QUOA 1LULA 3GCWA 3OGGA 3RYPA 1JYXA 5DAXA 1JBCA 3ZYJB 2ADEA 4BU2A 5C4WC 4FOWA 2BWCA 4N90A 4NPRA 4CZSA 1DP0A 1W99A 4IDZA 3N7KA 3T2PA 3HIFA 3LWCA 5FZFA 3WF4A 4N43A 3HWJA 4PDWB 2Y6FA 4EN9B 3CF6E 5CKNA 2GSYA 1WBLA 2JJ6A 3WNMA 4NIDA 1WKYA 5JI7A 1AR71 1C8NA 1YIPA 1D0GA 1S4CA 4JTOA 5E1RA 4AXOA 2ZKLA 2WZPP 3I4IA 1AL21 4YW1A 1X82A 1WUVA 3TNPB 5EQUA 5E8AA 3WZ1A 5HI0A 1QEXA 3UJQA 2B4KA 1BZWA 5C8CB 2CL2A 1YQCA 3IAQA 1I5ZA 5JXGA 5KC6A 2HWC3 4FTEA 1S0FA 4R9AA 3RJRA 1SQ4A 5E16A 1JZ6A 1RUH1 5JIAA 5T52A 1VBE2 1BHGA 5JSOA 5KWRA 1QJFA 3M8LA 1SMVA 2DU0A 1JZ4A 4QAWA 4RYDA 3VBHB 2DCJA 2VM9A 4FVVA 1AF9A 2YC0A 4AFAA 2ZGQA 2JWPA 2BPA2 2DVGA 1POV1 2RS31 5FLHA 3V64A 3AL6A 4CCJA 2FDIA 4Y1XA 1ASJ3 1UO9A 5SV5A 1Q5OA 2XQRA 3S5QA 3B94A 3I2DA 3U1XA 3M2MA 5DAWA 3ZFEB 4CDUA 2OZ6A 2WNUC 3IM0A 1IPSA 5LA9A 4FPHA 2Z42A 4K6BA 5CFDB 1YRZA 1LHWA 4YZ2A 1SLTA 2N7GA 4CA9A 3HN3A 3VBFB 2RDRA 1GZTA 2ZMNA 3EB7A 1Q8PA 5T3NA 4BQ2A 4D6QA 3KCCA 1WCSA 1GZWB 3DPRA 3WXPA 4YZ5A 5IJRA 4HKOA 2YU1A 3VBOA 1G8WA 3UKNA 4MO3M 1CZTA 1LJ7A 3WQ7A 2ZGLA 4FO9A 1ASJ1 3D6EA 3WW1A 3LOIA 2VNGA 3U0ZA 1XNCA 1Z0HA 5LBFA 4J1WA 1VBC2 5FKCA 1GZ9A 1CVNA 4AHWA 4X8PA 4M00A 2CAVA 3ES4A 2C24A 4AFMA 5AVAA 1CAWB 5IK8A 4CRQA 1O4TA 1ND3C 4QX7A 2FCVA 4Z8BA 1XNAA 1V70A 4Y22A 2ZA9A 2XDVA 3J8F1 1GZCA 2Y60A 3DN7A 2BBVA 1KDMA 4P02B 4SLIA 2HYXA 2WO3A 3W5NA 2YROA 5FZ9A 1RUD3 2WFF3 4QKBA 1BMV2 3OYWB 1IS3A 4AE2A 1ACCA 1AXYA 2G19A 5FYUA 3WR0A 2Y33A 5FZ6A 2HEWF 3A22A 3WT3A 1PMHX 3CNAA 4R4ZA 3WCRA 1IS6A 4AQ2A 5A1FA 4IE6A 4TWTA 1AR93 2KA3A 4PBPA 2DTWA 1XU1A 2IFWA 4L99A 1FOD2 1OI6A 4IL7A 4E4ZA 4DS0A 1V9U2 4GMP0 2FCTA 3MW4A 5A33A 4AVSA 3V0AB 2XJRA 4BMEA 1XE7A 3VKOA 4EWDA 4DO0A 4PF5A 3NNGA 5FBZA 1LB2A 2FDFA 1LCLA 1BCXA 1SPPB 1RUI2 2C9AA 2XGXA 4PLOA 4CEWB 1GQPA 4LUMA 4KU8A 5FZCA 3VHNA 3E6CC 3V0BA 4QQPA 3SKJE 2CWSA 4FPJA 2GU9A 1KEXA 3JZVA 2MEV2 4AK3A 2B9VA 3MV01 4G9SB 4B1LA 1UOFA 2ZJCA 3BOWA 1JOBA 1RUC3 1W2NA 2BVVA 3ENRA 1WZXA 2I45A 4TYSA 5FLIA 1X8MA 1SFPA 2MEV1 3BTZA 3EQEA 1RXGA 1Y4WA 2R6QA 1DDLA 2LW8A 3S5AA 4CEWC 2GAUA 2J1TA 4LO6B 1UZWA 2UY8A 2VMGA 5C9AC 4Q4V1 4Y1UA 1H2MA 2YDEA 3TEXA 2V4AA 1LEMA 1D0HA 1ALYA 4RN5A 4Q4W1 4Z82A 1ULDA 4C0HA 2V09A 4XUPA 5BNPB 5AVPA 2L9LA 2ZX2A 5TSWA 1CAUA 4BWOA 4JRLA 2VBBA 4BA6A 1JZ3A 1FOD3 4IV1B 4XE9A 4AI8A 1L7LA 4LA2A 3AZYA 4MADA 3WUCA 4A7YA 1K5MC 1FXZA 4M3CB 5T5PA 2XMLA 3CHXA 5KXDA 4OMCA 1DQ1A 4RR3B 4XF1A 3W21A 4D8MA 2YV8A 3LFIA 2JG8C 1T6GC 1ASJ2 3FBMA 4R9BA 4FPYA 1PO23 4KI5M 3ZMOA 1AYM3 1OLME 1GP6A 5FXVA 5CKQA 2XJPA 2DBIA 3PUSA 5DZGA 3VKLA 3OBAA 2FBEA 2HWE3 5LBEA 4CDQC 2IFRA 4P14A 1NA1A 1CZSA 5CKMA 3KV5A 1UPIA 1BJQA 3FFQA 3LD8A 1QJY1 3M3IA 2O8OA 4LO5B 2D6NA 5J37A 1ND2C 3VHPA 4B1MA 1WMEA 1UZYA 2GMEA 1RJ7A 3E5QA 2EF6A 5L7OB 3O1SA 4GH4B 3VDDC 4XJAA 1OUSA 2XR4A 1GLHA 1SHWB 3U11A 1QHDA 1W04A 4XC9A 4ET7A 1MS0A 2ZAHA 3T4VA 3AMHA 1W8ZA 1MS1A 2WSUA 2RE9A 2WWUA 2HJIA 2JE7A 4COZA 4S2FA 1ZRRA 3BIWE 3QH7A 4ZXEA 3VBOB 4C90A 3AL5A 4UFHA 3RYRA 1KGYA 5FV3A 1UU4A 1V6OA 2P4EA 5A3MA 3R4DB 4OI1A 2NMOA 5L9RA 5FZBA 4HL0A 2ZZQA 2WNUB 1POQA 2ZEXA 4ZKTB 2ZAAA 4AFCA 2Y38A 4FFIA 4N7UA 5JSRA 1UIKA 2WAAA 3OPTA 1W0PA 1MQTC 1M06G 2WZR2 2VUCA 3RZJA 2HKXA 2K2SA 1RUC2 3UETA 4FXKB 1UMHA 3AKRA 2VGDA 1OLQA 1W6MA 3GBWA 5JIUA 1G6NA 1QNWA 4KMQA 3VBHC 3PUQA 1GKBA 2VMHA 4PQ9A 4MGYE 3URFA 4AR2A 1XE0A 2KD7A 1YI9A 3VHRA 2Z79A 4N7IA 1N1TA 1OQDA 2WT0A 4NVPA 4XJWA 4L0PA 1JUIA 2JE9A 3SQOA 2NPIA 2ZEZA 4IEVA 1ODNA 1HXS2 2WLPA 3OPWA 4QHZA 1HQNA 3R0RA 5DG1A 4H2AA 2EICA 4LT5A 4HKLA 1H6YA 4QDQA 2R071 1WMDA 1O3TA 4Z1VA 1S1AA 1REEA 4AI9A 3GCXA 2YGMA 5A7SA 1WW5A 3BU7A 5AC91 5CFCB 4M3CF 4QQ2A 1B35A 3D5OA 4JVAA 2HWD3 5LWBA 4Q0SA 4CCDA 4I30A 3RMXA 3UGGA 3LPGA 3FLTA 2DTYA 5C4WB 4IEWA 3VDDA 4MSVA 1OC1A 3WNKA 2W91A 2CDOA 4FFGA 3AMMA 4NJ4A 4JKKA 5DUXA 5FY1A 5EJ1B 2ZZJA 2B42B 2PFWA 1D7PM 3P3PA 1HW5A 3VZLA 1GP4A 5H9RA 1ODMA 3I3DA 2RMU3 5A7WA 2R16A 4HKWA 5L36A 5ACA3 4AFBA 5LW9A 2ZX0A 4Q29A 4KBBA 4ASMB 4KQ7A 1UX7A 3AVSA 3AZXA 3HQUA 4AL9A 4RHV2 3ZYHA 4HPKA 1J3RA 3NV3A 1QOSA 3O1PA 5LA2A 4QPIB 2CGOA 2IZWA 3AYDA 4FOQA 4HMZA 1FATA 3SEPA 5K0UA 3LF7A 1I3HA 5CYYA 1UIJA 4Q0VA 3ZPYA 2J22A 5FZMA 2E53A 3KHCA 1PX4A 4XF4A 2YB7A 4LBQB 4D6SA 3O1OA 1OMIA 1FX5A 4QXHA 1F4HA 1STMA 3OUIA 2WO1A 5E89A 2XXZA 2Y6GA 4RD7A 5FZDA 1TVGA 5F6KA 3EBRA 3Q9OA 1UYYA 5FY8A 4OMDA 1W8UA 4CU6A 5KHKA 2HBUA 4J25A 1RVF3 2RS11 2VMDA 1EV11 3WNXA 1PK6A 2AYHA 4M4PA 4Q4X1 1IS5A 2CYFA 4KGQA 3T4HB 1XBFA 2J1UA 1RUI3 2PLV2 2ZGRA 4NUBA 2X5IA 4OUMA 1U5YA 3PMSA 1S55A 4E9KA 1TME3 2IXHA 4AZZA 2IUWA 1ZBE2 1WMXA 4UFLA 1W3XA 4FFHA 4QKFA 1W6PA 5CU1A 1V0AA 3MO4A 4Q0QA 5L7OA 1DZTA 4Q4Y3 4HN0A 1PVC3 1H8TB 3WDUA 2YGLA 3PVBB 4MVTA 1AJOA 3BKZA 1HXS3 4E4DX 3K4DA 1ULOA 4OHYA 3LAGA 4IE4A 1HQWA 4ATEA 2WLQA 3WQ0A 4MOAA 5ANQA 1ZM1A 4DXSA 5BNOB 3ITQA 4NO4A 5LK5A 3C3VA 4DFSA 1DIWA 3UKTA 4AGRA 5EIYB 4COYA 2XJUA 4LHSA 3INAA 1SLCA 4LKDA 2HWB1 4IV3C 2EIDA 3B7MA 3WEZA 4R9DA 3N36A 4ZPIA 3FJSA 3JB4C 5AFBA 5LBCA 2OUJA 2E33A 2VG9A 1L7QA 1E5IA 3U78A 1W9WA 3WW2A 2O8QA 4PLMA 4CCKA 2DV9A 2WFF1 2X8KA 2RJLA 4AWDA 3K48A 3UT0A 4WVVA 3VZNA 2PHLA 4OLLA 1J1TA 1KITA 1UY3A 4NOTA 2DDUA 3UKVA 3HT1A 2B5HA 4MLOA 3IMNA 1AL0G 4CP0A 1VAMA 1O4ZA 2BGCA 4E4HA 4AHXA 2YU2A 1X9PA 1UCXA 4LBOA 2IXKA 2VZOA 4D94A 3R05A 2CWMA 4TXWA 2VAUA 2XBO1 4OHVA 4JGYB 2D98A 1EUTA 3AXDA 4ARYA 1OA3A 3PVNA 2FCUA 4GIQA 1A34A 3Q8EA 1XNKA 2H6CA 2KM2A 4EROA 3B3QE 3AZZA 5JCTA 2PHRA 4XHBA 2ET1A 3POEA 4YPJA 2RR13 3N9LA 4YW5A 2I2SA 4MGIE 3TYJA 4CP9A 1NCQC 1OPOA 1AX0A 1IG3A 3AXEA 1KJLA 4CXWA 3V0AA 3B9CA 3N9OA 4YZ4A 1Y43B 2WUHA 1BLZA 5FWEA 2GMMA 4P9GA 1UYPA 2CSGA 3ZXKA 1KQRA 5FYHA 1MS8A 3KM5A 3R6SA 3AKSA 1K12A 1V6MA 2GNMA 3F95A 4BHPA 1A8MA 2BUKA 3AYEA 5EJZB 4E2QA 3LSEA 3O7OA 1KFUL 1TG7A 4IEYA 4UF0B 3CJIB 4XFFA 1DCSA 3UL2A 3WG4A 4YM3A 2J1AA 3IZOA 2FDJA 4WVWA 3PU3A 1DGRA 2PHUA 3IAPA 4CP2A 2PLV1 4H3WA 5LB6A 5JDBA 1LOCA 2RS12 1G9FA 2WYSA 3G7DA 4W4ZA 1NT0A 1AYN3 3GDBA 2WWSA 2XLFA 1OOPA 2VD7A 5LATA 2OA2A 4CP1A 2RDNA 4CU7A 3KT4A 4CDQA 4P9LA 4E2SA 5IFPA 4KWUA 4B7EA 3UNPA 2ZEYA 4HOOA 3SC7X 4AVAA 2IXIA 5A1AA 5LA0A 4QPGC 2BJSA 2GH2A 2WNOA 3I2IA 1QXJA 4P9JA 3AMQA 3ZFGC 5IK7A 4CUGA 1ENSA 1R083 5K0UB 1RTVA 2VNVA 1HV0A 2OT7A 2VTXJ 4OI4A 1RUJ3 2LUWA 1GNYA 3VKNA 4ZS3A 1SCSA 4WM8A 4CEYB 2HBTA 2Y8KA 5BNNC 4UFJA 1JZ5A 3EHKA 1YFUA 4WZFA 2JEMA 5JOXA 2CNAA 4META 4Q4V3 3THDA 3H0OA 2V5DA 4FBFA 4KH9A 2PXJA 3AP5A 1QKQA 4K3UA 4XFBA 2QE3A 5CIRA 1IZ3A 1VBB2 4LNVA 4ZY9A 3VD7A 1TMF2 1W6MB 3OOXA 5FZAA 4D6RA 4FAGA 5C3PA 3GXUA 1Q8QA 4PBOA 4YRDA 3UESA 2CTVA 1J84A 1GICA 3ACLA 3VBRA 4IERA 1RUJ2 4W8JA 3PUAA 2JDUA 4XABA 1SEFA 2YXSA 1IHMA 1R1A3 2CDPA 1NCRB 3L2HA 4CDUB 1UZZA 5DG2A 1I5PA 1AR92 1AJKA 2HWB3 3K75B 3VL9A 3OD4A 5M0TA 1JMUB 3THCA 2WN2A 4IGQA 1VAKA 3QLQA 1GMMA 2R073 1W2UA 1BBT2 3PVOA 4ZHNA 4EWEA 1R082 4RFRB 5C3SA 4D0QA 1JYVA 1R64A 3O12A 4NHMA 2UWAA 3HNMA 1CAXB 2Q1ZB 3N7JA 4QPIA 4WV8A 1Q8OA 4DNYA 1H0BA 2ZGPA 2CGPA 3DYMA 3S57A 2AZ5A 4LO8A 1S0DA 1XYNA 3MV11 1IS4A 1XJAA 3AP6A 2WNVB 3ORJA 4K21A 2BEOA 1Z7S1 2BOIA 2EAAA 2WJSA 4ZU7A 1O4YA 3GJAA 4PIZA 4CDWB 2ZCWA 4GKYA 1C4RA 1O7FA 1BBT3 4JKMA 1WA4A 2BRTA 4UI9L 4P08A 5HCHA 5C8WA 1UW8A 3QD6A 4RSUA 4BE3A 1RUC1 1W9SA 2W46A 5EFUA 3HOBA 2LM3A 1FMD3 4NRPA 3SMHA 1FNYA 1CQ9A 1RXFA 1ULFA 2P37A 4N43B 5KHIA 2JECA 1FAYA 3ZSEA 1GSLA 3OYWA 4EZ4A 2JDKA 5A1LA 4M3CA 3B69A 2YC2A 2WQZC 5D2AA 1C1LA 3ZYPA 1V6NA 3RZMA 1R081 2YMZA 5F8PA 4YW7A 3SEEA 2OYZA 1OFNA 1XB9A 4YG6A 3J8F3 4GAZA 4XIKA 2AREA 4GB31 1DU3D 1H1AA 1MPXA 3BTAA 5DN2A 5ANNA 5C70A 5GZEA 4QX3A 3MW3A 2D5HA 3Q8FA 1XSQA 2A5ZA 2R49A 4Q8KA 5B2GB 1JW6A 4O65A 5FO7B 1HB4A 3IBMA 3OSDA 1B35B 2OZJA 1PM7A 5JOWA 2Q8DA 4SBVA 2ERFA 4XDPA 2AEYA 4AQTA 2R32A 5FK7A 3NV2A 2W47A 2DFBA 3PU8A 3K4AA 3W20A 3MF6A 1PM4A 5J3UA 3WCSA 3M7AA 5F32A 4HLTA 3LEKA 2XWJB 3WF1A 3EO6A 1WWYA 1EAH3 1N3OA 3LEGA 2XJVA 4EN7B 1CN1A 3OGJA 1GOGA 2W1SA 1Y9QA 1JYNA 5A3LA 1JZ7A 5J96B 5CFDA 