5FZ6A

Crystal structure of the catalytic domain of human jarid1b in complex with maybridge fragment n05859b (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
462
structure length
452
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSNYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Maybridge Fragment N05859B (Ligand Modelled Based on Pandda Event Map, Sgc - Diamond I04-1 Fragment Screening)
rcsb
source organism Homo sapiens
total genus 140
structure length 452
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz6A01
5F3CA 3PURA 3UYJA 5A3PA 4E4HA 5FYHA 3PU8A 5FV3A 5IWFA 4IGOA 2Q8DA 2OQ6A 3KV4A 4XDPA 4AAPA 3PUSA 3PDQA 3N9MA 4QXCA 5FPAA 5F5CA 4IGQA 5FPVA 3AVRA 3ZLIA 5FZEA 4EYUA 1VRBA 3OPWA 4QU1A 5FY1A 5A7OA 4CCMA 4DIQA 4LITA 4NUBA 2VD7A 5FUNA 3DXUA 3AVSA 5FZOB 5IVBA 2WWJA 5ISLA 4UF0B 5CEHA 2P5BA 4GJYA 5A7SA 2GP5A 5A7PA 5FJKA 4LXLA 5FZHA 5FP8A 5FZ0A 5FZKA 4BXFA 3PTRB 5IVJA 5LW9A 5F32A 4GJZA 2Q8CA 5FXWA 5FPUA 5FZ6A 5F3GA 4QWNA 4CSWA 3KV9A 4Y4RA 5FZGA 5FWJA 5FYSA 3K3OA 5FY4A 5FZ3A 5F37A 5F5AA 3OPTA 2YBSA 5FYYA 4D6QA 3PU3A 4V2VA 5ANQA 5FZBA 4D6SA 4BISA 2WWUA 5E6HA 3U78A 5A7WA 3NJYA 3N9LA 4GD4A 5FZFA 4HONA 2Q8EA 4CCOA 4QXHA 5F3IA 5FP7A 4CCNA 5F2SA 5KR7A 5A7NA 5FY5A 5FPLA 5FY8A 5F39A 3K2OA 2YU2A 5IVFA 5IVVA 2YBKA 2W2IA 4QXBA 3N9NA 2OQ7A 5FYTA 5FZIA 5A80A 5LWBA 5IW0A 5A3WA 2YPDA 5FZLA 5FWEA 5FZMA 4LIVA 5A3NA 5A1LA 4URAA 4CCJA 4AI9A 5F3EA 5A1FA 5FZCA 5A7QA 5F2WA 4LIUA 5FYMA 3LD8A 2XDVA 3LDBA 5FYUA 5FZ7A 4CUGA 5FY9A 5IVYA 3PUQA 4BU2A 2YU1A 5A7WB 4HOOA 3KV5A 5K4LA 5FJHA 3AL6A 5IVEA 5LY1A 4QX8A 4IGPA 5IVCA 5F5IA 5FUPA 5FBJA 5FYIA 3U4SA 4C8DA 5FXXA 4TN7A 2OT7A 2XUEA 5FZ9A 3N9PA 5FY0A 4CCLA 4QX7A 4Y3OA 3N9QA 5FYCA 4EZHA 4CCKA 3K3NA 5FXZA 3KVAA 5FZ8A 4EZ4A 5FZDA 2PXJA 5FY7A 4XDOA 2OX0A 2OS2A 3PUAA 3KVBA 5FYZA 2XXZA 3KV6A 5FZ1A 5FZ4A 4DO0A 2GP3A 5FP3A 5FZOA 5FP4A 3N9OA 5FYVA 4UF0A 3DXTA 5FZAA 3AL5A 4V2WA 3ZPOA 3RVHA 4ASKA 5FPBA 2YBPA 4D6RA 5FXVA 5LY2A 5FYBA 4Y33A 5FP9A 2XMLA 5A3TA 4GAZA
chains in the Genus database with same CATH superfamily
4MXWA 2GC2A 5FKCA 4MHRA 5KXEA 3UGFA 1W9SA 1S0CA 2JKBA 3VDAA 3I8TA 3CKHA 1YXWA 2Y26A 1N1SA 4UXAA 5C7GA 3ZOIA 4COYA 3KCYA 3X29B 4BDVB 3BU7A 5FMCA 3R4SA 1OA4A 1UOGA 1YCIA 3GDBA 3NV2A 3POFA 2V09A 2FDHA 4N8MA 4NUBA 2Q1MA 4A6OA 5FRAA 2ZHKA 1GP4A 4ORFA 5DPNA 3NVCA 1QNYA 2GSYA 4QX3A 4CUCA 2OA2A 2PHXA 2NQYA 1HRV1 1ULOA 3V64A 4CEYA 4JDNA 1URXA 2ZMKA 1OURA 2KM2A 3R4DB 5EXOA 5HXMA 2ZEZA 3VL8A 1Q5OA 2ZOEB 4NOTA 1GUIA 3H8UA 4RHV1 4GMP3 3KV9A 3J7MA 4BLJA 2IZWA 2VZ1A 1ZZCA 1OQ1A 2HWF3 3ZFEB 5JCTA 4K21A 4V2VA 1JYXA 1OHFA 4XACA 2P2KA 4BISA 1HLCA 3EQEA 2DTYA 4PQ9A 1RXFA 1MS1A 2VMFA 1D2SA 3IKWA 5JIAA 2FD8A 1FT9A 2JE9A 4YM3A 4GB31 5FZFA 3I97A 4DZGA 2D5FA 2FCUA 2G9GA 5J3UA 4LHNA 4OUSA 1S0DA 4HMZA 1JOPA 3CL1A 1ZZBA 1XBFA 3LEIA 5JDBA 5CAZA 3QLQA 3RQ0A 4AVTA 1DFQA 2YBKA 2HWF1 4XZUG 2W2IA 1YFXA 3LFMA 2RVAA 3HOBA 4CEYB 5A3WA 2WYSA 5FZLA 1QXJA 3LGRA 2BFUL 1DGRA 3K51A 4L8QA 2RV9A 1L7QA 2WN2A 3FX3A 2WLPA 1EUTA 3P1IA 1NLSA 2A1XA 5H9SA 1RL3A 5B4NA 2BV4A 4LUMA 2BOJA 3LFIA 1M4WA 4YRDA 5BNPB 3ZYHA 1CAXA 3BPZA 4DXRA 4PLNA 1WCSA 3LEGA 2XLGA 4LOTA 1RUI2 3A21A 2VUJA 3RZHA 4UWDA 5APAA 3PLQA 1YLLA 3O1OA 1WMXA 3N7KA 1O4ZA 4Y3OA 1J3RA 2WFPA 3I3EA 1C8NA 3K48A 5FXZA 2Y64A 5CFDB 5JI9A 3OEBA 3WUCA 4Q4Y2 4B29A 4LBMA 4QM8A 1AYM2 3C7OA 5L7OA 3ZN4A 2EIGA 1NQDA 1OFNA 4NHXA 4XUNA 5JXJA 2EVXA 1US3A 5FZOA 2WNVA 2UU8A 3VZMA 3T2OA 3WP6A 1AXZA 2D6PA 1D0GA 3POGA 4EN6B 4XTMA 5C3QA 5C9AA 2XHKA 3THPA 4ZPIA 4TSVA 2ERFA 1CAXB 2JJ6A 5F7UA 4AI2A 1ND2B 3ZYRA 3PUHA 1ST8A 1F8VA 2W68A 2OPKA 1AXYA 4P9IA 1F5FA 2XH6A 4AK3A 3V0BB 1R64A 4LEJA 1LOBA 2D44A 5CA6A 1PO12 3ACFA 2W5FA 2WSVA 5AVPA 2NP0A 4AFBA 4ES8A 3ZO0B 1WA4A 1W8UA 2N7GA 1X9TA 3JB8A 4NWWA 4L11A 1BK1A 3VDDB 1I5ZA 2QVSB 2X09A 4EYUA 3K4ZA 1JYIA 2VAUA 1IOAA 2VBBA 1C57A 5HCHA 5HCFA 1CWPA 4OULA 1SFYA 1A3KA 3AVSA 4RGAA 5FZOB 4Z8BA 3H3UA 2WNVB 4NE9A 1NA1C 2Y6FA 3O1MA 4IEZA 5L9RA 3MUY1 1AZDA 3W58A 5GZDA 5F5QA 5IHRA 2BNOA 4S2FA 1PHMA 2QZ2A 3IB3A 2BYVE 4CUAA 5FAXA 4D7YA 2DVAA 4Q4X3 2W0XA 4TYSA 2MNGA 3DCQA 5I0TA 1ZRCA 2B9UA 1OI6A 1ONAA 3ZXAC 1OPMA 4A45A 5IK5A 5HPOA 2B9VA 1UZZA 3PU3A 4XBQA 1QJX2 1H2MA 4QHBA 2Z79A 1HN1A 1QIQA 4MGQA 4DQAA 3I2FA 1GANA 1HB4A 1MR5A 3N9LA 4LLFA 1OQDA 1GZWB 4PBOA 2VR4A 1W2UA 2JG9B 1PO13 2YC2A 3CZUA 3AJZA 3K75B 1VBD3 4CCNA 3E5UA 3WQ7A 3IPVA 1RB8G 2ZEXA 4Q4X1 4BQ2A 1CONA 1DGRN 2ZX4A 2VGDA 3L2HA 3GGLA 4J6GA 4XAAA 5JXHA 5LZ6A 2FDIA 1GU3A 1W6MB 2HWC1 3T4HB 4BWOA 1W28A 5E1RA 4F3JA 4NN0A 3UKVA 5LEJA 3VHNA 5FBZA 1ZVFA 1H1IA 1FPN3 3D3AA 3FLTA 3WT3A 4CEWA 3EBRA 2XG3A 4A7ZA 4O65A 5A1FA 1TVGA 3O12A 5I8TA 3D4KA 1QJFA 2YFZA 4XJZA 1I1EA 3S0MA 1GLHA 3RYKA 5FYMA 2ZTNA 1KJLA 4UYBA 1VBD1 4ITCA 2D6KA 1ULDA 2OZJA 2WT1A 3H7YA 4FPHA 2FDGA 1BHGA 2F6BA 1PGL1 4PDWB 1LEDA 3VZLA 1FOD2 2ORXA 4HOOA 1F5JA 1M06G 4XMAA 1V00A 5F5IA 1APNA 5C8WA 2WO1A 5AFEA 1FPN1 1JUIA 3WR0A 1S0GA 4F8AA 3IPVB 2EXJA 2DVGA 4LBKA 3N9PA 2A5ZA 1XNTA 4KU7A 2DCJA 3POYA 4XHBA 5EFUA 4CCLA 4CEWC 3U11A 3HR9A 1ACCA 4X6QB 5CYYA 1QMJA 3RNSA 2VZSA 4YZ3A 2ZAHA 3GBWA 5FK7A 4YYOA 1AL0G 2XVLA 1I5PA 1AJOA 2JDHA 3ETPA 1VR3A 2BGOA 4ZU4A 4XOGA 4ARXA 1IHMA 1E5RA 1S0FA 2E51A 4LUKA 4F7ZA 3MF9A 5HCBA 2H0BA 2JG8C 3SEPA 5BNOA 1JOJA 1U0AA 3ZSLA 2JKXA 3I2DA 1OH3A 2GN7A 2AC1A 3H1WA 2HWB2 2XQRA 4EJRA 