5FZ6A

Crystal structure of the catalytic domain of human jarid1b in complex with maybridge fragment n05859b (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
462
structure length
452
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSNYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Maybridge Fragment N05859B (Ligand Modelled Based on Pandda Event Map, Sgc - Diamond I04-1 Fragment Screening)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 140
structure length 452
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz6A01
5A3WA 4NUBA 5F32A 5FYUA 5FXWA 5FP7A 5FJKA 2XDVA 5FUNA 4IGOA 3ZPOA 5A3PA 2YBPA 4EZHA 4TN7A 5FJHA 1VRBA 4ASKA 4BISA 5A1FA 5A7WA 5FWEA 4GJYA 5IW0A 5F5IA 5K4LA 3U4SA 4XDPA 4IGQA 4GD4A 4V2WA 4CCMA 5F3IA 5FPLA 5FY9A 5FZIA 4DO0A 5F3CA 2OX0A 3UYJA 5LWBA 2XXZA 4BXFA 3OPWA 2YU1A 5FZ0A 4GJZA 5A80A 3NJYA 5IWFA 2Q8DA 5F2WA 5CEHA 5IVBA 4D6QA 5FZ7A 3N9PA 5FZBA 2YBSA 3N9MA 5FZEA 4Y33A 5FUPA 4AAPA 4Y3OA 4QXHA 5A3NA 5A7QA 4LIVA 5IVEA 4QWNA 5FPVA 5FY4A 5FY0A 4CUGA 5F3EA 4EYUA 5FZ3A 3N9LA 5FPUA 5A7SA 5FY5A 2OQ6A 3PURA 3K3NA 5LY2A 3KV5A 3DXUA 5FZCA 3LDBA 4URAA 5FBJA 4CCJA 3RVHA 5FYZA 5A7WB 3U78A 3PTRB 5FZMA 5FV3A 3N9QA 5FYVA 5FXVA 5FZFA 4CCOA 5FZHA 5ISLA 5IVYA 4XDOA 5FY8A 5FYSA 3AL5A 5F2SA 4C8DA 3AVRA 5FYIA 5FPAA 4QX7A 2OQ7A 4GAZA 5F3GA 5FP3A 5FYMA 4QXBA 5FY7A 4CCKA 3OPTA 5IVVA 4LIUA 4AI9A 4EZ4A 3K3OA 5ANQA 5FXXA 5FZ1A 5A7OA 5FZDA 5LW9A 3AVSA 5FYBA 3N9NA 5FZOA 3ZLIA 5FWJA 5FZLA 5IVFA 3KVBA 4LITA 4BU2A 5FPBA 2YBKA 5A1LA 5FXZA 3KV4A 5FYHA 3AL6A 4QXCA 4QX8A 4HONA 3DXTA 3PU3A 5A3TA 2WWJA 4UF0A 5FZAA 4Y4RA 5FYTA 3PU8A 5E6HA 5FZ9A 5F37A 2XMLA 5IVJA 3KV6A 3PUQA 5F5AA 2YPDA 5A7NA 4CSWA 2YU2A 2P5BA 3LD8A 4DIQA 2VD7A 5FYYA 5FYCA 5FP4A 5FZ8A 4CCNA 4D6SA 2Q8CA 4LXLA 5LY1A 4E4HA 2Q8EA 3N9OA 2XUEA 2PXJA 3PUSA 5A7PA 4QU1A 3PDQA 4IGPA 3KVAA 4V2VA 5FZ4A 5FZOB 2OT7A 2WWUA 5F39A 2GP3A 2W2IA 5FZKA 5IVCA 5FZ6A 4CCLA 3PUAA 5F5CA 5KR7A 5FZGA 4HOOA 5FP8A 4UF0B 5FP9A 3KV9A 2OS2A 4D6RA 2GP5A 3K2OA 5FY1A
chains in the Genus database with same CATH superfamily
1QQP3 1MEC3 2EXHA 3W9AA 3S30A 3MW2A 1VBE2 3NNFA 1JU4A 4FFGA 3VBRC 3OGGA 3ME2A 3EHKA 2PHTA 4I3GA 4P9JA 3U75A 3X29B 4I0BA 4PBOA 4YW6A 3CJIC 4M01A 4AQ2A 3NJZA 1OQEA 2VZUA 1AR91 1W2TA 5A7WA 1CPNA 1DQ6A 4LA2A 3OF1A 1H6XA 1LGBA 1WA6X 5FPLA 2JXAA 1Q43A 4N7UA 5C5UA 4FT8A 3S5AA 1CAVB 4FQ4A 1SDDB 4DOUA 4IE7A 5LB6A 1IS6A 1QNWA 5I0TA 4LHNA 4P9GA 5T55A 4BHPA 5JPNB 5JXIA 5JVVA 1E5HA 4HMZA 1W0PA 2A75A 4AAPA 1W8TA 5FZEA 3S7IA 1YQ2A 1C5IA 1D0GA 4ASMB 3ASIA 1NKGA 3V56A 1V6MA 1ODMA 2VMHA 1TME2 4LBKA 4QQOA 1WD3A 4YVSA 1G9FA 3M2MA 3GZAA 1X7NA 3NAPA 3VBSB 5C6CA 1WKYA 2OQ6A 2BPA2 1Q8VA 2EICA 4JX0A 1WW7A 4LHKA 3LA2A 1D4M1 4NRMA 5KXBA 4QKBA 4AEKA 5L9RA 3RVHA 2ZCWA 4N53A 3U78A 2NQYA 4W8JA 1YQ8A 1Z0HA 4XCAA 5FYVA 5FZMA 5FZFA 1S0EA 4NO4A 1PZ7A 2CWMA 3DN7A 5EP9A 3AL5A 1V00A 2RS51 2BNMA 4QDRA 1O59A 3LCPA 3Q8FA 4AHXA 4JHTA 2UYBA 1C1LA 5F3GA 1DHKB 2RDSA 3ECQA 4JKMA 1WW4A 2BBVA 5JOYA 1IQDC 2L9LA 4K9SA 4Q0UA 4AGRA 4OHZA 2WC2A 4JDOA 3GZEA 4RHV3 1FYUA 2E63A 3J7LA 1YYNA 1H4HA 2J1VA 5JZGB 5A3LA 3I49A 3KCYA 3KVBA 1C4RA 5D8AB 4GB33 4E4DX 1JZ2A 3WP5A 5FPBA 1RUE3 3ITQA 3RI8A 2RS13 4AW7A 1DZRA 1YRZA 2ZXQA 5FKCA 1LULA 3E5QA 5ACA1 1RUJ3 5CKQA 1HKDA 2J1TA 4A44A 4PIXA 4Y5Z0 2R043 4QT6A 2P3IA 4Z92B 1AXKA 2JECA 4DEQA 5JZGC 4YM1A 4FFHA 4LBQB 3RGBA 2D7FA 3ILNA 5D8AC 3WQ0A 2DUPA 1VB4A 1XU2A 3SQOA 4X8PA 2B4KA 4NE9A 1YJKA 1RUI2 5A7PA 3JBG3 5BNPB 2FHRA 4BQ1A 2G19A 5FUIA 2W5FA 1LODA 1VPHA 1Q8PA 2ZZQA 1LOEA 4M4PA 1VIWB 1A6CA 1MPXA 2IZWA 1BK0A 3WDUA 3H1WA 5KXCA 1SLTA 2Z69A 2WABA 1GYKA 1K42A 4LJHA 2G9FA 3NV3A 4U36A 2WWSA 5FREA 4AQTA 5L36A 1OD5A 1GOGA 3HBKA 4NOTA 4AK3A 4BQXA 1S55A 5T54A 2DU0A 1DQ2A 2GP5A 1EUTA 3K2OA 1UOJA 2MEV3 4AE2A 5C5TA 2IC1A 2HWB3 5BNPC 1PO22 3WNKA 2P17A 2RG4A 1AR61 3CU7A 4QX0A 5I8YA 3ZIWA 4LBOA 2VZQA 3NNGA 1J3RA 2ZS6B 3MEPA 4X6RB 4FTEA 1YFXA 4AWDA 4EN9B 3IN9A 5F5IA 1W04A 2HLEA 1FATA 3K77A 5F3IA 1PZ9A 1GZWA 1F4HA 2D43A 2VNGA 3I59B 3T3YA 5DUWA 3ZXJA 4BB3A 4L92A 5F3CA 1S0FA 4DQAA 2QQPA 5A70A 3OPWA 2ID4A 2WUHA 3WQ7A 4S2FA 1ZBE2 2YC0A 2O14A 5L7OA 4AHYA 1VP6A 5CEHA 4BMBA 1Y43B 4D69A 2WYSA 4D6QA 1QMJA 2YBSA 5GALA 4Y33A 1RB8G 5GJ6A 2JDAA 3AMHA 4DY5A 1BVP1 1YXWA 2DVGA 2ZGSA 4LKSA 2XJPA 5A7QA 3VBRA 4CZSA 1JYXA 4Z2WA 2XJSA 1YEWA 1IPJA 4AVVA 1GR3A 3FL7A 2GN3A 4AG4A 4EN7B 3CJIA 1W03A 3DXUA 3DECA 3J7HA 3LIGA 2X09A 4TYSA 3P6BA 1W8OA 3O0WA 1YFUA 4QQLA 2GAUA 3CZUA 4KH9A 3NW4A 4M3CE 3AK0A 4YGBA 1IKQA 3P1IA 1AX1A 5J09A 4Q4Y1 1AL23 2W91A 4D8MA 4N43A 4Y4YA 1IG3A 4OLLA 5CYYA 1E5IA 1SCRA 3KF3A 3ZKUA 3G7DA 4BLIA 5G04L 5KWRA 1H9WA 1H6YA 1HRI3 3M8LA 5FY7A 2FDHA 2FBEA 3CZJA 4BQWA 4W4ZA 3K4DA 1PO12 4O61A 4N9HA 5IFPA 4KWJA 1YFYA 2C4XA 4PHZA 1QJEA 3I2IA 1TQ5A 1FOD2 4KGGA 1ODNA 1HV0A 1HQWA 1W8ZA 2DWRA 2ZX1A 3OOXA 2GH2A 4BZ4A 4CE8A 3AYAA 4HT1T 3VBFA 1PO23 4MGKE 4QX8A 3EJKA 3JQWA 4L0PA 4P9WA 1DLLA 5J3UA 1UNBA 2DFBA 2GC2A 5FZAA 2PQSA 1N3PA 5LEJA 2W94A 4FCAA 2Q30A 3SISA 1RVF1 4YFZA 4XFCA 1RTVA 5A1AA 4PBPA 1Q8SA 2ARBA 4CSWA 3HT2A 1ZX5A 1UMHA 1PMHX 3UNPA 3O5SA 1NE4A 4K1YA 4Q4W2 2YC2A 3H3UA 2Q8CA 2LROA 3TBDA 1WCKA 3FUOA 4B1MA 1Z7S1 3AFKA 2Q8EA 2UYAA 2YMZA 2YZ4A 1H1MA 1ZBE3 4A41A 4A7ZA 3PUSA 4R8HA 3W20A 3WG3A 5CB7A 3WW2A 4E2QA 2K2SA 1ND3A 2ETEA 3RPQA 2VZ3A 5HBAA 1IPKA 3A22A 4V2VA 1UD1A 2YV8A 3VKNA 2HWE3 1REFA 4AOCA 1CVNA 2W2IA 3ZN6B 4L11A 3CKHA 4B7EA 4MHRA 4LBNA 1OVSA 1PVXA 3PUAA 5KHJA 1RUNA 2NZ9A 2ZTNA 5L73A 4AI8A 4YVWA 1LHOA 1N1VA 4HETA 3OG2A 2H6BA 3HR9A 4MZUA 1H8VA 4JKKA 4XXPA 1F4AA 4CDXB 4XJAA 1LHVA 5JXGA 1W6NB 2ARXA 2HWF3 3I2KA 4FXKB 4GMP0 4L99A 4NUBA 1R081 2D97A 1F15A 1GP4A 2C24A 3C3VA 3WG2A 3MW4A 1DLCA 3ZYGA 2Z4FA 2W87A 1VB2A 2R0HA 2OZ6A 3P3PA 5FMBA 4TN7A 4PQQA 2VW0A 3ETPA 1XE0A 3AM2A 1VBA2 4AVBA 4MH0E 3J26N 3MBWA 1LHNA 2W3JA 1W6MA 2I07B 3VL8A 1EV13 2P3YA 1DF0A 4JTOA 4XFHA 2O8QA 5BUVA 1G7YA 4CDXC 4RS5B 3MFAA 4LTAA 2WQ4A 4QPWA 1UZVA 4LBQA 4QGLA 2ZMNA 3IAQA 1U5ZA 4A7KA 3M3QA 2QQLA 5C3PA 2ADDA 1REDA 4L9BA 5FZ7A 4AVTA 4OHYA 1Y9MA 4OULA 4AEJA 1YQ5A 4QHZA 1W2NA 2J1AA 3OUHA 4SLIA 4YW2A 3M7AA 4CU6A 2ZGUA 4QWNA 1XNBA 3QBQA 4P9YA 3LKJA 4BM8A 3RZGA 4XDQA 1ZNPA 4CPBD 5J37A 3KLSA 4W6YA 3ZYIB 1J83A 4RS5C 1T6BX 5F8PA 5A6YA 3LWCA 4QKNA 5JCTA 4Q4W3 5CKMA 1WCSA 5LBFA 3BU0A 1RUH2 3BOWA 2Q8OA 1MS5A 1N3QA 1HJGA 4FOQA 4E9KA 2XJUA 1UXZA 1DYKA 1GWMA 1R1A1 3LPFA 2R061 1NCRB 1I5PA 1IGOA 4GA9A 3OCPA 5FYSA 1QJX2 2BERA 3H1YA 4YZ5A 4O65A 3ENRA 1O6UA 1PVC3 1OUSA 3JZVA 1DGRN 4EWEA 1Y3TA 3QCWA 1QJY3 2PAMA 4N8MA 1UPIA 4BK5A 1BVVA 4WM8B 2PHDA 1BLZA 2XLAA 3KQRA 3LEMA 5CIRA 3TNPB 3WCRA 5AC93 1FXZA 1TMF3 2RDRA 2BZDA 4NPMA 3VHPA 4F7ZA 5HXVA 1LRHA 3NSTA 3NNJA 3BODA 3NWKA 5JR7B 3AP7A 1QWRA 2YPJA 1NCRC 1AYM1 4DXRA 4B4PA 2QZ3A 2WFF3 2WT2A 4P5HA 2RM22 3OGSA 3MFCA 3DF0A 5F9TA 1XNKA 5BV6A 5GLVA 4OUEA 1ULGA 4WM8C 1AYN2 3PIJA 3QACA 1XBFA 2W1QA 2ORZA 4UW5A 1ZVFA 2W1WA 3AFGA 2WT1A 1LENA 1C8M1 3ZFEA 2ZOEB 3NNMA 3D4KA 1G86A 3SCGA 2F4PA 5DPNA 3O14A 2C1FA 3UT0A 5ERLA 4GH4A 1CONA 4RN5A 1KJLA 3TEZA 2A6WA 4HN1A 5HI0A 2RDNA 1S4CA 1DGLA 4KU7A 3NO8A 3HNBM 1UXXX 3ZXKA 3WZ1A 1W39A 1CIWA 5LASA 4NN0A 4Z82A 1AF9A 2RS33 1YO8A 2G1MA 1VBC2 3O12A 1RMU1 3UV9A 1SLLA 4UOJA 1HX6A 4HOOA 1WLTA 1Z78A 2R1BA 4JRAA 1R091 1W6QA 4HLTA 1ASJ3 2JG9A 4YLZA 4XE9A 1Y4WA 1PNGA 4GULA 4H7LA 4CEWB 4P9LA 2BP6A 2VOWA 4CEYB 2EALA 3WUCA 1QJX3 5L9VA 3VBOB 1UU5A 2D6NA 3AJYA 1YCIA 2AR6A 1PX3A 3I3BA 4IW3A 4UWDA 3N4MA 3OGRA 1RIRA 1BEV2 4Y20A 3U4SA 2ZEZA 4KWLA 4CCMA 3MDPA 4BQ4A 1L7QA 2BJSA 4DO0A 4FPHA 3HBZA 1E5SA 1UMIA 2PN5A 3GBGA 4FPCA 4Q26A 4E8DA 3A21A 4G3YC 2WN3A 5K0UB 3ZMOA 5IAVA 5A80A 5M0TA 4D7YA 5DQ0A 2E31A 3E97A 4CEWC 4FAHA 2D3RA 4CEYC 4IV1C 4M0NA 1NZCA 2QFEA 3ORJA 1CPMA 1CZSA 2KM2A 3ZYFA 4NAOA 3ZOIA 4ZONA 1NCQB 2C9KA 2ZGTA 1NA1B 2A70A 2D98A 2VW2A 3DYPA 4LIVA 4LBMA 4QPGB 5FY4A 4QMAA 5F3EA 2R7EB 1AYN3 3WNPA 1NOVA 2VULA 5LY2A 1HQLA 4CP1A 3BPSA 1NQJA 4URAA 3VZOA 4CRQA 5K0UC 2W39A 4KG8A 3MUY1 2JE7A 2VL4A 2ZA9A 1X36A 2WZEA 3A0KA 2PFWA 3WNNA 1AR73 4CDXA 4E8CA 1UKRA 3CJXA 2JDMA 1IZ3A 4XDOA 5GZDA 4ZZ5A 1Y7BA 1NCQC 1UOGA 3OYWA 1NA1C 5F2SA 4QPGC 2FDGA 5FPAA 2XKOA 1PMJX 4IV3A 3VZMA 2JDNA 5FP3A 4X6QB 2JX9A 4YZ3A 4HVQA 5KXDA 1GOFA 4XXAA 2FQPA 3M3CA 1G9BA 5LW9A 2QNKA 1RUF1 2QQKA 2PAKA 1UN1A 4XFFA 5A33A 1RUD1 1RUC2 1HJFA 5IVFA 1AUYA 2ADEA 2VG9A 1TE1B 1JW6A 1JYCA 3BCWA 4MGSA 1O3RA 3USUA 1UYXA 2YBKA 3IWZA 3B3QE 5FYHA 5IAXA 5DN2A 3THTA 3ZYBA 3I3EA 5FYTA 5I8TA 1PGL2 1GNZA 1VR3A 3OUIA 4ZU7A 4WZCA 5JLVA 2A3WA 2BFUS 2W68A 2XMLA 3U1XA 2BOIA 4UFJA 5SV8A 1X8EA 3KV6A 5F5AA 2JJ6A 3T4VA 3FFZA 4IERA 1X9TA 2W46A 4BQ3A 3L2YA 3ZXDA 2ZGNA 1PIV3 4Y24A 5FQ0A 5G05L 1CAXA 1SHWB 3MO4A 3A7QA 1VRH1 4Q4X1 5HCAA 1N1TA 5BXXA 1AR92 3PVNA 1NUKA 3DL3A 3UK9A 5CAZA 1AR81 1W2AX 4XMAA 1LU1A 1U5IA 2XH6A 3H7YA 1APNA 3H9AA 1E57A 1UPSA 3ZN5A 1KDKA 3KSCA 3LF7A 5FP8A 2VO5A 3A23A 1LU2A 2JICA 2Y6LA 3HQRA 4WM8A 5DDJ1 5FO9B 4KU8A 3MLJA 4CUCA 2LM3A 1MS9A 2GNDA 1ND2A 3AMPA 3VD3A 1D4VB 1C28A 1REEA 4Q2FA 3ZR6A 4KGQA 4COVA 3POWA 3LEGA 4AHWA 1GQGA 3SH4A 2WINB 2FZ2A 3JD71 4BXSV 5H9PA 4A4AA 3AJZA 4UBHA 1PK6A 5T5LA 2R0FA 3AKQA 1D4M2 2CWSA 2G4IA 1W2UA 5LK5A 2JDPA 2RR11 4FPFA 1D2SA 1F31A 4GJYA 4QM9A 4GD4A 1V0AA 2WA3A 4YPJA 4YW5A 1I6XA 3WDWA 1YC61 