3M1HA

Crystal structure analysis of the k3 cleaved adhesin domain of lys-gingipain (kgp) from porphyromonas gingivalis w83
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
176
structure length
174
Chain Sequence
AEVLNEDFENGIPASWKTIDADGDGNNWTTTPPPGGSSFAGHNSAICVSSASYINFEGPQNPDNYLVTPELSLPGGGTLTFWVCAQDANYASEHYAVYASSTGNDASNFANALLEEVLTAKTVVPEAIRGTRAQGTWYQKTVQLPAGTKYVAFRHFGCTDFFWINLDDVVITSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell invasion
molecule keywords Lysine specific cysteine protease
publication title The modular structure of haemagglutinin/adhesin regions in gingipains of Porphyromonas gingivalis.
pubmed doi rcsb
source organism Porphyromonas gingivalis
total genus 42
structure length 174
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.47: Gingipain K.
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07675 Cleaved_Adhesin Cleaved Adhesin Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m1hA00
3BOPA 4HANA 3ZYPA 1QDCA 2P3JA 3MPPG 1MS9A 3ENRA 1UZYA 3A0KA 5E8AA 5F5QA 1D0HA 3AX4A 1ENQA 4XIOA 2GMEA 5JOXA 2PELA 4YW4A 1LHNA 1U0AA 2OUHA 4PBPA 1WLCA 3GALA 1F5FA 2JE9A 4LBMA 1BYHA 2GN7A 1LOBA 1GV9A 2H0BA 1AX0A 3V64A 1SLBA 1KDMA 3SH3A 1MZ5A 5T5JA 3SNMA 4XE9A 1W0PA 4C1WA 4Y22A 4YM2A 5GZEA 5T5PA 1WCSA 2WJSA 2DTYA 2ENRA 2WT2A 1W6NB 2DVBA 4FPGA 3VV1A 4KBBA 3QCWA 3ZXEA 1UN1A 4YFWA 4UW6A 1A3KA 2V73A 3AP9A 1JYIA 1BKZA 2ZGUA 4YM3A 1SCSA 4Y1YA 2AGSA 4GKXA 4CZSA 1N1SA 1APNA 1UAIA 2WNEA 5GZDA 4NO4A 3V0BB 1MR5A 3GNEA 4U2AA 2ZGNA 1PZ7A 3POWA 1F9KA 4AVSA 1S0JA 3WLUA 3M3EA 4GA9A 5GJ6A 1ENSA 3WUCA 4FPYA 3PJQA 4AGVA 4IQPA 4YW3A 1AXZA 2A3YA 3WG1A 1DYPA 2E7TA 2RHPA 2WT0A 1S0GA 1S0CA 1AX2A 1LU1A 2ZMNA 1LHUA 4XILA 3MW4A 1FV2A 1LOGA 4M3CB 4YZ2A 1LGBA 3UJQA 1ZM1A 2ZHLA 3D5OA 3NV1A 1GYKA 5DZFA 1QMJA 4LBQD 5H9QA 2W39A 2WSVA 4P9XA 1N3PA 3CNAA 1CN1A 3RMXA 3WDWA 5JDBA 2DUOA 4FP2A 1UMZA 5EYXA 4LBJA 5HCBA 4JRAA 4YZ5A 1S0IA 3O5SA 1ULFA 4ASMB 1MVQA 4YGDA 3VKNA 2NZ9A 2TEPA 1BJQA 3B9CA 1G9DA 3NV2A 1Q8OA 5T55A 3USUA 3LSEA 2ZZJA 2LTNA 4Y1UA 1WD3A 1UX6A 1QGLA 4AYUA 3L2YA 4W65A 4DPNA 1CONA 4PCRA 2A6WA 1AJKA 2FHRA 3T1MA 2ARXA 1Q8PA 3OY8B 3PVEA 1DHKB 2ZGQA 1S0FA 1RINA 2ZGLA 2NN8A 3PMEA 1VAMA 4YW2A 4AGRA 2DU0A 3FLTA 2VW1A 3ATGA 4LBNA 3RS6A 1Q8SA 2D6NA 1IKPA 2EXHA 3ASIA 3VKLA 2ZGPA 4PQ9A 4YW5A 5CBLA 3VUOA 2R16A 3HR9A 2CNAA 3ZXKA 1S0BA 3SH4A 1C1LA 2NYYA 3O0XA 1C57A 1G9CA 1FX5A 1G7YA 1Q8QA 1LOFC 3AXDA 2D43A 1WW4A 2WT1A 1GANA 3USUB 4AGGA 4FQZA 1CESA 2DVDA 4ATEA 2D6KA 2YXSA 4YFZA 3ZSLA 4YM1A 4M00A 3WDTA 4YZ1A 4YG0A 1WW6A 1AVBA 1DZQA 4BMBA 5IK7A 3FUOA 2C9AA 1JW6A 1LEMA 4OZXA 3WUDA 5T5LA 2Q5TA 1DIWA 3NWKA 4XHBA 4CTEA 3VKFC 2DU1A 2JJ6A 3UK9A 2A6XA 5SV8A 1LGNA 4BMEA 4Q8KA 2GNBA 2JDZA 5IK8A 2GMPA 1HLCA 3V0BA 4DQAA 5JOWA 2EIGA 2DUPA 2UWCA 4TZDA 4M3CF 1O4ZA 4XTPA 3DGTA 1DBNA 3A0NA 4D69A 4FOWA 2ES3A 5L73A 1EPWA 1GSLA 4CRQA 1N3QA 4Q26A 4ISRA 2OUJA 5GLUA 5H9RA 1GZCA 1JYCA 4Y20A 3AZYA 3W58A 2DYCA 4R9CA 5KXCA 1KQRA 1IKQA 1Y7BA 1ULCA 5EXOA 4M3CA 2VW0A 3O0WA 1A8DA 1IS4A 2SBAA 5AVAA 1W6QB 4DS0A 2XB6C 4YW1A 3ZYRA 2ZHNA 4K21A 4R9AA 2VW2A 3VKMA 4BLJA 4GKYA 1WW5A 1H30A 2ZGOA 1OFSA 5IUQA 1AF9A 4DRRA 2AR6A 3UL2A 2B7YA 2D6OX 4YGCA 5GZCA 1OKQA 2D6LX 2GDFA 4R9BA 1HQLA 2P3KA 4F83A 4Y1ZA 3ZVXA 1FAYA 1XQNA 4XMAA 5T52A 5CA6A 1SCRA 1KJRA 2A75A 4WV8A 4XJ9A 2VUAA 4LBOA 4Y1XA 4LBLA 4YG6A 4FPCA 5HCAA 1G9FA 2BQPA 4XBNA 1FV3A 1V6NA 3FLRA 1VLNA 3A4UA 4PF5A 5KXEA 3B69A 4Y20B 1JN2P 2D3PA 3MW2A 2D6PA 2W52A 3OYWB 1W0OA 3M3OA 5DG1A 3OY8A 1UZZA 2DTWA 3AZWA 1QDOA 1W6PB 2ZGKA 3FUQA 4FPKA 5CAZA 3RG0A 3R4UA 3WCRA 1JOJA 2A70A 1FNZA 2GNMA 2YMZA 3O12A 1LOAA 4Y24A 4ZXKA 1YIFA 1DQ2A 3AJYA 3D4KA 4YLZA 4K1ZA 4XBLA 4XTMA 2ZHKA 1LGCA 2UURA 4NOTA 3FBYA 5BYNA 3RRDA 1CIWA 1FYUA 1GZWB 1YYNA 2EAKA 2YV8A 1BZWA 3AYEA 1OQ1A 5HCFA 1GNZA 3ILNA 1LTEA 1V6MA 1NXD1 2YY1A 1UL9A 4ITCA 1QU0A 1ZA4A 1GBGA 1AX1A 1KRIA 1TEIA 2OVUA 1YXWA 3BTAA 2CWSA 1X50A 1DQ1A 1GICA 4GXLA 2ZMKA 4MYEA 3NV4A 1IS3A 1V6KA 2ZAAA 1QNYA 1LJ7A 1A78A 1G8WA 1LHWA 1N1TA 1MS1A 3I8TA 3WZ1A 1N1VA 4UW5A 3MW3A 4P9YA 3M3CA 4I30A 3APBA 2E7QA 3N7KA 4WZFA 4Q1PA 4FPJA 1DQ6A 4XBQA 1QOOA 4Y1VA 2CWMA 1C4RA 4JCKA 2VXRA 1SLCA 4ISQA 5DUVA 1MS8A 1KDKA 2R1BA 4TYSA 3AP4A 3AZXA 1LOFA 1SLTA 5E88A 1LULA 1YRZA 5GM0A 1FATA 3N7JA 2ZBJA 1AJOA 2AH2A 1KJLA 3AXEA 3IMNA 5F9TA 3SISA 1V6IA 1JHNA 1Q8VA 2EXJA 1ENRA 3POYA 1JUIA 4LBKA 4YG3A 3ZPYA 1MS0A 4FPOB 1N47A 1VALA 2DVFA 4FVVA 3N35A 1GLHA 3ILRA 1HQWA 2NMNA 2NP0A 4GWNA 1SLLA 2XG3A 1D2SA 3N36A 3WDVA 3KM5A 3R05A 3WCSA 5JOYA 3M1HA 4WVVA 3SH5A 1WLWA 3BIWE 4YGBA 4RA0A 1W6QA 3TB0A 1AXKA 5DUXA 1URXA 2GN3A 2VY0A 2ZHMA 1ULGA 4Y26A 3C2UA 1MS3A 1Z0HA 1PZ9A 2ZGRA 3AZVA 3WG4A 4AVTA 2UWAA 3ZSKA 2E6VA 2AYHA 1G86A 3NV3A 4L8QA 3RQ0A 3JUUA 2PHFA 5DUWA 4SLIA 3ZSJA 3V0AB 2DURA 2FMDA 4RL7A 3WVJA 4AWDA 2UU8A 2CYFA 5GALA 4P9WA 4Q2FA 1I1EA 1N1YA 1RIRA 2ARBA 1LODA 3OBRA 5T50A 1C1FA 1W6MB 2JE7A 1VIWB 4M3CE 4BM8A 2E51A 3V65A 5GLWA 3PVOA 5DXDA 2HYKA 4XIKA 1JBCA 2A6ZA 5EWSA 1MS5A 2SLIA 4YZ3A 4FPLA 5IT6A 1HKDA 3AK0A 4Q27A 3OYWA 2ZGTA 4LBQB 2R1DA 1LHOA 4XHXA 4YZ4A 1W6PA 2OW4A 4AVVA 4C1XA 1QNWA 1DQ0A 1CR7A 5T5OA 3SLIA 1PZ8A 2AUYA 