3M1HA

Crystal structure analysis of the k3 cleaved adhesin domain of lys-gingipain (kgp) from porphyromonas gingivalis w83
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
176
structure length
174
Chain Sequence
b'AEVLNEDFENGIPASWKTIDADGDGNNWTTTPPPGGSSFAGHNSAICVSSASYINFEGPQNPDNYLVTPELSLPGGGTLTFWVCAQDANYASEHYAVYASSTGNDASNFANALLEEVLTAKTVVPEAIRGTRAQGTWYQKTVQLPAGTKYVAFRHFGCTDFFWINLDDVVITSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine specific cysteine protease
publication title The modular structure of haemagglutinin/adhesin regions in gingipains of Porphyromonas gingivalis.
pubmed doi rcsb
source organism Porphyromonas gingivalis
molecule tags Cell invasion
total genus 42
structure length 174
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 3.4.22.47: Gingipain K.
pdb deposition date 2010-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07675 Cleaved_Adhesin Cleaved Adhesin Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m1hA00
4WZFA 3NWKA 1G8WA 5T5LA 3VKLA 1CVNA 3R05A 5E8AA 5H9QA 1AX1A 2P34A 2NMOA 4AWDA 1SLCA 2HYKA 4KBBA 3MEPA 1LHWA 1WBLA 1LULA 4FPLA 4LBKA 2UWAA 2W08A 3POSA 3WHTA 1W0PA 2CWSA 4SLIA 3IN9A 3WCSA 1S0JA 2W68A 3A0NA 4FPYA 4FPEA 1H9WA 2A71A 4YZ4A 3R4SA 5E88A 5GLZA 3U4XA 4AGVA 5GLTA 1HKDA 3N7MA 5FRAA 2AH2A 1D2SA 2CWMA 3M1HA 1LTEA 3AK0A 2JECA 5DZFA 1N1TA 3TB0A 1URXA 2P37A 1VLNA 4Y1VA 4XYXA 2JD4A 1ULCA 3N7LA 3VKOA 2ES3A 3B9CA 4K21A 3B69A 2NYYA 3AZWA 4Q2FA 2R0FA 1GNZA 3VKNA 4GWNA 3WDUA 1LOBA 1Q56A 4XJAA 3LSEA 1V6MA 4L8QA 5DZGA 2ZGSA 3B00A 2GN7A 4YG0A 5DUWA 4XILA 4C1WA 3QCWA 1SCSA 4FP2A 4P9YA 1GNHA 2DVAA 2ZGRA 3PVNA 4M3CF 5DUVA 2B7YA 5IK4A 4DPNA 4Q1PA 3USUA 3AJZA 4LBLA 1QKQA 1RINA 1CPMA 3C2UA 1GBGA 2LALA 4ZXKA 3AX4A 1MS9A 2JDZA 4K20A 1LHUA 1JN2P 1W0OA 1OFSA 2DYCA 3I4IA 3UJOA 5GLVA 3KM5A 3RSJA 2E6VA 2WLQA 4GKXA 3LSDA 4WVWA 4XJ9A 1H9PA 3Q9OA 4JCKA 4M3CA 4BLJA 3ZXLA 5GALA 3WV6A 3USUB 3CNAA 4R9AA 4Q27A 1ULFA 1BXHA 2EXJA 2JJ6A 1UZZA 1DGLA 3BOPA 1AF9A 1KDKA 3DUIA 5JLVA 5JOYA 2D7FA 4UW4A 1IS4A 1SBDA 2NM1A 2TEPA 3O12A 4M3CB 2DV9A 4P14A 5DG1A 4XTPA 4YM1A 4FPKA 1LOEA 1CQ9A 4FOQA 1DQ6A 3BODA 1S0FA 5T50A 4XMAA 1VAVA 3POWA 3W59A 2AUYA 3D6EA 4FVVA 4M00A 4XTMA 1DLLA 1HDKA 3ZSKA 4YGCA 1Q8OA 2WSUA 4YG3A 2EXIA 3BTAA 1Q8QA 1AXZA 2VU9A 1QOTA 1UX6A 2FMDA 4Q1RA 1VIWB 1CONA 1ENSA 1YO8A 1C57A 3OYWB 4XBLA 1A3KA 1C1LA 2GALA 1JYCA 5CA6A 2C5DA 3FFZA 3SH3A 3ZXFA 1WLWA 2VY0A 3FBYA 1SBEA 2R16A 3WDVA 3UK9A 3V0BA 5DG2A 3WOGA 1DQ5A 2VUAA 4LBQD 3I8TA 1ZA4A 3AXDA 1TEIA 3VKFC 4JRAA 4Y22A 3ZSLA 2P3KA 2ZA9A 3UL2A 1MS5A 4XIKA 1G7YA 1RITA 2Z42A 1SLIA 1SBFA 2ZACA 3R4UA 4YG6A 3H0OA 1NXD1 1BQPA 2VW0A 3AXEA 4FP3A 3V0BB 2D6PA 4ATEA 1GICA 3M3QA 1QMJA 2V73A 4AYUA 3WZ1A 1WLDA 1XQNA 4NOTA 4XHBA 5F5QA 1AX0A 3T1MA 1S0BA 4YZ3A 3ILRA 2VW2A 3WNXA 1SACA 4P9WA 4Y22B 5EWSA 4IQPA 5T54A 3OY8A 2PHFA 3PVEA 3ATGA 3AYEA 5EXOA 5IK7A 3WG1A 4HL0A 1GV9A 1WW5A 1GKBA 2WT2A 2OW4A 4YM2A 1LU2A 1GYKA 2ZGTA 3N35A 1LOAA 3JU9A 5GZDA 4BPZA 3OGGA 5CAZA 3M3OA 2YXSA 4I30A 3OPZA 3OY8B 3WDWA 3T1LA 1S0CA 4DRVA 5GZGA 2ZHLA 3AJYA 1C1FA 1FV2A 4M3CE 1MS3A 3NV2A 3M3EA 2DUPA 2A6WA 1PZ9A 5FREA 1JXNA 3RG0A 4BOWA 1LHOA 1BKZA 2ZZJA 2GMPA 5CB7A 4FPJA 4PBPA 3ZXKA 4F83A 5GLWA 1IS5A 1Y7BA 1DBNA 1H30A 1V6OA 1N3QA 2ERFA 2R1BA 3ZSMA 5JOWA 1JHNA 2I2SA 3ZXJA 1Z0HA 1LEMA 4PCRA 2R49A 1MS0A 1FNYA 3A4UA 1HQWA 3NV4A 4K1YA 1IS6A 1V6KA 1UL9A 3O0XA 1PZ7A 1S0GA 4YM3A 1LEDA 4XJZA 4Q8LA 5GZCA 3DGTA 1UPSA 2A6VA 2DTYA 3POYA 4TZDA 2D6LX 3O0WA 3MW4A 2LTNA 1W6QA 1G9FA 4Z8BA 5DUUA 1LHVA 1QGLA 2WT1A 1HQLA 2D6MA 4AGGA 2JKBA 2NZ9A 4AGRA 3LCPA 3WDYA 1S0DA 3ILFA 5HCFA 2E53A 4LBQA 4MYEA 1W6MA 2G4IA 2ZHNA 1JUIA 1DFQA 2UWBA 2DURA 2DU0A 2PHTA 1JW6A 2CTVA 2C9AA 3WVJA 1LOCA 1W6QB 3D5OA 1LGNA 5T5OA 2P2KA 4PF5A 4FPHA 2YMZA 3WG3A 1J1TA 2BQPA 2OUJA 4LBQB 1W6MB 4PBOA 5GJ6A 1MS8A 2OUHA 1QNYA 2CNAA 4YLZA 3WDXA 4R9BA 3O0VA 2GNDA 4YW2A 3RS6A 5JOZA 1ENRA 2R0HA 4XHXA 1V6JA 1OKQA 3MPPG 1YRZA 1ENQA 3ENRA 1UKGA 1DZQA 3OYWA 4BQ1A 4C1XA 1N3OA 4CRQA 1PZ8A 1A78A 1DQ0A 2WKKA 1LJ7A 2KM2A 2ZGQA 3AYDA 5H9SA 2AENA 1GZWA 3HR9A 2WSVA 2ZAAA 2GMMA 1V6IA 2ARXA 2ZMNA 1MVEA 1ZM1A 3MW2A 4FPGA 1SLTA 4RL7A 3AP5A 3ZYRA 1WW4A 4DS0A 3HN1A 1QOOA 3OBRA 4XJ8A 1CJPA 1DHKB 2CL2A 3AZZA 1QDOA 3IKWA 1N1YA 2PHUA 1D0HA 1AXKA 1GZWB 1DYPA 1KJLA 3NV1A 4XJWA 4WVVA 1AX2A 2YZ4A 3QLQA 1LU1A 3ZPYA 2W39A 3B3QE 4XDQA 4Q8KA 4FQ4A 4FPCA 1ONAA 2D3SA 5GM0A 3SISA 5T55A 4BLIA 3ASIA 2WT0A 4GALA 1JOJA 4WV8A 1F9KA 4UW3A 5JDBA 1G9DA 2ZGKA 5IK8A 4XBQA 5AVAA 4R9DA 4U2AA 3W58A 5H9PA 3HMYA 1YIFA 3N36A 1IKQA 3APBA 4XJUA 4Y20A 2RHPA 2E7QA 3AP9A 4Y24A 3AZVA 1AXYA 1G9CA 2ENRA 1DYKA 1UN1A 1FX5A 2OVUA 1IKPA 3GNEA 2DVFA 4XE9A 4CTEA 1KJRA 4FOYA 1MZ6A 4ASMB 1QU0A 1VAMA 3WG2A 5SV8A 1CN1A 3GALA 4Y20B 2ZBJA 2DUOA 4U36A 3V0AB 2JE7A 4YM0A 5GZFA 5JOXA 3SITA 3AP6A 4HANA 2SBAA 3FLRA 1MZ5A 3L2YA 3ZSJA 2ARBA 2NMNA 3VKMA 3BIWE 1WD3A 1CPNA 1R1ZA 3ILNA 4FQZA 1MS4A 1LOFC 2ZHMA 4R9CA 3O5SA 3NV3A 4GXLA 5EYXA 4ISRA 1FATA 2ZHKA 1O4ZA 1APNA 2EAKA 5KXDA 2UU8A 2EIGA 1S0IA 5L73A 1SFYA 3FUOA 5E89A 4AVVA 4BM8A 5JMCA 4ITCA 3WUCA 3TAYA 3FLPA 2GN3A 1N1VA 2ZGLA 2VW1A 1LHNA 2WNEA 1N3PA 3ZXEA 4XOGA 