3U4XA 3OOXA 4H2AA 4GH4A 4YG0A 4IEVA 1UO9A 4XVHA 1YWKA 2W47A 4AVBA 1Q8QA 1LHVA 1DGWX 3USUA 4MO3M 1BK0A 1FOD3 3H1YA 4OUMA 3DYPA 3SITA 1FV2A 4RQPB 2IXHA 2WO2A 1B35C 4AEMA 3C7EA 2O14A 1F4AA 2CU5A 5E16A 5FKBA 4OQ8A 1UY0A 1FAYA 5BNNC 1H9WA 3NNFA 4GKYA 4MGIE 4FPCA 3VHPA 1KQRA 3M7AA 1W9TA 4XCAA 5BNQA 4KWJA 1LU1A 3PTRB 5BUVA 1NZCA 2VOVA 3VBHA 2A6YA 4YNIA 3RPQA 4AQ2A 2RG4A 5JWPA 1PNFA 2RJKA 2QQOA 2ZACA 4HPKA 1X50A 4GH4B 4LKEA 4YZ4A 3ZKYA 3VDCA 4HVRA 1Q8OA 2DTWA 2ZCWA 5C33A 1JZ6A 1D4M2 2HWB3 3A23A 3ILFA 3USUB 3ZN6A 4AQ6A 2WWSA 3DN7A 2FQPA 2GNTA 3MI8A 2RE9A 1SFPA 3NW4A 3ACIA 3SKVA 4DS0A 2GMMA 3C7HA 4QB6A 3ORJA 4PLOA 1A8MA 1PM7A 5CVRA 3CEWA 2OW4A 3VKMA 1JYWA 4XETA 1ZYBA 2CDPA 4QXHA 4XTPA 3W59A 4FPJA 5F2SA 3WQ1A 3HPNA 1POQA 3MDPA 1W2AX 3OYWB 1AL23 4MV2A 3VBUC 2VCCA 3DUIA 2B42B 3N9NA 3AP4A 4QKDA 3VUOA 1LESA 2MEV2 3BB6A 3VBHB 4CZSA 5FWEA 5CU1A 2XBO2 4OHYA 4HPKB 3B9CA 4OUEA 1COV3 3D0SA 4XQDA 5ACA2 3NMBA 2YYOA 4KWKA 1CZTA 3USSA 2PELA 5D8AC 4XFFA 4YGEA 3AFGA 3ZN6B 3WNPA 1DQ4A 4C0HA 4XFGA 4UFIA 5LRSA 3RZKA 2UY9A 3GHMA 3DEMA 1AL21 1V6OA 2ILMA 3T1LA 4P9YA 1D4M3 1W6NA 3A0KA 5IVCA 1WUVA 4UAPA 2LM3A 2R072 5I91A 2ZS6B 2XUEA 3U10A 3KGLA 1COV1 2ETEA 4FT8A 5DMYA 5D2AA 3VZOA 4GWJA 3ZYFA 3K3NA 1NCRA 3RSJA 4Y22A 1DBNA 1AR82 1SLTA 2LW8A 4I0BA 3ZYBA 1UYXA 4BQXA 5JLVA 5BNOC 5FIXA 3URFA 4Q26A 4ASLA 2G9ZA 5FZ4A 1JODA 2IXLA 1UQXA 2VXJA 4XMIA 2GMPA 4DXSA 1FMD2 5JPNB 4IEUA 1TZOA 2GH8A 2GNMA 1RVF2 1HQLA 1K42A 3NV3A 3POSA 4UFLA 2XJRA 1JZ5A 1LRHA 2E9QA 5IFTA 1K5MC 2RS13 3RVHA 1H30A 1FATA 4OI1A 4OLLA 5FYBA 1W6NB 3GZUC 1HRI3 2D43A 2XMLA 1RHI1 2JDZA 3AM2A 2QUOA 4AWDA 3PURA 2GMEA 4I01A 1D7PM 2J1RA 2Y6LA 4JHZA 3VD3A 2PAKA 2FMYA 4QPIC 4HVQA 5LBEA 2R063 2YZ4A 4KL1A 5IUQA 1NCRB 3EYPA 2BGCA 3QOPA 4Y22B 3M3EA 3R4UA 1DYPA 1J3PA 2QFEA 3W9AA 1SCRA 3JBG2 3BIWE 1OF4A 3R05A 5SV5A 4NHLA 2RS11 3WF4A 4AQSA 3FJSA 3JD73 4YW2A 3VB9A 3WNXA 3EB7A 3VZKA 2VD7A 1HXS2 1ZRIA 1HRI1 1OOPC 3UNPA 2TNFA 1NXMA 4AZZA 5BPXA 5IK8A 1K5JA 1ZM1A 2VNVA 1PZ8A 2XKPA 5FP8A 2R061 3RMYA 2QQUA 1XE0A 3ZKUA 2FDFA 4HN1A 1IKPA 2EXHA 4FI9A 4KQ7A 4WV8A 4QKNA 3H3ZA 3RYRA 1W8NA 4IV3A 4HETA 2WT2A 4FPGA 4GQ7A 4R4ZA 5L19A 4KMQA 1W39A 5F37A 4HL0A 3UJOA 3JD71 2WC2A 4LTAA 4D6QA 2R1DA 5F9TA 4JGZC 1T2XA 1GMMA 5FMDA 4AEDC 4HFSA 1RGSA 2VZVA 3LOIA 4S2GA 2F4PA 2K9ZA 2QDNA 4FVVA 1R1A2 2WBKA 3B7MA 2BPA2 2W52A 1BVP1 4UT5A 2R16A 1SPPA 1L7RA 2C6SA 1N3OA 1UZWA 1U5YA 2OPWA 1RUE1 1S0BA 2VXRA 3OGSA 4IEXA 5FPLA 3O1PA 5LBFA 3H8OA 4LULA 1WW5A 2ZEWA 3ABZA 2HYKA 1VMJA 2B39A 4LKDA 3UKNA 5GZCA 5KBFA 4P9XA 2A6ZA 5FREA 3DECA 1HXS3 1C3HA 1C4RA 1DLCA 2R7EB 2EXKA 3N36A 5F6LB 3OUIA 1NCQC 2ADDA 3KT7A 2ZGNA 1R093 1RUH3 2WAOA 1YYNA 2VZRA 3OJBA 3VZJA 4QQPA 1O6UA 1ND3C 2GZWA 2P1BA 4BYYA 1H4GA 1DCSA 3MUZ1 2WLQA 1MS0A 4Q0VA 5DQ0A 4DOUA 3ETQA 1A78A 4KG8A 1EYBA 3WDVA 3VBOA 4YLZA 5EJZB 2X5IA 3B02A 3I3DA 3T2TA 5DZFA 2Y38A 3O7OA 5IJRA 3VBRA 1JOBA 2F17A 2VOKA 4YVWC 1WLWA 3SC7X 2ZX0A 3C2UA 3VKNA 1R091 1RUH1 3CF6E 4SBVA 5HI0A 5IK4A 3PVNA 2CWMA 4YVSC 1V6MA 2EALA 3C7FA 3Q8AA 4GZ9A 3CO2A 1MVQA 4EZ4A 3DPRC 1YUDA 4LMFA 2H0VA 5EZWA 4BB3A 4AW7A 3PJQA 1U12A 1ULFA 1KGYA 3I59A 2W94A 1V9U3 4E27A 3HD8B 1TQ5A 4OZOA 4XXAA 2DCZA 2GN3A 3IDCB 4Z2AA 2E63A 2V5YA 1R082 3ZFGC 4COVA 4B3NA 4XAEA 3S7IA 3ZPOA 5GLVA 5EV7A 4YZ5A 2AGSA 4QU2A 3S5AA 4RS5C 2VNOA 4PI0A 4Y20A 1JZ2A 2UY8A 1WWYA 4N90A 5DAWA 3VBSC 1TMF2 2Z2SB 2X5IB 4UFKA 4Z07A 3VBRB 1MQTC 3OBTA 4P9WA 2WFF3 4HG6B 4QM9A 4D69A 1HX6A 1GZ9A 1V9U1 4I0WB 3PJYA 4ZZ8A 2OQ6A 1Z7S1 5KXBA 2IVIB 3K46A 3PDQA 1G9DA 3ZR6A 5E89A 4ISQA 1H2KA 3N9MA 4HKOA 4LBNA 1RC6A 1GKBA 3NNGA 2PQSA 1CX1A 4UFHA 2WQZC 5FPVA 4KNCA 2K2SA 2LUWA 3B5LB 5EYXA 1DDLA 5C8CA 4RR3C 4LO8A 3WNOA 4ZZ5A 2QQLA 4E4ZA 1JYTA 4FO9A 4Q4W1 5DABA 2WFF1 5FLIA 5LW9A 4LT5A 1R083 4QPGA 4FSJA 3HT1A 1QDCA 1S55A 3RJRA 4QX1A 2MPFA 4AOCA 3FHQA 1UYYA 5KHKA 4FFGA 3I54A 2A70A 3OPTA 1ULCA 3HAGA 5BY5A 5B4XA 3VV1A 3WEZA 1C28A 3MIGA 1P8JA 1WCKA 5KHJA 2DUQA 5EHDA 4OCTA 4QKBA 5CNAA 2VMCA 4QQHA 1KITA 2JDMA 1X8MA 1XNCA 2SBAA 2VECA 5ERLA 1C1LA 1GSLA 2TEPA 4N9IA 3S57A 2A3WA 3PMSA 4JKMA 5KR7A 5A3LA 1H0BA 1QGLA 2BBVA 1U5XA 1J1LA 1V6IA 3NNMA 5LEKA 2QQNA 4N53A 1RJ8A 2GC1A 5FDBA 3AMQA 5G05L 5J98B 3UGHA 3ZYPA 5ABJA 5J1XA 4XF3A 5ACA1 3OF1A 1JZ8A 1UKRA 3MIHA 3OBZA 3MEPA 4Y1YA 2IFWA 2C5DA 1DIWA 2D6OX 2GDFA 4LKFA 1MEC3 2DVBA 2BWCA 4P08A 3LEKA 4CUGA 4LPLA 1VBA1 2TUNA 3VD7A 5FY9A 4YG6A 5JXIA 4AHXA 4QD2A 4XILA 5IVYA 4XUTA 2HLEA 1UXXX 2YU1A 3B9IA 1US2A 4COUA 2FMDA 1TME1 2PHRA 1W2OA 4RA0A 3U4SA 1DG6A 5CG8A 1VRH3 3MGUA 5B2GB 3DGTA 4AFAA 2G1MA 5KC6A 1NE4A 5CG9A 5JPMB 4YARA 3WD5A 2JDYA 3WX5A 5JSOA 4N53B 1MEC1 1DZRA 4WVMB 1E5HA 4PQQA 2J1TA 4XF4A 5DG2A 1MS9A 3KLSA 5I0DA 2JXAA 4XFHA 4EN9B 4LHKA 1UZ0A 3OCPA 4BJ0A 4ASMB 4CRQA 1CAVA 3IDBB 4CU7A 1IPKA 4YGCA 4M3CB 3MW3A 3TAYA 2J42A 3QACA 1V6LA 3J26N 1RTVA 1DQ1A 4V2WA 1VRH1 4LNVA 4WM8A 1HRV2 4K20A 4R52A 4AGGA 2C9AA 4I09A 4JGYB 2XJUA 2IFRA 1GBGA 5KXDA 4RHV2 3MIDA 4BK4A 4YW3A 2E7TA 3NV4A 4J1WA 2DYCA 4IGOA 3ZMOA 5L7OC 4ZU7A 3NQHA 4QGLA 1KFXL 4HN0A 2XJQA 1CVNA 3JQWA 2VY0A 2Q30A 3N7JA 4FP2A 3ZDSA 4A7YA 4W6YA 3U1XA 3ENRA 1RUNA 5FPAA 4IGQA 3T30A 3WQBA 1S2BA 1V6JA 2I74A 3OPWA 3HEIA 3POWA 4GB32 4LA2A 4DIQA 1OQEA 1OKQA 2QQVA 3CJIB 3DXUA 3ZXDA 5C9AC 2WA4A 1JZ7A 1SACA 2VMDA 4A3XA 2GP5A 1W3XA 3EXUA 2V5DA 4WM8B 3LF7A 4UFMA 1RUG3 2HWF2 2QZ3A 