4U36A 3OJBA 5IK4A 5DG2A 2Z42A 5CB7A 5JLVA 3FLPA 3WDYA 3AP6A 3B01A 3RMYA 2R49A 2PHRA 1SBEA 1G9AA 1GZWA 3HN1A 2NMOA 2WQZC 5JVVA 2P37A 5E89A 1NLSA 1YI7A 1QKQA 1AZDA 4XJ8A 1B09A 1YO8A 2CTVA 1GKBA 2E53A 1O4YA 4BOWA 4Q1RA 1V6LA 2DVGA 1IS6A 5EYYA 3QLQA 3B3QE 3MEPA 3LSDA 3U4XA 3IKWA 2P3IA 4JC1A 3WNXA 4YGEA 4FPEA 4ZKTB 5JMCA 4M01A 4Q8LA 3FFZA 2DVAA 2W68A 4UW4A 4GALA 1S0DA 2EXKA 2DUQA 2KM2A 2R0HA 4XDQA 1Z78A 5JOZA 1WBFA 4H55A 3ZXJA 2CY6A 3WG3A 1LESA 2A7AA 2GNTA 5GZGA 2A71A 2A6VA 3WOGA 1SACA 1AXYA 1UKGA 1VAVA 2JD4A 4XJAA 1WLDA 2VU9A 2WSUA 5H9SA 1DQ5A 2ZMLA 2JECA 3TAYA 1LOCA 3KQRA 4BLIA 3JU9A 2ZABA 3WHUA 4ATFA 1HDKA 1RITA 1SLAA 2ZKNA 4FPHA 5T54A 3IM0A 2A6YA 1CVNA 1S0EA 2AREA 2PHUA 4Y22B 5DZGA 4Z8BA 4YM0A 1V6JA 1SBFA 1MS4A 3INAA 4XZPA 2A5ZA 1Q56A 1S1AA 1SBDA 3N3HA 3WG2A 2D6MA 3IPVA 1R1ZA 3R4SA 4FOVA 1LCLA 3M2MA 2JKBA 1BQPA 2P34A 3N7MA 1J1TA 1W6OA 3UJOA 1G9BA 5KXDA 4XXAA 4WVWA 4FPFA 4XJZA 4PBOA 5KXBA 2V5YA 3LCPA 4R9DA 4XJWA 2EXIA 3HMYA 3DUIA 1GZ9A 2PHWA 3AJZA 3H0OA 3OGGA 1LENA 2EALA 4XYXA 1BXHA 3ZXLA 2GALA 2C5DA 2DV9A 3OPZA 5FRAA 3VKOA 1WUVA 3V0AA 4BQ1A 1F31A 3AP5A 1N3OA 1DFQA 1V6OA 5LK5A 3M3QA 2G4IA 2DWRA 1CPMA 2AENA 4P14A 1I3HA 1WBLA 1W6MA 3WV6A 1JXNA 1ONAA 1QOTA 1DLLA 1LECA 3B00A 3RSJA 1IOAA 1LU2A 2GMMA 2YROA 5H9PA 3SITA 5GZFA 1MACA 2NM1A 1DGLA 1IS5A 2ZACA 3AYDA 1MZ6A 4GWMA 5CNAA 1MVEA 5GLTA 2WKKA 3PVNA 3IPVB 3Q9OA 1UPSA 4FP3A 2GNDA 4HL0A 4LBQA 3T1LA 2ERFA 2VH9A 1V00A 1W6OB 2R0FA 3AZZA 1LEDA 1H9PA 3POSA 3AP7A 2EF6A 2A3WA 2D3RA 2PHTA 1FNYA 3WDXA 3IN9A 3AFKA 4XXPA 4K20A 2ZGSA 2YZ4A 1ULDA 3BODA 5FREA 5GLVA 3W59A 3WDUA 2D44A 1QOSA 2A3XA 4FQ4A 1LOEA 5DUUA 1GNHA 2UWBA 5GLZA 1SLIA 3D6EA 2ZGMA 1ULEA 1KITA 4UW3A 4DFSA 1CJPA 1QF3A 2ZA9A 3WHTA 3T2TA 2W08A 4K1YA 4XMIA 3ZXFA 1LHVA 3O0VA 1CPNA 1W6NA 2D3SA 1WW7A 2LALA 4XOGA 5IK5A 3AYCA 1CQ9A 1H9WA 2CL2A 2P2KA 5DZEA 3I4IA 3N7LA 3ILFA 1SFYA 2WLQA 3AYAA 1DYKA 3ZSMA 2D7FA 4BPZA 2I2SA 4DRVA 2PHXA 1DQ4A 3OBTA 1WD4A 4FOQA 4FOYA 4XJUA
chains in the Genus database with same CATH superfamily
3ZYPA 1UU4A 2P3JA 3MPPG 4LO5B 5IFTA 3LOBA 4A42A 4UFIA 4XIOA 4AVAA 1AR73 4BA6A 1LHNA 3LA7A 4J25A 4PBPA 1ZBA1 4GZ9A 1WLCA 3GALA 1BYHA 3VDDB 1CJDA 1JUHA 2GN7A 2RR11 1LOBA 4EZHA 1V9U2 2BV4A 3AMPA 1RC6A 4CP9B 1KDMA 3SH3A 3W5MA 4CEYC 1AR81 1XU2A 2MEV3 4YM2A 5GZEA 1OURA 4CDQB 2DTYA 2WT2A 4BU2A 3DXTA 4FPGA 4KBBA 1GOHA 5L36A 2V73A 4IV1A 2WR9A 1JYIA 2PLV3 3LWCA 1BKZA 3AKPA 2W2IA 5CFDB 1JZ3A 1RHI3 2WNVC 4QKDA 2DCTA 1UAIA 1M4WA 4NO4A 2XDVA 3GNEA 4KL1A 2ZGNA 3AM2A 4RQPC 4URTA 1PZ7A 3IBMA 3BI3A 5FZ6A 4QX8A 5FXWA 5DAPA 1O4TA 3M3EA 4Q0PA 3PJQA 4AAPA 4IQPA 1KFUL 1VB2A 2A3YA 4A44A 1COV2 4R52A 4DIQA 4DXRA 1S0CA 4OHWA 1XYPA 4QM9A 4B7EA 3W21A 1LU1A 5J3UA 1REFA 3RZMA 1S4CA 4CDWC 5FUNA 1ZZ7A 4N53C 4W6XA 1UXXX 4HK8A 1F8VA 1OUSA 4YZ2A 1OOPC 1OVSA 3DPRC 1D4M2 1BEV3 3L9JT 4KGGA 4P08A 5H9QA 5AFBA 4ZU4A 2QDNA 5A7NA 5JXJA 1B35B 3RMXA 1BK1A 5ISLA 3BTXA 1VBC3 4CXXA 1ZZBA 1H2LA 4EN7B 4WVZA 1VBB2 2WWUA 3NVCA 3WQ0A 4JDOA 2WUHA 2OX0A 1NYWA 2LUWA 3E6DA 1G6NA 3JZVA 4JGZB 5I0SA 3NV2A 1HQNA 4OULA 3TEZA 1J58A 5LB6A 4B4RA 1QGLA 4AYUA 4CCDA 2XKOA 4QXBA 3OB8A 1QJZA 3SHRA 4Q4Y3 1UZVA 2WDBA 4JRLA 3WXPA 3OCPA 2ARXA 5FMCA 3WP6A 3OY8B 1PGW1 4D94A 2QQUA 4AEDA 5FDBA 1DHKB 1W39A 2VCMA 2BBAA 4GH4C 2J1AA 2EIEA 4PHZA 3GZAA 1VAMA 4RHV3 5A3TA 3RZJA 5BNPA 1EV13 3ATGA 1YEWA 4HN1A 2FCVA 2VTFA 4JTNA 4LBNA 3ZO0B 2QQOA 5E1RA 4CDXB 2DCJA 2D6NA 4RR3C 3ME2A 1DCSA 2P3YA 5E16A 3KD4A 2CNAA 2VOVA 1QQP1 4BQYA 2ZX0A 3VD7A 4HMZA 1YQ5A 2QVSB 1G9CA 1C57A 4E2GA 4MGYE 2YB7A 4A2UA 5FYHA 1O8SA 3VDDA 2D43A 2OQ7A 5K0UA 1GANA 3CIHA 5FYMA 3USUB 2GC3A 4CVUA 3CKHA 5FP4A 1C8M2 1UNBA 5ABJC 4M00A 4YZ1A 4I3GA 2WA4A 5FO7B 3ACFA 3RJRA 3WF4A 1QXRA 1WW6A 2RJ2A 5AC93 2BWAA 5FZ4A 2VNRA 1HB1A 1DF0A 5CG8A 1LEMA 4OZXA 2Y6FA 3DL3A 1S55A 3WUDA 1VPHA 2ZX2A 5IW0A 4CTEA 4EV0A 5HCHA 2JDMA 3VKFC 3J7LA 4LIVA 4ZXEA 3UK9A 1O3QA 2A6XA 3PNAA 5CFDA 5F6LB 5FZ9A 5KHHA 4Q0UA 4COVA 2QDRA 2GNBA 1ASJ2 1XNKA 2GMPA 3KV6A 3LEGA 2G9GA 4Y3OA 5FJHA 5FZHA 1ZRCA 3VD5A 1RJ8A 2K46A 4QKBA 3A23A 5F1RA 3NNJA 1SZBA 1ZBE1 2GC1A 1EAH3 4E9KA 4D6RA 3DGTA 3MYXA 3UGHA 4CUCA 3A0NA 3UKTA 4FOWA 5FZFA 2VUJA 3MIEA 4QXKA 3THTA 2XUMA 3WP5A 4MXWB 2HEWF 4ISRA 3DXUA 3LEKA 4DUXA 3IDEA 4XACA 1XNDA 3URFA 3A7QA 4Y20A 4Q4V2 4YPJA 3AZYA 3N4MA 1S2EA 5CIRA 3VD9A 4AHXA 2VVFA 5EXOA 2VW0A 2XVGA 3VGIA 4INDA 3A21A 3MV01 4LO7A 1IHMA 3PL0A 2SBAA 3NAPB 5C3SA 4BQ3A 2MHFA 5JAXA 3FHIB 4QU1A 2ZHNA 4R9AA 4AXOA 2WC2A 2WBKA 4BLJA 1YJKA 2CDOA 3ZYGA 2RV9A 3LQCA 4B3NA 5IUQA 5DDJ1 3JD72 2ADEA 2QQMA 3QD6A 4JV4A 1ZBA3 4XQDA 5FKBA 4D6QA 1JYWA 4HPKB 3MF6A 1OKOA 1UY0A 4YVWB 2RR13 5AVPA 4Y1ZA 5EHDA 1XBFA 4XMAA 3NJZA 1OI6A 1U5YA 2W5FA 1FI2A 3CJIB 4JGZA 4WV8A 5F3CA 2DBIA 3VBFC 1AR83 3B94A 4P9IA 3MLLA 3J8F3 5A3WA 1SPPB 3JB4C 4D0QA 4Q29A 3R0RA 4IDZA 1BHGA 1G9FA 4CEWC 1NCQA 1ZYBA 4OUMA 4BK5A 5A3UA 4DO0A 3WW3A 3I97A 3LE0A 3OY8A 1UZZA 2OZ6A 5CAZA 5C4WB 2FMYA 5FMOL 3J4UH 1JOJA 5JMOA 2YMZA 1VBA1 1W05A 4CDXA 1BLZA 4S2FA 1J1LA 1DQ2A 4JGYC 3KGLA 2VJXA 5JZGC 4DNYA 3B93A 5I8SA 5BYNA 2EAKA 1FYUA 1YYNA 3AYEA 4Q0SA 1RB8G 1C3HA 1GNZA 2WWJA 3ILNA 3I54A 3HEIA 4IE7A 1RL3A 2C1FA 3RWNA 