3OEAA

Crystal structure of the q121e mutants of c.polysaccharolyticus cbm16-1 bound to cellopentaose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
146
structure length
146
Chain Sequence
SHMVNMVSNPGFEDGLDSWQDWQQDMSAVPEAAHNGALGLKIGGGKAAGGGQDIPLKPNTTYILGAWAKFDSKPAGTFDVVVQYHLKDANNTYVQHILNFNETDWTYKQLLFTTPDVFGSTPELALWKGDTSKANLYVDDVYLVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-layer associated multidomain endoglucanase
publication title Mutational insights into the roles of amino acid residues in ligand binding for two closely related family 16 carbohydrate binding modules.
pubmed doi rcsb
source organism Caldanaerobius polysaccharolyticus
molecule tags Hydrolase
total genus 28
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3oeaA00
3T08A 2VL4A 4OZOA 2JE8A 4ZZ8A 5B4NA 1EUUA 1JZ6A 3SEPA 2QBXA 1F4HA 2X05A 2W1SA 4D0QA 2QQLA 1GOGA 4LKSA 2OKXA 3I97A 2X09A 4XUPA 3DYMA 3C7HA 4A44A 4MADA 3T09A 4E8DA 4UI9L 1H6XA 4UAPA 1JYXA 2J1AA 1ULOA 1SDDB 4BK4A 2BZDA 1OF4A 2RVAA 3T2PA 4QB2A 2JKXA 1GQPA 2VZQA 2DCKA 3SKJE 2Y6JA 4M4PA 4QX0A 3OGVA 2KD7A 4P00B 3VD7A 1W8OA 2ZEYA 4A42A 3UESA 1XNAA 3ABZA 5C7GA 5JR2A 2VQUA 3CMGA 1MPXA 2VZ3A 4RYDA 3WQBA 3LPFA 2W9XA 3HEIA 1J84A 3HJRA 4P5YA 4DUVA 1GMMA 2ID4A 1NKGA 1R64A 2VOTA 3I3EA 1J83A 4A3ZA 1UY0A 3D3AA 3MBWA 4QX3A 2BBAA 1W99A 3WEZA 2J1SA 2C26A 3K46A 5I0DA 4CVUA 3T0DA 2HYXA 3DYPA 3K75B 2J1EA 1OF3A 3MV01 4QX1A 1JI6A 5EJZB 2YB7A 1UY3A 3ACIA 2WZEA 2QQOA 2QQJA 2VZUA 4D8MA 3K77A 3VDBA 1JYNA 2BERA 2V5DA 1TVGA 4MGQA 3NJXA 3WF1A 3DECA 1OT5A 2BGOA 3NQHA 1JU3A 1UYXA 4P08A 4QPWA 3FHQA 3F2ZA 4QB6A 2YC4A 5IYYA 2VZRA 1P8JA 1O8PA 4KI5M 2XOMA 2QQKA 4DUXA 2WQ8A 5EJ1B 2WO3A 3BGAA 1UY1A 2W47A 1W0NA 2VMFA 4A4AA 2VMCA 3IB3A 5DPNA 3WNPA 5IFPA 5JXHA 3K4DA 2J1VA 2Y6LA 1KGYA 1GUIA 1XNTA 2W94A 4BJ0A 3BN6A 3GDBA 5IHRA 1NX9A 1H6YA 3WF2A 5LA0A 2YFUA 3GM8A 3I2KA 3LEGA 4PT6A 5B4XA 1DYOA 2WABA 1JZ8A 4W4ZA 4BDVB 5G04L 2WBKA 3MV11 2ZEZA 1WCQA 2VTFA 4JX0A 2J1TA 1T2XA 1K3IA 1F4AA 2Z4FA 2Y64A 3VD4A 3SEEA 4QX2A 4TTGA 2E32A 4GWIA 1RYYA 3I3DA 3GGLA 4MO3M 2EIDA 3FN9A 4JHZA 3I2GA 1US3A 1UZ0A 3W5MA 4LHSA 1JYVA 5JXIA 1OD3A 3IDAA 4A41A 1XC6A 4XUNA 4DXTA 3I2FA 1UX7A 4MGSA 3T2QA 2VJXA 3OEAA 1JZ4A 2C9KA 3NJVA 2W5FA 1UY2A 1PMJX 4CU8A 2VZ1A 3A23A 2WUHA 2XONA 2WZ8A 5LA2A 4XVHA 2VMDA 3SKVA 3E1F1 1W9SA 2ZXQA 3OGRA 3OEBA 2V72A 2WAAA 3CZUA 2W1UA 1O59A 3EYPA 2J7MA 3IIIA 5JUVA 2Y6HA 5HPOA 1CZVA 4XUTA 3T0BA 1O8SA 4OMDA 3C7EA 2LW8A 1CIYA 3CQOA 4IUGA 2VO5A 4LQRA 4DXSA 1NUKA 2VM9A 1L7QA 2ZEWA 2EIBA 3VD9A 3CZJA 2PQSA 1KEXA 3JXSA 1PX3A 4A45A 3P1IA 3WF3A 1GOFA 1TG7A 4RN5A 1HN1A 1XPWA 4XZUG 2JD9A 2VZPA 3WF0A 4E8CA 3FHAA 3CDZB 2E33A 2BGPA 1SHWB 2J22A 4ZXEA 4ARXA 3DYOA 2VC9A 4XUQA 3MUZ1 3VD5A 3PUIA 4OYUA 2VQTA 1UMHA 2QQNA 5CYYA 1K42A 1GU3A 4TXWA 3ECQA 1UXZA 3UNPA 1PMHX 3WF4A 1JZ2A 3I2IA 1JYWA 3T2OA 3HPNA 2XQXA 4XUOA 4OUEA 1UMIA 2VCBA 3U37A 3ACFA 1UXXX 2LS6A 3C8XA 5IJRA 1JZ3A 2W1QA 1CZSA 3LPGA 4ZZ5A 4BXSV 5CZKA 3ETPA 1GNYA 1EUTA 3LQCA 3ZM8A 2HLEA 4HG6B 2VZSA 2WYSA 4GZ9A 5IFTA 2ORZA 1NAEA 2EICA 3LEIA 3T0AA 1JHJA 2X10A 2CDOA 3A7QA 4ARYA 4JKLA 4ET7A 2Y6KA 5DQ0A 4W8JA 4BK5A 3OBAA 4DUWA 1ULPA 2E26A 2Y8KA 3WSOA 3OB8A 3WNKA 1UY4A 2B9VA 4QDSA 3C7FA 1UWWA 1L7RA 2DDUA 4L0PA 3W5NA 1W9WA 2VCAA 1GOHA 4M4RA 3CKHA 3NNGA 4DXRA 5LA1A 5JMOA 3AC0A 3PUHA 5LCWL 2ZEXA 1DLCA 5EIYB 1JZ7A 4MOAA 2JDAA 1CX1A 1CZTA 2J1UA 1LNSA 4CU7A 3K4AA 3CIHA 4PQQA 1YQ2A 4CU9A 2WO2A 4CUAA 2W87A 1IQDC 1BHGA 1WKYA 3I2JA 2W91A 2Y6GA 5JXJA 2YG0A 5F7UA 3C7GA 4KMQA 4KWUA 3HNYM 3WNMA 3WNNA 3IAQA 2VZOA 3IAPA 2C4XA 3EB7A 4JKMA 3HNBM 4Z2AA 1K45A 2CDPA 3J7HA 2VZVA 2RV9A 3I3BA 2W1WA 3MUY1 4QAWA 4CU6A 2E31A 2EIEA 3UETA 1W8NA 2W95A 3HOBA 5DMYA 4LPLA 1JZ5A 3GXUA 3NRUA 4AAXA 5C70A 1SG3A 3WNLA 2WAOA 1W9TA 3A22A 2R7EB 2WDBA 2L9LA 4QDRA 2ORXA 3C7OA 2QQMA 5DN2A 4XURA 5C71A 3THCA 1US2A 2WN2A 4FI9A 4CUCA 3ACGA 3ACHA 2RJ2A 5FUIA 3THDA 1I5PA 1OH4A 3A21A 1DP0A 2W92A 3VD3A 3LE0A 1K12A 3LEKA 2V4VA 2W3JA 3VDCA 1PX4A 4PF1A 4ZY9A 4GWJA 3WNOA 3K4ZA 4QB1A 1UYZA 4YPJA 2WN3A 2W46A 3HNMA 2YC2A 4JKKA 4QDQA 1JU4A 3MO4A 4UOJA 2B4KA 3I2HA 1D7PM 3OG2A 4CUBA 4W50A 4A6OA 2VMEA 5J1XA 4P02B 4DEVA 5HXMA 5G05L 4AG4A 3P6BA 2XHNA 2YFZA 3OGSA 1UYYA 5JXGA 2J1RA 5A1AA 3HN3A 3VDAA 2VCCA 4OMCA 2VZTA 2QQIA 2DCJA 2WO1A 2VR4A 3FL7A 4DEQA
chains in the Genus database with same CATH superfamily
2HKXA 2F17A 3T08A 4OZOA 3KS7A 3O1OA 1W3XA 2HWC1 3LCPA 4HVQA 4F3JA 4XF1A 1EUUA 3ZYBA 4K40A 3SEPA 4CXYA 5FZHA 2QBXA 4X6RB 3ZXAC 4EYUA 2W1SA 1UQXA 4OUMA 4OFGA 4HVRA 1PNFA 4AK3A 1IPJA 1LKNA 2Y26A 4LKSA 5J96B 1PZ7A 3HT1A 3BODA 2R071 3ZSKA 3U1XA 4CP9A 1PZ8A 1ZZ8A 2VCMA 5HBAA 1E5SA 1OA4A 3ST7A 1QNWA 1NCQC 1OQDA 2YU1A 3MF6A 4A44A 3ZFEA 1H6XA 2XGXA 1PO23 3LIGA 2J1AA 3IKWA 4Q4W3 4DB5A 3ENRA 4BK4A 2BZDA 4QU2A 2BFUS 4L92A 3FJSA 1HXS2 4AI9A 1G86A 2JKXA 4FBFA 4N43B 4TLFA 1R1A3 5BPXA 2PHWA 1D4VB 4WM8B 3TN91 3B9CA 3ZDSA 2K46A 3SKJE 2PQQA 3UYJA 3M3IA 4GMP1 2ZHNA 4QX0A 3GF6A 2DUQA 2PAKA 1PVC1 5A80A 5FMBA 2ZEYA 5GM0A 4AVSA 4B4PA 2PHXA 1AYN1 1K5MA 1NCRC 1Z7S1 1URXA 2RDNA 3R4DB 3NV3A 5JR2A 5L9BA 1W90A 1MPXA 5F6KA 4LBNA 4HFSA 5A6YA 1FPN3 1QJY2 1WMFA 2YBPA 1DIWA 2Q1ZB 1XNCA 4ZONA 3LPFA 4LK6A 2BDRA 2I07B 4O65A 4N43A 3O5SA 5IVYA 2IVIB 1J84A 4DRVA 1VE0A 3HJRA 4WM8A 1UU5A 1O5LA 4DUVA 2XMLA 4IEZA 4QMAA 1ULCA 3D82A 4LO7A 3OJBA 2BEOA 1Q56A 2A1XA 3I3EA 4QX7A 3ROUA 5GLUA 3O1TA 3BTZA 1VLNA 4AGVA 2QCSB 1LOGA 1DYPA 1QGLA 3AKPA 4QX3A 2ZPXA 1GZTA 3IBMA 1UN1A 1ZZ7A 1W8FA 1G9AA 2GAUA 3GBFA 2C26A 5I0DA 4ZPIA 5FK7A 3ZKYA 4CVUA 5FMOS 3AJYA 3K75B 4YVSB 4NHXA 2J1EA 1LGBA 2ZS6B 5FJHA 2GALA 2H0BA 1H1AA 1UY3A 3ACIA 5KHIA 1QIQA 1JOJA 2O14A 1WW7A 2QQOA 4NIDA 4D8MA 1D0GA 1LECA 5F5IA 1O4ZA 3UGHA 3VDBA 2BERA 5GLTA 3U07A 1AR62 2IWGB 3BTAA 3WF1A 3MPBA 3GJBA 1W3VA 1Q8OA 4GAZA 4QPWA 3VLBB 3F2ZA 2P3IA 1U5XA 5FRAA 1WCSA 4FP2A 1W9YA 5FMCA 3TYJA 4XXPA 3ZVXA 4NRMA 4YVSA 3FC0A 4XHXA 2VZRA 5T5PA 4UF0B 1O8PA 1Q8VA 3HQXA 2RJLA 3WQ7A 2XOMA 5LBBA 4DUXA 3B93A 2DBNA 4XFCA 1X8MA 3B7MA 4XIOA 1QXJA 3SC7X 1OFSA 1PIV2 4Y33A 4AQ2A 1LOFC 2D3PA 2SLIA 4GQ7A 2Q1MA 1GWLA 4NR1A 1XQNA 4OHYA 4LULA 4U36A 3DXUA 3OBRA 4EWDA 2E6VA 5DPNA 3SH5A 2WLPA 4ZS3A 3WNPA 4XEZA 4NVPA 2WO7A 3K4DA 4AFDA 4HN1A 3BI3A 4COUA 1VP6A 1NY71 1REFA 4UF0A 1TMF3 3J26N 2JWPA 1MVQA 3OD0A 4BJ0A 4LO5B 3GDBA 1RMU1 4L97A 2PLV2 4AZZA 2DTWA 3LEGA 1ENQA 1DYOA 2WFF3 3KVAA 1VBA1 3WDTA 5FO7B 2VTXJ 4CCLA 5BNPC 2G1MA 4IXLA 2Y34A 3B69A 2NLRA 2XBO3 3FX3A 2A6YA 4XF9A 2HWF1 4B3NA 1UD1A 4JX0A 2TUNA 3CJIB 3SMHA 1DYKA 5A7SA 1T2XA 3H1WA 1K3IA 2BWAA 2O8QA 3PUSA 4PIYA 4XJUA 5LEJA 2ZAHA 3QD6A 2HWD1 4XC9A 3SEEA 1W0PA 2XWBB 4K9SA 5IUQA 1DGRA 4UT5A 3RYPA 1RYYA 5FYBA 1ULGA 3LSEA 4MO3M 4CDXB 3VZMA 2ZGRA 3FN9A 5JAXA 3HIFA 1S0FA 4IEOA 3I2GA 4R4XA 2DCYA 3W5MA 2ZHLA 4H14A 1UKRA 5JXIA 4XUNA 4CCOA 1V9U3 4ASLA 2PHFA 3CJIA 4ES9A 5FPZA 2RDRA 5FYYA 4XPVA 4AI1A 2G9GA 2C9KA 1M4WA 5A1LA 2YPJA 1PMJX 2XVKA 3L9JT 2VZ1A 4QPIC 5DDJ3 2A70A 5FZ4A 3RWKX 1CVNA 5ACA2 1BBT3 5I0UA 4JTOA 2VBDA 1ODNA 2Z69A 5CNAA 3JB8A 4NHLA 3B94A 2RM22 1W9SA 3E1F1 2ZXQA 3OGRA 4JV4A 4Q4Y3 4RD7A 4YYOA 2R061 3POWA 4CDXA 5IVCA 3VKFC 2ZX0A 5KC5A 2V09A 4RGKA 2IXCA 1ST8A 2RDQA 1WCUA 2W1UA 2WL1A 1W2UA 3CZUA 4MHRA 4NWVA 4W6WA 2Q8CA 4MGIE 4I3GA 1D0HA 1L3JA 1CZVA 4NPMA 4W65A 3T0BA 2YHJA 4FPJA 4JDOA 1YFWA 2VQAA 2LW8A 4S2HA 3B01A 3VDDB 1Q43A 1C8M1 3B9IA 4JDMA 3LF7A 1AR81 2ARAA 1DQ2A 1CIYA 2FQPA 4MG2A 3QBQA 3N7LA 4I01A 4KBZA 2VBBA 5FZCA 2VM9A 4C1WA 1H8TB 5CG9A 2EAAA 2JENA 5DABA 1XNKA 1IS6A 3AVSA 1H4HA 5LA9A 2ZGOA 4GB33 4J6GA 1KEXA 3PTYA 5BNNB 1GR3A 3W59A 2ZA9A 1BJQA 3AP9A 2VOXA 1TG7A 3BVCA 5H9PA 1PNGA 2YY1A 3N9QA 1VBC3 1BK1A 1N1SA 5J48A 4G4FA 5GLZA 3RG0A 5L19A 2VVFA 3VDDA 4YARA 1EYBA 3T4VA 5A6ZA 4TSVA 1PGL1 2XUEA 3BB6A 1GZWB 2YU2A 3VGIA 5HI0A 2HWC3 1PVXA 2BGPA 3H42B 1Q8PA 4B29A 4ARXA 1COV3 5A32B 4LNVA 2PXJA 2VECA 3POGA 4XTMA 1H8TA 1DQ6A 3ZDVA 2C1FA 5B2GB 4IV1B 1ASJ2 1EV12 5FWEA 5CYYA 5BNNA 4LBQB 3ZSJA 3ZXEA 1RUH1 2A73B 2CTVA 4TXWA 3BALA 5AFBA 3LSDA 1QJEA 2R073 2YZ4A 4FP3A 1QXRA 2XQXA 3N9LA 4XOGA 1QU0A 1WW5A 3I2OA 5DG2A 3NAPB 3U37A 1VMJA 1AYM1 3PHMA 2RS52 1GZWA 4XDOA 1DZRA 2LS6A 5J98B 3ZXLA 5FZBA 4B8EA 4WM7C 3PMSA 5A32A 4BXSV 2RR11 3NNJA 3KMHA 2UYAA 1JW6A 3NV4A 4A7YA 4IV1A 4Q26A 3RVHA 1QJU1 4KG0A 4Y5SA 1ZRIA 3TN93 2W0XA 5C9AB 5FZOB 1DCSA 3M3EA 1FMD2 1COV2 3OBZA 1OPMA 1UOJA 3IN9A 4XTPA 2JE9A 4GMP3 1X50A 4JGZC 4JQRA 4P9IA 5I8YA 1OLRA 1PVC3 3NAPA 5CFDB 1ZRDA 4MVTA 4GA9A 2MEV2 3VHNA 1Z7S3 4CDUB 3RNSA 5L9VA 4EN9B 2JEMA 3W58A 5IVBA 2BW8A 1SBDA 2X10A 2ZGMA 1D2SA 3SISA 1TQ5A 2CU5A 2CDOA 3LDRA 1KFUL 1SCRA 1ZRRA 3ILFA 1FV2A 3A7QA 2P3YA 1KFXL 5F2WA 2GNMA 2AENA 1UW8A 3KV9A 3LB9A 4JKLA 3WOGA 1IPKA 5C9AA 2SBAA 4H7LA 5FZOA 1VRBA 1RHI1 3R6SA 4CDWB 2OVUA 2ZJCA 4BK5A 2FMYA 2B45X 4K8FA 1RVF1 4AFCA 2B8MA 4Z82A 4DUWA 3DPRB 3FE5A 1RXFA 1OOPB 2K0GA 3DUIA 3KQ4B 2E26A 3MLKA 3ZFFB 2Y8KA 4X8PA 5FLIA 4LXLA 5H9SA 4CDUA 1QQP2 4KL1A 5I91A 3RWNA 2KXLA 1JYCA 2B9VA 2VVDA 4DS0A 2DFCA 4QDSA 5A7QA 1CJDA 2ZMLA 2C0ZA 4MV2A 5FZEA 2NMOA 4PBOA 4B7EA 4OVEA 3NKTA 1GOHA 4DXRA 2FCVA 2DYCA 2VULA 1GP4A 1NA1B 3PUHA 5LCWL 2W39A 1DU3D 3VBFB 4QPYA 2VNRA 2Y60A 2JDAA 5E8AA 4M3CE 2WRAA 1LULA 4QPGB 3DPRA 4CZSA 1OOPA 3ZFFA 3F95A 2BNOA 3V0AB 4CCJA 3RI9A 2DV9A 2P5BA 4Q4V2 4N53B 2WO2A 3GCWA 4CUAA 1W28A 3I49A 2W87A 1WKYA 2WA3A 4XETA 3I54A 5D1IA 1MS3A 2Y6GA 1GYKA 1HXS1 4GH4B 3SCHA 2R16A 3BKZA 5GLWA 2YG0A 3CJXA 1Y43B 1NA1A 1JUIA 1TEIA 2IVJA 4COWA 3SCGA 2AACA 3U14A 4ZKTB 3S30A 2MHFA 5KXDA 3HNYM 1MEC2 2XB6C 3LA7A 3IAQA 4QPGA 1SZBA 5GALA 3AP6A 1Y3TA 5KHKA 2LRPA 4FFIA 5KBFA 4N53A 3OY8B 2ZGNA 4LBOA 1HLCA 5FOBB 4XAEA 5FZDA 4SBVA 5T50A 1RL3A 4GH4A 2ETEA 1QJY1 3FUOA 3WLUA 2R1DA 1HB1A 3WG1A 2JX9A 2W95A 4AVBA 1TME2 2GN7A 3OGJA 2WT1A 1JZ5A 1K5MC 4JDNA 3AZXA 4P14A 1RMU3 4FFFA 5FP8A 2GNDA 5KXBA 1XRUA 1VBA3 4JQTA 4AQ6A 3PDQA 1C57A 2WDBA 5FXXA 2CL2A 5JIAA 3ZKUA 2L9LA 4N43C 4NIIA 2ORXA 4IETA 3OY8A 3AK0A 1QDCA 3C7OA 5GZDA 1BYHA 4WM8C 5DN2A 3S6PA 5FTTC 3TBDA 2X8KA 3BTYA 2VE1A 4MLOA 1CAWB 3IDEA 3ACGA 4UFMA 3POJA 1KS4A 3UV9A 2E51A 3WDWA 1SLBA 1F2NA 1Y9MA 1S0EA 1YUDA 2W92A 3VD3A 3UGGA 4EWEA 3PJQA 2HWD3 3MLLA 3HBZA 3LEKA 2V4VA 1UCXA 3PUQA 1FPN1 1PX4A 3R4UA 5C4WB 1JHNA 4GWJA 3WG2A 2OUJA 3LGRA 3AYEA 1WLWA 1RUJ2 1UYZA 3ME2A 1JOBA 2BTVC 3SITA 5T52A 4QWNA 1GWMA 3NNMA 3M8LA 2A3YA 1JU4A 2XLFA 4YGDA 1APNA 4S2GA 3I2HA 1H1IA 3WY6A 4O9EA 4N90A 2JDUA 3AYAA 5T3NA 5DAPA 4COVA 3ORJA 5J1XA 3AZZA 3POBA 2BGCA 1W6PB 3PU8A 4AG4A 4M3CB 4AVAA 2XHNA 2YFZA 4IGPA 3OGSA 1H8VA 4HONA 5C4WA 1W8HA 3I3QA 1PIV1 2WYFA 3DN7A 2Q30A 