2WNEA 3VBUB 4BXFA 3TBDA 5K9YA 4GJZA 1X7NA 3AZYA 4QGMA 1XNAA 1HB2A 1LOFA 1G86A 3FL7A 3ELNA 1S4CA 3P5BA 4Y1UA 5FFOC 2Y0OA 4N43C 4U2AA 1FI2A 1HRV3 2D7FA 3ZFEA 2DVFA 3MV01 3SMHA 1W8FA 1IQDC 4XUOA 2GH2A 4QMAA 4W8JA 2AEZA 4H3WA 2J1UA 4RHV3 1CZVA 1RMU1 3AMPA 1DYOA 5FLHA 5T5LA 3BU0A 3BUCA 2G19A 3NJYA 2ZHMA 4WZCA 4XYXA 1MPXA 1RUG1 2ZGSA 4R9DA 3BIEA 5T54A 2JICA 5JR7B 5F3IA 1XYNA 2DDUA 2ARCA 3I2IA 2MHFA 1O8SA 4XF1A 3VL9A 4Z1VA 3V56A 3WOGA 2D40A 4GB33 1Z78A 4ATFA 3ES4A 3FBYA 4A44A 3T0DA 1F9KA 1D2QA 3VBFC 1QWRA 2C9KA 1REEA 3I2OA 1W6PB 3MIEA 3AMMA 3MLJA 1UY2A 2YFUA 2BWAA 3KD4A 5DAXA 5C3SA 4XC9A 4XBLA 1QOSA 4QHOA 1QKQA 2R30A 5FYUA 1IS5A 2WNOA 5BNPA 4CXWA 1UMHA 2VQTA 2XWBB 4U36A 5LY1A 1IPSA 3AC0A 4JV4A 4IGPA 3LA7A 4IE5A 4C8DA 5FXXA 1Y9QA 5CFDA 3MFAA 5FY0A 1LTEA 2PHTA 4LK6A 1PMIA 2WSUA 5H9RA 1CN1A 1ZBE1 2X05A 3E1F1 3ZIWA 3BVCA 3WZ1A 4DXZA 4ATEA 3VGIA 2EXIA 1QH7A 4TLGA 3VN4A 1X8EA 4CDXC 4NPRA 4HZFA 1IS4A 2VBPA 3WW4A 1XU2A 3LDRA 3THCA 4CTEA 5KHIA 5FPZA 1LNSA 1OD3A 1PMJX 1WCDJ 2LROA 1ZZ7A 2VVDA 2C4XA 2QKDA 4XW3A 4ZONA 4UI9L 1QXPA 3LCPA 1VBB3 3DXTA 4O61A 4Q0QA 3RMXA 1H1AA 5FZAA 2B5HA 4IEPA 4AVSA 4NHMA 1ZBA3 4RN5A 4R4XA 4UBHA 3T2PA 4BQ4A 4IETA 5FPBA 5FO9B 1UY3A 1ND2A 1CJDA 4Y33A 4IEYA 3RZGA 4MVTA 3WF1A 3V0BA 3LOBA 2VCMA 3WHTA 5FYHA 4BQYA 5K0UA 1UMZA 1LOEA 4K6BA 1GQHA 1EPWA 1OBNA 3RZLA 1VBB1 3CZJA 1JUHA 3SEEA 3VDDA 3INAA 4JC1A 4MUVA 3ZYJB 4CA9A 1DHKB 4RFRB 3T1MA 1ZBA1 4LBOA 5FZEA 1VRBA 4IV1C 4CCMA 5JSPA 3M3IA 1N1YA 1CAUA 3AXEA 3OTFA 5FUNA 5IVBA 4Q4X2 3SLIA 4GJYA 1XNKA 5CBLA 4Y1VA 3AKRA 1X36A 3AMNA 2HWC2 5JOXA 2ET1A 5FTTC 3AYCA 1LOCA 4KH9A 4PIXA 2CHHA 3OGJA 5IFPA 3EMRA 5F3GA 1XYOA 4JCKA 3B01A 3LQCA 2JD4A 1SQ4A 1TNFA 5K0UB 2X53S 2Y6GA 1VBD2 1DQ2A 2NLRA 1PGL2 1W8WA 3GZAA 2Y8KA 5K8SA 2LRPA 4JHTA 1WZXA 1OMIA 1GZWA 5A7WA 1K45A 1QY4A 2JG9A 3EHKA 3GBGA 4QB2A 4YW1A 1IG0A 4LBLA 4SLIA 1SLIA 2F4LA 4XFCA 4AVCA 4CE8A 4E2GA 5M0TA 3BKZA 2XVKA 3VDBA 4W6WA 1CAUB 2I07B 1FPN2 1G8WA 2J22A 1AJKA 5FY5A 1W6MA 2VZ3A 1BMV1 4QHZA 3ZR5A 1C8M1 2WAAA 4B7EA 3SCHA 3AKPA 2FBEA 1XSRA 4D94A 4W4ZA 3UK9A 3B00A 3ASIA 5GLTA 3ZFFC 2VZTA 1BEV1 3WNLA 1F35A 5DAQA 3T09A 1ASJ1 2DWRA 2HWC3 3B94A 2WNUC 5C4WC 2DU0A 2AACA 4MGZE 2QQPA 5L36A 2YG0A 1SEFA 4PDWA 3QBQA 4B7KA 1XYPA 4TZDA 2VW2A 1DYKA 1GP6A 1XJAA 1PK6B 3PUQA 4FAHA 4D0QA 5A7WB 4FFHA 5DDJ1 5FUPA 2Q1ZB 4R9CA 1UU5A 2WZ8A 1DQ5A 1RJ7A 4JQRA 5T5OA 4AXOA 3NAPB 4CU6A 2WZR3 5A33A 1KS5A 2VL4A 1OT5A 3GNEA 3C7GA 4I30A 4L97A 4RL7A 2KXLA 5FYZA 3UKTA 4XF9A 4FPOB 1ZX5A 1PVC1 3O14A 4QKFA 2GP3A 3O0WA 3ZSMA 2HWE3 1RIRA 3KCCA 1NAEA 2YHJA 1H8TA 4I3PA 1UYPA 3KGZA 4BE3A 5A3UA 2ZGOA 1AUYA 5GALA 2ORZA 5DUWA 1Z0HA 4XE9A 2UWAA 4NAMA 3LIGA 2UYBA 2P3JA 1V6NA 2WZR1 1DF0A 3QD6A 2JENA 4N7IA 5GJ6A 2VZUA 3N7LA 5IATA 4RQPA 2E32A 1O3TA 4AAPA 4FPLA 1RUF3 2HWE1 1ULGA 2D3SA 3HWJA 3BN6A 5A33B 3CNAA 4XABA 4D7SA 3ACGA 3WCRA 4HANA 4QU1A 2VW0A 4Y26A 5CISA 1I3HA 2CAVA 5EIYB 2WQ4A 4WVZA 4GXLA 3U75A 1H8TB 2ES3A 1VMFA 2XGXA 3IN9A 4EN8B 2XVGA 1VAKA 2VZQA 5FJKA 1NOVA 4QQ2A 5FZKA 5I0UA 2CY6A 1RUF1 2V72A 4HKLA 4PF5A 3BGAA 5C71A 4OZXA 1VB4A 3MYXA 1W0NA 2RM21 4GWMA 1DLLA 2R6QA 2HYXA 3K3OA 4LK7A 5F5AA 2W08A 2WO3A 3Q9OA 2C1FA 5ANQA 3O1RA 5GKAC 2VPVA 4D3WA 1VBE3 3N35A 3VKFC 1H8VA 3BTAA 3WXPA 1AL22 2WS91 2ZX3A 3IM0A 3WHUA 2PHDA 2Q8EA 5C3OA 3FE5A 3KT4A 1XPWA 3OYWA 1COV2 1E5IA 4ZU5A 2RS33 1FV3A 4L2NA 1WBLA 3PVEA 2FDJA 4GA9A 4L99A 1C5IA 2YU2A 1ENXA 2DUPA 1WBFA 1REDA 1BCXA 4CDUC 4C1XA 5FZIA 4QXBA 4EN7B 2OQ7A 4IV3C 4ZHNA 2QQJA 4M3CF 3Q8BA 2HEWF 3WG2A 3QCWA 1QQP3 1VBE1 5A1LA 3S5QA 4LQRA 4XXPA 4AI9A 5FMOL 4E8CA 1Q56A 2B46X 4AFCA 3GHNA 2TBVA 2FCVA 2P34A 1NUKA 2OZ6A 5F2WA 2XDVA 2Q4SA 3P6BA 4B4QA 1R1ZA 1UOBA 4HLTA 1VAMA 2RS31 2YMZA 3LA2A 2PLV1 4DUXA 4LBQD 1YQCA 4YW7A 1QEXA 1UIKA 1O4TA 1T6GC 1NA1A 3R6SA 1RHI2 4Y5Z0 4KWLA 1NXD1 1V6KA 4A2UA 4M0HA 1QQP1 1RINA 4IL7A 2D5HA 4KI5M 2VZPA 3N9QA 4W6XA 2VOXA 3H0OA 4LLOA 2DV9A 1LENA 2DBIA 4CDWC 4XDOA 2XLFA 2WO7A 4YW6A 3KV6A 4K7JA 1ULEA 2RS12 4M4PA 5LBCA 1KXGA 5J36A 2JECA 4PF1A 5E8AA 1HRI2 4AHZA 5I0RA 1RUC3 5A6QA 1RXGA 2XHNA 3AL5A 2XQXA 3GF6A 1TNRA 3VBOC 1SZBA 1PMHX 4BQ1A 2B4KA 1Y9MA 2IXIA 2R062 3GALA 1DGWA 4XEZA 2XONA 2BP6A 4P9LA 2W1SA 3FUOA 4L9BA 1NA1B 5CKMA 2WL1A 1E57A 4NAOA 4HSJA 3ZYIB 5FV3A 2QBXA 3FZ3A 3JD72 1HB1A 3KV4A 1ALYA 4AI1A 4B4PA 5HBAA 2JDKA 3HIFA 4YZ1A 1RHI3 1Y7BA 3VHRA 1RUC1 1HJGA 3J8F1 1U5ZA 1SDDB 4Q27A 3TN91 5JI7A 4CP0A 5A3MA 5J7MA 5KXCA 3GXUA 3M4FA 3WQ0A 3K4AA 1TEIA 1G7YA 1BVVA 5HCAA 1Q8PA 3D82A 3NV1A 1HW5A 4M0NA 3RWKX 2NMNA 1W6QA 1GNHA 1RUE2 5CZKA 2WWJA 4ARYA 2NPIA 3ZSEA 2P5BA 2CYFA 5FO7B 3IAPA 4LXLA 5J96B 1J59A 3TNPB 4CXXA 3PIGA 1JZ3A 4O7XA 3E97A 4PIZA 5CFCC 1QDOA 3D6EA 3ES1A 2V4VA 4FOVA 2HH9A 5DXDA 3O0VA 2WT0A 2JDAA 3FFQA 1C1FA 4XJUA 2YBSA 4NHYA 2YGLA 1JHJA 2UWCA 2IC1A 2Z69A 2QQKA 5C8CC 5C5UA 1C5HA 2JIJA 4N7UA 1KFUL 3I2JA 3DKQA 2Y6KA 3DL3A 3MPPG 3MICA 4KG0A 4BCUA 2K0GA 4CCOA 3MLLA 1XE7A 2W87A 4HK8A 4M4RA 4AFDA 4P9JA 3RZMA 1POV1 1W6QB 3IMMA 3FWEA 1R092 1RUH2 2ZBJA 4FPKA 4META 4QPGC 1AYN3 3U07A 2JB8A 4LR4A 3LEMA 4LE4A 1BLZA 4N9HA 1HQWA 5A80A 4EN0A 1BQPA 1RUE3 2PAMA 2ZGMA 4WM7C 4LIVA 5FLJA 5A3NA 3T4VA 2IWGB 2MEV1 1GQGA 3ILRA 4CEWB 2YC0A 2VTFA 1IZ3A 3BOPA 5A7QA 2Z42A 3M3CA 1MVEA 3P3PA 3B93A 4BIOA 4AE2A 1ZZ9A 5EJ1B 2B45X 4IDZA 4MHUA 3VD9A 3MW4A 4FFFA 2EIBA 4XIOA 3I49A 4YFZA 3POIA 