3M1HA

Crystal structure analysis of the k3 cleaved adhesin domain of lys-gingipain (kgp) from porphyromonas gingivalis w83
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
176
structure length
174
Chain Sequence
AEVLNEDFENGIPASWKTIDADGDGNNWTTTPPPGGSSFAGHNSAICVSSASYINFEGPQNPDNYLVTPELSLPGGGTLTFWVCAQDANYASEHYAVYASSTGNDASNFANALLEEVLTAKTVVPEAIRGTRAQGTWYQKTVQLPAGTKYVAFRHFGCTDFFWINLDDVVITSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine specific cysteine protease
publication title The modular structure of haemagglutinin/adhesin regions in gingipains of Porphyromonas gingivalis.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Cell invasion
total genus 42
structure length 174
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.47: Gingipain K.
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07675 Cleaved_Adhesin Cleaved Adhesin Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m1hA00
3AFKA 2ENRA 4AVSA 1GNHA 5EYYA 3BIWE 2ZGUA 5HCAA 5JMCA 1MS5A 1YO8A 2D7FA 3NWKA 2SLIA 3R05A 4YW4A 2JD4A 4YZ3A 1SBFA 3BODA 2GMPA 5GZCA 2JE7A 2EXIA 3O12A 4Y1XA 2GALA 3V0BA 1GBGA 1N3PA 1GKBA 2GNBA 5GZGA 1CESA 2CYFA 1N3QA 4Y24A 5T55A 4U2AA 5T50A 2DTYA 1S0CA 1S0GA 3OPZA 3UJQA 1DZQA 1DYKA 1OKQA 1HLCA 1QOOA 4YM0A 3SLIA 3ZYRA 1WLWA 5GALA 4H55A 1OFSA 4Y26A 2AR6A 1V6MA 2GNTA 3WUCA 2OVUA 1LENA 3ZXJA 2NP0A 4FQ4A 1CQ9A 1S0BA 5DUVA 4W65A 4YFZA 3APBA 2ZACA 1AF9A 1V6NA 4LBQB 1KQRA 1LHVA 1O4YA 3DUIA 1I1EA 2VW0A 1LHUA 1UX6A 2ARBA 3V64A 4BM8A 4BMBA 4WVVA 4UW5A 4SLIA 4FPCA 2YROA 3V0AA 3IM0A 4GKYA 1YYNA 1FX5A 1NXD1 1W6NA 1IS3A 5KXCA 1MS4A 1CR7A 1FNZA 2OUJA 4Q26A 3TAYA 3UJOA 5JOWA 2A7AA 4LBKA 3PMEA 2HYKA 2D3SA 4WVWA 2ARXA 2AUYA 1LCLA 2SBAA 1UZYA 3AZVA 1X50A 3RSJA 4AYUA 1N47A 3QLQA 2ZGMA 1VAVA 1VIWB 1QMJA 1APNA 2R49A 4K1ZA 4ZXKA 4UW6A 1IOAA 4XDQA 1SBEA 2P37A 1DLLA 4M00A 1IS4A 1WD3A 4FPOB 2P3KA 4Q1PA 1ULEA 4YW2A 5EYXA 4OZXA 2YMZA 3A0KA 3AP9A 1W6OB 1LOBA 1ZA4A 3NV3A 1H30A 2JECA 4HL0A 1ULCA 1GANA 1ENQA 2Q5TA 1Q8OA 3SNMA 3ASIA 1SFYA 1D0HA 2P3JA 3FFZA 2DURA 4R9DA 1KITA 1S1AA 5E89A 3OYWA 2A6VA 2DU1A 2VH9A 4GALA 1WBLA 1LULA 1JOJA 1WW5A 3AP7A 1LOGA 4FVVA 4FPEA 2DUOA 4XBQA 3VKMA 4D69A 2C5DA 1SLLA 3BOPA 1GZCA 1JN2P 2UWCA 4K21A 1WW6A 1GZ9A 3AYDA 2D3PA 3ZPYA 3FUOA 5DZGA 4KBBA 3LCPA 5DUWA 5JOZA 1LU2A 1V6IA 3GALA 1N1SA 1HDKA 4Q8LA 4BLJA 5GJ6A 1H9PA 5IK8A 3SISA 1JHNA 2ZAAA 1F5FA 2DU0A 4L8QA 1AXKA 4XBLA 5T5JA 3HMYA 1LOCA 2BQPA 3WOGA 4XJZA 5E8AA 1N1YA 2GMMA 2CL2A 5SV8A 2NMOA 1QU0A 3AP6A 3D5OA 1G86A 4JCKA 3WDUA 1SLTA 2D6KA 1R1ZA 2A3WA 1XQNA 1G9FA 1SLCA 1WLDA 1UMZA 3NV4A 2ZZJA 1HQWA 2LALA 2EXHA 5LK5A 2R0HA 1DYPA 2A6XA 2I2SA 3WG4A 2VY0A 1RIRA 1C1LA 4CZSA 3POWA 2W08A 3M3EA 4Y20A 5DXDA 4LBJA 2YZ4A 3ZSLA 4YM1A 3IKWA 4M3CA 4LBLA 1VLNA 4XXPA 4CRQA 4Q8KA 3NV1A 3POSA 4Q1RA 1UZZA 2UURA 1VAMA 3MW4A 4I30A 4XXAA 1C4RA 2WQZC 3FBYA 4FPHA 3AP4A 4Q27A 4YGDA 1JW6A 1DHKB 2ZHMA 1Q8SA 4XTMA 3RS6A 2AGSA 1LOEA 1BXHA 2D44A 2VU9A 4XJ9A 5F5QA 3M1HA 1W6PB 3SH5A 1Q8PA 4F83A 1AVBA 1LOFA 2VXRA 3N36A 4Y1UA 3ZXKA 1IS5A 1V6JA 1EPWA 3Q9OA 3VKLA 2PHFA 2YY1A 2ZA9A 4YLZA 1ULFA 2JDZA 1GZWB 1RITA 1UKGA 2XG3A 3M2MA 2AH2A 5L73A 1FYUA 5GZDA 3AZZA 3WZ1A 2OUHA 2A6YA 3WDVA 2WLQA 5T5OA 1DIWA 1AX0A 1C57A 2WNEA 2EAKA 3AXEA 1UPSA 1MZ6A 4XHBA 3N7JA 3N7MA 3AP5A 4XJAA 3PVNA 1W6MA 2WT1A 2WSUA 4LBQD 1IKPA 3RMYA 5JOXA 5KXDA 4IQPA 2ZGTA 3GNEA 1PZ7A 3IMNA 1MACA 3B01A 1J1TA 2P3IA 3N7LA 2AYHA 4ZKTB 4ISRA 5GLTA 1LGNA 1RINA 1W6QB 3C2UA 1DQ2A 5T54A 2A70A 3UL2A 3ILRA 3WG1A 2A71A 2EALA 2JKBA 1MS1A 3PVEA 4Y22A 3OY8A 3O5SA 1KRIA 1YIFA 3PJQA 4K20A 2FMDA 1G8WA 1GV9A 1LGCA 2W52A 4LBOA 5KXEA 4FQZA 1CIWA 4Y1YA 2ZGRA 4XTPA 2EXKA 4HANA 2EXJA 2NZ9A 3O0VA 3QCWA 1B09A 1GSLA 2WSVA 1BJQA 1BKZA 4GWNA 2ZMNA 1I3HA 3VKFC 4MYEA 1YI7A 2A5ZA 4FPGA 3AXDA 1W0OA 5FREA 5DZEA 2LTNA 2R0FA 1LHOA 2KM2A 3L2YA 4LBQA 5FRAA 1SACA 4XJWA 2DVGA 2GNDA 2ZMKA 1UN1A 5CB7A 2WT0A 3AYEA 1KDKA 1AZDA 1LESA 4XYXA 1DQ6A 4PCRA 1URXA 1VALA 3IPVB 4YFWA 4XJ8A 2E6VA 4XMIA 3HN1A 2TEPA 2XB6C 2V5YA 4M3CF 2R16A 1S0JA 1V6OA 1DQ1A 3N3HA 4FOYA 5H9QA 1DFQA 2ZGSA 2ZHLA 5T5PA 3B00A 1S0FA 1QKQA 3USUA 1DGLA 4YGCA 1CPNA 2CWSA 2R1DA 2EF6A 2GNMA 3O0XA 5GLVA 5H9RA 1MS3A 1HKDA 2D6NA 4M3CE 3WDTA 2D6OX 2R1BA 5DZFA 5T52A 2E53A 1QDCA 2CY6A 2P2KA 4XE9A 1D2SA 4Y1ZA 3WCSA 1A3KA 5H9PA 3SITA 4ASMB 1LOFC 4YG6A 4DQAA 3WVJA 1G9DA 1QDOA 1Q8QA 2ERFA 4BPZA 2DWRA 3B69A 1MVEA 4XILA 4Y20B 1IS6A 1W6OA 1QNWA 5H9SA 1KJRA 1KDMA 4YZ4A 3RMXA 2B7YA 3R4SA 3MW3A 4ISQA 3B3QE 1WW7A 4AGRA 2D3RA 1LTEA 4WV8A 1G7YA 3AZXA 1FATA 5CAZA 1Q56A 3VKOA 3MPPG 1FAYA 3AK0A 1S0EA 4XOGA 1A8DA 4K1YA 1WW4A 1YXWA 5GZFA 2AREA 4YW3A 3WNXA 5BYNA 5JDBA 1A78A 2VW2A 4YM3A 4M01A 4XBNA 4GA9A 1QGLA 3N35A 3SH3A 2GDFA 3VKNA 2W68A 1G9AA 5GZEA 2A6WA 2ZGNA 2ES3A 3AJYA 4XJUA 3LSEA 3M3OA 4YZ5A 3ZXLA 3FLTA 3ZSKA 3V0BB 4P9WA 3ZXFA 2UWBA 4R9BA 1AJKA 4R9CA 1AX1A 1DQ4A 5F9TA 1LU1A 5IT6A 3VUOA 2UU8A 3OBRA 3WG2A 1GICA 3RG0A 2GN3A 4JC1A 1NLSA 3KQRA 3U4XA 4YZ2A 1Z0HA 3ZSJA 2EIGA 4P9XA 4TZDA 1JYIA 2WJSA 1YRZA 4ATFA 4BOWA 4AGVA 5CNAA 1AJOA 3BTAA 4DPNA 3NV2A 2DVAA 3CNAA 3A4UA 4P9YA 2PHUA 2WKKA 4C1XA 1S0IA 1JUIA 4NO4A 4RL7A 4NOTA 4YG3A 5GLUA 