1AX1A 5C5UA 1TEIA 2OVUA 1PNGA 1YXWA 3BPZA 1GICA 2RS52 3POFA 3HPNA 4MYEA 3RFRA 3NV4A 4XFGA 4D7YA 1RUJ2 3I8TA 3WZ1A 2WO3A 1N1TA 5LASA 4MHRA 3GYDA 3ZX7A 2DCZA 3N7KA 4CU8A 3SCHA 4RGKA 2YU2A 4MV2A 1KFXL 1C4RA 3ORJA 2VXRA 1TME1 4BIOA 4Z1VA 4Y4YA 3UGFA 4FXKB 2J1RA 3E1F1 4JHZA 1V9U1 4CUBA 5FYZA 2ZBJA 1AJOA 4CCNA 4IE0A 2VNVA 4NPMA 3SISA 1RUH2 1JHNA 3CJXA 5FZCA 1ENRA 4L92A 5A7QA 1JUIA 3ZPYA 5JI7A 2WFF2 1WWYA 3I7DA 5DAWA 2JG8B 1HQWA 5BY5A 3NW4A 4HKLA 4NUBA 3WDVA 2YC4A 2VMEA 3GHNA 3UETA 2IVJA 3R05A 4XFIA 3M1HA 3WCSA 2XVKA 3I2FA 4WVVA 2JIGA 5FQ0B 1MPXA 3KWVA 2UYBA 3BIWE 4S2HA 4AEDC 3GBFA 2OKXA 2KR2A 3PIGA 1P8JA 1AXKA 4HXCA 4AL9A 2GN3A 5CG9A 1PM4A 4OI0A 3UKVA 1ULGA 2GC0A 4O61A 2C26A 3D3AA 5BNPC 3AZVA 4EE2A 2VULA 3HNBM 1QQP3 4AVTA 1CWPA 1WMDA 3K75B 3ZOIA 3OEAA 4AEMA 2PHFA 2Y26A 5FP9A 1W9SA 2FMDA 3POEA 4YVWA 3O7OA 3POJA 3THPA 3HOBA 5IVFA 1CAUA 1US2A 4EN6B 5J96B 4HONA 2JE7A 2VZSA 1VIWB 4M3CE 2WABA 4IE5A 1VRH2 3VDDC 2BPA2 5KHJA 3N9MA 3PVOA 3W9AA 3S7EA 2QQLA 3TN91 4ASLA 4E8CA 3ZN6B 2JWPA 2OZJA 2A6ZA 2W95A 1FOD2 2LS6A 5EWSA 5F39A 4NRPA 1ND2B 4XFBA 1XSRA 4FPLA 5C6CA 2QQJA 3AK0A 2I07B 3MGUA 4LBQB 5FZEA 3SKJE 4CDQC 2R1DA 2XR4A 2VE1A 3EO6A 2Y33A 1NY71 4XHXA 1AYN1 2VOWA 5FY9A 2WN3A 5D21A 4C1XA 5C4WA 5FY4A 3U1XA 1QNWA 1DYOA 3HNMA 1BVVA 2BUKA 4I0WB 4QPWA 4W50A 5CFDC 3SQOA 5JPNB 4AEKA 1ZBE3 1ZNPA 2HWE2 5KHGA 2Z42A 3DKWA 5FR3A 1RJ7A 4AQSA 1QXJA 3WDYA 3RMYA 1GWKA 2JG9A 5D2AA 1SBEA 5A33B 1YIPA 1YHFA 4K8FA 4CP1A 3I59B 4BXFA 4G4FA 3K46A 1NLSA 4V2WA 3O1PA 4CPBA 2CTVA 3LF7A 4K3UA 3MIFA 4IEYA 3WQ7A 2VZVA 1V6LA 2BGOA 3HQXA 1GOFA 4W6YA 5EYYA 3QLQA 5BXXA 1TMF1 3KCYA 1OHFA 1RMU2 2VO5A 3KHCA 3LFMA 1I5PA 3IKWA 1QJX1 3MIGA 3WNXA 1W2AX 4XF1A 3ZN4A 3AMHA 4QB1A 5DPNA 1QJFA 1J3PA 3OG2A 1JTZX 4UFMA 3MO4A 5DDJ3 3I3QA 4ZS3A 4XFCA 2EXKA 1B35C 1NA1A 3AKRA 4ES8A 3OUHA 1A34A 5DN2A 5JUVA 3WOGA 1A6CA 1PO22 4UYBA 4YVSA 4IGOA 1D4VB 1DQ5A 3BOWA 5HXMA 1F4AA 3H8UA 3KQRA 3JU9A 4JGZC 1JZ6A 3DKQA 4P5HA 1SLAA 1W2TA 3IIAA 5FK7A 3F2ZA 1MZFA 3PMSA 2A6YA 4EJRA 5KHKA 2RMU2 4XF4A 4Y22B 2HWC2 4YM0A 1M06G 1WMFA 3MHZA 1SBDA 1S1AA 3H42B 5A70A 4QQPA 2E7AA 3WNOA 1JMUB 2D6MA 3SCFA 4GMP0 3ZFFA 2WA3A 3N7MA 5FQ0A 2WQ8A 1G9BA 4MH0E 4S2GA 1CD3G 1AR63 4XJZA 4FPFA 5A3NA 2V5YA 3LCPA 4R9DA 4XJWA 3LB9A 3DUIA 4CDXC 1JZ5A 4JVAA 2IFWA 4IV3C 1OLRA 3WY6A 1BXHA 3WEZA 2XWBB 5HI0A 5FRAA 1WUVA 2ZZQA 3S7IA 1OPMA 2P17A 1N3OA 4MADA 4A6OA 5LK5A 1CZTA 2G4IA 1W9WA 1XNCA 2DWRA 3WV6A 2R041 4P14A 1I3HA 4Z82A 5C8CA 5I0TA 4UFKA 1LECA 1GP5A 4NHLA 2ARCA 2FDGA 1UY1A 3F95A 3ZN6A 5I0DA 1MACA 1X82A 4IL7A 1MZ6A 1D0GA 1ND2A 1HRI1 5CNAA 1MVEA 2X53S 2UY9A 4IXLA 1HRV2 3PVNA 1UPSA 4LBQA 3HAGA 2ERFA 3HJRA 3ZXGA 3PUHA 2XJRA 1LEDA 1TME3 3POSA 3AP7A 2EF6A 1W28A 4H2AA 2ADDA 3WDXA 2OXBA 3IN9A 4XXPA 3KQ4B 1UY2A 1V9U3 1PX4A 3OPWA 2XHKA 1RUG2 3VBRB 4K8RB 1RUD2 1ULDA 2AC1A 2BP6A 3BODA 4PLOA 1LAJA 1OLQA 3ZYJB 4XF0A 2Z79A 1LOEA 5DUUA 5A33A 4AFAA 4YSFA 5C9AB 4OVEA 4B29A 2OT7A 3I59A 4DFSA 1QF3A 2XLAA 3C8XA 3PLQA 1TE1B 2ZA9A 3T09A 4AVCA 3WHTA 3T2TA 1IGOA 4Y5TA 1JODA 4YW6A 5FZ1A 3WX5A 1XOYA 3O0VA 1CPNA 5IK5A 1WZXA 1CQ9A 2FBEA 5DZEA 3N7LA 5B4XA 3ILFA 3NRUA 3OD4A 3ZSMA 4Q4W2 2D7FA 4ZZ5A 3ZDSA 2I2SA 5A7WB 1FMD1 1WCUA 2LROA 1YUDA 3NAPC 4IEXA 4CU7A 1E57A 5FY5A 4XJUA 2VUDA 3LEIA 5JR2A 3BU0A 1QDCA 3ENRA 4H14A 3K4ZA 4TTGA 2PELA 1J84A 2C9KA 2OUHA 3FHQA 2E31A 1PK6B 1F5FA 4YVWC 2IXCA 3VHOA 2FDKA 1K12A 2ZTNA 1UMIA 5IVEA 3TN93 4OI1A 3CJIC 4OZOA 4QGNA 1W8NA 5T5JA 4XE9A 4LHLA 4PIXA 5GKAC 2VM9A 2Y6LA 2ZEYA 4Y22A 5T5PA 1WCSA 1W6NB 3VV1A 3QCWA 1AYN3 3AKSA 4KWJA 3FWEA 2VVDA 3NJYA 2FDIA 2VOXA 2ZGUA 4ZU5A 3WF2A 3ZR5A 4CZSA 3M70A 2RS12 3MIDA 2PQQA 5TSWA 4H7LA 3ZYIB 3J7HA 3GM8A 4IEOA 1MR5A 5LY2A 2KD7A 3ST7A 3RI8A 3POWA 1F9KA 4XDOA 4A7KA 5BNNB 3ZFGC 3WLUA 2IFRA 1H2KA 3FMGA 4ZS2A 1ENSA 1ZRDA 1ZZ6A 3G6JB 3NNMA 4FPYA 4KQ7A 2WFF1 1HIXA 5IVYA 1YQ8A 2RM21 1AXZA 2D93A 1X7NA 3TOJA 4QX3A 4XILA 3ECQA 1TMF3 4AQ2A 4OQ8A 2ZAHA 4UWDA 1HB4A 1LOGA 4M3CB 2QQWA 5FXVA 2BDRA 1QJX3 2ID4A 3MFCA 4LEJA 1HW5A 3U14A 2XQXA 4LKFA 3UJQA 3VHPA 1ZM1A 5LZ6A 4N90A 4M4RA 1QMJA 2ATFA 4OUSA 3H9AA 2NLRA 4IV1B 4XAAA 2UYAA 2WSVA 4XFHA 4P9XA 3ON7A 4QQHA 2HEYF 2FDHA 3CNAA 1CN1A 1UMHA 3WDWA 1QH7A 4AW7A 3C3VA 3JQWA 1F35A 1SDDB 3KS7A 4FP2A 1UMZA 4MGKE 5FUIA 5LRSA 2G9ZA 4C90A 5FIXA 5FPBA 3MLKA 4LBJA 3UKNA 1JYTA 3ROUA 2YBSA 1S0IA 3VBRA 1VB4A 1MVQA 2QZ2A 4ASMB 3BUCA 4YGDA 5DQ0A 4LKDA 1BJQA 2HJIA 1J59A 3LSEA 4BCUA 2LTNA 1RUC1 4AFDA 1JZ7A 1UX6A 2BGPA 3DYOA 3SCGA 3L2YA 1H6XA 3LZZA 4PJYA 2XOMA 3THDA 3RZKA 4LUMA 2WZPP 1OSGA 2FHRA 4XABA 4AI2A 5FZGA 2JG8C 2F4PA 1BBT2 4RFRB 2ZKLA 4BZ4A 3JQXA 2ZGQA 3AL6A 5FYCA 3ETPA 1S0FA 1AR91 2NN8A 3PMEA 1GQPA 4AGRA 3ZIWA 3FLTA 3RZLA 1OA2A 2IZWA 4N43A 4WM8B 5FZLA 5FLHA 3U75A 1SMVA 2ZGPA 4PQ9A 4YW5A 2R16A 5KR7A 3FZ3A 2W46A 4QDRA 2WQ4A 4QB2A 4AG4A 1S0BA 3SH4A 3OSDA 2VD7A 4NE9A 1W8UA 2JDAA 2R043 2ZXQA 1FX5A 1G7YA 2VBBA 4AZZA 1RYYA 1Q8QA 3H8XA 2HWF2 2P5BA 3ABZA 3AMNA 1WW4A 1W04A 3RJ2X 4AGGA 1W8OA 2HBUA 3T30A 1CESA 4LKEA 3RNSA 3V56A 2B8MA 4ATEA 3I2JA 3C7EA 2D6KA 2YXSA 1CZVA 4K9SA 3EB7A 4YM1A 1H8TA 3WDTA 3ZSLA 1NOVA 5D8AA 5FO9B 1HRI3 5KWRA 5L9VA 1H4GA 5BNQA 3DYMA 4CA9A 5IK7A 