2R063 4BMEA 5CEHA 3DF0A 2VCCA 4YVSC 4LTAA 1WMXA 4BQ1A 2QQIA 5C3SA 1HJFA 1SBFA 4FAGA 2I2SA 4C1XA 1VRH2 3AZYA 4RFT0 1AX2A 5LZ6A 3FL7A 4PIXA 5ANQA 4R4ZA 1VIWB 5DAWA 1AF9A 5FFOC 2VL4A 4AEJA 5M0TA 2JE8A 4Y1ZA 1UIKA 1W6PA 4FTBA 3M3QA 1C8M3 4E4DX 3BOPA 1AR83 1F4HA 1YO8A 2PLV1 2RHPA 4L2NA 4D0QA 2WQZC 3H8RA 1DGWA 4DRRA 1FI2A 2X53S 4JC1A 4KWJA 5GLVA 4H3WA 1NQJA 4RQPB 2OKXA 2WS92 2WWJA 5FY5A 3TAYA 5CAZA 3TEYA 3DYMA 1WZXA 1QJFA 2XJQA 2PHDA 4UAPA 1JYXA 4Q1PA 4V2VA 1LHVA 1SDDB 5AFEA 4YGCA 3M3OA 5A6QA 3LA2A 2D97A 1M06G 1OURA 4QX5A 4QB2A 4X8NA 1C8NA 3KF3A 1OA3A 4CP1A 2KA3A 3ZXFA 1N1YA 1ENXA 1LAJA 5ISLA 2ADEA 4YG6A 1U5IA 2R0HA 4ISQA 4MXWB 2VAUA 3H8UA 4MGTA 3O1SA 1KDMA 2MNGA 1RITA 2CGNA 3ILNA 2ZHKA 4M4PA 3BUCA 1RUH3 1WLDA 2EXIA 4QQ2A 1SLTA 1NLSA 1IG3A 3UESA 1XNAA 1NXMA 4PCRA 1GP6A 1QWRA 3TNQA 3ZR5A 3ABZA 3DXTA 4K20A 4CP0A 4DOUA 1V6MA 4I3PA 2BWCA 1JYIA 1KJRA 3CMGA 1GLHA 2VZ3A 1KXGA 3NNLA 2Q8OA 4AHZA 1LB2A 1AYM3 1ACCA 4EROA 5ACA1 5C33A 1ALYA 4DMIA 2HEWF 2D98A 4HKOA 3VZNA 1SLIA 3HEIA 4RHV2 4AQSA 1WD4A 5E88A 3PVEA 2RR13 4IEYA 2RM21 1ZX5A 3CJIC 4MXWA 4Y1XA 3DV8A 2XWJB 2DVAA 4LO8A 1YQ5A 2ZGPA 3NW4A 1EAH2 1O3SA 2R042 5EHDA 1RUC2 2GH8A 3FHIB 2V4AA 4Y22A 2BBAA 1STMA 2C9AA 1AUYA 1H0BA 1MS0A 1D2QA 1DBNA 4FPEA 4CDXC 1H9PA 4LKEA 1C3HA 3WEZA 5F1RA 4CE8A 2WFPA 2WQ4A 2YUEA 1OUSA 4QT6A 1H2NA 2CWMA 3ZN4A 4AR2A 1JOPA 2JG8B 3T0DA 3ZO0B 2WNVB 3AKRA 1U12A 2GC1A 3H7YA 3IWZA 2XJPA 4KH9A 1FX5A 3DYPA 1A8DA 4Q29A 4Y24A 4NIAA 2VW1A 2R6QA 1ZBA2 4KNCA 3MV01 4QX1A 2BNMA 3SNMA 2YB7A 2JDHA 2QQJA 3SCFA 2C5DA 5F5CA 1RHI3 1YC61 3VHRA 5JSOA 1TNRA 1CR7A 4MGKE 3NJXA 1HB3A 1OT5A 2BGOA 2Q0AA 4P08A 1XYNA 5A3UA 5LEKA 2LALA 5IVVA 5CIRA 1W8ZA 3AMMA 3LFIA 3UJQA 2JG8A 2WNVA 2CYFA 4UFKA 2VUAA 2HWE2 5IYYA 5BUVA 2YXSA 1BVVA 2PELA 4KI5M 2DURA 3CLPA 1VBE2 4YW4A 3BU0A 1H1MA 1IHMA 1EV11 2WO3A 1HX6A 3VDDC 2XH6A 3K3NA 1O7FA 2I74A 2W47A 1W0NA 2UWBA 3E6DA 3FWEA 4QD2A 5LASA 3VV1A 5A3NA 3AKQA 1J1TA 4WV8A 3IIAA 4KU7A 2XHKA 1H8TC 1UOBA 4YM2A 3KLSA 4BXFA 2IFWA 2H6BA 5FKBA 3MIDA 4TN7A 5IK4A 2RS51 4HBNA 1VBB2 4K6BA 5FYCA 5BNNC 2JIGA 4TYSA 2XQRA 2Y6LA 1HXS3 1KGYA 1GUIA 4EZHA 3BN6A 1G9FA 4GKXA 1Q3EA 4XF3A 1POV0 5FQ0B 1DFQA 3RQ0A 4ZHNA 3KHCA 5B4XA 4LITA 4TLGA 3OGGA 4NRQA 4YW1A 2WABA 4YM0A 3B02A 1FMD1 2YV8A 4NE9A 1COV1 5D2AA 3GZUC 1RC6A 2DTYA 3ETQA 1KJLA 4BDVB 5G04L 1OLME 2A6XA 3MV11 1HRI2 2D6LX 3AFKA 4LA3A 1DQ0A 2MEV1 4IV1C 5IW0A 5JOYA 5I0RA 3VBUB 1UPSA 2VTFA 2WKKA 5EJ3A 4COZA 4EQVA 3LOBA 2YGMA 3RRDA 4FQ4A 1I3HA 1OLQA 1V6IA 2AREA 5J7MA 3P3PA 1F4AA 3HWJA 4R52A 1QJY3 4LE3A 4Y4YA 2E7TA 1MQTB 4CRQA 3M3CA 4ASKA 1RIRA 5FQ0A 3NAPC 2E32A 3AMQA 4XE9A 2GH2A 1SQ4A 4GWIA 4YFZA 2A6WA 4AGGA 1CAVB 3CU7A 2ZGSA 4JHZA 1AR73 4UFHA 5K0UB 1YLLA 1UZ0A 4YZ4A 1JYVA 3UJOA 4BH9A 4A41A 3N7MA 4BQ5A 1XC6A 2TNFA 3ZPYA 3U4XA 4HT1T 3VBUA 5FWJA 5C9AC 1ZBE2 3RJRA 3T2QA 3M4FA 3OEAA 1JZ4A 2WIIB 3KT7A 2BU9A 1VMHA 4XJAA 5J37A 1GQGA 3A23A 2TEPA 1Q8SA 2CGPA 2WUHA 3WZ1A 2ZX4A 3AMPA 1O3RA 1POQA 4CDUC 1FXZA 1CAVA 3PUAA 1HB2A 5F32A 5A3OA 2QQUA 3N9MA 3OEBA 1I1EA 3O1VA 2PMWB 1DQ5A 1LHNA 5K0UA 1WD3A 2IXLA 2WAAA 5FMOL 5C5UA 3GCXA 2NP0A 4K1YA 4UW3A 1QH7A 5T55A 4CP2A 1AR63 4Q5OA 3E97A 1R1ZA 2J7MA 4Q4V1 1YQ6A 5I8TA 2Y0IA 4YG3A 4Y20B 4JHTA 1AR72 5L7OB 1FT9A 1O8SA 1QDOA 2FCTA 2UY9A 4OMDA 5EYXA 5F3GA 4E9KA 3DPRC 4ISRA 1OOPC 4LHLA 3V65A 3ZFFC 3WQ1A 3UKVA 4EV0A 1LHUA 1G9DA 3CO2A 3R4SA 3U0ZA 4LQRA 2P17A 1NUKA 1IQAA 3ZIXA 3E6CC 1C5HA 1L7QA 4YGEA 4FSJA 2ZEWA 5FBJA 1MEC1 1S0GA 1CN1A 2JDMA 4D7TA 4JVAA 4DFSA 1PIV3 4D7SA 3G7DA 1PX3A 3AYCA 4XHBA 4QM8A 2VXRA 2Q5TA 3ALQA 1NA1C 2R32A 4FCAA 2RJKA 3J7NA 4Y20A 5L7OA 1XPWA 3Q9OA 3ITQA 3VBFC 2VH9A 5C3PA 3FBMA 4QPGC 2ENRA 2WLQA 3Q8AA 3WF0A 4WZFA 4E8CA 1W2AX 2YBSA 1TME1 4AEDB 3AL6A 1JUHA 2J22A 4LMFA 4X6QB 4N53C 3DYOA 5GZFA 2CSGA 2PLV3 1H2LA 4Q0PA 3PUIA 4HXCA 2VQTA 4GH4C 3VL9A 1WCDJ 2FCUA 3U10A 4C0BA 1YHFA 5FY0A 4E2QA 1UXZA 1PMHX 1JZ2A 3QCWA 3HPNA 1QJX2 4AHXA 5LBFA 2YBKA 4XJWA 4OUEA 1H2KA 1UMIA 4CCCA 2EALA 1XE7A 4H55A 3W21A 3WDYA 3C8XA 3MYXA 4AEDA 1JZ3A 3J8F2 3NJZA 5LBCA 1CZSA 1KITA 3POFA 3WW4A 3ZXGA 4CSWA 2XL7A 3ETPA 4D6RA 2GMPA 4P5HA 3THPA 3VBRB 4AI8A 3LQCA 3TB0A 1JH5A 1UU6A 4ES8A 1LGNA 1OUXA 1XYOA 4Z8BA 5LY1A 4KWKA 3ZSEA 2P3JA 4R9CA 2WYSA 1RUJ1 1ZZBA 1YEWA 2ZACA 1WLTA 5FUNA 4GZ9A 1SFYA 4XBLA 3WXPA 2ORZA 1NAEA 3O14A 1LTEA 5T5OA 3QLQA 1V6NA 2QKDA 4MH0E 5EP9A 3OUIA 3T0AA 2MPFA 4YW5A 5FPLA 1CPMA 1W8WA 3WDVA 4E4HA 2VTXA 5ACA3 3DGTA 4FVVA 1HW5A 1MACA 5FPBA 3VBRA 1FOD3 5A1FA 3SH4A 2Y6KA 4PLNA 4PI2A 2PA7A 1REEA 1W6MB 2RM23 4ET7A 1ND3B 1BVP1 3S7EA 1V6KA 3WP5A 4W8JA 3WCRA 5FYZA 4LT5A 4OHZA 2C6SA 2Z79A 4M0NA 4NUBA 4IEXA 3ZOIA 1ULPA 4N7IA 1VMFA 1VRH1 3KV5A 5C4WC 3KD4A 3OB8A 5HV0A 1UF2C 1O5UA 4P9WA 3WNKA 3VZJA 1W0OA 4AHYA 4Y4RA 4PJYA 3W20A 1UWWA 2J42A 2LTNA 2IXIA 2TBVA 3MIHA 4LA2A 1W9WA 5K4LA 4BWOA 3JQXA 5CFCB 2FDHA 3NNGA 4I30A 1ENRA 2JE7A 4QU1A 5JMOA 1W6MA 3AP4A 1ND3A 1YYNA 4PDWB 5A3LA 1ND2B 1JZ7A 5EIYB 1E5IA 1IGOA 4MOAA 2A3WA 2D6PA 2WS91 1GQHA 4Q2FA 4QHZA 1CZTA 4YW3A 3OPTA 1CX1A 4BA6A 1FOD2 1JYTA 2A7AA 3K4AA 2X5IB 4AL9A 5JI9A 4XMAA 3NKGA 5BYNA 1YQ2A 2WA4A 3RZZA 1F31A 4YNIA 3A0KA 5F37A 1IQDC 3MF9A 3WP6A 1SACA 3H0OA 3KWVA 3H8OA 1S1AA 2FDJA 3VBOB 5APAA 5CFCA 5FY4A 2BOJA 2Z42A 1AHSA 5KXEA 1JXNA 4F8AA 3MDPA 4PDWA 4QXHA 1ND2A 3C7GA 1XBFA 5CVRA 2GP3A 5C6CA 4A6SA 4BLJA 1ASJ3 1EV13 4LUMA 3WINE 4AVTA 3IAPA 1YJLA 2DU0A 5FAXA 2HWB2 5LWBA 1RUG2 4Z92B 3TEZA 4Z2AA 2CDPA 1MZ6A 1LOCA 4FPCA 2VZVA 5I0TA 2RV9A 4RQPC 4QAWA 4CU6A 3ZLIA 1LEMA 2E31A 1Y9GA 1W6OB 2EIEA 2RS53 1LCLA 3V64A 3VBOA 2XPJA 5F5AA 5FO8B 4RHV1 3EHKA 3D6EA 4P9XA 2ES3A 5DMYA 3BIEA 2DCTA 1C28A 1IZ3A 1QH6A 2VNOA 3GXUA 3HMYA 3JBG2 4AAXA 1SG3A 1IS4A 3T2TA 4XCAA 3H1YA 4FPGA 4UBGA 3A0NA 4YW6A 4KU8A 1HRV2 1EAH1 1FMD3 1S2KA 4WVMB 2VMHA 4C91A 3O7OA 2UYBA 4JCKA 4Q0UA 1RUC1 4PHZA 1MS1A 4JRAA 3THTA 4Q4X2 3VBSB 1I6XA 2O0OA 1YFYA 2OIIA 3POYA 4QXCA 5FYHA 1PK6B 4PF5A 5FZIA 1SEFA 4JRLA 4RR3B 2MEV3 2WN2A 4NHKA 2RJ2A 1E5RA 4XFGA 5DAXA 3N7JA 3THDA 1I5PA 4FOVA 4NN0A 4IW3A 4PLMA 2P4EA 3VZLA 1DP0A 1MZFA 1ZBA1 1WCKA 1J1LA 3Q8FA 2GNBA 5HCFA 2HJIA 2W3JA 5T54A 3CF6E 5HCAA 4IGOA 2HEYF 4WVMA 4M0HA 1VPHA 2D93A 3P3NA 3WDXA 5KHGA 2XJRA 4KBBA 5ABJB 5FZ8A 3VBSA 1LODA 5FYTA 4AYUA 5DUXA 1DZTA 4LBQA 2XDVA 3RYRA 5F2SA 2XR4A 3HNMA 2IXKA 1QQP3 1WLCA 5D8AB 3ZXJA 4IE6A 2B39A 2NQYA 4ATEA 2GMEA 2HWE1 3OG2A 1GANA 4LBQD 2VMEA 4A6OA 2FDKA 3KQRA 4P02B 3NNFA 4GMP0 4OI4A 5JLVA 3P6BA 4NMIA 1VBE1 4I02A 5KHJA 3PTRB 5TSWA 1XU1A 4MYEA 3O1RA 1QOOA 3JU9A 2Y6FA 3NV1A 2JG8C 2PAEA 1F35A 2WNVC 3GNEA 3LD8A 4UW5A 2P1BA 1VR3A 4XZPA 3VDAA 4YM3A 5ABJA 2VOVA 3H3ZA 4U2AA 2VZTA 1RGSA 3N9OA 4LOSA 2DCJA 4FQZA 2D7FA 2VR4A 5D8AA 1S0DA 4Q4V3 1G7YA 3WNMA 1VBB1 4DEQA 1OH3A 3LWCA 3SLIA 3Q8CA 2UU8A 3WR0A 4LKDA 3GHMA 3G6JB 5DAQA 4DXZA 4ZZ8A 5B4NA 5CFDA 4LBLA 1JZ6A 1A78A 1BEV2 2IFRA 1E57A 2X05A 2GNTA 4ZU7A 2D3RA 3MICA 4UFLA 4C8DA 2QJVA 1UO9A 2QQLA 3KZ4C 1WW4A 3HQRA 1GOGA 4QHOA 4L8QA 3U75A 2JDKA 1MEC3 1R092 3VKOA 3ZMOA 5IVJA 4QQPA 2G19A 2CNAA 2X09A 3D8CA 5DUWA 2PFWA 3I2DA 5FZ7A 2XJSA 4XUPA 4AOCA 1HRI1 5HXVA 5LK5A 4CUGA 3C7HA 4CDWA 2FZ1A 3T09A 4UI9L 4E8DA 4CEYB 2WNOA 1GICA 2YMZA 1U5YA 5FY7A 1HN0A 1ULOA 2JXAA 3N9NA 1L7LA 1OF4A 1NE6A 2JIJA 1PMIA 1TME3 2RVAA 3T2PA 4XBNA 3WNXA 1TZOA 4LBJA 3WP3A 1JN2P 2PAMA 4O7XA 4QX8A 5EFUA 3RSJA 4AEMA 5BNQA 1MS9A 2CGOA 2VZQA 5CA6A 5FDBA 3POSA 3L2HA 3OSDA 1OHFA 2OZJA 4Q1RA 4EN6B 3IDBB 4YM1A 3VD7A 1J58A 2B7YA 3VBFA 4A42A 1X8EA 2D3SA 4DQAA 1ZBE1 4MUVA 1NZCA 3K51A 3NV2A 5C8CB 3S5AA 3RJ2X 1NLQA 3V0AA 2VNGA 3LAGA 5A70A 2AR6A 2H6CA 3LEMA 4HANA 5C3QA 5JDBA 1Y9QA 3PVOA 2DFBA 2IUWA 3AKTA 5F5QA 4BQ3A 3AB0A 5LY2A 3VBUC 2JKBA 2BBVA 5JPMB 1MR5A 4P5YA 4FPHA 1GMMA 5E89A 3KT1A 1ZRCA 2AZ5A 1R64A 1VBD2 1I9RA 3K2OA 5EV7A 3WV6A 1RUJ3 1AL22 1UY0A 1OVPA 2DUOA 3AM2A 5FPAA 4A3ZA 1W99A 5C8CA 2R49A 1AR71 4IE4A 2ADDA 3KB5A 4FOQA 3QACA 4NWWA 5K0UC 3OCPA 3K46A 4CDQB 4QGLA 4M3CF 2HYXA 5A3PA 1ODMA 2OA2A 1JBCA 1OA2A 1PO13 4N7UA 4XABA 5FIXA 3BTXA 4FTSA 3IMMA 3ZMNA 2P34A 3H3LA 2BVBA 5EJZB 1YJKA 3PURA 3JD72 5LK7B 1YIFA 1ZRFA 4HETA 3K77A 1TNFA 4XF0A 4EZ4A 1R082 2A75A 4A2UA 5IATA 1VJ2A 2NPIA 1TVGA 2WR9A 3AZVA 1C5IA 1SLAA 3PVBB 4MGQA 3Q8EA 1QY4A 2QQVA 4XXAA 3USUB 3ZN5A 4JGYB 1VRH3 2XUMA 3FHQA 3IMNA 5BNPB 3VB9A 1HDKA 4CDQA 1AR61 1YCIA 1DGWX 4YZ1A 2P2KA 1OKOA 2DBIA 4CCKA 3ILRA 3S7IA 3BYWA 4A7ZA 2ZZQA 1P8JA 2RMU2 1UNBA 1CAWA 3JUUA 4GXLA 1YI7A 4PI0A 1SLCA 4XQ4A 1X82A 4XBQA 4GD4A 4DY5A 3SXWA 5L7OC 3ZXDA 1SFNA 2AUYA 2WQ8A 3QH6A 1UL9A 5EJ1B 1NE4A 2ZAAA 5DXDA 2QE3A 5JZGB 1PO12 3RZJA 3RFRA 2QQPA 1UY1A 4PIZA 2VMFA 4EJRA 2WS93 4A4AA 5LB6A 4AHWA 1UPIA 2VMCA 3USUA 1QJX1 3IT8A 4IE7A 1WW6A 3AXDA 3IB3A 1BZWA 4JGYA 2GMMA 4I0BA 4EWAA 1RUE2 5IFPA 3UKTA 2EVXA 3N7KA 1DF0A 2Q8EA 3WUCA 5FZGA 2VMIA 3J8F1 2J1VA 3CL1A 5FYUA 5J09A 2JDYA 1AL0G 2Z2SB 4HKLA 3LZZA 4E2GA 4A7KA 2RS12 5IHRA 1RTVA 4MSVA 2PHTA 1UZVA 2PTMA 2ZX1A 3GM8A 5JZGA 4QQLA 5JI7A 3MW3A 3T1LA 4M3CA 4AEDC 1FV3A 1LOAA 4AFAA 3HT2A 1JZ8A 1J59A 2GP5A 2Y38A 3BCWA 3BOWA 4AFBA 4CPBA 1OPOA 2WZR2 2OW4A 2ERFA 2VW0A 2WBKA 1O6UA 1HB4A 5CKQA 2ZEZA 3QH7A 1N3QA 1SLLA 4GJYA 4Y26A 4COYA 2P6CA 4CPBD 1H2MA 4YG0A 2J1TA 4OUSA 4LUKA 1BMV2 1Q5OA 2PHLA 4BIFA 2Y64A 3X29B 5DZFA 4RHV3 3KCXA 3HR9A 1LRHA 2R30A 1O4YA 2OT7A 3IDCB 4YW7A 3I3DA 1WBFA 3OOXA 5D21A 2EIDA 1WA4A 3E5XA 3UGFA 5FK8A 4FT8A 4NHYA 5FZAA 4LLFA 1HQWA 1EAH3 1AJOA 4LHSA 1OD3A 2R043 3IDAA 4FO9A 4L99A 1RUC3 3B00A 2WC2A 3VBRC 5A3WA 4HKWA 4RQPA 2EA7A 4FXGB 4DXTA 4YLZA 2AGSA 5A7PA 4MGSA 1XSQA 1XE8A 4DIQA 1QOTA 3NL1A 4AVCA 3NJVA 3RPQA 4CU8A 2R1BA 5F6LB 4L9BA 4BMBA 1AXYA 2XONA 1WBLA 2AEZA 2WZ8A 1EY2A 2A6VA 5LA2A 2FHRA 3VHPA 1BXHA 1ZBA3 2KR2A 3PIGA 2I45A 2V72A 4YGBA 3S57A 4B7KA 3KSCA 4A3XA 1A6CA 1FOD1 4RSUA 1TE1B 3PMEA 3E5UA 5KXCA 4Q8LA 2ET1A 1O59A 2QTWB 2ZHMA 3MHZA 3FLTA 1F15A 1LEDA 1W05A 1SCSA 2Y6HA 3IIIA 4HK9A 1ND3C 4XUTA 5AC92 5JUVA 4HK8A 1BKZA 4HSLA 3EBRA 5LRSA 3SHRA 3ASIA 1UYPA 4YVWB 1A3KA 5K8SA 5FLHA 2UWAA 3ZYGA 1RUF3 1IKPA 2HWE3 5EXOA 1T6GC 3CQOA 4LJHA 4META 2VO5A 2WT2A 1IOAA 3ZYRA 1VBE3 4DXSA 5IK5A 2B9UA 4GJZA 1HV0A 3VD9A 1X33A 1LR5A 1ONAA 3CZJA 3GALA 4NJ4A 4OHWA 3JXSA 3I7DA 5FP9A 1HQNA 1PM4A 1RUG1 3DCQA 5CFCC 3P1IA 3WF3A 2EF6A 2LUWA 1GOFA 1MVEA 4PDWC 2UURA 1HN1A 2DVBA 1ND2C 4XFFA 4H2AA 4Y1YA 4Y1UA 3TNPB 4DZGA 5JSPA 4YVWA 2WZPP 4OI0A 2JD9A 5AVPA 1VBB3 3CDZB 2IXHA 3DL3A 1SHWB 3HQUA 4P9GA 4DINB 4R9DA 4ZXEA 5FJKA 2VVEA 3JBG1 4LHKA 5BNOB 5FOJB 4XUQA 3MUZ1 1WMDA 2IXJA 3VN4A 3VD5A 1RUD3 3AXEA 4OYUA 1RUF2 1HRV1 5ANNA 1UMHA 4QXKA 1VAVA 4QGMA 4UBHA 3VBOC 3VHOA 3WT3A 4Z2WA 