4DFSA 2GMEA 1B09A 2ZGNA 4LBJA 4W65A 3SLIA 5GZEA 4UW6A 2E7TA 4LBMA 1GZCA 5DUXA 2GDFA 1DQ4A 1QOSA 2GNBA 4YGEA 3SH4A 1UAIA 2ZMKA 2NN8A 4H55A 2AREA 4ISQA 4OZXA 5CNAA 5IK5A 2ZMLA 1CR7A 1LGBA 2A7AA 2DVDA 2UURA 3RMYA 4YGDA 4YW5A 1Z78A 3RRDA 1G9AA 2ZGMA 2D6NA 2A6XA 1YI7A 4LBNA 2WQZC 1SLAA 1O4YA 1UMZA 2Q5TA 1LECA 4GWMA 3N7KA 3B01A 4GKYA 1MVQA 3INAA 1V00A 4FPOB 2EXHA 4Y1YA 1DQ1A 4LBOA 5T52A 3PMEA 1LODA 3WG4A 2DVGA 2NP0A 5T5JA 4FOVA 2H0BA 3UJQA 1YYNA 2EXKA 1N1SA 4P9XA 1MR5A 4DQAA 2FHRA 5H9RA 3SH5A 4YZ1A 4FOWA 1IS3A 4M01A 1SLLA 2D3PA 1HLCA 3WLUA 1QF3A 3T2TA 5F9TA 3AP7A 2YROA 1IOAA 2V5YA 5CBLA 1LOFA 4JC1A 1W6NA 2W52A 3KQRA 1WD4A 1ULEA 1WCSA 4TYSA 1SCRA 2R1DA 3WDTA 1WUVA 2ZKNA 4D69A 1V6NA 3AYCA 3PJQA 2XB6C 2CYFA 1AJKA 5IT6A 3FUQA 3IM0A 2PHXA 2PHRA 1ULGA 4XIOA 4UW5A 1AVBA 1I3HA 2A3WA 1N47A 2D44A 5HCBA 5IUQA 1Q8PA 1LENA 3SNMA 4XZPA 3VV1A 4AVSA 2GNMA 1W6NB 2AYHA 2D6OX 2XG3A 1VALA 3OBTA 1QNWA 1KQRA 1S1AA 1A8DA 1FYUA 4BMEA 1FNZA 2D6KA 1NLSA 2D3RA 1DQ2A 1MS1A 4YW1A 1Q8SA 2E51A 3WCRA 5T5PA 1KDMA 2AGSA 1CESA 5LK5A 3RMXA 4DRRA 1G9BA 1G86A 3AFKA 3AZYA 4XXPA 2EF6A 2YV8A 2AR6A 4CZSA 5BYNA 4GA9A 1S0EA 2CY6A 5KXEA 1LOGA 2WJSA 1U0AA 5GLUA 2ZGPA 3WUDA 1AJOA 4YZ5A 1GLHA 1GSLA 4Y1ZA 4ATFA 3D4KA 1RIRA 5DZEA 2EALA 2A3YA 4YW3A 2P3JA 1WBFA 3PVOA 1YXWA 4RA0A 4BMBA 3MW3A 1ULDA 1FAYA 4NO4A 2D43A 2DWRA 1OQ1A 2PHWA 1I1EA 3A0KA 4FPFA 1LGCA 1Q8VA 2PELA 4PQ9A 1GANA 2SLIA 4XXAA 1KITA 2DUQA 3V0AA 2P3IA 3M3CA 1SLBA 2JE9A 3FLTA 3N7JA 3RQ0A 3ZYPA 3M2MA 1F31A 3IMNA 1JBCA 1V6LA 1C4RA 1BYHA 3VUOA 3IPVA 1JYIA 4Y1UA 4AVTA 1BJQA 4XBNA 1W6OA 4ZKTB 3OJBA 1EPWA 1W6PA 2ZGUA 4XMIA 4YGBA 2A75A 2ZABA 5DXDA 5KXBA 5HCAA 1X50A 1GZ9A 4YFWA 2A5ZA 1UZYA 2ZGOA 1BZWA 1LESA 2A6ZA 1LCLA 3AZXA 4K1ZA 3ZVXA 2DTWA 5JVVA 3AYAA 1AZDA 3IPVB 3V64A 2VXRA 1W6OB 4YFZA 1W6PB 4YZ2A 1KRIA 3JUUA 1F5FA 1WW7A 1MACA 3N3HA 2DU1A 4Y26A 5EYYA 2A6YA 3V65A 4YW4A 2A70A 3WHUA 3AP4A 2GNTA 1FV3A 1WW6A 2DVBA 1QDCA 2UWCA 1CIWA 1DIWA 4Y1XA 2YY1A 1WLCA 2A3XA 5KXCA 2VH9A 4Q26A
chains in the Genus database with same CATH superfamily
4WZFA 5T5LA 1NQJA 1UY0A 1W2NA 3VKLA 3WP6A 1YQCA 3R05A 2B46X 2ARCA 1PNFA 2WFF2 4P02B 3BU7A 1PNGA 1RUF3 2NMOA 3DPRB 4AWDA 1H6YA 1XE7A 5FQ0B 1HB2A 1VBD2 4XF1A 1LHWA 4GH4A 1RUH1 2Y33A 1REDA 4LBKA 1OI6A 1OXCA 2BWAA 3OSDA 4UFIA 3WHTA 1W0PA 4BWOA 1OVPA 1UY3A 3IN9A 3WCSA 3ALQA 4FFIA 4KGQA 1VAKA 4Q0SA 4CEWA 1H9WA 2JD9A 3LKJA 5ANQA 1ND3B 3E6BA 3ZFGC 5CU1A 1PIV2 1OPMA 2E63A 2P6HA 2RR13 2XKOA 3N7MA 2AH2A 3M1HA 3AVRA 2ZAHA 1VMJA 4A7ZA 4RHV1 5F3GA 1NCRC 4Y1VA 3SKJE 3MUY1 3N7LA 4XYXA 5F2WA 3T09A 3CJIA 4NAMA 2MHFA 1O3SA 5DQ0A 4K21A 5FJHA 4HG6B 2Y64A 1QJZA 5FMDA 1ZZ6A 2B45X 2JG8B 5FYSA 4DY3A 3WDUA 1Q56A 3VBRB 5HPOA 2WZR3 4LIVA 5A3OA 4J1XA 3KT4A 2WZPP 2CAUA 2GN7A 4O9GA 1H1AA 3VHPA 2VZRA 2H6CA 3RYRA 4C1WA 2QQPA 2ZGRA 2DVAA 2WQ8A 1X9PA 3VKOA 4DPNA 1VBA3 4D0QA 4LBLA 5BNOB 1CPMA 2YUEA 4S2FA 5JSOA 1W0NA 2LALA 4IEOA 1XPWA 4ZXKA 4CUAA 4K20A 4EN9B 5L9VA 1KFUL 4KWJA 1DU3D 3LOBA 2VCCA 1YUDA 4E4HA 4OMDA 2RDQA 4QX7A 1R1A3 2WZR1 3KM5A 4PDWC 3RVHA 2WFF1 2RS13 1CX1A 4Q4W2 3Q8FA 4BJ0A 3MYXA 4BLJA 3S5QA 4OULA 4EZHA 3KT1A 1VBD1 3USUB 3CNAA 2WWUA 1JHJA 1DGLA 3BOPA 2QKDA 1C3HA 3KV5A 4INDA 4LKSA 4AQTA 4QQLA 2WNVB 5EPAA 1ST8A 4J6GA 4BQ5A 4QQ2A 5AVPA 2VMFA 4GMP3 2HWF2 3V56A 3O12A 1BK0A 2DV9A 1R1A1 5HXVA 4P14A 4CEYA 4F7ZA 1RJ8A 3I49A 3RZJA 1JZ4A 4XTPA 1XNDA 1CAWA 4COVA 3T0DA 4JDOA 4E8CA 2CU5A 4EZ4A 5F39A 1DQ6A 4ASLA 2YB7A 2WAOA 2BGOA 3S30A 3POWA 4FVVA 3ZSKA 3HPNA 2WSUA 5FXZA 2ZS6B 1VMFA 4NPMA 1UIKA 5BNNA 4CP9B 5A3NA 1QOTA 1C8M3 3PHMA 3VGIA 1ENSA 3OYWB 3RYKA 4XBLA 4IEYA 3UKNA 2VZOA 1WLWA 3JXSA 2VY0A 4M4PA 1IG0A 4QM8A 1OOPB 4KWKA 1F5JA 3R6SA 1PO13 2BGPA 4GD4A 4CDUB 5FLJA 3D0JA 5FO9B 4LQRA 2CHHA 1NOVA 3D82A 1Z7S2 4XURA 3CJIC 2XWBB 3ETQA 2Z42A 3KZ4C 3AL5A 1SBFA 2ZACA 3JQXA 3VZJA 4YG6A 4DOUA 1NXD1 1EP0A 1AL23 4ATEA 3VZKA 1GOFA 3M3QA 4QXKA 4RS5A 4RSUA 4AI1A 1NG0A 1AR83 2YU1A 4LO7A 4AL9A 4XETA 1AX0A 4YZ3A 3VDBA 1WKYA 3ILRA 1SACA 4X6QB 3I2GA 4CDWB 5F8PA 5BXXA 3MBWA 1OKOA 2PHFA 1H1MA 1REEA 2BFUL 2G9FA 2WAAA 5LBBA 2YU2A 1GV9A 2HWF1 4OI0A 2GAUA 5FIXA 2XGXA 5BPXA 4AEDC 2OW4A 1JU4A 2XJQA 3JD73 4YM2A 1PM7A 2P5BA 1BVVA 3N35A 5HBAA 3KLSA 3QACA 2YXSA 2KR2A 3ACFA 4V2VA 3UT0A 3L2HA 4CCLA 3J26N 4C0BA 3OEBA 4OI2A 4GQ7A 3NV2A 1T6BX 1NXMA 2VULA 3VBHA 1RUJ2 5J3UA 1C5HA 1DZTA 1EUTA 5FREA 3RG0A 4EJRA 2X29A 1BKZA 2PHLA 5DN2A 2GMPA 2R042 3FMGA 4QGMA 5FZ8A 5A70A 5BY5A 5JWPA 4YVWA 5IW0A 1JTZX 1Y7BA 1H30A 1V6OA 4FFHA 3ZN6B 3AVSA 4PJYA 5LBEA 5JOWA 3ZXJA 4B1MA 3NKTA 1MEC2 2X53S 3LA3A 1Z0HA 1HX6A 2R49A 1Z7S1 3A4UA 3UV9A 1RUNA 3NV4A 4KBZA 5F6KA 2WN3A 3HBKA 4QU2A 1V6KA 3CBNA 5CIRA 4H7MA 5FY7A 1UU4A 1LEDA 4AHWA 3HD8B 4X6RB 2C4XA 1LAJA 3WQ0A 4N9IA 1UPSA 3POYA 2DTYA 3RPQA 2ZTNA 2G19A 1WCUA 3RYPA 3DF0A 3X29B 1W6QA 4EN8B 3NJVA 1LHVA 1QGLA 1QQP1 2D6MA 4DUVA 4AGGA 1QY4A 2NZ9A 4LR4A 3LCPA 3WDYA 3MFCA 4PI2A 5FY5A 1OH4A 1S0DA 3PUHA 4JGZA 3FBMA 4A6OA 1QJU2 1UF2C 2E53A 5A6ZA 2G4IA 4OI1A 3ACHA 2EAAA 3K4DA 2QDRA 2UWBA 1TMF2 1VRH3 4NIIA 3J7HA 4HOOA 4B7KA 4BQXA 2C9AA 1LOCA 1LGNA 3DXTA 3WW2A 1HXS3 2JDNA 4OZOA 4N8MA 4RS5C 4FPHA 5KR7A 3AMNA 3VL9A 5FBZA 2R32A 1OA2A 