2J1EA 5J37A 4L11A 2AZ5A 1ND2C 2J42A 3CHXA 3PVBB 4KNCA 1DIWA 1NXMA 4UBHA 1BK0A 5LBBA 1KS4A 4NAMA 2YPJA 5SV8A 3BGAA 1JZ8A 3VDCA 1HLCA 3TNQA 1X9TA 1NE4A 2XLFA 3TEYA 2EIGA 4PIZA 5FZOB 1X8MA 5BNNA 3VBUC 2VVEA 3I3MA 1KS5A 2B45X 3WNMA 2ES3A 4LA3A 2WFPA 2ETEA 4CRQA 1W8WA 2WO7A 1N3QA 5K0UB 4Q26A 4RFT0 1Q5OA 4E27A 1JYCA 4R8HA 3HQRA 4R9CA 4CCCA 1XXNA 1O3SA 1OH3A 1ULCA 3J8F1 4M3CA 4MGZE 3S30A 3PUIA 1FMD3 2IXLA 2Q0AA 5B4NA 4CSWA 1IS4A 1XE0A 4DS0A 2WS91 5FZKA 5FPLA 3SXWA 3ZYRA 4BH9A 3E97A 2VW2A 4KU7A 1QEXA 4UFJA 4WZCA 4ARXA 1QJY1 1OFSA 3POIA 4F8AA 5LEJA 1PGL2 4JAAA 4ZPIA 2FCUA 1BMV1 2ORZA 5GZCA 2D6LX 4R9BA 3THCA 5CEHA 2FDFA 4DEVA 1HQLA 2P3KA 4UAPA 3NKGA 3OEBA 5G04L 4JQTA 1C28A 4ZONA 3HIFA 5L9BA 4D6SA 3MUZ1 2J1TA 3Q8EA 2A75A 4Q0QA 4XJ9A 3LIHA 4CP2A 2V4VA 3IIIA 4Y1XA 4LBLA 5FV3A 2OIIA 4FPCA 4UFLA 1VBE1 2Y0IA 3T08A 1H0BA 2BQPA 2IXJA 2TBVA 3FLRA 4QGLA 5KC5A 1HRV1 3B69A 4Y20B 3MW2A 2D3PA 4XCAA 4PDWA 5BPXA 3IDBB 3OYWB 3ACGA 5FZAA 3AZWA 5DABA 5ACA1 3OF1A 3RG0A 1Y3TA 1GNYA 1J3RA 5EP9A 1RUG1 2A70A 4LO8A 5CKNA 1RUD1 2GNMA 3O12A 1LOAA 4CYDA 4WM8A 1K5MA 4CE8A 3P3NA 3GCXA 3AVRA 4K1ZA 4PQQA 4XBLA 2QKDA 3RYKA 5F7UA 2WFF3 2H0VA 2JDNA 1UCXA 3PURA 3FBYA 2RM23 2W0XA 4I0BA 2Q8DA 1CIWA 3RRDA 5FPXA 2BNNA 2YV8A 1BZWA 5JCTA 1ZRRA 1W8HA 1OQ1A 4NIIA 2VR4A 4QXCA 3ZKUA 1NXD1 3ZR6A 3OUIA 2ZX3A 4ITCA 1RUI1 4KWKA 1QU0A 4WM7B 5K4LA 2ZX1A 3ZXDA 5BUVA 1REDA 5T3NA 4CDUC 3BTAA 4LHNA 2CWSA 4OHXA 4GXLA 1NCQB 2ZMKA 2B5HA 4G9SB 1YC61 1V6KA 2ZAAA 1QNYA 1LJ7A 3RZGA 1NT0A 1R081 4ZY9A 4I30A 3APBA 5JIUA 1VP6A 4Q1PA 4AF9A 5CYYA 4B1MA 2FZ2A 4BQWA 5A6QA 2CWMA 1UYYA 4I0AA 4JCKA 1SLCA 3AMMA 4GWIA 4ISQA 4FAHA 5IATA 4LLOA 4MGQA 5FUPA 4I09A 4TYSA 1JH5A 1LOFA 1SLTA 2PMWB 2YDEA 1RUC3 2JENA 5FZOA 4MVTA 3VBRC 1REEA 3AXEA 1KJLA 3BYWA 5FY8A 2NQYA 2EXJA 1QJU1 2HWD1 4NIGA 1U5XA 1O3RA 1MS0A 1SG3A 3OBZA 2FZ1A 5C9AC 4FVVA 3N35A 2HEVF 3ILRA 5IVCA 3Q8CA 2NMNA 4GWNA 1D2SA 3NNFA 4LOSA 4KWUA 3RWKX 2PXJA 3D0JA 1AR93 2BNMA 3SH5A 1PVC1 2VZQA 4B4QA 2VZOA 1XSQA 5DAVA 1Y9GA 2HWE3 2GH8A 5DUXA 3U4SA 5C8WA 1O3TA 2VY0A 1R1A2 4Y26A 1MS3A 2Y60A 2QNKA 3WG4A 1WA4A 3K2OA 4FBFA 5A1FA 1QIQA 3H3ZA 2DF7A 1AYM2 5F3GA 5FAXA 3NV3A 3V0AB 3JUUA 2DURA 3H1WA 2CYFA 5GALA 4P9WA 4IE4A 3ES4A 2D5HA 1N1YA 5I0UA 2O14A 2WAAA 1C8NA 1ZZ8A 2WYFA 4AOCA 3E6CC 2F17A 1UWWA 3OBRA 5JXGA 1C1FA 1PK6C 5FOJB 4C0BA 4QPIB 2AACA 5JXHA 4MO3M 5GLWA 3KV5A 4AI9A 3TWIA 5DXDA 5IFPA 1K42A 5FZMA 1GOGA 2VXJA 3EHKA 5FYSA 4V1PA 5LCWL 1J83A 1MS5A 2BW8A 4YZ3A 2XL9A 1RUF2 5APAA 2YHJA 1CX1A 1AL21 3T2PA 4C0HA 4DXZA 4NHYA 2R061 3OYWA 4LHKA 4FSJA 1O7FA 3RYRA 4YZ4A 2OW4A 2ET7A 3MIHA 2A1XA 3N9QA 2ILMA 1DQ0A 1PZ8A 4C91A 5I8YA 4U36A 3OJBA 2R072 5DG2A 4JHTA 1RUE2 5B2GB 3SMHA 4R4ZA 3AP6A 3B01A 5FFOC 3WNKA 2PHRA 1YI9A 2WZEA 4WBBA 2AEYA 1CAUB 2BGCA 4FXGB 3LGRA 4Y4RA 3SEPA 2P37A 1X8EA 1XU1A 1BBT1 4WM7A 1UU5A 1FPN1 1WKYA 4OQ9A 4AI1A 1W8FA 2E53A 5ERLA 1O4YA 3K3NA 4BOWA 2DVGA 1W2NA 4CUAA 1IS6A 2WS93 3B3QE 2W9XA 3MEPA 1UZWA 2P3IA 4JC1A 2JIJA 3TNPB 4LO6B 3S0MA 1QJY3 4FPEA 4NIAA 3H8RA 2Z69A 2CAUA 2W68A 3FFZA 4IV1C 4LO4B 5LA9A 4E4SA 4XDQA 5JOZA 1S2BA 3AC0A 2CY6A 2VQAA 2VTXA 4UI9L 5GZGA 2A6VA 4UFHA 3ZMNA 1AR61 1K3IA 3VB9A 1SACA 1AXYA 4BDVB 2B39A 4XJAA 1WLDA 3KVAA 2WSUA 4X8PA 4AI3A 2JECA 2RS31 2JG9B 5LA1A 4BLIA 1VBE3 1AR72 1NCRA 4LUKA 2XKPA 2ZABA 4F3JA 3CBNA 3WHUA 1HDKA 1RITA 5T54A 1HRV3 3NJXA 2AREA 5DZGA 5FMOS 2ZPXA 1UD1A 2Y0OA 3BCWA 3J9SA 4XZPA 3E5QA 4CU9A 2IXKA 4XAEA 5ACA3 4Q4X2 1LCLA 2XBO1 3M2MA 2JKBA 2P34A 1RUG3 1W6OA 2XJPA 2VBPA 4XQWA 1RUD3 1Y9MA 3FX3A 2XHNA 5EJZB 5SV5A 4PBOA 1UY4A 5FPAA 5KXBA 2BU9A 2EXIA 2LW8A 2PLV2 2BWCA 2RDSA 3KT7A 1NA1B 4QPGA 2Y64A 3N9OA 4QX0A 4WM8C 1RHI2 3OGGA 5JSOA 4XYXA 3V0AA 2BOIA 2C5DA 3VKOA 4YVSB 5C7GA 1HX6A 1F31A 4Z07A 3B9IA 4CCKA 3EXUA 1RUI3 4QGMA 1VBD2 4OMDA 3KF3A 1CPMA 3T2QA 4QPIA 5LRRA 4A3XA 1DLLA 1W8ZA 2BEOA 3AVSA 4OHVA 5JPMB 2YROA 1R083 1IS5A 1MQTA 4BJ0A 4GWMA 5FPUA 4OLLA 4QX1A 2V72A 4FCAA 1POV1 3K48A 4HL0A 2VOKA 4YARA 5LEKA 3AZZA 4LNVA 4W8JA 1UQXA 2BZDA 2BYVE 3D0SA 1PNFA 2XJTA 3OBAA 4TLGA 5L7OB 1BEV2 5FJKA 4QDSA 4J6GA 2ZGSA 4N7UA 1T2XA 2P1BA 3KHBA 3TYJA 1DGRA 1E5HA 3LPGA 1VBC2 2YZ4A 3POBA 1CGPA 1YLLA 2VOTA 2VMIA 1OLME 3FL7A 4PLNA 1QJU3 2HWD3 3PUSA 4EZ4A 1XJAA 3NNGA 1W8TA 1DP0A 5A6ZA 1COV1 2R32A 5GLZA 2XPJA 3PUAA 4MGIE 1CJPA 5BNOA 5C8CB 4CPBD 4BQ5A 1U5IA 4E8DA 4R4XA 2W08A 2X09A 4LR4A 5K0UC 1LHVA 3H7YA 3IDCB 3GF6A 5L19A 2D3SA 3NJVA 2LALA 1XE7A 4XOGA 1PVC3 4YRDA 2WLPA 5FYVA 4COYA 1D4M1 1SFYA 1F2NA 2VZ3A 2WLQA 2VUCA 4MOAA 2E32A 5A32B 4Q4Y2 1CAWB 3VBOB 4PT6A 4RN5A 4DRVA 1DQ4A 4MLOA 3WF0A 2BBVA 4L2NA 1VBB1 2HBTA 4H7MA 4MHUA 4HANA 1DGWA 5ANNA 4RHV2 3A0KA 2PAEA 5F5QA 5FZ3A 1ENQA 1EV12 1JI6A 3FFQA 2GMEA 1JYVA 4YW4A 1U0AA 3BTZA 1W2OA 4JTOA 2KA3A 3AKQA 4LBMA 5FWJA 5F32A 1YQ6A 4LMFA 5LWBA 2B42B 4AEJA 3PU3A 4GAZA 2X29A 2H0BA 5JR7B 1AX0A 3V64A 4W4ZA 5F37A 3W5NA 1HB3A 2Q8EA 1YJLA 3KT1A 4QHBA 1W0PA 1AL23 1XRUA 3NMBA 4JDNA 1VAKA 3BVCA 2R063 3M8LA 4QQ2A 4NIHA 1ZRIA 2ENRA 3H1MA 5EZWA 5FLIA 2DVBA 5A7OA 2JICA 2WO1A 4UW6A 4YFWA 1A3KA 3OGRA 1YFYA 3AP9A 3FBMA 5AC92 2HYXA 3LA2A 2WAOA 2AGSA 4AE2A 3A22A 4O9EA 1N1SA 3JBG2 1WMEA 2XJVA 4YW7A 