1JYWA 4Q4X1 3T2OA 4XUOA 1PGW2 1ASJ1 5LRRA 2NM1A 1HRI3 5LATA 4AF9A 1GFF2 4AI0A 1GNZA 4OI2A 4AE2A 4D3WA 1QKQA 3B3QE 4CYDA 4KQ7A 3FLRA 3CHXA 5IJRA 3C3VA 5LW9A 4D6SA 1N3OA 5A3TA 2DVDA 3RGBA 5A7WB 2W68A 1ULEA 4ZZ5A 5BNOA 2G4IA 5CZKA 4EE2A 1GNYA 3MIGA 1YFXA 1OSGA 2ZBJA 1F5JA 4FPYA 1YNAA 1ZZ9A 2QDNA 5FBZA 2V73A 3KV4A 5KWRA 2HLEA 2VZSA 1G8WA 3ZSLA 3AKSA 4BYYA 3I59B 3LKJA 5A33B 1N3PA 3ZR6A 1N1VA 1D4M2 1DZQA 4UW6A 3TEWA 1GP5A 5K9YA 1RUD2 2E7AA 2D44A 3GZAA 5IFTA 1IPSA 1UZYA 2BFUL 5GZGA 2EICA 4EN8B 2A71A 1ZBE3 1W03A 5FY8A 3VKNA 3LEIA 4HL0A 4WVWA 5FPVA 1SPPB 1AXZA 1DQ1A 1X9TA 5A7WA 3E5QA 1NYWA 3VBSC 3RZLA 1W2TA 2JG9B 4AAPA 2EXHA 2W2IA 3T3YA 4ARYA 5JCTA 3CBNA 1KRIA 2ARXA 4NO4A 4DO0A 3CEWA 3I59A 1WWYA 4HMZA 5HCBA 3ZFEB 4KWLA 1H30A 1XXNA 2YROA 3OBAA 4HZFA 4K8RB 5IAVA 3PIJA 5BY5A 1Y4WA 5FZLA 4RFRB 3TWIA 1SPPA 1UY4A 5ABJC 4BE3A 3C7FA 1Z78A 2XXZA 3RYKA 4IDZA 1L7RA 2DDUA 2BRTA 4IV3B 5F39A 3UKNA 5JMCA 1BEV1 2E9QA 2VGDA 3ES1A 2JG9A 1QQP1 2VCAA 3OUJA 1PHMA 5SV8A 3ZPOA 2XVGA 4XMIA 1OFNA 5D8AC 4XFHA 4CCDA 1CESA 3AC0A 1CONA 1SDWA 4BISA 2WNUB 5C8WA 4CCMA 2K2SA 1MQTA 2W08A 1R091 1K5MB 3V0BB 1CQ9A 5CFDC 1IS3A 1QNYA 2B46X 4IEVA 1VAKA 5J36A 3TOJA 1S0IA 4XFAA 2WNEA 4BQXA 2CV6A 2BPA2 4MHUA 5FV3A 3WW1A 4V2WA 4CU9A 4Y5Z0 4PBPA 5FXZA 4IV3A 3HD8B 2HBTA 1V6JA 1LU1A 2A5ZA 2EIGA 3I2JA 5KR7A 4BM8A 5JXJA 3O0VA 5FUPA 3E6BA 1A34A 1QF3A 4CDWC 2WNUA 1RINA 2VW2A 1DQ4A 5FZ0A 1FNZA 4KMQA 4NPLA 3V0BA 2YC0A 4O9GA 2EXJA 4IQPA 3EB7A 3WX5A 3ZYFA 4CEWB 4PLOA 4OCTA 3DKQA 2O8OA 3HNBM 1QJX3 2DVFA 5FZ6A 3J7HA 1S55A 3D0SA 3H3UA 1AZDA 2KM2A 3O12A 1PO22 2W1WA 3MUY1 4Q4W2 3RZMA 2FDIA 2ZCWA 4RS5B 4URAA 4WVVA 3PU3A 1W8NA 1GZ9A 3J8F3 3VKMA 3FUQA 3VBHB 3HOBA 4P9YA 4Q0SA 4LPLA 4RGGA 4OI1A 3AZWA 4ASMB 4BPZA 4CEYC 1R1A2 5C70A 5K7PA 1RJ7A 1WGPA 1DGLA 3WNLA 1DGRN 5FLJA 4AVVA 4D6QA 1VBD1 3HAGA 4CEWA 2ZOEB 1W9TA 4BQWA 2R7EB 2ZGQA 2B5HA 3MPPG 1A8MA 3WG3A 3NMBA 1AL21 5FYVA 1T6BX 4GIQA 3ZFGB 1N47A 4FFGA 4OLLA 2D6OX 4CA9A 5KC6A 1OBNA 4XURA 1HKDA 2ZMNA 1US2A 2NYYA 4CUCA 4FI9A 5C3OA 5JOXA 1LESA 3ACHA 4RS5A 4XFBA 1FPN2 3LOIA 3ON7A 4GWNA 5DAVA 5FZMA 1UKGA 3VBHA 2XVLA 4IE0A 2GU9A 5FP4A 5I93A 2HBUA 2RS33 5GJ6A 3J7LA 1F9KA 3LE0A 5C8CC 1K12A 3WG4A 2WINB 1WA6X 3VDCA 4E2SA 3JD71 2GDFA 5FY1A 3JCIA 5EQUA 1R081 5J3UA 3WNOA 5JPNB 3AX4A 4HSJA 3NSTA 3TRSB 3ZFGA 1OLMA 5FKCA 2OXBA 4YPJA 4I0WB 5EZWA 2WN3A 2VQ0A 4Q8KA 4M00A 2YC2A 2VG9A 4XILA 5FY9A 4YZ3A 3AP5A 2ZGLA 1PGSA 1CAXB 4XCBA 1IKQA 1D7PM 2QDRA 4W50A 3D0JA 3WVJA 4CUBA 2ZGTA 4KGGA 2RMU1 4DEVA 1OD5A 5G05L 3DEMA 4OZXA 1B35B 5H9RA 1LOBA 2J1RA 4QQHA 5A1AA 4CDQC 1PO11 4NOTA 5JOZA 1RUOA 4LHNA 2RS32 2Y33A 5DZEA 3H7JA 3NJYA 1AR93 4INDA 4CCNA 4JAAA 2Q1FA 4S2DA 3MIEA 1J3PA 1RUE1 1HV1A 5FZ9A 4UWDA 2D6KA 5GZEA 2YPDA 4R8HA 3AP7A 1CAXA 4UFJA 3MFAA 4J25A 4MXVA 3OUHA 4L11A 5DUVA 3RMXA 1GBGA 2D5HA 1DHKB 2RS11 4LOTA 3POEA 1B35A 4JGYC 3H9AA 1KQRA 3OD4A 4Q27A 2PHUA 4AQTA 2GZWA 3U11A 3VZKA 4LEJA 3I97A 3EQEA 2GN3A 2WZR1 2Y0OA 4YZ5A 2HWB3 1RUG3 3MEPA 3IPVB 5CKMA 4MADA 1JMUB 4GWMA 5F8PA 4YSFA 1OKQA 5JZGC 1C1LA 1X36A 2QVSB 4QQOA 2RDSA 4XQDA 4WBBA 5HCHA 3EO6A 1ENSA 1N1TA 1BMV1 4XW3A 1AR92 2WT0A 5BV6A 4OQ9A 1RUI3 1TMF2 1DDLA 1ULFA 2CAUA 4D7YA 4O61A 3WUDA 1GQPA 4GULA 2R0FA 3J7MA 3JBG3 3KVBA 2UWCA 2WFF2 4SLIA 4ZU4A 4W6XA 4QKFA 5C5TA 2YYOA 2DCKA 4NAOA 4RL7A 1HRV3 1DLLA 1SFPA 2VXJA 1AX0A 2Y6JA 3LA3A 1NOVA 2IC1A 3OGVA 4LLOA 2KD7A 4P00B 4Y3OA 1W6QB 1C1FA 1W8OA 1OQ1A 1WUVA 3IPVA 4Q4X3 4DY3A 5CG8A 3T30A 2XBO2 1CPNA 2JDPA 1CAUB 5C7GA 3SQOA 2VQUA 4LO6B 3RMYA 3KHBA 1LHOA 2X5IA 4OHXA 3Q8BA 4IL7A 1VB2A 4ZS2A 4RYDA 3WQBA 2W9XA 4N9HA 3K48A 4AWDA 2Z5WA 4ONUA 4XIKA 2ID4A 1RUNA 1NKGA 2BYVE 1RUI2 4FPFA 2VUCA 2VOTA 2XG3A 5DZGA 3USSA 1J83A 3HN1A 4P9LA 3OPZA 1W6QA 1LENA 2QZ2A 4C90A 4HPKB 4XFIA 2FD8A 3D3AA 3MBWA 1CAUA 1V9U2 5AC91 5F9TA 4LE4A 1JTZX 1G9CA 3FMGA 4M01A 2J1SA 2R041 2IZWA 2G9ZA 3EXUA 4EN7B 5DDJ2 3WQ0A 1W06A 3EMRA 1BBT2 1CD3G 1EPZA 4UYBA 5EPAA 5FREA 3NO8A 4BCUA 2DVGA 1OF3A 4FTEA 1W6OA 3WHUA 1JI6A 4Q4Y2 2PHRA 4OQ8A 4CXWA 2WZEA 3J4UH 4N9IA 4QKBA 2VZUA 1VB4A 2D5FA 3KF5A 4UW4A 2JDZA 2VU9A 4HPKA 1JYNA 5FCCA 2C24A 2V5DA 5BXXA 2ZX3A 3DECA 1RJ8A 3NQHA 3ACLA 1JU3A 1UYXA 4ITCA 3VL8A 2WJSA 2CY6A 3DKWA 1JS9A 1C4RA 4XQWA 4FOWA 4QB6A 1PK6A 4NAMA 3AVRA 3L2YA 1WMEA 1YQ8A 2YC4A 5F3EA 4RR3A 5DUUA 1BEV3 1OQEA 1S2BA 2VOKA 2ZMKA 3UL2A 4FAHA 3A4UA 1NCQB 2QQKA 5GZCA 4LIUA 1RUF1 1XU2A 4YVWC 4IERA 4ORFA 5L36A 2RE9A 4LIVA 3BGAA 2A3XA 4GB32 1R093 4E4SA 4KGQA 1QEXA 1UOGA 1PGW1 3ATGA 4FPOB 5IK7A 1GKBA 4URTA 4YW2A 1VBC2 4V1PA 2BP6A 5JXHA 1O3TA 2ARBA 4K7JA 3JB4C 5IT6A 1ZYBA 2HWC2 1LOEA 3IM0A 4BHPA 2ATFA 4NRPA 4LBMA 1XNTA 2ILMA 1NCQA 2W94A 3SH3A 1W9FA 1NX9A 2HH9A 1H6YA 5LBEA 2HEVF 3WF2A 2DU1A 2YFUA 3I2KA 4B4RA 4PT6A 1S0BA 1NCRB 3ZYIB 2ZGKA 3RZKA 3UT0A 2ZKNA 1AYN3 2OPWA 1H4GA 1NXD1 3WD5A 1ZA7A 4LK7A 2R072 1D4M1 1H9WA 4W4ZA 5CB7A 3MW2A 5BNOC 1RUD1 3ES4A 4CCEA 1S0JA 4LO4B 1WCQA 4B1LA 3GYDA 5I8SA 1ZREA 4OHVA 4IEUA 4NPRA 2OPKA 5L9RA 3U78A 3ZIWA 2Z4FA 1O91A 4G3YC 3MGUA 1X9PA 4YRDA 3FLPA 3VD4A 1V70A 2ZX2A 1YQCA 4QX2A 4J1WA 1F5FA 1XB9A 4TTGA 1RB8G 2FZ2A 1NCRA 5JIUA 5FZFA 3GGLA 1VAMA 4FPKA 3TN92 1W2NA 1LU2A 1VBD3 3HVDA 1US3A 1ZZ6A 4Q0QA 1W04A 1ULDA 1OC1A 3U4SA 2D40A 1X7NA 1PVC2 1AL23 1K5JA 2N7GA 1S0CA 3WW3A 3N36A 2D6NA 4N8MA 3RS6A 1AYN2 1Z7S2 2QFEA 3I2FA 5L73A 3RZGA 1UX7A 4I09A 2VJXA 1J3RA 1DG6A 4DNYA 2W5FA 2YGLA 1UY2A 1QXPA 3LDKA 3POIA 4E27A 3INAA 5FP3A 4P9JA 3BU7A 4CEYA 3O1MA 5LA0A 4EN0A 2CHHA 1ZVFA 3OYWB 4XVHA 5FPUA 1UZWA 2VMDA 4K21A 4Y5TA 3SKVA 1XE0A 1GNHA 1LJ7A 2DCZA 2XKOA 2JB4A 3CNAA 5FYMA 5JOWA 1V00A 3JD73 3KT4A 5IVEA 2GC0A 2XJUA 4AEKA 1AX1A 1R083 1PM7A 2JG9C 4QKDA 5EYYA 3MIBA 1POV1 4AXOA 3EYPA 3VKLA 1U0AA 2JJ6A 2CWSA 3T4HB 5HPOA 2VPVA 4R9BA 3ZN6B 4E4ZA 3GJAA 3PL0A 1MQTC 1BK0A 3C7EA 4NHMA 1UAIA 3ZFEC 2F6BA 5CISA 2F4PA 2G9FA 1AJKA 5FR3A 2VNVA 1Y7BA 1NG0A 1GV9A 2RG4A 1HQLA 1G6NA 4QXBA 4LKFA 1OMIA 4BU2A 5IAXA 3OYWA 2RMU3 4BZ4A 4IUGA 1CGPA 3AYDA 2XJTA 4DPNA 1B09A 2EIBA 1GZCA 4IV3C 4IESA 2PQSA 3JQWA 4Z07A 2WWUA 5A7NA 1AVBA 4NROA 5T5JA 4FPLA 1ZNPA 5FO9B 4XDPA 1Z0HA 4A45A 4F83A 3WW2A 3QOPA 3ZN6A 2WNUC 2JD4A 4RN5A 2WSUA 5E16A 4XZUG 1JODA 1CX4A 1ZM1A 2ZTNA 1PO21 1CWPA 4Q4W1 1KDKA 1RUE3 1QMJA 5CADA 4OULA 2VZPA 3FHAA 4CTEA 2E33A 3OBTA 1LOFA 5T5LA 2O1QA 3MW4A 1R1A1 2RS13 2VC9A 3FFZA 5JSRA 5ERLA 4YZ2A 1OXCA 2Q4SA 2QQNA 1K42A 3KGZA 1GU3A 1FATA 2VMGA 3LDBA 4HOOA 1MS5A 2HWF3 3ECQA 3RI8A 3AJZA 3UNPA 4HLTA 3WF4A 3I2IA 2XLGA 3FZ3A 2GC3A 1EPWA 1NLRA 2WZR3 4GALA 4BB3A 2E63A 1V6OA 2ZGUA 3VZOA 2VCBA 3ACFA 1XNBA 1UXXX 2D6MA 4IGQA 5FXWA 3WDUA 4CEWC 2OYZA 4Z1VA 3MIFA 2JICA 1SBEA 2W1QA 4QKNA 1FAYA 5SV5A 1NY72 3LPGA 1BQPA 5BNPA 2EXKA 2OUHA 5JR7B 4TWTA 3OF1A 3FFQA 2DF7A 3M2MA 4BLIA 1EUTA 4UFIA 1RMU2 4G9SB 2ZZJA 1XOYA 3ZM8A 3GHNA 2QZ3A 4RS5C 1QJZA 2F4LA 4HG6B 3B5LB 4IEPA 1VBA2 4IEWA 4LR4A 3VBHC 4NIGA 2VOWA 3GZTB 1UMZA 4MX3A 4QPIB 5FZ3A 5H9QA 2AC1A 2GC2A 3O1PA 3EJKA 3M1HA 4FXKB 3S5QA 4F7ZA 1YRZA 3PJYA 3O1UA 4QGNA 3AL5A 3N3HA 4XAAA 3URFA 3M7AA 2JB8A 4AI2A 4QM9A 2HWF2 2OQ6A 1O3QA 3NVCA 4AGRA 1JHJA 2FBEA 1LGCA 4WVZA 3OTFA 3ZFGC 3I8TA 1S4CA 1SMVA 1NT0A 3H50A 3N9PA 4Q0VA 5FZKA 4B4QA 2BOIA 2HWD2 4Y1VA 1V0AA 2K9ZA 4UXAA 4D69A 1OI6A 5IWFA 2NN8A 3WHTA 2CAVA 4BQ2A 5DQ0A 2RS31 5FPXA 4XJ8A 4QPIA 2XKPA 1CIWA 3APBA 4IEQA 2B42B 1MZ5A 1QOSA 3T1MA 4JZRA 1KD7A 3WSOA 2EAKA 2FDGA 2DUPA 3W9AA 5AC93 3M70A 5F3CA 1RXGA 1HIXA 3MLJA 3AMNA 4AFMA 4L0PA 4YFWA 1MS8A 4C0HA 3JZVA 3GBWA 3IZOA 2PYTA 2OS2A 5A6XA 1XYPA 2ZABA 1OVSA 3W5NA 1LHWA 4M4RA 5CBLA 3CKHA 2BNNA 4RA0A 4XDQA 3V56A 5LA1A 1YIPA 1I5ZA 1QHDA 2ZEXA 5GKAC 5DG1A 1DLCA 5EWSA 5F3IA 2R062 4BIOA 2WSVA 2J1UA 4S2FA 3ZYPA 1KS5A 4ZXKA 1LNSA 1W2OA 3KCCA 4CU7A 1B35C 1BCXA 4LORA 5FYIA 3J9SA 3CIHA 4PQQA 2X29A 4B1MA 2GSYA 3WP4A 1NZIA 4XYXA 4H7MA 1W8UA 1AXKA 3D5OA 1BHGA 1AR91 1XNDA 4K1ZA 2NMNA 1UZZA 4FFHA 5A3MA 3PVNA 2Q8DA 5IK8A 2XL9A 1TMF1 2W91A 3O0WA 1W39A 3C2UA 4I0AA 1C8M2 3GZEA 1FYUA 4XF4A 2VY0A 1W8TA 1NQDA 2V5YA 1AR82 4J1XA 4RGAA 3ZYHA 4KG8A 4AW7A 5CKNA 5F7UA 2ARCA 3K3OA 2WFF1 5I0SA 3R0RA 2P6HA 4Y22B 5CU1A 4KWUA 2VUJA 3WNNA 2VZOA 2C4XA 5HV4A 3LFMA 3NWKA 4BOWA 2E53A 4JKMA 4QHBA 1GWKA 2XBO1 1CJPA 1K45A 4WM7B 4ZU5A 4JTNA 4I2OA 2VBPA 1YI9A 3I3BA 2HWB1 5FYSA 1VALA 1UOFA 2FDFA 3FBYA 3ZYJB 5FZ1A 3UETA 2DWRA 2ZKLA 1QJU3 1MS4A 3PNAA 1PGL2 1J3QA 3MI8A 3ZXKA 2OX0A 2P37A 3HBKA 3NRUA 5E6HA 4JGZB 4MGYE 2VD7A 1RUI1 3RZHA 1PZ9A 2AH2A 2WAOA 2AEYA 2LM3A 2X5IC 3KCYA 1FNYA 3A22A 1UU4A 1UX6A 4W6YA 1RUH2 3I3MA 4XACA 4WM7A 4QDRA 1D4M3 2BVVA 4GKYA 2BV4A 3TEXA 2BUKA 1V9U1 3AMHA 2YDEA 2QQMA 1MZEA 1O4TA 2A6ZA 4HN0A 3UK9A 3THCA 5C71A 2XLAA 2NZ9A 2PN5A 4K3UA 5DDJ1 4YWAA 4WZCA 1AYM2 5FUIA 4TZDA 1E5HA 1BBT1 1GSLA 4XJZA 4D94A 1HJGA 3MZHA 1OH4A 5C3RA 3A21A 4NIHA 4JGZA 5KHHA 1IS5A 2RR12 3GBGA 3PLQA 2D43A 1RVF3 3BIWE 3I4IA 4Q4Y1 4PQ9A 2UY8A 5FP7A 3RDIA 4FOYA 4R9AA 2HYKA 2AYHA 4PF1A 1UIJA 1Q8QA 1QJU2 2JECA 4IE5A 4LBKA 4ZY9A 5JVVA 2LROA 4BQYA 3K4ZA 3ELNA 3ZSMA 4CXXA 3S0MA 2FMDA 4HVOA 4QB1A 3KGLA 4MGZE 5A7OA 1S2EA 3VUOA 3P5BA 5JWPA 5AVAA 1YWKA 3H8XA 2W46A 1W6NB 3OPWA 3LIHA 4JKKA 2VUDA 4QDQA 3N4MA 3N35A 3MO4A 4UOJA 1G9BA 2B4KA 5FXVA 2QUOA 1V6LA 2BQPA 2OZ6A 2QNKA 3BPSA 3AFGA 5HXMA 1XJAA 2XJVA 2ET7A 1YXWA 3H1MA 2E7QA 3ZX7A 1EP0A 1REDA 1UYYA 1XSRA 3KM5A 1ZZCA 3KV6A 4MZUA 5JXGA 1F8VA 3HN3A 4GB31 5FMDA 2H0VA 1RHI2 4BQ4A 1PK6C 2WWSA 1BLZA 4OMCA 4ATFA 4RR3C 1RVF2 2QQWA 3WCSA 2OQ7A 2JDNA 4CP9B 2BJSA 3MFCA 1IG0A 4AI3A 5E1RA 2WO1A 1POV3 1W6NA 1ZA4A 1VBC1 2W52A 3O0XA 1U5ZA 3BPZA 4XJ9A 5A33A 5IVFA 2P3KA 3R05A 3D4KA 1YFUA
chains in the Genus database with same CATH topology