3POEA 1H4GA 3MIBA 3J7MA 3H9AA 3QH6A 2PHDA 5EIYB 4LBQB 5I0UA 3LAGA 1W06A 2C1FA 2CNAA 2CGPA 1ENRA 2HWD2 1VR3A 4IV3C 1F4AA 1JYTA 1YRZA 1ENQA 1LKNA 1RVF2 2MEV3 2R041 1DZQA 3ENRA 3LOIA 4UI9L 1X82A 1UMHA 5FMBA 1W8UA 4C1XA 3IIIA 3MV11 5A1AA 1OMIA 4N53B 5H9SA 5A80A 1MEC1 1W9TA 3HR9A 1FXZA 3I2KA 2XJVA 1ZRRA 2ZAAA 1UOFA 4ONUA 3H8RA 2ZMNA 1JZ6A 1ZM1A 2QQUA 3MW2A 4M0HA 4K8RB 1SLTA 5I0TA 3ZSEA 5LA0A 2EVXA 1YFWA 1RXGA 3VZMA 5IFPA 3OBRA 4Y3OA 3EXUA 1OPOA 1X9TA 2QQOA 3U10A 2MPFA 4FCAA 1QDOA 2BNNA 2DCJA 1GZWB 4XUNA 3GBWA 1SZBA 1IPSA 4YVWC 3AKSA 2W87A 4NRPA 4XDQA 3NAPA 4Q4Y3 3VBUB 4YNIA 4CP2A 5T55A 4BLIA 1NUKA 2YYOA 4GALA 5AC92 1JOJA 1QJU1 5JDBA 1NE4A 1OA3A 3T4VA 1G9DA 4UFJA 2R062 1EAH3 4YVSA 5AVAA 5IK8A 4R9DA 1BEV3 5FY9A 5H9PA 3WP3A 1TMF1 1YIFA 1IKQA 1ZBA3 2Y6KA 3APBA 3GCXA 4B4RA 5FYBA 4XJUA 2JENA 1V0AA 2BDRA 2GU9A 4CVUA 4ZZ5A 5EQUA 1NZIA 3AL6A 4M0NA 1X33A 2VZ3A 3GZTB 3PUQA 4LPLA 2JDPA 3IB3A 5C4WA 1ASJ3 2X5IB 3KT7A 2DVFA 3NNLA 3CEWA 4NE9A 5ANNA 5FYIA 2PFWA 2WFPA 3LB9A 4ZXEA 4FOYA 1MZ6A 2YPDA 4O61A 2VMGA 4XUTA 1XU1A 3W21A 1UQXA 1BEV1 2B8MA 1ZBA1 2JE7A 1RVF1 4MGIE 4S2HA 4NHLA 3ZDVA 3ZMNA 4AVBA 4LT5A 4UFKA 2SBAA 4QDSA 3VHNA 3L2YA 2FCVA 2Y6HA 2NMNA 5HXMA 4NMIA 3LGRA 5FKBA 1WD3A 1UXZA 5DDJ3 2ZX3A 3TEWA 1ASJ1 2ZJCA 1CAVA 2O14A 3OGSA 3O5SA 1W39A 4K3UA 4R9CA 5D2AA 3EBRA 5J7MA 2DBNA 3THCA 4LITA 4A42A 1D0GA 1O4ZA 3MIHA 4KNCA 5FFOC 3ZFFB 4I01A 1I9RA 2BV4A 1OLRA 4A41A 4XFAA 1SFYA 1WMEA 1EYBA 4PHZA 1UY2A 4XFFA 3ZO0B 5L7OB 3I54A 1W2TA 1ZRIA 1PGL2 2R073 3RNSA 4DFSA 1K5MC 2VW1A 1WZXA 3ZXEA 1QEXA 2Z2SB 1ZBE2 4QPYA 1OD3A 1XNTA 4O7XA 1TNFA 1XE0A 3U0ZA 2HLEA 5DUXA 2ET7A 2OPKA 4N43C 1REFA 1UAIA 3FWEA 2NN8A 2EIDA 2AREA 5AC91 5C5TA 1W9FA 5ABJB 3SMHA 5IK5A 1CR7A 1YWKA 2R061 2A7AA 2DVDA 2UURA 3BYWA 2XHKA 3GYDA 4HVOA 5K0UA 5J98B 1HV0A 1NCQB 3FC0A 2A6XA 5CFCB 1J3QA 4LBNA 1BK1A 3MFAA 3SC7X 4I0BA 4BIOA 1POV1 1PHMA 2Q5TA 4Q4V2 3JB4C 3DYPA 4WM7B 3E6DA 1JOPA 5D1IA 2EXHA 1C5IA 5C9AA 5F7UA 2PYTA 3PMEA 4I0WB 2LS6A 1LODA 5I0RA 1LRHA 2DVGA 2B4KA 2NP0A 5A32A 3IWZA 4NN0A 5IVYA 4FOVA 1YFXA 2H0BA 4X8PA 5DAVA 4YZ1A 1MR5A 4EROA 2XBO1 3SH5A 2Z69A 4DIQA 4OHYA 2ZEWA 2UY8A 2D3PA 3IDEA 1RUD2 1QF3A 1OC1A 2IZWA 2OQ6A 2YROA 2ZKLA 3TN93 2W0XA 2D40A 3J8F2 1BVP1 5CBLA 1LOFA 1KD7A 2W52A 5A6XA 4OHZA 3KQRA 1WD4A 3VBFB 2R1DA 2WZEA 3PJQA 4QX5A 2CYFA 3BI3A 1AYN2 1W8HA 2PHXA 3VL8A 1SFPA 1ULGA 1JI6A 4L99A 5CFDA 2XJPA 2YHJA 3EMRA 5B4NA 3CDZB 1DZRA 3E5QA 1PGSA 2BW8A 4Z2AA 1SMVA 1IG3A 3VBSA 4IESA 2D6OX 2AYHA 5A6YA 5I8YA 1VALA 3OBTA 1ZBE1 3TN91 1ZZCA 1KQRA 1FNZA 2IXJA 1E57A 3PIJA 2WLPA 3GJBA 1HRI2 2D3RA 3MGUA 4RR3B 1LNSA 1Q8SA 5DAQA 5FTTC 5J48A 1CESA 1VJ2A 2RVAA 1HV1A 2VQUA 5I0SA 4IERA 4DRRA 1AUYA 1G9BA 4QX1A 2FQPA 3AFKA 3K3OA 3AZYA 1R082 4XAAA 2FDKA 5BYNA 4QPGA 2N7GA 4GA9A 2XL9A 1RUE3 2CY6A 2Q1MA 3GF6A 4LULA 2VNOA 4Q4V1 5GLUA 3SXWA 5CADA 1PK6B 1V9U1 4GIQA 3GBFA 1GSLA 4LIUA 4QXCA 5DABA 4OQ9A 3U11A 3LEIA 4A3ZA 1QH6A 4A45A 2TBVA 2WNOA 4YW3A 1W99A 2BZDA 1YXWA 5BV6A 1O5UA 1ULDA 1FAYA 4NO4A 2WS93 3AMQA 4MGYE 3GXUA 1WMDA 3ELNA 5JIAA 4FPFA 3EO6A 1LGCA 1Q8VA 2SLIA 2Y0OA 3K75B 4QGLA 4XXAA 1KITA 5JAXA 1TNRA 3U4SA 3N7JA 4D6QA 3J8F1 3FLTA 1STMA 4IE5A 5C8CB 3M2MA 3IMNA 1JU3A 3HAGA 1JBCA 1V6LA 1C4RA 1D7PM 3VBRC 2EICA 2ZOEB 4NHYA 3KVAA 3OG2A 4JGYB 4ZKTB 1NAEA 4GWJA 4XMIA 4YGBA 1W9YA 2A75A 1RUI2 2ZABA 4OUMA 2HWC3 4MSVA 4GB32 1W8WA 2WS91 4QKBA 2JG9B 4CU8A 5A6QA 1NT0A 1VBC3 1LCLA 2W1UA 2XJRA 3AZXA 4GZ9A 3PTYA 3MUZ1 3IPVB 4LKDA 5FR3A 2VXRA 3IZOA 5A3MA 1HRI1 1NYWA 1H1IA 3QH7A 5FDBA 1ACCA 3N3HA 5LCWL 4G4FA 4WM8B 4YW4A 3AP4A 2GNTA 1WW6A 4CZSA 4QB2A 4E27A 1DIWA 1R081 4XABA 1WLCA 3ZFEA 5JPMB 5EP9A 5LK7B 4AK3A 4DQAA 2D93A 5A33B 1GQGA 1NA1B 2RV9A 4XFCA 1HN1A 5ISLA 3VBOA 1S2EA 5H9QA 3FFQA 3OUHA 1HRV3 2IXHA 3VBSC 3HEIA 2QVSB 5FZEA 1UZWA 1RL3A 1Q43A 1WBLA 3LEMA 2VC9A 4P5HA 5IVBA 5FZLA 4MHUA 4HPKB 1Q5OA 2RMU1 3HQRA 2R30A 4QHZA 3S7IA 5FZ4A 1S0JA 2DBIA 3M7AA 3C7EA 2A71A 1O5LA 5E88A 3OD4A 3Q8EA 4CCCA 1AYM2 2G9ZA 1QJFA 4LNVA 4QPGC 5FXWA 4D6RA 3U4XA 4AAXA 3ES1A 2ET1A 2RE9A 5FRAA 1CGPA 1QWRA 3OBZA 1CZVA 1LTEA 5FZ3A 5DZFA 1N1TA 5JZGB 1OH3A 1URXA 3TOJA 1SHWB 2BJSA 2FDJA 2JD4A 1OOPC 2LROA 3W5MA 1RUI1 4GB31 3B69A 4CDUC 4Q2FA 2R0FA 3NL1A 1WLTA 2J42A 1LOBA 2ZEYA 3PUSA 1KFXL 4XJAA 1X8EA 4R52A 3RZMA 4HKWA 5FMCA 1R093 2QQIA 4AVAA 2VQAA 3C3VA 1COV3 3QCWA 1SCSA 4FXKB 5FZOA 3PVNA 2B7YA 3WX5A 1W9SA 5J96B 4D7YA 4MH0E 3AJZA 4EN0A 1RINA 1MQTB 2V72A 5FPBA 3I97A 2VNGA 1WA6X 1UYXA 5KHGA 4Q0PA 1AR62 4KU8A 3I59A 2JEMA 2JDZA 4LKEA 2Y26A 4RQPB 1LHUA 5LY1A 1OURA 3P3PA 4CDWC 3VLBB 3H3LA 1JS9A 1ZRDA 3GZAA 2JDYA 2BERA 4XDOA 2WLQA 4GKXA 3LSDA 1R091 1H9PA 4JCKA 1RMU2 1COV1 4RGGA 3WV6A 3ZKUA 3RJRA 3KSCA 4F8AA 1MZEA 4Q27A 1ULFA 1BXHA 1QJX2 3JB8A 4NAOA 2JJ6A 4R9AA 4YW6A 5FYVA 1AF9A 1PO23 2VVFA 3DL3A 3BPSA 5CEHA 5JOYA 4PT6A 3KV6A 4IE4A 4LO8A 3IDCB 4P9JA 5L9RA 2HWB3 4UXAA 4QPIA 5ACA2 3ZFEC 2NM1A 5FWJA 1AYM1 4CP0A 4M3CB 1O3TA 5FZ1A 4YM1A 3O1UA 5KWRA 4FOQA 1ZRCA 4RGAA 2KD7A 5T50A 1RUH2 2ILMA 4XMAA 3W59A 3AKTA 4M00A 4XTMA 4CCOA 1RB8G 2IXLA 4E4SA 4FSJA 2BFUS 2EXIA 2VMCA 3BTAA 1F8VA 2G1MA 1GZTA 2HWB1 3KMHA 3PJYA 2CAVA 3EJKA 2F4PA 1H8TB 1CONA 1C57A 