1NZIA 4JQRA 1VJ2A 2VMCA 1W3XA 2X5IA 2Z5WA 5FMBA 2PQSA 1GU3A 1V0AA 3VL9A 1S0JA 3S57A 3VL8A 1DZRA 4GA9A 5CFCB 4CEYB 4KU8A 2W3JA 3RZZA 3T2OA 5C70A 4YW3A 4OCTA 1BBT3 2FQPA 4NN0A 1DYPA 3WG1A 1FPN3 1C8M1 2RHPA 1EAH2 2D5FA 2HWB2 1AX2A 4NPRA 1RXFA 2ZMNA 3OOXA 4HVRA 4XVHA 1H1AA 4AI0A 4DXTA 3MW4A 4EYUA 3FHAA 1FV2A 2J1SA 4WM7C 1ULOA 4MZUA 4EN0A 2J1VA 3NV1A 3D5OA 5I0RA 1NCQC 4TSVA 1GYKA 2WZR2 2ET1A 4LBQD 1S2KA 1YWKA 4KBZA 1C5IA 4X8NA 1EYBA 2IC1A 1AYM1 1ASJ1 4HFSA 4QKNA 4CUGA 3KGZA 2DUOA 3PTRB 1IPSA 5L7OA 1YCIA 2E26A 3H3LA 1ZREA 2Q1MA 3N9PA 3FE5A 5HCBA 3S5QA 1SHWB 4YZ5A 1PMIA 2RS33 3USSA 4Z2AA 3T0DA 1QHDA 2CHHA 3VKNA 2TEPA 1G9DA 1ODMA 1W0NA 1Q8OA 4JDMA 4LE4A 2ZZJA 3Q8AA 1AHSA 1VMJA 1LR5A 2QQIA 2VZRA 2ZEXA 3VHRA 2RR12 2Y6GA 4A41A 4Q4V1 5LBEA 4DPNA 2PAMA 2A6WA 5FY0A 5C3QA 4YYOA 3T1MA 1NG0A 4OI2A 1NZCA 1IPJA 5FZBA 4B8EA 1R092 2XBO3 4META 1GUIA 3P3PA 2WINB 1OA4A 5JWPA 3NO8A 3J26N 4HKOA 3NKTA 4KGQA 3IT8A 5FOBB 2ZGLA 5A32A 4DUWA 1OF3A 1CAWA 3VBOA 3CEWA 4YW2A 3K4AA 5HV0A 3K77A 1Q8SA 1XE8A 3VZMA 3HQUA 3JD71 1IKPA 1SFPA 4IEUA 2L9LA 4XCBA 3LD8A 3UYJA 3VKLA 2OS2A 5CBLA 3VUOA 2K9ZA 3HR9A 4I3PA 2VMHA 4HVOA 1OC1A 2BFUL 4PF1A 3ZFFB 3KCCA 1DLCA 1C1LA 2NYYA 2YBKA 4LULA 1MZEA 4OHYA 3WNLA 3AXDA 2WT1A 2ORXA 5J98B 2OPWA 2VPVA 4H3WA 2ZJCA 3IZOA 4FQZA 3BU7A 3T4HB 4AFCA 4YFZA 3VZOA 5IAXA 3LDKA 4AHZA 1POV3 1AVBA 2WNUA 3MLJA 2C9AA 5FXXA 2Y38A 1JW6A 2ZEWA 2OPKA 5T5LA 2Q5TA 3M4FA 5FLJA 4OMCA 3NWKA 4XHBA 4DEQA 4BIFA 1SEFA 2DU1A 5HV4A 4BMEA 3H50A 1JYXA 2JDZA 5IK8A 1FT9A 4DMIA 4LKSA 2I74A 4N43B 2E9QA 3VBSB 4DQAA 5LA0A 1LRHA 2YYOA 1NUKA 1ALYA 1COV3 4TZDA 5A7SA 4MGTA 1O4ZA 1JS9A 4XTPA 5CFCA 5I8TA 4NJ4A 3EMRA 1NLRA 4CEYA 4D69A 4JZRA 5L73A 5BV6A 1EPWA 1GSLA 3BKZA 4XQ4A 2G9FA 5J09A 1GMMA 5FBJA 2OUJA 1OPOA 5GLUA 5H9RA 1IZ3A 1CAXA 1VMFA 2RS51 2Y6JA 5LA2A 3W58A 3OUJA 4Q4X1 1D4M3 2XXZA 2YUEA 1H8TB 1RUJ1 2VCBA 1IKQA 3PTYA 4LTAA 1WCDJ 1VR3A 1Y7BA 5D8AB 1STMA 1RVF2 1XNAA 2PA7A 2W87A 3O0WA 4JKMA 4QU2A 5AVAA 1W6QB 1VBB3 2RDRA 2XGXA 3CU7A 4FTBA 4I2OA 5DMYA 4YW1A 1WA6X 1WMXA 2PYTA 1L7QA 2D40A 4A7YA 1WW5A 1H30A 2C6SA 2ZGOA 3KVBA 1O5UA 2ZS6B 1H1MA 5C4WC 4NRMA 2B7YA 3RGBA 4YGCA 2ARAA 3M3IA 2GDFA 3EYPA 4BISA 2CV6A 3IWZA 1KXGA 2XMLA 4IEPA 2YC2A 4KMQA 1QQP2 4GB32 3ZYHA 5T52A 1RUH1 4LBOA 3RPQA 2CAVA 2WWSA 4NWVA 5KHIA 3QBQA 2Z2SB 4CDWA 4N53A 1X36A 2JG9C 1HJFA 3MUY1 1BVP1 1UYXA 2OA2A 1OOPA 4XBNA 4FI9A 1X9PA 1V6NA 2QCSB 3A4UA 5KXEA 4LPLA 2RE9A 4Z92B 2NPIA 2C0ZA 2D6PA 2W52A 4GD4A 4L9BA 1W0OA 3M3OA 5DG1A 4P02B 2Y6HA 4XF3A 4TN7A 1QDOA 1W6PB 2CU5A 2ZGKA 4OFGA 4XUPA 1PO12 4W6WA 2W92A 3WCRA 1L3JA 1CZSA 4P00B 1FNZA 4Y24A 4BYYA 3VHNA 1YIFA 3AJYA 4YLZA 1H8VA 1W9TA 4AFBA 3CF6E 2BRTA 1C5HA 1PIV2 1ND3B 4XTMA 3ACHA 4XDPA 1NA1C 2PTMA 1YFUA 3GZUC 4NOTA 5FK8A 4MG2A 1XPWA 1W03A 1ZBE2 2VG9A 5A3PA 1C8M3 3UT0A 1EY2A 2B4KA 3Q8BA 1YQCA 1VRH1 4YVSC 5F3IA 5HCFA 5JI9A 2JDPA 4C8DA 1V6MA 4TWTA 5F6KA 2BVBA 1UL9A 1ZA4A 4FAGA 3GZEA 1FOD1 4QAWA 4AHWA 4ARYA 1X50A 3BPSA 3NNLA 1AL0G 5F5CA 1IS3A 2WNOA 3HBZA 4GH4A 5FBZA 3WT3A 1POV0 2AEZA 4GQ7A 4SBVA 2R6QA 4PDWB 3O14A 4XUOA 4BB3A 1AYM3 1ASJ3 1UY3A 3MW3A 4P9YA 4JGYB 1U12A 4IGQA 5FMDA 2E7QA 4WZFA 4RR3A 5IAVA 1OH4A 2YG0A 1DQ6A 3QH6A 2JKXA 3ZFFC 4LHSA 4D7TA 3C7OA 1MS8A 4QWNA 2HWE1 3VBSA 1K5MB 4M4PA 3I2HA 4EROA 5DDJ2 3AP4A 4QDQA 3E5XA 5E88A 1LULA 5E6HA 5CKMA 2TNFA 3LIGA 1YRZA 5GM0A 1FATA 4E4ZA 1UOBA 3IMNA 5EJ1B 4Q4V3 4NHKA 4CP0A 3FJSA 1Q8VA 3POYA 4OUEA 5CADA 4YG3A 2XH6A 3P1IA 4FPOB 4IEZA 2FD8A 4DUVA 2O0OA 2E63A 3N9NA 4LJHA 4NMIA 3WQBA 1KEXA 5C8CC 2NP0A 4K6BA 2XG3A 3N36A 1RMU1 2CGPA 3KM5A 4KG0A 2Q8CA 3JBG1 1F5JA 2XQRA 1ZX5A 3WP4A 4RA0A 1W6QA 2MNGA 3TB0A 3H7JA 4LE3A 4IERA 3JD73 3VBOC 1AUYA 3C2UA 4EN8B 1Z0HA 1PZ9A 2BTVC 2XWJB 1VBA2 5A1LA 2AYHA 1G86A 5IJRA 1PO21 1GWLA 4L8QA 5DUWA 3ITQA 1UPIA 3LDRA 4RL7A 4XUNA 3U11A 2K0GA 1D7PM 4Q2FA 5C33A 2QBXA 1RIRA 2ARBA 4DOUA 2HWB1 4HSLA 4HLTA 1W6MB 5FKCA 4BM8A 3GCWA 3QOPA 2FCTA 2W1QA 2RMU1 1OLMA 4CCJA 2HWC1 3I49A 1LNSA 3WP3A 1UOJA 2DCYA 1JBCA 4ES9A 2WZR1 2JEMA 5IT6A 1CX4A 1H6YA 1HKDA 2PN5A 1XNTA 5JSPA 3HBKA 4Q27A 1UYPA 3I3EA 3JXSA 2XJQA 3HN3A 2CDPA 1W6PA 3NSTA 4RS5B 4AVVA 5FYIA 1GR3A 2IVIB 2K2SA 2Q4SA 3ZLIA 3J7NA 1CR7A 2BNOA 1YFWA 4KWLA 3ZKYA 5T5OA 1UIKA 3SLIA 1A8MA 4I01A 4BHPA 1WCKA 3D82A 1TME2 2XLGA 4RD7A 3E6BA 3VBFA 1ND3A 1GP6A 2QJVA 2R49A 1PVXA 2W1SA 2WYSA 5FZDA 2RJKA 4EWAA 3HN1A 4CEWA 2NMOA 3GJBA 5CFCC 2WQZC 1NKGA 2JB4A 1SDWA 2RS53 2WL1A 3DECA 3GDBA 1R091 4NRQA 4Q4X3 3W20A 1RUJ3 3QH7A 4NVPA 1B09A 4PLMA 1O59A 3E5UA 4N9HA 3K3OA 3ZYFA 4CXWA 1ODNA 1WGPA 5EFUA 3ZN5A 5J48A 3O1VA 2WRAA 5CZKA 3LSDA 5HPOA 1CIYA 1PM7A 3L2HA 1UF2C 2H6BA 3KSCA 1OMIA 3PDQA 4JGYA 4JX0A 5LBCA 3ZMOA 5JMCA 2W1UA 4Q8LA 5FCCA 2DVAA 2PHLA 4UW4A 5JZGA 1OA3A 4A7ZA 3GGLA 2DUQA 1PHMA 2EIBA 2J1UA 1VBD3 3ZXJA 3K51A 2BERA 3WG3A 1H1IA 4COWA 4XZUG 1PMHX 4Y5Z0 5LBFA 1RUH3 1UKGA 1UW8A 1VAVA 2VGDA 1RGSA 2VU9A 3ELNA 3PJYA 5H9SA 2GP3A 2ZMLA 1PX3A 3TAYA 2GC2A 3CL1A 3EJKA 2EAAA 1GZTA 3UGGA 1MEC2 2J22A 4CCEA 2VZPA 2FDJA 1CVNA 1TNFA 2QFEA 4FT8A 3TN92 4AI8A 4Z8BA 5I91A 1V6JA 3JB8A 1MS4A 3INAA 3PIJA 2A5ZA 1Q56A 5EIYB 1UZ0A 3WG2A 3VD3A 4Q4W1 3IPVA 1OFNA 1R1ZA 3R4SA 1QWRA 