4DEVA 4F8AA 2RS52 1XNTA 3ATGA 3WDTA 3ZSEA 4KMQA 4BCUA 3DEMA 3FN9A 5K8SA 1WA4A 2DBIA 3GJAA 2ZHLA 4GWNA 2DCYA 3VLBB 4ATEA 2PLV1 4META 4WV8A 3S5QA 1LJ7A 2HWD1 2FZ1A 3I8TA 4Y3OA 5L19A 2UURA 4ITCA 3LZZA 1GUIA 4NWWA 1JZ3A 2IXKA 4YGDA 1CQ9A 1AX2A 3O0VA 4FPJA 2J22A 1MR5A 5HPOA 4AVSA 4UFIA 5FZ3A 4R9DA 4FFFA 3K3NA 1PMIA 4QAWA 2K0GA 1H2MA 1COV3 3OY8A 5CFCB 5ACA2 4A6OA 1S0JA 2VNRA 4S2GA 5FYZA 2RJLA 4CDWA 1LTEA 1H30A 4DNYA 1SZBA 4HN0A 4W65A 1IOAA 5DUUA 4OI0A 5FZHA 2QE3A 1JYVA 5LBCA 3VBUC 2P34A 3OUJA 1SBFA 4NIHA 3ZXAC 4CEYA 2ZX4A 4R4XA 4IV1A 4QX7A 1K5MA 1LOBA 4CCKA 1DQ0A 1CZVA 2E32A 3ILFA 4PCRA 3BYWA 3ZXFA 3K3OA 3HN1A 3UKNA 5A7OA 2DURA 1OBNA 2YY1A 3RDIA 1UX6A 3OBZA 5CFCC 2VCCA 2ZHNA 5JSOA 3HJRA 4LHLA 1MS1A 5FBZA 4LBQD 5HV4A 3MIBA 2JWPA 5K0UA 4QU2A 2XQRA 1VBB1 1HW5A 3LB9A 4QX1A 4Y22B 3T4HB 4JDNA 5EV7A 1O3QA 1LESA 4L97A 3WEZA 1DYOA 4R52A 1D4M3 3PUQA 4LK7A 2DFCA 4OI4A 4XZPA 1IG0A 1K45A 4OHVA 5J1XA 4LULA 4DIQA 1AR62 3BTXA 1ZM1A 4RR3B 2VVFA 2GNMA 1O5UA 4FFIA 3RFRA 5LA1A 1UQXA 3O1RA 1CWPA 3POYA 2RS53 1YNAA 1DFQA 2VY0A 4CDQA 3POGA 5IT6A 3LE0A 5E89A 2DU1A 2QVSB 4QX3A 5BNNB 4NRQA 3DCQA 3AMNA 3BOPA 3OJBA 3APBA 1JTZX 1XXNA 2D6OX 1W6OA 1XC6A 3EBRA 5EYXA 3GGLA 5FZKA 4IE0A 4UFLA 1QJU1 1OLRA 4FPGA 5FPZA 5C4WA 3ZSJA 2GSYA 1HN0A 3LSEA 1E5RA 4RR3C 1HRV1 3AZXA 3POIA 4XJ9A 3SXWA 5JR2A 2WDBA 1A78A 2HBTA 1F8VA 2CAUA 4D6RA 3MHZA 2BOJA 3VD5A 2VR4A 5BNNC 5ACA3 1JZ5A 5F5QA 2CY6A 2BNOA 2ZBJA 5FYUA 4DXZA 2WO3A 1WMEA 2DVDA 2WLPA 4FPYA 4B29A 3U37A 1NY71 1CGPA 3M70A 4AEDB 1FNYA 3J7MA 2B39A 5A32B 3FHAA 3SH3A 5DMYA 2YFUA 3WVJA 1WW6A 3NJVA 3WW4A 3J4UH 3K4AA 5DZGA 2GC1A 5FLJA 4LO7A 1OT5A 4LK6A 3H8OA 2WNUB 4Y1VA 1J58A 1HIXA 2NMOA 4FPKA 4EROA 4GJZA 4CPBA 4MX3A 5T5PA 4MGQA 1PGSA 3CQOA 1W8NA 1BXHA 2WFPA 1HV1A 3D8CA 5D21A 3S6PA 1RUG1 4AEDC 1KDMA 5B2GB 1R1ZA 1G9AA 4NPLA 5FPVA 2TNFA 1BK1A 4ZZ8A 3ZSMA 3H1MA 5LCWL 3ZXEA 1O5LA 1GFF2 3AP4A 3PIGA 4GKXA 2WNUC 4EWDA 3FLPA 4I30A 1VMFA 4GWIA 4JC1A 4XABA 5GLUA 1LNSA 2VUCA 4HBNA 3FC0A 1RVF2 4D0QA 4YM2A 4XYXA 1BHGA 5TSWA 3N9QA 5GZFA 3VKMA 2JG8B 3ZYRA 5AFEA 1FPN1 2WZR1 3OBRA 3KT7A 4Z2AA 1MQTB 4OHWA 2VMGA 3CMGA 4FPEA 4HVOA 5FMOS 4FXGB 2BTVC 2XKPA 1VBD1 3C8XA 1Z7S2 4JDMA 3KWVA 4QQHA 1ST8A 2IXIA 4OYUA 4AFBA 4H2AA 1YWKA 1BYHA 3ES1A 4J6GA 2WNOA 3AVSA 1ZBA3 4XIOA 5FYBA 2ZGMA 3USSA 3OEAA 5FZLA 3HEIA 5BY5A 1JYIA 3WW1A 3WF2A 5A1LA 4L2NA 5JMOA 1QJZA 1YLLA 4GIQA 2JG8C 3AL6A 2J1UA 2HEYF 2XONA 3HQUA 3DXTA 3PTYA 4WVWA 2WWJA 1MQTC 1CX1A 3ZFFB 4IEPA 1SDWA 4MVTA 3NV1A 2E7QA 5C71A 2A3XA 1OKOA 2EIDA 2VPVA 3ACHA 2CGNA 1POV3 4ES8A 2XHKA 2YU2A 1XJAA 2R6QA 1H4GA 1R082 1JH5A 3VBUA 2WA4A 1X50A 3AB0A 2YDEA 4WM7B 4JAAA 2V73A 3VBSC 2OYZA 3K51A 2EAKA 3B69A 1S2KA 2XJRA 4ZHNA 3VHRA 4IQPA 3ZFFC 3NV4A 3OB8A 1XNCA 2PHXA 3TAYA 1A8DA 2EIEA 2XVLA 4QDQA 2IXJA 4AHZA 2WYFA 3LOIA 4IEYA 2WO7A 3B5LB 1VBE3 4AL9A 2BWAA 3GDBA 4WM7C 3MLLA 3ZO0B 3S57A 2WBKA 4OFGA 1OOPA 3I3MA 3M3IA 4KNCA 1CAWB 3C7FA 1LOGA 3E5XA 1UCXA 3OPZA 2ILMA 1X9PA 2BU9A 1OXCA 4ZU5A 1EPZA 1HB4A 1JYWA 3WHUA 2Z2SB 3DYMA 4QKFA 1V9U1 3ZPOA 4B8EA 4CYDA 3ROUA 2AEYA 2BWCA 1EAH2 2E26A 4IEZA 2NLRA 1DQ5A 3WG1A 4LE4A 1Z7S3 1UZ0A 1R1A2 1SBEA 4XTPA 2R062 4ET7A 5I0SA 1DDLA 1TME3 2PHUA 3KB5A 5FK8A 4BXFA 4RR3A 1US3A 4DXTA 3SCHA 2Q8DA 2P6HA 2WRAA 3HVDA 1ZZCA 5FR3A 3THPA 5IVBA 3UKTA 4S2DA 3N9PA 3IPVA 3RNSA 4BOWA 1RGSA 5HCHA 4TLFA 2XUMA 3PVOA 4RFRB 4UFHA 4M3CB 4KI5M 4GKYA 1J1LA 5DUXA 3IM0A 2IXLA 1W6PA 5FY5A 3HMYA 5EZWA 5EWSA 2FD8A 1AYM2 1R083 5FZCA 4ARYA 3SNMA 2OUJA 4FQZA 1W28A 3O1UA 5IK4A 1O8SA 3UJOA 2JEMA 1QQP1 1MEC1 2ERFA 1OQ1A 3GM8A 3B01A 4OVEA 4A42A 2I2SA 1X8MA 4XUOA 4LO8A 2A6XA 2WS91 4W6WA 4W6XA 4YRDA 5FY8A 1J59A 3TN92 2XL7A 4XBNA 3VDDA 1C8M2 1XB9A 4XZUG 5IHRA 4QB2A 2ZMLA 4ISQA 4UT5A 4CP9A 2WNVA 1RJ8A 3FX3A 4AEDA 2DCKA 3VBHB 1OPMA 3IDEA 3J8F1 4NROA 3VZLA 5CADA 1GQHA 5LRRA 5DAXA 5FZOA 1SPPA 3LEIA 5F1RA 1FV2A 3AXEA 4QKDA 4FTSA 1URXA 1UU6A 2V5YA 3SCFA 2ZGLA 5E8AA 1RMU2 2HEWF 3VDCA 4UF0A 1O8PA 1XU1A 3ZX7A 3THDA 1GNHA 3PU8A 1R092 4BMEA 3KCCA 3T2PA 1RUI3 1QXPA 1EAH3 3HOBA 3WXPA 3VBHC 2YG0A 3I3DA 3Q9OA 3IB3A 1GP5A 3ES4A 4UW3A 2VTFA 2BQPA 4DRVA 4LQRA 1H1IA 3SEEA 5CBLA 3IAPA 5LBBA 4LXLA 1N47A 3VDAA 5FLIA 5LATA 2VCAA 1D7PM 1X33A 3J7NA 1LEDA 5C7GA 4QB6A 1ZYBA 1LCLA 4I3PA 3KVAA 1FNZA 1ZZ8A 1CAVA 1J3PA 4ZPIA 3T1LA 4OUMA 2PQQA 2WIIB 4P9XA 4XFBA 3H8XA 5CNAA 4YM3A 2DF7A 1NE6A 1NZIA 1VAMA 2WZ8A 2OUHA 5T3NA 3U14A 2XLFA 3VHNA 5CFDB 1G6NA 5CU1A 5AVAA 3HNYM 4RHV1 3VGIA 4ZS2A 5CVRA 1O3SA 3ACIA 4GB31 3T0AA 3C7OA 4Q5OA 3EO6A 4AEMA 1JN2P 1RUE1 2WAAA 3VBSA 2RS11 3T2TA 1ULFA 1B35B 3GF6A 5B4NA 2D5FA 1J3QA 3TN93 1RUJ1 3ZFFA 4BISA 1C8M3 3ACGA 1AJKA 4RGAA 4XJUA 2VBBA 3FE5A 5CFDC 2AH2A 3ALQA 2LW8A 2R041 4XDPA 5DUVA 1RHI1 4JV4A 3WNXA 4DZGA 2DCJA 1WMDA 3I4IA 5EYYA 4XJWA 1GWLA 2Y60A 1C3HA 3R4UA 3RI9A 3SKVA 2E33A 2OX0A 3UYJA 3VL9A 2V5DA 4ATFA 4D7TA 1AL0G 3Q8AA 4FP3A 2R49A 1W9WA 1B35C 5CZKA 1MZ5A 4MHUA 3LGRA 2GC0A 4ZS3A 3JBG1 5J7MA 2HBUA 2QQOA 1RMU3 2QQIA 3D82A 2Q0AA 4W50A 3RMXA 3RYPA 1RUF2 4YGCA 4IE6A 5JZGA 4YZ2A 1RUD2 4NR1A 1R093 1HN1A 5D8AA 2XOMA 1RL3A 1K3IA 4EYUA 2D93A 4A3ZA 3WF3A 1F5FA 2G9GA 2ET7A 2NN8A 2QTWB 2B46X 3POFA 4NWVA 1DP0A 5C3SA 4I0AA 3IMMA 4CCDA 4P5YA 3RZMA 3TEYA 1AJOA 4CCEA 1OD3A 5HCFA 3WF1A 1OLMA 2MEV1 2GC3A 2HWB1 1CAWA 5H9RA 5JAXA 1PO13 4DRRA 5ISLA 3IDAA 2IVJA 4YYOA 2HYKA 1FOD3 5FOJB 5A3OA 3H42B 3AYDA 2XWJB 3LA7A 3U11A 1CJDA 4MSVA 3ZM8A 4GAZA 1VRH2 4Q4X2 4EN0A 1SMVA 1STMA 3V0BB 3T1MA 1S0CA 3H3LA 4DXSA 4K40A 5BNPA 4YW3A 4XQDA 5FZDA 1JOPA 1AR82 3W5MA 4NIGA 3H3ZA 2CV6A 3KHCA 4COWA 4E2GA 1KXGA 4YZ4A 4IL7A 3KV4A 4NAMA 4KWKA 5FXZA 4QXCA 3KHBA 2PHFA 1Q5OA 1WLCA 5DDJ2 4ES9A 1LOCA 3B9IA 5F37A 1GLHA 1FMD1 4Q8KA 5A7NA 2GMMA 1CR7A 2B42B 3FWEA 1L7RA 3T09A 4NIAA 3BPZA 4OZXA 5FP4A 4D6SA 3JD72 3S7EA 5LZ6A 5H9QA 1G9CA 5FO8B 1WZXA 2PTMA 3RSJA 2JE8A 2PMWB 3DYOA 4XQ4A 2RR12 4OMDA 3M3EA 2UU8A 4DPNA 3I59A 1AL21 2X05A 3VZNA 3Q8BA 2OT7A 2WWUA 1RUF3 2WN2A 3ABZA 4NRPA 2VZPA 3E6CC 1RUD3 4NPRA 5FZ6A 4CCLA 1HRI1 1A34A 3RYKA 3R05A 2AACA 5KR7A 2X5IB 2Z79A 5FP9A 1XOYA 2PLV2 5KBFA 2HWD2 3N36A 2E53A 1UYPA 2JENA 3VBHA 1Q8QA 5IYYA 1SQ4A 1VBA3 4INDA 4JGZB 4PI0A 4MG2A 1A8MA 1NG0A 2G9ZA 4IEXA 1KS4A 5FP7A 1ZRIA 4IGOA 4LKFA 4LMFA 5IUQA 3BIWE 2W95A 2Y26A 4RGGA 1N3OA 2Y0OA 3FJSA 4JTNA 1SLAA 5BYNA 3KQ4B 4YNIA 5I93A 2B9VA 1SBDA 2VECA 2X5IC 3LA3A 3Q8CA 1W99A 2H0BA 4Q4X3 1BZWA 1RXFA 1UZZA 4Z1VA 2XGXA 1VAVA 3NMBA 4RGKA 4UFKA 2JE9A 4JGZC 2YU1A 3GYDA 2OXBA 4O9GA 2Y6GA 4YW1A 3NVCA 4LO5B 1C8NA 4NVPA 2E7TA 1MS8A 4AZZA 3W58A 1DGWA 1JHJA 4FPLA 1TNFA 2VZOA 2HWE1 1XNAA 3PUIA 2TEPA 1RUH3 1JOJA 5DDJ3 1NLSA 4COYA 1X82A 5FY0A 2J42A 4A7YA 2VMFA 3O7OA 5DXDA 5J36A 4LORA 1VBB2 3ACFA 3AC0A 1VAKA 5FTTC 1W9SA 1WMXA 2OVUA 3DKQA 4XETA 2KD7A 5GKAC 5LA2A 4OQ9A 2HWF1 2ZABA 4JGYA 4HSLA 4C90A 1H2KA 3VV1A 4AI1A 1HXS1 2UWBA 2VBPA 4GZ9A 4ASLA 4PQ9A 1HLCA 4XMIA 3CDZB 3VD9A 2ZX3A 2JKBA 3M4FA 1SG3A 1W8UA 3O1TA 1WCUA 3OPTA 2WO1A 3VBOC 4YFWA 1EV11 2RM23 4I09A 4FSJA 2PAEA 5C8CB 4C0BA 3U4XA 2Y6JA 4G9SB 4LLFA 2HWD3 3ZN6A 4BU2A 4Q0SA 5JXJA 1QJU2 4NJ4A 4IEQA 4XILA 3TRSB 5A3TA 1I9RA 3DPRB 2RMU1 3I3QA 5I0RA 1HB3A 3L2HA 1HRV2 4Q0VA 4QGMA 4Y26A 2VNOA 1BQPA 1OH4A 2AEZA 2ZKLA 1UKGA 2ZHMA 3TOJA 3WF4A 4DS0A 4FBFA 3HD8B 3O1OA 1W6NA 3WD5A 5KXEA 1NXD1 3UGGA 2O8OA 2VW1A 2JDHA 1FX5A 3H8UA 3KZ4C 1LKNA 2OIIA 4QB1A 5FYYA 5C8CC 2CL2A 3GNEA 2A71A 5DZEA 4IEUA 3RYRA 4CCNA 2CDOA 1NY72 5AVPA 1EP0A 1O4TA 3LQCA 1GZCA 4HPKB 1OC1A 2P37A 3WDYA 5HV0A 1VBC3 4COZA 4UYBA 2XVKA 3AMQA 1YFWA 4I01A 2R30A 3DPRC 4XIKA 4KBZA 2XJTA 1TVGA 3MV11 2BFUL 4P08A 4MADA 5LBEA 3PVEA 2W08A 4RS5A 4BQ5A 5F39A 1PVC1 3HIFA 1QIQA 3LAGA 1QJY1 1LOAA 2JIGA 2LRPA 3AMMA 4UAPA 5DAQA 1OA2A 2EXKA 1C57A 1MS0A 3INAA 5AC91 1H8TB 1TMF1 5IK8A 4G4FA 1OUXA 3OGVA 1VBB3 4OQ8A 1RUG2 1WCDJ 3D6EA 5FOBB 2OPKA 2C9AA 2X53S 3F2ZA 1BEV3 3HPNA 3KMHA 3MI8A 1KQRA 3PL0A 4CXYA 2FCUA 3O1PA 3IMNA 3ON7A 3QLQA 4XTMA 1L7LA 3T08A 1KGYA 2VE1A 2WFF1 3RMYA 4BWOA 5A3PA 4Z07A 3MPBA 4EZHA 1YHFA 5F7UA 4O9EA 2VOTA 1JBCA 1VRBA 2DYCA 3BU7A 5GLWA 1GWKA 3WNLA 1H8TC 1OPOA 2GU9A 5K4LA 3W59A 4FTBA 3RWNA 5K9YA 2AZ5A 2EIGA 1NCRA 3T30A 2F4LA 4XJ8A 1FPN2 2EVXA 2WZR2 3FFQA 4NHMA 5CG8A 2RJKA 1CAUB 5FZ0A 2X29A 4RQPB 4XOGA 4LNVA 3RG0A 2DCZA 1VBD2 2EA7A 3FBYA 4LKEA 3AP5A 5FZBA 3RRDA 3N9MA 2WQ8A 4GMP3 3O1VA 3ZSLA 4IXLA 5EXOA 5A3NA 1KFUL 2E9QA 4JGYB 4JZRA 2V09A 4KBBA 4MYEA 3SMHA 3T0BA 4B3NA 2A1XA 5IVEA 2RS31 3BIEA 5FPUA 1V70A 3H8RA 1D2QA 2BUKA 2QZ2A 1V6OA 3WQBA 1POQA 3AZZA 3RQ0A 4N9IA 4XJZA 3WR0A 4A2UA 1OI6A 4RQPC 1ASJ1 2X5IA 5FDBA 5APAA 3HWJA 2VCMA 4Y1ZA 5A7WB 1OA4A 1S0GA 1BJQA 5FXVA 1YIPA 4CP0A 1RUC3 2F6BA 4JGYC 5E1RA 1CN1A 3KF5A 4OCTA 4FOWA 3KM5A 1GP6A 1O91A 5FYMA 1ZRFA 3JQXA 1XPWA 4MV2A 4EZ4A 3ZXGA 5H9SA 3KT4A 5ANQA 2ET1A 3OBTA 3ZXLA 3IDBB 2GH8A 3BVCA 4YVSB 4TZDA 3RZLA 4IEOA 4A45A 4LITA 4Q1RA 3BI3A 3JB8A 1OURA 3I2OA 1OFNA 1K5JA 3NAPB 1PM4A 3E6DA 3NNLA 4HSJA 1UOBA 3SLIA 4RFT0 1XRUA 3LDRA 4MXVA 4AFAA 1OA3A 1ULDA 3K48A 4K8FA 1AR93 5IVJA 2YXSA 4N53B 2XJVA 1VLNA 3WDXA 1W9TA 1MACA 2P5BA 1FV3A 2VQUA 2ZGOA 2E7AA 2VD7A 3ELNA 2MNGA 4M3CF 2F17A 4CEWA 1SFNA 2ZGQA 2C0ZA 1V9U2 1EYBA 2Y64A 1UOFA 2IXCA 2WZR3 2DCTA 5FO7B 2D44A 2WZPP 3VBOA 3NAPC 1GMMA 3THCA 4JRLA 4AAXA 3IIIA 1PGW1 2XWBB 1AR71 3BB6A 