4ARYA 3WR0A 1C1LA 2GALA 1JYCA 4L0PA 3SH3A 2J1TA 1SBEA 2R16A 2VNVA 4LA2A 1RUF2 1XBFA 3WDVA 3UK9A 2VBPA 2JXAA 1DQ5A 1JZ3A 4FFFA 2VUAA 4RHV2 4UFLA 1UMIA 4QHBA 3I8TA 2VD7A 2OX0A 3AXDA 4Q0UA 3MIDA 1QXJA 2WNUB 4XAEA 3GGLA 1TEIA 5JXIA 1RUG3 2HH9A 4Y22A 2ZA9A 3MLLA 1SLIA 4PDWA 1ZZBA 2UY9A 1JYVA 3OPWA 3V0BB 2RR12 3ZOIA 3MLKA 1GICA 1L7QA 1V70A 2C9KA 4FT8A 1RMU1 1O6UA 5LRSA 4XUOA 1XQNA 4XHBA 5FUIA 1RC6A 1CZTA 1S0BA 5BNPA 3ZYJB 2VW2A 3NJZA 4P9WA 5EWSA 3B7MA 5AFEA 5CVRA 2D5FA 4UBGA 3UGFA 3ATGA 3AYEA 5IK7A 5LBFA 4TLGA 1WW5A 2KA3A 4Q4X3 5ACA1 3H8XA 1K45A 5FPXA 4MGZE 2HBUA 2WZR2 3WQ1A 2GC2A 3JU9A 4BPZA 1F2NA 3VDDB 3PUAA 2CDOA 1I6XA 4JKMA 2JX9A 3OPZA 1CD3G 3OY8B 2IC1A 4XQWA 3RFRA 4DRVA 2VOTA 1DGRN 5FPLA 4YYOA 1VBA2 1FV2A 3PU3A 1VRBA 1CX4A 4N53C 4QX0A 4DO0A 4IGOA 4WVMB 3THDA 2DUPA 4AFAA 1JZ2A 4MXWB 3I2FA 1PZ9A 3MI8A 3WINE 3VD9A 1JXNA 4QPIC 2E7AA 1R1A2 2E31A 3RZZA 2RS12 4PBPA 5JPNB 1IS5A 1RUF1 2I74A 4UFMA 4XF4A 5A7WB 3ZSMA 5JI9A 2VZPA 4PF1A 1JHNA 2VJXA 4PI0A 3RGBA 1UD1A 1Y9GA 2ZEZA 3U14A 4OCTA 2BRTA 1TG7A 1FMD3 1E5HA 2IXKA 5LA1A 2JDKA 1B35C 4MG2A 2K2SA 1ZA7A 1UL9A 3ON7A 2PTMA 4LLFA 4MGSA 5LZ6A 5FUNA 5APAA 1F35A 2IFRA 2RR11 3C7OA 4META 5BNQA 5K4LA 3O0WA 2VZUA 1XOYA 3MW4A 5C3PA 3AMHA 5DUUA 4AEMA 2WT1A 4W6YA 1HQLA 5CZKA 2JKBA 4AGRA 3DYOA 2W9XA 5JXJA 2WBKA 1OF3A 1W8FA 4FI9A 3CKHA 3OGRA 2VOVA 4P9IA 4JDNA 5HCFA 5A7QA 1UY1A 3NMBA 4AEDA 2ZHNA 1C8M2 3CJXA 1JUIA 4ZU5A 5C3RA 4EWDA 2DU0A 3C7FA 1IGOA 1JW6A 1G6NA 1OUSA 2CTVA 3PMSA 2UYAA 5FZ0A 2WR9A 4A6SA 2D97A 5C9AB 4OUEA 3OB8A 4PF5A 2YMZA 1PO12 3R4DB 1J1TA 5L9BA 5DMYA 4D7SA 1XU2A 1VBA1 2OUJA 1W6MB 2QZ3A 4O9EA 3I3BA 5BNPC 2GH2A 1CAUB 3G7DA 3N9OA 2PA7A 4YLZA 2HWE3 3OUIA 1P8JA 3O0VA 3ZXDA 5E1RA 4GJYA 5CG9A 1R64A 1UO9A 2LRPA 1VP6A 1YQ8A 2R0HA 2RS33 4LMFA 3E6CC 1O4TA 1OKQA 3MPPG 4FXGB 4Q0VA 4OLLA 1XRUA 2RS11 1AL22 4BQ1A 2VQTA 2XLFA 1LJ7A 2HBTA 1AR82 2XPJA 5KHIA 1VB4A 2WSVA 3WW4A 1V6IA 1VBB3 2ARXA 4LORA 3EHKA 5M0TA 1MVEA 1UW8A 5EHDA 4NVPA 4RL7A 3AP5A 4NWVA 3ZYRA 1WW4A 4DS0A 1QOOA 4XJ8A 4GMP1 4PQQA 1CJPA 1ULOA 5FYYA 5FZAA 1VE0A 3H8UA 2CL2A 4R4ZA 3AZZA 3JD72 2XL7A 4E4DX 3IKWA 3KVBA 1LB2A 1GWLA 1RXFA 1KJLA 2Y6FA 5FZIA 2RJ2A 2VMHA 3QLQA 3I2JA 1PVC3 3WEZA 1ZNPA 3LE0A 4Q8KA 4JRLA 4AI0A 5LRRA 2D3SA 4TSVA 5GM0A 4CCMA 1WMFA 2XLGA 2BNOA 3ASIA 2PMWB 1OT5A 4UW3A 1AR73 1FOD3 1C8M1 2CSGA 2VMIA 4QKDA 5KHKA 3N36A 3KQ4B 3UNPA 3SEPA 3KHBA 4Y20A 1QJY3 3POFA 5FK8A 3E5XA 3FX3A 1PO11 4A7KA 4J25A 3ZN5A 1G9CA 4XC9A 2QJVA 1QQP2 3LA7A 1WWYA 2H0VA 4W50A 4CTEA 3BGAA 2O1QA 4IV3A 1VAMA 1W90A 4IUGA 3VD7A 2ZBJA 1US3A 4LO5B 4QD2A 5GZFA 4ES8A 3FHAA 1AL21 2RS53 4HANA 4KWUA 4TN7A 4A2UA 1QJY1 3B5LB 4HZFA 3ZSJA 3TWIA 5FOJB 1AR81 4R8HA 2WWSA 3VKMA 3W5NA 3HT2A 3ILNA 3NW4A 4NIDA 1GUIA 3KV4A 2XXZA 4KG0A 2EAKA 1APNA 3BTZA 4MGQA 4RR3C 4BE3A 1YHFA 4L92A 4JDMA 3FUOA 3JD71 1U5XA 4BM8A 2J1VA 1VRH2 3RZKA 2R7EB 1FI2A 2OIIA 3TAYA 1IQAA 1N1VA 1NX9A 1N3PA 3DEMA 1HXS2 4RN5A 5FO7B 1B09A 2ZGNA 4LBJA 4W65A 5FJKA 2E7TA 2VMDA 3WNPA 3EB7A 3NNMA 4XCAA 1DQ4A 2QQMA 1FPN3 2GNBA 4BQ3A 4XVHA 1PK6C 2ZMKA 4OZXA 3SH4A 1O3RA 5A7OA 2B9UA 1KS5A 1W8NA 3RMYA 4BK4A 4D6SA 3S6PA 2DFBA 3WF4A 3FZ3A 2VOKA 3UKTA 2ZGMA 1PMHX 2OZJA 5FP3A 3S57A 2MEV2 3M8LA 4N90A 4L97A 3VD3A 2JDMA 4LHLA 1UMZA 1LECA 4I2OA 3OGJA 4GWMA 3K51A 4GKYA 4I09A 4D7TA 4FTBA 4CU6A 3INAA 1V00A 4FPOB 3O14A 3HNMA 4CDXB 2C26A 4LBOA 2YGLA 1NY72 4S2DA 2VUCA 5K7PA 2BOJA 3T0BA 1DG6A 5C8CC 3WG4A 4JVAA 4HLTA 2WQ4A 4LOTA 4XPVA 3UJQA 1YYNA 2EXKA 4P9XA 4CYDA 2C0ZA 1US2A 2FHRA 1SPPA 5H9RA 3NRUA 3OTFA 4JGYC 4XFIA 1IS3A 2IVIB 1SLLA 4IEPA 3WLUA 4EV0A 3A7QA 2HEYF 3AP7A 5EV7A 3WY6A 1HJGA 2NPIA 2W3JA 2VL4A 4DXSA 4Z2WA 2XKPA 1W6NA 4JC1A 2GZWA 1DGRA 4Q4Y2 2DCKA 4TYSA 3SCGA 1SCRA 2VG9A 2VNRA 4IV1B 1NKGA 2JICA 1U12A 2XB6C 2OT7A 1AJKA 3HN3A 3FUQA 3O7OA 4RYDA 2YBPA 1CAXB 2WWJA 1EAH2 3VHRA 1BEV2 2AEYA 1I3HA 2A3WA 4IEQA 2D44A 5HCBA 4WM8C 1ZBA2 1Q8PA 1VRH1 1K5MA 3T4HB 4AVSA 4HSJA 2XLAA 4K8FA 1GQPA 4CDQB 1HXS1 1WA4A 3O1SA 1S1AA 1A8DA 1FYUA 4JX0A 2BNMA 3ZDSA 4BMEA 5KC5A 1NLSA 1UWWA 1ASJ2 4N43A 1DQ2A 5LATA 2E51A 3U07A 5HI0A 5T5PA 3CZUA 2AGSA 3AM2A 3ROUA 3KCXA 4NRMA 3VD5A 3AMMA 1ND2B 2EF6A 4E2QA 2AR6A 2HEWF 5I93A 2AEZA 2VCMA 5FK7A 3QOPA 2MEV1 1ZRFA 2XQRA 1S0EA 2VOXA 5KXEA 3O1MA 1X36A 4LEJA 4LHKA 4L9BA 4W6WA 3OEAA 1H6XA 2PQQA 1RHI3 4LJHA 4LUKA 5FY0A 4ATFA 1UY4A 5DDJ2 3D4KA 2EALA 4XW3A 1NY71 1F15A 5J09A 1XNCA 4Y4RA 4Q5OA 4LA3A 3ZFGB 4CCNA 5JZGC 3MW3A 2DWRA 1OQ1A 5DAPA 5FZKA 2V4VA 3ZXAC 2OKXA 3A0KA 4PIYA 4S2GA 2Q30A 3LIHA 1GP5A 2PELA 1UYPA 2J22A 4PQ9A 5JR7B 4ASKA 4FBFA 2R072 3V0AA 1NCRB 2P3IA 3RQ0A 3H7JA 1W9WA 3JBG3 3BU0A 3PUIA 5FYUA 4Q4Y1 3VUOA 1JYIA 1RJ7A 5FXVA 2WUHA 3D3AA 5D8AA 4XFHA 1HW5A 2YPJA 2RM23 4XZUG 4UBHA 1W6PA 5DXDA 4UF0B 3WD5A 1JZ8A 3ZKYA 1O8SA 1EAH1 5AFBA 1Y9MA 3BN6A 1GZ9A 2XBO2 3SKVA 4MLOA 1LESA 4A7YA 2AACA 1MQTC 1NLQA 3GM8A 4CA9A 3ZVXA 2DTWA 2OPWA 3AYAA 5JVVA 3B94A 1W8ZA 1EV13 1AZDA 3T2OA 5B4XA 3V64A 4YSFA 5A1FA 1W6OB 1XYPA 3WSOA 2PQSA 5LASA 2UYBA 2WL1A 3DPRA 2DU1A 3J7NA 3V65A 4D3WA 5FQ0A 1H2KA 2B39A 1FV3A 1S4CA 1JUHA 3H42B 4LLOA 2DVBA 4DEQA 4BCUA 2YY1A 2A3XA 2OXBA 1D4M3 2VH9A 4OVEA 2C24A 1E5SA 2I07B 3MIEA 2QZ2A 