1AYN1 3HBKA 3JB4C 3KQRA 3OG2A 3PVBB 5FJHA 2JG8B 4CP1A 1WW6A 2LS6A 3A0NA 3NSTA 3SCGA 2JDUA 4TN7A 1MZ6A 3UGGA 2R071 1JN2P 1V9U2 3WW2A 1REFA 2GC0A 4FQZA 1Z7S2 5ABJC 3ZXKA 2PN5A 4OHVA 4PHZA 5I0SA 3KQ4B 2Q8OA 5KC5A 2DCKA 1KD7A 3DYMA 1AR93 2XXZA 3AYDA 4JRLA 2ZPXA 3KSCA 1O5LA 1OLQA 1SLCA 1ODNA 1PGSA 1WD4A 3I3QA 4QX5A 4DO0A 1OKOA 3OGGA 2P4EA 3WG4A 2R043 4FOWA 1W0OA 2BVVA 4Q4W2 4XBNA 2WR9A 2XJTA 3KS7A 4A4AA 2WFF2 1CJPA 2QTWB 3OD0A 4DRVA 1GNYA 2ZGUA 5BNNB 4QDRA 2ZJCA 4LBQA 1KRIA 2BFUS 1GR3A 3J7LA 4LHSA 3WCSA 1YI7A 2DFCA 2W1UA 2JX9A 1B09A 4NPLA 4AYUA 1AR91 4PCRA 5IWFA 1PGW1 3L9JT 2BBAA 2ADEA 4UFJA 4OI4A 3F95A 1EAH1 5KWRA 2R041 3G7DA 1FYUA 4IESA 1YJKA 5TSWA 3OGRA 3IDAA 5FR3A 4LOSA 5T5PA 5A6ZA 1Z7S3 3JU9A 3AK0A 4WM8C 1AR63 3ZXFA 2WRAA 4YGBA 1QJU1 3TYJA 1YEWA 2A3YA 4ZS3A 4AEKA 3B69A 4URTA 1YQ6A 2JE8A 4Q8LA 5E88A 4CYDA 1O3QA 4YZ2A 3ILNA 4UBGA 3JQXA 1RUJ1 2OIIA 2R49A 3MPBA 2R1BA 3H8XA 3RS6A 1ENRA 4NRPA 2WINB 2CDOA 4LBQB 1ENQA 5FZ6A 5JVVA 4Q4W3 4QB1A 4Y5SA 2PTMA 1LB2A 1D4VB 2V73A 3VD5A 1LKNA 1OLRA 2BEOA 4J1XA 4M3CE 5FYSA 1SBFA 1JU3A 2W1WA 3FN9A 2O8OA 1GP5A 4CCCA 1NZIA 3AYAA 1AX0A 1AR61 2BJSA 2H6CA 2YDEA 3J7NA 3NRUA 3P3NA 4J25A 5LASA 3PNAA 1XNBA 1VBA2 4BM8A 4MGTA 4G3YC 2VO5A 2HWD3 2FCTA 4UW6A 3U78A 4NROA 2RMU3 4IEOA 3OBAA 3MZHA 3C8XA 1O3RA 5D8AB 3QH6A 4QGNA 1EUUA 1TME2 2B8MA 1YQ2A 2ARBA 1UXZA 5DAVA 2W1QA 4DY5A 2GNDA 1K5MA 3OGVA 2J7MA 5A7NA 4C91A 5FO8B 1V0AA 3PMEA 1LOFC 1Y9GA 1IS3A 5F39A 5FY8A 1GOFA 1ZRFA 2AENA 2VQUA 1MEC2 1U5IA 1WMDA 3H7JA 5LA1A 3ZFEC 2ZGTA 4DB5A 5BYNA 4FTEA 2SLIA 2HWD1 3LA3A 4Q4V1 2RMU1 2J1SA 5C70A 4HVOA 2EIDA 4BMEA 5JOWA 4LIUA 4KBBA 5BNOB 5ACA3 1UD1A 1W05A 1VRH2 3I2GA 4Y5TA 1RUOA 1RUD3 5FMBA 1W8ZA 4YM2A 1JW6A 5FPXA 2YXSA 1HKDA 2XLAA 4MYEA 1F4HA 1GWMA 1NE6A 4GIQA 4NJ4A 2RJ2A 4P9GA 2W95A 1J84A 1N3QA 3WINE 5HV4A 2DURA 4IE0A 1Y43B 3ZSKA 4CEYC 1VBA3 4K3UA 4X6RB 3HT2A 5JXGA 1K5MB 4B1LA 4FTBA 4Z92B 4W50A 4WVMA 5FYCA 1N1TA 3ECQA 1NT0A 1ZA7A 1SHWB 2WN3A 1TME3 5DG1A 5CB7A 4Y1XA 3KMHA 3RZZA 4ZS2A 2ZMNA 2ZGLA 4RSUA 1QOOA 1RUD1 3MBWA 2FZ1A 2W92A 2CAUA 5FZ1A 4LORA 4JGZA 4M3CA 4FAGA 4ZXEA 2RS53 5BNPC 4CU8A 1ZRDA 2ZA9A 3I3MA 2GNBA 3MO4A 2CSGA 3KT1A 4Q0PA 1CGPA 2GAUA 2WKKA 1RITA 2P3YA 1YJLA 2YPJA 4YFWA 5EQUA 2WA3A 5FUIA 1ODMA 4JGYA 1IKQA 2ZGPA 3SHRA 1YIPA 2WDBA 5CFDC 4IE4A 1AVBA 1UZYA 3SXWA 5G04L 4XUQA 1OOPB 5FZGA 1CR7A 3ITQA 4XZPA 4NMIA 1N3PA 1LHUA 1ZRRA 3AX4A 2ZGRA 5T5JA 1KDKA 1YFUA 4Y4YA 1QU0A 3KZ4C 4XIKA 2RS51 3UJQA 4FCAA 4TLFA 1NCQA 1RMU2 5EWSA 2PHFA 3D0JA 4TWTA 2D98A 4DPNA 1EV11 5A32A 3AVRA 4EROA 1ND3A 1GOHA 1RUG2 1AX1A 2AH2A 1VBC3 3CJIA 2ZAAA 1UZVA 1BBT1 4JTNA 4MX3A 1DGLA 3VZNA 2CTVA 4JGZB 4LITA 2VG9A 1I6XA 2PFWA 5F6KA 4I3GA 1WLCA 2Y6JA 1PIV3 4AEDB 3FHIB 1ND2C 1QJY3 4Y24A 4BOWA 5ISLA 3AZZA 4JDMA 4OVEA 2VW1A 4JQTA 2KD7A 3FFZA 4RYDA 1DQ0A 2BW8A 4MADA 5IVJA 1JMUB 2ATFA 1YHFA 3IIAA 2O0OA 5J48A 2IVJA 5BV6A 5SV8A 3I4IA 2J1AA 4QPWA 4AHYA 5T55A 4CSWA 4YVSA 5LK7B 1HV0A 4K1ZA 4AL9A 3IAQA 3VDDC 1LR5A 1VBC1 3DPRA 5FZ3A 3RJ2X 3S6PA 4KU8A 4DNYA 5I93A 1NY71 4EV0A 3OUJA 5FZBA 1SDWA 1NCQB 4Q5OA 4QXKA 1PIV1 1J58A 1QJY1 2QQIA 1MZEA 2WNVC 2D6LX 2G4IA 3MLKA 5A3OA 3LZZA 4OMCA 2QJVA 2BERA 3HMYA 4PBPA 5A32B 3M8LA 1W6OB 1ND3B 1J83A 1SCSA 1OUSA 4LKSA 5AC93 3CBNA 1RMU3 3FHAA 4LHLA 1LECA 4JTOA 3TEXA 1ZBE2 4RS5A 1JTZX 4K40A 1KS4A 3JXSA 3HNBM 2R32A 2YC4A 4QQOA 3VBSA 4DEQA 5LWBA 3J9SA 4ZY9A 1W6PA 5CKQA 3WVJA 1MQTA 1CESA 1YC61 2JE7A 2G9FA 5FZMA 4YSFA 3H8RA 2RDSA 2QCSB 2WQ8A 3V65A 4AG4A 5BXXA 4YVSB 4BZ4A 1QNWA 3PVOA 3DPRB 1QJEA 2ZKNA 1PM4A 3LD8A 3U37A 2JG9C 5AC91 1A8DA 2RDRA 4MGKE 4YG3A 1K12A 2Q5TA 4RR3A 3CMGA 4NRQA 5JIUA 4ZKTB 3ZFGB 1SMVA 3WP3A 3VD4A 1AX2A 1SLLA 1QHDA 4FFIA 3UT0A 4OHXA 1SLBA 5C5TA 3RDIA 4NPMA 1IQAA 5LBBA 5LK5A 3Q8CA 3O1VA 1YRZA 1UPSA 4KGQA 3WDYA 2A6WA 1UOJA 4Q2FA 4RS5B 3KVAA 4IQPA 1VBB2 4COWA 2VZOA 3VBSB 4BQ3A 2A73B 1N47A 4CP2A 1GNZA 1STMA 1CX4A 1MQTB 4Q1RA 4BPZA 1LJ7A 1ZBA2 1ZBE3 2I45A 2VBDA 1WCUA 4PDWC 3ZXLA 4DUVA 2RR11 4H7LA 3WLUA 2JDNA 1NLQA 2XJSA 3HQRA 5FYVA 4ES9A 2XUMA 3M3QA 1AR73 4EQVA 1H6YA 1MZ5A 2NMOA 2VC9A 3K4DA 3TB0A 3WP5A 2VM9A 4O9GA 4B8EA 4EWDA 5JOZA 5LA0A 4RR3B 4IUGA 5FXVA 4TTGA 5GZEA 3WDTA 4L0PA 5FOBB 1N1VA 1XE8A 5T3NA 3H42B 1PO23 4XFBA 3VLBB 3WG3A 1HV1A 5F3CA 1WW7A 3AMHA 5C3PA 4Q0SA 4RGGA 4DEVA 4MXWB 4PIYA 2Q8DA 2LALA 2AUYA 3WDUA 3LB9A 2CGNA 4DMIA 1PX4A 2VJXA 5EPAA 1AR71 2JWPA 3PTYA 3OUHA 5DUVA 1H8TC 1VJ2A 1UW8A 2CNAA 3E6CC 4XFIA 3N3HA 2QQMA 1UX7A 4E8DA 1NG0A 2XJPA 5JR2A 2Y0IA 3HQXA 1PO21 2DCTA 4B1MA 5A7SA 1J3QA 4IERA 4GMP1 1BMV2 3NL1A 4AFMA 2O1QA 4BA6A 1C8M2 1LGCA 3I2HA 4XPVA 1OPOA 4RQPC 5FPUA 1FNYA 1KJRA 3EJKA 1BEV2 2Q1FA 2JEMA 1JH5A 1LULA 4CP9A 1ASJ2 2IXJA 5FY4A 3A4UA 3QH7A 4W65A 2H6BA 3WV6A 2PYTA 3JUUA 4FOQA 2D3PA 4PI2A 5E6HA 4JZRA 4KGGA 2VCAA 5DZEA 3HVDA 2P6HA 3CJXA 5DDJ2 1UL9A 4A42A 4H55A 4HSLA 1HB3A 2QE3A 2E33A 3E5XA 4CDQA 4GH4C 3A7QA 3BTXA 3BCWA 4TXWA 2OUHA 2E7QA 5IYYA 1OF3A 1OD5A 1YFYA 4WVWA 2DUOA 3O0XA 3CHXA 3PIJA 3NKTA 3TEWA 4K9SA 1OXCA 4JKLA 1G9FA 3IWZA 3TEZA 4URAA 2JD9A 3ZSJA 1PVC2 3WNMA 1QOTA 2JB4A 1C8M3 3IT8A 4FP3A 4M01A 4OMDA 5DUXA 3WP4A 2ARAA 2BRTA 2A75A 2DVDA 3RYPA 4BHPA 2FZ2A 3K77A 3UV9A 5T52A 2A6VA 1BEV3 1PK6A 1FNZA 1ASJ3 2W9XA 3NJVA 1YI9A 4XURA 1UY4A 4BU2A 3RGBA 4DFSA 3T08A 3KV5A 1VALA 4I02A 2EICA 2WZR2 5IVEA 1A34A 3MHZA 5JZGA 2A6XA 3GBFA 