3T08A 2VL4A 4OZOA 2JE8A 4ZZ8A 5B4NA 1EUUA 1JZ6A 3SEPA 2QBXA 1F4HA 2X05A 2W1SA 4D0QA 2QQLA 1GOGA 4LKSA 2OKXA 3I97A 2X09A 4XUPA 3DYMA 3C7HA 4A44A 4MADA 3T09A 4E8DA 4UI9L 1H6XA 4UAPA 1JYXA 2J1AA 1ULOA 1SDDB 4BK4A 2BZDA 1OF4A 2RVAA 3T2PA 4QB2A 2JKXA 1GQPA 2VZQA 2DCKA 3SKJE 2Y6JA 4M4PA 4QX0A 3OGVA 2KD7A 4P00B 3VD7A 1W8OA 2ZEYA 4A42A 3UESA 1XNAA 3ABZA 5C7GA 5JR2A 2VQUA 3CMGA 1MPXA 2VZ3A 4RYDA 3WQBA 3LPFA 2W9XA 3HEIA 1J84A 3HJRA 4P5YA 4DUVA 1GMMA 2ID4A 1NKGA 1R64A 2VOTA 3I3EA 1J83A 4A3ZA 1UY0A 3D3AA 3MBWA 4QX3A 2BBAA 1W99A 3WEZA 2J1SA 2C26A 3K46A 5I0DA 4CVUA 3T0DA 2HYXA 3DYPA 3K75B 2J1EA 1OF3A 3MV01 4QX1A 1JI6A 5EJZB 2YB7A 1UY3A 3ACIA 2WZEA 2QQOA 2QQJA 2VZUA 4D8MA 3K77A 3VDBA 1JYNA 2BERA 2V5DA 1TVGA 4MGQA 3NJXA 3WF1A 3DECA 1OT5A 2BGOA 3NQHA 1JU3A 1UYXA 4P08A 4QPWA 3FHQA 3F2ZA 4QB6A 2YC4A 5IYYA 2VZRA 1P8JA 1O8PA 4KI5M 2XOMA 2QQKA 4DUXA 2WQ8A 5EJ1B 2WO3A 3BGAA 1UY1A 2W47A 1W0NA 2VMFA 4A4AA 2VMCA 3IB3A 5DPNA 3WNPA 5IFPA 5JXHA 3K4DA 2J1VA 2Y6LA 1KGYA 1GUIA 1XNTA 2W94A 4BJ0A 3BN6A 3GDBA 5IHRA 1NX9A 1H6YA 3WF2A 5LA0A 2YFUA 3GM8A 3I2KA 3LEGA 4PT6A 5B4XA 1DYOA 2WABA 1JZ8A 4W4ZA 4BDVB 5G04L 2WBKA 3MV11 2ZEZA 1WCQA 2VTFA 4JX0A 2J1TA 1T2XA 1K3IA 1F4AA 2Z4FA 2Y64A 3VD4A 3SEEA 4QX2A 4TTGA 2E32A 4GWIA 1RYYA 3I3DA 3GGLA 4MO3M 2EIDA 3FN9A 4JHZA 3I2GA 1US3A 1UZ0A 3W5MA 4LHSA 1JYVA 5JXIA 1OD3A 3IDAA 4A41A 1XC6A 4XUNA 4DXTA 3I2FA 1UX7A 4MGSA 3T2QA 2VJXA 3OEAA 1JZ4A 2C9KA 3NJVA 2W5FA 1UY2A 1PMJX 4CU8A 2VZ1A 3A23A 2WUHA 2XONA 2WZ8A 5LA2A 4XVHA 2VMDA 3SKVA 3E1F1 1W9SA 2ZXQA 3OGRA 3OEBA 2V72A 2WAAA 3CZUA 2W1UA 1O59A 3EYPA 2J7MA 3IIIA 5JUVA 2Y6HA 5HPOA 1CZVA 4XUTA 3T0BA 1O8SA 4OMDA 3C7EA 2LW8A 1CIYA 3CQOA 4IUGA 2VO5A 4LQRA 4DXSA 1NUKA 2VM9A 1L7QA 2ZEWA 2EIBA 3VD9A 3CZJA 2PQSA 1KEXA 3JXSA 1PX3A 4A45A 3P1IA 3WF3A 1GOFA 1TG7A 4RN5A 1HN1A 1XPWA 4XZUG 2JD9A 2VZPA 3WF0A 4E8CA 3FHAA 3CDZB 2E33A 2BGPA 1SHWB 2J22A 4ZXEA 4ARXA 3DYOA 2VC9A 4XUQA 3MUZ1 3VD5A 3PUIA 4OYUA 2VQTA 1UMHA 2QQNA 5CYYA 1K42A 1GU3A 4TXWA 3ECQA 1UXZA 3UNPA 1PMHX 3WF4A 1JZ2A 3I2IA 1JYWA 3T2OA 3HPNA 2XQXA 4XUOA 4OUEA 1UMIA 2VCBA 3U37A 3ACFA 1UXXX 2LS6A 3C8XA 5IJRA 1JZ3A 2W1QA 1CZSA 3LPGA 4ZZ5A 4BXSV 5CZKA 3ETPA 1GNYA 1EUTA 3LQCA 3ZM8A 2HLEA 4HG6B 2VZSA 2WYSA 4GZ9A 5IFTA 2ORZA 1NAEA 2EICA 3LEIA 3T0AA 1JHJA 2X10A 2CDOA 3A7QA 4ARYA 4JKLA 4ET7A 2Y6KA 5DQ0A 4W8JA 4BK5A 3OBAA 4DUWA 1ULPA 2E26A 2Y8KA 3WSOA 3OB8A 3WNKA 1UY4A 2B9VA 4QDSA 3C7FA 1UWWA 1L7RA 2DDUA 4L0PA 3W5NA 1W9WA 2VCAA 1GOHA 4M4RA 3CKHA 3NNGA 4DXRA 5LA1A 5JMOA 3AC0A 3PUHA 5LCWL 2ZEXA 1DLCA 5EIYB 1JZ7A 4MOAA 2JDAA 1CX1A 1CZTA 2J1UA 1LNSA 4CU7A 3K4AA 3CIHA 4PQQA 1YQ2A 4CU9A 2WO2A 4CUAA 2W87A 1IQDC 1BHGA 1WKYA 3I2JA 2W91A 2Y6GA 5JXJA 2YG0A 5F7UA 3C7GA 4KMQA 4KWUA 3HNYM 3WNMA 3WNNA 3IAQA 2VZOA 3IAPA 2C4XA 3EB7A 4JKMA 3HNBM 4Z2AA 1K45A 2CDPA 3J7HA 2VZVA 2RV9A 3I3BA 2W1WA 3MUY1 4QAWA 4CU6A 2E31A 2EIEA 3UETA 1W8NA 2W95A 3HOBA 5DMYA 4LPLA 1JZ5A 3GXUA 3NRUA 4AAXA 5C70A 1SG3A 3WNLA 2WAOA 1W9TA 3A22A 2R7EB 2WDBA 2L9LA 4QDRA 2ORXA 3C7OA 2QQMA 5DN2A 4XURA 5C71A 3THCA 1US2A 2WN2A 4FI9A 4CUCA 3ACGA 3ACHA 2RJ2A 5FUIA 3THDA 1I5PA 1OH4A 3A21A 1DP0A 2W92A 3VD3A 3LE0A 1K12A 3LEKA 2V4VA 2W3JA 3VDCA 1PX4A 4PF1A 4ZY9A 4GWJA 3WNOA 3K4ZA 4QB1A 1UYZA 4YPJA 2WN3A 2W46A 3HNMA 2YC2A 4JKKA 4QDQA 1JU4A 3MO4A 4UOJA 2B4KA 3I2HA 1D7PM 3OG2A 4CUBA 4W50A 4A6OA 2VMEA 5J1XA 4P02B 4DEVA 5HXMA 5G05L 4AG4A 3P6BA 2XHNA 2YFZA 3OGSA 1UYYA 5JXGA 2J1RA 5A1AA 3HN3A 3VDAA 2VCCA 4OMCA 2VZTA 2QQIA 2DCJA 2WO1A 2VR4A 3FL7A 4DEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T08 A;  2VL4 A;  4OZO A;  2JE8 A;  4ZZ8 A;  5B4N A;  1EUU A;  1JZ6 A;  3SEP A;  2QBX A;  1F4H A;  2X05 A;  2W1S A;  4D0Q A;  2QQL A;  1GOG A;  4LKS A;  2OKX A;  3I97 A;  2X09 A;  4XUP A;  3DYM A;  3C7H A;  4A44 A;  4MAD A;  3T09 A;  4E8D A;  4UI9 L;  1H6X A;  4UAP A;  1JYX A;  2J1A A;  1ULO A;  1SDD B;  4BK4 A;  2BZD A;  1OF4 A;  2RVA A;  3T2P A;  4QB2 A;  2JKX A;  1GQP A;  2VZQ A;  2DCK A;  3SKJ E;  2Y6J A;  4M4P A;  4QX0 A;  3OGV A;  2KD7 A;  4P00 B;  3VD7 A;  1W8O A;  2ZEY A;  4A42 A;  3UES A;  1XNA A;  3ABZ A;  5C7G A;  5JR2 A;  2VQU A;  3CMG A;  1MPX A;  2VZ3 A;  4RYD A;  3WQB A;  3LPF A;  2W9X A;  3HEI A;  1J84 A;  3HJR A;  4P5Y A;  4DUV A;  1GMM A;  2ID4 A;  1NKG A;  1R64 A;  2VOT A;  3I3E A;  1J83 A;  4A3Z A;  1UY0 A;  3D3A A;  3MBW A;  4QX3 A;  2BBA A;  1W99 A;  3WEZ A;  2J1S A;  2C26 A;  3K46 A;  5I0D A;  4CVU A;  3T0D A;  2HYX A;  3DYP A;  3K75 B;  2J1E A;  1OF3 A;  3MV0 1;  4QX1 A;  1JI6 A;  5EJZ B;  2YB7 A;  1UY3 A;  3ACI A;  2WZE A;  2QQO A;  2QQJ A;  2VZU A;  4D8M A;  3K77 A;  3VDB A;  1JYN A;  2BER A;  2V5D A;  1TVG A;  4MGQ A;  3NJX A;  3WF1 A;  3DEC A;  1OT5 A;  2BGO A;  3NQH A;  1JU3 A;  1UYX A;  4P08 A;  4QPW A;  3FHQ A;  3F2Z A;  4QB6 A;  2YC4 A;  5IYY A;  2VZR A;  1P8J A;  1O8P A;  4KI5 M;  2XOM A;  2QQK A;  4DUX A;  2WQ8 A;  5EJ1 B;  2WO3 A;  3BGA A;  1UY1 A;  2W47 A;  1W0N A;  2VMF A;  4A4A A;  2VMC A;  3IB3 A;  5DPN A;  3WNP A;  5IFP A;  5JXH A;  3K4D A;  2J1V A;  2Y6L A;  1KGY A;  1GUI A;  1XNT A;  2W94 A;  4BJ0 A;  3BN6 A;  3GDB A;  5IHR A;  1NX9 A;  1H6Y A;  3WF2 A;  5LA0 A;  2YFU A;  3GM8 A;  3I2K A;  3LEG A;  4PT6 A;  5B4X A;  1DYO A;  2WAB A;  1JZ8 A;  4W4Z A;  4BDV B;  5G04 L;  2WBK A;  3MV1 1;  2ZEZ A;  1WCQ A;  2VTF A;  4JX0 A;  2J1T A;  1T2X A;  1K3I A;  1F4A A;  2Z4F A;  2Y64 A;  3VD4 A;  3SEE A;  4QX2 A;  4TTG A;  2E32 A;  4GWI A;  1RYY A;  3I3D A;  3GGL A;  4MO3 M;  2EID A;  3FN9 A;  4JHZ A;  3I2G A;  1US3 A;  1UZ0 A;  3W5M A;  4LHS A;  1JYV A;  5JXI A;  1OD3 A;  3IDA A;  4A41 A;  1XC6 A;  4XUN A;  4DXT A;  3I2F A;  1UX7 A;  4MGS A;  3T2Q A;  2VJX A;  3OEA A;  1JZ4 A;  2C9K A;  3NJV A;  2W5F A;  1UY2 A;  1PMJ X;  4CU8 A;  2VZ1 A;  3A23 A;  2WUH A;  2XON A;  2WZ8 A;  5LA2 A;  4XVH A;  2VMD A;  3SKV A;  3E1F 1;  1W9S A;  2ZXQ A;  3OGR A;  3OEB A;  2V72 A;  2WAA A;  3CZU A;  2W1U A;  1O59 A;  3EYP A;  2J7M A;  3III A;  5JUV A;  2Y6H A;  5HPO A;  1CZV A;  4XUT A;  3T0B A;  1O8S A;  4OMD A;  3C7E A;  2LW8 A;  1CIY A;  3CQO A;  4IUG A;  2VO5 A;  4LQR A;  4DXS A;  1NUK A;  2VM9 A;  1L7Q A;  2ZEW A;  2EIB A;  3VD9 A;  3CZJ A;  2PQS A;  1KEX A;  3JXS A;  1PX3 A;  4A45 A;  3P1I A;  3WF3 A;  1GOF A;  1TG7 A;  4RN5 A;  1HN1 A;  1XPW A;  4XZU G;  2JD9 A;  2VZP A;  3WF0 A;  4E8C A;  3FHA A;  3CDZ B;  2E33 A;  2BGP A;  1SHW B;  2J22 A;  4ZXE A;  4ARX A;  3DYO A;  2VC9 A;  4XUQ A;  3MUZ 1;  3VD5 A;  3PUI A;  4OYU A;  2VQT A;  1UMH A;  2QQN A;  5CYY A;  1K42 A;  1GU3 A;  4TXW A;  3ECQ A;  1UXZ A;  3UNP A;  1PMH X;  3WF4 A;  1JZ2 A;  3I2I A;  1JYW A;  3T2O A;  3HPN A;  2XQX A;  4XUO A;  4OUE A;  1UMI A;  2VCB A;  3U37 A;  3ACF A;  1UXX X;  2LS6 A;  3C8X A;  5IJR A;  1JZ3 A;  2W1Q A;  1CZS A;  3LPG A;  4ZZ5 A;  4BXS V;  5CZK A;  3ETP A;  1GNY A;  1EUT A;  3LQC A;  3ZM8 A;  2HLE A;  4HG6 B;  2VZS A;  2WYS A;  4GZ9 A;  5IFT A;  2ORZ A;  1NAE A;  2EIC A;  3LEI A;  3T0A A;  1JHJ A;  2X10 A;  2CDO A;  3A7Q A;  4ARY A;  4JKL A;  4ET7 A;  2Y6K A;  5DQ0 A;  4W8J A;  4BK5 A;  3OBA A;  4DUW A;  1ULP A;  2E26 A;  2Y8K A;  3WSO A;  3OB8 A;  3WNK A;  1UY4 A;  2B9V A;  4QDS A;  3C7F A;  1UWW A;  1L7R A;  2DDU A;  4L0P A;  3W5N A;  1W9W A;  2VCA A;  1GOH A;  4M4R A;  3CKH A;  3NNG A;  4DXR A;  5LA1 A;  5JMO A;  3AC0 A;  3PUH A;  5LCW L;  2ZEX A;  1DLC A;  5EIY B;  1JZ7 A;  4MOA A;  2JDA A;  1CX1 A;  1CZT A;  2J1U A;  1LNS A;  4CU7 A;  3K4A A;  3CIH A;  4PQQ A;  1YQ2 A;  4CU9 A;  2WO2 A;  4CUA A;  2W87 A;  1IQD C;  1BHG A;  1WKY A;  3I2J A;  2W91 A;  2Y6G A;  5JXJ A;  2YG0 A;  5F7U A;  3C7G A;  4KMQ A;  4KWU A;  3HNY M;  3WNM A;  3WNN A;  3IAQ A;  2VZO A;  3IAP A;  2C4X A;  3EB7 A;  4JKM A;  3HNB M;  4Z2A A;  1K45 A;  2CDP A;  3J7H A;  2VZV A;  2RV9 A;  3I3B A;  2W1W A;  3MUY 1;  4QAW A;  4CU6 A;  2E31 A;  2EIE A;  3UET A;  1W8N A;  2W95 A;  3HOB A;  5DMY A;  4LPL A;  1JZ5 A;  3GXU A;  3NRU A;  4AAX A;  5C70 A;  1SG3 A;  3WNL A;  2WAO A;  1W9T A;  3A22 A;  2R7E B;  2WDB A;  2L9L A;  4QDR A;  2ORX A;  3C7O A;  2QQM A;  5DN2 A;  4XUR A;  5C71 A;  3THC A;  1US2 A;  2WN2 A;  4FI9 A;  4CUC A;  3ACG A;  3ACH A;  2RJ2 A;  5FUI A;  3THD A;  1I5P A;  1OH4 A;  3A21 A;  1DP0 A;  2W92 A;  3VD3 A;  3LE0 A;  1K12 A;  3LEK A;  2V4V A;  2W3J A;  3VDC A;  1PX4 A;  4PF1 A;  4ZY9 A;  4GWJ A;  3WNO A;  3K4Z A;  4QB1 A;  1UYZ A;  4YPJ A;  2WN3 A;  2W46 A;  3HNM A;  2YC2 A;  4JKK A;  4QDQ A;  1JU4 A;  3MO4 A;  4UOJ A;  2B4K A;  3I2H A;  1D7P M;  3OG2 A;  4CUB A;  4W50 A;  4A6O A;  2VME A;  5J1X A;  4P02 B;  4DEV A;  5HXM A;  5G05 L;  4AG4 A;  3P6B A;  2XHN A;  2YFZ A;  3OGS A;  1UYY A;  5JXG A;  2J1R A;  5A1A A;  3HN3 A;  3VDA A;  2VCC A;  4OMC A;  2VZT A;  2QQI A;  2DCJ A;  2WO1 A;  2VR4 A;  3FL7 A;  4DEQ A; 
#chains in the Genus database with same CATH topology
 2HKX A;  2F17 A;  3T08 A;  4OZO A;  3KS7 A;  3O1O A;  1W3X A;  2HWC 1;  3LCP A;  4HVQ A;  4F3J A;  4XF1 A;  1EUU A;  3ZYB A;  4K40 A;  3SEP A;  4CXY A;  5FZH A;  2QBX A;  4X6R B;  3ZXA C;  4EYU A;  2W1S A;  1UQX A;  4OUM A;  4OFG A;  4HVR A;  1PNF A;  4AK3 A;  1IPJ A;  1LKN A;  2Y26 A;  4LKS A;  5J96 B;  1PZ7 A;  3HT1 A;  3BOD A;  2R07 1;  3ZSK A;  3U1X A;  4CP9 A;  1PZ8 A;  1ZZ8 A;  2VCM A;  5HBA A;  1E5S A;  1OA4 A;  3ST7 A;  1QNW A;  1NCQ C;  1OQD A;  2YU1 A;  3MF6 A;  4A44 A;  3ZFE A;  1H6X A;  2XGX A;  1PO2 3;  3LIG A;  2J1A A;  3IKW A;  4Q4W 3;  4DB5 A;  3ENR A;  4BK4 A;  2BZD A;  4QU2 A;  2BFU S;  4L92 A;  3FJS A;  1HXS 2;  4AI9 A;  1G86 A;  2JKX A;  4FBF A;  4N43 B;  4TLF A;  1R1A 3;  5BPX A;  2PHW A;  1D4V B;  4WM8 B;  3TN9 1;  3B9C A;  3ZDS A;  2K46 A;  3SKJ E;  2PQQ A;  3UYJ A;  3M3I A;  4GMP 1;  2ZHN A;  4QX0 A;  3GF6 A;  2DUQ A;  2PAK A;  1PVC 1;  5A80 A;  5FMB A;  2ZEY A;  5GM0 A;  4AVS A;  4B4P A;  2PHX A;  1AYN 1;  1K5M A;  1NCR C;  1Z7S 1;  1URX A;  2RDN A;  3R4D B;  3NV3 A;  5JR2 A;  5L9B A;  1W90 A;  1MPX A;  5F6K A;  4LBN A;  4HFS A;  5A6Y A;  1FPN 3;  1QJY 2;  1WMF A;  2YBP A;  1DIW A;  2Q1Z B;  1XNC A;  4ZON A;  3LPF A;  4LK6 A;  2BDR A;  2I07 B;  4O65 A;  4N43 A;  3O5S A;  5IVY A;  2IVI B;  1J84 A;  4DRV A;  1VE0 A;  3HJR A;  4WM8 A;  1UU5 A;  1O5L A;  4DUV A;  2XML A;  4IEZ A;  4QMA A;  1ULC A;  3D82 A;  4LO7 A;  3OJB A;  2BEO A;  1Q56 A;  2A1X A;  3I3E A;  4QX7 A;  3ROU A;  5GLU A;  3O1T A;  3BTZ A;  1VLN A;  4AGV A;  2QCS B;  1LOG A;  1DYP A;  1QGL A;  3AKP A;  4QX3 A;  2ZPX A;  1GZT A;  3IBM A;  1UN1 A;  1ZZ7 A;  1W8F A;  1G9A A;  2GAU A;  3GBF A;  2C26 A;  5I0D A;  4ZPI A;  5FK7 A;  3ZKY A;  4CVU A;  5FMO S;  3AJY A;  3K75 B;  4YVS B;  4NHX A;  2J1E A;  1LGB A;  2ZS6 B;  5FJH A;  2GAL A;  2H0B A;  1H1A A;  1UY3 A;  3ACI A;  5KHI A;  1QIQ A;  1JOJ A;  2O14 A;  1WW7 A;  2QQO A;  4NID A;  4D8M A;  1D0G A;  1LEC A;  5F5I A;  1O4Z A;  3UGH A;  3VDB A;  2BER A;  5GLT A;  3U07 A;  1AR6 2;  2IWG B;  3BTA A;  3WF1 A;  3MPB A;  3GJB A;  1W3V A;  1Q8O A;  4GAZ A;  4QPW A;  3VLB B;  3F2Z A;  2P3I A;  1U5X A;  5FRA A;  1WCS A;  4FP2 A;  1W9Y A;  5FMC A;  3TYJ A;  4XXP A;  3ZVX A;  4NRM A;  4YVS A;  3FC0 A;  4XHX A;  2VZR A;  5T5P A;  4UF0 B;  1O8P A;  1Q8V A;  3HQX A;  2RJL A;  3WQ7 A;  2XOM A;  5LBB A;  4DUX A;  3B93 A;  2DBN A;  4XFC A;  1X8M A;  3B7M A;  4XIO A;  1QXJ A;  3SC7 X;  1OFS A;  1PIV 2;  4Y33 A;  4AQ2 A;  1LOF C;  2D3P A;  2SLI A;  4GQ7 A;  2Q1M A;  1GWL A;  4NR1 A;  1XQN