4QU1A 4IGPA 4JHZA 4PDWB 4HKLA 2P6CA 5FLHA 1YI9A 4Q4V1 2EXJA 3ZN4A 2OA2A 3EMRA 3W5NA 4N53C 4MGZE 1BBT1 4JKLA 3WCSA 3BN6A 3LIHA 1GZTA 4PLOA 4H7MA 3ZSKA 2J1RA 1JOBA 3N7LA 1DZTA 2FDJA 3KV9A 4AF9A 1W3XA 1NCQA 2O1QA 1NA1A 3MIDA 1TG7A 4P9IA 5T52A 5A3WA 4QPGA 2AYHA 4XVHA 4PDWC 2I74A 2NMNA 3TWIA 5JWPA 1JMUB 2PA7A 5EJ1B 2ZKNA 1UY1A 2YBPA 3LFIA 4LBLA 4XEZA 5FJHA 3B94A 2Y6FA 3NRUA 4FPOB 5FRAA 2W0XA 2J1SA 2GALA 3V0AB 1QQP2 1MEC2 2QQNA 5JIUA 3ACLA 4ZU4A 3VB9A 2K46A 2RVAA 4IEWA 5CISA 2WS92 5FMDA 1PIV1 1ZRDA 4C0HA 1G9DA 5J96B 4JQTA 4KQ7A 1EUUA 5DABA 4EN8B 5LWBA 3CL1A 3QH6A 4ZXEA 1OVPA 2JB4A 3CO2A 3OD4A 4EWAA 1UY3A 3WNMA 3B9CA 2ZEWA 4HPKA 5HXMA 4NHXA 2CU5A 2BGPA 5JSPA 4DUVA 3J8F2 3VZJA 1S2BA 2D40A 3JB4C 2D6LX 4B1LA 5E16A 5JIAA 2QJVA 2BW8A 1LR5A 2OPWA 1OSGA 4XUTA 1Q8OA 2C5DA 1WMFA 3PURA 4XFAA 2ZAHA 4PIZA 3LDBA 1JS9A 5FBJA 1N1YA 1YQ6A 2OW4A 4XUNA 4TWTA 2ENRA 1TEIA 2ZPXA 2CGPA 3PTRB 4Q4Y2 4AGGA 3UETA 3HN3A 4UBGA 3WX5A 2WO2A 4K21A 1GZWB 1VMHA 2B45X 3HT1A 3AVRA 3UGFA 3VKFC 1JI6A 2UWAA 4B7KA 1LAJA 2P4EA 4DMIA 5L7OB 1PZ8A 2VGDA 1W0OA 3N3HA 2XBO1 2A6ZA 2B9UA 5IVVA 1C5HA 1MS3A 1NQDA 3TYJA 2NM1A 1RYYA 1U5YA 1NX9A 4ZY9A 4XF9A 1SCSA 1JYNA 3CLPA 2BGCA 3ZFGB 4WZFA 1AR63 3D0SA 4TSVA 3PLQA 5JOZA 1BMV1 1KRIA 2VMCA 1AHSA 2VQAA 2VTXA 3N7KA 4Y4RA 5FMOL 2BRTA 3MPPG 5IATA 4RHV2 5L7OC 2V72A 4J1XA 1GZ9A 3CNAA 3MGUA 5IFTA 3BTYA 2DVFA 2Y8KA 3I2GA 4YARA 3M1HA 4XHBA 1RUE2 4A6SA 3U0ZA 3OTFA 1H2LA 2RS12 2FDFA 5FZ8A 4E27A 4N43B 3ZDSA 2WS93 3ZFGC 1YQCA 1COV1 4XFGA 4B4QA 1RUJ2 4HG6B 2VTXJ 1UWWA 3WSOA 4AFMA 4GWMA 3PDQA 1QKQA 2R042 4PLMA 1RHI2 2DDUA 2ZEXA 3J8F3 4BDVB 2GP3A 3AZVA 2VMEA 2D3PA 4V1PA 3VBFB 1IHMA 5D2AA 5A6QA 4AFCA 4N43C 3JBG2 3SITA 3VHOA 2VOVA 3T0DA 2XR4A 3WG4A 1MZ6A 1ULEA 4QQ2A 2VH9A 4IDZA 1ZRRA 1J84A 2Q1ZB 1GOHA 3AP9A 1XYNA 4Q4Y3 1JYTA 2VQTA 2JKXA 2AUYA 3GCWA 4MGTA 3DV8A 1OQDA 1H9PA 4P02B 5CFCA 5JSRA 3WOGA 1FAYA 4IE5A 3VBFC 2MEV2 2OZJA 3SHRA 1W3VA 4KG0A 2HWB2 1SLBA 3OD0A 1J1TA 4IGQA 4QD2A 1ND3B 4LOTA 3N35A 5LK7B 1WBLA 1JXNA 2VBDA 4WVMB 1V6NA 2P2KA 2OKXA 4FAGA 2HWC1 5C3QA 1JUIA 5KC5A 3B02A 2IUWA 1PHMA 3DUIA 4YW7A 1QH7A 1RUOA 3IZOA 4YVWB 1UW8A 3GZUC 3MYXA 1ZA4A 4PLNA 3FBMA 1HB2A 3UKVA 4ARXA 3G6JB 4PDWA 2E51A 1RVF3 5KC6A 1JZ4A 1M06G 2VXJA 5GZCA 3ZKYA 5EPAA 4YG6A 4LKDA 3MIEA 3JUUA 4QXKA 3LSDA 1WWYA 3GBFA 1ND3C 2Q1MA 5A7SA 3MUZ1 1F9KA 4Y22A 2Z42A 1SLCA 4J25A 3WW3A 5IK7A 1WCQA 4HANA 4CCJA 4XAEA 2RHPA 2ORXA 1T2XA 5C3OA 4HZFA 1OMIA 4YVWC 1FMD2 4E2SA 3AKTA 5FV3A 1W6MB 5I0DA 1RJ7A 3B7MA 3PMSA 2Y33A 3IT8A 2DUQA 3Q8EA 4XF1A 5IVYA 3ZYPA 1DQ4A 4AFDA 1DGWX 1RHI3 4B4RA 5FYIA 4CDUB 1W8WA 1A3KA 1P8JA 2R071 3C7EA 4QXBA 5BNNA 2ZGKA 4OUSA 2DVAA 5KHHA 3WHTA 4DB5A 2CDPA 2ZJCA 2RDQA 3NQHA 1ENRA 5FKBA 2ZAAA 3V0AA 2BBAA 5KHIA 1UY2A 4LBJA 1AL22 4Y1YA 1V6LA 3JU9A 3VUOA 2FDIA 3PHMA 4EJRA 3UESA 4BA6A 3EXUA 1HRI2 3I2JA 1UL9A 2PYTA 4WVVA 3PU3A 1V6IA 3K75B 4I02A 4CDUC 4MOAA 4AQSA 2WL1A 4DUXA 5F6LB 3E1F1 5DAWA 3OGJA 4EN6B 4Z8BA 3POEA 2XG3A 5FPXA 1JU3A 2UWCA 2ZHKA 4TTGA 3PJYA 1F5JA 3WNOA 4TLGA 4E4ZA 4ONUA 3FMGA 3VD4A 3IBMA 3C7GA 4AI3A 5KHGA 3IIAA 4HK9A 2W47A 5A32A 3ZPYA 1RITA 1OLME 3KD4A 1ENQA 1MVQA 3AZYA 3OEBA 4YM0A 3S0MA 5I8SA 4R9AA 5T5JA 1LOFC 4UW4A 1Q56A 5A3UA 2WNUA 3NV2A 2VM9A 3VKLA 4CU7A 3MF6A 2XL9A 3V64A 1UMZA 2BVBA 2WSUA 1LGCA 2B8MA 2DTWA 1ACCA 4JQRA 4Y1UA 5GLTA 3ZYJB 1UX7A 3D5OA 4H55A 5CG9A 2W9XA 4IEVA 1GANA 4URTA 2IXHA 3R4DB 3WUDA 4CU9A 1RXGA 3SEPA 2XHNA 1QDOA 1ZBA1 1CZTA 3CIHA 1AZDA 5FY1A 4LUKA 2HWE2 2RV9A 1GICA 3AKSA 3LEKA 5FAXA 5IK5A 1CD3G 1R1A3 2ATFA 1GQPA 1W2OA 2R063 1FMD3 3IKWA 3ZFGA 4AI2A 1O4ZA 2VC9A 5LRSA 4UI9L 3ZFEB 2LS6A 2BGOA 4AVAA 4ASKA 2WR9A 2BNNA 1DU3D 1ENXA 2GDFA 1POV1 3D0JA 3P3NA 1RINA 4GH4B 2EF6A 2HWF2 2A6VA 4YSFA 5JXHA 3M3OA 4P00B 4BPZA 2Q5TA 1AXYA 2QQVA 2JG8A 5FY9A 2CNAA 2D3SA 1QNYA 1HXS2 1MQTA 2R1DA 2Y0IA 1IKPA 1IPSA 2JD9A 5I0UA 4RD7A 4M4RA 5IWFA 4N7IA 4IETA 4XF0A 3GHMA 1AYM3 2CTVA 2WSVA 2Y6KA 1NAEA 1ZZ9A 3SC7X 2QQMA 3ZFEC 5SV5A 3WF0A 1EV12 1W6QB 1ZZ7A 2X10A 1UU4A 2IVIB 3EQEA 4BK4A 4CCCA 5C9AB 4GH4C 2JG9B 3LPGA 3MF9A 4KL1A 1XYOA 1VBE1 3N9LA 3PVBB 2V4AA 3NKGA 1VMJA 1YJLA 5EJZB 1C1FA 3N7JA 2JD4A 2QDRA 2RMU2 4BE3A 4LA3A 2Y34A 1W8HA 3JCIA 1CESA 2C26A 4YWAA 5DAPA 3TEWA 4Y20B 3MLKA 3PMEA 1PM7A 2CGOA 2WT0A 4WM7A 5C9AC 2JG9C 4X8NA 2VU9A 4HVRA 2FCVA 1SFPA 1LHWA 1XE8A 4QM8A 4FVVA 4AI9A 2YGLA 4BIFA 4Y5SA 1TME1 5GLZA 2VUAA 4XFIA 1PVC2 2I45A 4HFSA 1UZWA 3I97A 4WVMA 1QJY2 4K6BA 5C8WA 4HONA 5AC92 2P1BA 4L8QA 1TMF2 4O7XA 2DTYA 5JPMB 3ST7A 2FCTA 1NLQA 2LALA 2RJ2A 4HKOA 1GU3A 3KGLA 3R4SA 3VZKA 1R64A 4MLOA 4ZXKA 2HJIA 4XPVA 5EHDA 4YG3A 3OYWB 2QQJA 2WFF2 2YROA 2JB8A 1QOTA 5LY1A 1HXS3 2D6KA 2FMDA 3AYCA 4IV3B 1XQNA 2VAUA 5BNOB 2P3JA 3ZMNA 1ULPA 3C2UA 1V6KA 4CA9A 2VMDA 5A33B 4QQPA 3O1MA 4QHOA 1OLQA 3UL2A 4XQWA 1QDCA 4I0WB 1GSLA 4UW6A 3USUB 2VXRA 1QEXA 3URFA 3RZKA 4CDUA 1JZ8A 3HQXA 3ETQA 1QU0A 2P3KA 4XURA 1XNDA 1XSRA 4OMCA 2RMU3 3R0RA 4IV3C 4M3CA 3B93A 3GBWA 3I54A 5A6XA 5CA6A 1W0NA 4ISRA 5F32A 1T6GC 2RS32 5FXWA 5BNOC 1UAIA 5FJKA 2XDVA 2NYYA 1QF3A 2UY9A 4AR2A 3BUCA 1DCSA 3WY6A 1TNRA 5FQ0B 3F95A 1LECA 1CAXB 1F2NA 1UIKA 3POJA 5EIYB 2E6VA 1ASJ2 1FI2A 1RUI1 3HAGA 4QDSA 1EAH1 5FMCA 1EPWA 2DVBA 5LA0A 1LOFA 5IW0A 5C70A 2A5ZA 1H1AA 2A73B 2HH9A 3I2DA 1WW5A 4MGIE 3AKRA 4QPIB 2IFWA 2XXZA 3VD7A 3MZHA 4XF3A 3U07A 1DZQA 2V4VA 4YW4A 1CJPA 2GN7A 3NJYA 4K8RB 2QDNA 4XCBA 5F6KA 5JUVA 2KA3A 5C33A 4D94A 1EY2A 4PF1A 1ZZ6A 4MO3M 1UIJA 3A4UA 4NMIA 2DUOA 2D6PA 4QXHA 4C1XA 3SKJE 1UYZA 1M4WA 3POSA 1ND2B 2X8KA 4S2HA 4COUA 1PO21 3H7JA 1K12A 4LUMA 4CUGA 3WP6A 3I2FA 1GNYA 2BEOA 1IS5A 2XJQA 1UO9A 4QPIC 1DIWA 3FHIB 4IE4A 1PK6B 2XQXA 3MIGA 1VRH3 5E88A 2BDRA 1W06A 2SLIA 3I7DA 4QGNA 3TB0A 3FUQA 2HEVF 1G8WA 1AR83 1NXMA 3NL1A 2JDZA 3I2HA 3LOBA 3CF6E 1ND2C 4Q8LA 1ZBE1 3TN91 1SEFA 4AXOA 2H6CA 4KWUA 1ALYA 2QKDA 2SBAA 3ILRA 2AREA 1PGW2 2ZGPA 4LIUA 1AR72 4RA0A 2R16A 1S2EA 1PK6C 4FO9A 4HK8A 4PF5A 3OSDA 3OBAA 3EB7A 4Q4V2 3ZLIA 1SACA 2QQWA 2AGSA 2Z5WA 1BBT2 4K20A 5CFDA 3JD73 4FI9A 2ZX2A 5L9BA 1WUVA 3V65A 4J1WA 4QPYA 4LEJA 4DY3A 5D1IA 3OY8B 5FZ9A 4A3XA 5J98B 5JI9A 2H0VA 4FOYA 2RR13 3AZWA 4CDWB 2TUNA 2YPDA 3AP6A 1KD7A 5ANNA 5C9AA 1B35A 1UY4A 2ZGRA 1QOOA 3NKTA 4XHXA 4BH9A 3KT1A 1WLWA 1US2A 3VKOA 1B09A 3T2OA 4IV1B 1K5MB 2CAVA 1F35A 3BTAA 1LB2A 2ARAA 2UY8A 1PO11 2PLV3 3GZTB 4BIOA 2O0OA 2ZMKA 2VZVA 4WBBA 2AENA 1FOD1 1PIV2 1V6JA 2WAOA 5JOWA 3RZJA 4CDWC 4ZKTB 2D5HA 1FT9A 5JMCA 1IQAA 3BTZA 5EFUA 4YG0A 3VN4A 3O1SA 1LEMA 3L9JT 1ENSA 1QOSA 1OF3A 3RS6A 2VZSA 2JIJA 4HXCA 1BKZA 2YHJA 4N90A 1K5MC 5IVCA 2N7GA 2TBVA 1OH3A 3PUHA 4PJYA 4XUPA 4MXWB 1HB1A 3BKZA 1JZ7A 2VZTA 2MPFA 3WV6A 2ZZJA 1NYWA 2Y38A 4Q4W1 4GWJA 1I5ZA 4PI2A 2KR2A 2RE9A 3KS7A 4PT6A 4NIIA 2IWGB 2Q4SA 4CDQB 5A1FA 3AXDA 4CUAA 1JUHA 5FWEA 2BYVE 3GCXA 4DUWA 4M0HA 4P14A 3ZR5A 2W1UA 4BQ2A 4XAAA 3K4ZA 1W6OB 2VCBA 2WKKA 2ZACA 1NLRA 3FLTA 4IUGA 2CYFA 1ULOA 2C6SA 3GHNA 1Y9GA 2VJXA 4Q0PA 5BNQA 1O4YA 1OFSA 4PIYA 4Q27A 4Q4V3 3WLUA 3R6SA 1PX4A 2VUJA 5AFBA 1U12A 5C4WB 3V0BA 1VALA 2XBO2 1YI7A 1BBT3 2KXLA 2ES3A 5FUPA 1QJFA 4OZOA 1WLDA 4CDQC 1KS5A 3QH7A 5BNOA 5JOXA 5FK7A 4LT5A 1W05A 2VMIA 1UF2C 2GNBA 5HCBA 4K3UA 4SBVA 3TNQA 3AKPA 3FHQA 3C7HA 3KV5A 1BMV2 4AVCA 2LTNA 1AVBA 4R4ZA 2GMPA 4HL0A 2W52A 1IS4A 1I3HA 3WP3A 5C4WC 1VBA1 1LGNA 5DG2A 2QCSB 2YB7A 1U5XA 4MGYE 4CXXA 4CCOA 1DBNA 1POV0 2HYXA 3GJBA 3WT3A 1IS3A 4F83A 1WBFA 3KCXA 4NHLA 3ZIXA 1JHNA 4AI0A 5GM0A 4C8DA 2WNVC 1HQNA 4F3JA 4XF4A 1YUDA 1COV2 2PHWA 1GBGA 1QJU3 1XYPA 2AC1A 3LFMA 2VNVA 1ZA7A 4XC9A 4Y1XA 4OI2A 5ABJB 4CXWA 4AYUA 2WNEA 1HRV3 2CHHA 5FXXA 3ZYHA 5FZ1A 3HNMA 2DV9A 2EXIA 5B4XA 2WJSA 3DGTA 2A3YA 3FLRA 3P5BA 3GALA 1MZEA 4QPIA 4LR4A 2VOXA 3U10A 3MW3A 4U2AA 4XBQA 3UGHA 2VUDA 5A3MA 1W90A 2HKXA 3VDBA 1S0BA 5DAVA 1RUH1 4JGZA 4CP2A 5ABJC 1I1EA 3CHXA 4QX5A 3H50A 2Q1FA 4K1ZA 1KFXL 1QJX1 1YIFA 2R32A 4ORFA 2K9ZA 1GV9A 3K46A 4LE3A 4MUVA 4QX2A 3W21A 2B7YA 2ZEYA 4FOVA 2EIBA 2XUEA 4CU8A 4H3WA 4JVAA 3PNAA 2YYOA 2W1SA 4AGVA 1RUG3 2B5HA 2XBO3 5FZ4A 2QUOA 3KGZA 3ZDVA 3WP4A 1W9FA 1L3JA 3BALA 3LDKA 5FIXA 5C3RA 3PJQA 2HWC2 2VZ1A 3D3AA 4FP2A 5F5CA 1OHFA 4NHKA 4YZ1A 2JDUA 3JXSA 2XVGA 2RM21 2JDKA 3QOPA 4GXLA 4H14A 1S0IA 2BV4A 2OS2A 2VOKA 2VZRA 1AYN1 5DG1A 2CSGA 3B00A 1ZREA 2FDKA 4YVSC 1ONAA 3VBUB 4R9CA 2QBXA 5FUNA 5CKNA 1CX4A 2XPJA 1FPN3 2QQUA 2WQZC 3RZZA 4GALA 2PHRA 1DYPA 1H2NA 1AXZA 3J9SA 5FCCA 3CBNA 1VBD3 1MVEA 2FMYA 1O7FA 5K7PA 1DQ1A 1SFYA 1W8FA 4XW3A 1UY0A 4V2WA 4BYYA 5FZIA 5EQUA 3GXUA 1SLIA 3O0XA 2MHFA 2BVVA 2GMEA 1VBC1 4D3WA 5F2WA 3AYEA 2R072 4RL7A 1N1SA 2JDYA 1Y9QA 5J48A 1OOPB 5C8CA 2VVEA 3RZHA 4K7JA 4DFSA 4EE2A 3EYPA 4R9BA 2YUEA 4EV0A 3WQ1A 1MZFA 1ZZBA 2XLGA 1JODA 5A6ZA 1WGPA 2EAAA 3DPRA 4QHBA 2IFRA 5JI7A 4EQVA 1VE0A 3AX4A 4UFMA 1VJ2A 3SH5A 4OI1A 1XE7A 1QGLA 1BEV1 1DGRA 4E4SA 5IJRA 1HDKA 1OF4A 1QHDA 2A7AA 4D7SA 3ZVXA 1OOPC 2YGMA 5DZFA 5EJ3A 4MXWA 5FFOC 1RC6A 3RWKX 2W92A 5T5OA 3UJQA 3E5UA 4LOSA 2WLQA 4YGEA 2VQ0A 5KHKA 1WD4A 4LPLA 4C91A 4AQ6A 2PELA 4C1WA 2OQ7A 1UYYA 1Q3EA 4OHXA 1S0DA 3E6BA 2HWC3 4CUBA 2YFZA 3IPVB 4LLOA 5GZEA 4Q1PA 1BCXA 4I2OA 3DKWA 3N9NA 1QXJA 3FZ3A 4RSUA 4TXWA 4Y5TA 5FWJA 4NIDA 3MICA 2XB6C 1AX0A 2ZX0A 5BPXA 4GQ7A 4XACA 4BLJA 1KITA 4LHSA 1W6PB 4NHYA 4BJ0A 2GNTA 1H8TA 1LHUA 1V9U3 3CEWA 2GZWA 3MIHA 1UZYA 1CIYA 3H0OA 4GMP1 5E6HA 3BGAA 2ARCA 4BQYA 1ZBA2 1OKQA 3POBA 3MV01 5JDBA 1S1AA 1TZOA 4XUQA 1NT0A 3LD8A 4Q0QA 5FYCA 1H0BA 3IDCB 2LUWA 3WDVA 3VDDB 4XBLA 2J1EA 2DBNA 1PNFA 4E4HA 1QXRA 4IESA 3RJRA 3TEXA 3N9OA 1ULCA 4LO6B 4CP9B 2WNVB 5T50A 2PXJA 4CVUA 3T2QA 3QD6A 3A0NA 2Y6HA 1GKBA 1ZRCA 5LA9A 2R073 4LO4B 1MS4A 3VBRB 2NPIA 2VVDA 1QH6A 1QY4A 2D6MA 4M00A 1RUC1 1JZ6A 5LEKA 3RJ2X 5FZOB 4UXAA 1SPPB 1CAUA 1U0AA 4HKWA 4JCKA 4RQPA 2J7MA 3MIFA 1O3TA 3WINE 3CJIB 3N7MA 2YC4A 3NJXA 4CTEA 4DINB 1KEXA 4RYDA 1W9YA 4WVZA 5FZGA 5I91A 4UF0B 1PGL1 3VDDC 1DG6A 5ABJA 2NP0A 2PHLA 4GB32 4Q29A 1XSQA 1D0HA 5GZGA 1KJRA 2A6YA