2D6LX 3OGGA 4UW4A 5IK7A 4YZ1A 4FPKA 3WHUA 5JLVA 3V0AB 2CWMA 3OY8B 4FPFA 2DVBA 3AYAA 1W6NB 2AENA 1JBCA 2WT2A 3DGTA 3O0WA 4AVVA 2DYCA 3HR9A 1AXYA 4XZPA 1N1VA 2FHRA 4CTEA 1KJLA 1Q8VA 3AYCA 5EWSA 5KXBA 1SLBA 2UWAA 3TB0A 3R4UA 1LHNA 2ZABA 3T1MA 4BLIA 1GYKA 1F9KA 2A75A 3T1LA 1QNYA 2H0BA 1SBDA 2D6MA 2CNAA 1W6PA 4FOQA 1LJ7A 1MVQA 3AZWA 3OJBA 4Q2FA 3VV1A 3ILFA 5IK4A 1QOTA 1U0AA 1GZWA 1WBFA 2ZGLA 3ZXEA 2ZBJA 4DRRA 2GN7A 1H9WA 2PHRA 3W59A 1MS0A 1FNYA 3PVOA 5AVAA 2DUQA 3WV6A 1Y7BA 1W0PA 1ONAA 3AJZA 1LEMA 1BZWA 4FOWA 2PHXA 3M3QA 1MR5A 1SCRA 3OYWB 1GLHA 2A3YA 4FP3A 3WDXA 2W39A 4BMEA 4FPLA 2YXSA 1AXZA 1O4ZA 1GNZA 1JYCA 1SCSA 2ZMLA 5EXOA 2JJ6A 2NM1A 4JRAA 4YW1A 1FV3A 3WG3A 4GKXA 3AZYA 3SH4A 4WZFA 3WDWA 4U36A 3USUB 1W6QA 2DVDA 4XIOA 1ENRA 2A3XA 3WUDA 1N3OA 3JUUA 5CBLA 4P14A 1CONA 4PQ9A 1TEIA 2PHTA 1DBNA 1DQ5A 1LOAA 1SLAA 2V73A 2JE9A 2Z42A 1WCSA 2ZHNA 3ILNA 4FPYA 2GMEA 4XMAA 3AX4A 5HCBA 3ENRA 2OW4A 1ZM1A 2E7TA 3WHTA 2YV8A 1IKQA 3ZYPA 3FLRA 2DTWA 2PHWA 4Y1VA 2DUPA 1JXNA 1QOSA 1CVNA 2ZHKA 3FLPA 4YM2A 1UAIA 3T2TA 1MS9A 3WDYA 3WLUA 4AGGA 1F31A 2ZGQA 4YG0A 1V00A 3KM5A 2DVFA 5IK5A 4FOVA 1S0DA 5DG2A 1FV2A 2PELA 1G9BA 3I4IA 3IN9A 4PF5A 4ATEA 4RA0A 1LECA 4M3CB 3V65A 1BYHA 2DV9A 3IPVA 4YW5A 4XHXA 2NMNA 1V6LA 1SLIA 3LSDA 1CPMA 1UL9A 1Z78A 1OQ1A 2CTVA 5DUXA 3ZVXA 1QF3A 3D4KA 3INAA 2ZGOA 3MEPA 2C9AA 3D6EA 3MW2A 4FP2A 4GWMA 5GM0A 2D6PA 5CA6A 1LODA 2RHPA 5JVVA 3RQ0A 3A0NA 3I8TA 3OBTA 4YGBA 4DRVA 4ITCA 4YGEA 4R9AA 5GLWA 4XIKA 4Z8BA 2E51A 4PBOA 5GLZA 4BQ1A 5IUQA 5E88A 2VUAA 4DS0A 1PZ9A 1DQ0A 1PZ8A 1C1FA 1WUVA 4C1WA 4LBMA 5HCFA 3UK9A 1WLCA 4LBNA 5JOYA 3FUQA 2E7QA 4FPJA 4AVTA 4UW3A 1CJPA 1MZ5A 1MS8A 3JU9A 1G9CA 1LGBA 2NYYA 1LHWA 1WD4A 3ZSMA 3ATGA 2G4IA 5T5LA 2D43A 4TYSA 1V6KA 3M3CA 3N7KA 1W6MB 4AWDA 1CN1A 2ZGKA 4DFSA 1ULDA 1BQPA 1ENSA 4PBPA 2ZGPA 1HQLA 3RRDA 3POYA 2VW1A 5DG1A 2A6ZA 2ZKNA 1N1TA 3H0OA 4GXLA 1LEDA 3WCRA 5DUUA 3B9CA 3W58A 1ULGA 4Y22B 2NN8A 2P34A 1AX2A
chains in the Genus database with same CATH superfamily
4IEPA 1AHSA 3AFKA 3PU3A 1VBC3 1VMFA 1GNHA 2CDOA 2PN5A 5EYYA 4AVSA 3R05A 5FYZA 4CCJA 2WA4A 1RUJ3 5ACA2 2JD4A 4YZ3A 2VD7A 4QDSA 5GZCA 4YNIA 4Y1XA 3O1SA 5FO8B 2GALA 3PUSA 1RUI1 1X8MA 4WM7A 1N3PA 4OHYA 3T2PA 3PUIA 2W1SA 4Y24A 3WF4A 2DTYA 4OHZA 3S5QA 1OKQA 1QOOA 3NMBA 3SLIA 1I5ZA 5A7WB 1F15A 4B7KA 3ACHA 2WZR2 1J59A 4I3GA 4W6YA 3GBFA 4Y26A 3POIA 3EO6A 4AHZA 1VPHA 4CCDA 1S0BA 4W65A 3H1YA 5FTTC 4KWLA 4UFHA 2LM3A 3PTYA 3C7EA 4AQSA 5HV0A 4BJ0A 3LF7A 4IV1A 1J84A 4BXSV 3A22A 1HJGA 4EYUA 5CISA 1WCDJ 3ZYBA 4WVVA 1AR73 4UW5A 4SLIA 3CU7A 3BOWA 3BTZA 3LQCA 1FX5A 1NXD1 2B5HA 2HJIA 4CU8A 1IS3A 3WZ1A 3T0DA 5FZHA 3UJOA 1W04A 2A7AA 4NHKA 3PMEA 2XH6A 2HYKA 3UGGA 1JYVA 4CEWA 1F2NA 1PIV2 4RSUA 2WZPP 2OZ6A 1N47A 2W95A 5FYIA 3QLQA 2ZGMA 5FPLA 1O3RA 1NY72 3R6SA 1OSGA 1QMJA 5F5AA 3ABZA 4TWTA 1W8FA 1APNA 2P4EA 5CG8A 3P6BA 1IOAA 1POV3 1RC6A 3PURA 3ZN6A 1GQGA 1RUE1 1EAH2 2RS33 4JKMA 2WC2A 2P37A 5AVPA 5JSOA 4FPOB 2P3KA 1RXGA 4TLGA 4N9HA 5EYXA 4OZXA 2ZAHA 3VBFA 5FYTA 4CDXB 4K7JA 4CXYA 4V2VA 4DO0A 1UW8A 2JB4A 3LGRA 5CKQA 4HL0A 1ULCA 1GANA 1ENQA 1U5YA 4XW3A 5JUVA 2W1WA 2P3JA 3GBWA 2DURA 3J8F3 5E89A 4CU9A 2CAUA 2RVAA 2DU1A 3LA2A 2VH9A 4CDQA 5BNNA 2ET7A 5FZGA 3VDBA 3VDAA 3AP7A 1W9WA 1P8JA 2XLAA 4HVRA 5AFEA 5IVJA 2C5DA 2ORXA 3PDQA 1Y4WA 3IMMA 3EHKA 1DF0A 4K21A 5FZLA 1GZ9A 2RS53 1DLCA 2D3PA 4NHXA 3VD5A 2F6BA 5DZGA 4AEJA 3RZMA 4JZRA 2XJRA 2ZJCA 3M4FA 1HDKA 3CJIC 4KWKA 5IK8A 4BH9A 3B02A 4NWVA 2WO1A 4NAMA 4WVMB 4OFGA 2CDPA 2E63A 1VBD3 3SISA 1VMHA 4WVZA 4CP2A 1JZ5A 5CFDA 2VVFA 4JGZA 3SKVA 2XR4A 2DCYA 2Y64A 4YVWB 2BOJA 5FCCA 5E8AA 4CSWA 5JXJA 5FKBA 2YBSA 4L2NA 3WP4A 4B7EA 4DXRA 1RUNA 1ZREA 4MGYE 1SLTA 4WM7C 2E7AA 3S5AA 2PMWB 1RB8G 3MGUA 2EA7A 1UMZA 4IGQA 2VTXA 1HQWA 4XAAA 4KL1A 2VQTA 1NLRA 4WM8A 2I2SA 4OYUA 2VY0A 3RYRA 4CZSA 2XHKA 3M3EA 4P9LA 4Y20A 5DXDA 4TLFA 4LBJA 5BV6A 2YDEA 2XLFA 3VHNA 5LY2A 3IKWA 1VBC1 2XGXA 1AR61 2AEZA 2JDHA 3LOBA 1VLNA 4XXPA 4QDRA 3EB7A 3KHCA 4IV1C 2WUHA 2NQYA 3W20A 2UURA 2FZ1A 3RWNA 4Y5Z0 3CJXA 4RFRB 1BBT1 3AP4A 4IE6A 2ZHMA 2Y38A 3MUZ1 5BUVA 2BNOA 3RS6A 1H6XA 2D44A 2XJQA 4KI5M 3IDCB 2J1EA 2R062 4NIHA 1LOFA 1S2KA 4JV4A 5JXHA 2ZTNA 1Q5OA 2VXRA 2C4XA 4Y1UA 5FXWA 4CEWC 3BI3A 3TEZA 5FZBA 1OA4A 1ULFA 1W2OA 2JDZA 4GMP0 4LE4A 5FZ7A 2QZ3A 4CDUA 4F7ZA 5B2GB 1RMU1 1PX4A 2AH2A 1FYUA 3MIBA 3U37A 4ZY9A 1OKOA 4R8HA 2A6YA 1R093 2B4KA 2FQPA 2WQ4A 3KWVA 4UYBA 3WDVA 1OD5A 2WLQA 4NVPA 4MGIE 4HKOA 1AX0A 1C57A 2HKXA 5FLHA 1GP5A 2JWPA 2WNEA 3U11A 1YHFA 5BNOA 3TEWA 3AXEA 5DN2A 4K3UA 4IERA 3QH7A 2OXBA 1I9RA 4O65A 5FUPA 2IZWA 4XFGA 3M3IA 2JB8A 3HQXA 4AR2A 1O3TA 1W6MA 1XB9A 2WSUA 2WT1A 3AKSA 4DUWA 1O91A 1I6XA 3GNEA 1CAUB 2BTVC 3IMNA 3LPGA 4AEMA 5HXMA 1MACA 1OQEA 1UOFA 1J1TA 1YQ8A 2P3IA 3K4AA 1RUE2 4ZKTB 3FHIB 1GR3A 1W6QB 3C2UA 3ZSEA 3VD4A 2QQKA 3I3QA 5BNNC 4CDQC 4A41A 3ES1A 2XJUA 3NSTA 5FR3A 3VBHB 1YIFA 4LUMA 1SMVA 1GV9A 4IETA 4AW7A 1OA2A 2RS31 4QGMA 3CBNA 1AYM3 3MFAA 4Y1YA 2ZGRA 2JX9A 3EQEA 3HOBA 3JBG3 4HANA 1OA3A 4IW3A 2EXJA 3CHXA 3O0VA 2LRPA 2O8QA 2XJPA 3PL0A 1W9FA 4N53B 3O7OA 5LBBA 2V4VA 1XE7A 5IFPA 1F8VA 5A7WA 1VAKA 2B45X 2D97A 3POBA 4JGZC 3OPTA 