4C8DA 5AFEA 2CHHA 4XILA 3MFAA 5HV4A 4MGZE 3OBTA 3VBFA 5IUQA 1V9U1 1VJ2A 3NV4A 2D6OX 3ZR6A 1WMFA 5JMCA 4JC1A 4UAPA 4GJZA 4AQSA 1AHSA 2EIGA 1K5JA 4DUVA 3PNAA 1ULCA 2XWBB 4CCNA 2ZABA 3H9AA 1KFXL 2JG9B 3ACHA 2BZDA 2JG9C 1TME2 2BQPA 1BQPA 2P6HA 5LCWL 3ZDSA 1U5IA 5FYTA 4MH0E 4BISA 1F35A 4DEVA 1OH3A 1W2OA 5HCBA 3N7LA 3POFA 3RJ2X 2E51A 1G9AA 3H1YA 1ZA7A 4KU7A 1TNRA 1PVC2 1LTEA 2P3YA 3CJXA 4JKLA 3BN6A 5C71A 3M3EA 3NQHA 2D6KA 4B29A 3L2YA 4XZUG 3ZFFC 5BNQA 5DUWA 2XG3A 2ZMKA 2GNBA 3J9SA 4AVVA 1PO11 1W9TA 4IV3A 4BK4A 1IOAA 4IW3A 1FMD2 1JHNA 4FTSA 5IVVA 1XC6A 1H2KA 4QDSA 3SNMA 1UY2A 1K45A 2YZ4A 3ACIA 1Q56A 2Y6LA 3VZMA 2J1SA 3GZTB 3B93A 3KF5A 5DPNA 3HR9A 2GNDA 4LHNA 1R091 1RINA 4D7SA 4A3ZA 2W5FA 2VZTA 2HWF3 1RUE2 2PHFA 5FQ0B 2IVJA 3J4UH 5FZOA 5F1RA 2OKXA 5KHGA 2Q5TA 4A7KA 2R062 3TEZA 3B5LB 4N9IA 1ENXA 3W58A 3AJYA 3AZVA 3OY8A 5JUVA 3B02A 1O3QA 1LKNA 1RJ8A 2PQSA 4DPNA 2B8MA 3CMGA 4OZOA 5BNOA 4HSJA 3OD0A 5ABJB 2Y0IA 2VQUA 2P1BA 1OD5A 4CCOA 1AR82 4GMP1 4BQ4A 1W8FA 3MDPA 4LKEA 5EWSA 1LU1A 2RM21 3I7DA 1RUJ1 2Y6HA 5A6XA 4MZUA 4R52A 4P9WA 2WKKA 2W1UA 3VBUC 1XNDA 4BMBA 3SCFA 3VUOA 1AYN2 1X9TA 3JD71 3LA3A 3LDKA 4QHOA 3WQ1A 2XONA 4PHZA 1NQDA 1C8M3 1CAWA 1YO8A 1QJX2 1HN0A 4H55A 1YLLA 3T09A 4ISQA 2QFEA 4HK9A 3VZKA 2B9UA 1H6XA 1WA6X 5GLZA 2Y0OA 2ZX4A 1CAUB 4CDWC 3DPRC 5LRSA 4DB5A 1R092 2ET7A 2UWBA 1QQP1 2PHDA 2VZVA 5FZ1A 1O6UA 3CIHA 3NW4A 3WINE 2X5IB 4IQPA 4XIOA 5DAPA 5BNPA 2GC2A 1H1MA 1WLDA
chains in the Genus database with same CATH topology
3OB8A 3A23A 3CDZB 1O59A 4ZXEA 3NRUA 4GWJA 1OF4A 1KGYA 3DYPA 4XUOA 1UZ0A 2Y64A 3DECA 3VD3A 3ABZA 4A6OA 3FHAA 1UMIA 2ZEXA 2QBXA 3HNBM 4QX1A 3DYOA 1OT5A 2JKXA 4BK5A 5IYYA 2WAAA 2ORZA 2ORXA 3T2QA 1SG3A 2E31A 5JXIA 1UXXX 2W95A 4P00B 3UETA 3FN9A 4BDVB 2J1RA 2JE8A 1NKGA 1UMHA 3IB3A 4QB6A 4QB2A 1P8JA 4KMQA 3OGVA 1K42A 2VL4A 2YFUA 2RVAA 2WZEA 3T0AA 3WNPA 2KD7A 2XOMA 4M4RA 2VZQA 4L0PA 1XNTA 4W50A 2ZEZA 3CZUA 4A41A 2EICA 4XUQA 1H6YA 4QDQA 2VOTA 4CUAA 2VZPA 4A44A 5JXJA 4PQQA 3C7EA 3A7QA 4CVUA 3ACGA 2E26A 3LPGA 2ZXQA 3WF3A 4CU9A 1CZVA 1UYZA 3D3AA 3CQOA 2HLEA 3LQCA 1IQDC 2JDAA 3WNKA 2W91A 2CDOA 3GM8A 2QQJA 1US2A 4JKKA 1GOFA 3GGLA 2V72A 5EJ1B 1D7PM 1K3IA 4CUBA 3F2ZA 1US3A 2Y6KA 1JI6A 3I3DA 2BERA 3OG2A 4GWIA 1RYYA 2W94A 3P1IA 1UX7A 4AG4A 3J7HA 4CUCA 2C26A 5FUIA 3I2GA 4LQRA 2BGPA 2C4XA 5LA2A 1XPWA 3T2OA 2VCCA 3SEPA 5CYYA 3NJXA 2J22A 2YG0A 1PX4A 2YB7A 2QQOA 1F4HA 2VMCA 2VCBA 2WO1A 2Y6GA 1TVGA 2WO2A 1UYYA 4OMDA 4CU6A 1DLCA 2VMDA 4JHZA 4TTGA 4M4PA 1OF3A 2VZSA 2X09A 1W8OA 3OEBA 3I2FA 2J1UA 5JXHA 4GZ9A 4DXRA 1UY0A 1NX9A 2QQLA 3C7FA 3MO4A 2RV9A 3PUHA 3E1F1 3I2KA 4QX0A 3K4DA 3HPNA 1UY4A 1ULOA 4BXSV 3JXSA 2VCAA 4MOAA 4DXSA 2VR4A 4JX0A 3WSOA 3WF0A 5DQ0A 3FHQA 3P6BA 3PUIA 5EIYB 3I2JA 4LHSA 5B4XA 2ZEWA 2EIDA 3WNLA 3WEZA 2RJ2A 4ZZ8A 2C9KA 2E33A 5G04L 1L7QA 1EUUA 3C7GA 1W9WA 2JD9A 3VDAA 4AAXA 3CZJA 1W8NA 1UY3A 3LE0A 2DDUA 3T08A 2VC9A 2VZOA 4TXWA 1UXZA 1J83A 1T2XA 1O8SA 1JYWA 1EUTA 4ARYA 4E8DA 5J1XA 3C8XA 3OGSA 4OYUA 3I2HA 4MGQA 2VZRA 2J1EA 1LNSA 4YPJA 4XURA 5I0DA 3AC0A 2QQIA 2V4VA 1L7RA 2WABA 3WQBA 3HNYM 2WUHA 2WQ8A 2E32A 1UWWA 4ZZ5A 3K4ZA 1K12A 5EJZB 4FI9A 3VD5A 1TG7A 4QX2A 3C7OA 2J1AA 1PX3A 4MGSA 3IAPA 4PF1A 3ACFA 1GU3A 3CKHA 5HPOA 2WYSA 3WNNA 4W4ZA 3GDBA 4CU7A 4LPLA 2W1WA 5IFPA 4KWUA 4QPWA 1ULPA 3UNPA 1W0NA 2ZEYA 1OD3A 2R7EB 5A1AA 2VZ3A 5LA0A 3I2IA 1UYXA 1JZ2A 2QQNA 1JU3A 1GNYA 2DCKA 5CZKA 3WF2A 4DUWA 2Y8KA 5JR2A 1SDDB 1JZ5A 3THDA 2V5DA 2EIBA 1OH4A 1JYXA 4IUGA 4ZY9A 3VD7A 4A42A 4Z2AA 2QQKA 3W5MA 3GXUA 3UESA 1DP0A 1J84A 3C7HA 1UY1A 1W99A 3T2PA 3ETPA 4P5YA 3WF4A 4W8JA 2W1QA 5C7GA 3WNMA 1WKYA 2CDPA 3SKVA 3HEIA 5DMYA 2EIEA 1I5PA 2J7MA 3K75B 3A21A 3THCA 2WN2A 3MUZ1 2B4KA 1GMMA 3IAQA 4A45A 5JXGA 2J1VA 4D0QA 1R64A 1JYVA 1YQ2A 1JZ6A 3HNMA 2YFZA 1BHGA 3FL7A 3I3BA 1DYOA 4PT6A 1JZ4A 4QAWA 2W92A 3DYMA 2QQMA 4RYDA 2DCJA 2VM9A 3MV11 2WBKA 1NAEA 3OGRA 4QB1A 1WCQA 2Y6JA 3NJVA 4XUTA 4JKMA 5IFTA 3WNOA 4UI9L 4P08A 2BBAA 1W9SA 2VJXA 2W46A 5B4NA 3HOBA 3HN3A 1CIYA 2W9XA 4DUXA 3EB7A 1JHJA 2BGOA 2YC2A 4CU8A 3U37A 5IJRA 3SEEA 4XUNA 2ID4A 4MO3M 4E8CA 1CZTA 5C70A 5DN2A 1MPXA 3ZM8A 4QX3A 1PMJX 4HG6B 3T0BA 1XNAA 1CX1A 2LS6A 2W47A 3K4AA 5G05L 2X05A 4P02B 3LEKA 3VD9A 1GUIA 3WF1A 2HYXA 2WO3A 3W5NA 1GOHA 3LEGA 4OUEA 2WN3A 1GOGA 2W1SA 3I97A 1JYNA 4A4AA 3A22A 1JZ7A 1PMHX 5JMOA 3MBWA 2XHNA 2VTFA 3ECQA 3K77A 4UAPA 3VD4A 4DUVA 3VDBA 3ACHA 4LKSA 2BZDA 3NNGA 4XVHA 5LCWL 2VZUA 3IDAA 4DEVA 1GQPA 2VO5A 3SKJE 1KEXA 2X10A 2B9VA 3MV01 4JKLA 5HXMA 3BN6A 5C71A 3I3EA 3MUY1 3NQHA 2XQXA 1HN1A 2W3JA 2WDBA 4XZUG 4QDRA 3T0DA 2LW8A 2J1TA 2WZ8A 2WAOA 1W9TA 5F7UA 4BK4A 4RN5A 3K46A 4XUPA 1XC6A 4QDSA 1UY2A 1K45A 2L9LA 3ACIA 2Y6LA 2J1SA 2YC4A 5DPNA 2VZ1A 3VDCA 1JZ3A 2Z4FA 1JZ8A 4A3ZA 2W5FA 2VZTA 3HJRA 4ARXA 4MADA 4UOJA 2OKXA 2VMEA 3LPFA 5JUVA 3IIIA 3LEIA 2PQSA 1JU4A 4OMCA 3EYPA 4D8MA 3CMGA 4OZOA 5IHRA 5LA1A 2VQUA 4KI5M 1NUKA 4DXTA 2VMFA 3OBAA 2VQTA 2Y6HA 2W87A 4DEQA 1CZSA 2W1UA 1O8PA 2XONA 3OEAA 3T09A 4BJ0A 1H6XA 3BGAA 1SHWB 4ET7A 2VZVA 1F4AA 3CIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OB8 A;  3A23 A;  3CDZ B;  1O59 A;  4ZXE A;  3NRU A;  4GWJ A;  1OF4 A;  1KGY A;  3DYP A;  4XUO A;  1UZ0 A;  2Y64 A;  3DEC A;  3VD3 A;  3ABZ A;  4A6O A;  3FHA A;  1UMI A;  2ZEX A;  2QBX A;  3HNB M;  4QX1 A;  3DYO A;  1OT5 A;  2JKX A;  4BK5 A;  5IYY A;  2WAA A;  2ORZ A;  2ORX A;  3T2Q A;  1SG3 A;  2E31 A;  5JXI A;  1UXX X;  2W95 A;  4P00 B;  3UET A;  3FN9 A;  4BDV B;  2J1R A;  2JE8 A;  1NKG A;  1UMH A;  3IB3 A;  4QB6 A;  4QB2 A;  1P8J A;  4KMQ A;  3OGV A;  1K42 A;  2VL4 A;  2YFU A;  2RVA A;  2WZE A;  3T0A A;  3WNP A;  2KD7 A;  2XOM A;  4M4R A;  2VZQ A;  4L0P A;  1XNT A;  4W50 A;  2ZEZ A;  3CZU A;  4A41 A;  2EIC A;  4XUQ A;  1H6Y A;  4QDQ A;  2VOT A;  4CUA A;  2VZP A;  4A44 A;  5JXJ A;  4PQQ A;  3C7E A;  3A7Q A;  4CVU A;  3ACG A;  2E26 A;  3LPG A;  2ZXQ A;  3WF3 A;  4CU9 A;  1CZV A;  1UYZ A;  3D3A A;  3CQO A;  2HLE A;  3LQC A;  1IQD C;  2JDA A;  3WNK A;  2W91 A;  2CDO A;  3GM8 A;  2QQJ A;  1US2 A;  4JKK A;  1GOF A;  3GGL A;  2V72 A;  5EJ1 B;  1D7P M;  1K3I A;  4CUB A;  3F2Z A;  1US3 A;  2Y6K A;  1JI6 A;  3I3D A;  2BER A;  3OG2 A;  4GWI A;  1RYY A;  2W94 A;  3P1I A;  1UX7 A;  4AG4 A;  3J7H A;  4CUC A;  2C26 A;  5FUI A;  3I2G A;  4LQR A;  2BGP A;  2C4X A;  5LA2 A;  1XPW A;  3T2O A;  2VCC A;  3SEP A;  5CYY A;  3NJX A;  2J22 A;  2YG0 A;  1PX4 A;  2YB7 A;  2QQO A;  1F4H A;  2VMC A;  2VCB A;  2WO1 A;  2Y6G A;  1TVG A;  2WO2 A;  1UYY A;  4OMD A;  4CU6 A;  1DLC A;  2VMD A;  4JHZ A;  4TTG A;  4M4P A;  1OF3 A;  2VZS A;  2X09 A;  1W8O A;  3OEB A;  3I2F A;  2J1U A;  5JXH A;  4GZ9 A;  4DXR A;  1UY0 A;  1NX9 A;  2QQL A;  3C7F A;  3MO4 A;  2RV9 A;  3PUH A;  3E1F 1;  3I2K A;  4QX0 A;  3K4D A;  3HPN A;  1UY4 A;  1ULO A;  4BXS V;  3JXS A;  2VCA A;  4MOA A;  4DXS A;  2VR4 A;  4JX0 A;  3WSO A;  3WF0 A;  5DQ0 A;  3FHQ A;  3P6B A;  3PUI A;  5EIY B;  3I2J A;  4LHS A;  5B4X A;  2ZEW A;  2EID A;  3WNL A;  3WEZ A;  2RJ2 A;  4ZZ8 A;  2C9K A;  2E33 A;  5G04 L;  1L7Q A;  1EUU A;  3C7G A;  1W9W A;  2JD9 A;  3VDA A;  4AAX A;  3CZJ A;  1W8N A;  1UY3 A;  3LE0 A;  2DDU A;  3T08 A;  2VC9 A;  2VZO A;  4TXW A;  1UXZ A;  1J83 A;  1T2X A;  1O8S A;  1JYW A;  1EUT A;  4ARY A;  4E8D A;  5J1X A;  3C8X A;  3OGS A;  4OYU A;  3I2H A;  4MGQ A;  2VZR A;  2J1E A;  1LNS A;  4YPJ A;  4XUR A;  5I0D A;  3AC0 A;  2QQI A;  2V4V A;  1L7R A;  2WAB A;  3WQB A;  3HNY M;  2WUH A;  2WQ8 A;  2E32 A;  1UWW A;  4ZZ5 A;  3K4Z A;  1K12 A;  5EJZ B;  4FI9 A;  3VD5 A;  1TG7 A;  4QX2 A;  3C7O A;  2J1A A;  1PX3 A;  4MGS A;  3IAP A;  4PF1 A;  3ACF A;  1GU3 A;  3CKH A;  5HPO A;  2WYS A;  3WNN A;  4W4Z A;  3GDB A;  4CU7 A;  4LPL A;  2W1W A;  5IFP A;  4KWU A;  4QPW A;  1ULP A;  3UNP A;  1W0N A;  2ZEY A;  1OD3 A;  2R7E B;  5A1A A;  2VZ3 A;  5LA0 A;  3I2I A;  1UYX A;  