1XC6A 1OLME 1QXRA 3ZM8A 1O91A 1POV0 3NAPA 4LO5B 2D6NA 2NN8A 1X82A 3ATGA 3VBHC 2X29A 1UOFA 3J7HA 1WLDA 2KR2A 4CDQB 3IIIA 2A7AA 3NKGA 5GZFA 1NQJA 3OD4A 4CP9B 2HWE2 1MS3A 5DDJ3 1NKGA 1WMFA 1XSQA 4PT6A 1DU3D 2P17A 4FXGB 1Q3EA 2HKXA 4N43A 1X33A 3HNYM 4D8MA 1RUI3 2YY1A 4CVUA 4Y1ZA 2Q0AA 5L7OB 3HN3A 1XU1A 1OUXA 3N9OA 4Q0UA 4Q4Y3 4BLIA 2XL7A 2EF6A 1AYM3 1J1TA 1H6XA 4QDQA 4FTSA 2VMIA 2E6VA 1WLTA 5EJ3A 1PVC3 5JMCA 1RUF2 2YBPA 1YIFA 3TWIA 4CUBA 3M2MA 1ZZ6A 2AEYA 5C9AB 2RM22 3MIBA 2R0HA 3EO6A 2I2SA 2ARXA 1RUI1 3LAGA 4P00B 5CIRA 5JZGB 4NIDA 5GLWA 4AEJA 3VBFA 3HNMA 3WF3A 4XDPA 1XXNA 1YQ8A 1CPNA 4P5YA 4X8PA 4N43B 4Q4Y1 3HN1A 4CXYA 2WS92 5F5CA 1AYM1 2Y33A 2L9LA 4S2HA 3ZLIA 4MG2A 4MGYE 3UESA 1NX9A 2V4AA 4NWVA 3N7MA 3GJBA 3T0AA 4AI3A 1G9CA 2Y60A 3RWNA 4ZXKA 3BI3A 3DV8A 2ZEYA 1IPJA 3H1MA 1FXZA 2NYYA 1TG7A 3APBA 1UX6A 4RGKA 3W21A 4NR1A 5IT6A 1O8PA 3W5NA 3WNKA 1LGNA 5KHHA 3WSOA 1F31A 1S0IA 2EAAA 2WJSA 1W9WA 2VMEA 2Q8CA 1NCRC 1VBE2 2W3JA 1OLMA 5GZGA 4Y4RA 1W90A 3POEA 1H2NA 4IW3A 4CDXA 1VAVA 3E6DA 2HBTA 3AZWA 1UY1A 2BUKA 1V70A 3I3BA 3VBFB 5D1IA 4E2QA 2VU9A 2XB6C 3WG1A 1PO11 2RM23 1NYWA 4ISRA 4E9KA 1D0HA 2RS32 2WWUA 3WNNA 4C1WA 2PLV2 2E31A 5JOYA 2CV6A 1GOGA 3CLPA 4XFAA 4DINB 1JS9A 4MLOA 3JCIA 3FC0A 4GD4A 3LE0A 5C3RA 3TOJA 3DKWA 4LJHA 4R9BA 4NIHA 2VQAA 1QJX3 2Y34A 1QQP2 4OQ9A 3V0AA 4LE3A 2WS93 2OKXA 5FCCA 1E5SA 1UIJA 5C6CA 4QPYA 1WGPA 2CL2A 1CQ9A 1WA6X 1HDKA 5FMOS 3AP6A 3O1UA 5LA2A 3VKOA 5JSRA 1JYNA 4HT1T 3FMGA 4CCEA 5FQ0A 1DZTA 2B7YA 5ANNA 2PHUA 4CCJA 5F3EA 1JBCA 2ZXQA 1MS5A 4XJWA 4CDXB 1W06A 4JKKA 2E7AA 5L9VA 1UKGA 1LHOA 2VTXA 1HN0A 1ENSA 1GICA 1QJX1 5CADA 1CPMA 1AXKA 2PQQA 4IV1A 1JXNA 4GKXA 3DYOA 5DZGA 4B4RA 3LPGA 2P3IA 1K3IA 1O7FA 3ALQA 3AP9A 5GM0A 3AL6A 1UCXA 1BZWA 4QX8A 4YW4A 3GJAA 3SCFA 5F1RA 3O1TA 3WW1A 1SG3A 2ZX1A 4IE6A 4L92A 4NVPA 1O5UA 4NHKA 1JYVA 1CAWA 2VOWA 2PLV3 4K8RB 3V0AB 2YUEA 2HBUA 5J37A 4CCKA 3LKJA 1VPHA 1VLNA 3AKQA 1RUC2 2OUJA 3J8F2 3B3QE 5FY7A 3TN92 4BXSV 5A6XA 1ZA4A 1GZTA 3AZXA 4UW4A 1OFSA 5FQ0B 4C90A 3AXDA 5FP3A 1EP0A 3O5SA 4MZUA 1DQ6A 4G9SB 1MS8A 2AREA 4P14A 3MV11 2OVUA 4ET7A 1GQPA 4IV1B 1W9YA 4Q1PA 4BK5A 5J09A 2WUHA 1FOD1 3KWVA 3AFKA 1OA2A 3LSEA 1LEMA 1G9AA 3L2YA 4E4HA 2VULA 1BXHA 3PU8A 1CAWB 2CGOA 3JZVA 3ZFFA 3SQOA 2ID4A 4AHWA 3U0ZA 4QXCA 5IAXA 2XL9A 2BTVC 2WNUA 5C4WA 3AJYA 2BZDA 1PVXA 1LCLA 4YPJA 5CKNA 4WZFA 3ZN5A 2QNKA 3FLPA 4NIAA 4AVAA 1JZ4A 1O4YA 3J8F3 4HK9A 3TN93 5JMOA 1PZ7A 1WD3A 2X5IC 2WABA 4A3ZA 2JIGA 2XKOA 1PNGA 3ROUA 1WKYA 5FZHA 3VBRC 1GYKA 3POBA 2ZKLA 4Q29A 3KM5A 5FZ0A 4EE2A 3SH3A 2HWB1 5F32A 1DP0A 3ACHA 1F15A 4AI0A 1UMIA 3TRSB 1LODA 3TNQA 2X10A 3BPSA 2RDNA 3BYWA 2W46A 2BU9A 2C0ZA 2WYFA 4I2OA 1GWLA 4GWNA 3WF0A 4YW5A 4MH0E 1QF3A 4XQWA 1GFF2 4XJAA 3SH4A 1LOAA 3ZFFB 2VMHA 3ZMNA 4D6SA 1OA3A 3PUIA 1AYN2 3SKJE 3ZVXA 2WNUB 5C4WB 5GLZA 3W20A 3KHBA 2Z5WA 3MFCA 5FP7A 4OHZA 4YWAA 2P6CA 5HXVA 2EIEA 2VQ0A 5GLUA 3K2OA 4R9AA 3KHCA 5IVVA 3CIHA 5FOJB 2QDRA 3GM8A 3KB5A 4UW3A 4A41A 2DBNA 3HJRA 2PA7A 1POV3 2D97A 3CQOA 1O59A 1JU4A 2BNNA 4FXKB 4XUPA 5IW0A 1L3JA 3IMNA 3Q8EA 2RHPA 5AVAA 3VHOA 4F83A 2BQPA 4QX2A 2FDKA 2VUCA 3E5QA 3LIHA 2A3XA 1S0JA 4XDQA 1D4M1 1YFWA 3A22A 4JAAA 3LDBA 2RDQA 1HJFA 1JHNA 2E26A 3DF0A 1UF2C 2MEV3 2GC3A 2Z4FA 3IDEA 2XBO3 4D7TA 3NJZA 2VTXJ 4AI8A 2JG8A 3SISA 3W5MA 3U14A 1OH4A 4UOJA 1WMEA 3M1HA 4LO7A 3OBRA 1AR92 4DUWA 1YNAA 1PGW2 4EWAA 3KCXA 1GWKA 4FPYA 2VE1A 1EAH2 2VNRA 4ONUA 2R042 3FLRA 5FZ8A 2PXJA 1ULPA 1S1AA 5A6YA 3GCXA 4JVAA 2HJIA 2OS2A 2R073 3PUAA 2CWSA 2XBO1 3AP5A 1OC1A 3NNJA 4H7MA 4I0AA 4QAWA 3RFRA 1EPZA 4QDSA 1B35A 4E4DX 1UU6A 4YM0A 2XJVA 3NNLA 4HBNA 5JUVA 1QJU2 4E4SA 4FBFA 1XOYA 4BMBA 3T3YA 1AR83 3T0BA 1SBEA 3C3VA 2ENRA 5BNNA 1RUJ2 1BYHA 3GZTB 3I2KA 1OVPA 2HEYF 3BTYA 1CD3G 1FMD3 2DFBA 2UYAA 3RI8A 2BOIA 4N53C 4X8NA 1RVF3 2XWJB 2UURA 3N4MA 4GAZA 3WF2A 4CDUA 4DY3A 5A3PA 4K8FA 4A6SA 4QQLA 3S7EA 1W2NA 2HEVF 1LU2A 2D3RA 2K46A 1W0PA 1I9RA 4H14A 4O9EA 3PUSA 5EYYA 5HV0A 2NM1A 1AR62 4GULA 4BH9A 1AR81 3OY8A 4MXVA 1LGBA 1OSGA 5LA9A 4CCDA 1L7LA 4JRAA 3LPFA 5KHGA 1B35B 3RZJA 1EAH3 4IEQA 4AF9A 5K7PA 1FMD1 2O8QA 4MOAA 4OYUA 4JGYC 5L73A 4V1PA 5I8SA 1RVF1 1H9PA 5CEHA 5IK7A 3NO8A 3JBG3 1SLAA 2PHLA 1QJU3 1MS4A 3M3OA 3R0RA 4INDA 2VVFA 5FXWA 3UETA 3VBUA 2P37A 2VVEA 2YGMA 1XQNA 2HWD2 2J1EA 4Q4V2 4QWNA 2XOMA 2RMU2 4AGVA 5FWJA 1RUJ3 4CDUB 5DUUA 4OHWA 2GU9A 2BVBA 3AZVA 3E6BA 1YQ5A 4IV3B 4CDWA 5A1AA 2ZZQA 5FYYA 1W8HA 1LOGA 3SNMA 1BKZA 3CJIC 5AFBA 3THTA 3ZYGA 1QH6A 3OY8B 2Y6HA 5D8AA 2X8KA 2D6MA 4M00A 3JBG1 4LA3A 1JYCA 1EY2A 1IS6A 3IZOA 1Y4WA 4K1YA 1W8TA 1HXS1 1SPPB 2VNGA 5D21A 3H3LA 3Q8FA 4GMP0 1JI6A 4IEWA 2BGPA 3H50A 5IVFA 3OPZA 1R1A3 4PLMA 3TEYA 4CPBD 2BDRA 2YV8A 3RI9A 4AQTA 3ZIXA 5DAPA 4Q8KA 4NRMA 4RFT0 4P02B 5FK8A 1RUD2 3D8CA 4C0BA 4JDOA 2ZGQA 2BNMA 4KWUA 2A71A 3IBMA 2VH9A 3CU7A 2WZPP 3KF5A 3H9AA 5FZCA 1A6CA 1YO8A 2P3KA 3HBZA 1FX5A 4CDWB 4FPFA 2DF7A 4AAXA 1UWWA 4Q4V3 1UNBA 1CIWA 2WZEA 3THDA 1GZCA 3WUDA 4BQWA 1TE1B 4LBJA 1UPIA 1R1A1 5K4LA 3ZDVA 1W2TA 2W39A 2VOTA 5FYIA 3VBOB 1H4HA 2D93A 1DZQA 2OT7A 4XJ8A 4XQ4A 2ZHLA 2RS52 4EZHA 5CFCA 2JDPA 3D5OA 2IUWA 4Z82A 3HQUA 1PZ9A 5FZDA 4FPEA 2E53A 4QPIA 2DCYA 4AR2A 1EV12 2AR6A 2VUDA 3KVBA 5H9PA 3O1SA 2J1VA 1BBT2 1VP6A 2R0FA 3I59B 4NIGA 5FP4A 4FQ4A 1S2KA 4UF0A 1VB2A 1XNDA 5LATA 2AYHA 1WW4A 1W03A 4FOYA 1UAIA 2WIIB 4XHXA 3ZX7A 