3VZKA 5I93A 4HETA 1BQPA 4IUGA 5IWFA 2LM3A 2X10A 2D97A 3UJOA 3TEXA 1JOBA 5KXDA 1NY72 1AYN2 1UX7A 1RUNA 3J7MA 2PHWA 3AJZA 3N9LA 3H0OA 1Q43A 2VAUA 1W90A 2EALA 1WLTA 3ZXLA 2RG4A 4DY5A 1HV1A 1VRH3 3ZXAC 4BQ1A 4HBNA 1IG0A 3AP5A 2D98A 3WR0A 1V6OA 2XVLA 1OUXA 4LIUA 3M3QA 5C3RA 3ZSEA 1FOD3 1W6MA 5G05L 2XONA 1NCRB 5K7PA 3DV8A 5FWEA 1CAVA 1RVF1 4LORA 1IOAA 3ETQA 3SITA 3MI8A 5GZFA 2NM1A 2JB8A 2IWGB 5F5IA 1YQ2A 4GMP1 4UBGA 4N9IA 4NHMA 1TMF2 2YFZA 2WKKA 4DINB 3Q9OA 3T0BA 3T1LA 3OPTA 3ZFEB 1QJX2 2RS11 3K4DA 4IV3B 1W6OB 2R0FA 4FFIA 4LA2A 1Z7S2 1H9PA 2EA7A 3AL5A 4RS5A 2D3RA 4FTEA 5J7MA 1RXGA 3AFKA 4GB31 3O1OA 5CVRA 4D8MA 4K7JA 1Y9QA 4N8MA 3LPFA 4QPGB 4N43C 1T6BX 3AB0A 3VBSC 4EN9B 4A6SA 3LKJA 1ZZ9A 1E5SA 2D44A 3ZDVA 4N7IA 5FZ0A 5DAQA 4GULA 2P6CA 1SFNA 5F5AA 3GZTB 4P5YA 4XEZA 4CP9A 1ULEA 1KITA 4P9GA 1ST8A 1RMU3 3FC0A 4DZGA 4K1YA 4MGSA 5ANQA 4CDQA 2YGLA 3CQOA 1WW7A 3JBG3 1O5LA 2QTWB 3AYCA 1H9WA 2CL2A 4MXVA 1PO11 1PMJX 1ENXA 3I4IA 1H8TC 1MQTB 5LY1A 4X6QB 4LXLA 5D8AC 1DYKA 3WNNA 3O1RA 5FPVA 4BPZA 3H3UA 3NL1A 4HSJA 3WW4A 1Y4WA 2JD9A 4NR1A 1HXS2 1WCQA 1ZVFA 2PHXA 3OBTA 3VDBA 1WD4A 1PIV1 1LKNA 1SLIA 4FOQA 1K5JA 1PO23 1UYZA 3BOPA 1ACCA 1MS9A 1W9YA 4OYUA 1UZYA 5E8AA 3RVHA 2QZ3A 1D0HA 3NQHA 3AX4A 4ZZ8A 4DY3A 3OGVA 2HWB3 5JOXA 1JZ2A 4L99A 5CISA 3C7FA 2JE9A 2RMU3 2HWC3 3I2GA 5BNNC 1JU4A 5K8SA 1GV9A 1W3VA 1KGYA 2R042 1SLBA 3TEWA 2WZR3 1MZ5A 2VMGA 2QQKA 3SNMA 5BNOB 3RDIA 4C1WA 3S5AA 3AFGA 4COUA 2WJSA 1VMHA 1QH6A 3ACIA 3ZXEA 1UN1A 3HD8B 1HRI2 1B35A 2W47A 3U07A 4YM3A 1SCSA 4Y1YA 5FY7A 4GKXA 1APNA 2WNEA 5GZDA 3I3BA 5CU1A 4F7ZA 3V0BB 1DGRN 4U2AA 4QX2A 4AQTA 3KT4A 4AVSA 4UXAA 5C5TA 3R6SA 4A3ZA 5GJ6A 1VRBA 3WUCA 1ND3C 2HWF1 5A6XA 4AGVA 1R093 1XYOA 5L9RA 5AFEA 2E7TA 4XFFA 2WT0A 1S0GA 4QX7A 1LHUA 2DFBA 5FYYA 1YFXA 4K40A 1T6GC 2DBNA 5FO8B 3O1UA 1H2NA 4D7SA 1LGBA 4HG6B 4XC9A 4HK9A 2ZHLA 5IVJA 5DZFA 1XYNA 2W39A 5FYBA 2ZOEB 3WF1A 4PDWC 4PI0A 1N3PA 3CO2A 3ZFEA 2KXLA 1DG6A 2MEV2 1FMD2 4IV3A 2VZUA 4BE3A 1JOPA 3ZFGB 3U10A 2VQ0A 4ET7A 5JDBA 4OI4A 2QE3A 5IVBA 3FN9A 5EYXA 1YNAA 4FFGA 4MSVA 4UF0B 4JRAA 5F2WA 2X5IB 4XURA 3O5SA 1ULFA 4WVMB 3WQ1A 1K5MC 2NZ9A 3B9CA 4FTSA 5M0TA 5T55A 3USUA 2VMDA 4Y1UA 3HT1A 1WD3A 2VNOA 1TVGA 1EUTA 2YGMA 2F4LA 4MX3A 4W65A 4PI2A 1CONA 2YC0A 2QQVA 4PCRA 1AJKA 4B1LA 3Q8FA 4Q4W3 3WF3A 2BJSA 5K9YA 2JXAA 1OT5A 3O1SA 4E4DX 1Q8PA 3PVEA 1XNBA 3LEMA 4E2QA 1HJGA 2JDYA 1V70A 3ZM8A 2ZCWA 1RINA 4GWJA 3G7DA 2DU0A 4IW3A 2GH2A 2W1WA 2VW1A 2TUNA 4O7XA 1JU3A 4J1XA 4UOJA 3RS6A 3VZNA 4AAXA 2P4EA 1PGL1 2CSGA 2EXHA 3ASIA 4QPYA 4AFMA 4AR2A 5HBAA 3M7AA 3ZXKA 3U0ZA 3LDBA 1O91A 1EPZA 3I3DA 4ZHNA 3O0XA 2F6BA 2X05A 3VBHB 3WNPA 4RYDA 3BIEA 3R4DB 1LOFC 1H4HA 1RVF3 3CDZB 1PGSA 4MXWA 5FP8A 3TBDA 2C24A 2RM22 2I45A 5A80A 2DVDA 2W91A 1NX9A 1W06A 3LAGA 4JKKA 1NE6A 4GMP3 3ZIXA 4YG0A 4DXSA 3U37A 1DZQA 4BMBA 3FUOA 3O1TA 3DEMA 4FO9A 4BK4A 3NAPA 2RS13 3VD4A 2J7MA 3I2OA 3KV4A 4HOOA 1F4HA 2JJ6A 1KD7A 4JKLA 1LGNA 4FFHA 4GB33 4Q8KA 2DCKA 4URAA 4RS5C 4YWAA 3T3YA 4HPKA 3V0BA 5JOWA 1D2QA 2DUPA 2QQPA 2GZWA 2UWCA 3LFIA 1NQJA 4M3CF 3CJIA 4LOTA 5LW9A 2UY8A 1K45A 1MEC1 1DBNA 2WN2A 3H8OA 4QXHA 5EQUA 1SPPA 5F2SA 5FXZA 1RUC2 2GU9A 2WIIB 3EBRA 4A45A 4ASKA 2R30A 1EUUA 1GZCA 1PO13 5KXCA 2DYCA 2B46X 1KQRA 3MZHA 4Q0VA 3WD5A 3SC7X 3P6BA 3POGA 3IAPA 2VECA 2WNUB 1A8DA 3BALA 4XFAA 1IQAA 3AKTA 2EVXA 4XUQA 3CLPA 3OGSA 1PIV3 1I5ZA 2B9VA 1DGWX 4IE6A 2XB6C 1POQA 3ACLA 1AR92 4K21A 3MBWA 4AQ6A 5HXVA 3VKMA 2RDQA 2VC9A 2V4AA 4GKYA 3ZFGA 3AMQA 2W94A 3LOIA 3VBUB 4DRRA 1AF9A 5FP7A 2YU1A 2AR6A 3UL2A 4L0PA 2D6OX 2BVVA 4UF0A 1OKQA 4LITA 2V5DA 1LB2A 2G1MA 2PHDA 4BQ2A 2JX9A 2VZ1A 4F83A 4M0HA 4WVMA 5FZ8A 1FAYA 1XQNA 5A3OA 3ZVXA 1QXPA 1SCRA 1KJRA 5CA6A 2VUAA 3JCIA 2EICA 2VCCA 4LLFA 4LK6A 4YG6A 5HCAA 3B7MA 3ZPOA 1DZTA 1FV3A 2CGOA 1VLNA 4PF5A 3SKVA 1CAXB 3HWJA 4Z2WA 5C71A 1JN2P 2XJUA 4IESA 1OD3A 1W99A 4IGPA 4QQLA 2YFUA 2G19A 3OGJA 4QQOA 4Y33A 1Z7S1 2DTWA 2WNVB 1UXZA 3FUQA 1R1A1 1XB9A 4FPKA 5A3MA 3R4UA 3WSOA 4IEQA 4RQPB 2XUEA 5KBFA 4ZXKA 3S6PA 2GSYA 1L7RA 2VQUA 3D4KA 4O65A 4QD2A 3HVDA 5IVVA 1Y43B 2BOJA 2JDHA 2VTXJ 2HWF3 2ZHKA 3WINE 1LGCA 2JDUA 2UURA 4I02A 4LQRA 4Q5OA 1GZWB 2Y34A 4KG8A 2O8OA 2ZEZA 1I9RA 5FP3A 3VBHA 3OD0A 3GBGA 1OQDA 1LTEA 5LATA 2E33A 1TQ5A 1ZBA2 2YY1A 3IB3A 3DN7A 2JG8A 4CDWB 3I2KA 1GBGA 4N53B 5A1AA 1KRIA 4LK7A 1NCRC 3KLSA 1OOPB 1RUF1 3EQEA 1DQ1A 3LA3A 1DDLA 3DPRB 4NAOA 1NAEA 2RVAA 4UT5A 4AHYA 1AR82 1HXS1 4XW3A 4CCOA 1A78A 1G8WA 1LHWA 3J8F2 1MS1A 1VBA3 4KH9A 1N1VA 1O6UA 4UW5A 3KF5A 1HV0A 3M3CA 4IEVA 3I2IA 5JSRA 2WS92 4FPJA 4XBQA 1QOOA 2GP5A 1US3A 4Y1VA 3ZFEC 5C3PA 3VZJA 4M0NA 2R071 2ZX4A 1GFF2 3PUQA 5DUVA 1QJY2 4HT1T 1KDKA 1RUE1 4YNIA 2R1BA 3AZXA 4RSUA 1ZRFA 1BMV2 4IETA 4QPGC 3N7JA 1UKRA 2AH2A 3CZJA 1OBNA 4CDUB 5FYUA 5F9TA 1V6IA 4BQXA 5J36A 2LRPA 4LBKA 4BWOA 3BTYA 1N47A 1VALA 2DVFA 3O1MA 1GLHA 3SEEA 1VBE2 5F3EA 5FY1A 1SLLA 4QPIC 2VNGA 1UOFA 1OF4A 5JOYA 4GH4B 3T0AA 1IG3A 4IEWA 3GXUA 3U78A 5JXIA 1WLWA 4B4PA 4ONUA 1JHJA 4YGBA 1F15A 1MQTC 4CCMA 2BFUS 1URXA 4BQ4A 5ACA2 2ZHMA 1OQEA 4DB5A 2YBPA 4RR3B 1JZ4A 3H1YA 1ULPA 2ZGRA 2H6CA 5FYTA 5DAXA 1UU6A 2UWAA 3VBUA 3ZSKA 2E6VA 4NPLA 3RQ0A 4SLIA 3ZSJA 