2WZ8A 1G8WA 3NWKA 5E8AA 4RFT0 3U78A 1AX1A 2P34A 4ET7A 1ND3A 3TN92 3S0MA 2W94A 1SLCA 4OMCA 2HYKA 4G3YC 4KBBA 5DDJ1 4OQ8A 3MEPA 4CCJA 4BQ2A 4JKKA 3BIEA 2ADDA 2UWAA 3RI9A 1SDWA 2ZX0A 4IW3A 5LA9A 2IXCA 2WO3A 4BA6A 2YFUA 2YFZA 3NQHA 4FPYA 1D4M1 3FJSA 4KWLA 5C5UA 3NVCA 4YZ4A 3WNMA 3R4SA 2FCUA 1JZ7A 1W28A 3LA2A 5JI7A 2R071 4AGVA 5GLTA 2JG8A 1UYZA 1HKDA 1GFF2 3AKRA 4ZZ8A 1D2SA 2CWMA 3OOXA 4GH4B 3VBRA 1V9U2 4GULA 5IATA 2VMEA 1SDDB 2IVJA 4HSLA 5FMOL 2A1XA 2P4EA 5FY1A 3TB0A 4EN6B 4MADA 5A3PA 4AI8A 4B4QA 1TME3 1VLNA 1BBT3 4CEWB 2ES3A 2XHNA 5E6HA 4QMAA 4XCBA 2Q0AA 3DXUA 5BNOA 3J4UH 1WMXA 1IZ3A 2WNUC 1JMUB 3POBA 1RUE2 3LSEA 1V6MA 1CJDA 2CDPA 4L8QA 3IBMA 4BISA 4CUGA 1JODA 5DUWA 3KF5A 3C7HA 3ETPA 5F3CA 3UKVA 4FP2A 3CJIB 4M3CF 3R0RA 3CF6E 1TME1 2RDSA 5D8AC 3HBZA 3USUA 4AHZA 1QKQA 2OQ7A 2ZZQA 4HBNA 4FO9A 5F2SA 4XUQA 1GBGA 2WS92 4NPLA 4IL7A 3Q8AA 3P1IA 2WNVA 1W0OA 4KI5M 2E26A 3I4IA 5GLVA 1DLCA 3K3NA 3RSJA 2E6VA 3RZGA 4BQYA 5FP8A 1ZVFA 4COZA 2ZEXA 4MXVA 2XQXA 2ZX1A 3ZXLA 4BXSV 4CCKA 1ALYA 4H14A 5F5IA 1XJAA 5JLVA 1KDKA 2QQVA 3DUIA 3DPRC 4EE2A 1UCXA 2AZ5A 4UW4A 5SV5A 4QQOA 1IS4A 1PMJX 3CLPA 4KGGA 4H7LA 2ATFA 5J36A 2PAEA 1VBC2 5A7SA 3UGGA 2HEVF 5DG1A 3SCHA 2BU9A 4CP9A 3USSA 5IHRA 1NQDA 4DXZA 2VXJA 3BUCA 1LOEA 3TRSB 1ND3C 3KGLA 2IWGB 3T0AA 3BODA 4NWWA 4Z1VA 1OOPA 1VAVA 4PIZA 3RJ2X 1YQ2A 2AUYA 4CDUA 2RMU2 4ZU7A 3CMGA 4AXOA 4YGCA 3SQOA 4AAPA 1W2OA 1AXZA 3HQXA 1IQDC 3LWCA 4CEYB 1W2AX 2PAKA 2VU9A 1UX6A 4JHZA 4B7EA 1VIWB 1VMHA 4AI9A 5IAVA 1CAWB 5CG8A 1RUE1 3T2PA 5G05L 4QXBA 5CA6A 2C5DA 3FFZA 3ZXFA 3AKQA 1HRV2 2JG8C 4XFGA 3LDKA 4I02A 4TLFA 5TSWA 2Q4SA 3WOGA 4LBQD 4COYA 3CIHA 5BNNB 4XDPA 1U5YA 2J1SA 5FXXA 4LXLA 1H2MA 4CDWA 3KB5A 1OQDA 3UL2A 2FDFA 3LIGA 3I2IA 1G7YA 4XIKA 5BNOC 1TQ5A 1CIYA 3FE5A 2X05A 3AKPA 3H0OA 2IUWA 2VW0A 3AXEA 4FP3A 4RFRB 1UNBA 4YRDA 1JYNA 4UWDA 5A3UA 5A3TA 2F17A 4KU7A 1L7RA 3WZ1A 2XUMA 4NOTA 5F5QA 3I3MA 3T1MA 1BMV2 4DXTA 2VPVA 2VE1A 4LE4A 1XYOA 4IQPA 5FPVA 4I3PA 1QHDA 2HWC1 2X09A 4JQTA 4HL0A 1ZX5A 3GDBA 3I2HA 3OCPA 1GKBA 2WT2A 4RS5B 3WP4A 1VBC1 3HVDA 2WNVC 1GYKA 2ZGTA 1LOAA 1SG3A 5GZDA 2I45A 2PLV3 3ZYHA 4ZS2A 1R092 3OGGA 1COV2 2P1BA 3M3OA 4Z92B 1QXPA 3UGHA 2RDRA 4EYUA 3WDWA 3T1LA 1K5JA 1S0CA 5EJ1B 2QUOA 3ZN6A 5FPAA 5I8TA 3AJYA 2W1WA 2Y38A 1C1FA 5FBJA 4M3CE 2NQYA 3ZM8A 4P5YA 1MZFA 2L9LA 1XNAA 4KH9A 2E32A 2Q8OA 2A6WA 4AE2A 4BOWA 1LHOA 4KL1A 1J3PA 3DECA 2WC2A 2EIBA 3HJRA 1YI9A 3ZXKA 1HRV1 4L11A 3SEEA 3I3QA 3QBQA 4LE3A 1DBNA 2ERFA 3U1XA 4HN0A 5IVFA 3I3EA 1H0BA 2JKXA 1PO22 4QWNA 1LEMA 4TTGA 2ADEA 5LY2A 3VBHB 2XMLA 3RZHA 1MS0A 1FNYA 1XSQA 1YEWA 1YLLA 4EWEA 3CQOA 4K1YA 1KGYA 2HWB2 3O0XA 2NLRA 4XJZA 5IYYA 4YVWB 2BWCA 4Q8LA 1L7LA 5GZCA 1VBE3 2A6VA 2D6LX 5BUVA 4UFHA 2JB8A 2QQNA 1BMV1 1G9FA 2W1SA 3GBGA 1WCDJ 4MO3M 3NKGA 1IHMA 5IJRA 3WQBA 1E5RA 3SHRA 1AR93 1A8MA 2FMYA 3ILFA 4AI3A 1OVSA 3H50A 4LBQA 4CUBA 5IFTA 1K3IA 2WABA 2DURA 2GC0A 2QCSB 1UU6A 1AL0G 4E2GA 1W6QB 5FZ9A 1YJKA 3IT8A 5T5OA 2P2KA 3THPA 3H1YA 1PGW2 1DP0A 2EIEA 1ZZ8A 1UOBA 1UOGA 1W04A 1X8MA 3KGZA 4JGZB 4QX3A 1AR91 4N53A 4BHPA 1MPXA 4PBOA 2P6CA 3BB6A 4Y4YA 5GJ6A 1MS8A 4HK9A 1UKRA 1RUG2 3PU8A 4ZONA 1RUC3 3WDXA 4E2SA 5HV4A 4R9BA 3RS6A 1EY2A 2GNDA 3MICA 1YFUA 5JOZA 4XHXA 1V6JA 4QKFA 1DDLA 3K4AA 4AOCA 4W4ZA 1DYOA 1HB1A 4KQ7A 5JMOA 2WO2A 1N3OA 5FYHA 4CRQA 1A78A 3AYDA 2WKKA 2OYZA 2AENA 1GZWA 3VB9A 2BVVA 3POJA 2RG4A 1PO21 3NNFA 2XH6A 3P3NA 4IE7A 4FPGA 1B35A 1Y4WA 2FBEA 4IGQA 4TXWA 3VBUA 3HN1A 4Q4X2 2QQLA 1U5ZA 1XC6A 2OA2A 2XJUA 1N1YA 5E16A 3DV8A 1DYPA 2OZ6A 4XJWA 4IEVA 4ZPIA 4P9LA 4WVVA 1AX2A 3I3DA 4XQ4A 1XXNA 4LHNA 3N9LA 2J1RA 4FQ4A 1XB9A 1OD5A 2O8OA 2XUEA 3AFGA 5KHJA 1RYYA 4FTSA 4DZGA 2IXIA 1SFNA 2X5IA 3MIGA 4CDXC 3IDAA 5DAXA 2GC1A 2K9ZA 4ES9A 4LK6A 4WBBA 4DNYA 2VZ1A 5FWEA 3I2DA 2VZVA 5FZFA 3NAPB 2RHPA 1PGW1 2E7QA 4Y24A 3H8OA 3AZVA 2Y0IA 2JWPA 2ENRA 4UOJA 1OQEA 1GWKA 3GNEA 1IKPA 4XE9A 2Z4FA 1FMD2 4YVSB 4HKLA 1KJRA 3TBDA 3ZX7A 1RUG1 3WW1A 3A21A 4ASMB 4AFBA 4FFGA 3N9QA 3WG2A 5SV8A 4IV1C 4CCEA 2DUOA 3V0AB 3ZFFA 3DYMA 3ZYFA 4ZHNA 2XOMA 3AP6A 3FLRA 1MZ5A 4BH9A 5C4WB 3H3ZA 3P5BA 1XNBA 2VVDA 3BIWE 3BPZA 1CPNA 1R1ZA 2ZXQA 5CKMA 3T08A 1M06G 4B8EA 2DCTA 1POV0 1MS4A 2PN5A 4CDQC 1RUH3 3KV9A 4GXLA 5EYXA 5FKCA 4JKLA 2YBSA 1FATA 3VDCA 4CXXA 2UU8A 1Y43B 2EIGA 4Q4X1 1S0IA 3BCWA 2J1EA 1UU5A 3H7YA 3PVBB 5ABJA 4MX3A 4BYYA 4UAPA 5E89A 4AVVA 1BHGA 5J37A 5T3NA 2GN3A 3NSTA 2ZGLA 1LHNA 1ND2C 1NCQA 3K77A 3N9NA 4YARA 5CFCA 1CAVB 3SLIA 1X7NA 3ZXGA 1GZCA 4RHV3 2BUKA 4WM7A 3VD4A 3FHIB 4CUCA 3K46A 5CNAA 2HWE2 3VBUC 4AZZA 2RS32 4YW5A 2F4LA 3KCCA 4C91A 2TNFA 2W5FA 1GP6A 2D6NA 1YI7A 2EA7A 1F4HA 2VVEA 4Y5Z0 2GC3A 4IETA 1W3XA 3WQ7A 5C7GA 3B01A 1NE6A 4IEUA 4NJ4A 4AW7A 1HQNA 2VQ0A 2XJSA 2VTFA 3J9SA 1Y3TA 4XF9A 4XUPA 1VBB2 2RJLA 1FMD1 4P00B 4YW7A 3ZR6A 2BP6A 3O1OA 5K0UB 5ERLA 4A44A 3VBFA 5DPNA 2JIJA 3ACLA 3D0SA 2X5IC 5FP4A 2Y8KA 5HCHA 4FOWA 4M01A 4NHMA 3GCWA 2O0OA 3MIFA 2V09A 3T2TA 2WFF3 5F9TA 4OUSA 1WCQA 1PVC2 1WGPA 5L19A 4DY5A 4NROA 2CGNA 1VBD3 3ZN4A 4BB3A 1WCSA 2DDUA 5A32B 3MV01 4CXWA 4D69A 1Q3EA 3AYCA 4RR3A 4BDVB 3AC0A 3IM0A 2ORZA 1AR72 1FOD2 4OFGA 4UW5A 3O1VA 2VBBA 1N47A 2ZX2A 3ST7A 5IUQA 1LENA 