1JZ2 A;  2QQN A;  1JU3 A;  1GNY A;  2DCK A;  5CZK A;  3WF2 A;  4DUW A;  2Y8K A;  5JR2 A;  1SDD B;  1JZ5 A;  3THD A;  2V5D A;  2EIB A;  1OH4 A;  1JYX A;  4IUG A;  4ZY9 A;  3VD7 A;  4A42 A;  4Z2A A;  2QQK A;  3W5M A;  3GXU A;  3UES A;  1DP0 A;  1J84 A;  3C7H A;  1UY1 A;  1W99 A;  3T2P A;  3ETP A;  4P5Y A;  3WF4 A;  4W8J A;  2W1Q A;  5C7G A;  3WNM A;  1WKY A;  2CDP A;  3SKV A;  3HEI A;  5DMY A;  2EIE A;  1I5P A;  2J7M A;  3K75 B;  3A21 A;  3THC A;  2WN2 A;  3MUZ 1;  2B4K A;  1GMM A;  3IAQ A;  4A45 A;  5JXG A;  2J1V A;  4D0Q A;  1R64 A;  1JYV A;  1YQ2 A;  1JZ6 A;  3HNM A;  2YFZ A;  1BHG A;  3FL7 A;  3I3B A;  1DYO A;  4PT6 A;  1JZ4 A;  4QAW A;  2W92 A;  3DYM A;  2QQM A;  4RYD A;  2DCJ A;  2VM9 A;  3MV1 1;  2WBK A;  1NAE A;  3OGR A;  4QB1 A;  1WCQ A;  2Y6J A;  3NJV A;  4XUT A;  4JKM A;  5IFT A;  3WNO A;  4UI9 L;  4P08 A;  2BBA A;  1W9S A;  2VJX A;  2W46 A;  5B4N A;  3HOB A;  3HN3 A;  1CIY A;  2W9X A;  4DUX A;  3EB7 A;  1JHJ A;  2BGO A;  2YC2 A;  4CU8 A;  3U37 A;  5IJR A;  3SEE A;  4XUN A;  2ID4 A;  4MO3 M;  4E8C A;  1CZT A;  5C70 A;  5DN2 A;  1MPX A;  3ZM8 A;  4QX3 A;  1PMJ X;  4HG6 B;  3T0B A;  1XNA A;  1CX1 A;  2LS6 A;  2W47 A;  3K4A A;  5G05 L;  2X05 A;  4P02 B;  3LEK A;  3VD9 A;  1GUI A;  3WF1 A;  2HYX A;  2WO3 A;  3W5N A;  1GOH A;  3LEG A;  4OUE A;  2WN3 A;  1GOG A;  2W1S A;  3I97 A;  1JYN A;  4A4A A;  3A22 A;  1JZ7 A;  1PMH X;  5JMO A;  3MBW A;  2XHN A;  2VTF A;  3ECQ A;  3K77 A;  4UAP A;  3VD4 A;  4DUV A;  3VDB A;  3ACH A;  4LKS A;  2BZD A;  3NNG A;  4XVH A;  5LCW L;  2VZU A;  3IDA A;  4DEV A;  1GQP A;  2VO5 A;  3SKJ E;  1KEX A;  2X10 A;  2B9V A;  3MV0 1;  4JKL A;  5HXM A;  3BN6 A;  5C71 A;  3I3E A;  3MUY 1;  3NQH A;  2XQX A;  1HN1 A;  2W3J A;  2WDB A;  4XZU G;  4QDR A;  3T0D A;  2LW8 A;  2J1T A;  2WZ8 A;  2WAO A;  1W9T A;  5F7U A;  4BK4 A;  4RN5 A;  3K46 A;  4XUP A;  1XC6 A;  4QDS A;  1UY2 A;  1K45 A;  2L9L A;  3ACI A;  2Y6L A;  2J1S A;  2YC4 A;  5DPN A;  2VZ1 A;  3VDC A;  1JZ3 A;  2Z4F A;  1JZ8 A;  4A3Z A;  2W5F A;  2VZT A;  3HJR A;  4ARX A;  4MAD A;  4UOJ A;  2OKX A;  2VME A;  3LPF A;  5JUV A;  3III A;  3LEI A;  2PQS A;  1JU4 A;  4OMC A;  3EYP A;  4D8M A;  3CMG A;  4OZO A;  5IHR A;  5LA1 A;  2VQU A;  4KI5 M;  1NUK A;  4DXT A;  2VMF A;  3OBA A;  2VQT A;  2Y6H A;  2W87 A;  4DEQ A;  1CZS A;  2W1U A;  1O8P A;  2XON A;  3OEA A;  3T09 A;  4BJ0 A;  1H6X A;  3BGA A;  1SHW B;  4ET7 A;  2VZV A;  1F4A A;  3CIH A; 
#chains in the Genus database with same CATH topology
 2WQ4 A;  3DUI A;  2G9Z A;  3LDB A;  3MLL A;  2OQ7 A;  1GR3 A;  3NRU A;  4GWJ A;  3ZLI A;  3RI9 A;  2VVE A;  4LMF A;  4XUO A;  3Q8B A;  4N53 B;  4XPV A;  4XCA A;  2D97 A;  4I02 A;  1KDK A;  5FJK A;  4M0H A;  1W28 A;  1W6N B;  4A6O A;  2PA7 A;  3FHA A;  5I0T A;  3ZIX A;  2P3I A;  5I91 A;  1S2K A;  4CEW A;  1YQ8 A;  2A1X A;  2JKX A;  4FPO B;  1LHO A;  4E4S A;  4FAH A;  2XUM A;  2QCS B;  3TN9 2;  1LHN A;  2ORZ A;  4BB3 A;  1AYN 1;  3JD7 2;  4YGE A;  1RUD 1;  2EA7 A;  2E7T A;  2VOV A;  3CO2 A;  4BDV B;  3ZFG A;  2JE8 A;  3NV1 A;  1OUX A;  1NKG A;  3NNL A;  4LJH A;  5IVC A;  4DMI A;  4LBK A;  1NLR A;  3POB A;  1P8J A;  4QB6 A;  1HX6 A;  4QB2 A;  1RUD 2;  2D43 A;  4Z92 B;  3DXT A;  2HH9 A;  2VH9 A;  3VBR B;  2Q1F A;  1VRH 3;  1K42 A;  4NAO A;  2YUE A;  4QM9 A;  1YHF A;  3FX3 A;  1AXK A;  2PEL A;  2RVA A;  2WZE A;  4L9B A;  5FY4 A;  4UW4 A;  2KR2 A;  2XOM A;  1J3P A;  1VBB 1;  2A6Z A;  1ZZB A;  5IAT A;  4Q4Y 1;  1VAL A;  2AEZ A;  3P3N A;  5FYI A;  3VLB B;  2HWD 1;  1S0B A;  2VZQ A;  1O5L A;  3D0J A;  1COV 1;  2OX0 A;  1XNT A;  3HVD A;  2R07 2;  1C5H A;  2Q1M A;  3PHM A;  2WZR 3;  4W50 A;  4BXF A;  1MS4 A;  4C0B A;  1VBC 1;  4ITC A;  4AI0 A;  2G9F A;  3AK0 A;  1NLS A;  2HWF 2;  1YFX A;  3NO8 A;  3HD8 B;  4WM8 B;  3VZJ A;  4LR4 A;  4LIU A;  5LZ6 A;  4CUA A;  4CEY C;  3NST A;  2HWF 1;  1CGP A;  2BV4 A;  4I01 A;  4Y4Y A;  4LOR A;  5CNA A;  5K0U C;  4I09 A;  2VUL A;  3IDC B;  2ZGN A;  1OPM A;  5HXV A;  1KJR A;  1FYU A;  2OUH A;  2DYC A;  1AUY A;  3CQO A;  4K9S A;  1PVX A;  4FOV A;  4I3G A;  4YAR A;  4JTN A;  1LGN A;  3NMB A;  1N47 A;  2A6X A;  2QQJ A;  2VXR A;  3GM8 A;  1O3R A;  2FDH A;  3MIF A;  3T1M A;  1LGB A;  3POJ A;  5J09 A;  2VQA A;  5C9A A;  1VBE 1;  4L97 A;  1N3P A;  3I54 A;  3I59 A;  3JUU A;  3OJB A;  4RL7 A;  5IAX A;  4X6R B;  2JIJ A;  2VPV A;  1HRI 1;  2BER A;  3OG2 A;  1QQP 3;  3POW A;  4LTA A;  3KV6 A;  4QU1 A;  2VW0 A;  4IV1 A;  4Z07 A;  1O91 A;  1RUE 3;  1YUD A;  4GWI A;  4JGZ A;  1RYY A;  3CJI C;  5EJ3 A;  1UZV A;  2WA4 A;  2AR6 A;  2P2K A;  2O1Q A;  3J7H A;  1ZRE A;  4Q27 A;  2VVF A;  1ENQ A;  1CES A;  2C26 A;  3PJQ A;  1NZC A;  1QJU 1;  5A33 B;  3I2G A;  1FPN 2;  4RS5 B;  4JCK A;  4AFD A;  2WNE A;  2WL1 A;  1OQE A;  4HVO A;  1SBD A;  1VB2 A;  2WT2 A;  4YVW C;  4B4Q A;  1NCQ B;  1GP5 A;  3FBY A;  2A3Y A;  1UU6 A;  5A7Q A;  4C91 A;  4AI2 A;  1QQP 2;  1POV 3;  2QQO A;  2RS3 3;  5FZ3 A;  4RGG A;  3N7M A;  4YZ3 A;  5T5O A;  4ZU5 A;  1DGL A;  2WNV A;  2WO2 A;  3H8R A;  1W6O B;  1D4M 1;  3ZOI A;  1Q3E A;  1J58 A;  1H9P A;  4QM8 A;  5A7N A;  3PL0 A;  3HAG A;  1YYN A;  1NE4 A;  4JGY C;  4RHV 3;  1VIW B;  1J3Q A;  4AEM A;  4B7K A;  1DLL A;  2BDR A;  2EXH A;  1W8O A;  2X09 A;  4QWN A;  4LEJ A;  1F5F A;  4O9G A;  5JXH A;  2B7Y A;  4GZ9 A;  4Q4X 2;  1PNF A;  1PZ9 A;  5FPZ A;  3ZX7 A;  4XJ8 A;  1YI7 A;  3BAL A;  4HPK B;  1WCU A;  4UBH A;  4Q1P A;  4DQA A;  2JKB A;  1WCK A;  3I2K A;  4R9C A;  4UBG A;  5EP9 A;  1SLI A;  1S0I A;  3ZSL A;  2JIG A;  5BUV A;  5ACA 1;  4YM2 A;  3RSJ A;  3TBD A;  3DF0 A;  3E5X A;  1RHI 3;  3JQX A;  3NKT A;  4PLN A;  3VB9 A;  4BXS V;  4EV0 A;  3PUR A;  1UQX A;  1OVS A;  2D6L X;  3KZ4 C;  3MIG A;  4JX0 A;  3USU A;  5DQ0 A;  4CCM A;  3O5S A;  3PUI A;  4OFG A;  1QIQ A;  3AB0 A;  1WW6 A;  1JOJ A;  2HWC 2;  2AH2 A;  1F8V A;  1LOF A;  1WW4 A;  3WNL A;  2GMP A;  1S0E A;  4YVW B;  3QH6 A;  3KSC A;  5H9Q A;  2W39 A;  2DVA A;  5IVY A;  3ZXL A;  1DZR A;  1BEV 1;  2C9K A;  1V00 A;  4FCA A;  4GA9 A;  4YFZ A;  3RG0 A;  1FMD 1;  1HB1 A;  1YNA A;  1RVF 2;  3CJI A;  1VBB 3;  2X29 A;  1D4V B;  4QXB A;  4XAC A;  4A7Z A;  5JPM B;  1W6P B;  2IXJ A;  3WVJ A;  3T2T A;  3MIB A;  4XTM A;  3VDA A;  4AAX A;  2EXI A;  5FZ0 A;  5FUN A;  1YCI A;  3OBZ A;  5A32 A;  1H1I A;  2ETE A;  3JB8 A;  3MF9 A;  5JAX A;  3HMY A;  2A71 A;  5A7O A;  2VOX A;  4ASL A;  1G9B A;  3T08 A;  2GP5 A;  4O61 A;  3H8X A;  1HB2 A;  1PGS A;  4JZR A;  4DZG A;  1T2X A;  4WVM A;  2DFC A;  4AEK A;  2DUP A;  4HFS A;  4E8D A;  5J1X A;  3THP A;  2FZ2 A;  3H42 B;  5C33 A;  3VV1 A;  3C8X A;  2VY0 A;  1ZBA 1;  3NAP A;  5FMO L;  1QJY 3;  3I2H A;  4NRQ A;  3UGH A;  1W0O A;  4UFI A;  1R09 3;  2VZR A;  2W68 A;  2ZBJ A;  4BM8 A;  2J1E A;  3KT7 A;  1LNS A;  2W08 A;  5FPL A;  5GLV A;  4Q2F A;  5FY9 A;  5C5U A;  2QQI A;  4LE4 A;  1G7Y A;  1CON A;  2ZOE B;  1L7R A;  1S0C A;  1BVP 1;  2IVI B;  2DWR A;  3K3N A;  2B39 A;  4YWA A;  2E6V A;  3HNY M;  3U10 A;  4BLI A;  4AGG A;  3RMY A;  5FPA A;  4XJZ A;  5FWJ A;  5KR7 A;  4WM8 C;  5A7P A;  4ZZ5 A;  3O14 A;  4I2O A;  1D4M 3;  1OVP A;  2RMU 1;  4M01 A;  4W65 A;  2G1M A;  3VD5 A;  2QQU A;  2GNT A;  4FQ4 A;  1AXZ A;  3SH5 A;  1K5M A;  5FXW A;  2HWD 2;  1PGL 2;  2VXJ A;  4Q4Y 2;  1QJU 3;  2RMU 2;  1DZQ A;  2E9Q A;  3I59 B;  1GBG A;  1PX3 A;  3JD7 3;  4MGS A;  4QU2 A;  1F5J A;  3ACF A;  4QD2 A;  4QGN A;  4U36 A;  4OI0 A;  5IVE A;  1GU3 A;  4PJY A;  4QKN A;  4XMA A;  1PZ7 A;  5L9B A;  1WD4 A;  3VBR C;  3WUD A;  3WNN A;  2Y34 A;  3GBG A;  1V6K A;  4QXK A;  3AX4 A;  3N9N A;  5FZG A;  3RRD A;  1XYO A;  4IE5 A;  5KHH A;  3ZN6 A;  2W1W A;  4P5H A;  5FZO B;  4FOY A;  2HWE 2;  3X29 B;  1Y3T A;  2R7E B;  3BPS A;  4HON A;  4J6G A;  1W3V A;  3TN9 1;  3GYD A;  3VGI A;  5CFC A;  1JZ2 A;  