A;  4OHY A;  4LUL A;  4U36 A;  3DXU A;  3OBR A;  4EWD A;  2E6V A;  5DPN A;  3SH5 A;  2WLP A;  4ZS3 A;  3WNP A;  4XEZ A;  4NVP A;  2WO7 A;  3K4D A;  4AFD A;  4HN1 A;  3BI3 A;  4COU A;  1VP6 A;  1NY7 1;  1REF A;  4UF0 A;  1TMF 3;  3J26 N;  2JWP A;  1MVQ A;  3OD0 A;  4BJ0 A;  4LO5 B;  3GDB A;  1RMU 1;  4L97 A;  2PLV 2;  4AZZ A;  2DTW A;  3LEG A;  1ENQ A;  1DYO A;  2WFF 3;  3KVA A;  1VBA 1;  3WDT A;  5FO7 B;  2VTX J;  4CCL A;  5BNP C;  2G1M A;  4IXL A;  2Y34 A;  3B69 A;  2NLR A;  2XBO 3;  3FX3 A;  2A6Y A;  4XF9 A;  2HWF 1;  4B3N A;  1UD1 A;  4JX0 A;  2TUN A;  3CJI B;  3SMH A;  1DYK A;  5A7S A;  1T2X A;  3H1W A;  1K3I A;  2BWA A;  2O8Q A;  3PUS A;  4PIY A;  4XJU A;  5LEJ A;  2ZAH A;  3QD6 A;  2HWD 1;  4XC9 A;  3SEE A;  1W0P A;  2XWB B;  4K9S A;  5IUQ A;  1DGR A;  4UT5 A;  3RYP A;  1RYY A;  5FYB A;  1ULG A;  3LSE A;  4MO3 M;  4CDX B;  3VZM A;  2ZGR A;  3FN9 A;  5JAX A;  3HIF A;  1S0F A;  4IEO A;  3I2G A;  4R4X A;  2DCY A;  3W5M A;  2ZHL A;  4H14 A;  1UKR A;  5JXI A;  4XUN A;  4CCO A;  1V9U 3;  4ASL A;  2PHF A;  3CJI A;  4ES9 A;  5FPZ A;  2RDR A;  5FYY A;  4XPV A;  4AI1 A;  2G9G A;  2C9K A;  1M4W A;  5A1L A;  2YPJ A;  1PMJ X;  2XVK A;  3L9J T;  2VZ1 A;  4QPI C;  5DDJ 3;  2A70 A;  5FZ4 A;  3RWK X;  1CVN A;  5ACA 2;  1BBT 3;  5I0U A;  4JTO A;  2VBD A;  1ODN A;  2Z69 A;  5CNA A;  3JB8 A;  4NHL A;  3B94 A;  2RM2 2;  1W9S A;  3E1F 1;  2ZXQ A;  3OGR A;  4JV4 A;  4Q4Y 3;  4RD7 A;  4YYO A;  2R06 1;  3POW A;  4CDX A;  5IVC A;  3VKF C;  2ZX0 A;  5KC5 A;  2V09 A;  4RGK A;  2IXC A;  1ST8 A;  2RDQ A;  1WCU A;  2W1U A;  2WL1 A;  1W2U A;  3CZU A;  4MHR A;  4NWV A;  4W6W A;  2Q8C A;  4MGI E;  4I3G A;  1D0H A;  1L3J A;  1CZV A;  4NPM A;  4W65 A;  3T0B A;  2YHJ A;  4FPJ A;  4JDO A;  1YFW A;  2VQA A;  2LW8 A;  4S2H A;  3B01 A;  3VDD B;  1Q43 A;  1C8M 1;  3B9I A;  4JDM A;  3LF7 A;  1AR8 1;  2ARA A;  1DQ2 A;  1CIY A;  2FQP A;  4MG2 A;  3QBQ A;  3N7L A;  4I01 A;  4KBZ A;  2VBB A;  5FZC A;  2VM9 A;  4C1W A;  1H8T B;  5CG9 A;  2EAA A;  2JEN A;  5DAB A;  1XNK A;  1IS6 A;  3AVS A;  1H4H A;  5LA9 A;  2ZGO A;  4GB3 3;  4J6G A;  1KEX A;  3PTY A;  5BNN B;  1GR3 A;  3W59 A;  2ZA9 A;  1BJQ A;  3AP9 A;  2VOX A;  1TG7 A;  3BVC A;  5H9P A;  1PNG A;  2YY1 A;  3N9Q A;  1VBC 3;  1BK1 A;  1N1S A;  5J48 A;  4G4F A;  5GLZ A;  3RG0 A;  5L19 A;  2VVF A;  3VDD A;  4YAR A;  1EYB A;  3T4V A;  5A6Z A;  4TSV A;  1PGL 1;  2XUE A;  3BB6 A;  1GZW B;  2YU2 A;  3VGI A;  5HI0 A;  2HWC 3;  1PVX A;  2BGP A;  3H42 B;  1Q8P A;  4B29 A;  4ARX A;  1COV 3;  5A32 B;  4LNV A;  2PXJ A;  2VEC A;  3POG A;  4XTM A;  1H8T A;  1DQ6 A;  3ZDV A;  2C1F A;  5B2G B;  4IV1 B;  1ASJ 2;  1EV1 2;  5FWE A;  5CYY A;  5BNN A;  4LBQ B;  3ZSJ A;  3ZXE A;  1RUH 1;  2A73 B;  2CTV A;  4TXW A;  3BAL A;  5AFB A;  3LSD A;  1QJE A;  2R07 3;  2YZ4 A;  4FP3 A;  1QXR A;  2XQX A;  3N9L A;  4XOG A;  1QU0 A;  1WW5 A;  3I2O A;  5DG2 A;  3NAP B;  3U37 A;  1VMJ A;  1AYM 1;  3PHM A;  2RS5 2;  1GZW A;  4XDO A;  1DZR A;  2LS6 A;  5J98 B;  3ZXL A;  5FZB A;  4B8E A;  4WM7 C;  3PMS A;  5A32 A;  4BXS V;  2RR1 1;  3NNJ A;  3KMH A;  2UYA A;  1JW6 A;  3NV4 A;  4A7Y A;  4IV1 A;  4Q26 A;  3RVH A;  1QJU 1;  4KG0 A;  4Y5S A;  1ZRI A;  3TN9 3;  2W0X A;  5C9A B;  5FZO B;  1DCS A;  3M3E A;  1FMD 2;  1COV 2;  3OBZ A;  1OPM A;  1UOJ A;  3IN9 A;  4XTP A;  2JE9 A;  4GMP 3;  1X50 A;  4JGZ C;  4JQR A;  4P9I A;  5I8Y A;  1OLR A;  1PVC 3;  3NAP A;  5CFD B;  1ZRD A;  4MVT A;  4GA9 A;  2MEV 2;  3VHN A;  1Z7S 3;  4CDU B;  3RNS A;  5L9V A;  4EN9 B;  2JEM A;  3W58 A;  5IVB A;  2BW8 A;  1SBD A;  2X10 A;  2ZGM A;  1D2S A;  3SIS A;  1TQ5 A;  2CU5 A;  2CDO A;  3LDR A;  1KFU L;  1SCR A;  1ZRR A;  3ILF A;  1FV2 A;  3A7Q A;  2P3Y A;  1KFX L;  5F2W A;  2GNM A;  2AEN A;  1UW8 A;  3KV9 A;  3LB9 A;  4JKL A;  3WOG A;  1IPK A;  5C9A A;  2SBA A;  4H7L A;  5FZO A;  1VRB A;  1RHI 1;  3R6S A;  4CDW B;  2OVU A;  2ZJC A;  4BK5 A;  2FMY A;  2B45 X;  4K8F A;  1RVF 1;  4AFC A;  2B8M A;  4Z82 A;  4DUW A;  3DPR B;  3FE5 A;  1RXF A;  1OOP B;  2K0G A;  3DUI A;  3KQ4 B;  2E26 A;  3MLK A;  3ZFF B;  2Y8K A;  4X8P A;  5FLI A;  4LXL A;  5H9S A;  4CDU A;  1QQP 2;  4KL1 A;  5I91 A;  3RWN A;  2KXL A;  1JYC A;  2B9V A;  2VVD A;  4DS0 A;  2DFC A;  4QDS A;  5A7Q A;  1CJD A;  2ZML A;  2C0Z A;  4MV2 A;  5FZE A;  2NMO A;  4PBO A;  4B7E A;  4OVE A;  3NKT A;  1GOH A;  4DXR A;  2FCV A;  2DYC A;  2VUL A;  1GP4 A;  1NA1 B;  3PUH A;  5LCW L;  2W39 A;  1DU3 D;  3VBF B;  4QPY A;  2VNR A;  2Y60 A;  2JDA A;  5E8A A;  4M3C E;  2WRA A;  1LUL A;  4QPG B;  3DPR A;  4CZS A;  1OOP A;  3ZFF A;  3F95 A;  2BNO A;  3V0A B;  4CCJ A;  3RI9 A;  2DV9 A;  2P5B A;  4Q4V 2;  4N53 B;  2WO2 A;  3GCW A;  4CUA A;  1W28 A;  3I49 A;  2W87 A;  1WKY A;  2WA3 A;  4XET A;  3I54 A;  5D1I A;  1MS3 A;  2Y6G A;  1GYK A;  1HXS 1;  4GH4 B;  3SCH A;  2R16 A;  3BKZ A;  5GLW A;  2YG0 A;  3CJX A;  1Y43 B;  1NA1 A;  1JUI A;  1TEI A;  2IVJ A;  4COW A;  3SCG A;  2AAC A;  3U14 A;  4ZKT B;  3S30 A;  2MHF A;  5KXD A;  3HNY M;  1MEC 2;  2XB6 C;  3LA7 A;  3IAQ A;  4QPG A;  1SZB A;  5GAL A;  3AP6 A;  1Y3T A;  5KHK A;  2LRP A;  4FFI A;  5KBF A;  4N53 A;  3OY8 B;  2ZGN A;  4LBO A;  1HLC A;  5FOB B;  4XAE A;  5FZD A;  4SBV A;  5T50 A;  1RL3 A;  4GH4 A;  2ETE A;  1QJY 1;  3FUO A;  3WLU A;  2R1D A;  1HB1 A;  3WG1 A;  2JX9 A;  2W95 A;  4AVB A;  1TME 2;  2GN7 A;  3OGJ A;  2WT1 A;  1JZ5 A;  1K5M C;  4JDN A;  3AZX A;  4P14 A;  1RMU 3;  4FFF A;  5FP8 A;  2GND A;  5KXB A;  1XRU A;  1VBA 3;  4JQT A;  4AQ6 A;  3PDQ A;  1C57 A;  2WDB A;  5FXX A;  2CL2 A;  5JIA A;  3ZKU A;  2L9L A;  4N43 C;  4NII A;  2ORX A;  4IET A;  3OY8 A;  3AK0 A;  1QDC A;  3C7O A;  5GZD A;  1BYH A;  4WM8 C;  5DN2 A;  3S6P A;  5FTT C;  3TBD A;  2X8K A;  3BTY A;  2VE1 A;  4MLO A;  1CAW B;  3IDE A;  3ACG A;  4UFM A;  3POJ A;  1KS4 A;  3UV9 A;  2E51 A;  3WDW A;  1SLB A;  1F2N A;  1Y9M A;  1S0E A;  1YUD A;  2W92 A;  3VD3 A;  3UGG A;  4EWE A;  3PJQ A;  2HWD 3;  3MLL A;  3HBZ A;  3LEK A;  2V4V A;  1UCX A;  3PUQ A;  1FPN 1;  1PX4 A;  3R4U A;  5C4W B;  1JHN A;  4GWJ A;  3WG2 A;  2OUJ A;  3LGR A;  3AYE A;  1WLW A;  1RUJ 2;  1UYZ A;  3ME2 A;  1JOB A;  2BTV C;  3SIT A;  5T52 A;  4QWN A;  1GWM A;  3NNM A;  3M8L A;  2A3Y A;  1JU4 A;  2XLF A;  4YGD A;  1APN A;  4S2G A;  3I2H A;  1H1I A;  3WY6 A;  4O9E A;  4N90 A;  2JDU A;  3AYA A;  5T3N A;  5DAP A;  4COV A;  3ORJ A;  5J1X A;  3AZZ A;  3POB A;  2BGC A;  1W6P B;  3PU8 A;  4AG4 A;  4M3C B;  4AVA A;  2XHN A;  2YFZ A;  4IGP A;  3OGS A;  1H8V A;  4HON A;  5C4W A;  1W8H A;  3I3Q A;  1PIV 1;  2WYF A;  3DN7 A;  2Q30 A;  2R06 3;  4BME A;  5CEH A;  3DF0 A;  2VCC A;  4YVS C;  4LTA A;  1WMX A;  4BQ1 A;  2QQI A;  5C3S A;  1HJF A;  1SBF A;  4FAG A;  2I2S A;  4C1X A;  1VRH 2;  3AZY A;  4RFT 0;  1AX2 A;  5LZ6 A;  3FL7 A;  4PIX A;  5ANQ A;  4R4Z A;  1VIW B;  5DAW A;  1AF9 A;  5FFO C;  2VL4 A;  4AEJ A;  5M0T A;  2JE8 A;  4Y1Z A;  1UIK A;  1W6P A;  4FTB A;  3M3Q A;  1C8M 3;  4E4D X;  3BOP A;  1AR8 3;  1F4H A;  1YO8 A;  2PLV 1;  2RHP A;  4L2N A;  4D0Q A;  2WQZ C;  3H8R A;  1DGW A;  4DRR A;  1FI2 A;  2X53 S;  4JC1 A;  4KWJ A;  5GLV A;  4H3W A;  1NQJ A;  4RQP B;  2OKX A;  2WS9 2;  2WWJ A;  5FY5 A;  3TAY A;  5CAZ A;  3TEY A;  3DYM A;  1WZX A;  1QJF A;  2XJQ A;  2PHD A;  4UAP A;  1JYX A;  4Q1P A;  4V2V A;  1LHV A;  1SDD B;  5AFE A;  4YGC A;  3M3O A;  5A6Q A;  3LA2 A;  2D97 A;  1M06 G;  1OUR A;  4QX5 A;  4QB2 A;  4X8N A;  1C8N A;  3KF3 A;  1OA3 A;  4CP1 A;  2KA3 A;  3ZXF A;  1N1Y A;  1ENX A;  1LAJ A;  5ISL A;  2ADE A;  4YG6 A;  1U5I A;  2R0H A;  4ISQ A;  4MXW B;  2VAU A;  3H8U A;  4MGT A;  3O1S A;  1KDM A;  2MNG A;  1RIT A;  2CGN A;  3ILN A;  2ZHK A;  4M4P A;  3BUC A;  1RUH 3;  1WLD A;  2EXI A;  4QQ2 A;  1SLT A;  1NLS A;  1IG3 A;  3UES A;  1XNA A;  1NXM A;  4PCR A;  1GP6 A;  1QWR A;  3TNQ A;  3ZR5 A;  3ABZ A;  3DXT A;  4K20 A;  4CP0 A;  4DOU A;  1V6M A;  4I3P A;  2BWC A;  1JYI A;  1KJR A;  3CMG A;  1GLH A;  2VZ3 A;  1KXG A;  3NNL A;  2Q8O A;  4AHZ A;  1LB2 A;  1AYM 3;  1ACC A;  4ERO A;  5ACA 1;  5C33 A;  1ALY A;  4DMI A;  2HEW F;  2D98 A;  4HKO A;  3VZN A;  1SLI A;  3HEI A;  4RHV 2;  4AQS A;  1WD4 A;  5E88 A;  3PVE A;  2RR1 3;  4IEY A;  2RM2 1;  1ZX5 A;  3CJI C;  4MXW A;  4Y1X A;  3DV8 A;  2XWJ B;  2DVA A;  4LO8 A;  1YQ5 A;  2ZGP A;  3NW4 A;  1EAH 2;  1O3S A;  2R04 2;  5EHD A;  1RUC 2;  2GH8 A;  3FHI B;  2V4A A;  4Y22 A;  2BBA A;  1STM A;  2C9A A;  1AUY A;  1H0B A;  1MS0 A;  1D2Q A;  1DBN A;  4FPE A;  4CDX C;  1H9P A;  4LKE A;  1C3H A;  3WEZ A;  5F1R A;  4CE8 A;  2WFP A;  2WQ4 A;  2YUE A;  1OUS A;  4QT6 A;  1H2N A;  2CWM A;  3ZN4 A;  4AR2 A;  1JOP A;  2JG8 B;  3T0D A;  3ZO0 B;  2WNV B;  3AKR A;  1U12 A;  2GC1 A;  3H7Y A;  3IWZ A;  2XJP A;  4KH9 A;  1FX5 A;  3DYP A;  1A8D A;  4Q29 A;  4Y24 A;  4NIA A;  2VW1 A;  2R6Q A;  1ZBA 2;  4KNC A;  3MV0 1;  4QX1 A;  2BNM A;  3SNM A;  2YB7 A;  2JDH A;  2QQJ A;  3SCF A;  2C5D A;  5F5C A;  1RHI 3;  1YC6 1;  3VHR A;  5JSO A;  1TNR A;  1CR7 A;  4MGK E;  3NJX A;  1HB3 A;  1OT5 A;  2BGO A;  2Q0A A;  4P08 A;  1XYN A;  5A3U A;  5LEK A;  2LAL A;  5IVV A;  5CIR A;  1W8Z A;  3AMM A;  3LFI A;  3UJQ A;  2JG8 A;  2WNV A;  2CYF A;  4UFK A;  2VUA A;  2HWE 2;  5IYY A;  5BUV A;  2YXS A;  1BVV A;  2PEL A;  4KI5 M;  2DUR A;  3CLP A;  1VBE 2;  4YW4 A;  3BU0 A;  1H1M A;  1IHM A;  1EV1 1;  2WO3 A;  1HX6 A;  3VDD C;  2XH6 A;  3K3N A;  1O7F A;  2I74 A;  2W47 A;  1W0N A;  2UWB A;  3E6D A;  3FWE A;  4QD2 A;  5LAS A;  3VV1 A;  5A3N A;  3AKQ A;  1J1T A;  4WV8 A;  3IIA A;  4KU7 A;  2XHK A;  1H8T C;  1UOB A;  4YM2 A;  3KLS A;  4BXF A;  2IFW A;  2H6B A;  5FKB A;  3MID A;  4TN7 A;  5IK4 A;  2RS5 1;  4HBN A;  1VBB 2;  4K6B A;  5FYC A;  5BNN C;  2JIG A;  4TYS A;  2XQR A;  2Y6L A;  1HXS 3;  1KGY A;  1GUI A;  4EZH A;  3BN6 A;  1G9F A;  4GKX A;  1Q3E A;  4XF3 A;  1POV 0;  5FQ0 B;  1DFQ A;  3RQ0 A;  4ZHN A;  3KHC A;  5B4X A;  4LIT A;  4TLG A;  3OGG A;  4NRQ A;  4YW1 A;  2WAB A;  4YM0 A;  3B02 A;  1FMD 1;  2YV8 A;  4NE9 A;  1COV 1;  5D2A A;  3GZU C;  1RC6 A;  2DTY A;  3ETQ A;  1KJL A;  4BDV B;  5G04 L;  1OLM E;  2A6X A;  3MV1 1;  1HRI 2;  2D6L X;  3AFK A;  4LA3 A;  1DQ0 A;  2MEV 1;  4IV1 C;  5IW0 A;  5JOY A;  5I0R A;  3VBU B;  1UPS A;  2VTF A;  2WKK A;  5EJ3 A;  4COZ A;  4EQV A;  3LOB A;  2YGM A;  3RRD A;  4FQ4 A;  1I3H A;  1OLQ A;  1V6I A;  2ARE A;  5J7M A;  3P3P A;  1F4A A;  3HWJ A;  4R52 A;  1QJY 3;  4LE3 A;  4Y4Y A;  2E7T A;  1MQT B;  