5CFDC 5LRSA 3J8F1 3DKQA 2PLV3 5LBEA 1AYN3 1QJFA 5IVEA 3BPSA 5IVYA 4H2AA 1XSQA 5A3MA 4PQQA 1LHOA 2H0VA 1L7LA 4Z2WA 4QMAA 3Q8EA 2JDKA 3S6PA 3CO2A 5FPXA 3AYEA 3A21A 5FZKA 1FMD1 1AZDA 2RS51 4XYXA 5FY8A 2IXLA 4ZU4A 5LA2A 4GZ9A 4PJYA 3B94A 1XNTA 2IXJA 3W9AA 1QJX3 4P00B 3LE0A 4P5HA 3H3UA 1V6OA 2CGNA 1HRI3 5F3CA 4FOYA 4NHMA 4X8PA 2ZHLA 4RD7A 3B00A 5FXVA 1OI6A 1W8UA 1NCQB 1JZ3A 4YGCA 2CWSA 2R1DA 1OURA 4KH9A 2GNMA 2KA3A 2RJKA 5FZ0A 1ND3B 5H9RA 3U78A 1HKDA 4GWIA 3ZKYA 5DZFA 3NQHA 3RZJA 1OUSA 1O8PA 3IIIA 1PMJX 2DBNA 4XE9A 4Y1ZA 4ONUA 3TRSB 1VBC2 3MV11 2W92A 4Y4YA 1AR62 5DAPA 1LOFC 3DEMA 3S7EA 3UGHA 4DQAA 3WVJA 1RUJ2 4AEKA 1Q8QA 2ERFA 4BPZA 4AFMA 2OPKA 4IUGA 5IJRA 4BWOA 1IS6A 2VMDA 2JENA 4YZ4A 1KDMA 5FFOC 3D82A 4CDUC 1XNAA 3R4SA 1C8M1 4W6XA 2HYXA 3CKHA 3P3PA 4N9IA 4A6OA 2IFRA 2EIEA 5FPBA 1M4WA 3Q8AA 1KD7A 1G7YA 1FATA 1JZ2A 4XAEA 5BNOC 3MPPG 3AK0A 1S0EA 2BNMA 2HWF1 4Q0SA 1NQDA 2KD7A 3GDBA 4YSFA 1WW4A 3PIGA 4G9SB 2Y0OA 4KQ7A 1YXWA 2AREA 3PLQA 5I8TA 5LK7B 3S0MA 1A78A 1O5UA 2GP3A 4XBNA 4GA9A 1QGLA 4XF9A 3NJXA 4OQ9A 1AR91 3FBMA 1G9AA 4L92A 5EZWA 5GZEA 4RS5B 3AJYA 4XJUA 4MHRA 3AKQA 4WVMA 4QHZA 4P9WA 3ZXFA 2GC0A 2WAAA 5FZOB 2XJSA 2OKXA 5F9TA 1LU1A 1UU4A 2I74A 3NNGA 5IT6A 4RGAA 1GICA 3RG0A 3U4XA 2PTMA 3ACFA 4V2WA 2WN3A 5FWEA 3ZSJA 1NCRB 2HLEA 4QQ2A 1UYZA 4EZ4A 3I3DA 4ZZ8A 2Q8DA 5LATA 2JDNA 4I2OA 2XJTA 4X6RB 5CNAA 3BTAA 4Z1VA 1ACCA 2QQOA 3NV2A 5IHRA 4NHYA 3T4HB 5CKMA 1OC1A 4HK9A 2WABA 4CCMA 1JUIA 4NO4A 3UKNA 4NOTA 4F8AA 1ZZ8A 5LB6A 4B3NA 2J1TA 2RS32 4LT5A 4UW4A 4LULA 3R0RA 4PLMA 5C8CB 1NE6A 2IFWA 4CUCA 3POJA 4Q29A 2CWMA 4JDNA 4AVVA 3IDEA 4CTEA 5F2SA 2BYVE 2FHRA 2VMCA 5KXBA 2VULA 4AG4A 1R1A3 2UWAA 1PK6A 3FZ3A 4CCNA 3R4UA 2ZABA 5A3UA 3J8F2 1OHFA 3GZUC 3JBG1 4UFIA 3T1LA 2JDUA 1GQHA 5HPOA 3BKZA 3SHRA 4BCUA 4IEOA 1XRUA 2FCVA 4Q5OA 5FO7B 4A2UA 5JWPA 3AFGA 3MZHA 1RUG1 1YEWA 2XVKA 3NNMA 4Q2FA 1COV3 1NAEA 3LAGA 2ZEWA 2PLV1 1UXZA 4RYDA 3T2QA 5IK4A 2RS52 3S57A 2ZBJA 1NE4A 2QQPA 1GWKA 1J1LA 3IDAA 3ME2A 1MS0A 1FNYA 2VPVA 3PVOA 3WW2A 1EUTA 5AVAA 5EJZB 1VBD2 1ONAA 4D7TA 4JHZA 1LEMA 1BZWA 4K9SA 3CIHA 1EPZA 1H6YA 4HKLA 1MR5A 3C3VA 3NKGA 1SCRA 2VNOA 3PHMA 4CU6A 2W0XA 1F5JA 4W50A 1QJX1 4UI9L 3VBUB 1UMHA 2W39A 2XQRA 3KCCA 2QQVA 2BRTA 2WNOA 4URTA 3WDXA 1O4ZA 3C7GA 2JJ6A 1CAUA 4YW1A 3GJAA 3ZFGA 3RZLA 3HEIA 3U07A 1BK0A 3GHNA 3KQ4B 3UETA 5CZKA 2BBVA 3USUB 1NQJA 1NZIA 1W6QA 5A70A 3MF9A 2P3YA 2MHFA 3Q8FA 3AKPA 4QKDA 2A3XA 5CBLA 3JUUA 1RUOA 3VBHA 4CUGA 5FP8A 3G7DA 4IEZA 3U4SA 1DBNA 1DQ5A 1SLAA 4FPYA 3ILNA 4NN0A 5FYMA 4XC9A 3FJSA 4NAOA 2C1FA 1ZM1A 5JSRA 3WNMA 4PI2A 1JTZX 3ZYPA 4N53A 3H8RA 1RUF3 3H8OA 4Y1VA 5F2WA 2DUPA 2PAKA 1XYNA 2JEMA 3DF0A 3L9JT 3PVBB 4D8MA 4J25A 5DDJ1 1F31A 4AGGA 2HWE1 4NIDA 5IK5A 4I0WB 4FOVA 1S0DA 2X5IB 5JMOA 1V9U3 3I4IA 1GOHA 2WQ8A 2P1BA 4L97A 4CPBD 1PGSA 4ATEA 5HI0A 2EAAA 2J42A 3OGVA 5FV3A 3V65A 4O9GA 4NPLA 2YPJA 4JKLA 4XHXA 2VAUA 4BIOA 3LSDA 3HIFA 5FZDA 3F2ZA 3ZVXA 3KV9A 2IXCA 4FP2A 2GAUA 1GMMA 3D6EA 5KHHA 1X33A 2D6PA 2P6HA 3LEGA 3MI8A 4E4ZA 1UNBA 1LODA 2RHPA 4O61A 4RR3A 4YGBA 4DRVA 5L36A 1PK6C 1OH4A 2WYFA 4R9AA 4YWAA 4A4AA 3FX3A 5GLWA 1RUC1 1ND3A 4XIKA 2E32A 3POEA 1US2A 4DUXA 4PBOA 4FFHA 5E88A 4AAXA 1PZ8A 1WUVA 1YIPA 2HEVF 2F17A 2XHNA 1WLCA 5J1XA 3ZO0B 5JOYA 2E7QA 4UT5A 1SQ4A 4AVTA 3HBZA 4BK5A 1MZ5A 1ND2B 1YUDA 4PDWA 2NYYA 3KCYA 5G04L 1AYM2 3RFRA 1G9CA 3LEIA 1XNBA 3JBG2 4B29A 4BU2A 4TYSA 4RHV3 4OMCA 1NT0A 4Y33A 5FP7A 5C33A 4BQ3A 4HZFA 3RDIA 2ZGKA 1ULDA 4B4RA 4X6QB 1RUG2 1ENSA 2Y6LA 1HQLA 1WMDA 2VW1A 5DG1A 1SFNA 2PLV2 3BIEA 1AYN2 2Y6FA 1N1TA 3H0OA 3KGZA 3WQ7A 1LEDA 4NIIA 2HWC3 3WCRA 1TZOA 3NRUA 5LRRA 2NN8A 1W8NA 1AX2A 1C5HA 4QPIB 1VBB1 2ENRA 1J3PA 5JMCA 1O6UA 2HH9A 2IVJA 3BYWA 3NWKA 2VZUA 4L9BA 3SXWA 1COV1 1FOD1 5FPZA 3ZFGC 4CDWA 1SBFA 3LA7A 4MGSA 4RS5A 4UWDA 2VCMA 5K0UA 1IZ3A 2EXIA 3LB9A 4QXCA 2VXJA 3LDKA 3T09A 1GBGA 2Y6KA 2GNBA 2F4PA 1CESA 1F4HA 1QJX2 2CYFA 3E6BA 5FZOA 3VBHC 4COUA 5T50A 3UJQA 1ULPA 1OUXA 2WR9A 1HRI2 3W21A 4H55A 1NCRA 1OFSA 2K46A 5FK7A 2AR6A 2ZKLA 5GZGA 1W03A 2JKXA 3AMHA 5FYYA 2NP0A 4FQ4A 1UCXA 5DUVA 1XU2A 4J1XA 2YU2A 4BZ4A 4I3PA 2LUWA 4KBZA 2WFF3 4QB6A 4N53C 3T3YA 3UESA 4B1LA 2WNVA 4KU8A 2VO5A 1ST8A 1I1EA 1W0NA 1UX6A 1HV0A 5ACA1 2RDQA 4NRMA 5F3IA 4HVOA 4GMP3 4HVQA 1KS4A 3NW4A 1GQPA 5HV4A 3PU8A 4FPCA 3HVDA 2VCBA 3IM0A 5FMBA 4DB5A 4XUTA 3T0BA 2UYBA 3WP6A 3VHPA 3Q8BA 2XKOA 1H1MA 1FNZA 4Q26A 5JOWA 3TAYA 3E1F1 2FDGA 5AC93 4LBKA 4CXWA 1ZZ9A 2WZR1 2VG9A 4WVWA 1EY2A 2ARXA 2ZEYA 4YPJA 3WNNA 3ZYFA 1HX6A 1LCLA 3UKVA 3AVRA 1ZVFA 4ES8A 1VAVA 5K7PA 2XBO3 1IG3A 4K1ZA 1QJU3 4UW6A 1OBNA 4IDZA 4PF1A 1IPSA 4XDQA 4M00A 4UXAA 4RR3C 1WD3A 1CAWB 3GBGA 1IPKA 5IFTA 3HJRA 3O1OA 3A0KA 1ND3C 4XACA 4MH0E 1W6OB 2BGCA 1LOBA 3NV3A 3C7HA 1XU1A 1HB2A 3R4DB 2Q5TA 4QHBA 1D0HA 4QU1A 3FFZA 1GUIA 5ANQA 4R9DA 1PIV1 3J4UH 1UIJA 1YFUA 1JZ6A 3VBUA 1WBLA 3OPWA 4QPYA 3RZKA 4PDWC 3ACGA 4OQ8A 1RUC2 3P1IA 1LOGA 3KV4A 4FPEA 1AL21 3GJBA 3NO8A 3WNOA 3BOPA 1EAH1 1WW6A 3ZPYA 5FZ3A 4N90A 4XUNA 3LCPA 5FDBA 4BLJA 3OG2A 2Q8OA 3WD5A 5F5IA 3WQBA 2PAMA 1OPOA 3DL3A 1C28A 2ZAAA 2DU0A 2RR13 4ES9A 2G9FA 3HMYA 1LOCA 4UFKA 5EP9A 5FZ6A 1A8MA 3WOGA 5BNPB 4XEZA 