5I8YA 5F8PA 4LO4B 4S2DA 4OI2A 1F2NA 1W3VA 1W04A 2DU1A 4WBBA 2PAEA 1OOPA 3AKSA 5LY2A 4BQ5A 2PMWB 5FP9A 4Y20B 3UYJA 5LB6A 4IXLA 1HQNA 1VBC2 4DRRA 2EA7A 1NY72 4WM7A 3KF3A 3S30A 5CFCB 1G9BA 3ME2A 1CZSA 4G4FA 1XB9A 1PIV2 1Q8SA 1QJY2 4BIFA 1TMF3 1W9FA 5A70A 4QPIB 1VIWB 2VMGA 4MGSA 2W91A 1MZFA 3MF6A 5EP9A 4UW5A 3BODA 5FY1A 5A7OA 1W8OA 3UL2A 2YB7A 3ON7A 3AKTA 4AEDA 4EWEA 5C8CB 1O3SA 1IGOA 1R081 5DN2A 3RG0A 1NLRA 3MIFA 4UF0B 1EV13 4XJ9A 4QX0A 2KA3A 1OVSA 1SFNA 5A7PA 1AF9A 1BBT3 4Z2WA 3MW2A 3WY6A 4OI0A 5JAXA 4JX0A 1QJZA 1G6NA 3I7DA 3BALA 3NJXA 5LCWL 1TMF1 2YROA 4XF0A 4QPGB 4AVVA 1S0EA 2QQWA 5L9BA 1BJQA 5H9QA 1SBDA 1LHNA 4RD7A 1KEXA 3GCWA 4R8HA 4NIIA 3T2QA 4WVVA 5AC92 1WCQA 3WDXA 3AYEA 4WM7B 4IE7A 1CIYA 4E2SA 1W6OA 2XPJA 3OEAA 3ZXJA 4CU9A 4XCBA 3SH5A 5IAVA 4YGDA 3POJA 4HONA 3F2ZA 3ZXEA 3OB8A 2FHRA 3OSDA 2UWBA 1HIXA 3AB0A 3M70A 1UYZA 4KBZA 4QT6A 2IXCA 3BTZA 2VUAA 2ZZJA 5LRRA 3GYDA 5FYTA 2RJLA 4YVWA 5K0UC 2YPDA 3FBMA 3ZPYA 1X9PA 1H2LA 1ZNPA 4COZA 3FUQA 3PHMA 2ZABA 3LWCA 5ABJB 2ZMLA 1GV9A 1Q8VA 2RR12 3NWKA 3ST7A 4PJYA 4HKWA 3ACLA 3BOWA 2ZX2A 1MACA 3LDKA 1H1MA 2EAKA 1LHWA 3PL0A 4OFGA 5FZ7A 4LO6B 3CDZB 3ZFGA 4CDQC 3WW3A 4YM1A 5FBJA 4A7KA 2NZ9A 3WDWA 5FZ9A 1ZREA 1IG3A 2AZ5A 1Q43A 1VE0A 1XRUA 1KDMA 1Y3TA 4QX7A 2ZHNA 2OYZA 4MSVA 1LAJA 4CPBA 3VKLA 2CGPA 1AR72 4YVWB 1ZZ8A 2OX0A 2PHWA 1AHSA 1RYYA 4DXTA 4GALA 3G6JB 4HXCA 2IXKA 3ZXGA 1W99A 1PK6C 1UU4A 2OXBA 2XR4A 1T6BX 1PX3A 2ZGKA 1PO22 2ET7A 4P5HA 4NO4A 1CAVB 1S2EA 2C24A 2GALA 5T50A 5JZGC 3RRDA 2LTNA 2C26A 2RR13 3NAPC 4ASKA 3AP7A 4D6RA 3LSDA 4AGRA 3GZEA 1VMHA 4GWIA 1UN1A 3J4UH 5A3TA 2VCBA
chains in the Genus database with same CATH topology
5F3CA 3PURA 3UYJA 5A3PA 4E4HA 5FYHA 3PU8A 5FV3A 5IWFA 4IGOA 2Q8DA 2OQ6A 3KV4A 4XDPA 4AAPA 3PUSA 3PDQA 3N9MA 4QXCA 5FPAA 5F5CA 4IGQA 5FPVA 3AVRA 3ZLIA 5FZEA 4EYUA 1VRBA 3OPWA 4QU1A 5FY1A 5A7OA 4CCMA 4DIQA 4LITA 4NUBA 2VD7A 5FUNA 3DXUA 3AVSA 5FZOB 5IVBA 2WWJA 5ISLA 4UF0B 5CEHA 2P5BA 4GJYA 5A7SA 2GP5A 5A7PA 5FJKA 4LXLA 5FZHA 5FP8A 5FZ0A 5FZKA 4BXFA 3PTRB 5IVJA 5LW9A 5F32A 4GJZA 2Q8CA 5FXWA 5FPUA 5FZ6A 5F3GA 4QWNA 4CSWA 3KV9A 4Y4RA 5FZGA 5FWJA 5FYSA 3K3OA 5FY4A 5FZ3A 5F37A 5F5AA 3OPTA 2YBSA 5FYYA 4D6QA 3PU3A 4V2VA 5ANQA 5FZBA 4D6SA 4BISA 2WWUA 5E6HA 3U78A 5A7WA 3NJYA 3N9LA 4GD4A 5FZFA 4HONA 2Q8EA 4CCOA 4QXHA 5F3IA 5FP7A 4CCNA 5F2SA 5KR7A 5A7NA 5FY5A 5FPLA 5FY8A 5F39A 3K2OA 2YU2A 5IVFA 5IVVA 2YBKA 2W2IA 4QXBA 3N9NA 2OQ7A 5FYTA 5FZIA 5A80A 5LWBA 5IW0A 5A3WA 2YPDA 5FZLA 5FWEA 5FZMA 4LIVA 5A3NA 5A1LA 4URAA 4CCJA 4AI9A 5F3EA 5A1FA 5FZCA 5A7QA 5F2WA 4LIUA 5FYMA 3LD8A 2XDVA 3LDBA 5FYUA 5FZ7A 4CUGA 5FY9A 5IVYA 3PUQA 4BU2A 2YU1A 5A7WB 4HOOA 3KV5A 5K4LA 5FJHA 3AL6A 5IVEA 5LY1A 4QX8A 4IGPA 5IVCA 5F5IA 5FUPA 5FBJA 5FYIA 3U4SA 4C8DA 5FXXA 4TN7A 2OT7A 2XUEA 5FZ9A 3N9PA 5FY0A 4CCLA 4QX7A 4Y3OA 3N9QA 5FYCA 4EZHA 4CCKA 3K3NA 5FXZA 3KVAA 5FZ8A 4EZ4A 5FZDA 2PXJA 5FY7A 4XDOA 2OX0A 2OS2A 3PUAA 3KVBA 5FYZA 2XXZA 3KV6A 5FZ1A 5FZ4A 4DO0A 2GP3A 5FP3A 5FZOA 5FP4A 3N9OA 5FYVA 4UF0A 3DXTA 5FZAA 3AL5A 4V2WA 3ZPOA 3RVHA 4ASKA 5FPBA 2YBPA 4D6RA 5FXVA 5LY2A 5FYBA 4Y33A 5FP9A 2XMLA 5A3TA 4GAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F3C A;  3PUR A;  3UYJ A;  5A3P A;  4E4H A;  5FYH A;  3PU8 A;  5FV3 A;  5IWF A;  4IGO A;  2Q8D A;  2OQ6 A;  3KV4 A;  4XDP A;  4AAP A;  3PUS A;  3PDQ A;  3N9M A;  4QXC A;  5FPA A;  5F5C A;  4IGQ A;  5FPV A;  3AVR A;  3ZLI A;  5FZE A;  4EYU A;  1VRB A;  3OPW A;  4QU1 A;  5FY1 A;  5A7O A;  4CCM A;  4DIQ A;  4LIT A;  4NUB A;  2VD7 A;  5FUN A;  3DXU A;  3AVS A;  5FZO B;  5IVB A;  2WWJ A;  5ISL A;  4UF0 B;  5CEH A;  2P5B A;  4GJY A;  5A7S A;  2GP5 A;  5A7P A;  5FJK A;  4LXL A;  5FZH A;  5FP8 A;  5FZ0 A;  5FZK A;  4BXF A;  3PTR B;  5IVJ A;  5LW9 A;  5F32 A;  4GJZ A;  2Q8C A;  5FXW A;  5FPU A;  5FZ6 A;  5F3G A;  4QWN A;  4CSW A;  3KV9 A;  4Y4R A;  5FZG A;  5FWJ A;  5FYS A;  3K3O A;  5FY4 A;  5FZ3 A;  5F37 A;  5F5A A;  3OPT A;  2YBS A;  5FYY A;  4D6Q A;  3PU3 A;  4V2V A;  5ANQ A;  5FZB A;  4D6S A;  4BIS A;  2WWU A;  5E6H A;  3U78 A;  5A7W A;  3NJY A;  3N9L A;  4GD4 A;  5FZF A;  4HON A;  2Q8E A;  4CCO A;  4QXH A;  5F3I A;  5FP7 A;  4CCN A;  5F2S A;  5KR7 A;  5A7N A;  5FY5 A;  5FPL A;  5FY8 A;  5F39 A;  3K2O A;  2YU2 A;  5IVF A;  5IVV A;  2YBK A;  2W2I A;  4QXB A;  3N9N A;  2OQ7 A;  5FYT A;  5FZI A;  5A80 A;  5LWB A;  5IW0 A;  5A3W A;  2YPD A;  5FZL A;  5FWE A;  5FZM A;  4LIV A;  5A3N A;  5A1L A;  4URA A;  4CCJ A;  4AI9 A;  5F3E A;  5A1F A;  5FZC A;  5A7Q A;  5F2W A;  4LIU A;  5FYM A;  3LD8 A;  2XDV A;  3LDB A;  5FYU A;  5FZ7 A;  4CUG A;  5FY9 A;  5IVY A;  3PUQ A;  4BU2 A;  2YU1 A;  5A7W B;  4HOO A;  3KV5 A;  5K4L A;  5FJH A;  3AL6 A;  5IVE A;  5LY1 A;  4QX8 A;  4IGP A;  5IVC A;  5F5I A;  5FUP A;  5FBJ A;  5FYI A;  3U4S A;  4C8D A;  5FXX A;  4TN7 A;  2OT7 A;  2XUE A;  5FZ9 A;  3N9P A;  5FY0 A;  4CCL A;  4QX7 A;  4Y3O A;  3N9Q A;  5FYC A;  4EZH A;  4CCK A;  3K3N A;  5FXZ A;  3KVA A;  5FZ8 A;  4EZ4 A;  5FZD A;  2PXJ A;  5FY7 A;  4XDO A;  2OX0 A;  2OS2 A;  3PUA A;  3KVB A;  5FYZ A;  2XXZ A;  3KV6 A;  5FZ1 A;  5FZ4 A;  4DO0 A;  2GP3 A;  5FP3 A;  5FZO A;  5FP4 A;  3N9O A;  5FYV A;  4UF0 A;  3DXT A;  5FZA A;  3AL5 A;  4V2W A;  3ZPO A;  3RVH A;  4ASK A;  5FPB A;  2YBP A;  4D6R A;  5FXV A;  5LY2 A;  5FYB A;  4Y33 A;  5FP9 A;  2XML A;  5A3T A;  4GAZ A; 