3B9IA 3SNMA 3VV1A 1PIV3 3ZFFC 1YCIA 5F1RA 1QJY2 1T2XA 3HNYM 1QXRA 2VCBA 5L7OC 3TEYA 2D6KA 3H1WA 1J84A 3WT3A 1PK6A 1W3VA 3OF1A 1KDMA 2WDBA 4AQ2A 4FTEA 5CFDB 2HWE1 4BQ4A 4PLNA 2VBDA 3MLJA 4GAZA 3W9AA 2BEOA 1G86A 3GJAA 5EJ3A 3SCFA 5KC6A 2RS31 4ARXA 1JZ5A 3VBSB 1JYXA 3J7LA 4DINB 2BBAA 5ABJC 1GR3A 1PIV1 2RS52 4CXYA 2VUDA 1LOGA 3T30A 1O3QA 4SBVA 2XVLA 4N9HA 3WUDA 4YZ5A 4CPBD 1GLHA 1NCQC 1UZVA 4XF3A 4Y1ZA 4WVZA 5A3LA 5CFCC 1VBB1 5C8CA 2A3YA 4GH4C 1JOBA 2P3JA 4LK7A 4WM7C 2PAMA 3QD6A 4QM9A 4RGKA 4QPGB 5K8SA 2D43A 1KXGA 2PHWA 4JGYA 2E9QA 2FCTA 4R4XA 4CEWC 2WYSA 1GANA 5FZCA 1H4HA 2JG9A 5FYTA 2DUQA 2W47A 5FPZA 5FO8B 4Q4W3 3M3IA 1PVC1 3ZYGA 5FYMA 4MOAA 1S2KA 1BYHA 3IPVA 1OLME 2R6QA 4K9SA 1FPN2 4AEKA 5FV3A 3LQCA 1EPWA 2ZGUA 3OJBA 4PLMA 5KXBA 4D94A 1AR71 4IXLA 2FDHA 1FOD1 1OUXA 1X50A 2GP5A 4WM8A 3VBFC 2HWF3 2A5ZA 1UZYA 1BZWA 2DCYA 2ZGOA 4FAGA 5JXGA 2A6ZA 2LW8A 4H3WA 4K1ZA 3TEZA 4OYUA 5FY8A 3E1F1 3PLQA 5A33A 1NA1A 4Q4W1 4EQVA 1H2LA 3WF2A 3Q8CA 4COWA 5FMOS 2YDEA 3JUUA 1ULPA 3OPTA 1F5FA 1WW7A 1MACA 5EYYA 4EN7B 5FPUA 1AHSA 2VUJA 1QJEA 2O8QA 4LO4B 4Y1XA 4HPKA 3LFIA 2RS51 2MNGA 1CVNA 4CE8A 1GU3A 4HONA 1TE1B 3WW3A 2JDAA 4AQ6A 3TYJA 3MDPA 5CISA 3PURA 1LULA 4FPLA 4AFCA 3RWNA 1WCKA 2VZQA 2W08A 3POSA 4K7JA 4UT5A 5CYYA 3ZFEB 4DEVA 5C3QA 5JZGA 2CWSA 1Z7S3 1A6CA 4SLIA 2KXLA 2YG0A 3NNJA 2W68A 3A0NA 3ECQA 4FPEA 3VBOB 3N9MA 3GZUC 5GLZA 5FZBA 2H6BA 5K9YA 1KEXA 4CEYC 2WO7A 3AK0A 2JECA 5FYZA 1QH7A 4ZU4A 4B3NA 1JYWA 2OS2A 4MVTA 1BCXA 1FPN1 2P37A 1Y9QA 1QQP3 3BVCA 4HFSA 3DN7A 1ULCA 4URTA 3ZLIA 5J1XA 4CPBA 4QGNA 4Q29A 3B9CA 2NYYA 4K40A 3E5UA 4BZ4A 4YWAA 3AZWA 3ZPOA 4YPJA 3BKZA 5A7NA 3M70A 1MQTA 4XEZA 1GNZA 3VKNA 4GWNA 5BNNC 1UPIA 3I2OA 3PDQA 4RQPA 3G6JB 2VTXA 2WIIB 2ZGSA 3B00A 1O91A 2JG9C 3LEGA 4JTNA 5DZGA 4YG0A 3ES4A 4XILA 1RHI2 3CZJA 1W8TA 2XJTA 1YIPA 4HETA 5F5AA 4P9YA 4E8DA 1ZZ7A 1GNYA 1GNHA 3URFA 5DUVA 1JH5A 5IK4A 3FHQA 4BIFA 4Q1PA 4GWIA 4XF0A 5CKNA 3H1MA 2JE8A 3C2UA 5A7PA 3VZOA 2WA3A 3AX4A 1MS9A 1RUJ3 1W03A 1JN2P 4QHOA 1OFSA 2DYCA 3MF9A 3UJOA 1H2NA 2R043 4WVWA 1GP4A 5FZOB 2VR4A 3O1RA 4XJ9A 5IAXA 3Q9OA 3NO8A 3Q8BA 4M3CA 1NA1C 3JBG2 3POIA 5EZWA 5FZDA 5EJZB 5GALA 1XE8A 3VZLA 3VZNA 3WXPA 4AR2A 2B5HA 2EXJA 1MEC3 4OI4A 3WF0A 1UZZA 2Y60A 4C8DA 1ODMA 1T6GC 2RM22 2VGDA 3I59B 5C33A 2YBKA 2D7FA 5C8WA 1QIQA 3DKWA 1VPHA 2C6SA 1RUJ1 1SBDA 2TEPA 2XR4A 3THTA 3ZYBA 3WF3A 3ZR5A 2VZSA 3WF1A 1H8VA 2YC4A 3C8XA 1H8TA 1EV12 4FPKA 3ZIXA 1CQ9A 4QB6A 3ME2A 1S0FA 1OLQA 2QTWB 2WRAA 3B93A 1W05A 3W20A 5L36A 5F37A 1PX4A 1OBNA 3RZLA 3D6EA 1DLLA 1HDKA 4QPIB 1Q8OA 4YG3A 1Q8QA 1QJU3 2Z79A 3VHOA 2WNUA 4AG4A 1D4M2 1UX7A 2FMDA 2XDVA 4Q1RA 1UIJA 5FCCA 1YO8A 3KD4A 4Z82A 5LB6A 1TMF3 1YQ6A 3VBHC 1A3KA 4BQWA 5LEJA 3FBYA 4HVRA 1RHI1 3V0BA 4QXHA 5DG2A 2XWJB 3U75A 2QFEA 1XSRA 1NLRA 1B35B 4QX8A 1ZA4A 2HYXA 4NHKA 4BU2A 3IDBB 3K48A 4W8JA 3VKFC 2TUNA 3MHZA 2Q1ZB 4JQRA 4JRAA 1U5IA 3LDBA 3ZSLA 2P3KA 5F6LB 1J83A 1MS5A 1RITA 2DFCA 2HWD3 3R4UA 1LR5A 5C3OA 4K6BA 1RVF3 1BQPA 3PTRB 3JZVA 4B4PA 2D6PA 4Q0QA 2W2IA 3E97A 4RQPC 5C71A 1D2QA 1L3JA 1QMJA 3JBG1 3IAQA 2V73A 4AYUA 2ZCWA 1WLDA 4NUBA 3VDDA 3WNXA 1TME2 2RM21 3LF7A 1BBT2 4Y22B 5T54A 2BOIA 3OY8A 5LBCA 3D8CA 3PVEA 4OHWA 4PDWB 5EXOA 2XONA 3WG1A 3OBAA 4AF9A 1W8OA 4I0AA 4C90A 4JGZC 4QT6A 4HVQA 1ZREA 4NIGA 2HWD1 2ID4A 4WVMA 3CHXA 1DCSA 4LUMA 1LU2A 4MXWA 4AEJA 1EV11 5BNPB 5CAZA 5JR2A 2CGOA 3NNGA 4I30A 5F3EA 3ABZA 4V2WA 1UXXX 5GZGA 2ZHLA 5A7WA 5LA2A 3O1PA 4NPRA 1MS3A 5AC93 4EWAA 5IVEA 1UOJA 1UZ0A 3M3EA 4IGPA 2R063 1S2BA 4H2AA 1NZCA 2Q1FA 1YC61 2WA4A 4NIHA 3UYJA 2A73B 2ZZJA 5IVJA 5F5CA 5CB7A 1RTVA 4FPJA 4F83A 5GLWA 2J1AA 1POV3 3K4ZA 1H8TC 1TVGA 1N3QA 2R1BA 4KMQA 4B1LA 3S5AA 1HB3A 2I2SA 3WP5A 3AMPA 4HKOA 3KCYA 4PCRA 1ODNA 3I7DA 1PMIA 4Z07A 1GQHA 3EQEA 1HQWA 2B42B 2GSYA 1IS6A 2LM3A 1PZ7A 1S0GA 4XACA 4COUA 4YM3A 5B2GB 1OSGA 2XBO3 2W46A 1PX3A 2P17A 3MPBA 1YJLA 1GMMA 3DGTA 3IMMA 2VECA 4HK8A 3ZMOA 4TZDA 4RD7A 4BXFA 4OHVA 2LTNA 2WYFA 1K42A 4Z8BA 4JAAA 3POGA 1BBT1 3RWKX 3VN4A 3NAPC 4LKFA 2WINB 3UETA 2YGMA 4MYEA 1W6MA 3CU7A 3GZEA 4P9GA 1GWMA 1CAUA 4Y5SA 5FP9A 1DFQA 4YVSC 1PVXA 4AHYA 1C28A 2PHTA 2ZPXA 3GHMA 4E9KA 2FZ1A 3WVJA 4GMP0 3D5OA 1HJFA 3K2OA 3U37A 1ZBE3 2D5HA 3WG3A 2BQPA 1IPKA 4CU9A 2Y6JA 2K0GA 3VDDC 1HB4A 1J1LA 2HKXA 4AEDB 5C4WC 2HWC2 2OUHA 1QNYA 4X8NA 5D21A 5KHHA 4YW2A 5C6CA 3F2ZA 2Q8CA 5I8SA 3EYPA 2BVBA 4JHTA 2VTXJ 1UKGA 3FN9A 3IAPA 4B29A 5FYCA 4QAWA 5I91A 3OYWA 1PGL1 4PIXA 1PZ8A 4Q4V3 1DQ0A 2ZGQA 3O1TA 2KM2A 1J59A 1V9U3 3MF6A 4IEXA 3OGVA 4ZY9A 3RDIA 4AVCA 2GMMA 1EPZA 3IIAA 3KS7A 5A1LA 2BGCA 4HN1A 2F6BA 2VAUA 1CWPA 1SQ4A 2QBXA 5DAWA 1SEFA 2WO1A 3ACIA 5JIUA 1DHKB 2J7MA 4E4ZA 2W92A 4NR1A 1OA4A 2DF7A 1FT9A 1D0HA 2PHUA 1AXKA 2PLV2 3NV1A 1RUD3 2YZ4A 3CL1A 3ZPYA 1LU1A 2VOWA 3J8F3 3PL0A 1TZOA 2W39A 2Y6LA 3B3QE 1ZYBA 2RJKA 4N7IA 3LPGA 4QDQA 3LDRA 4FPCA 4QKNA 4W6XA 1ONAA 4Y33A 3SISA 5G04L 5JSRA 2BYVE 3KWVA 2WT0A 5IVCA 4WV8A 1AYN3 1F9KA 4CCDA 3ACGA 4NIAA 2ZGKA 4AHXA 2FDIA 3BOWA 3HIFA 4XBQA 3W58A 4U2AA 4CU7A 5FLHA 3HMYA 2G9GA 4LOSA 5K0UC 3N9PA 2E33A 4M4RA 5HV0A 1RUD1 3AP9A 3WNOA 1AXYA 4ZS3A 1DYKA 1UN1A 2JB4A 1FX5A 3CO2A 3WNNA 1HRI3 1O7FA 2OVUA 2X8KA 