2BFU L;  2JXA A;  2JB8 A;  2QQN A;  1V9U 3;  3S6P A;  3MHZ A;  1IGO A;  1JU3 A;  2D93 A;  3A0K A;  2DCK A;  5CZK A;  1VBC 3;  2GN3 A;  3ILF A;  1R1Z A;  3ZN4 A;  5IVJ A;  3I49 A;  4DOU A;  1XYP A;  1QJX 3;  2XJS A;  1MZE A;  2LAL A;  1ZRF A;  1OH4 A;  2WRA A;  1CAX A;  4S2H A;  4BPZ A;  4HN1 A;  2X5I C;  4IUG A;  4Z2A A;  4A42 A;  3VBS B;  1ZYB A;  2XUE A;  4H7M A;  3QCW A;  5AC9 3;  4V2W A;  3FMG A;  4CE8 A;  2E7A A;  3C7H A;  3NAP C;  3ETP A;  3FC0 A;  1PZ8 A;  5C7G A;  1CX4 A;  2CAU A;  4YYO A;  4KBZ A;  2XVG A;  4OHW A;  3VBU B;  3VL8 A;  5DMY A;  4RS5 C;  3ZXG A;  2EIE A;  1YC6 1;  2RR1 2;  4QX8 A;  4BZ4 A;  1UX6 A;  4G4F A;  4NE9 A;  2E7Q A;  2P3K A;  3A21 A;  1BYH A;  1TME 1;  3MUZ 1;  1TEI A;  5FAX A;  1AL2 2;  1RIR A;  1C5I A;  2PMW B;  3U4S A;  1LHV A;  1QWR A;  4RQP A;  2JDM A;  2RM2 3;  3PTR B;  4A45 A;  2QZ3 A;  3O1M A;  2J1V A;  3MPP G;  1YQ2 A;  1FPN 3;  5DUV A;  3I3B A;  2DUR A;  2CU5 A;  5FYY A;  2F4P A;  4PT6 A;  2WS9 2;  2IXL A;  2W92 A;  2QQM A;  2UUR A;  4I0B A;  5EHD A;  3H8U A;  5C4W A;  3KQR A;  5A3P A;  3ILN A;  3NL1 A;  1C1F A;  3MIE A;  4XXP A;  3ZXA C;  4IXL A;  3OGR A;  4QB1 A;  2WA3 A;  1UPS A;  4LOT A;  1WCQ A;  5FZ4 A;  1QJZ A;  1C57 A;  3KWV A;  4Y26 A;  5F3G A;  1ND2 B;  2D3S A;  4Y3O A;  3WNO A;  4KL1 A;  5FOJ B;  1YEW A;  4BQ1 A;  3POS A;  2VJX A;  2W52 A;  4CPB A;  4OQ9 A;  5B4N A;  5F37 A;  3W9A A;  1CIY A;  1VLN A;  2ATF A;  4DUX A;  4CDQ B;  3ZYG A;  3FE5 A;  5BXX A;  1KS5 A;  1DYK A;  3UYJ A;  2OQ6 A;  3W59 A;  4CU8 A;  1CAV B;  2VBP A;  4H7L A;  3GF6 A;  3BYW A;  5FO9 B;  2XKO A;  4XUN A;  2ID4 A;  1W6Q A;  2XL7 A;  3NNF A;  1ZVF A;  2MHF A;  4K8F A;  4E8C A;  5KHJ A;  2BW8 A;  3WHT A;  1HRV 3;  4PI0 A;  1N1S A;  4RR3 C;  5FQ0 A;  1FOD 1;  2R04 1;  1SAC A;  3AJZ A;  3DKW A;  3WP3 A;  1RC6 A;  1N3Q A;  5F2S A;  3BOP A;  1QJY 2;  2VUD A;  4IEZ A;  1PMJ X;  2HWE 1;  2ARX A;  1WGP A;  1ZZ8 A;  1ZRI A;  2JG9 A;  4LOS A;  4MXV A;  4B8E A;  4HG6 B;  4MG2 A;  1RUG 2;  1ZBE 1;  1DGW A;  2RHP A;  2R1D A;  4LXL A;  3SIS A;  3CLP A;  1CX1 A;  2LS6 A;  4MXW B;  2D3R A;  4XJU A;  3RS6 A;  1QMJ A;  1EYB A;  4MX3 A;  2QKD A;  1U12 A;  2A75 A;  2Q8C A;  4FT8 A;  5JOZ A;  2ZX1 A;  3AKP A;  5C9A B;  4H14 A;  4Z2W A;  1WLT A;  3HBZ A;  2BNO A;  1WLW A;  3LCP A;  2A70 A;  4HZF A;  4A4A A;  4RGK A;  4JGY A;  1UAI A;  1YIF A;  3KB5 A;  2NZ9 A;  5DUU A;  1BK0 A;  1UF2 C;  3VKF C;  1LRH A;  2FHR A;  4OHX A;  2Q4S A;  2PAK A;  1NY7 1;  3ZVX A;  2NN8 A;  4GWN A;  2WSV A;  3VD4 A;  2O14 A;  3ZN5 A;  4XDO A;  5LEK A;  1GZW A;  3DPR B;  2C1F A;  2WS9 3;  3J7M A;  5FTT C;  4LIT A;  1J1L A;  1QJU 2;  4QHB A;  4UT5 A;  5FY7 A;  4LKS A;  3TRS B;  5C5T A;  2XHK A;  3WG3 A;  1BKZ A;  1PGL 1;  2XBO 3;  3WW3 A;  2IXC A;  4UXA A;  4GUL A;  4LKF A;  5F5A A;  3IWZ A;  4YLZ A;  2LRO A;  2X10 A;  3VHO A;  3WOG A;  4K20 A;  2JG8 A;  3N9Q A;  3NVC A;  3I3E A;  1OKO A;  3MUY 1;  2AGS A;  4S2D A;  5L9V A;  3LDR A;  5ABJ A;  1AR8 1;  2WDB A;  2Z5W A;  1EP0 A;  2UYB A;  4M3C E;  4QDR A;  3LGR A;  4N43 C;  5FY5 A;  4OCT A;  2NLR A;  3T0D A;  1UD1 A;  4FSJ A;  3KHB A;  1H8T A;  2RS3 2;  2WZ8 A;  4D3W A;  2ILM A;  4F7Z A;  4AED A;  4C1W A;  1RMU 1;  2OVU A;  3S7I A;  4CSW A;  5AC9 2;  3ZSJ A;  1OQ1 A;  1QJX 1;  4HVR A;  2ZX3 A;  4JQR A;  4IEQ A;  2GC3 A;  4ATF A;  4YG3 A;  1WCD J;  4BQW A;  2YC4 A;  1SLB A;  2VZ1 A;  4N9H A;  4OUS A;  4LLF A;  4HVQ A;  5CG9 A;  3KS7 A;  4L92 A;  1H4H A;  2Z4F A;  5K8S A;  3NWK A;  3I2O A;  3FFZ A;  3USS A;  4UFK A;  1PO1 3;  1HJF A;  1RB8 G;  3SIT A;  3TEY A;  5EZW A;  2FD8 A;  2VME A;  3RZH A;  3LPF A;  1COV 2;  3LEI A;  3UV9 A;  1JU4 A;  2D6M A;  1OA4 A;  3ALQ A;  5GZD A;  5FK8 A;  5IHR A;  5LA1 A;  3RDI A;  3ZFF B;  1OUR A;  3ZSK A;  4YNI A;  1NUK A;  3GJB A;  2VMF A;  2PQQ A;  5FZL A;  3LSD A;  5DDJ 2;  2VQT A;  1X50 A;  3RNS A;  2JDH A;  4Y20 A;  4IEX A;  4FPK A;  5GLU A;  1OHF A;  3VBF C;  5KXB A;  1VBE 3;  1RUG 1;  4HT1 T;  2Q0A A;  2ARC A;  1DQ6 A;  3H7J A;  4CDU C;  1O8P A;  3ZKY A;  3M3C A;  3QOP A;  2SBA A;  2ARA A;  4IE7 A;  4DIN B;  2B45 X;  1COV 3;  4YGD A;  3FWE A;  4RFT 0;  2PAM A;  1RVF 1;  2MPF A;  3MLJ A;  5FZ8 A;  3L9J T;  4X8N A;  3RZK A;  1XRU A;  3PME A;  1RUF 1;  4LHK A;  5A32 B;  1RMU 3;  3RZL A;  4EN6 B;  5A6Z A;  1F4A A;  4YSF A;  4EWA A;  5A6Q A;  4YW3 A;  3ZIW A;  1ULE A;  1D4M 2;  4A3X A;  3OB8 A;  2A73 B;  3BI3 A;  1RUH 2;  3A23 A;  1YQ6 A;  1VMH A;  3CDZ B;  1BVV A;  3ZPO A;  1OF4 A;  3JBG 3;  1RUG 3;  3DYP A;  4BIF A;  5BNN B;  1LOA A;  1MZF A;  2GC1 A;  2Y64 A;  3DEC A;  3ASI A;  2WWJ A;  1IQA A;  2EVX A;  3NKG A;  1JH5 A;  1UMI A;  5C8C C;  2QBX A;  1ND3 A;  2RS1 3;  3DYO A;  3E5U A;  4QGM A;  5FP9 A;  4BK5 A;  1Q8V A;  2JDZ A;  1C28 A;  4QPG B;  2ORX A;  3T2Q A;  4YZ1 A;  2E31 A;  4QPG A;  5JXI A;  2GN7 A;  3T30 A;  4P00 B;  3AVR A;  3FN9 A;  1HRI 3;  4HET A;  2J1R A;  4Y22 B;  1RUH 3;  3IB3 A;  2MNG A;  4YVS A;  4B3N A;  1VAV A;  4IGP A;  1R1A 2;  4TSV A;  4ISR A;  1FI2 A;  3POG A;  4Q4X 3;  5FYS A;  5LAS A;  5CG8 A;  1ZRC A;  5C3Q A;  4UW6 A;  2VL4 A;  5J7M A;  1SBF A;  3T0A A;  5FZE A;  1QXR A;  1PVC 1;  4XYX A;  2IWG B;  5EYY A;  3UGF A;  1UOB A;  2D6P A;  2GZW A;  1SBE A;  1OBN A;  2QQV A;  2R04 2;  4AHY A;  3APB A;  4DXZ A;  4A41 A;  5KXE A;  3RWK X;  5JZG A;  5C3R A;  4V1P A;  2AUY A;  4D69 A;  1G86 A;  4W6Y A;  4GD4 A;  3KD4 A;  3IDE A;  3SLI A;  1PNG A;  2VOT A;  1MVQ A;  5JXJ A;  2WO7 A;  4PQQ A;  5I8Y A;  3C7E A;  4XJ9 A;  3OCP A;  4ES9 A;  1VE0 A;  4JV4 A;  3ACG A;  4CVU A;  3NAP B;  5A3T A;  4PIX A;  5CAD A;  3BCW A;  1NCQ A;  4YG0 A;  1GNH A;  1UYZ A;  1CPN A;  1YFW A;  4UYB A;  1TNF A;  1D2Q A;  4JDM A;  2WNV C;  4UFM A;  3VBS C;  1IQD C;  4AGV A;  4DRV A;  2R04 3;  1PIV 3;  5IW0 A;  3ZKU A;  1FT9 A;  2C6S A;  1HRI 2;  1Y9G A;  1GFF 2;  4XBN A;  5F5C A;  4FPC A;  4CUB A;  1PK6 C;  3WX5 A;  5CVR A;  1W8H A;  2RM2 2;  1US3 A;  4KG0 A;  4NN0 A;  5C3O A;  4LA3 A;  4BQY A;  1YFY A;  5I8S A;  3LKJ A;  3N9P A;  5GAL A;  2XVL A;  1DQ4 A;  1ZRD A;  1MS5 A;  1JN2 P;  2HYK A;  5KXC A;  2W94 A;  1TMF 1;  4Y1Z A;  1XOY A;  1FPN 1;  3H3L A;  2JDY A;  4NRM A;  1GWM A;  3IDB B;  3CEW A;  4YM1 A;  4CUC A;  3H1W A;  5C8C A;  1W90 A;  1ENR A;  2GDF A;  1CJD A;  1RUF 3;  2OII A;  3M3O A;  3ON7 A;  5FUI A;  4LQR A;  2GAL A;  1W8T A;  2WC2 A;  4IEP A;  1U5Z A;  2YHJ A;  5LRR A;  3T2O A;  3MW2 A;  1NCR C;  4D7Y A;  4ASK A;  4NIA A;  5FMO S;  1FV3 A;  3ZN6 B;  4Y33 A;  2VMC A;  2VCB A;  4XW3 A;  3BU0 A;  2RG4 A;  1XE8 A;  3ZYI B;  2JDP A;  2DF7 A;  3SCH A;  2VOW A;  3FUQ A;  2ZTN A;  2DCY A;  3MID A;  4TTG A;  5T55 A;  2VZS A;  1JOD A;  4CCL A;  1DBN A;  3ZR5 A;  4GJY A;  3I2F A;  4XTP A;  1OLM A;  1DGW X;  2YYO A;  1A3K A;  1RMU 2;  1IKQ A;  4LUK A;  4DXR A;  3U75 A;  3CBN A;  5EV7 A;  4YW4 A;  2D40 A;  2F6B A;  5JZG C;  4LO4 B;  1YJK A;  5FUP A;  3ZYB A;  4NR1 A;  3PTY A;  2TNF A;  3ZFG B;  1TQ5 A;  1SDW A;  5FZK A;  4CDX A;  4LUL A;  3BOD A;  1NXM A;  1OKQ A;  3FZ3 A;  4COW A;  4EN0 A;  3U4X A;  4QX0 A;  2JD4 A;  3ZXD A;  1QNY A;  5DDJ 3;  5FIX A;  3LIH A;  5FMB A;  1J59 A;  1QGL A;  4QQO A;  3WDV A;  2EAK A;  1UNB A;  2QDR A;  3JXS A;  4JDO A;  5K9Y A;  3ES1 A;  2VR4 A;  4U2A A;  3WSO A;  3HQR A;  3FHQ A;  4UW5 A;  3T1L A;  2KXL A;  1X7N A;  3MYX A;  5FO8 B;  3I2J A;  1DQ0 A;  1JYC A;  2RDQ A;  3LEM A;  4ZU4 A;  2BFU S;  5B4X A;  5L19 A;  2ZEW A;  3WW4 A;  5BPX A;  5FRE A;  4MXW A;  1Y9M A;  1XNB A;  2VUA A;  1V6J A;  2RJ2 A;  2Y26 A;  5D8A C;  4QPI C;  3TWI A;  1F31 A;  4XDQ A;  1TE1 B;  4E2G A;  1EUU A;  3IMM A;  5CB7 A;  2AAC A;  3M3Q A;  5CEH A;  2A7A A;  2WYF A;  1VBD 3;  4LE3 A;  3AP4 A;  2JD9 A;  2W0X A;  2NQY A;  4L2N A;  3DGT A;  4Q0U A;  3AKT A;  