#chains in the Genus database with same CATH topology
 4MXW A;  2GC2 A;  5FKC A;  4MHR A;  5KXE A;  3UGF A;  1W9S A;  1S0C A;  2JKB A;  3VDA A;  3I8T A;  3CKH A;  1YXW A;  2Y26 A;  1N1S A;  4UXA A;  5C7G A;  3ZOI A;  4COY A;  3KCY A;  3X29 B;  4BDV B;  3BU7 A;  5FMC A;  3R4S A;  1OA4 A;  1UOG A;  1YCI A;  3GDB A;  3NV2 A;  3POF A;  2V09 A;  2FDH A;  4N8M A;  4NUB A;  2Q1M A;  4A6O A;  5FRA A;  2ZHK A;  1GP4 A;  4ORF A;  5DPN A;  3NVC A;  1QNY A;  2GSY A;  4QX3 A;  4CUC A;  2OA2 A;  2PHX A;  2NQY A;  1HRV 1;  1ULO A;  3V64 A;  4CEY A;  4JDN A;  1URX A;  2ZMK A;  1OUR A;  2KM2 A;  3R4D B;  5EXO A;  5HXM A;  2ZEZ A;  3VL8 A;  1Q5O A;  2ZOE B;  4NOT A;  1GUI A;  3H8U A;  4RHV 1;  4GMP 3;  3KV9 A;  3J7M A;  4BLJ A;  2IZW A;  2VZ1 A;  1ZZC A;  1OQ1 A;  2HWF 3;  3ZFE B;  5JCT A;  4K21 A;  4V2V A;  1JYX A;  1OHF A;  4XAC A;  2P2K A;  4BIS A;  1HLC A;  3EQE A;  2DTY A;  4PQ9 A;  1RXF A;  1MS1 A;  2VMF A;  1D2S A;  3IKW A;  5JIA A;  2FD8 A;  1FT9 A;  2JE9 A;  4YM3 A;  4GB3 1;  5FZF A;  3I97 A;  4DZG A;  2D5F A;  2FCU A;  2G9G A;  5J3U A;  4LHN A;  4OUS A;  1S0D A;  4HMZ A;  1JOP A;  3CL1 A;  1ZZB A;  1XBF A;  3LEI A;  5JDB A;  5CAZ A;  3QLQ A;  3RQ0 A;  4AVT A;  1DFQ A;  2YBK A;  2HWF 1;  4XZU G;  2W2I A;  1YFX A;  3LFM A;  2RVA A;  3HOB A;  4CEY B;  5A3W A;  2WYS A;  5FZL A;  1QXJ A;  3LGR A;  2BFU L;  1DGR A;  3K51 A;  4L8Q A;  2RV9 A;  1L7Q A;  2WN2 A;  3FX3 A;  2WLP A;  1EUT A;  3P1I A;  1NLS A;  2A1X A;  5H9S A;  1RL3 A;  5B4N A;  2BV4 A;  4LUM A;  2BOJ A;  3LFI A;  1M4W A;  4YRD A;  5BNP B;  3ZYH A;  1CAX A;  3BPZ A;  4DXR A;  4PLN A;  1WCS A;  3LEG A;  2XLG A;  4LOT A;  1RUI 2;  3A21 A;  2VUJ A;  3RZH A;  4UWD A;  5APA A;  3PLQ A;  1YLL A;  3O1O A;  1WMX A;  3N7K A;  1O4Z A;  4Y3O A;  1J3R A;  2WFP A;  3I3E A;  1C8N A;  3K48 A;  5FXZ A;  2Y64 A;  5CFD B;  5JI9 A;  3OEB A;  3WUC A;  4Q4Y 2;  4B29 A;  4LBM A;  4QM8 A;  1AYM 2;  3C7O A;  5L7O A;  3ZN4 A;  2EIG A;  1NQD A;  1OFN A;  4NHX A;  4XUN A;  5JXJ A;  2EVX A;  1US3 A;  5FZO A;  2WNV A;  2UU8 A;  3VZM A;  3T2O A;  3WP6 A;  1AXZ A;  2D6P A;  1D0G A;  3POG A;  4EN6 B;  4XTM A;  5C3Q A;  5C9A A;  2XHK A;  3THP A;  4ZPI A;  4TSV A;  2ERF A;  1CAX B;  2JJ6 A;  5F7U A;  4AI2 A;  1ND2 B;  3ZYR A;  3PUH A;  1ST8 A;  1F8V A;  2W68 A;  2OPK A;  1AXY A;  4P9I A;  1F5F A;  2XH6 A;  4AK3 A;  3V0B B;  1R64 A;  4LEJ A;  1LOB A;  2D44 A;  5CA6 A;  1PO1 2;  3ACF A;  2W5F A;  2WSV A;  5AVP A;  2NP0 A;  4AFB A;  4ES8 A;  3ZO0 B;  1WA4 A;  1W8U A;  2N7G A;  1X9T A;  3JB8 A;  4NWW A;  4L11 A;  1BK1 A;  3VDD B;  1I5Z A;  2QVS B;  2X09 A;  4EYU A;  3K4Z A;  1JYI A;  2VAU A;  1IOA A;  2VBB A;  1C57 A;  5HCH A;  5HCF A;  1CWP A;  4OUL A;  1SFY A;  1A3K A;  3AVS A;  4RGA A;  5FZO B;  4Z8B A;  3H3U A;  2WNV B;  4NE9 A;  1NA1 C;  2Y6F A;  3O1M A;  4IEZ A;  5L9R A;  3MUY 1;  1AZD A;  3W58 A;  5GZD A;  5F5Q A;  5IHR A;  2BNO A;  4S2F A;  1PHM A;  2QZ2 A;  3IB3 A;  2BYV E;  4CUA A;  5FAX A;  4D7Y A;  2DVA A;  4Q4X 3;  2W0X A;  4TYS A;  2MNG A;  3DCQ A;  5I0T A;  1ZRC A;  2B9U A;  1OI6 A;  1ONA A;  3ZXA C;  1OPM A;  4A45 A;  5IK5 A;  5HPO A;  2B9V A;  1UZZ A;  3PU3 A;  4XBQ A;  1QJX 2;  1H2M A;  4QHB A;  2Z79 A;  1HN1 A;  1QIQ A;  4MGQ A;  4DQA A;  3I2F A;  1GAN A;  1HB4 A;  1MR5 A;  3N9L A;  4LLF A;  1OQD A;  1GZW B;  4PBO A;  2VR4 A;  1W2U A;  2JG9 B;  1PO1 3;  2YC2 A;  3CZU A;  3AJZ A;  3K75 B;  1VBD 3;  4CCN A;  3E5U A;  3WQ7 A;  3IPV A;  1RB8 G;  2ZEX A;  4Q4X 1;  4BQ2 A;  1CON A;  1DGR N;  2ZX4 A;  2VGD A;  3L2H A;  3GGL A;  4J6G A;  4XAA A;  5JXH A;  5LZ6 A;  2FDI A;  1GU3 A;  1W6M B;  2HWC 1;  3T4H B;  4BWO A;  1W28 A;  5E1R A;  4F3J A;  4NN0 A;  3UKV A;  5LEJ A;  3VHN A;  5FBZ A;  1ZVF A;  1H1I A;  1FPN 3;  3D3A A;  3FLT A;  3WT3 A;  4CEW A;  3EBR A;  2XG3 A;  4A7Z A;  4O65 A;  5A1F A;  1TVG A;  3O12 A;  5I8T A;  3D4K A;  1QJF A;  2YFZ A;  4XJZ A;  1I1E A;  3S0M A;  1GLH A;  3RYK A;  5FYM A;  2ZTN A;  1KJL A;  4UYB A;  1VBD 1;  4ITC A;  2D6K A;  1ULD A;  2OZJ A;  2WT1 A;  3H7Y A;  4FPH A;  2FDG A;  1BHG A;  2F6B A;  1PGL 1;  4PDW B;  1LED A;  3VZL A;  1FOD 2;  2ORX A;  4HOO A;  1F5J A;  1M06 G;  4XMA A;  1V00 A;  5F5I A;  1APN A;  5C8W A;  2WO1 A;  5AFE A;  1FPN 1;  1JUI A;  3WR0 A;  1S0G A;  4F8A A;  3IPV B;  2EXJ A;  2DVG A;  4LBK A;  3N9P A;  2A5Z A;  1XNT A;  4KU7 A;  2DCJ A;  3POY A;  4XHB A;  5EFU A;  4CCL A;  4CEW C;  3U11 A;  3HR9 A;  1ACC A;  4X6Q B;  5CYY A;  1QMJ A;  3RNS A;  2VZS A;  4YZ3 A;  2ZAH A;  3GBW A;  5FK7 A;  4YYO A;  1AL0 G;  2XVL A;  1I5P A;  1AJO A;  2JDH A;  3ETP A;  1VR3 A;  2BGO A;  4ZU4 A;  4XOG A;  4ARX A;  1IHM A;  1E5R A;  1S0F A;  2E51 A;  4LUK A;  4F7Z A;  3MF9 A;  5HCB A;  2H0B A;  2JG8 C;  3SEP A;  5BNO A;  1JOJ A;  1U0A A;  3ZSL A;  2JKX A;  3I2D A;  1OH3 A;  2GN7 A;  2AC1 A;  3H1W A;  2HWB 2;  2XQR A;  4EJR A;  3U4X A;  3OOX A;  4H2A A;  4GH4 A;  4YG0 A;  4IEV A;  1UO9 A;  4XVH A;  1YWK A;  2W47 A;  4AVB A;  1Q8Q A;  1LHV A;  1DGW X;  3USU A;  4MO3 M;  1BK0 A;  1FOD 3;  3H1Y A;  4OUM A;  3DYP A;  3SIT A;  1FV2 A;  4RQP B;  2IXH A;  2WO2 A;  1B35 C;  4AEM A;  3C7E A;  2O14 A;  1F4A A;  2CU5 A;  5E16 A;  5FKB A;  4OQ8 A;  1UY0 A;  1FAY A;  5BNN