2CV6A 5C9AC 2W95A 3LD8A 2Y34A 1AYN1 3A22A 5JCTA 2K46A 2QQKA 1QU0A 3DKQA 4J1WA 3MZHA 2P3YA 1CN1A 1R083 3GALA 2QQJA 4Y20B 4U36A 4YM0A 5JOXA 3SITA 1VBE2 2V5DA 4I3GA 2FZ2A 2B9VA 3MO4A 2Q8DA 5F32A 3LZZA 4UYBA 4TWTA 2ARBA 4ORFA 2W1QA 1O59A 4FQZA 4HXCA 4Y5TA 1I5PA 1AR92 1LOFC 2GP3A 2ZHMA 3A23A 4IV3B 3HOBA 3NV3A 3HWJA 1CZSA 4ISRA 4A3XA 3HQUA 1RUOA 4MGTA 2YC0A 2ZHKA 2RMU3 3JQWA 4QQHA 5KXDA 5L73A 4CP1A 2Z5WA 5I0DA 4MZUA 5JMCA 4DMIA 4NHXA 5CFDC 1A34A 4ITCA 1D4VB 1HIXA 3WUCA 3FLPA 2PLV1 1GOGA 1XYNA 2HJIA 2WNEA 4O65A 3PIGA 4MV2A 2GMEA 4XOGA 2V4AA 4MHRA 5GZEA 4QDRA 1ZZ9A 2Y6GA 4UW6A 1OF4A 4LBMA 4QQPA 3L9JT 4HMZA 2GDFA 1QOSA 4L2NA 4YGEA 3AB0A 5IVVA 4H55A 3LFMA 4ISQA 5CKQA 1RUC2 4CDXA 5FP7A 1RUI3 2ZMLA 2PXJA 1LGBA 1OFNA 4GB33 4IDZA 1C8NA 1DF0A 4YGDA 5FZ6A 1Z78A 3RRDA 1G9AA 3BALA 3TNPB 3WNKA 2VO5A 2WQZC 1EUUA 1J58A 1O4YA 1OLMA 1SLAA 2WN2A 3RI8A 3LPFA 2VZTA 3N7KA 1MVQA 4OHXA 4PLOA 2YC2A 2XVKA 4Y1YA 4AFDA 1DQ1A 1YFYA 5GKAC 5T52A 5FY4A 3DCQA 5JUVA 4DUWA 2QE3A 4QU1A 4IV1A 5T5JA 5FZ7A 2BPA2 1N1SA 5LWBA 1CAXA 1VBE1 2VCAA 4KG8A 5LW9A 1HLCA 3TEXA 1IOAA 2IFWA 2V5YA 2FD8A 5FUPA 3ZIWA 3C7GA 3HNBM 4CDQA 1ULEA 2J1UA 3BTYA 1POQA 1WUVA 2ZKNA 3WDTA 1V6NA 5FZGA 5IT6A 4N7UA 3S7EA 1SPPB 2FDGA 4JZRA 5EFUA 4DB5A 1W2UA 2PHRA 4XIOA 5FOBB 2RDNA 1AVBA 4DUXA 1KS4A 3ZYIB 2BBVA 4QX2A 5FZHA 3T2QA 5C3SA 3T3YA 1AYM3 4XZPA 1ND2A 4QB1A 5FZMA 5C70A 1M4WA 1W6NB 2GNMA 2JIGA 3NJYA 2XG3A 4AFMA 3OD0A 4IE6A 1QNWA 3VDAA 1K12A 5KBFA 3TNQA 1RGSA 4LTAA 3KF3A 2JDUA 1MS1A 4NRQA 1UYYA 2ORXA 2QNKA 3ITQA 4YW1A 3WCRA 4DXRA 4IEZA 2QDNA 5LK5A 4G9SB 1ENXA 1RUC1 3RMXA 4FAHA 1K5MB 4XXPA 2YV8A 1DGWX 2ETEA 3H3UA 3ZFGA 3JCIA 3B02A 3BTXA 1E5IA 3KHCA 2D98A 3P6BA 2WJSA 1U0AA 3M4FA 4AI2A 2ZGPA 1AJOA 4N43B 3VBOC 1J3RA 5F3IA 4LHSA 3OUJA 4QPWA 1NCRA 1RIRA 5DZEA 3UESA 1GOHA 4LO6B 1DGWA 3GHNA 1WBFA 3PVOA 4BMBA 4RA0A 4CSWA 4GJZA 2BTVC 1I1EA 1AR63 4BK5A 3HT1A 4UF0A 5JXHA 1IPJA 2W91A 4F3JA 1O8PA 2AC1A 4IEWA 3WNLA 5LEKA 1BLZA 3NJXA 4JTOA 4V1PA 3M3CA 1SLBA 2JE9A 3ZYPA 2JDHA 1F31A 4IE0A 1RMU3 2XVGA 3F95A 2X10A 4JV4A 3PNAA 1QJX3 4XQDA 4Y1UA 1BJQA 5FLIA 4XBNA 5IWFA 2DCZA 4AVTA 1W6OA 2ARAA 3ORJA 2Q8EA 1PM4A 4A4AA 5HCAA 1OHFA 4MUVA 5FAXA 1AR61 4YFWA 5ACA3 2LUWA 2GH8A 4MGKE 1YQ5A 2ZX4A 4URAA 5L7OA 5D8AB 2VM9A 4YFZA 1W6PB 4YZ2A 1KRIA 1QJX1 3FL7A 4AQSA 4Y26A 1XNKA 2A6YA 4C0HA 3LEKA 2A70A 1YNAA 1VB2A 3WHUA 4P08A 1I5ZA 3N4MA 4D8MA 1S55A 4HT1T 1QDCA 2UWCA 1CIWA 2QQWA 4WZCA 5KXCA 5A3WA 5JSPA 4Q26A 4XFBA 1HN0A
chains in the Genus database with same CATH topology
4WZFA 5T5LA 1NQJA 3VKLA 3WP6A 3R05A 2B46X 1PNFA 2WFF2 3BU7A 1PNGA 1RUF3 2NMOA 3DPRB 4AWDA 1XE7A 5FQ0B 1VBD2 4XF1A 1LHWA 4GH4A 1RUH1 1REDA 4LBKA 1OI6A 2BWAA 4BWOA 3WHTA 1W0PA 3IN9A 3WCSA 3ALQA 4KGQA 1VAKA 4Q0SA 4CEWA 1H9WA 3LKJA 1ND3B 3E6BA 3ZFGC 5CU1A 1PIV2 1OPMA 2E63A 2RR13 2XKOA 3N7MA 2AH2A 3M1HA 2ZAHA 4A7ZA 4RHV1 1NCRC 4Y1VA 3VKOA 4XYXA 3N7LA 3CJIA 1O3SA 2MHFA 4K21A 1QJZA 1ZZ6A 2B45X 2JG8B 4DY3A 3WDUA 1Q56A 3VBRB 2WZR3 2WZPP 4J1XA 3KT4A 2CAUA 2GN7A 4O9GA 1H1AA 3VHPA 3RYRA 2H6CA 4C1WA 2QQPA 2ZGRA 2DVAA 4DPNA 1VBA3 5BNOB 4LBLA 1CPMA 2YUEA 4S2FA 5JSOA 2LALA 4IEOA 4ZXKA 4EN9B 4K20A 1KFUL 4KWJA 1DU3D 3LOBA 1YUDA 1R1A3 2WZR1 3KM5A 4PDWC 2WFF1 2RS13 4Q4W2 3MYXA 4BLJA 4OULA 3KT1A 1VBD1 3USUB 3CNAA 1DGLA 3BOPA 2QKDA 1C3HA 4INDA 4AQTA 4QQLA 2WNVB 4J6GA 4QQ2A 5AVPA 4GMP3 2HWF2 3V56A 3O12A 2DV9A 1R1A1 5HXVA 4P14A 4CEYA 4F7ZA 1RJ8A 4XTPA 1XNDA 1CAWA 4COVA 4JDOA 1DQ6A 4ASLA 3S30A 3POWA 4FVVA 3ZSKA 2WSUA 2ZS6B 1UIKA 5BNNA 1QOTA 1C8M3 3PHMA 3VGIA 1ENSA 3OYWB 3RYKA 4XBLA 4IEYA 3UKNA 1WLWA 4QM8A 2VY0A 1OOPB 4KWKA 1F5JA 3R6SA 1PO13 4CDUB 5FLJA 3D0JA 5FO9B 1NOVA 3D82A 1Z7S2 3CJIC 2XWBB 3ETQA 2Z42A 3KZ4C 1SBFA 2ZACA 3JQXA 3VZJA 4YG6A 4DOUA 1NXD1 1EP0A 1AL23 4ATEA 3VZKA 4RS5A 3M3QA 4QXKA 4RSUA 4AI1A 1NG0A 1AR83 4LO7A 4XETA 1AX0A 4YZ3A 3ILRA 1SACA 4X6QB 4CDWB 5BXXA 2PHFA 1H1MA 1REEA 2BFUL 2G9FA 1GV9A 2HWF1 4OI0A 2GAUA 5BPXA 2XGXA 4AEDC 2OW4A 2XJQA 3JD73 4YM2A 1PM7A 3N35A 1BVVA 5HBAA 3KLSA 3QACA 2YXSA 3L2HA 3J26N 4C0BA 4OI2A 4GQ7A 3NV2A 1NXMA 2VULA 3VBHA 1RUJ2 5J3UA 1C5HA 1DZTA 5FREA 3RG0A 4EJRA 2X29A 1BKZA 2PHLA 5BY5A 2GMPA 2R042 3FMGA 4QGMA 5JWPA 4YVWA 1JTZX 1Y7BA 1H30A 1V6OA 3ZN6B 4PJYA 5JOWA 3ZXJA 3NKTA 1MEC2 2X53S 3LA3A 1Z0HA 1HX6A 2R49A 1Z7S1 3A4UA 3UV9A 1RUNA 3NV4A 5F6KA 4QU2A 1V6KA 5CIRA 4H7MA 1UU4A 1LEDA 4AHWA 3HD8B 4X6RB 3WQ0A 4N9IA 1UPSA 3POYA 2DTYA 3RPQA 2ZTNA 3RYPA 3DF0A 3X29B 1W6QA 4EN8B 1LHVA 1QGLA 1QQP1 2D6MA 4AGGA 1QY4A 2NZ9A 4LR4A 3LCPA 3WDYA 3MFCA 4ES9A 1S0DA 4JGZA 3FBMA 1QJU2 1UF2C 2E53A 2G4IA 4OI1A 2EAAA 2QDRA 2UWBA 1TMF2 1VRH3 4B7KA 2C9AA 1LOCA 1LGNA 3WW2A 1HXS3 4RS5C 4FPHA 3AMNA 3VL9A 5FBZA 2R32A 1OA2A 1H4GA 3MIBA 3H9AA 3QH6A 2PHDA 4LBQB 5I0UA 3LAGA 2C1FA 2CNAA 2CGPA 1ENRA 2HWD2 1VR3A 4IV3C 1YRZA 1ENQA 1LKNA 1RVF2 2MEV3 2R041 1DZQA 3ENRA 3LOIA 1X82A 4C1XA 1OMIA 4N53B 5H9SA 1MEC1 3HR9A 1FXZA 4ONUA 2XJVA 1ZRRA 2ZAAA 2ZMNA 1ZM1A 3MW2A 4M0HA 1SLTA 5I0TA 3ZSEA 2EVXA 1YFWA 3VZMA 3OBRA 3EXUA 1OPOA 3U10A 2MPFA 4FCAA 1QDOA 2BNNA 2DCJA 1GZWB 3GBWA 4YVWC 3AKSA 4XDQA 3NAPA 4Q4Y3 3VBUB 4YNIA 4CP2A 5T55A 4BLIA 2YYOA 4GALA 5AC92 1JOJA 1QJU1 5JDBA 1NE4A 