2MEV 3;  2VEC A;  4IEU A;  5BYN A;  1W8N A;  4XFG A;  3LE0 A;  4MGK E;  2ZAC A;  1HJG A;  4JGZ B;  4WZC A;  4OQ8 A;  2J42 A;  2QQW A;  2VC9 A;  3R4U A;  4E27 A;  3J26 N;  1JYW A;  2R0H A;  3D0S A;  1BBT 1;  1T6B X;  1E57 A;  1VRH 1;  3MI8 A;  4FP2 A;  3OGS A;  1JOP A;  2D3P A;  4GH4 A;  4OZX A;  4XF9 A;  3DEM A;  5FPB A;  3MIC A;  1F9K A;  4RA0 A;  4CEY A;  2ZHK A;  1SCR A;  4MGQ A;  2V73 A;  4DY5 A;  3JCI A;  4GXL A;  3SH3 A;  3UK9 A;  4CYD A;  1NA1 C;  5L73 A;  1DQ2 A;  1ZBA 2;  3RPQ A;  5GZC A;  5I0D A;  2H6B A;  3AC0 A;  3H50 A;  4MUV A;  1AR6 1;  5E88 A;  5CFC C;  5IVB A;  1ZZ9 A;  5LBB A;  3TEW A;  1KXG A;  3B01 A;  2TUN A;  3WQB A;  3OBR A;  3FLR A;  1JYI A;  3ZSM A;  2WFF 2;  1N1Y A;  4B4R A;  2EAL A;  2A6W A;  5GJ6 A;  4MV2 A;  3DKQ A;  3EJK A;  4C1X A;  1QH6 A;  3MEP A;  1S0J A;  2VW2 A;  1SFN A;  3KVA A;  4AOC A;  2VCM A;  3K3O A;  3OPZ A;  1C8M 1;  5I0R A;  1DQ5 A;  2QTW B;  3IIA A;  1UL9 A;  5JWP A;  3POY A;  4PF1 A;  1CIW A;  4Y5S A;  5I8T A;  5GZG A;  1MR5 A;  2QZ2 A;  2ZHN A;  1DF0 A;  4HAN A;  3BIE A;  2P5B A;  2YPD A;  4J1X A;  2CY6 A;  2ZHM A;  3V56 A;  5KBF A;  5JVV A;  1AYM 1;  4B4P A;  1W0N A;  2G4I A;  3KV9 A;  2ZGU A;  1OD3 A;  2VW1 A;  4Q5O A;  1MQT B;  2C5D A;  4XFC A;  1LOE A;  4OI2 A;  1MQT A;  1YXW A;  4Q1R A;  1ZNP A;  3PVE A;  3GZE A;  3M1H A;  4AQ6 A;  2NYY A;  1LED A;  4WBB A;  4CPB D;  2DVF A;  1OFS A;  1URX A;  1AR9 1;  3JBG 1;  4P9Y A;  4N53 A;  3VKM A;  4XF3 A;  4XXA A;  3TOJ A;  4RQP C;  3WF2 A;  3D8C A;  3ZO0 B;  3ETQ A;  3PJY A;  4DUW A;  2DUQ A;  2JIC A;  1LEC A;  1GQH A;  5KC5 A;  1I1E A;  1TZO A;  3OUJ A;  2VOK A;  4DY3 A;  1NZI A;  1KS4 A;  3VBO C;  5FDB A;  2PTM A;  2BP6 A;  4FFF A;  3AMN A;  2EIB A;  4XQW A;  2CV6 A;  5FMC A;  3DL3 A;  5I0S A;  1W9F A;  1APN A;  1UMZ A;  5DZE A;  5IWF A;  4DIQ A;  2GC0 A;  5T54 A;  2RS5 1;  5A6Y A;  1IPJ A;  2QQK A;  2BVB A;  4AVB A;  1FV2 A;  5FP4 A;  3W5M A;  1NY7 2;  5FYB A;  4QQL A;  4GH4 C;  3VDD B;  5DDJ 1;  1UY1 A;  3WP4 A;  5L7O C;  1RIT A;  4Q8L A;  1OOP C;  1MS9 A;  4P5Y A;  4P9X A;  3GBF A;  5JLV A;  4YW2 A;  2W1Q A;  3IKW A;  3IN9 A;  4BH9 A;  3SKV A;  1CR7 A;  3HEI A;  5FJH A;  3ZFE A;  4XF0 A;  5F9T A;  5FLJ A;  2WT1 A;  3RGB A;  4QQH A;  3RQ0 A;  3MFC A;  1RHI 2;  1DYP A;  5JPN B;  1W2T A;  2J7M A;  5FP7 A;  1JYT A;  3ZYR A;  3RWN A;  3ZDV A;  2RS5 3;  5FYC A;  5A3U A;  2LRP A;  1NQJ A;  2I74 A;  4A6S A;  2VNR A;  5T5L A;  3H3U A;  4AYU A;  2JX9 A;  3E97 A;  4NIG A;  3OY8 B;  2VUJ A;  3I8T A;  3M4F A;  2JG8 B;  3HT2 A;  2TBV A;  3WDT A;  1UKR A;  1LOF C;  3G6J B;  2HEV F;  3HN1 A;  1MVE A;  4CXY A;  1U0A A;  2G9G A;  2ZGO A;  2HEY F;  3BPZ A;  4LBL A;  4YGC A;  1W6Q B;  2YFZ A;  3I3Q A;  4QX5 A;  3FL7 A;  4LBQ D;  4WM7 B;  1DYO A;  1GNZ A;  4D7T A;  3Q8C A;  4YW6 A;  4QKD A;  5APA A;  2AC1 A;  4Y1V A;  5IK4 A;  1EPW A;  1AVB A;  3LOB A;  2WBK A;  1X36 A;  2O0O A;  1NAE A;  2PAE A;  1VBA 1;  4XBQ A;  5LY2 A;  4K7J A;  2FDG A;  1MAC A;  3S0M A;  3AYC A;  4V2V A;  2Y6J A;  3NJV A;  1EAH 1;  4GB3 3;  4L8Q A;  4RGA A;  4XEZ A;  4XUT A;  3I3M A;  4XAE A;  1W2A X;  4AF9 A;  5IFT A;  1O3S A;  1HIX A;  3VBU A;  2A6V A;  1S0G A;  2WIN B;  5GLT A;  2BBA A;  1ONA A;  1SZB A;  2D7F A;  3KV4 A;  3PIJ A;  5F5Q A;  3O0W A;  2FMD A;  4W6W A;  4N53 C;  5JSP A;  2W9X A;  2P34 A;  3KGZ A;  1JHJ A;  3ZYF A;  3FUO A;  2XJQ A;  2BGO A;  4Y4R A;  3U37 A;  5CIS A;  2ZHL A;  3WP5 A;  3AFG A;  5EYX A;  1QDO A;  3TN9 3;  4NMI A;  2NMN A;  5BV6 A;  3ZM8 A;  2R06 3;  4DRR A;  5F6L B;  4M0N A;  5IAV A;  4NIH A;  4QT6 A;  2WFP A;  3IPV A;  1QJE A;  3PDQ A;  3KMH A;  1UKG A;  2XPJ A;  2FMY A;  3P5B A;  1QU0 A;  2BNN A;  4BLJ A;  4LHL A;  4IET A;  4ONU A;  3N3H A;  3AZW A;  4S2G A;  1IKP A;  1JTZ X;  3O1U A;  3T0B A;  4I0W B;  4XMI A;  3N4M A;  2Q8E A;  5CBL A;  1RUF 2;  5A3W A;  4XBL A;  1RUN A;  2JB4 A;  4YVW A;  1VMJ A;  5FP3 A;  4FQZ A;  3WLU A;  1RL3 A;  5G05 L;  2X05 A;  2WNU A;  1VBA 3;  1W06 A;  1HB3 A;  2ZKN A;  1DFQ A;  1GUI A;  4HBN A;  4OVE A;  2RR1 1;  3VD9 A;  1JXN A;  1GOH A;  1JS9 A;  3MGU A;  5ABJ C;  2AEN A;  4HXC A;  2QDN A;  4KWJ A;  1LES A;  2GH8 A;  4LO7 A;  3WDY A;  4BQX A;  1G9C A;  4OUE A;  2WN3 A;  3I97 A;  1VBD 2;  1CAV A;  3PIG A;  3AYA A;  1AR7 3;  5JMO A;  3MBW A;  3V65 A;  5A7W B;  4KWL A;  1VMF A;  1L3J A;  2ADD A;  4CCE A;  3ZXE A;  4XHX A;  1YQ5 A;  2XHN A;  2HWB 2;  2VTF A;  3ECQ A;  3O0V A;  3K77 A;  3THT A;  1ND3 B;  3T3Y A;  5HCA A;  5EXO A;  2P6C A;  4NII A;  2ZPX A;  4KWK A;  2D5F A;  3GHM A;  1B09 A;  1LEN A;  3DXU A;  1EY2 A;  5IVF A;  3O1R A;  5D1I A;  2PHW A;  4RHV 1;  1IG0 A;  3VDB A;  5BNN A;  5T50 A;  2GP3 A;  4CXX A;  1VPH A;  4XVH A;  4BYY A;  1OLR A;  2VZU A;  3IDA A;  4O9E A;  4FPL A;  1QOT A;  2A6Y A;  2VO5 A;  4Q4W 3;  3RYK A;  1YWK A;  4MHR A;  3QBQ A;  1LOB A;  4COV A;  5HXM A;  2WR9 A;  5K7P A;  1MS3 A;  5F2W A;  4W6X A;  2XQX A;  4TZD A;  1AR6 3;  1HN1 A;  2YBS A;  2W3J A;  4ZXK A;  3BUC A;  1VBD 1;  4QMA A;  1OA2 A;  1U5X A;  4Y24 A;  5F39 A;  1WW7 A;  2WAO A;  5FYV A;  5F7U A;  4AI3 A;  4AHZ A;  5CFD C;  1KRI A;  1H9W A;  1K5M B;  1HLC A;  5DAQ A;  5D8A A;  3K46 A;  4O7X A;  4MYE A;  4KG8 A;  1UN1 A;  1BXH A;  4NHY A;  2Z2S B;  3N35 A;  2ES3 A;  4IV1 C;  5FMD A;  2PHT A;  3NNJ A;  2YBK A;  1A6C A;  4YGB A;  4TLG A;  5SV8 A;  1W8W A;  1NOV A;  1A8D A;  3VDC A;  2TEP A;  4TLF A;  2XLG A;  2R06 1;  3AFK A;  4Q26 A;  4UWD A;  4Y5T A;  1JZ8 A;  4G3Y C;  4ARX A;  3HJR A;  2V5Y A;  5BNP C;  4LK7 A;  1GWK A;  2VBD A;  4XAA A;  4A2U A;  4UOJ A;  5A70 A;  2DVB A;  4AW7 A;  1G9D A;  3III A;  2P3J A;  4K40 A;  2BYV E;  3EYP A;  3SXW A;  4GB3 2;  4XFI A;  2ZGT A;  1XXN A;  1DHK B;  1MEC 1;  1RGS A;  3IT8 A;  2F4L A;  1D2S A;  4DXT A;  1F15 A;  2VVD A;  2OPK A;  3KT1 A;  4URT A;  3V0B B;  1I6X A;  2NP0 A;  2W87 A;  5FOB B;  1QH7 A;  4DEQ A;  4BOW A;  1HDK A;  1OXC A;  3ELN A;  1AR7 2;  1B35 C;  5JOY A;  3A0N A;  4I0A A;  5HCF A;  3WG1 A;  3OEA A;  4GWM A;  3EMR A;  1PO2 1;  1YJL A;  1NYW A;  1WBF A;  2Q30 A;  2RDS A;  3BGA A;  4BJ0 A;  2ZML A;  3WHU A;  2VE1 A;  1UOG A;  4ES8 A;  4IEO A;  1A78 A;  3K2O A;  4NWW A;  5CA6 A;  5F3I A;  2JEN A;  3AKQ A;  5DAV A;  4FPF A;  2VNO A;  3N9M A;  4RR3 A;  1VRB A;  2QVS B;  3ST7 A;  3GZU C;  1O59 A;  4WM7 C;  1UZ0 A;  1H30 A;  1HXS 1;  1MEC 2;  3WDX A;  1GWL A;  4CCC A;  3ME2 A;  3VD3 A;  1VRH 2;  3DCQ A;  1O5U A;  3A4U A;  3ABZ A;  4PCR A;  4NWV A;  4AVT A;  4YFW A;  3SHR A;  3HNB M;  3KGL A;  4QX1 A;  1AL2 3;  4COU A;  4KNC A;  1OT5 A;  2H0V A;  4CP9 B;  1PMI A;  3ILR A;  5IYY A;  5CAZ A;  1SG3 A;  1V6L A;  1H2N A;  1WD3 A;  2EXK A;  1UXX X;  2W95 A;  3C2U A;  3SH4 A;  4BCU A;  3OTF A;  4FTB A;  4HK8 A;  1LU2 A;  2QQP A;  1ND2 A;  2BWA A;  2ZS6 B;  2B46 X;  3H7Y A;  4Y1Y A;  5I0U A;  3VBS A;  3WV6 A;  3O1V A;  2XJT A;  3OGV A;  4URA A;  2XH6 A;  3BVC A;  1OOP B;  2YFU A;  2K9Z A;  1EPZ A;  5FZI A;  2OXB A;  3TAY A;  5FYZ A;  3WNP A;  1EV1 2;  2P17 A;  5J98 B;  2E63 A;  4IES A;  4M4R A;  2JDN A;  2F17 A;  4JRA A;  2DVD A;  4WVM B;  2FZ1 A;  4XQ4 A;  3KCY A;  2VU9 A;  3GHN A;  5GZF A;  4LK6 A;  4CDX B;  1GAN A;  1Q8S A;  1KD7 A;  3CZU A;  5BY5 A;  3ATG A;  3LA2 A;  2I07 B;  4XUQ A;  1PIV 2;  5FY0 A;  1N1V A;  2PYT A;  5FBJ A;  4K8R B;  1W05 A;  4LBJ A;  5FCC A;  3B9I A;  3AM2 A;  2DUO A;  1AX1 A;  4Y5Z 0;  1OSG A;  3CL1 A;  2EXJ A;  4RQP B;  4F3J A;  1W6O A;  1H2L A;  2VZP A;  3MPB A;  4IND A;  3WG2 A;  4A44 A;  4EYU A;  1MZ5 A;  1UU5 A;  4XFA A;  3ZFE C;  1SFY A;  1EV1 3;  1PHM A;  2DCZ A;  3A7Q A;  2E26 A;  4NHL A;  3WF3 A;  2YPJ A;  2ZXQ A;  3JQW A;  4CU9 A;  1CZV A;  3Q8A A;  5IT6 A;  3D3A A;  1R1A 1;  2HLE A;  2VMI A;  3LFM A;  4JDN A;  3LQC A;  4BQ5 A;  4LBM A;  