1PMHX 2QQNA 4LQRA 1N1YA 2GMMA 2CL2A 4IL7A 1R1A2 2J1SA 5FYCA 4CDWC 3TWIA 5JR7B 4RS5C 3PNAA 2NMOA 1QU0A 4GH4B 2WIIB 5F6LB 1ZNPA 4RHV1 4EJRA 3EYPA 1XQNA 1SLCA 5F3EA 5L9BA 1H8VA 2QQMA 1VBB2 1XC6A 4A7ZA 2X5IA 3FHQA 1COV2 1NCRC 1ZYBA 4NROA 1WCKA 2Y6HA 2RDRA 4K8RB 3MV01 2BW8A 3D8CA 4LEJA 4YM1A 5C3PA 3I2FA 3OCPA 2WFPA 4E4SA 5J09A 4CRQA 3NV1A 1TMF3 1GNYA 2ZX1A 4FO9A 1UZZA 5FJKA 1VAMA 3HNYM 4AI2A 2WQZC 4BE3A 5JIUA 4Q27A 2JG8B 1JW6A 1DHKB 1K45A 2P6CA 2VM9A 4LMFA 4RQPB 1LOEA 1BXHA 5F5QA 3PUHA 1VBE3 2DCZA 1PGW1 1Q8PA 5LZ6A 3N36A 2O0OA 3O1VA 4QPWA 2ZX4A 4IV3B 2QQIA 2PHFA 2YY1A 2ZA9A 1KGYA 3OUIA 3K4DA 1UKGA 3M2MA 4MGZE 4QKNA 3E5UA 5L73A 4Q0VA 3W5NA 1UD1A 5EFUA 1X36A 1YI9A 4L99A 4N7UA 1ND2A 4GMP1 4TTGA 3NJYA 2B39A 4MLOA 1M06G 2GH8A 4A45A 5J98B 4AQTA 4XHBA 3WF1A 5C8WA 1LB2A 4IE4A 2J22A 4FXGB 2VZPA 1HIXA 4QX0A 1IKPA 5AFBA 2R061 2ZGTA 4Q4V3 1PZ7A 4Q0QA 2Y26A 4AEDA 1RTVA 2WO2A 3N7LA 4XQWA 3CZUA 4ISRA 5GLTA 1RINA 3E5XA 4H14A 1DQ2A 3KF5A 1UKRA 1WA4A 4CCLA 3ILRA 3VBUC 1J3RA 2A71A 2JKBA 4GJYA 3I54A 3VD7A 1A34A 4QPIA 1UU6A 2C24A 5FLJA 5IYYA 1QJU1 3I2KA 4K20A 5J36A 3F95A 1YC61 1LGCA 1W99A 4EN0A 2IWGB 2ZZQA 3K75B 2BWAA 4N43A 4ORFA 2GC3A 3QH6A 3MO4A 4XF3A 3OF1A 3GF6A 4XFCA 5FMCA 3WQ0A 2VOXA 2FD8A 4EE2A 3QCWA 5C3OA 2WSVA 3UGFA 3VHRA 5I0RA 4H3WA 4GWNA 4QX1A 4GAZA 3E5QA 1QH7A 3HT2A 1AL22 1H1AA 5IATA 3VZMA 4MSVA 3OUJA 4MYEA 4MUVA 3AXDA 1W0OA 2PQQA 5DZEA 5FZFA 4NRQA 2R0FA 4Y5TA 3T08A 3WW4A 3ZFEA 1CX1A 5L7OB 2DF7A 5FRAA 2ZMKA 3MYXA 4XF0A 4YW7A 1O3SA 1UN1A 2X09A 2X29A 5CB7A 4FTEA 1BLZA 1KDKA 4CCOA 4PCRA 1SDDB 1URXA 3LFMA 3V56A 2X5IC 4XMIA 5EQUA 4DUVA 1DG6A 1QJY3 3HN3A 2V5YA 2R16A 1KFXL 1MEC3 2V09A 3J7NA 5FIXA 3WEZA 5F7UA 3GCXA 1DQ1A 2IC1A 2RR11 3THDA 5FYVA 4RHV2 2RMU3 3O14A 1O7FA 2DDUA 4FFIA 3I59B 2Z79A 4OI2A 1CPNA 3I2OA 1EYBA 1MQTB 3S7IA 4EN7B 5I0DA 5FAXA 3O0XA 5FY1A 2XJVA 2J1AA 3MLLA 4QM9A 3SCHA 2D6OX 2HWC2 2CY6A 2CGPA 3AMPA 3WCSA 1OQDA 2BGOA 4L11A 1HXS3 3U1XA 1X8EA 3WW3A 3MBWA 5LCWL 2E31A 3ZX7A 3ZR5A 3NJZA 5A3WA 1OF4A 5C71A 2DWRA 1MVEA 4XILA 4AE2A 3RMXA 1W6OA 1QNWA 1W06A 5A3NA 5C9AA 1L3JA 2B7YA 2WNUB 3MW3A 5A7SA 2C6SA 4COZA 1JYWA 1GP4A 3N9NA 4YRDA 4AGRA 4CU7A 1WMXA 2MEV3 2VECA 3ZYJB 4LKEA 1BK1A 2YG0A 4WV8A 4D94A 1TMF1 2ATFA 1R083 1PGW2 3AZXA 1ND2C 1NXMA 2LROA 3VKOA 2XWBB 3WP5A 1W28A 4K1YA 4QWNA 3RZHA 4BA6A 5GZFA 2FDIA 2WFF2 1H2LA 1VJ2A 4YW3A 4MZUA 2BJSA 3UKTA 4YM3A 4M01A 5A6QA 1RUJ1 2ETEA 4HN0A 4AEDC 1Z7S3 2A6WA 2OZJA 2ES3A 4S2GA 1JYTA 4QX8A 4CCCA 2R32A 1UO9A 4R9BA 4QPIC 2YC2A 1IGOA 2VTFA 3ZXAC 4IEQA 2UU8A 2NPIA 3OBRA 4IE5A 5BNPA 1WKYA 2GN3A 2Q0AA 1NLSA 3CMGA 1YLLA 4XCBA 4HKWA 4YZ2A 2ADEA 2W1QA 4N43C 5FMOS 4GH4A 2E33A 2KXLA 4HK8A 4J1WA 2QQJA 3VLBB 4DPNA 2Z69A 4UFLA 3OBZA 5LY1A 4FTBA 1ZRCA 4META 2VMIA 5FPAA 1T2XA 3CNAA 4Q4V1 2ZX3A 1HB4A 2PHUA 3A4UA 1VR3A 4COYA 1AUYA 1QJU2 1W8WA 4YG3A 2P17A 5GLUA 3OGGA 5IK7A 1AR71 3VZNA 5FQ0B 5A3LA 1JZ4A 1XYOA 1VBA3 1YFWA 2FCUA 4HFSA 4D6RA 4MADA 1F35A 3OY8B 5JR2A 3V0AB 4JVAA 5JI7A 3ZFEC 4CCEA 2WT2A 5IW0A 4C8DA 1KFUL 2DYCA 1LKNA 4XZPA 1W05A 2XL9A 3HNBM 5C3QA 1KJLA 2PYTA 3AYCA 1XSRA 4QDQA 5EWSA 4I09A 1UY1A 1QHDA 4PLOA 5TSWA 5FZ4A 3TB0A 3TEYA 3T1MA 3MUY1 2JG8A 4LHKA 1F9KA 1JU3A 3SMHA 1NX9A 2DFBA 4MX3A 2OS2A 4QPGB 2D6MA 4ZZ5A 4HLTA 5IWFA 1LJ7A 1S2EA 2XMLA 3HAGA 2B46X 3ACLA 3OJBA 1POV1 2W46A 3ILFA 4QXHA 1K12A 5J48A 4LPLA 4IV3A 1YNAA 4QKBA 3RWKX 1QOTA 1TNFA 3MIGA 2ZGLA 2VNRA 4UF0B 5JZGB 4SBVA 2WZ8A 3KSCA 3H7YA 3QACA 3VD3A 4BXFA 3N4MA 2BUKA 4EV0A 1W0PA 5FZCA 2RR12 4HPKB 1PNGA 3KHBA 2FCTA 2PHXA 2VOVA 1DZTA 3OYWB 1E5HA 1ZA7A 4NE9A 5A80A 1ZRFA 1GLHA 1IQDC 2VNVA 4HOOA 1KEXA 4FPLA 5C9AC 2YXSA 1AXZA 1GNZA 1JYCA 5EXOA 2ZMLA 4UFJA 3W5MA 4JTNA 4DIQA 3RJ2X 1K42A 1DP0A 2RMU1 4P9IA 3WG3A 1GZTA 5CEHA 3I2DA 2XVLA 4U36A 3JB4C 3CL1A 2OIIA 4XIOA 5I91A 1ENRA 1QEXA 4ZHNA 5FZEA 3WUDA 1CONA 2TNFA 4IESA 2LW8A 1TEIA 2G1MA 1VBD1 4Z82A 1WLTA 1YFXA 2YFZA 3K51A 4BIFA 4DMIA 2XKPA 3WF3A 1LOAA 2Z42A 3QD6A 2QKDA 3K48A 1CAXB 2QVSB 5A32B 4DY3A 1TMF2 4MGTA 4BQWA 4PIZA 2PHWA 1RXFA 5D21A 1TVGA 4D0QA 2CV6A 1UAIA 3T2TA 3ZPOA 2D93A 2ZGQA 1VBE2 5BNPC 2BOIA 4YG0A 2EICA 3ZR6A 1DCSA 1RUH3 2QNKA 3D0SA 5DG2A 5KHIA 5CKNA 2PELA 1IG0A 4GH4C 5DQ0A 4PF5A 4CDXA 3H9AA 5A7PA 2YYOA 1H8TB 2O14A 2VOKA 3OUHA 4EWEA 4R4ZA 3ZYHA 1X9PA 1U5XA 1PO23 5C3RA 1REEA 3LPFA 4OMDA 5SV5A 2Q8EA 5HXVA 4YW5A 1QWRA 4BQ4A 2NMNA 2BFUS 5FLIA 1J83A 1Z7S1 3WQ1A 1WZXA 5DMYA 5DUXA 4UW3A 2G9GA 4GWMA 4B1MA 5LEJA 3MW2A 1YQ5A 3ES4A 2VMFA 3I59A 4EQVA 4IEWA 3I8TA 2WBKA 4Q4V2 2JDPA 5C70A 1W39A 1MQTA 4QGLA 4ITCA 1DGWA 1PGL1 1OXCA 3OEBA 4OI0A 4YARA 3BVCA 2YFUA 2JG8C 1AR72 1CGPA 4UBHA 5GLZA 4F3JA 2JG9B 3I97A 2ZEZA 4XFHA 1K5MB 2VUAA 3VBSB 4DS0A 1R091 4AAPA 1LR5A 4XF4A 2FZ2A 4LBNA 1CJDA 1MZFA 3FUQA 4LKFA 4TXWA 1CD3G 4YVWA 4CEYB 3AL5A 1CJPA 4BQ2A 1MS8A 4IV3C 4G4FA 1LGBA 2VZVA 3IT8A 1LHWA 1WD4A 3ATGA 4CPBA 5T5LA 2D43A 3AMMA 4TSVA 1V6KA 3RPQA 2VVEA 3K2OA 4JQRA 1OVPA 2X10A 3HNMA 4PBPA 4Q4X3 2ZGPA 4QQHA 1JYNA 3POYA 4IEXA 1GFF2 1V70A 3DN7A 5FZ1A 2MPFA 1OH3A 2A6ZA 2Y34A 3MPBA 5J37A 5D8AB 5DUUA 3B9CA 4ZS2A 1I5PA 3W58A 5EV7A 4Y22B 4GB33 1HRV3 3APBA 3WDWA 4E2QA 3E6CC 2K2SA 3GYDA 4DEVA 4LO6B 3BIWE 