4CRQ A;  3M3C A;  4ASK A;  1RIR A;  5FQ0 A;  3NAP C;  2E32 A;  3AMQ A;  4XE9 A;  2GH2 A;  1SQ4 A;  4GWI A;  4YFZ A;  2A6W A;  4AGG A;  1CAV B;  3CU7 A;  2ZGS A;  4JHZ A;  1AR7 3;  4UFH A;  5K0U B;  1YLL A;  1UZ0 A;  4YZ4 A;  1JYV A;  3UJO A;  4BH9 A;  4A41 A;  3N7M A;  4BQ5 A;  1XC6 A;  2TNF A;  3ZPY A;  3U4X A;  4HT1 T;  3VBU A;  5FWJ A;  5C9A C;  1ZBE 2;  3RJR A;  3T2Q A;  3M4F A;  3OEA A;  1JZ4 A;  2WII B;  3KT7 A;  2BU9 A;  1VMH A;  4XJA A;  5J37 A;  1GQG A;  3A23 A;  2TEP A;  1Q8S A;  2CGP A;  2WUH A;  3WZ1 A;  2ZX4 A;  3AMP A;  1O3R A;  1POQ A;  4CDU C;  1FXZ A;  1CAV A;  3PUA A;  1HB2 A;  5F32 A;  5A3O A;  2QQU A;  3N9M A;  3OEB A;  1I1E A;  3O1V A;  2PMW B;  1DQ5 A;  1LHN A;  5K0U A;  1WD3 A;  2IXL A;  2WAA A;  5FMO L;  5C5U A;  3GCX A;  2NP0 A;  4K1Y A;  4UW3 A;  1QH7 A;  5T55 A;  4CP2 A;  1AR6 3;  4Q5O A;  3E97 A;  1R1Z A;  2J7M A;  4Q4V 1;  1YQ6 A;  5I8T A;  2Y0I A;  4YG3 A;  4Y20 B;  4JHT A;  1AR7 2;  5L7O B;  1FT9 A;  1O8S A;  1QDO A;  2FCT A;  2UY9 A;  4OMD A;  5EYX A;  5F3G A;  4E9K A;  3DPR C;  4ISR A;  1OOP C;  4LHL A;  3V65 A;  3ZFF C;  3WQ1 A;  3UKV A;  4EV0 A;  1LHU A;  1G9D A;  3CO2 A;  3R4S A;  3U0Z A;  4LQR A;  2P17 A;  1NUK A;  1IQA A;  3ZIX A;  3E6C C;  1C5H A;  1L7Q A;  4YGE A;  4FSJ A;  2ZEW A;  5FBJ A;  1MEC 1;  1S0G A;  1CN1 A;  2JDM A;  4D7T A;  4JVA A;  4DFS A;  1PIV 3;  4D7S A;  3G7D A;  1PX3 A;  3AYC A;  4XHB A;  4QM8 A;  2VXR A;  2Q5T A;  3ALQ A;  1NA1 C;  2R32 A;  4FCA A;  2RJK A;  3J7N A;  4Y20 A;  5L7O A;  1XPW A;  3Q9O A;  3ITQ A;  3VBF C;  2VH9 A;  5C3P A;  3FBM A;  4QPG C;  2ENR A;  2WLQ A;  3Q8A A;  3WF0 A;  4WZF A;  4E8C A;  1W2A X;  2YBS A;  1TME 1;  4AED B;  3AL6 A;  1JUH A;  2J22 A;  4LMF A;  4X6Q B;  4N53 C;  3DYO A;  5GZF A;  2CSG A;  2PLV 3;  1H2L A;  4Q0P A;  3PUI A;  4HXC A;  2VQT A;  4GH4 C;  3VL9 A;  1WCD J;  2FCU A;  3U10 A;  4C0B A;  1YHF A;  5FY0 A;  4E2Q A;  1UXZ A;  1PMH X;  1JZ2 A;  3QCW A;  3HPN A;  1QJX 2;  4AHX A;  5LBF A;  2YBK A;  4XJW A;  4OUE A;  1H2K A;  1UMI A;  4CCC A;  2EAL A;  1XE7 A;  4H55 A;  3W21 A;  3WDY A;  3C8X A;  3MYX A;  4AED A;  1JZ3 A;  3J8F 2;  3NJZ A;  5LBC A;  1CZS A;  1KIT A;  3POF A;  3WW4 A;  3ZXG A;  4CSW A;  2XL7 A;  3ETP A;  4D6R A;  2GMP A;  4P5H A;  3THP A;  3VBR B;  4AI8 A;  3LQC A;  3TB0 A;  1JH5 A;  1UU6 A;  4ES8 A;  1LGN A;  1OUX A;  1XYO A;  4Z8B A;  5LY1 A;  4KWK A;  3ZSE A;  2P3J A;  4R9C A;  2WYS A;  1RUJ 1;  1ZZB A;  1YEW A;  2ZAC A;  1WLT A;  5FUN A;  4GZ9 A;  1SFY A;  4XBL A;  3WXP A;  2ORZ A;  1NAE A;  3O14 A;  1LTE A;  5T5O A;  3QLQ A;  1V6N A;  2QKD A;  4MH0 E;  5EP9 A;  3OUI A;  3T0A A;  2MPF A;  4YW5 A;  5FPL A;  1CPM A;  1W8W A;  3WDV A;  4E4H A;  2VTX A;  5ACA 3;  3DGT A;  4FVV A;  1HW5 A;  1MAC A;  5FPB A;  3VBR A;  1FOD 3;  5A1F A;  3SH4 A;  2Y6K A;  4PLN A;  4PI2 A;  2PA7 A;  1REE A;  1W6M B;  2RM2 3;  4ET7 A;  1ND3 B;  1BVP 1;  3S7E A;  1V6K A;  3WP5 A;  4W8J A;  3WCR A;  5FYZ A;  4LT5 A;  4OHZ A;  2C6S A;  2Z79 A;  4M0N A;  4NUB A;  4IEX A;  3ZOI A;  1ULP A;  4N7I A;  1VMF A;  1VRH 1;  3KV5 A;  5C4W C;  3KD4 A;  3OB8 A;  5HV0 A;  1UF2 C;  1O5U A;  4P9W A;  3WNK A;  3VZJ A;  1W0O A;  4AHY A;  4Y4R A;  4PJY A;  3W20 A;  1UWW A;  2J42 A;  2LTN A;  2IXI A;  2TBV A;  3MIH A;  4LA2 A;  1W9W A;  5K4L A;  4BWO A;  3JQX A;  5CFC B;  2FDH A;  3NNG A;  4I30 A;  1ENR A;  2JE7 A;  4QU1 A;  5JMO A;  1W6M A;  3AP4 A;  1ND3 A;  1YYN A;  4PDW B;  5A3L A;  1ND2 B;  1JZ7 A;  5EIY B;  1E5I A;  1IGO A;  4MOA A;  2A3W A;  2D6P A;  2WS9 1;  1GQH A;  4Q2F A;  4QHZ A;  1CZT A;  4YW3 A;  3OPT A;  1CX1 A;  4BA6 A;  1FOD 2;  1JYT A;  2A7A A;  3K4A A;  2X5I B;  4AL9 A;  5JI9 A;  4XMA A;  3NKG A;  5BYN A;  1YQ2 A;  2WA4 A;  3RZZ A;  1F31 A;  4YNI A;  3A0K A;  5F37 A;  1IQD C;  3MF9 A;  3WP6 A;  1SAC A;  3H0O A;  3KWV A;  3H8O A;  1S1A A;  2FDJ A;  3VBO B;  5APA A;  5CFC A;  5FY4 A;  2BOJ A;  2Z42 A;  1AHS A;  5KXE A;  1JXN A;  4F8A A;  3MDP A;  4PDW A;  4QXH A;  1ND2 A;  3C7G A;  1XBF A;  5CVR A;  2GP3 A;  5C6C A;  4A6S A;  4BLJ A;  1ASJ 3;  1EV1 3;  4LUM A;  3WIN E;  4AVT A;  3IAP A;  1YJL A;  2DU0 A;  5FAX A;  2HWB 2;  5LWB A;  1RUG 2;  4Z92 B;  3TEZ A;  4Z2A A;  2CDP A;  1MZ6 A;  1LOC A;  4FPC A;  2VZV A;  5I0T A;  2RV9 A;  4RQP C;  4QAW A;  4CU6 A;  3ZLI A;  1LEM A;  2E31 A;  1Y9G A;  1W6O B;  2EIE A;  2RS5 3;  1LCL A;  3V64 A;  3VBO A;  2XPJ A;  5F5A A;  5FO8 B;  4RHV 1;  3EHK A;  3D6E A;  4P9X A;  2ES3 A;  5DMY A;  3BIE A;  2DCT A;  1C28 A;  1IZ3 A;  1QH6 A;  2VNO A;  3GXU A;  3HMY A;  3JBG 2;  4AAX A;  1SG3 A;  1IS4 A;  3T2T A;  4XCA A;  3H1Y A;  4FPG A;  4UBG A;  3A0N A;  4YW6 A;  4KU8 A;  1HRV 2;  1EAH 1;  1FMD 3;  1S2K A;  4WVM B;  2VMH A;  4C91 A;  3O7O A;  2UYB A;  4JCK A;  4Q0U A;  1RUC 1;  4PHZ A;  1MS1 A;  4JRA A;  3THT A;  4Q4X 2;  3VBS B;  1I6X A;  2O0O A;  1YFY A;  2OII A;  3POY A;  4QXC A;  5FYH A;  1PK6 B;  4PF5 A;  5FZI A;  1SEF A;  4JRL A;  4RR3 B;  2MEV 3;  2WN2 A;  4NHK A;  2RJ2 A;  1E5R A;  4XFG A;  5DAX A;  3N7J A;  3THD A;  1I5P A;  4FOV A;  4NN0 A;  4IW3 A;  4PLM A;  2P4E A;  3VZL A;  1DP0 A;  1MZF A;  1ZBA 1;  1WCK A;  1J1L A;  3Q8F A;  2GNB A;  5HCF A;  2HJI A;  2W3J A;  5T54 A;  3CF6 E;  5HCA A;  4IGO A;  2HEY F;  4WVM A;  4M0H A;  1VPH A;  2D93 A;  3P3N A;  3WDX A;  5KHG A;  2XJR A;  4KBB A;  5ABJ B;  5FZ8 A;  3VBS A;  1LOD A;  5FYT A;  4AYU A;  5DUX A;  1DZT A;  4LBQ A;  2XDV A;  3RYR A;  5F2S A;  2XR4 A;  3HNM A;  2IXK A;  1QQP 3;  1WLC A;  5D8A B;  3ZXJ A;  4IE6 A;  2B39 A;  2NQY A;  4ATE A;  2GME A;  2HWE 1;  3OG2 A;  1GAN A;  4LBQ D;  2VME A;  4A6O A;  2FDK A;  3KQR A;  4P02 B;  3NNF A;  4GMP 0;  4OI4 A;  5JLV A;  3P6B A;  4NMI A;  1VBE 1;  4I02 A;  5KHJ A;  3PTR B;  5TSW A;  1XU1 A;  4MYE A;  3O1R A;  1QOO A;  3JU9 A;  2Y6F A;  3NV1 A;  2JG8 C;  2PAE A;  1F35 A;  2WNV C;  3GNE A;  3LD8 A;  4UW5 A;  2P1B A;  1VR3 A;  4XZP A;  3VDA A;  4YM3 A;  5ABJ A;  2VOV A;  3H3Z A;  4U2A A;  2VZT A;  1RGS A;  3N9O A;  4LOS A;  2DCJ A;  4FQZ A;  2D7F A;  2VR4 A;  5D8A A;  1S0D A;  4Q4V 3;  1G7Y A;  3WNM A;  1VBB 1;  4DEQ A;  1OH3 A;  3LWC A;  3SLI A;  3Q8C A;  2UU8 A;  3WR0 A;  4LKD A;  3GHM A;  3G6J B;  5DAQ A;  4DXZ A;  4ZZ8 A;  5B4N A;  5CFD A;  4LBL A;  1JZ6 A;  1A78 A;  1BEV 2;  2IFR A;  1E57 A;  2X05 A;  2GNT A;  4ZU7 A;  2D3R A;  3MIC A;  4UFL A;  4C8D A;  2QJV A;  1UO9 A;  2QQL A;  3KZ4 C;  1WW4 A;  3HQR A;  1GOG A;  4QHO A;  4L8Q A;  3U75 A;  2JDK A;  1MEC 3;  1R09 2;  3VKO A;  3ZMO A;  5IVJ A;  4QQP A;  2G19 A;  2CNA A;  2X09 A;  3D8C A;  5DUW A;  2PFW A;  3I2D A;  5FZ7 A;  2XJS A;  4XUP A;  4AOC A;  1HRI 1;  5HXV A;  5LK5 A;  4CUG A;  3C7H A;  4CDW A;  2FZ1 A;  3T09 A;  4UI9 L;  4E8D A;  4CEY B;  2WNO A;  1GIC A;  2YMZ A;  1U5Y A;  5FY7 A;  1HN0 A;  1ULO A;  2JXA A;  3N9N A;  1L7L A;  1OF4 A;  1NE6 A;  2JIJ A;  1PMI A;  1TME 3;  2RVA A;  3T2P A;  4XBN A;  3WNX A;  1TZO A;  4LBJ A;  3WP3 A;  1JN2 P;  2PAM A;  4O7X A;  4QX8 A;  5EFU A;  3RSJ A;  4AEM A;  5BNQ A;  1MS9 A;  2CGO A;  2VZQ A;  5CA6 A;  5FDB A;  3POS A;  3L2H A;  3OSD A;  1OHF A;  2OZJ A;  4Q1R A;  4EN6 B;  3IDB B;  4YM1 A;  3VD7 A;  1J58 A;  2B7Y A;  3VBF A;  4A42 A;  1X8E A;  2D3S A;  4DQA A;  1ZBE 1;  4MUV A;  1NZC A;  3K51 A;  3NV2 A;  5C8C B;  3S5A A;  3RJ2 X;  1NLQ A;  3V0A A;  2VNG A;  3LAG A;  5A70 A;  2AR6 A;  2H6C A;  3LEM A;  4HAN A;  5C3Q A;  5JDB A;  1Y9Q A;  3PVO A;  2DFB A;  2IUW A;  3AKT A;  5F5Q A;  4BQ3 A;  3AB0 A;  5LY2 A;  3VBU C;  2JKB A;  2BBV A;  5JPM B;  1MR5 A;  4P5Y A;  4FPH A;  1GMM A;  5E89 A;  3KT1 A;  1ZRC A;  2AZ5 A;  1R64 A;  1VBD 2;  1I9R A;  3K2O A;  5EV7 A;  3WV6 A;  1RUJ 3;  1AL2 2;  1UY0 A;  1OVP A;  2DUO A;  3AM2 A;  5FPA A;  4A3Z A;  1W99 A;  5C8C A;  2R49 A;  1AR7 1;  4IE4 A;  2ADD A;  3KB5 A;  4FOQ A;  3QAC A;  4NWW A;  5K0U C;  3OCP A;  3K46 A;  4CDQ B;  4QGL A;  4M3C F;  2HYX A;  5A3P A;  1ODM A;  2OA2 A;  1JBC A;  1OA2 A;  1PO1 3;  4N7U A;  4XAB A;  5FIX A;  3BTX A;  4FTS A;  3IMM A;  3ZMN A;  2P34 A;  3H3L A;  2BVB A;  5EJZ B;  1YJK A;  3PUR A;  3JD7 2;  5LK7 B;  1YIF A;  1ZRF A;  4HET A;  3K77 A;  1TNF A;  4XF0 A;  4EZ4 A;  1R08 2;  2A75 A;  4A2U A;  5IAT A;  1VJ2 A;  2NPI A;  1TVG A;  2WR9 A;  3AZV A;  1C5I A;  1SLA A;  3PVB B;  4MGQ A;  3Q8E A;  1QY4 A;  2QQV A;  4XXA A;  3USU B;  3ZN5 A;  4JGY B;  1VRH 3;  2XUM A;  3FHQ A;  3IMN A;  5BNP B;  3VB9 A;  1HDK A;  4CDQ A;  1AR6 1;  1YCI A;  1DGW X;  4YZ1 A;  2P2K A;  1OKO A;  2DBI A;  4CCK A;  3ILR A;  3S7I A;  3BYW A;  4A7Z A;  2ZZQ A;  1P8J A;  2RMU 2;  1UNB A;  1CAW A;  3JUU A;  4GXL A;  1YI7 A;  4PI0 A;  1SLC A;  4XQ4 A;  1X82 A;  4XBQ A;  4GD4 A;  4DY5 A;  3SXW A;  5L7O C;  3ZXD A;  1SFN A;  2AUY A;  2WQ8 A;  3QH6 A;  1UL9 A;  5EJ1 B;  1NE4 A;  2ZAA A;  5DXD A;  2QE3 A;  5JZG B;  1PO1 2;  3RZJ A;  3RFR A;  2QQP A;  1UY1 A;  4PIZ A;  2VMF A;  4EJR A;  2WS9 3;  4A4A A;  5LB6 A;  4AHW A;  1UPI A;  2VMC A;  3USU A;  1QJX 1;  3IT8 A;  4IE7 A;  1WW6 A;  3AXD A;  3IB3 A;  1BZW A;  4JGY A;  2GMM A;  4I0B A;  4EWA A;  1RUE 2;  5IFP A;  3UKT A;  2EVX A;  3N7K A;  1DF0 A;  2Q8E A;  3WUC A;  5FZG A;  2VMI A;  3J8F 1;  2J1V A;  3CL1 A;  5FYU A;  5J09 A;  2JDY A;  1AL0 G;  2Z2S B;  4HKL A;  3LZZ A;  4E2G A;  4A7K A;  2RS1 2;  5IHR A;  1RTV A;  4MSV A;  2PHT A;  1UZV A;  2PTM A;  2ZX1 A;  3GM8 A;  5JZG A;  4QQL A;  5JI7 A;  3MW3 A;  3T1L A;  4M3C A;  4AED C;  1FV3 A;  1LOA A;  4AFA A;  3HT2 A;  1JZ8 A;  1J59 A;  2GP5 A;  2Y38 A;  3BCW A;  3BOW A;  4AFB A;  4CPB A;  1OPO A;  2WZR 2;  2OW4 A;  2ERF A;  2VW0 A;  2WBK A;  1O6U A;  1HB4 A;  5CKQ A;  2ZEZ A;  3QH7 A;  1N3Q A;  1SLL A;  4GJY A;  4Y26 A;  4COY A;  2P6C A;  4CPB D;  1H2M A;  4YG0 A;  2J1T A;  4OUS A;  4LUK A;  1BMV 2;  1Q5O A;  2PHL A;  4BIF A;  2Y64 A;  3X29 B;  5DZF A;  4RHV 3;  3KCX A;  3HR9 A;  1LRH A;  2R30 A;  1O4Y A;  2OT7 A;  3IDC B;  4YW7 A;  3I3D A;  1WBF A;  3OOX A;  5D21 A;  2EID A;  1WA4 A;  3E5X A;  3UGF A;  5FK8 A;  4FT8 A;  4NHY A;  5FZA A;  4LLF A;  1HQW A;  1EAH 3;  1AJO A;  4LHS A;  1OD3 A;  2R04 3;  3IDA A;  4FO9 A;  4L99 A;  1RUC 3;  3B00 A;  2WC2 A;  3VBR C;  5A3W A;  4HKW A;  4RQP A;  2EA7 A;  4FXG B;  4DXT A;  4YLZ A;  2AGS A;  5A7P A;  4MGS A;  1XSQ A;  1XE8 A;  4DIQ A;  1QOT A;  3NL1 A;  4AVC A;  3NJV A;  3RPQ A;  4CU8 A;  2R1B A;  5F6L B;  4L9B A;  4BMB A;  1AXY A;  2XON A;  1WBL A;  2AEZ A;  2WZ8 A;  1EY2 A;  2A6V A;  5LA2 A;  