2BTV C;  2JDA A;  3RZG A;  1BMV 1;  1JUH A;  1US2 A;  3ZMN A;  4HSL A;  1GOF A;  3RVH A;  5LEJ A;  3GGL A;  2V72 A;  3H1M A;  4GAL A;  2VTX A;  3RFR A;  5FKB A;  3LZZ A;  3EXU A;  1K3I A;  4NHK A;  4NAM A;  4GKX A;  4R8H A;  1ZX5 A;  3F2Z A;  4AED C;  2R30 A;  2Y6K A;  1JI6 A;  1WLC A;  2RJK A;  4EJR A;  3O0X A;  1BEV 2;  2K0G A;  3K51 A;  1E5R A;  1ZZ7 A;  5FP8 A;  5FZH A;  2OS2 A;  4AVC A;  4NRO A;  1HQL A;  1VBA 2;  3KCX A;  3AP7 A;  3P1I A;  1NG0 A;  2A3W A;  5H9P A;  4AG4 A;  5F3C A;  2FDK A;  4OHZ A;  3DV8 A;  5FYM A;  3VZO A;  2ENR A;  2XKP A;  4AAP A;  1XQN A;  2BGP A;  2C4X A;  1S2E A;  2FQP A;  3MIH A;  3MZH A;  2XLA A;  1AR6 2;  1XPW A;  2VCC A;  4NPL A;  5FRA A;  2NM1 A;  2WII B;  2YY1 A;  5GLW A;  1W6N A;  1Z7S 3;  3NJX A;  2YG0 A;  1ZBA 3;  3LB9 A;  2BOJ A;  3H8O A;  3S7E A;  4PDW C;  1ZZC A;  4YVS C;  4IE0 A;  1NXD 1;  4FPE A;  4L11 A;  1NA1 B;  1TMF 3;  5JR7 B;  1RED A;  5A3N A;  3R4S A;  4JAA A;  4CTE A;  2Z69 A;  1ULG A;  3KQ4 B;  4QPY A;  3WP6 A;  1LOG A;  1DLC A;  1AX2 A;  2BU9 A;  2R0F A;  3FHI B;  4Q0P A;  4Q4V 2;  4JHZ A;  3NJY A;  4UW3 A;  1V6I A;  4AI1 A;  2PHX A;  3MLK A;  5DXD A;  1OF3 A;  1QF3 A;  2DBN A;  3BTX A;  3OEB A;  3SCG A;  5DZF A;  1CPM A;  3FLP A;  4K1Y A;  3D82 A;  2DU1 A;  2UYA A;  1DGR N;  4P9I A;  3CU7 A;  1LHU A;  5E6H A;  4JGZ C;  3OUH A;  3RZZ A;  1UY0 A;  1W03 A;  1AR8 3;  1NX9 A;  4CDW A;  1RUO A;  4XFH A;  2D44 A;  5I93 A;  2QQL A;  3GNE A;  3C7F A;  3QAC A;  4NPM A;  5D21 A;  5K4L A;  4BIO A;  5J36 A;  5IK5 A;  2RV9 A;  2WZR 1;  3PUH A;  3E1F 1;  2W2I A;  5FPV A;  1PGW 2;  1RUE 1;  4FP3 A;  4PI2 A;  4ZS2 A;  3E6D A;  1EAH 2;  4XZP A;  5GM0 A;  4EE2 A;  3KF3 A;  4I3P A;  1E5S A;  5F3E A;  3HPN A;  1UY4 A;  5D8A B;  2PLV 3;  3J7N A;  2VCA A;  5LK7 B;  3BB6 A;  2XBO 2;  4YM0 A;  1HKD A;  5ISL A;  4GQ7 A;  4XCB A;  3USU B;  3WF0 A;  3ZXF A;  1W9Y A;  1ZA4 A;  5HBA A;  3P6B A;  1NE6 A;  1PIV 1;  3ZFF A;  1SLA A;  1QOO A;  3GZA A;  2DCT A;  4YVS B;  4LBN A;  3WY6 A;  5JI9 A;  1SPP A;  4R4X A;  1GV9 A;  1QDC A;  1I9R A;  2RS5 2;  3PLQ A;  4PIY A;  3BTY A;  4K1Z A;  1AZD A;  5FXZ A;  4ZZ8 A;  1X33 A;  4ORF A;  1MZ6 A;  4XET A;  5F5I A;  2ARB A;  2ZGK A;  5G04 L;  4AEJ A;  1QXP A;  5EPA A;  4FPG A;  3C7G A;  4TN7 A;  1GYK A;  2OPW A;  1ZZ6 A;  3U07 A;  1UOJ A;  1Z78 A;  2OW4 A;  3CZJ A;  4OUL A;  3U14 A;  4IV3 B;  1CWP A;  2H0B A;  4QXC A;  4MHU A;  5JZG B;  3TB0 A;  5A80 A;  4X6Q B;  4LIV A;  2YBP A;  1SLL A;  1REF A;  2ZGS A;  2R1B A;  1GQG A;  4KGG A;  4UF0 A;  4AED B;  5J48 A;  4PDW A;  3POI A;  1UXZ A;  1J83 A;  1VB4 A;  1O8S A;  5BNO C;  1X8E A;  3LA7 A;  3HQX A;  4EQV A;  4F8A A;  5FPX A;  4EZH A;  3S30 A;  4OYU A;  5DAB A;  4XQD A;  2HWC 1;  1H8T C;  5FZ7 A;  1LAJ A;  4NHX A;  2CGN A;  4Q4W 2;  1XSR A;  2UWC A;  1E5H A;  3KLS A;  2QNK A;  2XVK A;  4XUR A;  1W39 A;  2Q8O A;  1HRV 2;  3RI8 A;  2V4V A;  5ERL A;  1BK1 A;  1FNZ A;  2IC1 A;  3LIG A;  4IGO A;  3WD5 A;  3NJZ A;  1M4W A;  2WAB A;  5GKA C;  4ZON A;  2BNM A;  2WQ8 A;  3JBG 2;  1H4G A;  2E32 A;  1IPK A;  1Q43 A;  3B00 A;  4FXG B;  4QGL A;  3VN4 A;  3ZXJ A;  1UWW A;  1NLQ A;  3K4Z A;  2K46 A;  5FXX A;  3D4K A;  4MGT A;  2XB6 C;  1LGC A;  1VP6 A;  4FI9 A;  5HV0 A;  3NNM A;  1PGW 1;  4CDX C;  4QX2 A;  4BQ3 A;  1C3H A;  3C7O A;  4N8M A;  1RUI 1;  1CD3 G;  3WDW A;  3TNQ A;  1S2B A;  4F83 A;  1VR3 A;  2WS9 1;  4JHT A;  1LR5 A;  2LTN A;  5FR3 A;  1HV1 A;  3OF1 A;  1ZBE 3;  3KVB A;  3E6B A;  4XOG A;  1PK6 B;  2X53 S;  3CKH A;  5HPO A;  3O1T A;  2C0Z A;  1Z7S 2;  1H8V A;  1PO1 2;  4LBQ A;  4LPL A;  5A3O A;  1XU2 A;  3J7L A;  4LLO A;  4QPW A;  1MEC 3;  1ULP A;  1Y7B A;  5T5J A;  2ZGM A;  1NCR A;  2VQ0 A;  4JQT A;  1HRV 1;  3GAL A;  1ST8 A;  3ROU A;  2VZ3 A;  5LY1 A;  3H3Z A;  4RS5 A;  1PO2 2;  3M70 A;  1UYX A;  1AYM 2;  1RHI 1;  1F2N A;  2A3X A;  3AMP A;  2UY9 A;  5FFO C;  2QJV A;  3VBH A;  5C6C A;  2XL9 A;  2PN5 A;  1BEV 3;  4GMP 3;  4Y20 B;  3AP9 A;  3IPV B;  4EN8 B;  5ACA 2;  5JR2 A;  1SDD B;  1LOD A;  4WVZ A;  3J8F 2;  1CJP A;  5H9S A;  3UJO A;  1QY4 A;  5FPU A;  1C8M 2;  2UU8 A;  2SLI A;  3HBK A;  4WM7 A;  3JU9 A;  1POV 0;  1DG6 A;  2QUO A;  1LUL A;  3GCW A;  3OGG A;  3RYP A;  1JYX A;  5DAX A;  1JBC A;  3ZYJ B;  2ADE A;  4BU2 A;  5C4W C;  4FOW A;  2BWC A;  4N90 A;  4NPR A;  4CZS A;  1DP0 A;  1W99 A;  4IDZ A;  3N7K A;  3T2P A;  3HIF A;  3LWC A;  5FZF A;  3WF4 A;  4N43 A;  3HWJ A;  4PDW B;  2Y6F A;  4EN9 B;  3CF6 E;  5CKN A;  2GSY A;  1WBL A;  2JJ6 A;  3WNM A;  4NID A;  1WKY A;  5JI7 A;  1AR7 1;  1C8N A;  1YIP A;  1D0G A;  1S4C A;  4JTO A;  5E1R A;  4AXO A;  2ZKL A;  2WZP P;  3I4I A;  1AL2 1;  4YW1 A;  1X82 A;  1WUV A;  3TNP B;  5EQU A;  5E8A A;  3WZ1 A;  5HI0 A;  1QEX A;  3UJQ A;  2B4K A;  1BZW A;  5C8C B;  2CL2 A;  1YQC A;  3IAQ A;  1I5Z A;  5JXG A;  5KC6 A;  2HWC 3;  4FTE A;  1S0F A;  4R9A A;  3RJR A;  1SQ4 A;  5E16 A;  1JZ6 A;  1RUH 1;  5JIA A;  5T52 A;  1VBE 2;  1BHG A;  5JSO A;  5KWR A;  1QJF A;  3M8L A;  1SMV A;  2DU0 A;  1JZ4 A;  4QAW A;  4RYD A;  3VBH B;  2DCJ A;  2VM9 A;  4FVV A;  1AF9 A;  2YC0 A;  4AFA A;  2ZGQ A;  2JWP A;  2BPA 2;  2DVG A;  1POV 1;  2RS3 1;  5FLH A;  3V64 A;  3AL6 A;  4CCJ A;  2FDI A;  4Y1X A;  1ASJ 3;  1UO9 A;  5SV5 A;  1Q5O A;  2XQR A;  3S5Q A;  3B94 A;  3I2D A;  3U1X A;  3M2M A;  5DAW A;  3ZFE B;  4CDU A;  2OZ6 A;  2WNU C;  3IM0 A;  1IPS A;  5LA9 A;  4FPH A;  2Z42 A;  4K6B A;  5CFD B;  1YRZ A;  1LHW A;  4YZ2 A;  1SLT A;  2N7G A;  4CA9 A;  3HN3 A;  3VBF B;  2RDR A;  1GZT A;  2ZMN A;  3EB7 A;  1Q8P A;  5T3N A;  4BQ2 A;  4D6Q A;  3KCC A;  1WCS A;  1GZW B;  3DPR A;  3WXP A;  4YZ5 A;  5IJR A;  4HKO A;  2YU1 A;  3VBO A;  1G8W A;  3UKN A;  4MO3 M;  1CZT A;  1LJ7 A;  3WQ7 A;  2ZGL A;  4FO9 A;  1ASJ 1;  3D6E A;  3WW1 A;  3LOI A;  2VNG A;  3U0Z A;  1XNC A;  1Z0H A;  5LBF A;  4J1W A;  1VBC 2;  5FKC A;  1GZ9 A;  1CVN A;  4AHW A;  4X8P A;  4M00 A;  2CAV A;  3ES4 A;  2C24 A;  4AFM A;  5AVA A;  1CAW B;  5IK8 A;  4CRQ A;  1O4T A;  1ND3 C;  4QX7 A;  2FCV A;  4Z8B A;  1XNA A;  1V70 A;  4Y22 A;  2ZA9 A;  2XDV A;  3J8F 1;  1GZC A;  2Y60 A;  3DN7 A;  2BBV A;  1KDM A;  4P02 B;  4SLI A;  2HYX A;  2WO3 A;  3W5N A;  2YRO A;  5FZ9 A;  1RUD 3;  2WFF 3;  4QKB A;  1BMV 2;  3OYW B;  1IS3 A;  4AE2 A;  1ACC A;  1AXY A;  2G19 A;  5FYU A;  3WR0 A;  2Y33 A;  5FZ6 A;  2HEW F;  3A22 A;  3WT3 A;  1PMH X;  3CNA A;  4R4Z A;  3WCR A;  1IS6 A;  4AQ2 A;  5A1F A;  4IE6 A;  4TWT A;  1AR9 3;  2KA3 A;  4PBP A;  2DTW A;  1XU1 A;  2IFW A;  4L99 A;  1FOD 2;  1OI6 A;  4IL7 A;  4E4Z A;  4DS0 A;  1V9U 2;  4GMP 0;  2FCT A;  3MW4 A;  5A33 A;  4AVS A;  3V0A B;  2XJR A;  4BME A;  1XE7 A;  3VKO A;  4EWD A;  4DO0 A;  4PF5 A;  3NNG A;  5FBZ A;  1LB2 A;  2FDF A;  1LCL A;  1BCX A;  1SPP B;  1RUI 2;  2C9A A;  2XGX A;  4PLO A;  4CEW B;  1GQP A;  4LUM A;  4KU8 A;  5FZC A;  3VHN A;  3E6C C;  3V0B A;  4QQP A;  3SKJ E;  2CWS A;  4FPJ A;  2GU9 A;  1KEX A;  3JZV A;  2MEV 2;  4AK3 A;  2B9V A;  3MV0 1;  4G9S B;  4B1L A;  1UOF A;  2ZJC A;  3BOW A;  1JOB A;  1RUC 3;  1W2N A;  2BVV A;  3ENR A;  1WZX A;  2I45 A;  4TYS A;  5FLI A;  1X8M A;  1SFP A;  2MEV 1;  3BTZ A;  3EQE A;  1RXG A;  1Y4W A;  2R6Q A;  1DDL A;  2LW8 A;  3S5A A;  4CEW C;  2GAU A;  2J1T A;  4LO6 B;  1UZW A;  2UY8 A;  2VMG A;  5C9A C;  4Q4V 1;  4Y1U A;  1H2M A;  2YDE A;  3TEX A;  2V4A A;  1LEM A;  1D0H A;  1ALY A;  4RN5 A;  4Q4W 1;  4Z82 A;  1ULD A;  4C0H A;  2V09 A;  4XUP A;  5BNP B;  5AVP A;  2L9L A;  2ZX2 A;  5TSW A;  1CAU A;  4BWO A;  4JRL A;  2VBB A;  4BA6 A;  1JZ3 A;  1FOD 3;  4IV1 B;  4XE9 A;  4AI8 A;  1L7L A;  4LA2 A;  3AZY A;  4MAD A;  3WUC A;  4A7Y A;  1K5M C;  1FXZ A;  4M3C B;  5T5P A;  2XML A;  3CHX A;  5KXD A;  4OMC A;  1DQ1 A;  4RR3 B;  4XF1 A;  3W21 A;  4D8M A;  2YV8 A;  3LFI A;  