chains in the Genus database with same CATH topology
5A3WA 4NUBA 5F32A 5FYUA 5FXWA 5FP7A 5FJKA 2XDVA 5FUNA 4IGOA 3ZPOA 5A3PA 2YBPA 4EZHA 4TN7A 5FJHA 1VRBA 4ASKA 4BISA 5A1FA 5A7WA 5FWEA 4GJYA 5IW0A 5F5IA 5K4LA 3U4SA 4XDPA 4IGQA 4GD4A 4V2WA 4CCMA 5F3IA 5FPLA 5FY9A 5FZIA 4DO0A 5F3CA 2OX0A 3UYJA 5LWBA 2XXZA 4BXFA 3OPWA 2YU1A 5FZ0A 4GJZA 5A80A 3NJYA 5IWFA 2Q8DA 5F2WA 5CEHA 5IVBA 4D6QA 5FZ7A 3N9PA 5FZBA 2YBSA 3N9MA 5FZEA 4Y33A 5FUPA 4AAPA 4Y3OA 4QXHA 5A3NA 5A7QA 4LIVA 5IVEA 4QWNA 5FPVA 5FY4A 5FY0A 4CUGA 5F3EA 4EYUA 5FZ3A 3N9LA 5FPUA 5A7SA 5FY5A 2OQ6A 3PURA 3K3NA 5LY2A 3KV5A 3DXUA 5FZCA 3LDBA 4URAA 5FBJA 4CCJA 3RVHA 5FYZA 5A7WB 3U78A 3PTRB 5FZMA 5FV3A 3N9QA 5FYVA 5FXVA 5FZFA 4CCOA 5FZHA 5ISLA 5IVYA 4XDOA 5FY8A 5FYSA 3AL5A 5F2SA 4C8DA 3AVRA 5FYIA 5FPAA 4QX7A 2OQ7A 4GAZA 5F3GA 5FP3A 5FYMA 4QXBA 5FY7A 4CCKA 3OPTA 5IVVA 4LIUA 4AI9A 4EZ4A 3K3OA 5ANQA 5FXXA 5FZ1A 5A7OA 5FZDA 5LW9A 3AVSA 5FYBA 3N9NA 5FZOA 3ZLIA 5FWJA 5FZLA 5IVFA 3KVBA 4LITA 4BU2A 5FPBA 2YBKA 5A1LA 5FXZA 3KV4A 5FYHA 3AL6A 4QXCA 4QX8A 4HONA 3DXTA 3PU3A 5A3TA 2WWJA 4UF0A 5FZAA 4Y4RA 5FYTA 3PU8A 5E6HA 5FZ9A 5F37A 2XMLA 5IVJA 3KV6A 3PUQA 5F5AA 2YPDA 5A7NA 4CSWA 2YU2A 2P5BA 3LD8A 4DIQA 2VD7A 5FYYA 5FYCA 5FP4A 5FZ8A 4CCNA 4D6SA 2Q8CA 4LXLA 5LY1A 4E4HA 2Q8EA 3N9OA 2XUEA 2PXJA 3PUSA 5A7PA 4QU1A 3PDQA 4IGPA 3KVAA 4V2VA 5FZ4A 5FZOB 2OT7A 2WWUA 5F39A 2GP3A 2W2IA 5FZKA 5IVCA 5FZ6A 4CCLA 3PUAA 5F5CA 5KR7A 5FZGA 4HOOA 5FP8A 4UF0B 5FP9A 3KV9A 2OS2A 4D6RA 2GP5A 3K2OA 5FY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A3W A;  4NUB A;  5F32 A;  5FYU A;  5FXW A;  5FP7 A;  5FJK A;  2XDV A;  5FUN A;  4IGO A;  3ZPO A;  5A3P A;  2YBP A;  4EZH A;  4TN7 A;  5FJH A;  1VRB A;  4ASK A;  4BIS A;  5A1F A;  5A7W A;  5FWE A;  4GJY A;  5IW0 A;  5F5I A;  5K4L A;  3U4S A;  4XDP A;  4IGQ A;  4GD4 A;  4V2W A;  4CCM A;  5F3I A;  5FPL A;  5FY9 A;  5FZI A;  4DO0 A;  5F3C A;  2OX0 A;  3UYJ A;  5LWB A;  2XXZ A;  4BXF A;  3OPW A;  2YU1 A;  5FZ0 A;  4GJZ A;  5A80 A;  3NJY A;  5IWF A;  2Q8D A;  5F2W A;  5CEH A;  5IVB A;  4D6Q A;  5FZ7 A;  3N9P A;  5FZB A;  2YBS A;  3N9M A;  5FZE A;  4Y33 A;  5FUP A;  4AAP A;  4Y3O A;  4QXH A;  5A3N A;  5A7Q A;  4LIV A;  5IVE A;  4QWN A;  5FPV A;  5FY4 A;  5FY0 A;  4CUG A;  5F3E A;  4EYU A;  5FZ3 A;  3N9L A;  5FPU A;  5A7S A;  5FY5 A;  2OQ6 A;  3PUR A;  3K3N A;  5LY2 A;  3KV5 A;  3DXU A;  5FZC A;  3LDB A;  4URA A;  5FBJ A;  4CCJ A;  3RVH A;  5FYZ A;  5A7W B;  3U78 A;  3PTR B;  5FZM A;  5FV3 A;  3N9Q A;  5FYV A;  5FXV A;  5FZF A;  4CCO A;  5FZH A;  5ISL A;  5IVY A;  4XDO A;  5FY8 A;  5FYS A;  3AL5 A;  5F2S A;  4C8D A;  3AVR A;  5FYI A;  5FPA A;  4QX7 A;  2OQ7 A;  4GAZ A;  5F3G A;  5FP3 A;  5FYM A;  4QXB A;  5FY7 A;  4CCK A;  3OPT A;  5IVV A;  4LIU A;  4AI9 A;  4EZ4 A;  3K3O A;  5ANQ A;  5FXX A;  5FZ1 A;  5A7O A;  5FZD A;  5LW9 A;  3AVS A;  5FYB A;  3N9N A;  5FZO A;  3ZLI A;  5FWJ A;  5FZL A;  5IVF A;  3KVB A;  4LIT A;  4BU2 A;  5FPB A;  2YBK A;  5A1L A;  5FXZ A;  3KV4 A;  5FYH A;  3AL6 A;  4QXC A;  4QX8 A;  4HON A;  3DXT A;  3PU3 A;  5A3T A;  2WWJ A;  4UF0 A;  5FZA A;  4Y4R A;  5FYT A;  3PU8 A;  5E6H A;  5FZ9 A;  5F37 A;  2XML A;  5IVJ A;  3KV6 A;  3PUQ A;  5F5A A;  2YPD A;  5A7N A;  4CSW A;  2YU2 A;  2P5B A;  3LD8 A;  4DIQ A;  2VD7 A;  5FYY A;  5FYC A;  5FP4 A;  5FZ8 A;  4CCN A;  4D6S A;  2Q8C A;  4LXL A;  5LY1 A;  4E4H A;  2Q8E A;  3N9O A;  2XUE A;  2PXJ A;  3PUS A;  5A7P A;  4QU1 A;  3PDQ A;  4IGP A;  3KVA A;  4V2V A;  5FZ4 A;  5FZO B;  2OT7 A;  2WWU A;  5F39 A;  2GP3 A;  2W2I A;  5FZK A;  5IVC A;  5FZ6 A;  4CCL A;  3PUA A;  5F5C A;  5KR7 A;  5FZG A;  4HOO A;  5FP8 A;  4UF0 B;  5FP9 A;  3KV9 A;  2OS2 A;  4D6R A;  2GP5 A;  3K2O A;  5FY1 A; 
#chains in the Genus database with same CATH topology
 1QQP 3;  1MEC 3;  2EXH A;  3W9A A;  3S30 A;  3MW2 A;  1VBE 2;  3NNF A;  1JU4 A;  4FFG A;  3VBR C;  3OGG A;  3ME2 A;  3EHK A;  2PHT A;  4I3G A;  4P9J A;  3U75 A;  3X29 B;  4I0B A;  4PBO A;  4YW6 A;  3CJI C;  4M01 A;  4AQ2 A;  3NJZ A;  1OQE A;  2VZU A;  1AR9 1;  1W2T A;  5A7W A;  1CPN A;  1DQ6 A;  4LA2 A;  3OF1 A;  1H6X A;  1LGB A;  1WA6 X;  5FPL A;  2JXA A;  1Q43 A;  4N7U A;  5C5U A;  4FT8 A;  3S5A A;  1CAV B;  4FQ4 A;  1SDD B;  4DOU A;  4IE7 A;  5LB6 A;  1IS6 A;  1QNW A;  5I0T A;  4LHN A;  4P9G A;  5T55 A;  4BHP A;  5JPN B;  5JXI A;  5JVV A;  1E5H A;  4HMZ A;  1W0P A;  2A75 A;  4AAP A;  1W8T A;  5FZE A;  3S7I A;  1YQ2 A;  1C5I A;  1D0G A;  4ASM B;  3ASI A;  1NKG A;  3V56 A;  1V6M A;  1ODM A;  2VMH A;  1TME 2;  4LBK A;  4QQO A;  1WD3 A;  4YVS A;  1G9F A;  3M2M A;  3GZA A;  1X7N A;  3NAP A;  3VBS B;  5C6C A;  1WKY A;  2OQ6 A;  2BPA 2;  1Q8V A;  2EIC A;  4JX0 A;  1WW7 A;  4LHK A;  3LA2 A;  1D4M 1;  4NRM A;  5KXB A;  4QKB A;  4AEK A;  5L9R A;  3RVH A;  2ZCW A;  4N53 A;  3U78 A;  2NQY A;  4W8J A;  1YQ8 A;  1Z0H A;  4XCA A;  5FYV A;  5FZM A;  5FZF A;  1S0E A;  4NO4 A;  1PZ7 A;  2CWM A;  3DN7 A;  5EP9 A;  3AL5 A;  1V00 A;  2RS5 1;  2BNM A;  4QDR A;  1O59 A;  3LCP A;  3Q8F A;  4AHX A;  4JHT A;  2UYB A;  1C1L A;  5F3G A;  1DHK B;  2RDS A;  3ECQ A;  4JKM A;  1WW4 A;  2BBV A;  5JOY A;  1IQD C;  2L9L A;  4K9S A;  4Q0U A;  4AGR A;  4OHZ A;  2WC2 A;  4JDO A;  3GZE A;  4RHV 3;  1FYU A;  2E63 A;  3J7L A;  1YYN A;  1H4H A;  2J1V A;  5JZG B;  5A3L A;  3I49 A;  3KCY A;  3KVB A;  1C4R A;  5D8A B;  4GB3 3;  4E4D X;  1JZ2 A;  3WP5 A;  5FPB A;  1RUE 3;  3ITQ A;  3RI8 A;  2RS1 3;  4AW7 A;  1DZR A;  1YRZ A;  2ZXQ A;  5FKC A;  1LUL A;  3E5Q A;  5ACA 1;  1RUJ 3;  5CKQ A;  1HKD A;  2J1T A;  4A44 A;  4PIX A;  4Y5Z 0;  2R04 3;  4QT6 A;  2P3I A;  4Z92 B;  1AXK A;  2JEC A;  4DEQ A;  5JZG C;  4YM1 A;  4FFH A;  4LBQ B;  3RGB A;  2D7F A;  3ILN A;  5D8A C;  3WQ0 A;  2DUP A;  1VB4 A;  1XU2 A;  3SQO A;  4X8P A;  2B4K A;  4NE9 A;  1YJK A;  1RUI 2;  5A7P A;  3JBG 3;  5BNP B;  2FHR A;  4BQ1 A;  2G19 A;  5FUI A;  2W5F A;  1LOD A;  1VPH A;  1Q8P A;  2ZZQ A;  1LOE A;  4M4P A;  1VIW B;  1A6C A;  1MPX A;  2IZW A;  1BK0 A;  3WDU A;  3H1W A;  5KXC A;  1SLT A;  2Z69 A;  2WAB A;  1GYK A;  1K42 A;  4LJH A;  2G9F A;  3NV3 A;  4U36 A;  2WWS A;  5FRE A;  4AQT A;  5L36 A;  1OD5 A;  1GOG A;  3HBK A;  4NOT A;  4AK3 A;  4BQX A;  1S55 A;  5T54 A;  2DU0 A;  1DQ2 A;  2GP5 A;  1EUT A;  3K2O A;  1UOJ A;  2MEV 3;  4AE2 A;  5C5T A;  2IC1 A;  2HWB 3;  5BNP C;  1PO2 2;  3WNK A;  2P17 A;  2RG4 A;  1AR6 1;  3CU7 A;  4QX0 A;  5I8Y A;  3ZIW A;  4LBO A;  2VZQ A;  3NNG A;  1J3R A;  2ZS6 B;  3MEP A;  4X6R B;  4FTE A;  1YFX A;  4AWD A;  4EN9 B;  3IN9 A;  5F5I A;  1W04 A;  2HLE A;  1FAT A;  3K77 A;  5F3I A;  1PZ9 A;  1GZW A;  1F4H A;  2D43 A;  2VNG A;  3I59 B;  3T3Y A;  5DUW A;  3ZXJ A;  4BB3 A;  4L92 A;  5F3C A;  1S0F A;  4DQA A;  2QQP A;  5A70 A;  3OPW A;  2ID4 A;  2WUH A;  3WQ7 A;  4S2F A;  1ZBE 2;  2YC0 A;  2O14 A;  5L7O A;  4AHY A;  1VP6 A;  5CEH A;  4BMB A;  1Y43 B;  4D69 A;  2WYS A;  4D6Q A;  1QMJ A;  2YBS A;  5GAL A;  4Y33 A;  1RB8 G;  5GJ6 A;  2JDA A;  3AMH A;  4DY5 A;  1BVP 1;  1YXW A;  2DVG A;  2ZGS A;  4LKS A;  2XJP A;  5A7Q A;  3VBR A;  4CZS A;  1JYX A;  4Z2W A;  2XJS A;  1YEW A;  1IPJ A;  4AVV A;  1GR3 A;  3FL7 A;  2GN3 A;  4AG4 A;  4EN7 B;  3CJI A;  1W03 A;  3DXU A;  3DEC A;  3J7H A;  3LIG A;  2X09 A;  4TYS A;  3P6B A;  1W8O A;  3O0W A;  1YFU A;  4QQL A;  2GAU A;  3CZU A;  4KH9 A;  3NW4 A;  4M3C E;  3AK0 A;  4YGB A;  1IKQ A;  3P1I A;  1AX1 A;  5J09 A;  4Q4Y 1;  1AL2 3;  2W91 A;  4D8M A;  4N43 A;  4Y4Y A;  1IG3 A;  4OLL A;  5CYY A;  1E5I A;  1SCR A;  3KF3 A;  3ZKU A;  3G7D A;  4BLI A;  5G04 L;  5KWR A;  1H9W A;  1H6Y A;  1HRI 3;  3M8L A;  5FY7 A;  2FDH A;  2FBE A;  3CZJ A;  4BQW A;  4W4Z A;  3K4D A;  1PO1 2;  4O61 A;  4N9H A;  5IFP A;  4KWJ A;  1YFY A;  2C4X A;  4PHZ A;  1QJE A;  3I2I A;  1TQ5 A;  1FOD 2;  4KGG A;  1ODN A;  1HV0 A;  1HQW A;  1W8Z A;  2DWR A;  2ZX1 A;  3OOX A;  2GH2 A;  4BZ4 A;  4CE8 A;  3AYA A;  4HT1 T;  3VBF A;  1PO2 3;  4MGK E;  4QX8 A;  3EJK A;  3JQW A;  4L0P A;  4P9W A;  1DLL A;  5J3U A;  1UNB A;  2DFB A;  2GC2 A;  5FZA A;  2PQS A;  1N3P A;  5LEJ A;  2W94 A;  4FCA A;  2Q30 A;  3SIS A;  1RVF 1;  4YFZ A;  4XFC A;  1RTV A;  5A1A A;  4PBP A;  1Q8S A;  2ARB A;  4CSW A;  3HT2 A;  1ZX5 A;  1UMH A;  1PMH X;  3UNP A;  3O5S A;  1NE4 A;  4K1Y A;  4Q4W 2;  2YC2 A;  3H3U A;  2Q8C A;  2LRO A;  3TBD A;  1WCK A;  3FUO A;  4B1M A;  1Z7S 1;  3AFK A;  2Q8E A;  2UYA A;  2YMZ A;  2YZ4 A;  1H1M A;  1ZBE 3;  4A41 A;  4A7Z A;  3PUS A;  4R8H A;  3W20 A;  3WG3 A;  5CB7 A;  3WW2 