2FHR A;  3VHP A;  1BXH A;  1ZBA 3;  2KR2 A;  3PIG A;  2I45 A;  2V72 A;  4YGB A;  3S57 A;  4B7K A;  3KSC A;  4A3X A;  1A6C A;  1FOD 1;  4RSU A;  1TE1 B;  3PME A;  3E5U A;  5KXC A;  4Q8L A;  2ET1 A;  1O59 A;  2QTW B;  2ZHM A;  3MHZ A;  3FLT A;  1F15 A;  1LED A;  1W05 A;  1SCS A;  2Y6H A;  3III A;  4HK9 A;  1ND3 C;  4XUT A;  5AC9 2;  5JUV A;  4HK8 A;  1BKZ A;  4HSL A;  3EBR A;  5LRS A;  3SHR A;  3ASI A;  1UYP A;  4YVW B;  1A3K A;  5K8S A;  5FLH A;  2UWA A;  3ZYG A;  1RUF 3;  1IKP A;  2HWE 3;  5EXO A;  1T6G C;  3CQO A;  4LJH A;  4MET A;  2VO5 A;  2WT2 A;  1IOA A;  3ZYR A;  1VBE 3;  4DXS A;  5IK5 A;  2B9U A;  4GJZ A;  1HV0 A;  3VD9 A;  1X33 A;  1LR5 A;  1ONA A;  3CZJ A;  3GAL A;  4NJ4 A;  4OHW A;  3JXS A;  3I7D A;  5FP9 A;  1HQN A;  1PM4 A;  1RUG 1;  3DCQ A;  5CFC C;  3P1I A;  3WF3 A;  2EF6 A;  2LUW A;  1GOF A;  1MVE A;  4PDW C;  2UUR A;  1HN1 A;  2DVB A;  1ND2 C;  4XFF A;  4H2A A;  4Y1Y A;  4Y1U A;  3TNP B;  4DZG A;  5JSP A;  4YVW A;  2WZP P;  4OI0 A;  2JD9 A;  5AVP A;  1VBB 3;  3CDZ B;  2IXH A;  3DL3 A;  1SHW B;  3HQU A;  4P9G A;  4DIN B;  4R9D A;  4ZXE A;  5FJK A;  2VVE A;  3JBG 1;  4LHK A;  5BNO B;  5FOJ B;  4XUQ A;  3MUZ 1;  1WMD A;  2IXJ A;  3VN4 A;  3VD5 A;  1RUD 3;  3AXE A;  4OYU A;  1RUF 2;  1HRV 1;  5ANN A;  1UMH A;  4QXK A;  1VAV A;  4QGM A;  4UBH A;  3VBO C;  3VHO A;  3WT3 A;  4Z2W A;  1JYW A;  4Q4X 1;  3T2O A;  4XUO A;  1PGW 2;  1ASJ 1;  5LRR A;  2NM1 A;  1HRI 3;  5LAT A;  4AF9 A;  1GFF 2;  4AI0 A;  1GNZ A;  4OI2 A;  4AE2 A;  4D3W A;  1QKQ A;  3B3Q E;  4CYD A;  4KQ7 A;  3FLR A;  3CHX A;  5IJR A;  3C3V A;  5LW9 A;  4D6S A;  1N3O A;  5A3T A;  2DVD A;  3RGB A;  5A7W B;  2W68 A;  1ULE A;  4ZZ5 A;  5BNO A;  2G4I A;  5CZK A;  4EE2 A;  1GNY A;  3MIG A;  1YFX A;  1OSG A;  2ZBJ A;  1F5J A;  4FPY A;  1YNA A;  1ZZ9 A;  2QDN A;  5FBZ A;  2V73 A;  3KV4 A;  5KWR A;  2HLE A;  2VZS A;  1G8W A;  3ZSL A;  3AKS A;  4BYY A;  3I59 B;  3LKJ A;  5A33 B;  1N3P A;  3ZR6 A;  1N1V A;  1D4M 2;  1DZQ A;  4UW6 A;  3TEW A;  1GP5 A;  5K9Y A;  1RUD 2;  2E7A A;  2D44 A;  3GZA A;  5IFT A;  1IPS A;  1UZY A;  2BFU L;  5GZG A;  2EIC A;  4EN8 B;  2A71 A;  1ZBE 3;  1W03 A;  5FY8 A;  3VKN A;  3LEI A;  4HL0 A;  4WVW A;  5FPV A;  1SPP B;  1AXZ A;  1DQ1 A;  1X9T A;  5A7W A;  3E5Q A;  1NYW A;  3VBS C;  3RZL A;  1W2T A;  2JG9 B;  4AAP A;  2EXH A;  2W2I A;  3T3Y A;  4ARY A;  5JCT A;  3CBN A;  1KRI A;  2ARX A;  4NO4 A;  4DO0 A;  3CEW A;  3I59 A;  1WWY A;  4HMZ A;  5HCB A;  3ZFE B;  4KWL A;  1H30 A;  1XXN A;  2YRO A;  3OBA A;  4HZF A;  4K8R B;  5IAV A;  3PIJ A;  5BY5 A;  1Y4W A;  5FZL A;  4RFR B;  3TWI A;  1SPP A;  1UY4 A;  5ABJ C;  4BE3 A;  3C7F A;  1Z78 A;  2XXZ A;  3RYK A;  4IDZ A;  1L7R A;  2DDU A;  2BRT A;  4IV3 B;  5F39 A;  3UKN A;  5JMC A;  1BEV 1;  2E9Q A;  2VGD A;  3ES1 A;  2JG9 A;  1QQP 1;  2VCA A;  3OUJ A;  1PHM A;  5SV8 A;  3ZPO A;  2XVG A;  4XMI A;  1OFN A;  5D8A C;  4XFH A;  4CCD A;  1CES A;  3AC0 A;  1CON A;  1SDW A;  4BIS A;  2WNU B;  5C8W A;  4CCM A;  2K2S A;  1MQT A;  2W08 A;  1R09 1;  1K5M B;  3V0B B;  1CQ9 A;  5CFD C;  1IS3 A;  1QNY A;  2B46 X;  4IEV A;  1VAK A;  5J36 A;  3TOJ A;  1S0I A;  4XFA A;  2WNE A;  4BQX A;  2CV6 A;  2BPA 2;  4MHU A;  5FV3 A;  3WW1 A;  4V2W A;  4CU9 A;  4Y5Z 0;  4PBP A;  5FXZ A;  4IV3 A;  3HD8 B;  2HBT A;  1V6J A;  1LU1 A;  2A5Z A;  2EIG A;  3I2J A;  5KR7 A;  4BM8 A;  5JXJ A;  3O0V A;  5FUP A;  3E6B A;  1A34 A;  1QF3 A;  4CDW C;  2WNU A;  1RIN A;  2VW2 A;  1DQ4 A;  5FZ0 A;  1FNZ A;  4KMQ A;  4NPL A;  3V0B A;  2YC0 A;  4O9G A;  2EXJ A;  4IQP A;  3EB7 A;  3WX5 A;  3ZYF A;  4CEW B;  4PLO A;  4OCT A;  3DKQ A;  2O8O A;  3HNB M;  1QJX 3;  2DVF A;  5FZ6 A;  3J7H A;  1S55 A;  3D0S A;  3H3U A;  1AZD A;  2KM2 A;  3O12 A;  1PO2 2;  2W1W A;  3MUY 1;  4Q4W 2;  3RZM A;  2FDI A;  2ZCW A;  4RS5 B;  4URA A;  4WVV A;  3PU3 A;  1W8N A;  1GZ9 A;  3J8F 3;  3VKM A;  3FUQ A;  3VBH B;  3HOB A;  4P9Y A;  4Q0S A;  4LPL A;  4RGG A;  4OI1 A;  3AZW A;  4ASM B;  4BPZ A;  4CEY C;  1R1A 2;  5C70 A;  5K7P A;  1RJ7 A;  1WGP A;  1DGL A;  3WNL A;  1DGR N;  5FLJ A;  4AVV A;  4D6Q A;  1VBD 1;  3HAG A;  4CEW A;  2ZOE B;  1W9T A;  4BQW A;  2R7E B;  2ZGQ A;  2B5H A;  3MPP G;  1A8M A;  3WG3 A;  3NMB A;  1AL2 1;  5FYV A;  1T6B X;  4GIQ A;  3ZFG B;  1N47 A;  4FFG A;  4OLL A;  2D6O X;  4CA9 A;  5KC6 A;  1OBN A;  4XUR A;  1HKD A;  2ZMN A;  1US2 A;  2NYY A;  4CUC A;  4FI9 A;  5C3O A;  5JOX A;  1LES A;  3ACH A;  4RS5 A;  4XFB A;  1FPN 2;  3LOI A;  3ON7 A;  4GWN A;  5DAV A;  5FZM A;  1UKG A;  3VBH A;  2XVL A;  4IE0 A;  2GU9 A;  5FP4 A;  5I93 A;  2HBU A;  2RS3 3;  5GJ6 A;  3J7L A;  1F9K A;  3LE0 A;  5C8C C;  1K12 A;  3WG4 A;  2WIN B;  1WA6 X;  3VDC A;  4E2S A;  3JD7 1;  2GDF A;  5FY1 A;  3JCI A;  5EQU A;  1R08 1;  5J3U A;  3WNO A;  5JPN B;  3AX4 A;  4HSJ A;  3NST A;  3TRS B;  3ZFG A;  1OLM A;  5FKC A;  2OXB A;  4YPJ A;  4I0W B;  5EZW A;  2WN3 A;  2VQ0 A;  4Q8K A;  4M00 A;  2YC2 A;  2VG9 A;  4XIL A;  5FY9 A;  4YZ3 A;  3AP5 A;  2ZGL A;  1PGS A;  1CAX B;  4XCB A;  1IKQ A;  1D7P M;  2QDR A;  4W50 A;  3D0J A;  3WVJ A;  4CUB A;  2ZGT A;  4KGG A;  2RMU 1;  4DEV A;  1OD5 A;  5G05 L;  3DEM A;  4OZX A;  1B35 B;  5H9R A;  1LOB A;  2J1R A;  4QQH A;  5A1A A;  4CDQ C;  1PO1 1;  4NOT A;  5JOZ A;  1RUO A;  4LHN A;  2RS3 2;  2Y33 A;  5DZE A;  3H7J A;  3NJY A;  1AR9 3;  4IND A;  4CCN A;  4JAA A;  2Q1F A;  4S2D A;  3MIE A;  1J3P A;  1RUE 1;  1HV1 A;  5FZ9 A;  4UWD A;  2D6K A;  5GZE A;  2YPD A;  4R8H A;  3AP7 A;  1CAX A;  4UFJ A;  3MFA A;  4J25 A;  4MXV A;  3OUH A;  4L11 A;  5DUV A;  3RMX A;  1GBG A;  2D5H A;  1DHK B;  2RS1 1;  4LOT A;  3POE A;  1B35 A;  4JGY C;  3H9A A;  1KQR A;  3OD4 A;  4Q27 A;  2PHU A;  4AQT A;  2GZW A;  3U11 A;  3VZK A;  4LEJ A;  3I97 A;  3EQE A;  2GN3 A;  2WZR 1;  2Y0O A;  4YZ5 A;  2HWB 3;  1RUG 3;  3MEP A;  3IPV B;  5CKM A;  4MAD A;  1JMU B;  4GWM A;  5F8P A;  4YSF A;  1OKQ A;  5JZG C;  1C1L A;  1X36 A;  2QVS B;  4QQO A;  2RDS A;  4XQD A;  4WBB A;  5HCH A;  3EO6 A;  1ENS A;  1N1T A;  1BMV 1;  4XW3 A;  1AR9 2;  2WT0 A;  5BV6 A;  4OQ9 A;  1RUI 3;  1TMF 2;  1DDL A;  1ULF A;  2CAU A;  4D7Y A;  4O61 A;  3WUD A;  1GQP A;  4GUL A;  2R0F A;  3J7M A;  3JBG 3;  3KVB A;  2UWC A;  2WFF 2;  4SLI A;  4ZU4 A;  4W6X A;  4QKF A;  5C5T A;  2YYO A;  2DCK A;  4NAO A;  4RL7 A;  1HRV 3;  1DLL A;  1SFP A;  2VXJ A;  1AX0 A;  2Y6J A;  3LA3 A;  1NOV A;  2IC1 A;  3OGV A;  4LLO A;  2KD7 A;  4P00 B;  4Y3O A;  1W6Q B;  1C1F A;  1W8O A;  1OQ1 A;  1WUV A;  3IPV A;  4Q4X 3;  4DY3 A;  5CG8 A;  3T30 A;  2XBO 2;  1CPN A;  2JDP A;  1CAU B;  5C7G A;  3SQO A;  2VQU A;  4LO6 B;  3RMY A;  3KHB A;  1LHO A;  2X5I A;  4OHX A;  3Q8B A;  4IL7 A;  1VB2 A;  4ZS2 A;  4RYD A;  3WQB A;  2W9X A;  4N9H A;  3K48 A;  4AWD A;  2Z5W A;  4ONU A;  4XIK A;  2ID4 A;  1RUN A;  1NKG A;  2BYV E;  1RUI 2;  4FPF A;  2VUC A;  2VOT A;  2XG3 A;  5DZG A;  3USS A;  1J83 A;  3HN1 A;  4P9L A;  3OPZ A;  1W6Q A;  1LEN A;  2QZ2 A;  4C90 A;  4HPK B;  4XFI A;  2FD8 A;  3D3A A;  3MBW A;  1CAU A;  1V9U 2;  5AC9 1;  5F9T A;  4LE4 A;  1JTZ X;  1G9C A;  3FMG A;  4M01 A;  2J1S A;  2R04 1;  2IZW A;  2G9Z A;  3EXU A;  4EN7 B;  5DDJ 2;  3WQ0 A;  1W06 A;  3EMR A;  1BBT 2;  1CD3 G;  1EPZ A;  4UYB A;  5EPA A;  5FRE A;  3NO8 A;  4BCU A;  2DVG A;  1OF3 A;  4FTE A;  1W6O A;  3WHU A;  1JI6 A;  4Q4Y 2;  2PHR A;  4OQ8 A;  4CXW A;  2WZE A;  3J4U H;  4N9I A;  4QKB A;  2VZU A;  1VB4 A;  2D5F A;  3KF5 A;  4UW4 A;  2JDZ A;  2VU9 A;  4HPK A;  1JYN A;  5FCC A;  2C24 A;  2V5D A;  5BXX A;  2ZX3 A;  3DEC A;  1RJ8 A;  3NQH A;  3ACL A;  1JU3 A;  1UYX A;  4ITC A;  3VL8 A;  2WJS A;  2CY6 A;  3DKW A;  1JS9 A;  1C4R A;  4XQW A;  4FOW A;  4QB6 A;  1PK6 A;  4NAM A;  3AVR A;  3L2Y A;  1WME A;  1YQ8 A;  2YC4 A;  5F3E A;  4RR3 A;  5DUU A;  1BEV 3;  1OQE A;  1S2B A;  2VOK A;  2ZMK A;  3UL2 A;  4FAH A;  3A4U A;  1NCQ B;  2QQK A;  5GZC A;  4LIU A;  1RUF 1;  1XU2 A;  4YVW C;  4IER A;  4ORF A;  5L36 A;  2RE9 A;  4LIV A;  3BGA A;  2A3X A;  4GB3 2;  1R09 3;  4E4S A;  4KGQ A;  1QEX A;  1UOG A;  1PGW 1;  3ATG A;  4FPO B;  5IK7 A;  1GKB A;  4URT A;  4YW2 A;  1VBC 2;  4V1P A;  2BP6 A;  5JXH A;  1O3T A;  2ARB A;  4K7J A;  3JB4 C;  5IT6 A;  1ZYB A;  2HWC 2;  1LOE A;  3IM0 A;  4BHP A;  2ATF A;  4NRP A;  4LBM A;  1XNT A;  2ILM A;  1NCQ A;  2W94 A;  3SH3 A;  1W9F A;  1NX9 A;  2HH9 A;  1H6Y A;  5LBE A;  2HEV F;  3WF2 A;  2DU1 A;  2YFU A;  3I2K A;  4B4R A;  4PT6 A;  1S0B A;  1NCR B;  3ZYI B;  2ZGK A;  3RZK A;  3UT0 A;  2ZKN A;  1AYN 3;  2OPW A;  1H4G A;  1NXD 1;  3WD5 A;  1ZA7 A;  4LK7 A;  2R07 2;  1D4M 1;  1H9W A;  4W4Z A;  5CB7 A;  3MW2 A;  5BNO C;  1RUD 1;  3ES4 A;  4CCE A;  1S0J A;  4LO4 B;  1WCQ A;  4B1L A;  3GYD A;  5I8S A;  1ZRE A;  4OHV A;  4IEU A;  4NPR A;  2OPK A;  5L9R A;  3U78 A;  3ZIW A;  2Z4F A;  1O91 A;  4G3Y C;  3MGU A;  1X9P A;  4YRD A;  3FLP A;  3VD4 A;  1V70 A;  2ZX2 A;  1YQC A;  4QX2 A;  4J1W A;  1F5F A;  1XB9 A;  4TTG A;  1RB8 G;  2FZ2 A;  1NCR A;  5JIU A;  5FZF A;  3GGL A;  1VAM A;  4FPK A;  3TN9 2;  1W2N A;  1LU2 A;  1VBD 3;  3HVD A;  1US3 A;  1ZZ6 A;  4Q0Q A;  1W04 A;  1ULD A;  1OC1 A;  3U4S A;  2D40 A;  1X7N A;  1PVC 2;  1AL2 3;  1K5J A;  2N7G A;  1S0C A;  3WW3 A;  3N36 A;  2D6N A;  4N8M A;  3RS6 A;  1AYN 2;  1Z7S 2;  2QFE A;  3I2F A;  5L73 A;  3RZG A;  1UX7 A;  4I09 A;  2VJX A;  1J3R A;  1DG6 A;  4DNY A;  2W5F A;  2YGL A;  1UY2 A;  1QXP A;  3LDK A;  3POI A;  4E27 A;  3INA A;  5FP3 A;  4P9J A;  3BU7 A;  4CEY A;  3O1M A;  5LA0 A;  4EN0 A;  2CHH A;  1ZVF A;  3OYW B;  4XVH A;  5FPU A;  1UZW A;  2VMD A;  4K21 A;  4Y5T A;  3SKV A;  1XE0 A;  1GNH A;  1LJ7 A;  2DCZ A;  2XKO A;  2JB4 A;  3CNA A;  5FYM A;  5JOW A;  1V00 A;  3JD7 3;  3KT4 A;  5IVE A;  2GC0 A;  2XJU A;  4AEK A;  1AX1 A;  1R08 3;  1PM7 A;  2JG9 C;  4QKD A;  5EYY A;  3MIB A;  1POV 1;  4AXO A;  3EYP A;  3VKL A;  1U0A A;  2JJ6 A;  2CWS A;  3T4H B;  5HPO A;  2VPV A;  4R9B A;  3ZN6 B;  4E4Z A;  3GJA A;  3PL0 A;  1MQT C;  1BK0 A;  3C7E A;  4NHM A;  1UAI A;  3ZFE C;  2F6B A;  5CIS A;  2F4P A;  2G9F A;  1AJK A;  5FR3 A;  2VNV A;  1Y7B A;  1NG0 A;  1GV9 A;  2RG4 A;  1HQL A;  1G6N A;  4QXB A;  4LKF A;  1OMI A;  4BU2 A;  5IAX A;  3OYW A;  2RMU 3;  4BZ4 A;  4IUG A;  1CGP A;  3AYD A;  2XJT A;  4DPN A;  1B09 A;  2EIB A;  1GZC A;  4IV3 C;  4IES A;  2PQS A;  3JQW A;  4Z07 A;  2WWU A;  5A7N A;  1AVB A;  4NRO A;  5T5J A;  4FPL A;  1ZNP A;  5FO9 B;  4XDP A;  1Z0H A;  4A45 A;  4F83 A;  3WW2 