2JG8 C;  1T6G C;  1ASJ 2;  3FBM A;  4R9B A;  4FPY A;  1PO2 3;  4KI5 M;  3ZMO A;  1AYM 3;  1OLM E;  1GP6 A;  5FXV A;  5CKQ A;  2XJP A;  2DBI A;  3PUS A;  5DZG A;  3VKL A;  3OBA A;  2FBE A;  2HWE 3;  5LBE A;  4CDQ C;  2IFR A;  4P14 A;  1NA1 A;  1CZS A;  5CKM A;  3KV5 A;  1UPI A;  1BJQ A;  3FFQ A;  3LD8 A;  1QJY 1;  3M3I A;  2O8O A;  4LO5 B;  2D6N A;  5J37 A;  1ND2 C;  3VHP A;  4B1M A;  1WME A;  1UZY A;  2GME A;  1RJ7 A;  3E5Q A;  2EF6 A;  5L7O B;  3O1S A;  4GH4 B;  3VDD C;  4XJA A;  1OUS A;  2XR4 A;  1GLH A;  1SHW B;  3U11 A;  1QHD A;  1W04 A;  4XC9 A;  4ET7 A;  1MS0 A;  2ZAH A;  3T4V A;  3AMH A;  1W8Z A;  1MS1 A;  2WSU A;  2RE9 A;  2WWU A;  2HJI A;  2JE7 A;  4COZ A;  4S2F A;  1ZRR A;  3BIW E;  3QH7 A;  4ZXE A;  3VBO B;  4C90 A;  3AL5 A;  4UFH A;  3RYR A;  1KGY A;  5FV3 A;  1UU4 A;  1V6O A;  2P4E A;  5A3M A;  3R4D B;  4OI1 A;  2NMO A;  5L9R A;  5FZB A;  4HL0 A;  2ZZQ A;  2WNU B;  1POQ A;  2ZEX A;  4ZKT B;  2ZAA A;  4AFC A;  2Y38 A;  4FFI A;  4N7U A;  5JSR A;  1UIK A;  2WAA A;  3OPT A;  1W0P A;  1MQT C;  1M06 G;  2WZR 2;  2VUC A;  3RZJ A;  2HKX A;  2K2S A;  1RUC 2;  3UET A;  4FXK B;  1UMH A;  3AKR A;  2VGD A;  1OLQ A;  1W6M A;  3GBW A;  5JIU A;  1G6N A;  1QNW A;  4KMQ A;  3VBH C;  3PUQ A;  1GKB A;  2VMH A;  4PQ9 A;  4MGY E;  3URF A;  4AR2 A;  1XE0 A;  2KD7 A;  1YI9 A;  3VHR A;  2Z79 A;  4N7I A;  1N1T A;  1OQD A;  2WT0 A;  4NVP A;  4XJW A;  4L0P A;  1JUI A;  2JE9 A;  3SQO A;  2NPI A;  2ZEZ A;  4IEV A;  1ODN A;  1HXS 2;  2WLP A;  3OPW A;  4QHZ A;  1HQN A;  3R0R A;  5DG1 A;  4H2A A;  2EIC A;  4LT5 A;  4HKL A;  1H6Y A;  4QDQ A;  2R07 1;  1WMD A;  1O3T A;  4Z1V A;  1S1A A;  1REE A;  4AI9 A;  3GCX A;  2YGM A;  5A7S A;  1WW5 A;  3BU7 A;  5AC9 1;  5CFC B;  4M3C F;  4QQ2 A;  1B35 A;  3D5O A;  4JVA A;  2HWD 3;  5LWB A;  4Q0S A;  4CCD A;  4I30 A;  3RMX A;  3UGG A;  3LPG A;  3FLT A;  2DTY A;  5C4W B;  4IEW A;  3VDD A;  4MSV A;  1OC1 A;  3WNK A;  2W91 A;  2CDO A;  4FFG A;  3AMM A;  4NJ4 A;  4JKK A;  5DUX A;  5FY1 A;  5EJ1 B;  2ZZJ A;  2B42 B;  2PFW A;  1D7P M;  3P3P A;  1HW5 A;  3VZL A;  1GP4 A;  5H9R A;  1ODM A;  3I3D A;  2RMU 3;  5A7W A;  2R16 A;  4HKW A;  5L36 A;  5ACA 3;  4AFB A;  5LW9 A;  2ZX0 A;  4Q29 A;  4KBB A;  4ASM B;  4KQ7 A;  1UX7 A;  3AVS A;  3AZX A;  3HQU A;  4AL9 A;  4RHV 2;  3ZYH A;  4HPK A;  1J3R A;  3NV3 A;  1QOS A;  3O1P A;  5LA2 A;  4QPI B;  2CGO A;  2IZW A;  3AYD A;  4FOQ A;  4HMZ A;  1FAT A;  3SEP A;  5K0U A;  3LF7 A;  1I3H A;  5CYY A;  1UIJ A;  4Q0V A;  3ZPY A;  2J22 A;  5FZM A;  2E53 A;  3KHC A;  1PX4 A;  4XF4 A;  2YB7 A;  4LBQ B;  4D6S A;  3O1O A;  1OMI A;  1FX5 A;  4QXH A;  1F4H A;  1STM A;  3OUI A;  2WO1 A;  5E89 A;  2XXZ A;  2Y6G A;  4RD7 A;  5FZD A;  1TVG A;  5F6K A;  3EBR A;  3Q9O A;  1UYY A;  5FY8 A;  4OMD A;  1W8U A;  4CU6 A;  5KHK A;  2HBU A;  4J25 A;  1RVF 3;  2RS1 1;  2VMD A;  1EV1 1;  3WNX A;  1PK6 A;  2AYH A;  4M4P A;  4Q4X 1;  1IS5 A;  2CYF A;  4KGQ A;  3T4H B;  1XBF A;  2J1U A;  1RUI 3;  2PLV 2;  2ZGR A;  4NUB A;  2X5I A;  4OUM A;  1U5Y A;  3PMS A;  1S55 A;  4E9K A;  1TME 3;  2IXH A;  4AZZ A;  2IUW A;  1ZBE 2;  1WMX A;  4UFL A;  1W3X A;  4FFH A;  4QKF A;  1W6P A;  5CU1 A;  1V0A A;  3MO4 A;  4Q0Q A;  5L7O A;  1DZT A;  4Q4Y 3;  4HN0 A;  1PVC 3;  1H8T B;  3WDU A;  2YGL A;  3PVB B;  4MVT A;  1AJO A;  3BKZ A;  1HXS 3;  4E4D X;  3K4D A;  1ULO A;  4OHY A;  3LAG A;  4IE4 A;  1HQW A;  4ATE A;  2WLQ A;  3WQ0 A;  4MOA A;  5ANQ A;  1ZM1 A;  4DXS A;  5BNO B;  3ITQ A;  4NO4 A;  5LK5 A;  3C3V A;  4DFS A;  1DIW A;  3UKT A;  4AGR A;  5EIY B;  4COY A;  2XJU A;  4LHS A;  3INA A;  1SLC A;  4LKD A;  2HWB 1;  4IV3 C;  2EID A;  3B7M A;  3WEZ A;  4R9D A;  3N36 A;  4ZPI A;  3FJS A;  3JB4 C;  5AFB A;  5LBC A;  2OUJ A;  2E33 A;  2VG9 A;  1L7Q A;  1E5I A;  3U78 A;  1W9W A;  3WW2 A;  2O8Q A;  4PLM A;  4CCK A;  2DV9 A;  2WFF 1;  2X8K A;  2RJL A;  4AWD A;  3K48 A;  3UT0 A;  4WVV A;  3VZN A;  2PHL A;  4OLL A;  1J1T A;  1KIT A;  1UY3 A;  4NOT A;  2DDU A;  3UKV A;  3HT1 A;  2B5H A;  4MLO A;  3IMN A;  1AL0 G;  4CP0 A;  1VAM A;  1O4Z A;  2BGC A;  4E4H A;  4AHX A;  2YU2 A;  1X9P A;  1UCX A;  4LBO A;  2IXK A;  2VZO A;  4D94 A;  3R05 A;  2CWM A;  4TXW A;  2VAU A;  2XBO 1;  4OHV A;  4JGY B;  2D98 A;  1EUT A;  3AXD A;  4ARY A;  1OA3 A;  3PVN A;  2FCU A;  4GIQ A;  1A34 A;  3Q8E A;  1XNK A;  2H6C A;  2KM2 A;  4ERO A;  3B3Q E;  3AZZ A;  5JCT A;  2PHR A;  4XHB A;  2ET1 A;  3POE A;  4YPJ A;  2RR1 3;  3N9L A;  4YW5 A;  2I2S A;  4MGI E;  3TYJ A;  4CP9 A;  1NCQ C;  1OPO A;  1AX0 A;  1IG3 A;  3AXE A;  1KJL A;  4CXW A;  3V0A A;  3B9C A;  3N9O A;  4YZ4 A;  1Y43 B;  2WUH A;  1BLZ A;  5FWE A;  2GMM A;  4P9G A;  1UYP A;  2CSG A;  3ZXK A;  1KQR A;  5FYH A;  1MS8 A;  3KM5 A;  3R6S A;  3AKS A;  1K12 A;  1V6M A;  2GNM A;  3F95 A;  4BHP A;  1A8M A;  2BUK A;  3AYE A;  5EJZ B;  4E2Q A;  3LSE A;  3O7O A;  1KFU L;  1TG7 A;  4IEY A;  4UF0 B;  3CJI B;  4XFF A;  1DCS A;  3UL2 A;  3WG4 A;  4YM3 A;  2J1A A;  3IZO A;  2FDJ A;  4WVW A;  3PU3 A;  1DGR A;  2PHU A;  3IAP A;  4CP2 A;  2PLV 1;  4H3W A;  5LB6 A;  5JDB A;  1LOC A;  2RS1 2;  1G9F A;  2WYS A;  3G7D A;  4W4Z A;  1NT0 A;  1AYN 3;  3GDB A;  2WWS A;  2XLF A;  1OOP A;  2VD7 A;  5LAT A;  2OA2 A;  4CP1 A;  2RDN A;  4CU7 A;  3KT4 A;  4CDQ A;  4P9L A;  4E2S A;  5IFP A;  4KWU A;  4B7E A;  3UNP A;  2ZEY A;  4HOO A;  3SC7 X;  4AVA A;  2IXI A;  5A1A A;  5LA0 A;  4QPG C;  2BJS A;  2GH2 A;  2WNO A;  3I2I A;  1QXJ A;  4P9J A;  3AMQ A;  3ZFG C;  5IK7 A;  4CUG A;  1ENS A;  1R08 3;  5K0U B;  1RTV A;  2VNV A;  1HV0 A;  2OT7 A;  2VTX J;  4OI4 A;  1RUJ 3;  2LUW A;  1GNY A;  3VKN A;  4ZS3 A;  1SCS A;  4WM8 A;  4CEY B;  2HBT A;  2Y8K A;  5BNN C;  4UFJ A;  1JZ5 A;  3EHK A;  1YFU A;  4WZF A;  2JEM A;  5JOX A;  2CNA A;  4MET A;  4Q4V 3;  3THD A;  3H0O A;  2V5D A;  4FBF A;  4KH9 A;  2PXJ A;  3AP5 A;  1QKQ A;  4K3U A;  4XFB A;  2QE3 A;  5CIR A;  1IZ3 A;  1VBB 2;  4LNV A;  4ZY9 A;  3VD7 A;  1TMF 2;  1W6M B;  3OOX A;  5FZA A;  4D6R A;  4FAG A;  5C3P A;  3GXU A;  1Q8Q A;  4PBO A;  4YRD A;  3UES A;  2CTV A;  1J84 A;  1GIC A;  3ACL A;  3VBR A;  4IER A;  1RUJ 2;  4W8J A;  3PUA A;  2JDU A;  4XAB A;  1SEF A;  2YXS A;  1IHM A;  1R1A 3;  2CDP A;  1NCR B;  3L2H A;  4CDU B;  1UZZ A;  5DG2 A;  1I5P A;  1AR9 2;  1AJK A;  2HWB 3;  3K75 B;  3VL9 A;  3OD4 A;  5M0T A;  1JMU B;  3THC A;  2WN2 A;  4IGQ A;  1VAK A;  3QLQ A;  1GMM A;  2R07 3;  1W2U A;  1BBT 2;  3PVO A;  4ZHN A;  4EWE A;  1R08 2;  4RFR B;  5C3S A;  4D0Q A;  1JYV A;  1R64 A;  3O12 A;  4NHM A;  2UWA A;  3HNM A;  1CAX B;  2Q1Z B;  3N7J A;  4QPI A;  4WV8 A;  1Q8O A;  4DNY A;  1H0B A;  2ZGP A;  2CGP A;  3DYM A;  3S57 A;  2AZ5 A;  4LO8 A;  1S0D A;  1XYN A;  3MV1 1;  1IS4 A;  1XJA A;  3AP6 A;  2WNV B;  3ORJ A;  4K21 A;  2BEO A;  1Z7S 1;  2BOI A;  2EAA A;  2WJS A;  4ZU7 A;  1O4Y A;  3GJA A;  4PIZ A;  4CDW B;  2ZCW A;  4GKY A;  1C4R A;  1O7F A;  1BBT 3;  4JKM A;  1WA4 A;  2BRT A;  4UI9 L;  4P08 A;  5HCH A;  5C8W A;  1UW8 A;  3QD6 A;  4RSU A;  4BE3 A;  1RUC 1;  1W9S A;  2W46 A;  5EFU A;  3HOB A;  2LM3 A;  1FMD 3;  4NRP A;  3SMH A;  1FNY A;  1CQ9 A;  1RXF A;  1ULF A;  2P37 A;  4N43 B;  5KHI A;  2JEC A;  1FAY A;  3ZSE A;  1GSL A;  3OYW A;  4EZ4 A;  2JDK A;  5A1L A;  4M3C A;  3B69 A;  2YC2 A;  2WQZ C;  5D2A A;  1C1L A;  3ZYP A;  1V6N A;  3RZM A;  1R08 1;  2YMZ A;  5F8P A;  4YW7 A;  3SEE A;  2OYZ A;  1OFN A;  1XB9 A;  4YG6 A;  3J8F 3;  4GAZ A;  4XIK A;  2ARE A;  4GB3 1;  1DU3 D;  1H1A A;  1MPX A;  3BTA A;  5DN2 A;  5ANN A;  5C70 A;  5GZE A;  4QX3 A;  3MW3 A;  2D5H A;  3Q8F A;  1XSQ A;  2A5Z A;  2R49 A;  4Q8K A;  5B2G B;  1JW6 A;  4O65 A;  5FO7 B;  1HB4 A;  3IBM A;  3OSD A;  1B35 B;  2OZJ A;  1PM7 A;  5JOW A;  2Q8D A;  4SBV A;  2ERF A;  4XDP A;  2AEY A;  4AQT A;  2R32 A;  5FK7 A;  3NV2 A;  2W47 