5HCAA 2D7FA 1YO8A 3ETQA 3NJVA 3VDDB 3RI8A 4GIQA 3VHOA 1SEFA 4YW4A 3UV9A 5A6ZA 2HWB3 5FMDA 3ZKUA 2Y6JA 3BODA 1AYM1 2GMPA 2OX0A 2NLRA 4R4XA 3LIHA 4ZONA 4QX3A 3O1MA 4AQ2A 1GKBA 1QJY2 2WL1A 2ZX2A 2RE9A 5T55A 2ZEXA 4U2AA 1SFPA 1MEC2 1S0CA 1S0GA 1EV13 3LIGA 4Q0UA 3SCGA 1WCUA 2RMU2 1Y9GA 4NWWA 1V6MA 3N9QA 1AYN1 1UZ0A 3WUCA 5JPMB 3ZXJA 1PM7A 1CQ9A 5K8SA 1H2KA 2ZACA 1AF9A 1PM4A 1POQA 1V6NA 2L9LA 4Q4W3 1JMUB 1KQRA 1O4YA 3DUIA 5E16A 1C5IA 1ZZBA 1LHUA 3V64A 2ARBA 1QXRA 5EHDA 4BM8A 1XNDA 4BMBA 1WA6X 1SPPB 3OOXA 5DAWA 1Y9MA 1HXS2 5FQ0A 1XJAA 2YROA 3V0AA 4GKYA 1YYNA 2BDRA 3VBOB 1H4GA 2Y6GA 5FZMA 2VZSA 3CZJA 1VRBA 4CDXC 4DNYA 4E4HA 5L7OC 1MS4A 1CR7A 3ALQA 1HRI1 2AZ5A 2D3SA 1BMV2 3JZVA 4KWUA 2MEV2 5JXGA 3WP3A 2AUYA 2SBAA 3C7OA 1R082 3J7MA 3ST7A 4OI1A 3CF6E 3NNFA 4I01A 3AM2A 5JAXA 2JE8A 4UOJA 1Y43B 4QKFA 4ZXKA 4FAHA 5ISLA 4DXSA 3MIHA 4IXLA 3I2GA 1DLLA 4Q1PA 1IS4A 4KGGA 1RUH1 2W1UA 1MQTC 4UF0A 2WYSA 5JZGA 5M0TA 4M0NA 4QX7A 4YW2A 2IVIB 3URFA 2YMZA 1Z7S2 3N9PA 3ZDVA 5FY4A 2R073 3POGA 2WWSA 4OUEA 1Q8OA 4HPKA 3SNMA 2G9ZA 4EROA 1L7RA 4JDOA 1KITA 3VZOA 3OYWA 4YVWC 3TN93 2ARCA 5FY9A 5FYBA 3SEPA 1PHMA 3GM8A 1LULA 1PGL2 4XUOA 1JOJA 3O1TA 4MG2A 1UZWA 4XZUG 4FVVA 1PVC3 3VKMA 3OD4A 1K3IA 1XE8A 3POFA 1SLLA 1GP6A 3AYDA 1R092 1WWYA 4LK7A 4KBBA 1SG3A 3LDRA 4IEVA 5DUWA 3O1UA 1PX3A 2C26A 5I0UA 5F5CA 3ZFFB 4Q8LA 1VBA2 4Y3OA 1JHNA 4OUSA 3N9MA 1AXKA 1ZZCA 5I0SA 2JDYA 2YGLA 5HBAA 4BQXA 5A32A 1NCQA 2DCTA 1D0GA 4UAPA 1JYXA 3UYJA 5HCHA 1W9YA 3D5OA 4JCKA 1G86A 3WDUA 1QJEA 1X9TA 1W8OA 2VZRA 5D1IA 3FMGA 1G9FA 3GXUA 1FPN3 1WLDA 4IGPA 3NV4A 5JI9A 5A3TA 4Q4X1 2LALA 1UPIA 2EXHA 1ZBA3 2R0HA 1DYPA 2A6XA 2YBKA 5FKCA 5GKAC 2WRAA 3OGSA 3POWA 2F4LA 4IEUA 4GB31 1HRV1 1LNSA 3LDBA 2JD9A 4LIUA 4OCTA 4GWJA 1XYPA 4KG0A 4LBLA 4URAA 3AKRA 5CYYA 2OQ6A 4LO4B 3FHAA 1TQ5A 4Q1RA 1R1A1 3MW4A 4I30A 2WA3A 4FPHA 3VKFC 4C91A 2ZOEB 4WM7B 1Q8SA 4XTMA 2IXHA 5BY5A 3MDPA 5IAXA 5APAA 4XJ9A 4E9KA 3SH5A 5ABJB 1AVBA 2J1UA 1W2TA 4HONA 1GOFA 1TME3 1IS5A 3ZXKA 5CFCC 3VL8A 1XE0A 3VKLA 5IVCA 2W94A 4A44A 4YLZA 1RITA 2QE3A 2XG3A 4QXBA 3T0AA 1PO13 1CWPA 2JG9A 1K5MA 3VBSA 3AZZA 3MLKA 3U14A 5A1LA 3MHZA 4A7KA 5A33B 5FZAA 4K8FA 1DIWA 5T5OA 2ADDA 2CSGA 2N7GA 4MXWB 3THPA 4LO5B 1Y9QA 4JTOA 4CP9B 3ZM8A 3MICA 2HBTA 3LEKA 5B4XA 3UNPA 1NOVA 1MZ6A 4PLNA 4FBFA 5JZGC 3N7MA 4C0HA 3AP5A 2J1VA 4XJAA 3AVSA 4LBQD 2R043 5JOXA 4MHUA 4JAAA 4JKKA 5LA1A 1OPMA 4LHLA 3B01A 1VB2A 1TNRA 4IGOA 3KT7A 4OHVA 5T54A 5C8CA 4LUKA 1RUH2 3GZEA 1MS1A 1OF3A 4Y22A 4E4DX 1H4HA 3HD8B 3O5SA 1KRIA 3J7LA 4LBOA 3QOPA 4LORA 5KXEA 4FQZA 1W90A 2OPWA 1PO22 3EJKA 1GOGA 4XTPA 1W2NA 2JXAA 3ZIXA 2EXKA 3A7QA 4B4PA 5FOBB 1RUI3 4QB2A 5L9VA 2JDMA 4Y4RA 1ALYA 3VBFB 2UYAA 1B09A 1GSLA 1RUF1 1OD3A 1RGSA 5FMOL 2G19A 4QX5A 5FYSA 3RYKA 4DZGA 3AB0A 1X82A 2BGPA 1RVF3 3BTXA 5LA9A 1I3HA 4G3YC 4LITA 1YI7A 2A5ZA 2VE1A 4FPGA 3TN91 4GQ7A 5C3SA 2VMEA 1NCQC 4RGGA 5FREA 5IAVA 1UY2A 1OLQA 1BHGA 1V9U1 2YU1A 1W9SA 1PVC1 3L2YA 1SACA 1MZEA 4EN8B 1J58A 3B7MA 3O1RA 1T6GC 1YFYA 4KMQA 3FL7A 1NZCA 2WT0A 4NPMA 1SPPA 1LESA 3C8XA 4DOUA 1HB3A 4XFIA 5FPUA 1VALA 1STMA 1UZVA 2DFCA 4LHSA 4XJ8A 4LTAA 1QY4A 3VBOA 3HN1A 3JCIA 4M3CF 2K9ZA 4NR1A 4AFBA 1S0JA 4HBNA 1AR83 2RM23 5CFDB 4YW6A 2EIBA 2IXIA 2ZGSA 4JGZB 2XUEA 5T5PA 1BVVA 4K40A 1S0FA 1OOPB 3DPRB 1ASJ3 4Q4X2 3SC7X 5FYHA 3USUA 5K9YA 1OMIA 5A7OA 4FAGA 3GHMA 5GLVA 2AACA 2QFEA 5FY5A 1MS3A 2D6NA 3CDZB 3USSA 3WDTA 2R1BA 4A42A 4AHXA 5T52A 2XOMA 1EP0A 1QDCA 2E53A 4NJ4A 4QHOA 1FPN1 1HRV2 1FT9A 2D98A 4GB32 1JZ7A 4ASMB 2W91A 3PMSA 4XUQA 2X53S 4O9EA 4COVA 1ZBA1 4HSLA 4WM8B 1YWKA 4GJZA 1QDOA 3TNPB 1JOBA 2EVXA 1W8HA 2HWB2 3B69A 4OVEA 4Y20B 4KG8A 3SH3A 5L19A 1REFA 5JXIA 4ISQA 3ZYIB 2JG9C 2Y60A 3B3QE 1K5MC 3VBSC 1OFNA 4E8CA 3ZN4A 2D3RA 1EV12 5CAZA 3VN4A 2AEYA 1Q56A 2ZS6B 1RJ8A 3CQOA 3M70A 4XOGA 3DYMA 2HWC1 5JCTA 3RGBA 3BN6A 4WBBA 3WNXA 2VZQA 3DYPA 4Q4W2 2VW2A 3N35A 1TME1 2GDFA 2GP5A 4NMIA 3VKNA 2I45A 2PQSA 3ZFFA 4BHPA 1HN1A 1ZRRA 5C8CC 4YZ5A 1Q43A 2CU5A 3ZXLA 3WF0A 4LKSA 2VTXJ 3ZSKA 4CDUB 3V0BB 4P9GA 1AJKA 4R9CA 3NKTA 1DQ4A 3LD8A 4QQOA 2PFWA 3VUOA 3DXTA 3WG2A 4JC1A 2EIGA 5L9RA 2BNNA 1JYIA 5A7NA 4ATFA 1UIKA 4AGVA 1GWMA 5FP4A 3ZXDA 3IAPA 3H8UA 1V0AA 4Q4Y3 4P08A 4XUPA 2WFF1 2R041 2RDNA 3VD9A 1W9TA 4C1XA 4P9YA 2WKKA 1S0IA 2VL4A 4CP1A 4XQDA 5G05L 3AL6A 5IVFA 4EN6B 2W5FA 3EBRA 4INDA 4YZ1A 5KBFA 3RVHA 5JLVA 1BVP1 1D4VB 2P5BA 4AVAA 4AQ6A 4MXVA 2DVBA 4K6BA 1W6NB 5FPVA 3O0WA 1AR63 5FY0A 3VZKA 2BFUL 1AXYA 4CP0A 1NG0A 1RUF2 2R072 2O1QA 1K5JA 5AC91 4BQ5A 5FWJA 1QJZA 3ZMNA 1E5IA 1BBT3 2FDJA 1JI6A 1SHWB 1H2MA 1Y3TA 2A75A 3H3LA 5DAXA 3TN92 1QNYA 2H0BA 3BTYA 4W6WA 3VBOC 1SBDA 3OTFA 1O8SA 1KS5A 1V9U2 4QQLA 2B8MA 2CNAA 2XBO1 1PVC2 5ABJA 4FOQA 1YQ6A 1MVQA 3AZWA 4GD4A 2Q1FA 1YJLA 3VV1A 1RVF1 3FE5A 3FFQA 1U0AA 4A3ZA 4QM8A 1XNKA 3DYOA 4DRRA 1H9WA 1RMU3 1W2AX 2FBEA 3MIFA 3JD73 3FN9A 2BZDA 5A33A 3CLPA 3WV6A 3H8XA 1NLQA 1Y7BA 3HWJA 4MXWA 4HETA 3U75A 3H1MA 2XVGA 4P9JA 3M3QA 3I2IA 4CP9A 5FBZA 1YQ2A 3SKJE 1XPWA 4S2DA 1H1IA 4H7MA 4BMEA 3AC0A 3PJYA 4MO3M 1AR81 2RM21 2WWUA 4XURA 1FV3A 1YQCA 4GKXA 3SH4A 1FPN2 1RYYA 4LXLA 3BCWA 3RNSA 3WY6A 2VR4A 3J26N 1ASJ1 5I93A 3BU7A 