A;  4E2Q A;  2K2S A;  1ND3 A;  2ETE A;  3RPQ A;  2VZ3 A;  5HBA A;  1IPK A;  3A22 A;  4V2V A;  1UD1 A;  2YV8 A;  3VKN A;  2HWE 3;  1REF A;  4AOC A;  1CVN A;  2W2I A;  3ZN6 B;  4L11 A;  3CKH A;  4B7E A;  4MHR A;  4LBN A;  1OVS A;  1PVX A;  3PUA A;  5KHJ A;  1RUN A;  2NZ9 A;  2ZTN A;  5L73 A;  4AI8 A;  4YVW A;  1LHO A;  1N1V A;  4HET A;  3OG2 A;  2H6B A;  3HR9 A;  4MZU A;  1H8V A;  4JKK A;  4XXP A;  1F4A A;  4CDX B;  4XJA A;  1LHV A;  5JXG A;  1W6N B;  2ARX A;  2HWF 3;  3I2K A;  4FXK B;  4GMP 0;  4L99 A;  4NUB A;  1R08 1;  2D97 A;  1F15 A;  1GP4 A;  2C24 A;  3C3V A;  3WG2 A;  3MW4 A;  1DLC A;  3ZYG A;  2Z4F A;  2W87 A;  1VB2 A;  2R0H A;  2OZ6 A;  3P3P A;  5FMB A;  4TN7 A;  4PQQ A;  2VW0 A;  3ETP A;  1XE0 A;  3AM2 A;  1VBA 2;  4AVB A;  4MH0 E;  3J26 N;  3MBW A;  1LHN A;  2W3J A;  1W6M A;  2I07 B;  3VL8 A;  1EV1 3;  2P3Y A;  1DF0 A;  4JTO A;  4XFH A;  2O8Q A;  5BUV A;  1G7Y A;  4CDX C;  4RS5 B;  3MFA A;  4LTA A;  2WQ4 A;  4QPW A;  1UZV A;  4LBQ A;  4QGL A;  2ZMN A;  3IAQ A;  1U5Z A;  4A7K A;  3M3Q A;  2QQL A;  5C3P A;  2ADD A;  1RED A;  4L9B A;  5FZ7 A;  4AVT A;  4OHY A;  1Y9M A;  4OUL A;  4AEJ A;  1YQ5 A;  4QHZ A;  1W2N A;  2J1A A;  3OUH A;  4SLI A;  4YW2 A;  3M7A A;  4CU6 A;  2ZGU A;  4QWN A;  1XNB A;  3QBQ A;  4P9Y A;  3LKJ A;  4BM8 A;  3RZG A;  4XDQ A;  1ZNP A;  4CPB D;  5J37 A;  3KLS A;  4W6Y A;  3ZYI B;  1J83 A;  4RS5 C;  1T6B X;  5F8P A;  5A6Y A;  3LWC A;  4QKN A;  5JCT A;  4Q4W 3;  5CKM A;  1WCS A;  5LBF A;  3BU0 A;  1RUH 2;  3BOW A;  2Q8O A;  1MS5 A;  1N3Q A;  1HJG A;  4FOQ A;  4E9K A;  2XJU A;  1UXZ A;  1DYK A;  1GWM A;  1R1A 1;  3LPF A;  2R06 1;  1NCR B;  1I5P A;  1IGO A;  4GA9 A;  3OCP A;  5FYS A;  1QJX 2;  2BER A;  3H1Y A;  4YZ5 A;  4O65 A;  3ENR A;  1O6U A;  1PVC 3;  1OUS A;  3JZV A;  1DGR N;  4EWE A;  1Y3T A;  3QCW A;  1QJY 3;  2PAM A;  4N8M A;  1UPI A;  4BK5 A;  1BVV A;  4WM8 B;  2PHD A;  1BLZ A;  2XLA A;  3KQR A;  3LEM A;  5CIR A;  3TNP B;  3WCR A;  5AC9 3;  1FXZ A;  1TMF 3;  2RDR A;  2BZD A;  4NPM A;  3VHP A;  4F7Z A;  5HXV A;  1LRH A;  3NST A;  3NNJ A;  3BOD A;  3NWK A;  5JR7 B;  3AP7 A;  1QWR A;  2YPJ A;  1NCR C;  1AYM 1;  4DXR A;  4B4P A;  2QZ3 A;  2WFF 3;  2WT2 A;  4P5H A;  2RM2 2;  3OGS A;  3MFC A;  3DF0 A;  5F9T A;  1XNK A;  5BV6 A;  5GLV A;  4OUE A;  1ULG A;  4WM8 C;  1AYN 2;  3PIJ A;  3QAC A;  1XBF A;  2W1Q A;  2ORZ A;  4UW5 A;  1ZVF A;  2W1W A;  3AFG A;  2WT1 A;  1LEN A;  1C8M 1;  3ZFE A;  2ZOE B;  3NNM A;  3D4K A;  1G86 A;  3SCG A;  2F4P A;  5DPN A;  3O14 A;  2C1F A;  3UT0 A;  5ERL A;  4GH4 A;  1CON A;  4RN5 A;  1KJL A;  3TEZ A;  2A6W A;  4HN1 A;  5HI0 A;  2RDN A;  1S4C A;  1DGL A;  4KU7 A;  3NO8 A;  3HNB M;  1UXX X;  3ZXK A;  3WZ1 A;  1W39 A;  1CIW A;  5LAS A;  4NN0 A;  4Z82 A;  1AF9 A;  2RS3 3;  1YO8 A;  2G1M A;  1VBC 2;  3O12 A;  1RMU 1;  3UV9 A;  1SLL A;  4UOJ A;  1HX6 A;  4HOO A;  1WLT A;  1Z78 A;  2R1B A;  4JRA A;  1R09 1;  1W6Q A;  4HLT A;  1ASJ 3;  2JG9 A;  4YLZ A;  4XE9 A;  1Y4W A;  1PNG A;  4GUL A;  4H7L A;  4CEW B;  4P9L A;  2BP6 A;  2VOW A;  4CEY B;  2EAL A;  3WUC A;  1QJX 3;  5L9V A;  3VBO B;  1UU5 A;  2D6N A;  3AJY A;  1YCI A;  2AR6 A;  1PX3 A;  3I3B A;  4IW3 A;  4UWD A;  3N4M A;  3OGR A;  1RIR A;  1BEV 2;  4Y20 A;  3U4S A;  2ZEZ A;  4KWL A;  4CCM A;  3MDP A;  4BQ4 A;  1L7Q A;  2BJS A;  4DO0 A;  4FPH A;  3HBZ A;  1E5S A;  1UMI A;  2PN5 A;  3GBG A;  4FPC A;  4Q26 A;  4E8D A;  3A21 A;  4G3Y C;  2WN3 A;  5K0U B;  3ZMO A;  5IAV A;  5A80 A;  5M0T A;  4D7Y A;  5DQ0 A;  2E31 A;  3E97 A;  4CEW C;  4FAH A;  2D3R A;  4CEY C;  4IV1 C;  4M0N A;  1NZC A;  2QFE A;  3ORJ A;  1CPM A;  1CZS A;  2KM2 A;  3ZYF A;  4NAO A;  3ZOI A;  4ZON A;  1NCQ B;  2C9K A;  2ZGT A;  1NA1 B;  2A70 A;  2D98 A;  2VW2 A;  3DYP A;  4LIV A;  4LBM A;  4QPG B;  5FY4 A;  4QMA A;  5F3E A;  2R7E B;  1AYN 3;  3WNP A;  1NOV A;  2VUL A;  5LY2 A;  1HQL A;  4CP1 A;  3BPS A;  1NQJ A;  4URA A;  3VZO A;  4CRQ A;  5K0U C;  2W39 A;  4KG8 A;  3MUY 1;  2JE7 A;  2VL4 A;  2ZA9 A;  1X36 A;  2WZE A;  3A0K A;  2PFW A;  3WNN A;  1AR7 3;  4CDX A;  4E8C A;  1UKR A;  3CJX A;  2JDM A;  1IZ3 A;  4XDO A;  5GZD A;  4ZZ5 A;  1Y7B A;  1NCQ C;  1UOG A;  3OYW A;  1NA1 C;  5F2S A;  4QPG C;  2FDG A;  5FPA A;  2XKO A;  1PMJ X;  4IV3 A;  3VZM A;  2JDN A;  5FP3 A;  4X6Q B;  2JX9 A;  4YZ3 A;  4HVQ A;  5KXD A;  1GOF A;  4XXA A;  2FQP A;  3M3C A;  1G9B A;  5LW9 A;  2QNK A;  1RUF 1;  2QQK A;  2PAK A;  1UN1 A;  4XFF A;  5A33 A;  1RUD 1;  1RUC 2;  1HJF A;  5IVF A;  1AUY A;  2ADE A;  2VG9 A;  1TE1 B;  1JW6 A;  1JYC A;  3BCW A;  4MGS A;  1O3R A;  3USU A;  1UYX A;  2YBK A;  3IWZ A;  3B3Q E;  5FYH A;  5IAX A;  5DN2 A;  3THT A;  3ZYB A;  3I3E A;  5FYT A;  5I8T A;  1PGL 2;  1GNZ A;  1VR3 A;  3OUI A;  4ZU7 A;  4WZC A;  5JLV A;  2A3W A;  2BFU S;  2W68 A;  2XML A;  3U1X A;  2BOI A;  4UFJ A;  5SV8 A;  1X8E A;  3KV6 A;  5F5A A;  2JJ6 A;  3T4V A;  3FFZ A;  4IER A;  1X9T A;  2W46 A;  4BQ3 A;  3L2Y A;  3ZXD A;  2ZGN A;  1PIV 3;  4Y24 A;  5FQ0 A;  5G05 L;  1CAX A;  1SHW B;  3MO4 A;  3A7Q A;  1VRH 1;  4Q4X 1;  5HCA A;  1N1T A;  5BXX A;  1AR9 2;  3PVN A;  1NUK A;  3DL3 A;  3UK9 A;  5CAZ A;  1AR8 1;  1W2A X;  4XMA A;  1LU1 A;  1U5I A;  2XH6 A;  3H7Y A;  1APN A;  3H9A A;  1E57 A;  1UPS A;  3ZN5 A;  1KDK A;  3KSC A;  3LF7 A;  5FP8 A;  2VO5 A;  3A23 A;  1LU2 A;  2JIC A;  2Y6L A;  3HQR A;  4WM8 A;  5DDJ 1;  5FO9 B;  4KU8 A;  3MLJ A;  4CUC A;  2LM3 A;  1MS9 A;  2GND A;  1ND2 A;  3AMP A;  3VD3 A;  1D4V B;  1C28 A;  1REE A;  4Q2F A;  3ZR6 A;  4KGQ A;  4COV A;  3POW A;  3LEG A;  4AHW A;  1GQG A;  3SH4 A;  2WIN B;  2FZ2 A;  3JD7 1;  4BXS V;  5H9P A;  4A4A A;  3AJZ A;  4UBH A;  1PK6 A;  5T5L A;  2R0F A;  3AKQ A;  1D4M 2;  2CWS A;  2G4I A;  1W2U A;  5LK5 A;  2JDP A;  2RR1 1;  4FPF A;  1D2S A;  1F31 A;  4GJY A;  4QM9 A;  4GD4 A;  1V0A A;  2WA3 A;  4YPJ A;  4YW5 A;  1I6X A;  3WDW A;  1YC6 1;  4DEV A;  4F8A A;  2RS5 2;  1XNT A;  3ATG A;  3WDT A;  3ZSE A;  4KMQ A;  4BCU A;  3DEM A;  3FN9 A;  5K8S A;  1WA4 A;  2DBI A;  3GJA A;  2ZHL A;  4GWN A;  2DCY A;  3VLB B;  4ATE A;  2PLV 1;  4MET A;  4WV8 A;  3S5Q A;  1LJ7 A;  2HWD 1;  2FZ1 A;  3I8T A;  4Y3O A;  5L19 A;  2UUR A;  4ITC A;  3LZZ A;  1GUI A;  4NWW A;  1JZ3 A;  2IXK A;  4YGD A;  1CQ9 A;  1AX2 A;  3O0V A;  4FPJ A;  2J22 A;  1MR5 A;  5HPO A;  4AVS A;  4UFI A;  5FZ3 A;  4R9D A;  4FFF A;  3K3N A;  1PMI A;  4QAW A;  2K0G A;  1H2M A;  1COV 3;  3OY8 A;  5CFC B;  5ACA 2;  4A6O A;  1S0J A;  2VNR A;  4S2G A;  5FYZ A;  2RJL A;  4CDW A;  1LTE A;  1H30 A;  4DNY A;  1SZB A;  4HN0 A;  4W65 A;  1IOA A;  5DUU A;  4OI0 A;  5FZH A;  2QE3 A;  1JYV A;  5LBC A;  3VBU C;  2P34 A;  3OUJ A;  1SBF A;  4NIH A;  3ZXA C;  4CEY A;  2ZX4 A;  4R4X A;  4IV1 A;  4QX7 A;  1K5M A;  1LOB A;  4CCK A;  1DQ0 A;  1CZV A;  2E32 A;  3ILF A;  4PCR A;  3BYW A;  3ZXF A;  3K3O A;  3HN1 A;  3UKN A;  5A7O A;  2DUR A;  1OBN A;  2YY1 A;  3RDI A;  1UX6 A;  3OBZ A;  5CFC C;  2VCC A;  2ZHN A;  5JSO A;  3HJR A;  4LHL A;  1MS1 A;  5FBZ A;  4LBQ D;  5HV4 A;  3MIB A;  2JWP A;  5K0U A;  4QU2 A;  2XQR A;  1VBB 1;  1HW5 A;  3LB9 A;  4QX1 A;  4Y22 B;  3T4H B;  4JDN A;  5EV7 A;  1O3Q A;  1LES A;  4L97 A;  3WEZ A;  1DYO A;  4R52 A;  1D4M 3;  3PUQ A;  4LK7 A;  2DFC A;  4OI4 A;  4XZP A;  1IG0 A;  1K45 A;  4OHV A;  5J1X A;  4LUL A;  4DIQ A;  1AR6 2;  3BTX A;  1ZM1 A;  4RR3 B;  2VVF A;  2GNM A;  1O5U A;  4FFI A;  3RFR A;  5LA1 A;  1UQX A;  3O1R A;  1CWP A;  3POY A;  2RS5 3;  1YNA A;  1DFQ A;  2VY0 A;  4CDQ A;  3POG A;  5IT6 A;  3LE0 A;  5E89 A;  2DU1 A;  2QVS B;  4QX3 A;  5BNN B;  4NRQ A;  3DCQ A;  3AMN A;  3BOP A;  3OJB A;  3APB A;  1JTZ X;  1XXN A;  2D6O X;  1W6O A;  1XC6 A;  3EBR A;  5EYX A;  3GGL A;  5FZK A;  4IE0 A;  4UFL A;  1QJU 1;  1OLR A;  4FPG A;  5FPZ A;  5C4W A;  3ZSJ A;  2GSY A;  1HN0 A;  3LSE A;  1E5R A;  4RR3 C;  1HRV 1;  3AZX A;  3POI A;  4XJ9 A;  3SXW A;  5JR2 A;  2WDB A;  1A78 A;  2HBT A;  1F8V A;  2CAU A;  4D6R A;  3MHZ A;  2BOJ A;  3VD5 A;  2VR4 A;  5BNN C;  5ACA 3;  1JZ5 A;  5F5Q A;  2CY6 A;  2BNO A;  2ZBJ A;  5FYU A;  4DXZ A;  2WO3 A;  1WME A;  2DVD A;  2WLP A;  4FPY A;  4B29 A;  3U37 A;  1NY7 1;  1CGP A;  3M70 A;  4AED B;  1FNY A;  3J7M A;  2B39 A;  5A32 B;  3FHA A;  3SH3 A;  5DMY A;  2YFU A;  3WVJ A;  1WW6 A;  3NJV A;  3WW4 A;  3J4U H;  3K4A A;  5DZG A;  2GC1 A;  5FLJ A;  4LO7 A;  1OT5 A;  4LK6 A;  3H8O A;  2WNU B;  4Y1V A;  1J58 A;  1HIX A;  2NMO A;  4FPK A;  4ERO A;  4GJZ A;  4CPB A;  4MX3 A;  5T5P A;  4MGQ A;  1PGS A;  3CQO A;  1W8N A;  1BXH A;  2WFP A;  1HV1 A;  3D8C A;  5D21 A;  3S6P A;  1RUG 1;  4AED C;  1KDM A;  5B2G B;  1R1Z A;  1G9A A;  4NPL A;  5FPV A;  2TNF A;  1BK1 A;  4ZZ8 A;  3ZSM A;  3H1M A;  5LCW L;  3ZXE A;  1O5L A;  1GFF 2;  3AP4 A;  3PIG A;  4GKX A;  2WNU C;  4EWD A;  3FLP A;  4I30 A;  1VMF A;  4GWI A;  4JC1 A;  4XAB A;  5GLU A;  1LNS A;  2VUC A;  4HBN A;  3FC0 A;  1RVF 2;  4D0Q A;  4YM2 A;  4XYX A;  1BHG A;  5TSW A;  3N9Q A;  5GZF A;  3VKM A;  2JG8 B;  3ZYR A;  5AFE A;  1FPN 1;  2WZR 1;  3OBR A;  3KT7 A;  4Z2A A;  1MQT B;  4OHW A;  2VMG A;  3CMG A;  4FPE A;  4HVO A;  5FMO S;  4FXG B;  2BTV C;  2XKP A;  1VBD 1;  