A;  3QOP A;  3ZN6 A;  2WNU C;  2JD4 A;  4RN5 A;  2WSU A;  5E16 A;  4XZU G;  1JOD A;  1CX4 A;  1ZM1 A;  2ZTN A;  1PO2 1;  1CWP A;  4Q4W 1;  1KDK A;  1RUE 3;  1QMJ A;  5CAD A;  4OUL A;  2VZP A;  3FHA A;  4CTE A;  2E33 A;  3OBT A;  1LOF A;  5T5L A;  2O1Q A;  3MW4 A;  1R1A 1;  2RS1 3;  2VC9 A;  3FFZ A;  5JSR A;  5ERL A;  4YZ2 A;  1OXC A;  2Q4S A;  2QQN A;  1K42 A;  3KGZ A;  1GU3 A;  1FAT A;  2VMG A;  3LDB A;  4HOO A;  1MS5 A;  2HWF 3;  3ECQ A;  3RI8 A;  3AJZ A;  3UNP A;  4HLT A;  3WF4 A;  3I2I A;  2XLG A;  3FZ3 A;  2GC3 A;  1EPW A;  1NLR A;  2WZR 3;  4GAL A;  4BB3 A;  2E63 A;  1V6O A;  2ZGU A;  3VZO A;  2VCB A;  3ACF A;  1XNB A;  1UXX X;  2D6M A;  4IGQ A;  5FXW A;  3WDU A;  4CEW C;  2OYZ A;  4Z1V A;  3MIF A;  2JIC A;  1SBE A;  2W1Q A;  4QKN A;  1FAY A;  5SV5 A;  1NY7 2;  3LPG A;  1BQP A;  5BNP A;  2EXK A;  2OUH A;  5JR7 B;  4TWT A;  3OF1 A;  3FFQ A;  2DF7 A;  3M2M A;  4BLI A;  1EUT A;  4UFI A;  1RMU 2;  4G9S B;  2ZZJ A;  1XOY A;  3ZM8 A;  3GHN A;  2QZ3 A;  4RS5 C;  1QJZ A;  2F4L A;  4HG6 B;  3B5L B;  4IEP A;  1VBA 2;  4IEW A;  4LR4 A;  3VBH C;  4NIG A;  2VOW A;  3GZT B;  1UMZ A;  4MX3 A;  4QPI B;  5FZ3 A;  5H9Q A;  2AC1 A;  2GC2 A;  3O1P A;  3EJK A;  3M1H A;  4FXK B;  3S5Q A;  4F7Z A;  1YRZ A;  3PJY A;  3O1U A;  4QGN A;  3AL5 A;  3N3H A;  4XAA A;  3URF A;  3M7A A;  2JB8 A;  4AI2 A;  4QM9 A;  2HWF 2;  2OQ6 A;  1O3Q A;  3NVC A;  4AGR A;  1JHJ A;  2FBE A;  1LGC A;  4WVZ A;  3OTF A;  3ZFG C;  3I8T A;  1S4C A;  1SMV A;  1NT0 A;  3H50 A;  3N9P A;  4Q0V A;  5FZK A;  4B4Q A;  2BOI A;  2HWD 2;  4Y1V A;  1V0A A;  2K9Z A;  4UXA A;  4D69 A;  1OI6 A;  5IWF A;  2NN8 A;  3WHT A;  2CAV A;  4BQ2 A;  5DQ0 A;  2RS3 1;  5FPX A;  4XJ8 A;  4QPI A;  2XKP A;  1CIW A;  3APB A;  4IEQ A;  2B42 B;  1MZ5 A;  1QOS A;  3T1M A;  4JZR A;  1KD7 A;  3WSO A;  2EAK A;  2FDG A;  2DUP A;  3W9A A;  5AC9 3;  3M70 A;  5F3C A;  1RXG A;  1HIX A;  3MLJ A;  3AMN A;  4AFM A;  4L0P A;  4YFW A;  1MS8 A;  4C0H A;  3JZV A;  3GBW A;  3IZO A;  2PYT A;  2OS2 A;  5A6X A;  1XYP A;  2ZAB A;  1OVS A;  3W5N A;  1LHW A;  4M4R A;  5CBL A;  3CKH A;  2BNN A;  4RA0 A;  4XDQ A;  3V56 A;  5LA1 A;  1YIP A;  1I5Z A;  1QHD A;  2ZEX A;  5GKA C;  5DG1 A;  1DLC A;  5EWS A;  5F3I A;  2R06 2;  4BIO A;  2WSV A;  2J1U A;  4S2F A;  3ZYP A;  1KS5 A;  4ZXK A;  1LNS A;  1W2O A;  3KCC A;  4CU7 A;  1B35 C;  1BCX A;  4LOR A;  5FYI A;  3J9S A;  3CIH A;  4PQQ A;  2X29 A;  4B1M A;  2GSY A;  3WP4 A;  1NZI A;  4XYX A;  4H7M A;  1W8U A;  1AXK A;  3D5O A;  1BHG A;  1AR9 1;  1XND A;  4K1Z A;  2NMN A;  1UZZ A;  4FFH A;  5A3M A;  3PVN A;  2Q8D A;  5IK8 A;  2XL9 A;  1TMF 1;  2W91 A;  3O0W A;  1W39 A;  3C2U A;  4I0A A;  1C8M 2;  3GZE A;  1FYU A;  4XF4 A;  2VY0 A;  1W8T A;  1NQD A;  2V5Y A;  1AR8 2;  4J1X A;  4RGA A;  3ZYH A;  4KG8 A;  4AW7 A;  5CKN A;  5F7U A;  2ARC A;  3K3O A;  2WFF 1;  5I0S A;  3R0R A;  2P6H A;  4Y22 B;  5CU1 A;  4KWU A;  2VUJ A;  3WNN A;  2VZO A;  2C4X A;  5HV4 A;  3LFM A;  3NWK A;  4BOW A;  2E53 A;  4JKM A;  4QHB A;  1GWK A;  2XBO 1;  1CJP A;  1K45 A;  4WM7 B;  4ZU5 A;  4JTN A;  4I2O A;  2VBP A;  1YI9 A;  3I3B A;  2HWB 1;  5FYS A;  1VAL A;  1UOF A;  2FDF A;  3FBY A;  3ZYJ B;  5FZ1 A;  3UET A;  2DWR A;  2ZKL A;  1QJU 3;  1MS4 A;  3PNA A;  1PGL 2;  1J3Q A;  3MI8 A;  3ZXK A;  2OX0 A;  2P37 A;  3HBK A;  3NRU A;  5E6H A;  4JGZ B;  4MGY E;  2VD7 A;  1RUI 1;  3RZH A;  1PZ9 A;  2AH2 A;  2WAO A;  2AEY A;  2LM3 A;  2X5I C;  3KCY A;  1FNY A;  3A22 A;  1UU4 A;  1UX6 A;  4W6Y A;  1RUH 2;  3I3M A;  4XAC A;  4WM7 A;  4QDR A;  1D4M 3;  2BVV A;  4GKY A;  2BV4 A;  3TEX A;  2BUK A;  1V9U 1;  3AMH A;  2YDE A;  2QQM A;  1MZE A;  1O4T A;  2A6Z A;  4HN0 A;  3UK9 A;  3THC A;  5C71 A;  2XLA A;  2NZ9 A;  2PN5 A;  4K3U A;  5DDJ 1;  4YWA A;  4WZC A;  1AYM 2;  5FUI A;  4TZD A;  1E5H A;  1BBT 1;  1GSL A;  4XJZ A;  4D94 A;  1HJG A;  3MZH A;  1OH4 A;  5C3R A;  3A21 A;  4NIH A;  4JGZ A;  5KHH A;  1IS5 A;  2RR1 2;  3GBG A;  3PLQ A;  2D43 A;  1RVF 3;  3BIW E;  3I4I A;  4Q4Y 1;  4PQ9 A;  2UY8 A;  5FP7 A;  3RDI A;  4FOY A;  4R9A A;  2HYK A;  2AYH A;  4PF1 A;  1UIJ A;  1Q8Q A;  1QJU 2;  2JEC A;  4IE5 A;  4LBK A;  4ZY9 A;  5JVV A;  2LRO A;  4BQY A;  3K4Z A;  3ELN A;  3ZSM A;  4CXX A;  3S0M A;  2FMD A;  4HVO A;  4QB1 A;  3KGL A;  4MGZ E;  5A7O A;  1S2E A;  3VUO A;  3P5B A;  5JWP A;  5AVA A;  1YWK A;  3H8X A;  2W46 A;  1W6N B;  3OPW A;  3LIH A;  4JKK A;  2VUD A;  4QDQ A;  3N4M A;  3N35 A;  3MO4 A;  4UOJ A;  1G9B A;  2B4K A;  5FXV A;  2QUO A;  1V6L A;  2BQP A;  2OZ6 A;  2QNK A;  3BPS A;  3AFG A;  5HXM A;  1XJA A;  2XJV A;  2ET7 A;  1YXW A;  3H1M A;  2E7Q A;  3ZX7 A;  1EP0 A;  1RED A;  1UYY A;  1XSR A;  3KM5 A;  1ZZC A;  3KV6 A;  4MZU A;  5JXG A;  1F8V A;  3HN3 A;  4GB3 1;  5FMD A;  2H0V A;  1RHI 2;  4BQ4 A;  1PK6 C;  2WWS A;  1BLZ A;  4OMC A;  4ATF A;  4RR3 C;  1RVF 2;  2QQW A;  3WCS A;  2OQ7 A;  2JDN A;  4CP9 B;  2BJS A;  3MFC A;  1IG0 A;  4AI3 A;  5E1R A;  2WO1 A;  1POV 3;  1W6N A;  1ZA4 A;  1VBC 1;  2W52 A;  3O0X A;  1U5Z A;  3BPZ A;  4XJ9 A;  5A33 A;  5IVF A;  2P3K A;  3R05 A;  3D4K A;  1YFU A; 
#chains in the Genus database with same CATH homology
 3T08 A;  2VL4 A;  4OZO A;  2JE8 A;  4ZZ8 A;  5B4N A;  1EUU A;  1JZ6 A;  3SEP A;  2QBX A;  1F4H A;  2X05 A;  2W1S A;  4D0Q A;  2QQL A;  1GOG A;  4LKS A;  2OKX A;  3I97 A;  2X09 A;  4XUP A;  3DYM A;  3C7H A;  4A44 A;  4MAD A;  3T09 A;  4E8D A;  4UI9 L;  1H6X A;  4UAP A;  1JYX A;  2J1A A;  1ULO A;  1SDD B;  4BK4 A;  2BZD A;  1OF4 A;  2RVA A;  3T2P A;  4QB2 A;  2JKX A;  1GQP A;  2VZQ A;  2DCK A;  3SKJ E;  2Y6J A;  4M4P A;  4QX0 A;  3OGV A;  2KD7 A;  4P00 B;  3VD7 A;  1W8O A;  2ZEY A;  4A42 A;  3UES A;  1XNA A;  3ABZ A;  5C7G A;  5JR2 A;  2VQU A;  3CMG A;  1MPX A;  2VZ3 A;  4RYD A;  3WQB A;  3LPF A;  2W9X A;  3HEI A;  1J84 A;  3HJR A;  4P5Y A;  4DUV A;  1GMM A;  2ID4 A;  1NKG A;  1R64 A;  2VOT A;  3I3E A;  1J83 A;  4A3Z A;  1UY0 A;  3D3A A;  3MBW A;  4QX3 A;  2BBA A;  1W99 A;  3WEZ A;  2J1S A;  2C26 A;  3K46 A;  5I0D A;  4CVU A;  3T0D A;  2HYX A;  3DYP A;  3K75 B;  2J1E A;  1OF3 A;  3MV0 1;  4QX1 A;  1JI6 A;  5EJZ B;  2YB7 A;  1UY3 A;  3ACI A;  2WZE A;  2QQO A;  2QQJ A;  2VZU A;  4D8M A;  3K77 A;  3VDB A;  1JYN A;  2BER A;  2V5D A;  1TVG A;  4MGQ A;  3NJX A;  3WF1 A;  3DEC A;  1OT5 A;  2BGO A;  3NQH A;  1JU3 A;  1UYX A;  4P08 A;  4QPW A;  3FHQ A;  3F2Z A;  4QB6 A;  2YC4 A;  5IYY A;  2VZR A;  1P8J A;  1O8P A;  4KI5 M;  2XOM A;  2QQK A;  4DUX A;  2WQ8 A;  5EJ1 B;  2WO3 A;  3BGA A;  1UY1 A;  2W47 A;  1W0N A;  2VMF A;  4A4A A;  2VMC A;  3IB3 A;  5DPN A;  3WNP A;  5IFP A;  5JXH A;  3K4D A;  2J1V A;  2Y6L A;  1KGY A;  1GUI A;  1XNT A;  2W94 A;  4BJ0 A;  3BN6 A;  3GDB A;  5IHR A;  1NX9 A;  1H6Y A;  3WF2 A;  5LA0 A;  2YFU A;  3GM8 A;  3I2K A;  3LEG A;  4PT6 A;  5B4X A;  1DYO A;  2WAB A;  1JZ8 A;  4W4Z A;  4BDV B;  5G04 L;  2WBK A;  3MV1 1;  2ZEZ A;  1WCQ A;  2VTF A;  4JX0 A;  2J1T A;  1T2X A;  1K3I A;  1F4A A;  2Z4F A;  2Y64 A;  3VD4 A;  3SEE A;  4QX2 A;  4TTG A;  2E32 A;  4GWI A;  1RYY A;  3I3D A;  3GGL A;  4MO3 M;  2EID A;  3FN9 A;  4JHZ A;  3I2G A;  1US3 A;  1UZ0 A;  3W5M A;  4LHS A;  1JYV A;  5JXI A;  1OD3 A;  3IDA A;  4A41 A;  1XC6 A;  4XUN A;  4DXT A;  3I2F A;  1UX7 A;  4MGS A;  3T2Q A;  2VJX A;  3OEA A;  1JZ4 A;  2C9K A;  3NJV A;  2W5F A;  1UY2 A;  1PMJ X;  4CU8 A;  2VZ1 A;  3A23 A;  2WUH A;  2XON A;  2WZ8 A;  5LA2 A;  4XVH A;  2VMD A;  3SKV A;  3E1F 1;  1W9S A;  2ZXQ A;  3OGR A;  3OEB A;  2V72 A;  2WAA A;  3CZU A;  2W1U A;  1O59 A;  3EYP A;  2J7M A;  3III A;  5JUV A;  2Y6H A;  5HPO A;  1CZV A;  4XUT A;  3T0B A;  1O8S A;  4OMD A;  3C7E A;  2LW8 A;  1CIY A;  3CQO A;  4IUG A;  2VO5 A;  4LQR A;  4DXS A;  1NUK A;  2VM9 A;  1L7Q A;  2ZEW A;  2EIB A;  3VD9 A;  3CZJ A;  2PQS A;  1KEX A;  3JXS A;  1PX3 A;  4A45 A;  3P1I A;  3WF3 A;  1GOF A;  1TG7 A;  4RN5 A;  1HN1 A;  1XPW A;  4XZU G;  2JD9 A;  2VZP A;  3WF0 A;  4E8C A;  3FHA A;  3CDZ B;  2E33 A;  2BGP A;  1SHW B;  2J22 A;  4ZXE A;  4ARX A;  3DYO A;  2VC9 A;  4XUQ A;  3MUZ 1;  3VD5 A;  3PUI A;  4OYU A;  2VQT A;  1UMH A;  2QQN A;  5CYY A;  1K42 A;  1GU3 A;  4TXW A;  3ECQ A;  1UXZ A;  3UNP A;  1PMH X;  3WF4 A;  1JZ2 A;  3I2I A;  1JYW A;  3T2O A;  3HPN A;  2XQX A;  4XUO A;  4OUE A;  1UMI A;  2VCB A;  3U37 A;  3ACF A;  1UXX X;  2LS6 A;  3C8X A;  5IJR A;  1JZ3 A;  2W1Q A;  1CZS A;  3LPG A;  4ZZ5 A;  4BXS V;  5CZK A;  3ETP A;  1GNY A;  1EUT A;  3LQC A;  3ZM8 A;  2HLE A;  4HG6 B;  2VZS A;  2WYS A;  4GZ9 A;  5IFT A;  2ORZ A;  1NAE A;  2EIC A;  3LEI A;  3T0A A;  1JHJ A;  2X10 A;  2CDO A;  3A7Q A;  4ARY A;  4JKL A;  4ET7 A;  2Y6K A;  5DQ0 A;  4W8J A;  4BK5 A;  3OBA A;  4DUW A;  1ULP A;  2E26 A;  2Y8K A;  3WSO A;  3OB8 A;  3WNK A;  1UY4 A;  2B9V A;  4QDS A;  3C7F A;  1UWW A;  1L7R A;  2DDU A;  4L0P A;  3W5N A;  1W9W A;  2VCA A;  1GOH A;  4M4R A;  3CKH A;  3NNG A;  4DXR A;  5LA1 A;  5JMO A;  3AC0 A;  3PUH A;  5LCW L;  2ZEX A;  1DLC A;  5EIY B;  1JZ7 A;  4MOA A;  2JDA A;  1CX1 A;  1CZT A;  2J1U A;  1LNS A;  4CU7 A;  3K4A A;  3CIH A;  4PQQ A;  1YQ2 A;  4CU9 A;  2WO2 A;  4CUA A;  2W87 A;  1IQD C;  1BHG A;  1WKY A;  3I2J A;  2W91 A;  2Y6G A;  5JXJ A;  2YG0 A;  5F7U A;  3C7G A;  4KMQ A;  4KWU A;  3HNY M;  3WNM A;  3WNN A;  3IAQ A;  2VZO A;  3IAP A;  2C4X A;  3EB7 A;  4JKM A;  3HNB M;  4Z2A A;  1K45 A;  2CDP A;  3J7H A;  2VZV A;  2RV9 A;  3I3B A;  2W1W A;  3MUY 1;  4QAW A;  4CU6 A;  2E31 A;  2EIE A;  3UET A;  1W8N A;  2W95 A;  3HOB A;  5DMY A;  4LPL A;  1JZ5 A;  3GXU A;  3NRU A;  4AAX A;  5C70 A;  1SG3 A;  3WNL A;  2WAO A;  1W9T A;  3A22 A;  2R7E B;  2WDB A;  2L9L A;  4QDR A;  2ORX A;  3C7O A;  2QQM A;  5DN2 A;  4XUR A;  5C71 A;  3THC A;  1US2 A;  2WN2 A;  4FI9 A;  4CUC A;  3ACG A;  3ACH A;  2RJ2 A;  5FUI A;  3THD A;  1I5P A;  1OH4 A;  3A21 A;  1DP0 A;  2W92 A;  3VD3 A;  3LE0 A;  1K12 A;  3LEK A;  2V4V A;  2W3J A;  3VDC A;  1PX4 A;  4PF1 A;  4ZY9 A;  4GWJ A;  3WNO A;  3K4Z A;  4QB1 A;  1UYZ A;  4YPJ A;  2WN3 A;  2W46 A;  3HNM A;  2YC2 A;  4JKK A;  4QDQ A;  1JU4 A;  3MO4 A;  4UOJ A;  2B4K A;  3I2H A;  1D7P M;  3OG2 A;  4CUB A;  4W50 A;  4A6O A;  2VME A;  5J1X A;  4P02 B;  4DEV A;  5HXM A;  5G05 L;  4AG4 A;  3P6B A;  2XHN A;  2YFZ A;  3OGS A;  1UYY A;  5JXG A;  2J1R A;  5A1A A;  3HN3 A;  3VDA A;  2VCC A;  4OMC A;  2VZT A;  2QQI A;  2DCJ A;  2WO1 A;  2VR4 A;  3FL7 A;  4DEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...