4LIVA 1JH5A 3SQOA 5EIYB 2GSYA 1NA1B 1ZBA2 3N9LA 4EWDA 2H6CA 2Z4FA 3LFIA 3KS7A 4PQ9A 3I2JA 4QU2A 3J7HA 3S30A 5EJ3A 4BISA 1J3QA 4LO7A 1CIYA 2PHTA 1XXNA 2RS13 4IE7A 2ZHNA 4BB3A 1JOPA 3ORJA 1ENXA 3AX4A 2OW4A 2E7TA 2B9VA 3WHTA 1IKQA 3ZFFC 2C9KA 3FLRA 2DTWA 4F83A 1CVNA 3WDYA 3WR0A 3WLUA 2OQ7A 2QBXA 4AZZA 1JODA 4MV2A 2OT7A 1CX4A 3KM5A 3DKWA 1CAWA 2BERA 4ZU5A 1TME2 2OA2A 1G9BA 2WS93 4XDOA 1UOJA 2W9XA 3L2HA 5A6YA 4FFFA 3KB5A 1PO12 4RA0A 2DBIA 1LECA 4M3CB 1FMD3 2BPA2 3OSDA 2JDAA 1V6LA 1CPMA 3I2HA 1OQ1A 1WGPA 2CTVA 5BNQA 1HJFA 4MGKE 4UFMA 1ODMA 2ILMA 4XFBA 4IEYA 1QF3A 4Z2AA 3SCFA 2ZGOA 3MEPA 2C9AA 5GM0A 4DINB 2I07B 4A6SA 2QQUA 4A3XA 5CADA 2A73B 1VBE1 2R042 2Z2SB 4OUMA 5JVVA 5C6CA 1OOPA 3A0NA 3DPRA 2CAVA 2LS6A 2QJVA 4YGEA 2WWJA 1HQNA 5A7QA 5C4WB 2PHDA 1RL3A 4KGQA 5C5TA 2QDNA 2E51A 2PAEA 4Q4Y1 4BQ1A 4M4RA 1PZ9A 1DQ0A 3IIAA 5ABJC 5HCFA 3HQUA 4D6QA 5AC92 1FXZA 4HXCA 1S2BA 3I3BA 3ZN5A 2W3JA 3VZJA 2FDHA 4JGYB 1C3HA 3VL9A 2RV9A 3ZSMA 3GZAA 1C8M3 1RUI2 2ZCWA 1CZSA 1JS9A 3M3CA 2WO7A 3Q8CA 4AWDA 1CN1A 3KT4A 4DFSA 1BQPA 4ARYA 2XBO2 5KC5A 4HMZA 1PK6B 1LRHA 4CE8A 3THTA 4S2HA 1RVF2 3GCWA 2BWCA 2HWF3 3OBAA 1AL0G 2GC2A 2FMYA 2VOWA 1BEV3 3BB6A 2AC1A 1UY4A 2D5HA 5FO9B 5F37A 1YJKA 3VBRB 2ZGUA 1MS5A 4AFCA 4B4QA 2SLIA 3ECQA 4C0BA 1AR93 3DECA 4A7YA 4BK4A 2JE7A 3O12A 3ZDSA 3V0BA 3M7AA 4MGQA 4RQPA 4AHYA 1N3QA 3JD71 3OPZA 5J3UA 1VP6A 1SDWA 1DZQA 3BGAA 1DYKA 1AR82 1HLCA 1UWWA 4YM0A 2RM22 3TOJA 3ZYRA 3U0ZA 5CFCB 1WLWA 2QCSB 5GALA 3ZLIA 2GNTA 4YVSB 2OVUA 1OT5A 2Y8KA 1ASJ2 1LENA 4HN1A 4AK3A 5LBCA 4YFZA 3VBFC 3MF6A 4P02B 3VB9A 4NUBA 2VCAA 4LBQB 1LHVA 3ZFGB 4C90A 2Q30A 2VW0A 4AHWA 4WZCA 1U5ZA 2XONA 5DABA 1IHMA 4X8NA 1RHI3 3BPZA 5E1RA 4DY5A 1HB1A 1QJY1 1W6NA 4OULA 1R64A 1MEC1 4MOAA 5KXCA 1UYYA 2OUJA 3WW1A 4CXXA 1ULOA 2RS11 2KR2A 4DXZA 4M4PA 2UY9A 3IB3A 4P5YA 1JZ8A 2RJ2A 1ZBE3 3AZVA 1UZYA 3PTRB 1X50A 3RSJA 3SEEA 4AYUA 1TG7A 1UOBA 2Q4SA 1VIWB 2R49A 2JIJA 1RUG3 5EJ1B 3TNQA 4AI3A 4E2SA 4BDVB 4AI1A 4LK6A 1SBEA 3H50A 4ZS3A 1KXGA 5FP3A 1HXS1 1OOPC 3DPRC 2VNGA 3B9IA 1ULEA 4LHNA 1PNFA 4QGNA 2WS91 5EPAA 3AP9A 2Z5WA 4E27A 1ZA4A 3PUQA 1IPJA 1H30A 1REDA 2JECA 3AKTA 3HQRA 4XDPA 3ASIA 2Q1ZB 4AI9A 1SFYA 1BMV1 3OD0A 2MEV1 2GC1A 2WDBA 1S1AA 3FC0A 2E26A 1O3QA 4WM8C 1R081 2VQ0A 2A6VA 4GALA 3DCQA 3I7DA 4MVTA 4OLLA 1WW5A 4AVBA 5L7OA 2DUOA 3ACIA 4XBQA 3ROUA 2VZ1A 4D69A 1G6NA 5T3NA 3EXUA 3TBDA 4Q4Y2 5LWBA 1QIQA 1XOYA 1GZCA 1JN2P 2UWCA 3EMRA 4JX0A 4LR4A 4RR3B 4CVUA 3FUOA 5FZ9A 5E6HA 1UYXA 2C0ZA 1NA1A 5JOZA 1LU2A 1O59A 1V6IA 3GALA 3RZGA 1N1SA 1UU5A 2IXKA 4XETA 5GJ6A 1H9PA 3K4ZA 5LA0A 1F5FA 4L8QA 2VJXA 5T5JA 4XBLA 4FI9A 4Q0PA 2BQPA 2PXJA 3K3OA 4XJZA 4I0AA 1NYWA 3KT1A 1L7QA 3IBMA 4PDWB 5SV8A 1BBT2 3AP6A 2HBUA 3NNJA 4LKDA 2D6KA 1R1ZA 2YUEA 1D4M3 4QXKA 2A3WA 1ZRIA 4RQPC 1JUHA 3NAPB 2ID4A 4LNVA 3PUAA 5DDJ3 3D3AA 2HWE3 2ZZJA 1WMFA 2HWD3 2XDVA 5LK5A 1QQP3 3IZOA 3VDCA 3WG4A 1RIRA 1C1LA 3KV6A 2GH2A 2W08A 3NVCA 3ETPA 4R52A 1BEV1 1VBA1 4HT1T 5F32A 4AOCA 4FSJA 1W2UA 2WNUA 2WZEA 2YZ4A 1RMU2 1GWLA 4OHXA 3ZSLA 5A6XA 4M3CA 3K77A 2BP6A 3JD72 3K46A 1GU3A 3WXPA 4Q8KA 4JQTA 3POSA 2RDSA 4B8EA 4FT8A 4CDWB 4QB1A 1B35B 3G6JB 4XXAA 1C4RA 5K0UB 3FBYA 4YGDA 1DGWX 3MFCA 1EUUA 3THCA 2AGSA 2VU9A 3E97A 3M1HA 4D7SA 1W6PB 3P5BA 2ZX0A 2YHJA 2ET1A 1OLMA 2R30A 2K0GA 1V6JA 5DAVA 1EPWA 1RUC3 3Q9OA 5C4WA 5KC6A 1VE0A 3A23A 1RUD3 4ZXEA 1E5SA 1GZWB 2JICA 4ET7A 1DDLA 2YBPA 2R6QA 1E57A 5GZDA 1PMIA 2WNVB 2OUHA 2XQXA 1MPXA 4LLFA 3T30A 3IWZA 4ARXA 1VB4A 4LOSA 5JSPA 5FXXA 1U5IA 2RS12 5FJHA 3WT3A 1JU4A 2EAKA 1RHI1 1UPSA 4JGYA 3RI9A 4BLIA 2VZOA 4QX2A 3H1WA 3N9OA 2QUOA 3N7JA 4KU7A 4ASKA 4ASLA 4BQYA 3PVNA 4HG6B 5FP9A 5KXDA 3RMYA 2QQLA 4Y5SA 4IQPA 1E5RA 4GULA 3WX5A 3NL1A 3J9SA 4NPRA 1POV0 3MIEA 2AYHA 1ZBE1 2RG4A 1UF2C 1LGNA 2WO3A 2VZ3A 2A70A 3UL2A 3WG1A 2EALA 3PVEA 3BUCA 3OY8A 3UT0A 4AXOA 1ZX5A 1VBB3 2WS92 4EN9B 3VBRA 3PJQA 2FMDA 4DXTA 5A1FA 1G8WA 1HN0A 2W52A 2WLPA 1NUKA 1FOD3 4CUAA 1JHJA 1CIWA 1FMD2 1W8TA 5DPNA 3D0JA 4CYDA 1NA1C 5LW9A 1D7PM 2NZ9A 4LOTA 2OYZA 4AL9A 1VRH3 1BJQA 4QPGA 1BKZA 3WF2A 3KCXA 2JIGA 1UMIA 2ZMNA 5CFCA 4L0PA 2ZPXA 4OZOA 4YVSA 3KMHA 4ZU7A 2LTNA 2YC0A 4IE0A 1IQAA 2V72A 3I49A 5FXZA 2KM2A 4N7IA 2XPJA 4LBQA 4XJWA 1US3A 2DVGA 2GNDA 3ZOIA 1D2QA 4KWJA 5ACA3 3K3NA 2V4AA 1PO21 2YB7A 4XCAA 3VZLA 1DQ6A 2IUWA 2QDRA 3GZTB 3IPVB 4PHZA 4YFWA 2E6VA 4D7YA 1HV1A 5CIRA 2TEPA 2XB6C 3CEWA 3ZYGA 2XWJB 3N3HA 2WNUC 1C8M2 1WMEA 5H9QA 3H7JA 2WZR3 1DFQA 3KD4A 4FCAA 2VC9A 5DAQA 5I0TA 1OVSA 3LWCA 1YCIA 1QXPA 1QKQA 3KF3A 3LZZA 2Y0IA 1DGLA 2EF6A 1XBFA 1T6BX 4AVCA 4NHLA 2HWF2 3AMNA 4M3CE 2VMGA 4EZHA 1D4M1 2VVDA 3ITQA 3LKJA 1BEV2 3O1PA 2GZWA 2P2KA 5F6KA 5KHGA 3B93A 2J7MA 2BVVA 1D2SA 1CAVB 1A3KA 5H9PA 3SITA 5BPXA 3HT1A 1VMJA 2HWD1 5CVRA 4JDMA 4YG6A 1CAXA 1QQP1 4PIXA 3WINE 1AR92 1G9DA 1ZRDA 5C4WC 3KVAA 3ON7A 5H9SA 1DU3D 3RYPA 1KJRA 2BU9A 5ERLA 3BALA 3LOIA 3WNPA 1ZZ6A 3B5LB 1WW7A 3JXSA 1OLME 3OGJA 1PIV3 1LTEA 1DGRN 1CZTA 2E9QA 1UOGA 1H2NA 3M8LA 4XF1A 5FY7A 4NIGA 1FAYA 1UQXA 2VBBA 3CJIB 3HPNA 4JGYC 1A8DA 1DYOA 1RJ7A 1AL23 2A1XA 4UBGA 5I8YA 3IDBB 1H8TA 4W8JA 2CHHA 1EAH3 1UX7A 1QH6A 1O5LA 4H7LA 2GU9A 5BYNA 5JDBA 2V5DA 2HEWF 2VBDA 