1OA3A 1G9DA 5IK8A 2R062 1EAH3 4YVSA 5AVAA 4R9DA 1BEV3 5H9PA 3WP3A 1TMF1 1YIFA 1IKQA 1ZBA3 3APBA 4B4RA 4XJUA 2JENA 2GU9A 4M0NA 1X33A 3GZTB 5C4WA 1ASJ3 2X5IB 3KT7A 2DVFA 3CEWA 2PFWA 2WFPA 3LB9A 4FOYA 1MZ6A 2VMGA 1XU1A 1BEV1 2B8MA 1ZBA1 2JE7A 1RVF1 4MGIE 4S2HA 4NHLA 3ZMNA 4AVBA 4LT5A 2SBAA 3VHNA 3L2YA 2NMNA 3LGRA 1WD3A 5DDJ3 2ZX3A 1ASJ1 2ZJCA 1CAVA 4R9CA 3O5SA 1W39A 4K3UA 5J7MA 3EBRA 1D0GA 1O4ZA 3MIHA 4KNCA 5FFOC 3ZFFB 4I01A 1I9RA 1OLRA 4XFAA 1SFYA 1WMEA 1EYBA 4XFFA 3ZO0B 5L7OB 3I54A 1PGL2 2R073 3RNSA 4DFSA 1K5MC 2VW1A 3ZXEA 2Z2SB 1ZBE2 4QPYA 1TNFA 3U0ZA 5DUXA 2ET7A 2OPKA 4N43C 1REFA 1UAIA 3FWEA 2NN8A 5AC91 2AREA 5ABJB 5IK5A 3SMHA 2R061 1CR7A 1YWKA 2A7AA 2DVDA 2UURA 5K0UA 2XHKA 3GYDA 4HVOA 5J98B 1HV0A 1NCQB 3FC0A 2A6XA 5CFCB 1J3QA 4LBNA 1BK1A 3MFAA 4I0BA 4BIOA 1POV1 1PHMA 2Q5TA 4Q4V2 3JB4C 4WM7B 3E6DA 5D1IA 2EXHA 1C5IA 5C9AA 2PYTA 3PMEA 4I0WB 5I0RA 1LODA 1LRHA 2DVGA 2NP0A 5A32A 3IWZA 4NN0A 4FOVA 1YFXA 2H0BA 4X8PA 4YZ1A 1MR5A 4EROA 2XBO1 3SH5A 2Z69A 4OHYA 2UY8A 2D3PA 3IDEA 1RUD2 1QF3A 2IZWA 2ZKLA 2YROA 3TN93 2W0XA 2D40A 3J8F2 1BVP1 5CBLA 1LOFA 1KD7A 2W52A 4OHZA 3KQRA 1WD4A 3VBFB 2R1DA 3PJQA 4QX5A 2CYFA 1AYN2 2PHXA 3VL8A 1ULGA 4L99A 5CFDA 2XJPA 2YHJA 1DZRA 3E5QA 1PGSA 2BW8A 1SMVA 3VBSA 4IESA 2D6OX 2AYHA 5I8YA 1VALA 3OBTA 1ZBE1 3TN91 1ZZCA 1KQRA 1FNZA 2IXJA 1E57A 4RR3B 2WLPA 1F8VA 1HRI2 2D3RA 3MGUA 5FTTC 1Q8SA 5J48A 1CESA 1VJ2A 1HV1A 5I0SA 4IERA 4DRRA 1AUYA 1G9BA 2FQPA 3AFKA 3AZYA 1R082 5BYNA 4QPGA 2N7GA 4GA9A 2XL9A 1RUE3 2CY6A 2Q1MA 3GF6A 4LULA 2VNOA 4Q4V1 5GLUA 3SXWA 5CADA 1PK6B 1V9U1 4GIQA 3GBFA 1GSLA 3U11A 1QH6A 2TBVA 4YW3A 1YXWA 5BV6A 1O5UA 1ULDA 1FAYA 4NO4A 2WS93 3AMQA 4MGYE 1WMDA 3ELNA 5JIAA 4FPFA 3EO6A 1LGCA 1Q8VA 2SLIA 2Y0OA 4XXAA 4QGLA 1KITA 5JAXA 1TNRA 3N7JA 3J8F1 3FLTA 5C8CB 3M2MA 3IMNA 3HAGA 1JBCA 1V6LA 1C4RA 3VBRC 2ZOEB 4JGYB 4ZKTB 4XMIA 4YGBA 2A75A 2ZABA 1RUI2 4OUMA 2HWC3 4MSVA 4GB32 2WS91 2JG9B 1VBC3 1LCLA 2XJRA 3AZXA 3PTYA 3IPVB 2VXRA 5A3MA 1HRI1 1NYWA 1H1IA 3QH7A 5FDBA 3N3HA 4G4FA 4WM8B 4YW4A 3AP4A 2GNTA 1WW6A 4CZSA 4E27A 1DIWA 1R081 5JPMB 1WLCA 3ZFEA 5LK7B 4AK3A 4DQAA 2D93A 5A33B 1GQGA 1NA1B 4XFCA 3VBOA 5H9QA 3FFQA 3VBSC 1HRV3 2IXHA 2QVSB 1RL3A 1Q43A 1WBLA 4P5HA 4HPKB 1Q5OA 2RMU1 2R30A 3S7IA 1S0JA 3M7AA 2A71A 1O5LA 5E88A 3OD4A 1AYM2 4LNVA 4QPGC 3U4XA 3ES1A 2ET1A 2RE9A 5FRAA 1CGPA 1QWRA 1LTEA 5JZGB 5DZFA 1N1TA 1URXA 3TOJA 2JD4A 1OOPC 1RUI1 4GB31 3B69A 4CDUC 4Q2FA 2R0FA 3NL1A 1WLTA 1LOBA 4XJAA 1KFXL 1X8EA 4R52A 4HKWA 1R093 4AVAA 2VQAA 3C3VA 1COV3 3QCWA 1SCSA 4FXKB 3PVNA 2B7YA 3WX5A 5J96B 4D7YA 4MH0E 3AJZA 4EN0A 1RINA 1MQTB 2VNGA 5KHGA 4Q0PA 1AR62 4KU8A 3I59A 2JEMA 2JDZA 4RQPB 2Y26A 1LHUA 3P3PA 4CDWC 3VLBB 1ZRDA 3GZAA 2WLQA 4GKXA 3LSDA 1R091 1H9PA 4JCKA 1RMU2 1COV1 4RGGA 3WV6A 3RJRA 3KSCA 4F8AA 1MZEA 4Q27A 1ULFA 1BXHA 1QJX2 3JB8A 4R9AA 2JJ6A 1AF9A 1PO23 2VVFA 3DL3A 5JOYA 4LO8A 3IDCB 4P9JA 2HWB3 4UXAA 4QPIA 5ACA2 3ZFEC 2NM1A 1AYM1 4CP0A 4M3CB 1O3TA 4YM1A 5KWRA 4FOQA 1ZRCA 4RGAA 5T50A 1RUH2 2ILMA 4XMAA 3W59A 3AKTA 4M00A 4XTMA 1RB8G 2IXLA 4E4SA 4FSJA 2BFUS 2EXIA 3BTAA 2HWB1 3KMHA 3PJYA 2CAVA 3EJKA 2F4PA 1H8TB 1CONA 1C57A 3WR0A 1C1LA 2GALA 1JYCA 3SH3A 1SBEA 2R16A 4LA2A 3WDVA 1RUF2 3UK9A 2JXAA 1DQ5A 2VUAA 4RHV2 4QHBA 3I8TA 3AXDA 4Q0UA 3MIDA 1QXJA 2WNUB 1TEIA 1RUG3 4Y22A 2ZA9A 3MLLA 1SLIA 4PDWA 1ZZBA 2UY9A 3V0BB 2RR12 3MLKA 1GICA 1V70A 4FT8A 1RMU1 5LRSA 1XQNA 4XHBA 1RC6A 1S0BA 5BNPA 3ZYJB 2VW2A 3NJZA 4P9WA 5EWSA 3B7MA 5AFEA 5CVRA 2D5FA 4UBGA 3ATGA 3AYEA 5IK7A 1WW5A 2KA3A 4Q4X3 5ACA1 5FPXA 4MGZE 2WZR2 3WQ1A 2GC2A 3JU9A 4BPZA 1F2NA 3VDDB 1I6XA 2JX9A 3OPZA 1CD3G 3OY8B 2IC1A 4XQWA 4DRVA 1DGRN 4YYOA 1VBA2 1FV2A 1CX4A 4N53C 4WVMB 2DUPA 4AFAA 4MXWB 3WINE 1PZ9A 3MI8A 1JXNA 4QPIC 2E7AA 1R1A2 3RZZA 2RS12 4PBPA 5JPNB 1IS5A 1RUF1 2I74A 4XF4A 3ZSMA 5JI9A 1JHNA 1UD1A 1FMD3 2IXKA 1B35C 2K2SA 1UL9A 2PTMA 4LLFA 2IFRA 2RR11 4META 5BNQA 3O0WA 3MW4A 3AMHA 5DUUA 4AEMA 2WT1A 4W6YA 1HQLA 2JKBA 4AGRA 4P9IA 5HCFA 2VOVA 4JDNA 4AEDA 2ZHNA 1C8M2 3CJXA 1JUIA 4ZU5A 4EWDA 2DU0A 1IGOA 1JW6A 1G6NA 2CTVA 3PMSA 2UYAA 2D97A 5C9AB 4PF5A 2YMZA 1PO12 3R4DB 1J1TA 4D7SA 1XU2A 1VBA1 2OUJA 1W6MB 2QZ3A 4O9EA 5BNPC 2GH2A 1CAUB 3G7DA 2PA7A 4YLZA 2HWE3 3O0VA 3ZXDA 5E1RA 5CG9A 3E6CC 1VP6A 2R0HA 2RS33 1O4TA 1OKQA 3MPPG 4FXGB 4Q0VA 4OLLA 1XRUA 2RS11 1AL22 4BQ1A 2XLFA 1LJ7A 1AR82 2XPJA 5KHIA 1VB4A 2WSVA 3WW4A 1V6IA 1VBB3 2ARXA 3EHKA 1MVEA 1UW8A 4NVPA 4RL7A 3AP5A 4NWVA 3ZYRA 1WW4A 4DS0A 1QOOA 4XJ8A 4GMP1 1CJPA 3H8UA 2CL2A 4R4ZA 3AZZA 3JD72 2XL7A 4E4DX 3IKWA 1LB2A 1KJLA 2VMHA 3QLQA 1PVC3 1ZNPA 4Q8KA 4JRLA 4AI0A 5LRRA 2D3SA 4TSVA 5GM0A 1WMFA 2XLGA 2BNOA 3ASIA 4UW3A 1AR73 1FOD3 1C8M1 2VMIA 5KHKA 3N36A 4Y20A 1QJY3 3E5XA 3FX3A 1PO11 4A7KA 3ZN5A 1G9CA 2QJVA 1QQP2 3LA7A 2H0VA 4CTEA 2O1QA 4IV3A 1VAMA 2ZBJA 4LO5B 4QD2A 5GZFA 4ES8A 4HANA 1AL21 2RS53 4A2UA 1QJY1 3B5LB 4HZFA 3ZSJA 3TWIA 5FOJB 1AR81 4R8HA 2WWSA 3VKMA 3HT2A 3ILNA 3NW4A 4KG0A 2EAKA 1APNA 4RR3C 4BE3A 1YHFA 4L92A 4JDMA 3FUOA 3JD71 1U5XA 4BM8A 1VRH2 1FI2A 2OIIA 3TAYA 1IQAA 1N1VA 1N3PA 1HXS2 5FO7B 1B09A 2ZGNA 4LBJA 4W65A 2E7TA 1DQ4A 1FPN3 2GNBA 3SH4A 1PK6C 2ZMKA 4OZXA 1O3RA 2B9UA 1KS5A 3RMYA