3C8X A;  1Z7S 2;  4JDM A;  3KWV A;  4QQH A;  1ST8 A;  2IXI A;  4OYU A;  4AFB A;  4H2A A;  1YWK A;  1BYH A;  3ES1 A;  4J6G A;  2WNO A;  3AVS A;  1ZBA 3;  4XIO A;  5FYB A;  2ZGM A;  3USS A;  3OEA A;  5FZL A;  3HEI A;  5BY5 A;  1JYI A;  3WW1 A;  3WF2 A;  5A1L A;  4L2N A;  5JMO A;  1QJZ A;  1YLL A;  4GIQ A;  2JG8 C;  3AL6 A;  2J1U A;  2HEY F;  2XON A;  3HQU A;  3DXT A;  3PTY A;  4WVW A;  2WWJ A;  1MQT C;  1CX1 A;  3ZFF B;  4IEP A;  1SDW A;  4MVT A;  3NV1 A;  2E7Q A;  5C71 A;  2A3X A;  1OKO A;  2EID A;  2VPV A;  3ACH A;  2CGN A;  1POV 3;  4ES8 A;  2XHK A;  2YU2 A;  1XJA A;  2R6Q A;  1H4G A;  1R08 2;  1JH5 A;  3VBU A;  2WA4 A;  1X50 A;  3AB0 A;  2YDE A;  4WM7 B;  4JAA A;  2V73 A;  3VBS C;  2OYZ A;  3K51 A;  2EAK A;  3B69 A;  1S2K A;  2XJR A;  4ZHN A;  3VHR A;  4IQP A;  3ZFF C;  3NV4 A;  3OB8 A;  1XNC A;  2PHX A;  3TAY A;  1A8D A;  2EIE A;  2XVL A;  4QDQ A;  2IXJ A;  4AHZ A;  2WYF A;  3LOI A;  4IEY A;  2WO7 A;  3B5L B;  1VBE 3;  4AL9 A;  2BWA A;  3GDB A;  4WM7 C;  3MLL A;  3ZO0 B;  3S57 A;  2WBK A;  4OFG A;  1OOP A;  3I3M A;  3M3I A;  4KNC A;  1CAW B;  3C7F A;  1LOG A;  3E5X A;  1UCX A;  3OPZ A;  2ILM A;  1X9P A;  2BU9 A;  1OXC A;  4ZU5 A;  1EPZ A;  1HB4 A;  1JYW A;  3WHU A;  2Z2S B;  3DYM A;  4QKF A;  1V9U 1;  3ZPO A;  4B8E A;  4CYD A;  3ROU A;  2AEY A;  2BWC A;  1EAH 2;  2E26 A;  4IEZ A;  2NLR A;  1DQ5 A;  3WG1 A;  4LE4 A;  1Z7S 3;  1UZ0 A;  1R1A 2;  1SBE A;  4XTP A;  2R06 2;  4ET7 A;  5I0S A;  1DDL A;  1TME 3;  2PHU A;  3KB5 A;  5FK8 A;  4BXF A;  4RR3 A;  1US3 A;  4DXT A;  3SCH A;  2Q8D A;  2P6H A;  2WRA A;  3HVD A;  1ZZC A;  5FR3 A;  3THP A;  5IVB A;  3UKT A;  4S2D A;  3N9P A;  3IPV A;  3RNS A;  4BOW A;  1RGS A;  5HCH A;  4TLF A;  2XUM A;  3PVO A;  4RFR B;  4UFH A;  4M3C B;  4KI5 M;  4GKY A;  1J1L A;  5DUX A;  3IM0 A;  2IXL A;  1W6P A;  5FY5 A;  3HMY A;  5EZW A;  5EWS A;  2FD8 A;  1AYM 2;  1R08 3;  5FZC A;  4ARY A;  3SNM A;  2OUJ A;  4FQZ A;  1W28 A;  3O1U A;  5IK4 A;  1O8S A;  3UJO A;  2JEM A;  1QQP 1;  1MEC 1;  2ERF A;  1OQ1 A;  3GM8 A;  3B01 A;  4OVE A;  4A42 A;  2I2S A;  1X8M A;  4XUO A;  4LO8 A;  2A6X A;  2WS9 1;  4W6W A;  4W6X A;  4YRD A;  5FY8 A;  1J59 A;  3TN9 2;  2XL7 A;  4XBN A;  3VDD A;  1C8M 2;  1XB9 A;  4XZU G;  5IHR A;  4QB2 A;  2ZML A;  4ISQ A;  4UT5 A;  4CP9 A;  2WNV A;  1RJ8 A;  3FX3 A;  4AED A;  2DCK A;  3VBH B;  1OPM A;  3IDE A;  3J8F 1;  4NRO A;  3VZL A;  5CAD A;  1GQH A;  5LRR A;  5DAX A;  5FZO A;  1SPP A;  3LEI A;  5F1R A;  1FV2 A;  3AXE A;  4QKD A;  4FTS A;  1URX A;  1UU6 A;  2V5Y A;  3SCF A;  2ZGL A;  5E8A A;  1RMU 2;  2HEW F;  3VDC A;  4UF0 A;  1O8P A;  1XU1 A;  3ZX7 A;  3THD A;  1GNH A;  3PU8 A;  1R09 2;  4BME A;  3KCC A;  3T2P A;  1RUI 3;  1QXP A;  1EAH 3;  3HOB A;  3WXP A;  3VBH C;  2YG0 A;  3I3D A;  3Q9O A;  3IB3 A;  1GP5 A;  3ES4 A;  4UW3 A;  2VTF A;  2BQP A;  4DRV A;  4LQR A;  1H1I A;  3SEE A;  5CBL A;  3IAP A;  5LBB A;  4LXL A;  1N47 A;  3VDA A;  5FLI A;  5LAT A;  2VCA A;  1D7P M;  1X33 A;  3J7N A;  1LED A;  5C7G A;  4QB6 A;  1ZYB A;  1LCL A;  4I3P A;  3KVA A;  1FNZ A;  1ZZ8 A;  1CAV A;  1J3P A;  4ZPI A;  3T1L A;  4OUM A;  2PQQ A;  2WII B;  4P9X A;  4XFB A;  3H8X A;  5CNA A;  4YM3 A;  2DF7 A;  1NE6 A;  1NZI A;  1VAM A;  2WZ8 A;  2OUH A;  5T3N A;  3U14 A;  2XLF A;  3VHN A;  5CFD B;  1G6N A;  5CU1 A;  5AVA A;  3HNY M;  4RHV 1;  3VGI A;  4ZS2 A;  5CVR A;  1O3S A;  3ACI A;  4GB3 1;  3T0A A;  3C7O A;  4Q5O A;  3EO6 A;  4AEM A;  1JN2 P;  1RUE 1;  2WAA A;  3VBS A;  2RS1 1;  3T2T A;  1ULF A;  1B35 B;  3GF6 A;  5B4N A;  2D5F A;  1J3Q A;  3TN9 3;  1RUJ 1;  3ZFF A;  4BIS A;  1C8M 3;  3ACG A;  1AJK A;  4RGA A;  4XJU A;  2VBB A;  3FE5 A;  5CFD C;  2AH2 A;  3ALQ A;  2LW8 A;  2R04 1;  4XDP A;  5DUV A;  1RHI 1;  4JV4 A;  3WNX A;  4DZG A;  2DCJ A;  1WMD A;  3I4I A;  5EYY A;  4XJW A;  1GWL A;  2Y60 A;  1C3H A;  3R4U A;  3RI9 A;  3SKV A;  2E33 A;  2OX0 A;  3UYJ A;  3VL9 A;  2V5D A;  4ATF A;  4D7T A;  1AL0 G;  3Q8A A;  4FP3 A;  2R49 A;  1W9W A;  1B35 C;  5CZK A;  1MZ5 A;  4MHU A;  3LGR A;  2GC0 A;  4ZS3 A;  3JBG 1;  5J7M A;  2HBU A;  2QQO A;  1RMU 3;  2QQI A;  3D82 A;  2Q0A A;  4W50 A;  3RMX A;  3RYP A;  1RUF 2;  4YGC A;  4IE6 A;  5JZG A;  4YZ2 A;  1RUD 2;  4NR1 A;  1R09 3;  1HN1 A;  5D8A A;  2XOM A;  1RL3 A;  1K3I A;  4EYU A;  2D93 A;  4A3Z A;  3WF3 A;  1F5F A;  2G9G A;  2ET7 A;  2NN8 A;  2QTW B;  2B46 X;  3POF A;  4NWV A;  1DP0 A;  5C3S A;  4I0A A;  3IMM A;  4CCD A;  4P5Y A;  3RZM A;  3TEY A;  1AJO A;  4CCE A;  1OD3 A;  5HCF A;  3WF1 A;  1OLM A;  2MEV 1;  2GC3 A;  2HWB 1;  1CAW A;  5H9R A;  5JAX A;  1PO1 3;  4DRR A;  5ISL A;  3IDA A;  2IVJ A;  4YYO A;  2HYK A;  1FOD 3;  5FOJ B;  5A3O A;  3H42 B;  3AYD A;  2XWJ B;  3LA7 A;  3U11 A;  1CJD A;  4MSV A;  3ZM8 A;  4GAZ A;  1VRH 2;  4Q4X 2;  4EN0 A;  1SMV A;  1STM A;  3V0B B;  3T1M A;  1S0C A;  3H3L A;  4DXS A;  4K40 A;  5BNP A;  4YW3 A;  4XQD A;  5FZD A;  1JOP A;  1AR8 2;  3W5M A;  4NIG A;  3H3Z A;  2CV6 A;  3KHC A;  4COW A;  4E2G A;  1KXG A;  4YZ4 A;  4IL7 A;  3KV4 A;  4NAM A;  4KWK A;  5FXZ A;  4QXC A;  3KHB A;  2PHF A;  1Q5O A;  1WLC A;  5DDJ 2;  4ES9 A;  1LOC A;  3B9I A;  5F37 A;  1GLH A;  1FMD 1;  4Q8K A;  5A7N A;  2GMM A;  1CR7 A;  2B42 B;  3FWE A;  1L7R A;  3T09 A;  4NIA A;  3BPZ A;  4OZX A;  5FP4 A;  4D6S A;  3JD7 2;  3S7E A;  5LZ6 A;  5H9Q A;  1G9C A;  5FO8 B;  1WZX A;  2PTM A;  3RSJ A;  2JE8 A;  2PMW B;  3DYO A;  4XQ4 A;  2RR1 2;  4OMD A;  3M3E A;  2UU8 A;  4DPN A;  3I59 A;  1AL2 1;  2X05 A;  3VZN A;  3Q8B A;  2OT7 A;  2WWU A;  1RUF 3;  2WN2 A;  3ABZ A;  4NRP A;  2VZP A;  3E6C C;  1RUD 3;  4NPR A;  5FZ6 A;  4CCL A;  1HRI 1;  1A34 A;  3RYK A;  3R05 A;  2AAC A;  5KR7 A;  2X5I B;  2Z79 A;  5FP9 A;  1XOY A;  2PLV 2;  5KBF A;  2HWD 2;  3N36 A;  2E53 A;  1UYP A;  2JEN A;  3VBH A;  1Q8Q A;  5IYY A;  1SQ4 A;  1VBA 3;  4IND A;  4JGZ B;  4PI0 A;  4MG2 A;  1A8M A;  1NG0 A;  2G9Z A;  4IEX A;  1KS4 A;  5FP7 A;  1ZRI A;  4IGO A;  4LKF A;  4LMF A;  5IUQ A;  3BIW E;  2W95 A;  2Y26 A;  4RGG A;  1N3O A;  2Y0O A;  3FJS A;  4JTN A;  1SLA A;  5BYN A;  3KQ4 B;  4YNI A;  5I93 A;  2B9V A;  1SBD A;  2VEC A;  2X5I C;  3LA3 A;  3Q8C A;  1W99 A;  2H0B A;  4Q4X 3;  1BZW A;  1RXF A;  1UZZ A;  4Z1V A;  2XGX A;  1VAV A;  3NMB A;  4RGK A;  4UFK A;  2JE9 A;  4JGZ C;  2YU1 A;  3GYD A;  2OXB A;  4O9G A;  2Y6G A;  4YW1 A;  3NVC A;  4LO5 B;  1C8N A;  4NVP A;  2E7T A;  1MS8 A;  4AZZ A;  3W58 A;  1DGW A;  1JHJ A;  4FPL A;  1TNF A;  2VZO A;  2HWE 1;  1XNA A;  3PUI A;  2TEP A;  1RUH 3;  1JOJ A;  5DDJ 3;  1NLS A;  4COY A;  1X82 A;  5FY0 A;  2J42 A;  4A7Y A;  2VMF A;  3O7O A;  5DXD A;  5J36 A;  4LOR A;  1VBB 2;  3ACF A;  3AC0 A;  1VAK A;  5FTT C;  1W9S A;  1WMX A;  2OVU A;  3DKQ A;  4XET A;  2KD7 A;  5GKA C;  5LA2 A;  4OQ9 A;  2HWF 1;  2ZAB A;  4JGY A;  4HSL A;  4C90 A;  1H2K A;  3VV1 A;  4AI1 A;  1HXS 1;  2UWB A;  2VBP A;  4GZ9 A;  4ASL A;  4PQ9 A;  1HLC A;  4XMI A;  3CDZ B;  3VD9 A;  2ZX3 A;  2JKB A;  3M4F A;  1SG3 A;  1W8U A;  3O1T A;  1WCU A;  3OPT A;  2WO1 A;  3VBO C;  4YFW A;  1EV1 1;  2RM2 3;  4I09 A;  4FSJ A;  2PAE A;  5C8C B;  4C0B A;  3U4X A;  2Y6J A;  4G9S B;  4LLF A;  2HWD 3;  3ZN6 A;  4BU2 A;  4Q0S A;  5JXJ A;  1QJU 2;  4NJ4 A;  4IEQ A;  4XIL A;  3TRS B;  5A3T A;  1I9R A;  3DPR B;  2RMU 1;  3I3Q A;  5I0R A;  1HB3 A;  3L2H A;  1HRV 2;  4Q0V A;  4QGM A;  4Y26 A;  2VNO A;  1BQP A;  1OH4 A;  2AEZ A;  2ZKL A;  1UKG A;  2ZHM A;  3TOJ A;  3WF4 A;  4DS0 A;  4FBF A;  3HD8 B;  3O1O A;  1W6N A;  3WD5 A;  5KXE A;  1NXD 1;  3UGG A;  2O8O A;  2VW1 A;  2JDH A;  1FX5 A;  3H8U A;  3KZ4 C;  1LKN A;  2OII A;  4QB1 A;  5FYY A;  5C8C C;  2CL2 A;  3GNE A;  2A71 A;  5DZE A;  4IEU A;  3RYR A;  4CCN A;  2CDO A;  1NY7 2;  5AVP A;  1EP0 A;  1O4T A;  3LQC A;  1GZC A;  4HPK B;  1OC1 A;  2P37 A;  3WDY A;  5HV0 A;  1VBC 3;  4COZ A;  4UYB A;  2XVK A;  3AMQ A;  1YFW A;  4I01 A;  2R30 A;  3DPR C;  4XIK A;  4KBZ A;  2XJT A;  1TVG A;  3MV1 1;  2BFU L;  4P08 A;  4MAD A;  5LBE A;  3PVE A;  2W08 A;  4RS5 A;  4BQ5 A;  5F39 A;  1PVC 1;  3HIF A;  1QIQ A;  3LAG A;  1QJY 1;  1LOA A;  2JIG A;  2LRP A;  3AMM A;  4UAP A;  5DAQ A;  1OA2 A;  2EXK A;  1C57 A;  1MS0 A;  3INA A;  5AC9 1;  1H8T B;  1TMF 1;  5IK8 A;  4G4F A;  1OUX A;  3OGV A;  1VBB 3;  4OQ8 A;  1RUG 2;  1WCD J;  3D6E A;  5FOB B;  2OPK A;  2C9A A;  2X53 S;  3F2Z A;  1BEV 3;  3HPN A;  3KMH A;  3MI8 A;  1KQR A;  3PL0 A;  4CXY A;  2FCU A;  3O1P A;  3IMN A;  3ON7 A;  3QLQ A;  4XTM A;  1L7L A;  3T08 A;  1KGY A;  2VE1 A;  2WFF 1;  3RMY A;  4BWO A;  5A3P A;  4Z07 A;  3MPB A;  4EZH A;  1YHF A;  5F7U A;  4O9E A;  2VOT A;  1JBC A;  1VRB A;  2DYC A;  3BU7 A;  5GLW A;  1GWK A;  3WNL A;  1H8T C;  1OPO A;  2GU9 A;  5K4L A;  3W59 A;  4FTB A;  3RWN A;  5K9Y A;  2AZ5 A;  2EIG A;  1NCR A;  3T30 A;  2F4L A;  4XJ8 A;  1FPN 2;  2EVX A;  2WZR 2;  3FFQ A;  4NHM A;  5CG8 A;  2RJK A;  1CAU B;  5FZ0 A;  2X29 A;  4RQP B;  4XOG A;  4LNV A;  3RG0 A;  2DCZ A;  1VBD 2;  2EA7 A;  3FBY A;  4LKE A;  3AP5 A;  5FZB A;  3RRD A;  3N9M A;  2WQ8 A;  4GMP 3;  3O1V A;  3ZSL A;  4IXL A;  5EXO A;  5A3N A;  1KFU L;  2E9Q A;  4JGY B;  4JZR A;  2V09 A;  