A;  2DFB A;  3PU8 A;  3K4A A;  3W20 A;  3MF6 A;  1PM4 A;  5J3U A;  3WCS A;  3M7A A;  5F32 A;  4HLT A;  3LEK A;  2XWJ B;  3WF1 A;  3EO6 A;  1WWY A;  1EAH 3;  1N3O A;  3LEG A;  2XJV A;  4EN7 B;  1CN1 A;  3OGJ A;  1GOG A;  2W1S A;  1Y9Q A;  1JYN A;  5A3L A;  1JZ7 A;  5J96 B;  5CFD A;  4C8D A;  5AFE A;  2CHH A;  4XIL A;  3MFA A;  5HV4 A;  4MGZ E;  3OBT A;  3VBF A;  5IUQ A;  1V9U 1;  1VJ2 A;  3NV4 A;  2D6O X;  3ZR6 A;  1WMF A;  5JMC A;  4JC1 A;  4UAP A;  4GJZ A;  4AQS A;  1AHS A;  2EIG A;  1K5J A;  4DUV A;  3PNA A;  1ULC A;  2XWB B;  4CCN A;  2ZAB A;  3H9A A;  1KFX L;  2JG9 B;  3ACH A;  2BZD A;  2JG9 C;  1TME 2;  2BQP A;  1BQP A;  2P6H A;  5LCW L;  3ZDS A;  1U5I A;  5FYT A;  4MH0 E;  4BIS A;  1F35 A;  4DEV A;  1OH3 A;  1W2O A;  5HCB A;  3N7L A;  3POF A;  3RJ2 X;  2E51 A;  1G9A A;  3H1Y A;  1ZA7 A;  4KU7 A;  1TNR A;  1PVC 2;  1LTE A;  2P3Y A;  3CJX A;  4JKL A;  3BN6 A;  5C71 A;  3M3E A;  3NQH A;  2D6K A;  4B29 A;  3L2Y A;  4XZU G;  3ZFF C;  5BNQ A;  5DUW A;  2XG3 A;  2ZMK A;  2GNB A;  3J9S A;  4AVV A;  1PO1 1;  1W9T A;  4IV3 A;  4BK4 A;  1IOA A;  4IW3 A;  1FMD 2;  1JHN A;  4FTS A;  5IVV A;  1XC6 A;  1H2K A;  4QDS A;  3SNM A;  1UY2 A;  1K45 A;  2YZ4 A;  3ACI A;  1Q56 A;  2Y6L A;  3VZM A;  2J1S A;  3GZT B;  3B93 A;  3KF5 A;  5DPN A;  3HR9 A;  2GND A;  4LHN A;  1R09 1;  1RIN A;  4D7S A;  4A3Z A;  2W5F A;  2VZT A;  2HWF 3;  1RUE 2;  2PHF A;  5FQ0 B;  2IVJ A;  3J4U H;  5FZO A;  5F1R A;  2OKX A;  5KHG A;  2Q5T A;  4A7K A;  2R06 2;  3TEZ A;  3B5L B;  4N9I A;  1ENX A;  3W58 A;  3AJY A;  3AZV A;  3OY8 A;  5JUV A;  3B02 A;  1O3Q A;  1LKN A;  1RJ8 A;  2PQS A;  4DPN A;  2B8M A;  3CMG A;  4OZO A;  5BNO A;  4HSJ A;  3OD0 A;  5ABJ B;  2Y0I A;  2VQU A;  2P1B A;  1OD5 A;  4CCO A;  1AR8 2;  4GMP 1;  4BQ4 A;  1W8F A;  3MDP A;  4LKE A;  5EWS A;  1LU1 A;  2RM2 1;  3I7D A;  1RUJ 1;  2Y6H A;  5A6X A;  4MZU A;  4R52 A;  4P9W A;  2WKK A;  2W1U A;  3VBU C;  1XND A;  4BMB A;  3SCF A;  3VUO A;  1AYN 2;  1X9T A;  3JD7 1;  3LA3 A;  3LDK A;  4QHO A;  3WQ1 A;  2XON A;  4PHZ A;  1NQD A;  1C8M 3;  1CAW A;  1YO8 A;  1QJX 2;  1HN0 A;  4H55 A;  1YLL A;  3T09 A;  4ISQ A;  2QFE A;  4HK9 A;  3VZK A;  2B9U A;  1H6X A;  1WA6 X;  5GLZ A;  2Y0O A;  2ZX4 A;  1CAU B;  4CDW C;  3DPR C;  5LRS A;  4DB5 A;  1R09 2;  2ET7 A;  2UWB A;  1QQP 1;  2PHD A;  2VZV A;  5FZ1 A;  1O6U A;  3CIH A;  3NW4 A;  3WIN E;  2X5I B;  4IQP A;  4XIO A;  5DAP A;  5BNP A;  2GC2 A;  1H1M A;  1WLD A; 
#chains in the Genus database with same CATH homology
 3OB8 A;  3A23 A;  3CDZ B;  1O59 A;  4ZXE A;  3NRU A;  4GWJ A;  1OF4 A;  1KGY A;  3DYP A;  4XUO A;  1UZ0 A;  2Y64 A;  3DEC A;  3VD3 A;  3ABZ A;  4A6O A;  3FHA A;  1UMI A;  2ZEX A;  2QBX A;  3HNB M;  4QX1 A;  3DYO A;  1OT5 A;  2JKX A;  4BK5 A;  5IYY A;  2WAA A;  2ORZ A;  2ORX A;  3T2Q A;  1SG3 A;  2E31 A;  5JXI A;  1UXX X;  2W95 A;  4P00 B;  3UET A;  3FN9 A;  4BDV B;  2J1R A;  2JE8 A;  1NKG A;  1UMH A;  3IB3 A;  4QB6 A;  4QB2 A;  1P8J A;  4KMQ A;  3OGV A;  1K42 A;  2VL4 A;  2YFU A;  2RVA A;  2WZE A;  3T0A A;  3WNP A;  2KD7 A;  2XOM A;  4M4R A;  2VZQ A;  4L0P A;  1XNT A;  4W50 A;  2ZEZ A;  3CZU A;  4A41 A;  2EIC A;  4XUQ A;  1H6Y A;  4QDQ A;  2VOT A;  4CUA A;  2VZP A;  4A44 A;  5JXJ A;  4PQQ A;  3C7E A;  3A7Q A;  4CVU A;  3ACG A;  2E26 A;  3LPG A;  2ZXQ A;  3WF3 A;  4CU9 A;  1CZV A;  1UYZ A;  3D3A A;  3CQO A;  2HLE A;  3LQC A;  1IQD C;  2JDA A;  3WNK A;  2W91 A;  2CDO A;  3GM8 A;  2QQJ A;  1US2 A;  4JKK A;  1GOF A;  3GGL A;  2V72 A;  5EJ1 B;  1D7P M;  1K3I A;  4CUB A;  3F2Z A;  1US3 A;  2Y6K A;  1JI6 A;  3I3D A;  2BER A;  3OG2 A;  4GWI A;  1RYY A;  2W94 A;  3P1I A;  1UX7 A;  4AG4 A;  3J7H A;  4CUC A;  2C26 A;  5FUI A;  3I2G A;  4LQR A;  2BGP A;  2C4X A;  5LA2 A;  1XPW A;  3T2O A;  2VCC A;  3SEP A;  5CYY A;  3NJX A;  2J22 A;  2YG0 A;  1PX4 A;  2YB7 A;  2QQO A;  1F4H A;  2VMC A;  2VCB A;  2WO1 A;  2Y6G A;  1TVG A;  2WO2 A;  1UYY A;  4OMD A;  4CU6 A;  1DLC A;  2VMD A;  4JHZ A;  4TTG A;  4M4P A;  1OF3 A;  2VZS A;  2X09 A;  1W8O A;  3OEB A;  3I2F A;  2J1U A;  5JXH A;  4GZ9 A;  4DXR A;  1UY0 A;  1NX9 A;  2QQL A;  3C7F A;  3MO4 A;  2RV9 A;  3PUH A;  3E1F 1;  3I2K A;  4QX0 A;  3K4D A;  3HPN A;  1UY4 A;  1ULO A;  4BXS V;  3JXS A;  2VCA A;  4MOA A;  4DXS A;  2VR4 A;  4JX0 A;  3WSO A;  3WF0 A;  5DQ0 A;  3FHQ A;  3P6B A;  3PUI A;  5EIY B;  3I2J A;  4LHS A;  5B4X A;  2ZEW A;  2EID A;  3WNL A;  3WEZ A;  2RJ2 A;  4ZZ8 A;  2C9K A;  2E33 A;  5G04 L;  1L7Q A;  1EUU A;  3C7G A;  1W9W A;  2JD9 A;  3VDA A;  4AAX A;  3CZJ A;  1W8N A;  1UY3 A;  3LE0 A;  2DDU A;  3T08 A;  2VC9 A;  2VZO A;  4TXW A;  1UXZ A;  1J83 A;  1T2X A;  1O8S A;  1JYW A;  1EUT A;  4ARY A;  4E8D A;  5J1X A;  3C8X A;  3OGS A;  4OYU A;  3I2H A;  4MGQ A;  2VZR A;  2J1E A;  1LNS A;  4YPJ A;  4XUR A;  5I0D A;  3AC0 A;  2QQI A;  2V4V A;  1L7R A;  2WAB A;  3WQB A;  3HNY M;  2WUH A;  2WQ8 A;  2E32 A;  1UWW A;  4ZZ5 A;  3K4Z A;  1K12 A;  5EJZ B;  4FI9 A;  3VD5 A;  1TG7 A;  4QX2 A;  3C7O A;  2J1A A;  1PX3 A;  4MGS A;  3IAP A;  4PF1 A;  3ACF A;  1GU3 A;  3CKH A;  5HPO A;  2WYS A;  3WNN A;  4W4Z A;  3GDB A;  4CU7 A;  4LPL A;  2W1W A;  5IFP A;  4KWU A;  4QPW A;  1ULP A;  3UNP A;  1W0N A;  2ZEY A;  1OD3 A;  2R7E B;  5A1A A;  2VZ3 A;  5LA0 A;  3I2I A;  1UYX A;  1JZ2 A;  2QQN A;  1JU3 A;  1GNY A;  2DCK A;  5CZK A;  3WF2 A;  4DUW A;  2Y8K A;  5JR2 A;  1SDD B;  1JZ5 A;  3THD A;  2V5D A;  2EIB A;  1OH4 A;  1JYX A;  4IUG A;  4ZY9 A;  3VD7 A;  4A42 A;  4Z2A A;  2QQK A;  3W5M A;  3GXU A;  3UES A;  1DP0 A;  1J84 A;  3C7H A;  1UY1 A;  1W99 A;  3T2P A;  3ETP A;  4P5Y A;  3WF4 A;  4W8J A;  2W1Q A;  5C7G A;  3WNM A;  1WKY A;  2CDP A;  3SKV A;  3HEI A;  5DMY A;  2EIE A;  1I5P A;  2J7M A;  3K75 B;  3A21 A;  3THC A;  2WN2 A;  3MUZ 1;  2B4K A;  1GMM A;  3IAQ A;  4A45 A;  5JXG A;  2J1V A;  4D0Q A;  1R64 A;  1JYV A;  1YQ2 A;  1JZ6 A;  3HNM A;  2YFZ A;  1BHG A;  3FL7 A;  3I3B A;  1DYO A;  4PT6 A;  1JZ4 A;  4QAW A;  2W92 A;  3DYM A;  2QQM A;  4RYD A;  2DCJ A;  2VM9 A;  3MV1 1;  2WBK A;  1NAE A;  3OGR A;  4QB1 A;  1WCQ A;  2Y6J A;  3NJV A;  4XUT A;  4JKM A;  5IFT A;  3WNO A;  4UI9 L;  4P08 A;  2BBA A;  1W9S A;  2VJX A;  2W46 A;  5B4N A;  3HOB A;  3HN3 A;  1CIY A;  2W9X A;  4DUX A;  3EB7 A;  1JHJ A;  2BGO A;  2YC2 A;  4CU8 A;  3U37 A;  5IJR A;  3SEE A;  4XUN A;  2ID4 A;  4MO3 M;  4E8C A;  1CZT A;  5C70 A;  5DN2 A;  1MPX A;  3ZM8 A;  4QX3 A;  1PMJ X;  4HG6 B;  3T0B A;  1XNA A;  1CX1 A;  2LS6 A;  2W47 A;  3K4A A;  5G05 L;  2X05 A;  4P02 B;  3LEK A;  3VD9 A;  1GUI A;  3WF1 A;  2HYX A;  2WO3 A;  3W5N A;  1GOH A;  3LEG A;  4OUE A;  2WN3 A;  1GOG A;  2W1S A;  3I97 A;  1JYN A;  4A4A A;  3A22 A;  1JZ7 A;  1PMH X;  5JMO A;  3MBW A;  2XHN A;  2VTF A;  3ECQ A;  3K77 A;  4UAP A;  3VD4 A;  4DUV A;  3VDB A;  3ACH A;  4LKS A;  2BZD A;  3NNG A;  4XVH A;  5LCW L;  2VZU A;  3IDA A;  4DEV A;  1GQP A;  2VO5 A;  3SKJ E;  1KEX A;  2X10 A;  2B9V A;  3MV0 1;  4JKL A;  5HXM A;  3BN6 A;  5C71 A;  3I3E A;  3MUY 1;  3NQH A;  2XQX A;  1HN1 A;  2W3J A;  2WDB A;  4XZU G;  4QDR A;  3T0D A;  2LW8 A;  2J1T A;  2WZ8 A;  2WAO A;  1W9T A;  5F7U A;  4BK4 A;  4RN5 A;  3K46 A;  4XUP A;  1XC6 A;  4QDS A;  1UY2 A;  1K45 A;  2L9L A;  3ACI A;  2Y6L A;  2J1S A;  2YC4 A;  5DPN A;  2VZ1 A;  3VDC A;  1JZ3 A;  2Z4F A;  1JZ8 A;  4A3Z A;  2W5F A;  2VZT A;  3HJR A;  4ARX A;  4MAD A;  4UOJ A;  2OKX A;  2VME A;  3LPF A;  5JUV A;  3III A;  3LEI A;  2PQS A;  1JU4 A;  4OMC A;  3EYP A;  4D8M A;  3CMG A;  4OZO A;  5IHR A;  5LA1 A;  2VQU A;  4KI5 M;  1NUK A;  4DXT A;  2VMF A;  3OBA A;  2VQT A;  2Y6H A;  2W87 A;  4DEQ A;  1CZS A;  2W1U A;  1O8P A;  2XON A;  3OEA A;  3T09 A;  4BJ0 A;  1H6X A;  3BGA A;  1SHW B;  4ET7 A;  2VZV A;  1F4A A;  3CIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...