2W2IA 5F3GA 4D6SA 2VQUA 4OI4A 2W68A 2HWB1 2VZTA 2YC4A 1RUD1 2ZGNA 3JQWA 3LSEA 3M3OA 4CUBA 2XLGA 1FI2A 1RHI2 3FLTA 2UWBA 1AX1A 4S2FA 5FK8A 3VBRC 4AFAA 3PIJA 2B42B 1EV11 4LA3A 1OLRA 4RFT0 3KQRA 3DV8A 1Z0HA 3I3MA 1CZVA 2PA7A 2WAOA 2PHLA 4P9XA 4YYOA 4TZDA 2WJSA 5FUIA 1YRZA 2FDFA 1ZBE2 4BOWA 2ZXQA 3WSOA 5A1AA 2CGOA 1AJOA 3NAPA 2DVAA 1W3VA 2Q1MA 2WINB 4CCKA 3KVBA 4QPGC 4Q4W1 3OEAA 4W4ZA 4HSJA 1A6CA 4RL7A 4IV1B 4NIAA 4AF9A 2ORZA 3NNLA 4AEDB 2D6LX 1C8NA 3LA3A 4CEYA 4YVSC 4FPKA 5CG9A 5I8SA 3WHUA 3TEXA 2ARAA 3AYAA 4FPFA 2AENA 4PT6A 1JBCA 1S4CA 3DGTA 3GGLA 3AMQA 3OB8A 3HR9A 5F8PA 3MLJA 1N1VA 4I02A 4Z92B 1PVXA 1Q8VA 4FXKB 5F39A 1X7NA 1SLBA 4N43B 3JQXA 2RJLA 1B35A 4CEWB 1LHNA 5K4LA 4E2GA 1GYKA 5BXXA 5D8AA 2TBVA 4Z07A 1VRH1 3DXUA 2QZ2A 2YGMA 1UY0A 1W6PA 5KHJA 3VDDA 3ZN6B 3T4VA 1UY3A 2W47A 2DCJA 3OGRA 2Y33A 1GZWA 1WBFA 3ZXEA 4E8DA 2GN7A 2PHRA 3ZFEB 3W59A 5B4NA 1TE1B 2R071 2DUQA 4NRPA 5FUNA 3P3NA 4LE3A 3AJZA 4TN7A 3ZMOA 4FOWA 3TYJA 5JPNB 3HBKA 4XFAA 5IVBA 2A3YA 4FP3A 4CDQB 5BNNB 5F1RA 1UYPA 4XQ4A 2QQWA 4J6GA 3ZXGA 1SCSA 5FOJB 2R063 2X8KA 2NM1A 2YPDA 4JRAA 3C7FA 1D4M2 3AZYA 4WZFA 3KZ4C 5DDJ2 1DZRA 4KNCA 2UY8A 2B9UA 2HWE2 3ZIWA 2DVDA 2HWD2 1ODNA 5KR7A 1QQP2 4RGKA 1U12A 1N3OA 5D2AA 4P14A 1W8ZA 4JHTA 4JRLA 4XPVA 5CU1A 3KV5A 4BYYA 2VUJA 1H8TC 5KHKA 4I0BA 2VMHA 2V73A 2JE9A 1WCSA 4XMAA 5JIAA 2GMEA 4V1PA 1XNCA 4CA9A 5HCBA 4LLOA 3ENRA 4AI8A 2YV8A 3BU0A 3QBQA 5C9AB 2D5FA 4XVHA 1NKGA 1S55A 3MIDA 4D3WA 1W3XA 1JXNA 1QOSA 2ZHKA 3FLPA 4YM2A 4AI0A 1MS9A 4XFFA 1RUE3 2X05A 1V00A 2DVFA 2O8OA 1NY71 4EWAA 1FV2A 5FZIA 2EIDA 5FBJA 4XABA 4PIYA 3IN9A 1RUD2 2VQAA 3JB8A 2TUNA 3KGLA 2MNGA 4LA2A 4PI0A 3NAPC 5IVVA 2VCCA 2VGDA 1BYHA 2DV9A 3I3EA 2DCKA 2R7EB 3IPVA 4CEYC 5FZ8A 1DGRA 1SLIA 5J96B 2XXZA 2XUMA 1BCXA 1UL9A 1Z78A 5C5UA 2J1RA 4AFDA 3H42B 2VUDA 3D4KA 3INAA 2H6BA 3VGIA 1LAJA 1WCQA 5CA6A 5FYUA 5ANNA 2WN2A 3LEMA 4ZPIA 3RQ0A 3WNLA 1Q3EA 3OBTA 4N8MA 2D40A 2Q8CA 1HW5A 3RZZA 5A3PA 1B35C 2VBPA 5K0UC 1QXJA 2HEYF 4FTSA 3KLSA 4FFGA 5LASA 5D8AC 4Z8BA 1O4TA 2VOTA 4M0HA 1PO11 5IUQA 2XL7A 3WNKA 4O7XA 3H3ZA 4QAWA 1CAVA 4C1WA 1C1FA 3IAQA 4LBMA 2BVBA 4LO8A 3UK9A 3VDDC 5A3OA 2BBAA 2BEOA 4RN5A 1FOD2 3ELNA 4FPJA 2VUCA 4OHWA 3T2OA 3U10A 5LEKA 2FDKA 3JU9A 5BNOB 1F4AA 2G4IA 1SZBA 4QQPA 5KWRA 4QT6A 2QTWB 2WNVC 3N7KA 4LJHA 1ZZ7A 1W6MB 1VRH2 5C7GA 3X29B 3RJRA 3RRDA 4COWA 5LBFA 3CJIA 2ZKNA 3E6DA 4DEQA 1H0BA 4GXLA 1UXXX 2W87A 3FWEA 4QD2A 5J7MA 1ULGA 2P34A 2BV4A
chains in the Genus database with same CATH topology
4IEPA 1AHSA 3AFKA 1VBC3 4AVSA 1GNHA 5EYYA 2PN5A 3R05A 2WA4A 1RUJ3 5ACA2 2JD4A 4YZ3A 5GZCA 4YNIA 4Y1XA 5FO8B 2GALA 1RUI1 1X8MA 4WM7A 1N3PA 4OHYA 4Y24A 2DTYA 4OHZA 1OKQA 1QOOA 1J59A 3SLIA 1I5ZA 4B7KA 2WZR2 4I3GA 4W6YA 3GBFA 4Y26A 3EO6A 4AHZA 1S0BA 4W65A 3H1YA 5FTTC 4KWLA 2LM3A 3PTYA 4AQSA 4IV1A 1WCDJ 4WVVA 1AR73 4UW5A 4SLIA 3CU7A 3BOWA 1FX5A 1NXD1 2B5HA 2HJIA 1IS3A 3UJOA 2A7AA 4NHKA 3PMEA 2XH6A 2HYKA 4CEWA 1F2NA 1PIV2 4RSUA 2WZPP 2OZ6A 1N47A 3QLQA 2ZGMA 1O3RA 1NY72 3R6SA 1OSGA 1QMJA 4TWTA 1APNA 5CG8A 1IOAA 1POV3 1RC6A 3ZN6A 1GQGA 1RUE1 1EAH2 2RS33 2WC2A 2P37A 5AVPA 5JSOA 4FPOB 2P3KA 4N9HA 5EYXA 4OZXA 2ZAHA 3VBFA 4CDXB 4K7JA 1UW8A 3LGRA 4HL0A 1ULCA 1GANA 1ENQA 1U5YA 4XW3A 2P3JA 3GBWA 2DURA 3J8F3 5E89A 2CAUA 2DU1A 3LA2A 2VH9A 4CDQA 5BNNA 2ET7A 3AP7A 2XLAA 4HVRA 5AFEA 2C5DA 3EHKA 1DF0A 4K21A 4AEJA 1GZ9A 2RS53 2D3PA 2F6BA 5DZGA 2XJRA 2ZJCA 3M4FA 1HDKA 3CJIC 4KWKA 5IK8A 4BH9A 3B02A 4NWVA 3SISA 4WVMB 4OFGA 2E63A 1VBD3 4WVZA 4CP2A 5CFDA 2VVFA 4JGZA 2DCYA 4YVWB 5FCCA 5E8AA 4L2NA 3WP4A 4B7EA 1RUNA 1ZREA 4MGYE 1SLTA 4WM7C 2E7AA 1RB8G 3MGUA 2EA7A 1UMZA 1HQWA 4KL1A 1NLRA 4WM8A 2I2SA 3RYRA 2VY0A 4CZSA 2XHKA 3M3EA 4P9LA 4Y20A 5DXDA 4TLFA 4LBJA 5BV6A 2YDEA 2XLFA 3VHNA 3IKWA 1VBC1 2XGXA 1AR61 3LOBA 1VLNA 4XXPA 4IV1C 2NQYA 2UURA 2FZ1A 3RWNA 4Y5Z0 3CJXA 1BBT1 3AP4A 2ZHMA 2Y38A 5BUVA 2BNOA 3RS6A 2D44A 2XJQA 3IDCB 2R062 1LOFA 1S2KA 4JV4A 2ZTNA 1Q5OA 2VXRA 4Y1UA 4CEWC 1OA4A 1ULFA 2JDZA 4GMP0 4LE4A 4F7ZA 2QZ3A 4CDUA 5B2GB 1RMU1 2AH2A 3WZ1A 1FYUA 3MIBA 5I0SA 4R8HA 2A6YA 1R093 2FQPA 2WQ4A 3WDVA 1OD5A 2WLQA 4NVPA 4MGIE 4HKOA 1AX0A 1C57A 2HKXA 5FLHA 2WNEA 3U11A 1YHFA 5BNOA 3AXEA 4K3UA 4IERA 3QH7A 1I9RA 2IZWA 4XFGA 3M3IA 1O3TA 3HQXA 1W6MA 2WT1A 2WSUA 3AKSA 1O91A 1I6XA 3GNEA 1CAUB 2BTVC 3IMNA 4AEMA 1MACA 1OQEA 1J1TA 2P3IA 4ZKTB 1RUE2 3FHIB 1GR3A 1W6QB 3C2UA 3ZSEA 5BNNC 4CDQC 3ES1A 2XJUA 3NSTA 3VBHB 1YIFA 4LUMA 1SMVA 1GV9A 4IETA 4AW7A 1OA2A 2RS31 4QGMA 1AYM3 3MFAA 4Y1YA 2ZGRA 2JX9A 3EQEA 3JBG3 4HANA 1OA3A 2EXJA 3O0VA 2O8QA 2XJPA 4N53B 3O7OA 1XE7A 1F8VA 1VAKA 2B45X 2D97A 5CFDC 4JGZC 5LRSA 3J8F1 2PLV3 1AYN3 5A3MA 1LHOA 2H0VA 4Z2WA 4QMAA 3S6PA 3CO2A 5FPXA 3AYEA 1FMD1 1AZDA 2RS51 4XYXA 2IXLA 4ZU4A 4PJYA 3B94A 3W9AA 2IXJA 1QJX3 4P5HA 3H3UA 1V6OA 2CGNA 1HRI3 4FOYA 4NHMA 4X8PA 2ZHLA 4RD7A 3B00A 1OI6A 1NCQB 4YGCA 2CWSA 2R1DA 4KH9A 2GNMA 2KA3A 2RJKA 1ND3B 5H9RA 1HKDA 5DZFA 4XE9A 4Y1ZA 3TRSB 4ONUA 1VBC2 4Y4YA 1AR62 1LOFC 3S7EA 4DQAA 3WVJA 1RUJ2 4AEKA 1Q8QA 2ERFA 4BPZA 4AFMA 2OPKA 4BWOA 1IS6A 2JENA 4YZ4A 1KDMA 5FFOC 3D82A 4CDUC 3R4SA 1C8M1 4W6XA 4N9IA 3P3PA 2IFRA 1M4WA 1KD7A 1G7YA 1FATA 