4KBB A;  4MYE A;  3SMH A;  3T0B A;  4B3N A;  2A1X A;  5IVE A;  2RS3 1;  3BIE A;  5FPU A;  1V70 A;  3H8R A;  1D2Q A;  2BUK A;  2QZ2 A;  1V6O A;  3WQB A;  1POQ A;  3AZZ A;  3RQ0 A;  4N9I A;  4XJZ A;  3WR0 A;  4A2U A;  1OI6 A;  4RQP C;  1ASJ 1;  2X5I A;  5FDB A;  5APA A;  3HWJ A;  2VCM A;  4Y1Z A;  5A7W B;  1OA4 A;  1S0G A;  1BJQ A;  5FXV A;  1YIP A;  4CP0 A;  1RUC 3;  2F6B A;  4JGY C;  5E1R A;  1CN1 A;  3KF5 A;  4OCT A;  4FOW A;  3KM5 A;  1GP6 A;  1O91 A;  5FYM A;  1ZRF A;  3JQX A;  1XPW A;  4MV2 A;  4EZ4 A;  3ZXG A;  5H9S A;  3KT4 A;  5ANQ A;  2ET1 A;  3OBT A;  3ZXL A;  3IDB B;  2GH8 A;  3BVC A;  4YVS B;  4TZD A;  3RZL A;  4IEO A;  4A45 A;  4LIT A;  4Q1R A;  3BI3 A;  3JB8 A;  1OUR A;  3I2O A;  1OFN A;  1K5J A;  3NAP B;  1PM4 A;  3E6D A;  3NNL A;  4HSJ A;  1UOB A;  3SLI A;  4RFT 0;  1XRU A;  3LDR A;  4MXV A;  4AFA A;  1OA3 A;  1ULD A;  3K48 A;  4K8F A;  1AR9 3;  5IVJ A;  2YXS A;  4N53 B;  2XJV A;  1VLN A;  3WDX A;  1W9T A;  1MAC A;  2P5B A;  1FV3 A;  2VQU A;  2ZGO A;  2E7A A;  2VD7 A;  3ELN A;  2MNG A;  4M3C F;  2F17 A;  4CEW A;  1SFN A;  2ZGQ A;  2C0Z A;  1V9U 2;  1EYB A;  2Y64 A;  1UOF A;  2IXC A;  2WZR 3;  2DCT A;  5FO7 B;  2D44 A;  2WZP P;  3VBO A;  3NAP C;  1GMM A;  3THC A;  4JRL A;  4AAX A;  3III A;  1PGW 1;  2XWB B;  1AR7 1;  3BB6 A;  4QU1 A;  4IGP A;  4JHZ A;  4PDW B;  4HKL A;  2P6C A;  5FLH A;  1YI9 A;  4Q4V 1;  2EXJ A;  3ZN4 A;  2OA2 A;  3EMR A;  3W5N A;  4N53 C;  4MGZ E;  1BBT 1;  4JKL A;  3WCS A;  3BN6 A;  3LIH A;  1GZT A;  4PLO A;  4H7M A;  3ZSK A;  2J1R A;  1JOB A;  3N7L A;  1DZT A;  2FDJ A;  3KV9 A;  4AF9 A;  1W3X A;  1NCQ A;  2O1Q A;  1NA1 A;  3MID A;  1TG7 A;  4P9I A;  5T52 A;  5A3W A;  4QPG A;  2AYH A;  4XVH A;  4PDW C;  2I74 A;  2NMN A;  3TWI A;  5JWP A;  1JMU B;  2PA7 A;  5EJ1 B;  2ZKN A;  1UY1 A;  2YBP A;  3LFI A;  4LBL A;  4XEZ A;  5FJH A;  3B94 A;  2Y6F A;  3NRU A;  4FPO B;  5FRA A;  2W0X A;  2J1S A;  2GAL A;  3V0A B;  1QQP 2;  1MEC 2;  2QQN A;  5JIU A;  3ACL A;  4ZU4 A;  3VB9 A;  2K46 A;  2RVA A;  4IEW A;  5CIS A;  2WS9 2;  5FMD A;  1PIV 1;  1ZRD A;  4C0H A;  1G9D A;  5J96 B;  4JQT A;  4KQ7 A;  1EUU A;  5DAB A;  4EN8 B;  5LWB A;  3CL1 A;  3QH6 A;  4ZXE A;  1OVP A;  2JB4 A;  3CO2 A;  3OD4 A;  4EWA A;  1UY3 A;  3WNM A;  3B9C A;  2ZEW A;  4HPK A;  5HXM A;  4NHX A;  2CU5 A;  2BGP A;  5JSP A;  4DUV A;  3J8F 2;  3VZJ A;  1S2B A;  2D40 A;  3JB4 C;  2D6L X;  4B1L A;  5E16 A;  5JIA A;  2QJV A;  2BW8 A;  1LR5 A;  2OPW A;  1OSG A;  4XUT A;  1Q8O A;  2C5D A;  1WMF A;  3PUR A;  4XFA A;  2ZAH A;  4PIZ A;  3LDB A;  1JS9 A;  5FBJ A;  1N1Y A;  1YQ6 A;  2OW4 A;  4XUN A;  4TWT A;  2ENR A;  1TEI A;  2ZPX A;  2CGP A;  3PTR B;  4Q4Y 2;  4AGG A;  3UET A;  3HN3 A;  4UBG A;  3WX5 A;  2WO2 A;  4K21 A;  1GZW B;  1VMH A;  2B45 X;  3HT1 A;  3AVR A;  3UGF A;  3VKF C;  1JI6 A;  2UWA A;  4B7K A;  1LAJ A;  2P4E A;  4DMI A;  5L7O B;  1PZ8 A;  2VGD A;  1W0O A;  3N3H A;  2XBO 1;  2A6Z A;  2B9U A;  5IVV A;  1C5H A;  1MS3 A;  1NQD A;  3TYJ A;  2NM1 A;  1RYY A;  1U5Y A;  1NX9 A;  4ZY9 A;  4XF9 A;  1SCS A;  1JYN A;  3CLP A;  2BGC A;  3ZFG B;  4WZF A;  1AR6 3;  3D0S A;  4TSV A;  3PLQ A;  5JOZ A;  1BMV 1;  1KRI A;  2VMC A;  1AHS A;  2VQA A;  2VTX A;  3N7K A;  4Y4R A;  5FMO L;  2BRT A;  3MPP G;  5IAT A;  4RHV 2;  5L7O C;  2V72 A;  4J1X A;  1GZ9 A;  3CNA A;  3MGU A;  5IFT A;  3BTY A;  2DVF A;  2Y8K A;  3I2G A;  4YAR A;  3M1H A;  4XHB A;  1RUE 2;  4A6S A;  3U0Z A;  3OTF A;  1H2L A;  2RS1 2;  2FDF A;  5FZ8 A;  4E27 A;  4N43 B;  3ZDS A;  2WS9 3;  3ZFG C;  1YQC A;  1COV 1;  4XFG A;  4B4Q A;  1RUJ 2;  4HG6 B;  2VTX J;  1UWW A;  3WSO A;  4AFM A;  4GWM A;  3PDQ A;  1QKQ A;  2R04 2;  4PLM A;  1RHI 2;  2DDU A;  2ZEX A;  3J8F 3;  4BDV B;  2GP3 A;  3AZV A;  2VME A;  2D3P A;  4V1P A;  3VBF B;  1IHM A;  5D2A A;  5A6Q A;  4AFC A;  4N43 C;  3JBG 2;  3SIT A;  3VHO A;  2VOV A;  3T0D A;  2XR4 A;  3WG4 A;  1MZ6 A;  1ULE A;  4QQ2 A;  2VH9 A;  4IDZ A;  1ZRR A;  1J84 A;  2Q1Z B;  1GOH A;  3AP9 A;  1XYN A;  4Q4Y 3;  1JYT A;  2VQT A;  2JKX A;  2AUY A;  3GCW A;  4MGT A;  3DV8 A;  1OQD A;  1H9P A;  4P02 B;  5CFC A;  5JSR A;  3WOG A;  1FAY A;  4IE5 A;  3VBF C;  2MEV 2;  2OZJ A;  3SHR A;  1W3V A;  4KG0 A;  2HWB 2;  1SLB A;  3OD0 A;  1J1T A;  4IGQ A;  4QD2 A;  1ND3 B;  4LOT A;  3N35 A;  5LK7 B;  1WBL A;  1JXN A;  2VBD A;  4WVM B;  1V6N A;  2P2K A;  2OKX A;  4FAG A;  2HWC 1;  5C3Q A;  1JUI A;  5KC5 A;  3B02 A;  2IUW A;  1PHM A;  3DUI A;  4YW7 A;  1QH7 A;  1RUO A;  3IZO A;  4YVW B;  1UW8 A;  3GZU C;  3MYX A;  1ZA4 A;  4PLN A;  3FBM A;  1HB2 A;  3UKV A;  4ARX A;  3G6J B;  4PDW A;  2E51 A;  1RVF 3;  5KC6 A;  1JZ4 A;  1M06 G;  2VXJ A;  5GZC A;  3ZKY A;  5EPA A;  4YG6 A;  4LKD A;  3MIE A;  3JUU A;  4QXK A;  3LSD A;  1WWY A;  3GBF A;  1ND3 C;  2Q1M A;  5A7S A;  3MUZ 1;  1F9K A;  4Y22 A;  2Z42 A;  1SLC A;  4J25 A;  3WW3 A;  5IK7 A;  1WCQ A;  4HAN A;  4CCJ A;  4XAE A;  2RHP A;  2ORX A;  1T2X A;  5C3O A;  4HZF A;  1OMI A;  4YVW C;  1FMD 2;  4E2S A;  3AKT A;  5FV3 A;  1W6M B;  5I0D A;  1RJ7 A;  3B7M A;  3PMS A;  2Y33 A;  3IT8 A;  2DUQ A;  3Q8E A;  4XF1 A;  5IVY A;  3ZYP A;  1DQ4 A;  4AFD A;  1DGW X;  1RHI 3;  4B4R A;  5FYI A;  4CDU B;  1W8W A;  1A3K A;  1P8J A;  2R07 1;  3C7E A;  4QXB A;  5BNN A;  2ZGK A;  4OUS A;  2DVA A;  5KHH A;  3WHT A;  4DB5 A;  2CDP A;  2ZJC A;  2RDQ A;  3NQH A;  1ENR A;  5FKB A;  2ZAA A;  3V0A A;  2BBA A;  5KHI A;  1UY2 A;  4LBJ A;  1AL2 2;  4Y1Y A;  1V6L A;  3JU9 A;  3VUO A;  2FDI A;  3PHM A;  4EJR A;  3UES A;  4BA6 A;  3EXU A;  1HRI 2;  3I2J A;  1UL9 A;  2PYT A;  4WVV A;  3PU3 A;  1V6I A;  3K75 B;  4I02 A;  4CDU C;  4MOA A;  4AQS A;  2WL1 A;  4DUX A;  5F6L B;  3E1F 1;  5DAW A;  3OGJ A;  4EN6 B;  4Z8B A;  3POE A;  2XG3 A;  5FPX A;  1JU3 A;  2UWC A;  2ZHK A;  4TTG A;  3PJY A;  1F5J A;  3WNO A;  4TLG A;  4E4Z A;  4ONU A;  3FMG A;  3VD4 A;  3IBM A;  3C7G A;  4AI3 A;  5KHG A;  3IIA A;  4HK9 A;  2W47 A;  5A32 A;  3ZPY A;  1RIT A;  1OLM E;  3KD4 A;  1ENQ A;  1MVQ A;  3AZY A;  3OEB A;  4YM0 A;  3S0M A;  5I8S A;  4R9A A;  5T5J A;  1LOF C;  4UW4 A;  1Q56 A;  5A3U A;  2WNU A;  3NV2 A;  2VM9 A;  3VKL A;  4CU7 A;  3MF6 A;  2XL9 A;  3V64 A;  1UMZ A;  2BVB A;  2WSU A;  1LGC A;  2B8M A;  2DTW A;  1ACC A;  4JQR A;  4Y1U A;  5GLT A;  3ZYJ B;  1UX7 A;  3D5O A;  4H55 A;  5CG9 A;  2W9X A;  4IEV A;  1GAN A;  4URT A;  2IXH A;  3R4D B;  3WUD A;  4CU9 A;  1RXG A;  3SEP A;  2XHN A;  1QDO A;  1ZBA 1;  1CZT A;  3CIH A;  1AZD A;  5FY1 A;  4LUK A;  2HWE 2;  2RV9 A;  1GIC A;  3AKS A;  3LEK A;  5FAX A;  5IK5 A;  1CD3 G;  1R1A 3;  2ATF A;  1GQP A;  1W2O A;  2R06 3;  1FMD 3;  3IKW A;  3ZFG A;  4AI2 A;  1O4Z A;  2VC9 A;  5LRS A;  4UI9 L;  3ZFE B;  2LS6 A;  2BGO A;  4AVA A;  4ASK A;  2WR9 A;  2BNN A;  1DU3 D;  1ENX A;  2GDF A;  1POV 1;  3D0J A;  3P3N A;  1RIN A;  4GH4 B;  2EF6 A;  2HWF 2;  2A6V A;  4YSF A;  5JXH A;  3M3O A;  4P00 B;  4BPZ A;  2Q5T A;  1AXY A;  2QQV A;  2JG8 A;  5FY9 A;  2CNA A;  2D3S A;  1QNY A;  1HXS 2;  1MQT A;  2R1D A;  2Y0I A;  1IKP A;  1IPS A;  2JD9 A;  5I0U A;  4RD7 A;  4M4R A;  5IWF A;  4N7I A;  4IET A;  4XF0 A;  3GHM A;  1AYM 3;  2CTV A;  2WSV A;  2Y6K A;  1NAE A;  1ZZ9 A;  3SC7 X;  2QQM A;  3ZFE C;  5SV5 A;  3WF0 A;  1EV1 2;  1W6Q B;  1ZZ7 A;  2X10 A;  1UU4 A;  2IVI B;  3EQE A;  4BK4 A;  4CCC A;  5C9A B;  4GH4 C;  2JG9 B;  3LPG A;  3MF9 A;  4KL1 A;  1XYO A;  1VBE 1;  3N9L A;  3PVB B;  2V4A A;  3NKG A;  1VMJ A;  1YJL A;  5EJZ B;  1C1F A;  3N7J A;  2JD4 A;  2QDR A;  2RMU 2;  4BE3 A;  4LA3 A;  2Y34 A;  1W8H A;  3JCI A;  1CES A;  2C26 A;  4YWA A;  5DAP A;  3TEW A;  4Y20 B;  3MLK A;  3PME A;  1PM7 A;  2CGO A;  2WT0 A;  4WM7 A;  5C9A C;  2JG9 C;  4X8N A;  2VU9 A;  4HVR A;  2FCV A;  1SFP A;  1LHW A;  1XE8 A;  4QM8 A;  4FVV A;  4AI9 A;  2YGL A;  4BIF A;  4Y5S A;  1TME 1;  5GLZ A;  2VUA A;  4XFI A;  1PVC 2;  2I45 A;  4HFS A;  1UZW A;  3I97 A;  4WVM A;  1QJY 2;  4K6B A;  5C8W A;  4HON A;  5AC9 2;  2P1B A;  4L8Q A;  1TMF 2;  4O7X A;  2DTY A;  5JPM B;  3ST7 A;  2FCT A;  1NLQ A;  2LAL A;  2RJ2 A;  4HKO A;  1GU3 A;  3KGL A;  3R4S A;  3VZK A;  1R64 A;  4MLO A;  4ZXK A;  2HJI A;  4XPV A;  5EHD A;  4YG3 A;  3OYW B;  2QQJ A;  2WFF 2;  2YRO A;  2JB8 A;  1QOT A;  5LY1 A;  1HXS 3;  2D6K A;  2FMD A;  3AYC A;  4IV3 B;  1XQN A;  2VAU A;  5BNO B;  2P3J A;  3ZMN A;  1ULP A;  3C2U A;  1V6K A;  4CA9 A;  2VMD A;  5A33 B;  4QQP A;  3O1M A;  4QHO A;  1OLQ A;  3UL2 A;  4XQW A;  1QDC A;  4I0W B;  1GSL A;  4UW6 A;  3USU B;  2VXR A;  1QEX A;  3URF A;  3RZK A;  4CDU A;  1JZ8 A;  3HQX A;  3ETQ A;  1QU0 A;  2P3K A;  4XUR A;  1XND A;  1XSR A;  4OMC A;  2RMU 3;  3R0R A;  4IV3 C;  4M3C A;  3B93 A;  3GBW A;  3I54 A;  5A6X A;  5CA6 A;  1W0N A;  4ISR A;  5F32 A;  1T6G C;  2RS3 2;  5FXW A;  5BNO C;  1UAI A;  5FJK A;  2XDV A;  2NYY A;  1QF3 A;  2UY9 A;  4AR2 A;  3BUC A;  1DCS A;  3WY6 A;  1TNR A;  5FQ0 B;  3F95 A;  1LEC A;  1CAX B;  1F2N A;  1UIK A;  3POJ A;  5EIY B;  2E6V A;  1ASJ 2;  1FI2 A;  1RUI 1;  3HAG A;  4QDS A;  1EAH 1;  5FMC A;  1EPW A;  2DVB A;  5LA0 A;  1LOF A;  5IW0 A;  5C70 A;  2A5Z A;  1H1A A;  2A73 B;  2HH9 A;  3I2D A;  1WW5 A;  4MGI