3X29B 1L7LA 1SQ4A 3WVJA 4AWDA 3T4VA 2UU8A 3PU8A 4QHZA 1TZOA 2IXIA 1W9FA 4ORFA 1I1EA 3B5LB 1AR71 4QT6A 1QY4A 3I2DA 4D3WA 1RUOA 1LODA 4COZA 1VE0A 5T50A 4QB6A 5ABJB 2E51A 2DDUA 3V65A 4FFFA 1HN0A 1RUI2 2HYKA 4XIKA 2DFCA 3B02A 3IDAA 2VQTA 2SLIA 5BNOC 2PFWA 1ZZCA 2IUWA 2VBDA 2MEV1 1GQGA 2ZGTA 2Q1ZB 1LHOA 5JIAA 2WNVA 3RI9A 1R082 4TXWA 4GJZA 3UNPA 1PGW2 3DF0A 1E5IA 2PLV1 2Q1FA 1UOGA 1HB2A 3P5BA 4RQPA 4NROA 1RHI1 1UIJA 2HKXA 5CKQA 2AUYA 2RDNA 5IK4A 1R64A 3KCXA 1MEC3 4EQVA 2XJSA 5EPAA 1OD5A 3GJAA 5CB7A 4HVQA 3FLPA 4XETA 5JLVA 1JYNA 1DU3D 1VBD1 1G9AA 3ES1A 1GZWA 3MF9A 5KC6A 4QMAA 5JVVA 2Q8OA 5E89A 1YI7A 1QJU2 1GQHA 1QKQA 1AZDA 2CGNA 2HWD2 3ALQA 4EWEA 4XJ8A 2YPDA 1YO8A 1TNRA 1GKBA 1IQDC 2WO2A 2A73B 4Q1RA 5EJ3A 3DPRA 2VCAA 3GBWA 1NLQA 4CCLA 3U4XA 4RGAA 3QACA 4XPVA 1OVPA 1X33A 2QUOA 1PVC2 4G3YC 1H2MA 4O9GA 3HT2A 4YGEA 4ZKTB 1FXZA 2Q30A 4M01A 3UESA 1BEV1 2EIDA 2WZ8A 1Q3EA 4GALA 1S0DA 2KM2A 2R0HA 1Z78A 1E5RA 1WBFA 1IPKA 4H55A 2V09A 3RYPA 1VBC1 1LESA 2A7AA 2GNTA 4MUVA 2A71A 3WW2A 1BCXA 3IMMA 1HN1A 2Z4FA 4XUTA 2JD4A 4AVBA 2OQ6A 5FPZA 3VBFB 4NWWA 2MPFA 1LOCA 2X5IC 4HN0A 4S2DA 4CDUA 3VLBB 2GAUA 4CEWB 3GHMA 4ATFA 5IHRA 2P6HA 2ZKNA 4FPHA 5A3LA 1OXCA 3IM0A 1RTVA 3MICA 5FZIA 1S0EA 1NQDA 2PHUA 1SBFA 1Z7S3 4GIQA 5FTTC 4PIYA 4RGGA 3N3HA 5F8PA 1R1A3 4L97A 4Q4Y1 2OYZA 4FOVA 3MIBA 1AL22 4A4AA 1J1TA 2R062 2XL7A 4P9JA 3KMHA 1QJEA 4XXAA 5D1IA 4NHXA 4WVWA 2O1QA 4BXSV 4EWDA 4GJYA 2IXHA 4RHV1 5EV7A 3ZYBA 3HMYA 3HNYM 5JZGB 1W2UA 4CXYA 1GZ9A 2PAKA 1EV11 1TG7A 2R7EB 1LENA 4E4HA 4ZU7A 2GALA 2DV9A 1U5ZA 2C4XA 2N7GA 3OPZA 3BN6A 5L7OC 1DFQA 4LT5A 5C9AA 4NIDA 1J3QA 2AENA 1WBLA 1JXNA 3VBHC 2RJLA 1ONAA 1RUF3 5ABJA 1QOTA 1UO9A 3MV11 2JE8A 3B00A 3RSJA 5J1XA 1HXS3 4CU6A 1LU2A 1FPN2 1I6XA 2GMMA 4XF9A 3MFAA 5H9PA 5A6YA 1DGLA 2ZACA 3AYDA 3VN4A 3C7GA 4Y5SA 5GLTA 4TLFA 4QHOA 5AC91 3IPVB 4KI5M 4FP3A 4HZFA 2GNDA 4V2VA 5A7WA 5IYYA 1ZA7A 2VH9A 1V00A 2R073 1GWMA 3RZHA 2JDKA 2VL4A 3OTFA 1RUE3 4HKWA 3KZ4C 5FZ7A 2A3WA 2PHTA 1FNYA 1O8PA 2Y8KA 3MDPA 4K20A 4OHZA 3DYPA 5GLVA 1PK6A 1XC6A 5FREA 3W59A 3VDAA 2X8KA 3WDUA 3VZLA 2O8QA 3WW1A 1AR62 1QOSA 2A3XA 3KV9A 4FQ4A 4QM8A 3BB6A 1GNHA 2UWBA 5A7PA 2HH9A 1EAH1 3CMGA 3D6EA 3DCQA 2RS32 2VZTA 2ZGMA 3PHMA 4QKFA 4UW3A 3TRSB 2HLEA 1EP0A 3D8CA 3MPBA 3CZUA 3ZXFA 4XMIA 5C3OA 2B9UA 1CAVB 4B7KA 1W6NA 3IAQA 2QQNA 2P2KA 3KB5A 4QX5A 4AEDB 5LK7B 3AYAA 4P9LA 2XBO2 2WNUC 4X6RB 2VMFA 5BNPB 4E2SA 2Y6KA 4J1WA 4AK3A 3C7HA 3UV9A 1GP4A 4FOYA
chains in the Genus database with same CATH topology
3ZYPA 1UU4A 2P3JA 3MPPG 4LO5B 3LOBA 4XIOA 4AVAA 1AR73 4BA6A 1LHNA 3LA7A 4PBPA 1ZBA1 1WLCA 3GALA 1BYHA 3VDDB 1CJDA 1JUHA 2GN7A 2RR11 1LOBA 1V9U2 3AMPA 1RC6A 1KDMA 3SH3A 4CEYC 1AR81 1XU2A 2MEV3 4YM2A 5GZEA 4CDQB 2DTYA 2WT2A 4FPGA 4KBBA 5L36A 2V73A 4IV1A 1JYIA 2PLV3 3LWCA 1BKZA 3AKPA 5CFDB 1RHI3 2WNVC 2DCTA 1UAIA 1M4WA 4NO4A 4KL1A 3GNEA 4URTA 2ZGNA 3AM2A 4RQPC 1PZ7A 3IBMA 1O4TA 3M3EA 4Q0PA 3PJQA 4IQPA 1KFUL 1VB2A 2A3YA 1COV2 4R52A 1S0CA 4OHWA 1XYPA 4QM9A 4B7EA 5J3UA 1LU1A 1REFA 4CDWC 1ZZ7A 4N53C 4W6XA 4HK8A 1F8VA 4YZ2A 1OOPC 3DPRC 1D4M2 1BEV3 3L9JT 4KGGA 5H9QA 5AFBA 4ZU4A 2QDNA 1B35B 3RMXA 1BK1A 1VBC3 4EN7B 1ZZBA 1H2LA 4WVZA 1VBB2 3NVCA 3WQ0A 4JDOA 1NYWA 2LUWA 3E6DA 1G6NA 3JZVA 4JGZB 5I0SA 3NV2A 1HQNA 4OULA 1J58A 4B4RA 1QGLA 4AYUA 2XKOA 1QJZA 3SHRA 4Q4Y3 4JRLA 3WXPA 3OCPA 2ARXA 3WP6A 3OY8B 1PGW1 4D94A 4AEDA 5FDBA 1DHKB 1W39A 4GH4C 4RHV3 3GZAA 1VAMA 5BNPA 1EV13 3ATGA 4HN1A 4JTNA 3ZO0B 4LBNA 4CDXB 5E1RA 2DCJA 2D6NA 4RR3C 3ME2A 5E16A 3KD4A 2CNAA 2VOVA 1QQP1 2ZX0A 4HMZA 2QVSB 1G9CA 1C57A 4E2GA 4MGYE 4A2UA 3VDDA 2D43A 5K0UA 3USUB 1GANA 2GC3A 1C8M2 5ABJC 4M00A 4YZ1A 4I3GA 2WA4A 5FO7B 3RJRA 1QXRA 1WW6A 5AC93 2BWAA 2VNRA 5CG8A 1DF0A 1LEMA 4OZXA 3DL3A 3WUDA 1S55A 4EV0A 2ZX2A 4CTEA 3VKFC 3UK9A 1O3QA 2A6XA 3PNAA 5CFDA 5F6LB 5KHHA 4Q0UA 4COVA 2QDRA 2GNBA 1ASJ2 1XNKA 2GMPA 1ZRCA 2G9GA 1RJ8A 5F1RA 1ZBE1 2GC1A 1EAH3 4E9KA 3DGTA 3MYXA 3A0NA 3UKTA 4FOWA 2VUJA 3MIEA 4QXKA 3THTA 2XUMA 3WP5A 4MXWB 2HEWF 4ISRA 3IDEA 1XNDA 3URFA 4Y20A 4Q4V2 3AZYA 3N4MA 5CIRA 4AHXA 2VVFA 5EXOA 2VW0A 2XVGA 3VGIA 4INDA 4LO7A 1IHMA 2SBAA 3NAPB 2MHFA 5JAXA 3FHIB 2ZHNA 4R9AA 4AXOA 2WC2A 4BLJA 1YJKA 3ZYGA 4B3NA 5IUQA 5DDJ1 3JD72 4XQDA 3QD6A 4JV4A 1ZBA3 4HPKB 3MF6A 4YVWB 2RR13 5AVPA 4Y1ZA 4XMAA 3NJZA 1OI6A 1U5YA 4JGZA 1FI2A 3CJIB 4WV8A 3VBFC 1AR83 3B94A 4P9IA 3MLLA 3J8F3 3JB4C 4Q29A 3R0RA 4CEWC 1G9FA 1NCQA 1ZYBA 4OUMA 3WW3A 3OY8A 1UZZA 2OZ6A 5CAZA 5C4WB 2FMYA 5FMOL 3J4UH 1JOJA 2YMZA 1VBA1 4CDXA 4S2FA 1J1LA 1DQ2A 4JGYC 3KGLA 5JZGC 4DNYA 3B93A 5I8SA 5BYNA 2EAKA 1FYUA 1YYNA 3AYEA 4Q0SA 1RB8G 1C3HA 1GNZA 3ILNA 3I54A 1RL3A 2C1FA 3RWNA 1AX1A 1TEIA 2OVUA 1PNGA 1YXWA 3BPZA 1GICA 2RS52 4D7YA 4MYEA 3NV4A 4XFGA 1RUJ2 3I8TA 3WZ1A 1N1TA 3GYDA 3ZX7A 2DCZA 3N7KA 3SCHA 4MV2A 1KFXL 1C4RA 2VXRA 1TME1 4BIOA 4Z1VA 4Y4YA 4FXKB 1V9U1 2ZBJA 1AJOA 3SISA 1RUH2 1JHNA 3CJXA 1ENRA 4L92A 1JUIA 3ZPYA 5JI7A 2WFF2 3I7DA 2JG8B 1HQWA 5BY5A 3NW4A 4HKLA 3WDVA 3GHNA 3ZFFB 3R05A 3WCSA 4XFIA 3M1HA 2XVKA 4WVVA 5FQ0B 4S2HA 2UYBA 3BIWE 4AEDC 3GBFA 5CG9A 1AXKA 2GN3A 4OI0A 3UKVA 1ULGA 2GC0A 5BNPC 3AZVA 2VULA 1QQP3 4AVTA 1WMDA 4AEMA 2PHFA 