5BNOC 3MPPG 3AK0A 1S0EA 2BNMA 2HWF1 4Q0SA 1NQDA 4YSFA 1WW4A 4G9SB 2Y0OA 4KQ7A 1YXWA 2AREA 3PLQA 5I8TA 5LK7B 3S0MA 1A78A 1O5UA 4XBNA 4GA9A 1QGLA 4XF9A 1AR91 3FBMA 1G9AA 4L92A 5EZWA 5GZEA 4RS5B 3AJYA 4XJUA 3AKQA 4WVMA 4P9WA 3ZXFA 2GC0A 5F9TA 2XJSA 1LU1A 1UU4A 2I74A 5IT6A 4RGAA 1GICA 3RG0A 3U4XA 2PTMA 3ZSJA 1NCRB 4QQ2A 4I2OA 2XJTA 4X6RB 5CNAA 3BTAA 4Z1VA 3NV2A 4HK9A 1JUIA 4NO4A 3UKNA 4NOTA 4F8AA 1ZZ8A 4B3NA 2RS32 4LT5A 4UW4A 4LULA 3R0RA 4PLMA 5C8CB 1NE6A 2IFWA 4Q29A 2CWMA 4JDNA 4AVVA 3IDEA 4CTEA 2BYVE 2FHRA 5KXBA 2VULA 4AG4A 1R1A3 2UWAA 1PK6A 3FZ3A 3R4UA 2ZABA 3J8F2 1OHFA 3GZUC 3JBG1 3T1LA 1GQHA 3SHRA 4BCUA 4IEOA 1XRUA 5FO7B 4A2UA 5JWPA 3AFGA 3MZHA 1RUG1 2XVKA 4Q2FA 1COV3 3LAGA 2PLV1 5IK4A 2RS52 2ZBJA 1NE4A 2QQPA 1J1LA 3ME2A 1MS0A 1FNYA 2VPVA 3PVOA 3WW2A 5AVAA 1VBD2 1ONAA 4D7TA 1LEMA 1BZWA 4K9SA 1EPZA 4HKLA 1MR5A 3C3VA 3NKGA 1SCRA 2VNOA 3PHMA 2W0XA 1F5JA 1QJX1 3VBUB 3KCCA 2W39A 3WDXA 4URTA 1O4ZA 2JJ6A 1CAUA 4YW1A 3ZFGA 3U07A 3GHNA 2BBVA 3USUB 1NQJA 1W6QA 3MF9A 2MHFA 3AKPA 2A3XA 5CBLA 3JUUA 1RUOA 3VBHA 3G7DA 4IEZA 1DBNA 1DQ5A 1SLAA 4FPYA 3ILNA 4NN0A 3FJSA 2C1FA 1ZM1A 5JSRA 1JTZX 3ZYPA 4N53A 1RUF3 4Y1VA 2DUPA 2PAKA 1XYNA 2JEMA 3DF0A 3L9JT 3PVBB 4AGGA 5DDJ1 1F31A 2HWE1 5IK5A 4I0WB 4FOVA 1S0DA 2X5IB 1V9U3 3I4IA 4L97A 1PGSA 4ATEA 5HI0A 2EAAA 3V65A 4O9GA 2YPJA 4XHXA 4BIOA 3LSDA 3HIFA 3ZVXA 2IXCA 4FP2A 2GAUA 3D6EA 5KHHA 1X33A 2D6PA 4E4ZA 3MI8A 1LODA 2RHPA 4RR3A 4YGBA 4DRVA 5L36A 1PK6C 4R9AA 3FX3A 5GLWA 1RUC1 1ND3A 4XIKA 4PBOA 5E88A 1PZ8A 1WUVA 1YIPA 2HEVF 1WLCA 3ZO0B 5JOYA 2E7QA 1SQ4A 4AVTA 3HBZA 1MZ5A 1ND2B 1YUDA 4PDWA 2NYYA 3KCYA 1G9CA 1AYM2 1XNBA 3JBG2 4B29A 4TYSA 4RHV3 5C33A 4HZFA 3RDIA 2ZGKA 1ULDA 4B4RA 4X6QB 1RUG2 1ENSA 1HQLA 1WMDA 2VW1A 5DG1A 1SFNA 2PLV2 1AYN2 3WQ7A 1N1TA 3H0OA 3KGZA 1LEDA 3WCRA 2HWC3 5LRRA 2NN8A 1AX2A 1C5HA 4QPIB 1VBB1 2ENRA 1J3PA 5JMCA 3NWKA 4L9BA 3ZFGC 3SXWA 1COV1 1FOD1 5FPZA 4CDWA 1SBFA 3LA7A 4RS5A 5K0UA 1IZ3A 2EXIA 3LB9A 1GBGA 2GNBA 2F4PA 1CESA 1QJX2 2CYFA 4COUA 3E6BA 5GZGA 3VBHC 5T50A 3UJQA 1HRI2 4H55A 1NCRA 1OFSA 2AR6A 2ZKLA 3AMHA 2NP0A 4FQ4A 1UCXA 5DUVA 1XU2A 4J1XA 4BZ4A 4I3PA 2LUWA 2WFF3 4N53C 2WNVA 4KU8A 1I1EA 1UX6A 1HV0A 5ACA1 4HVOA 4GMP3 4HVQA 1KS4A 3NW4A 4FPCA 3IM0A 4DB5A 2UYBA 3WP6A 3VHPA 2XKOA 1H1MA 1FNZA 4Q26A 5JOWA 3TAYA 5AC93 4LBKA 1ZZ9A 2WZR1 2VG9A 4WVWA 1EY2A 2ARXA 1HX6A 1LCLA 3UKVA 1ZVFA 4ES8A 1VAVA 5K7PA 2XBO3 4K1ZA 1QJU3 4UW6A 4XDQA 4M00A 4UXAA 4RR3C 1WD3A 1CAWB 3GBGA 1IPKA 3A0KA 1ND3C 4MH0E 1W6OB 2BGCA 1LOBA 3NV3A 1XU1A 3R4DB 2Q5TA 4QHBA 1D0HA 3FFZA 4R9DA 1PIV1 3J4UH 1UIJA 1YFUA 3VBUA 1WBLA 4QPYA 4PDWC 1RUC2 1LOGA 4FPEA 1AL21 3NO8A 3BOPA 1EAH1 1WW6A 3ZPYA 4N90A 3LCPA 5FDBA 4BLJA 2Q8OA 3WD5A 2PAMA 1OPOA 3DL3A 1C28A 2ZAAA 2DU0A 2RR13 4ES9A 2G9FA 3HMYA 1LOCA 1A8MA 3WOGA 5BNPB 4XEZA 1N1YA 2GMMA 2CL2A 4IL7A 1R1A2 4CDWC 3TWIA 5JR7B 4RS5C 3PNAA 2NMOA 1QU0A 4GH4B 2WIIB 5F6LB 1ZNPA 4RHV1 4EJRA 1XQNA 1SLCA 1H8VA 1VBB2 4A7ZA 2X5IA 1COV2 1NCRC 1ZYBA 1WCKA 2BW8A 3D8CA 4LEJA 4YM1A 3OCPA 2WFPA 4E4SA 5J09A 4CRQA 3NV1A 1TMF3 4FO9A 2ZX1A 1UZZA 1VAMA 4AI2A 2WQZC 4BE3A 5JIUA 4Q27A 2JG8B 1JW6A 1DHKB 4RQPB 1LOEA 1BXHA 5F5QA 1VBE3 2DCZA 1PGW1 1Q8PA 3N36A 2O0OA 2ZX4A 4IV3B 2PHFA 2YY1A 2ZA9A 4MGZE 1UKGA 3M2MA 3E5UA 5L73A 4Q0VA 1UD1A 5EFUA 1X36A 1YI9A 4L99A 4N7UA 1ND2A 4GMP1 4MLOA 2B39A 1M06G 2GH8A 5J98B 4AQTA 4XHBA 5C8WA 1LB2A 4FXGB 1HIXA 5AFBA 1IKPA 2R061 2ZGTA 4Q4V3 1PZ7A 4Q0QA 2Y26A 4AEDA 1RTVA 3N7LA 4XQWA 4ISRA 5GLTA 1RINA 3E5XA 4H14A 1DQ2A 1UKRA 1WA4A 3ILRA 3VBUC 1J3RA 2A71A 2JKBA 3I54A 4QPIA 1UU6A 5FLJA 1QJU1 4K20A 5J36A 1LGCA 4EN0A 2IWGB 2ZZQA 2BWAA 4N43A 4ORFA 2GC3A 3QH6A 4XF3A 3OF1A 3GF6A 4XFCA 3WQ0A 2VOXA 3QCWA 2WSVA 3VHRA 5I0RA 4H3WA 4GWNA 3E5QA 1QH7A 3HT2A 1AL22 1H1AA 3VZMA 4MSVA 4MYEA 4MUVA 3AXDA 1W0OA 2PQQA 5DZEA 2R0FA 3WW4A 3ZFEA 5L7OB 2DF7A 5FRAA 2ZMKA 3MYXA 4XF0A 1O3SA 1UN1A 2X29A 5CB7A 4FTEA 1KDKA 4PCRA 1URXA 3V56A 2X5IC 4XMIA 1DG6A 1QJY3 2V5YA 2R16A 1KFXL 1MEC3 2V09A 1DQ1A 2IC1A 2RR11 4RHV2 2RMU3 3O14A 1O7FA 3I59B 2Z79A 4OI2A 1CPNA 1EYBA 1MQTB 3S7IA 4EN7B 5FAXA 3O0XA 2XJVA 3MLLA 4QM9A 3SCHA 2D6OX 2HWC2 2CY6A 2CGPA 3AMPA 3WCSA 1OQDA 4L11A 1HXS3 1X8EA 3WW3A 3ZX7A 3NJZA 2DWRA 1MVEA 4XILA 4AE2A 3RMXA 1W6OA 1QNWA 5C9AA 1L3JA 2B7YA 2WNUB 3MW3A 4COZA 4YRDA 4AGRA 2MEV3 2VECA 3ZYJB 1BK1A 4WV8A 4D94A 1TMF1 2ATFA 1R083 1PGW2 3AZXA 1ND2C 1NXMA 3VKOA 2XWBB 3WP5A 4K1YA 4BA6A 5GZFA 2WFF2 1H2LA 1VJ2A 4YW3A 4MZUA 3UKTA 4YM3A 4M01A 1RUJ1 2ETEA 4HN0A 4AEDC 1Z7S3 2A6WA 2OZJA 2ES3A 4S2GA 2R32A 4R9BA 4QPIC 1IGOA 3ZXAC 4IEQA 2UU8A 2NPIA 3OBRA 5BNPA 2GN3A 2Q0AA 1NLSA 1YLLA 4HKWA 4YZ2A 4N43C 5FMOS 4GH4A 2KXLA 4HK8A 4J1WA 3VLBB 4DPNA 2Z69A 4FTBA 1ZRCA 4META 2VMIA 3CNAA 4Q4V1 2ZX3A 3A4UA 2PHUA 1VR3A 4COYA 1AUYA 1QJU2 4YG3A 2P17A 5GLUA 3OGGA 5IK7A 1AR71 3VZNA 5FQ0B 5A3LA 1XYOA 1VBA3 1YFWA 4HFSA 3V0AB 3OY8B 4JVAA 5JI7A 3ZFEC 2WT2A 1KFUL 2DYCA 1LKNA 4XZPA 2XL9A 1KJLA 2PYTA 3AYCA 5EWSA 4I09A 1QHDA 4PLOA 5TSWA 3TB0A 3T1MA 2JG8A 4LHKA 1F9KA 3SMHA 2DFBA 4MX3A 4QPGB 2D6MA 4HLTA 1LJ7A 3HAGA 2B46X 3ACLA 3OJBA 1POV1 3ILFA 5J48A 4IV3A 1YNAA 1QOTA 1TNFA 3MIGA 2ZGLA 2VNRA 5JZGB 4SBVA 3KSCA 3H7YA