E;  3AKR A;  4QPI B;  2IFW A;  2XXZ A;  3VD7 A;  3MZH A;  4XF3 A;  3U07 A;  1DZQ A;  2V4V A;  4YW4 A;  1CJP A;  2GN7 A;  3NJY A;  4K8R B;  2QDN A;  4XCB A;  5F6K A;  5JUV A;  2KA3 A;  5C33 A;  4D94 A;  1EY2 A;  4PF1 A;  1ZZ6 A;  4MO3 M;  1UIJ A;  3A4U A;  4NMI A;  2DUO A;  2D6P A;  4QXH A;  4C1X A;  3SKJ E;  1UYZ A;  1M4W A;  3POS A;  1ND2 B;  2X8K A;  4S2H A;  4COU A;  1PO2 1;  3H7J A;  1K12 A;  4LUM A;  4CUG A;  3WP6 A;  3I2F A;  1GNY A;  2BEO A;  1IS5 A;  2XJQ A;  1UO9 A;  4QPI C;  1DIW A;  3FHI B;  4IE4 A;  1PK6 B;  2XQX A;  3MIG A;  1VRH 3;  5E88 A;  2BDR A;  1W06 A;  2SLI A;  3I7D A;  4QGN A;  3TB0 A;  3FUQ A;  2HEV F;  1G8W A;  1AR8 3;  1NXM A;  3NL1 A;  2JDZ A;  3I2H A;  3LOB A;  3CF6 E;  1ND2 C;  4Q8L A;  1ZBE 1;  3TN9 1;  1SEF A;  4AXO A;  2H6C A;  4KWU A;  1ALY A;  2QKD A;  2SBA A;  3ILR A;  2ARE A;  1PGW 2;  2ZGP A;  4LIU A;  1AR7 2;  4RA0 A;  2R16 A;  1S2E A;  1PK6 C;  4FO9 A;  4HK8 A;  4PF5 A;  3OSD A;  3OBA A;  3EB7 A;  4Q4V 2;  3ZLI A;  1SAC A;  2QQW A;  2AGS A;  2Z5W A;  1BBT 2;  4K20 A;  5CFD A;  3JD7 3;  4FI9 A;  2ZX2 A;  5L9B A;  1WUV A;  3V65 A;  4J1W A;  4QPY A;  4LEJ A;  4DY3 A;  5D1I A;  3OY8 B;  5FZ9 A;  4A3X A;  5J98 B;  5JI9 A;  2H0V A;  4FOY A;  2RR1 3;  3AZW A;  4CDW B;  2TUN A;  2YPD A;  3AP6 A;  1KD7 A;  5ANN A;  5C9A A;  1B35 A;  1UY4 A;  2ZGR A;  1QOO A;  3NKT A;  4XHX A;  4BH9 A;  3KT1 A;  1WLW A;  1US2 A;  3VKO A;  1B09 A;  3T2O A;  4IV1 B;  1K5M B;  2CAV A;  1F35 A;  3BTA A;  1LB2 A;  2ARA A;  2UY8 A;  1PO1 1;  2PLV 3;  3GZT B;  4BIO A;  2O0O A;  2ZMK A;  2VZV A;  4WBB A;  2AEN A;  1FOD 1;  1PIV 2;  1V6J A;  2WAO A;  5JOW A;  3RZJ A;  4CDW C;  4ZKT B;  2D5H A;  1FT9 A;  5JMC A;  1IQA A;  3BTZ A;  5EFU A;  4YG0 A;  3VN4 A;  3O1S A;  1LEM A;  3L9J T;  1ENS A;  1QOS A;  1OF3 A;  3RS6 A;  2VZS A;  2JIJ A;  4HXC A;  1BKZ A;  2YHJ A;  4N90 A;  1K5M C;  5IVC A;  2N7G A;  2TBV A;  1OH3 A;  3PUH A;  4PJY A;  4XUP A;  4MXW B;  1HB1 A;  3BKZ A;  1JZ7 A;  2VZT A;  2MPF A;  3WV6 A;  2ZZJ A;  1NYW A;  2Y38 A;  4Q4W 1;  4GWJ A;  1I5Z A;  4PI2 A;  2KR2 A;  2RE9 A;  3KS7 A;  4PT6 A;  4NII A;  2IWG B;  2Q4S A;  4CDQ B;  5A1F A;  3AXD A;  4CUA A;  1JUH A;  5FWE A;  2BYV E;  3GCX A;  4DUW A;  4M0H A;  4P14 A;  3ZR5 A;  2W1U A;  4BQ2 A;  4XAA A;  3K4Z A;  1W6O B;  2VCB A;  2WKK A;  2ZAC A;  1NLR A;  3FLT A;  4IUG A;  2CYF A;  1ULO A;  2C6S A;  3GHN A;  1Y9G A;  2VJX A;  4Q0P A;  5BNQ A;  1O4Y A;  1OFS A;  4PIY A;  4Q27 A;  4Q4V 3;  3WLU A;  3R6S A;  1PX4 A;  2VUJ A;  5AFB A;  1U12 A;  5C4W B;  3V0B A;  1VAL A;  2XBO 2;  1YI7 A;  1BBT 3;  2KXL A;  2ES3 A;  5FUP A;  1QJF A;  4OZO A;  1WLD A;  4CDQ C;  1KS5 A;  3QH7 A;  5BNO A;  5JOX A;  5FK7 A;  4LT5 A;  1W05 A;  2VMI A;  1UF2 C;  2GNB A;  5HCB A;  4K3U A;  4SBV A;  3TNQ A;  3AKP A;  3FHQ A;  3C7H A;  3KV5 A;  1BMV 2;  4AVC A;  2LTN A;  1AVB A;  4R4Z A;  2GMP A;  4HL0 A;  2W52 A;  1IS4 A;  1I3H A;  3WP3 A;  5C4W C;  1VBA 1;  1LGN A;  5DG2 A;  2QCS B;  2YB7 A;  1U5X A;  4MGY E;  4CXX A;  4CCO A;  1DBN A;  1POV 0;  2HYX A;  3GJB A;  3WT3 A;  1IS3 A;  4F83 A;  1WBF A;  3KCX A;  4NHL A;  3ZIX A;  1JHN A;  4AI0 A;  5GM0 A;  4C8D A;  2WNV C;  1HQN A;  4F3J A;  4XF4 A;  1YUD A;  1COV 2;  2PHW A;  1GBG A;  1QJU 3;  1XYP A;  2AC1 A;  3LFM A;  2VNV A;  1ZA7 A;  4XC9 A;  4Y1X A;  4OI2 A;  5ABJ B;  4CXW A;  4AYU A;  2WNE A;  1HRV 3;  2CHH A;  5FXX A;  3ZYH A;  5FZ1 A;  3HNM A;  2DV9 A;  2EXI A;  5B4X A;  2WJS A;  3DGT A;  2A3Y A;  3FLR A;  3P5B A;  3GAL A;  1MZE A;  4QPI A;  4LR4 A;  2VOX A;  3U10 A;  3MW3 A;  4U2A A;  4XBQ A;  3UGH A;  2VUD A;  5A3M A;  1W90 A;  2HKX A;  3VDB A;  1S0B A;  5DAV A;  1RUH 1;  4JGZ A;  4CP2 A;  5ABJ C;  1I1E A;  3CHX A;  4QX5 A;  3H50 A;  2Q1F A;  4K1Z A;  1KFX L;  1QJX 1;  1YIF A;  2R32 A;  4ORF A;  2K9Z A;  1GV9 A;  3K46 A;  4LE3 A;  4MUV A;  4QX2 A;  3W21 A;  2B7Y A;  2ZEY A;  4FOV A;  2EIB A;  2XUE A;  4CU8 A;  4H3W A;  4JVA A;  3PNA A;  2YYO A;  2W1S A;  4AGV A;  1RUG 3;  2B5H A;  2XBO 3;  5FZ4 A;  2QUO A;  3KGZ A;  3ZDV A;  3WP4 A;  1W9F A;  1L3J A;  3BAL A;  3LDK A;  5FIX A;  5C3R A;  3PJQ A;  2HWC 2;  2VZ1 A;  3D3A A;  4FP2 A;  5F5C A;  1OHF A;  4NHK A;  4YZ1 A;  2JDU A;  3JXS A;  2XVG A;  2RM2 1;  2JDK A;  3QOP A;  4GXL A;  4H14 A;  1S0I A;  2BV4 A;  2OS2 A;  2VOK A;  2VZR A;  1AYN 1;  5DG1 A;  2CSG A;  3B00 A;  1ZRE A;  2FDK A;  4YVS C;  1ONA A;  3VBU B;  4R9C A;  2QBX A;  5FUN A;  5CKN A;  1CX4 A;  2XPJ A;  1FPN 3;  2QQU A;  2WQZ C;  3RZZ A;  4GAL A;  2PHR A;  1DYP A;  1H2N A;  1AXZ A;  3J9S A;  5FCC A;  3CBN A;  1VBD 3;  1MVE A;  2FMY A;  1O7F A;  5K7P A;  1DQ1 A;  1SFY A;  1W8F A;  4XW3 A;  1UY0 A;  4V2W A;  4BYY A;  5FZI A;  5EQU A;  3GXU A;  1SLI A;  3O0X A;  2MHF A;  2BVV A;  2GME A;  1VBC 1;  4D3W A;  5F2W A;  3AYE A;  2R07 2;  4RL7 A;  1N1S A;  2JDY A;  1Y9Q A;  5J48 A;  1OOP B;  5C8C A;  2VVE A;  3RZH A;  4K7J A;  4DFS A;  4EE2 A;  3EYP A;  4R9B A;  2YUE A;  4EV0 A;  3WQ1 A;  1MZF A;  1ZZB A;  2XLG A;  1JOD A;  5A6Z A;  1WGP A;  2EAA A;  3DPR A;  4QHB A;  2IFR A;  5JI7 A;  4EQV A;  1VE0 A;  3AX4 A;  4UFM A;  1VJ2 A;  3SH5 A;  4OI1 A;  1XE7 A;  1QGL A;  1BEV 1;  1DGR A;  4E4S A;  5IJR A;  1HDK A;  1OF4 A;  1QHD A;  2A7A A;  4D7S A;  3ZVX A;  1OOP C;  2YGM A;  5DZF A;  5EJ3 A;  4MXW A;  5FFO C;  1RC6 A;  3RWK X;  2W92 A;  5T5O A;  3UJQ A;  3E5U A;  4LOS A;  2WLQ A;  4YGE A;  2VQ0 A;  5KHK A;  1WD4 A;  4LPL A;  4C91 A;  4AQ6 A;  2PEL A;  4C1W A;  2OQ7 A;  1UYY A;  1Q3E A;  4OHX A;  1S0D A;  3E6B A;  2HWC 3;  4CUB A;  2YFZ A;  3IPV B;  4LLO A;  5GZE A;  4Q1P A;  1BCX A;  4I2O A;  3DKW A;  3N9N A;  1QXJ A;  3FZ3 A;  4RSU A;  4TXW A;  4Y5T A;  5FWJ A;  4NID A;  3MIC A;  2XB6 C;  1AX0 A;  2ZX0 A;  5BPX A;  4GQ7 A;  4XAC A;  4BLJ A;  1KIT A;  4LHS A;  1W6P B;  4NHY A;  4BJ0 A;  2GNT A;  1H8T A;  1LHU A;  1V9U 3;  3CEW A;  2GZW A;  3MIH A;  1UZY A;  1CIY A;  3H0O A;  4GMP 1;  5E6H A;  3BGA A;  2ARC A;  4BQY A;  1ZBA 2;  1OKQ A;  3POB A;  3MV0 1;  5JDB A;  1S1A A;  1TZO A;  4XUQ A;  1NT0 A;  3LD8 A;  4Q0Q A;  5FYC A;  1H0B A;  3IDC B;  2LUW A;  3WDV A;  3VDD B;  4XBL A;  2J1E A;  2DBN A;  1PNF A;  4E4H A;  1QXR A;  4IES A;  3RJR A;  3TEX A;  3N9O A;  1ULC A;  4LO6 B;  4CP9 B;  2WNV B;  5T50 A;  2PXJ A;  4CVU A;  3T2Q A;  3QD6 A;  3A0N A;  2Y6H A;  1GKB A;  1ZRC A;  5LA9 A;  2R07 3;  4LO4 B;  1MS4 A;  3VBR B;  2NPI A;  2VVD A;  1QH6 A;  1QY4 A;  2D6M A;  4M00 A;  1RUC 1;  1JZ6 A;  5LEK A;  3RJ2 X;  5FZO B;  4UXA A;  1SPP B;  1CAU A;  1U0A A;  4HKW A;  4JCK A;  4RQP A;  2J7M A;  3MIF A;  1O3T A;  3WIN E;  3CJI B;  3N7M A;  2YC4 A;  3NJX A;  4CTE A;  4DIN B;  1KEX A;  4RYD A;  1W9Y A;  4WVZ A;  5FZG A;  5I91 A;  4UF0 B;  1PGL 1;  3VDD C;  1DG6 A;  5ABJ A;  2NP0 A;  2PHL A;  4GB3 2;  4Q29 A;  1XSQ A;  1D0H A;  5GZG A;  1KJR A;  2A6Y A; 
#chains in the Genus database with same CATH homology
 5A3W A;  4NUB A;  5F32 A;  5FYU A;  5FXW A;  5FP7 A;  5FJK A;  2XDV A;  5FUN A;  4IGO A;  3ZPO A;  5A3P A;  2YBP A;  4EZH A;  4TN7 A;  5FJH A;  1VRB A;  4ASK A;  4BIS A;  5A1F A;  5A7W A;  5FWE A;  4GJY A;  5IW0 A;  5F5I A;  5K4L A;  3U4S A;  4XDP A;  4IGQ A;  4GD4 A;  4V2W A;  4CCM A;  5F3I A;  5FPL A;  5FY9 A;  5FZI A;  4DO0 A;  5F3C A;  2OX0 A;  3UYJ A;  5LWB A;  2XXZ A;  4BXF A;  3OPW A;  2YU1 A;  5FZ0 A;  4GJZ A;  5A80 A;  3NJY A;  5IWF A;  2Q8D A;  5F2W A;  5CEH A;  5IVB A;  4D6Q A;  5FZ7 A;  3N9P A;  5FZB A;  2YBS A;  3N9M A;  5FZE A;  4Y33 A;  5FUP A;  4AAP A;  4Y3O A;  4QXH A;  5A3N A;  5A7Q A;  4LIV A;  5IVE A;  4QWN A;  5FPV A;  5FY4 A;  5FY0 A;  4CUG A;  5F3E A;  4EYU A;  5FZ3 A;  3N9L A;  5FPU A;  5A7S A;  5FY5 A;  2OQ6 A;  3PUR A;  3K3N A;  5LY2 A;  3KV5 A;  3DXU A;  5FZC A;  3LDB A;  4URA A;  5FBJ A;  4CCJ A;  3RVH A;  5FYZ A;  5A7W B;  3U78 A;  3PTR B;  5FZM A;  5FV3 A;  3N9Q A;  5FYV A;  5FXV A;  5FZF A;  4CCO A;  5FZH A;  5ISL A;  5IVY A;  4XDO A;  5FY8 A;  5FYS A;  3AL5 A;  5F2S A;  4C8D A;  3AVR A;  5FYI A;  5FPA A;  4QX7 A;  2OQ7 A;  4GAZ A;  5F3G A;  5FP3 A;  5FYM A;  4QXB A;  5FY7 A;  4CCK A;  3OPT A;  5IVV A;  4LIU A;  4AI9 A;  4EZ4 A;  3K3O A;  5ANQ A;  5FXX A;  5FZ1 A;  5A7O A;  5FZD A;  5LW9 A;  3AVS A;  5FYB A;  3N9N A;  5FZO A;  3ZLI A;  5FWJ A;  5FZL A;  5IVF A;  3KVB A;  4LIT A;  4BU2 A;  5FPB A;  2YBK A;  5A1L A;  5FXZ A;  3KV4 A;  5FYH A;  3AL6 A;  4QXC A;  4QX8 A;  4HON A;  3DXT A;  3PU3 A;  5A3T A;  2WWJ A;  4UF0 A;  5FZA A;  4Y4R A;  5FYT A;  3PU8 A;  5E6H A;  5FZ9 A;  5F37 A;  2XML A;  5IVJ A;  3KV6 A;  3PUQ A;  5F5A A;  2YPD A;  5A7N A;  4CSW A;  2YU2 A;  2P5B A;  3LD8 A;  4DIQ A;  2VD7 A;  5FYY A;  5FYC A;  5FP4 A;  5FZ8 A;  4CCN A;  4D6S A;  2Q8C A;  4LXL A;  5LY1 A;  4E4H A;  2Q8E A;  3N9O A;  2XUE A;  2PXJ A;  3PUS A;  5A7P A;  4QU1 A;  3PDQ A;  4IGP A;  3KVA A;  4V2V A;  5FZ4 A;  5FZO B;  2OT7 A;  2WWU A;  5F39 A;  2GP3 A;  2W2I A;  5FZK A;  5IVC A;  5FZ6 A;  4CCL A;  3PUA A;  5F5C A;  5KR7 A;  5FZG A;  4HOO A;  5FP8 A;  4UF0 B;  5FP9 A;  3KV9 A;  2OS2 A;  4D6R A;  2GP5 A;  3K2O A;  5FY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...