2Y26A 2FMDA 4YVWA 3O7OA 3THPA 1CAUA 4EN6B 5J96B 2JE7A 1VIWB 4M3CE 1VRH2 3VDDC 2BPA2 5KHJA 3PVOA 3W9AA 3S7EA 3TN91 4ASLA 3ZN6B 2OZJA 2A6ZA 1FOD2 5EWSA 1ND2B 4XFBA 4FPLA 5C6CA 3AK0A 2I07B 3MGUA 4LBQB 4CDQC 2R1DA 3EO6A 4XHXA 1NY71 1AYN1 2VOWA 4C1XA 5C4WA 1QNWA 4I0WB 1BVVA 2BUKA 5CFDC 5JPNB 4AEKA 1ZBE3 1ZNPA 2HWE2 5KHGA 2Z42A 3DKWA 1RJ7A 4AQSA 1QXJA 3WDYA 3RMYA 2JG9A 1SBEA 5A33B 1YIPA 1YHFA 4K8FA 4CP1A 3I59B 4G4FA 1NLSA 2CTVA 4K3UA 3MIFA 4IEYA 3WQ7A 5BXXA 1V6LA 3HQXA 4W6YA 5EYYA 3QLQA 1TMF1 3KCYA 1OHFA 1RMU2 3IKWA 1QJX1 3MIGA 3WNXA 3ZN4A 4XF1A 3AMHA 1J3PA 1JTZX 5DDJ3 4XFCA 2EXKA 1B35C 1NA1A 3AKRA 4ES8A 3WOGA 1A6CA 1PO22 4YVSA 1D4VB 1DQ5A 3BOWA 3H8UA 3KQRA 3JU9A 4JGZC 4P5HA 1SLAA 3IIAA 1MZFA 3PMSA 2A6YA 4EJRA 5KHKA 2RMU2 4XF4A 4Y22B 2HWC2 4YM0A 1M06G 1WMFA 1SBDA 1S1AA 4QQPA 2E7AA 2D6MA 3SCFA 4GMP0 3ZFFA 2WA3A 3N7MA 5FQ0A 1G9BA 4MH0E 4S2GA 1CD3G 1AR63 4XJZA 4FPFA 2V5YA 3LCPA 4R9DA 4XJWA 3LB9A 3DUIA 4CDXC 4JVAA 2IFWA 4IV3C 1OLRA 3WY6A 1BXHA 2XWBB 5HI0A 5FRAA 1WUVA 2ZZQA 3S7IA 1OPMA 2P17A 1N3OA 5LK5A 2G4IA 2DWRA 1XNCA 3WV6A 2R041 4P14A 1I3HA 4Z82A 5C8CA 5I0TA 1LECA 4NHLA 3ZN6A 1MACA 1X82A 4IL7A 1MZ6A 1D0GA 1ND2A 1HRI1 5CNAA 1MVEA 2X53S 2UY9A 4IXLA 1HRV2 3PVNA 1UPSA 4LBQA 3HAGA 2ERFA 3ZXGA 2XJRA 1LEDA 1TME3 3POSA 3AP7A 2EF6A 3WDXA 3IN9A 4XXPA 1V9U3 2XHKA 1RUG2 3VBRB 1RUD2 1ULDA 3BODA 4PLOA 1OLQA 3ZYJB 4XF0A 2Z79A 1LOEA 5DUUA 5A33A 4AFAA 4YSFA 5C9AB 4OVEA 4B29A 3I59A 4DFSA 1QF3A 2XLAA 3PLQA 1TE1B 2ZA9A 4AVCA 3WHTA 3T2TA 1IGOA 3WX5A 3O0VA 1CPNA 5IK5A 1CQ9A 2FBEA 5DZEA 3N7LA 3ILFA 3OD4A 3ZSMA 4Q4W2 2D7FA 3ZDSA 2I2SA 1FMD1 1YUDA 3NAPC 4IEXA 1E57A 4XJUA 1QDCA 3ENRA 4H14A 2PELA 2OUHA 1PK6B 1F5FA 4YVWC 2IXCA 3VHOA 2ZTNA 3TN93 4OI1A 3CJIC 4QGNA 5T5JA 4XE9A 4LHLA 4PIXA 5GKAC 4Y22A 5T5PA 1WCSA 1W6NB 3VV1A 3QCWA 1AYN3 3AKSA 4KWJA 3FWEA 2VVDA 2VOXA 2ZGUA 4ZU5A 4CZSA 3M70A 2RS12 3MIDA 2PQQA 5TSWA 4H7LA 3ZYIB 4IEOA 1MR5A 3ST7A 3RI8A 3POWA 1F9KA 4A7KA 5BNNB 3ZFGC 3WLUA 2IFRA 1H2KA 3FMGA 1ENSA 1ZRDA 1ZZ6A 3G6JB 4FPYA 4KQ7A 2WFF1 1HIXA 2RM21 1AXZA 2D93A 1X7NA 3TOJA 4XILA 3ECQA 1TMF3 4AQ2A 2ZAHA 1LOGA 4M3CB 1QJX3 3MFCA 4LEJA 1HW5A 3VHPA 3UJQA 1ZM1A 4N90A 4OUSA 1QMJA 2ATFA 3H9AA 2NLRA 4IV1B 4XFHA 2WSVA 2UYAA 4P9XA 4QQHA 2HEYF 3CNAA 1CN1A 3WDWA 1QH7A 4AW7A 3C3VA 3JQWA 3KS7A 4FP2A 1UMZA 4MGKE 5LRSA 4C90A 3MLKA 4LBJA 3UKNA 3ROUA 1S0IA 3VBRA 1VB4A 1MVQA 2QZ2A 4ASMB 4YGDA 1BJQA 2HJIA 1J59A 3LSEA 4BCUA 2LTNA 1RUC1 4AFDA 1UX6A 3SCGA 3L2YA 3LZZA 4PJYA 4LUMA 2WZPP 1OSGA 2FHRA 4AI2A 2JG8C 2F4PA 1BBT2 2ZKLA 4BZ4A 3JQXA 2ZGQA 1S0FA 1AR91 2NN8A 3PMEA 4AGRA 3ZIWA 3FLTA 1OA2A 2IZWA 4N43A 4WM8B 5FLHA 1SMVA 2ZGPA 4PQ9A 4YW5A 2R16A 3FZ3A 2WQ4A 4AG4A 1S0BA 3SH4A 2R043 1FX5A 1G7YA 1Q8QA 2HWF2 3AMNA 1WW4A 3RJ2X 4AGGA 1CESA 3RNSA 3V56A 2B8MA 4ATEA 2D6KA 2YXSA 4K9SA 3ZSLA 4YM1A 3WDTA 1H8TA 5FO9B 1NOVA 5D8AA 5KWRA 1HRI3 1H4GA 5BNQA 5IK7A 5J37A 4L11A 2AZ5A 1ND2C 4KNCA 3PVBB 1DIWA 1NXMA 4UBHA 1KS4A 2YPJA 5SV8A 1HLCA 3TNQA 2XLFA 1NE4A 2EIGA 4PIZA 1X8MA 5BNNA 3VBUC 2VVEA 1KS5A 2B45X 2ES3A 4LA3A 2WFPA 2ETEA 4CRQA 1N3QA 5K0UB 4Q26A 4RFT0 1Q5OA 4E27A 1JYCA 4R8HA 4R9CA 1XXNA 1O3SA 1ULCA 3J8F1 4M3CA 4MGZE 3S30A 1FMD3 2IXLA 2Q0AA 1IS4A 4DS0A 2WS91 3SXWA 3ZYRA 4BH9A 3E97A 2VW2A 4KU7A 4WZCA 1QJY1 1OFSA 4F8AA 1PGL2 5LEJA 4JAAA 1BMV1 5GZCA 2D6LX 4R9BA 1HQLA 2P3KA 3NKGA 1C28A 3HIFA 4Q0QA 2A75A 4XJ9A 4CP2A 4Y1XA 4LBLA 2OIIA 4FPCA 1VBE1 2Y0IA 1H0BA 2BQPA 2IXJA 2TBVA 3FLRA 4QGLA 5KC5A 1HRV1 3B69A 4Y20B 3MW2A 2D3PA 4PDWA 5BPXA 3IDBB 3OYWB 3AZWA 5ACA1 3OF1A 3RG0A 1Y3TA 1J3RA 1RUG1 2A70A 4LO8A 1RUD1 2GNMA 3O12A 1LOAA 4CYDA 4WM8A 1K5MA 3P3NA 4K1ZA 4XBLA 2QKDA 3RYKA 2WFF3 2H0VA 1UCXA 3FBYA 2RM23 2W0XA 4I0BA 3RRDA 1CIWA 5FPXA 2BNNA 2YV8A 1BZWA 5JCTA 1ZRRA 1OQ1A 1NXD1 2ZX3A 4ITCA 1RUI1 4KWKA 1QU0A 4WM7B 3ZXDA 2ZX1A 5BUVA 1REDA 5T3NA 4CDUC 3BTAA 4LHNA 2CWSA 4OHXA 4GXLA 1NCQB 2ZMKA 2B5HA 4G9SB 1V6KA 2ZAAA 1QNYA 1LJ7A 1R081 4I30A 3APBA 5JIUA 1VP6A 4Q1PA 4AF9A 2FZ2A 2CWMA 4I0AA 4JCKA 1SLCA 3AMMA 4ISQA 4FAHA 4LLOA 4I09A 4TYSA 1JH5A 1LOFA 1SLTA 2YDEA 1RUC3 2JENA 4MVTA 3VBRC 1REEA 3AXEA 1KJLA 2NQYA 2EXJA 1QJU1 2HWD1 1U5XA 1O3RA 1MS0A 2FZ1A 5C9AC 4FVVA 3N35A 2HEVF 3ILRA 2NMNA 4GWNA 1D2SA 3D0JA 1AR93 2BNMA 3SH5A 1PVC1 4B4QA 5C8WA 1O3TA 2HWE3 2GH8A 5DUXA 2VY0A 1R1A2 4Y26A 1MS3A 2QNKA 3WG4A 1WA4A 4FBFA 3H3ZA 2DF7A 1AYM2 5FAXA 3NV3A 3V0AB 3JUUA 2DURA 3H1WA 2CYFA 5GALA 4P9WA 3ES4A 1N1YA 2D5HA 5I0UA 1C8NA 1ZZ8A 3E6CC 3OBRA 1C1FA 1PK6C 5FOJB 4C0BA 4QPIB 5GLWA 3TWIA 5DXDA 3EHKA 4V1PA 1MS5A 2BW8A 4YZ3A 2XL9A 1RUF2 2YHJA 1AL21 4C0HA 4DXZA 2R061 3OYWA 4LHKA 4FSJA 1O7FA 3RYRA 4YZ4A 2OW4A 2ET7A 3MIHA 2ILMA 1DQ0A 1PZ8A 4C91A 5I8YA 4U36A 3OJBA 2R072 5DG2A 1RUE2 5B2GB 3SMHA 4R4ZA 3AP6A 3B01A 5FFOC 2PHRA 1YI9A 4WBBA 1CAUB 2BGCA 4FXGB 3LGRA 2P37A 1X8EA 1XU1A 1BBT1 4WM7A 1UU5A 1FPN1 4AI1A 2E53A 1O4YA 4BOWA 2DVGA 1IS6A 2WS93 3B3QE 3MEPA 2P3IA 4JC1A 3TNPB 4LO6B 3S0MA 1QJY3 4FPEA 2Z69A 2CAUA 2W68A 3FFZA 4IV1C 4LO4B 4E4SA 4XDQA 5JOZA 1S2BA 2CY6A 2VQAA 5GZGA 2A6VA 3ZMNA 1AR61 1SACA 1AXYA 2B39A 4XJAA 1WLDA 4X8PA 2WSUA 4AI3A 2JECA 2RS31 2JG9B 4BLIA 1VBE3 1AR72 1NCRA 4LUKA 2XKPA 2ZABA 4F3JA 3WHUA <