C;  1H9W A;  3NNF A;  4GKY A;  4MGI E;  4FPC A;  3VHP A;  1KQR A;  3M7A A;  1W9T A;  4XCA A;  5BNQ A;  4KWJ A;  1LU1 A;  3PTR B;  5BUV A;  1NZC A;  2VOV A;  3VBH A;  2A6Y A;  4YNI A;  3RPQ A;  4AQ2 A;  2RG4 A;  5JWP A;  1PNF A;  2RJK A;  2QQO A;  2ZAC A;  4HPK A;  1X50 A;  4GH4 B;  4LKE A;  4YZ4 A;  3ZKY A;  3VDC A;  4HVR A;  1Q8O A;  2DTW A;  2ZCW A;  5C33 A;  1JZ6 A;  1D4M 2;  2HWB 3;  3A23 A;  3ILF A;  3USU B;  3ZN6 A;  4AQ6 A;  2WWS A;  3DN7 A;  2FQP A;  2GNT A;  3MI8 A;  2RE9 A;  1SFP A;  3NW4 A;  3ACI A;  3SKV A;  4DS0 A;  2GMM A;  3C7H A;  4QB6 A;  3ORJ A;  4PLO A;  1A8M A;  1PM7 A;  5CVR A;  3CEW A;  2OW4 A;  3VKM A;  1JYW A;  4XET A;  1ZYB A;  2CDP A;  4QXH A;  4XTP A;  3W59 A;  4FPJ A;  5F2S A;  3WQ1 A;  3HPN A;  1POQ A;  3MDP A;  1W2A X;  3OYW B;  1AL2 3;  4MV2 A;  3VBU C;  2VCC A;  3DUI A;  2B42 B;  3N9N A;  3AP4 A;  4QKD A;  3VUO A;  1LES A;  2MEV 2;  3BB6 A;  3VBH B;  4CZS A;  5FWE A;  5CU1 A;  2XBO 2;  4OHY A;  4HPK B;  3B9C A;  4OUE A;  1COV 3;  3D0S A;  4XQD A;  5ACA 2;  3NMB A;  2YYO A;  4KWK A;  1CZT A;  3USS A;  2PEL A;  5D8A C;  4XFF A;  4YGE A;  3AFG A;  3ZN6 B;  3WNP A;  1DQ4 A;  4C0H A;  4XFG A;  4UFI A;  5LRS A;  3RZK A;  2UY9 A;  3GHM A;  3DEM A;  1AL2 1;  1V6O A;  2ILM A;  3T1L A;  4P9Y A;  1D4M 3;  1W6N A;  3A0K A;  5IVC A;  1WUV A;  4UAP A;  2LM3 A;  2R07 2;  5I91 A;  2ZS6 B;  2XUE A;  3U10 A;  3KGL A;  1COV 1;  2ETE A;  4FT8 A;  5DMY A;  5D2A A;  3VZO A;  4GWJ A;  3ZYF A;  3K3N A;  1NCR A;  3RSJ A;  4Y22 A;  1DBN A;  1AR8 2;  1SLT A;  2LW8 A;  4I0B A;  3ZYB A;  1UYX A;  4BQX A;  5JLV A;  5BNO C;  5FIX A;  3URF A;  4Q26 A;  4ASL A;  2G9Z A;  5FZ4 A;  1JOD A;  2IXL A;  1UQX A;  2VXJ A;  4XMI A;  2GMP A;  4DXS A;  1FMD 2;  5JPN B;  4IEU A;  1TZO A;  2GH8 A;  2GNM A;  1RVF 2;  1HQL A;  1K42 A;  3NV3 A;  3POS A;  4UFL A;  2XJR A;  1JZ5 A;  1LRH A;  2E9Q A;  5IFT A;  1K5M C;  2RS1 3;  3RVH A;  1H30 A;  1FAT A;  4OI1 A;  4OLL A;  5FYB A;  1W6N B;  3GZU C;  1HRI 3;  2D43 A;  2XML A;  1RHI 1;  2JDZ A;  3AM2 A;  2QUO A;  4AWD A;  3PUR A;  2GME A;  4I01 A;  1D7P M;  2J1R A;  2Y6L A;  4JHZ A;  3VD3 A;  2PAK A;  2FMY A;  4QPI C;  4HVQ A;  5LBE A;  2R06 3;  2YZ4 A;  4KL1 A;  5IUQ A;  1NCR B;  3EYP A;  2BGC A;  3QOP A;  4Y22 B;  3M3E A;  3R4U A;  1DYP A;  1J3P A;  2QFE A;  3W9A A;  1SCR A;  3JBG 2;  3BIW E;  1OF4 A;  3R05 A;  5SV5 A;  4NHL A;  2RS1 1;  3WF4 A;  4AQS A;  3FJS A;  3JD7 3;  4YW2 A;  3VB9 A;  3WNX A;  3EB7 A;  3VZK A;  2VD7 A;  1HXS 2;  1ZRI A;  1HRI 1;  1OOP C;  3UNP A;  2TNF A;  1NXM A;  4AZZ A;  5BPX A;  5IK8 A;  1K5J A;  1ZM1 A;  2VNV A;  1PZ8 A;  2XKP A;  5FP8 A;  2R06 1;  3RMY A;  2QQU A;  1XE0 A;  3ZKU A;  2FDF A;  4HN1 A;  1IKP A;  2EXH A;  4FI9 A;  4KQ7 A;  4WV8 A;  4QKN A;  3H3Z A;  3RYR A;  1W8N A;  4IV3 A;  4HET A;  2WT2 A;  4FPG A;  4GQ7 A;  4R4Z A;  5L19 A;  4KMQ A;  1W39 A;  5F37 A;  4HL0 A;  3UJO A;  3JD7 1;  2WC2 A;  4LTA A;  4D6Q A;  2R1D A;  5F9T A;  4JGZ C;  1T2X A;  1GMM A;  5FMD A;  4AED C;  4HFS A;  1RGS A;  2VZV A;  3LOI A;  4S2G A;  2F4P A;  2K9Z A;  2QDN A;  4FVV A;  1R1A 2;  2WBK A;  3B7M A;  2BPA 2;  2W52 A;  1BVP 1;  4UT5 A;  2R16 A;  1SPP A;  1L7R A;  2C6S A;  1N3O A;  1UZW A;  1U5Y A;  2OPW A;  1RUE 1;  1S0B A;  2VXR A;  3OGS A;  4IEX A;  5FPL A;  3O1P A;  5LBF A;  3H8O A;  4LUL A;  1WW5 A;  2ZEW A;  3ABZ A;  2HYK A;  1VMJ A;  2B39 A;  4LKD A;  3UKN A;  5GZC A;  5KBF A;  4P9X A;  2A6Z A;  5FRE A;  3DEC A;  1HXS 3;  1C3H A;  1C4R A;  1DLC A;  2R7E B;  2EXK A;  3N36 A;  5F6L B;  3OUI A;  1NCQ C;  2ADD A;  3KT7 A;  2ZGN A;  1R09 3;  1RUH 3;  2WAO A;  1YYN A;  2VZR A;  3OJB A;  3VZJ A;  4QQP A;  1O6U A;  1ND3 C;  2GZW A;  2P1B A;  4BYY A;  1H4G A;  1DCS A;  3MUZ 1;  2WLQ A;  1MS0 A;  4Q0V A;  5DQ0 A;  4DOU A;  3ETQ A;  1A78 A;  4KG8 A;  1EYB A;  3WDV A;  3VBO A;  4YLZ A;  5EJZ B;  2X5I A;  3B02 A;  3I3D A;  3T2T A;  5DZF A;  2Y38 A;  3O7O A;  5IJR A;  3VBR A;  1JOB A;  2F17 A;  2VOK A;  4YVW C;  1WLW A;  3SC7 X;  2ZX0 A;  3C2U A;  3VKN A;  1R09 1;  1RUH 1;  3CF6 E;  4SBV A;  5HI0 A;  5IK4 A;  3PVN A;  2CWM A;  4YVS C;  1V6M A;  2EAL A;  3C7F A;  3Q8A A;  4GZ9 A;  3CO2 A;  1MVQ A;  4EZ4 A;  3DPR C;  1YUD A;  4LMF A;  2H0V A;  5EZW A;  4BB3 A;  4AW7 A;  3PJQ A;  1U12 A;  1ULF A;  1KGY A;  3I59 A;  2W94 A;  1V9U 3;  4E27 A;  3HD8 B;  1TQ5 A;  4OZO A;  4XXA A;  2DCZ A;  2GN3 A;  3IDC B;  4Z2A A;  2E63 A;  2V5Y A;  1R08 2;  3ZFG C;  4COV A;  4B3N A;  4XAE A;  3S7I A;  3ZPO A;  5GLV A;  5EV7 A;  4YZ5 A;  2AGS A;  4QU2 A;  3S5A A;  4RS5 C;  2VNO A;  4PI0 A;  4Y20 A;  1JZ2 A;  2UY8 A;  1WWY A;  4N90 A;  5DAW A;  3VBS C;  1TMF 2;  2Z2S B;  2X5I B;  4UFK A;  4Z07 A;  3VBR B;  1MQT C;  3OBT A;  4P9W A;  2WFF 3;  4HG6 B;  4QM9 A;  4D69 A;  1HX6 A;  1GZ9 A;  1V9U 1;  4I0W B;  3PJY A;  4ZZ8 A;  2OQ6 A;  1Z7S 1;  5KXB A;  2IVI B;  3K46 A;  3PDQ A;  1G9D A;  3ZR6 A;  5E89 A;  4ISQ A;  1H2K A;  3N9M A;  4HKO A;  4LBN A;  1RC6 A;  1GKB A;  3NNG A;  2PQS A;  1CX1 A;  4UFH A;  2WQZ C;  5FPV A;  4KNC A;  2K2S A;  2LUW A;  3B5L B;  5EYX A;  1DDL A;  5C8C A;  4RR3 C;  4LO8 A;  3WNO A;  4ZZ5 A;  2QQL A;  4E4Z A;  1JYT A;  4FO9 A;  4Q4W 1;  5DAB A;  2WFF 1;  5FLI A;  5LW9 A;  4LT5 A;  1R08 3;  4QPG A;  4FSJ A;  3HT1 A;  1QDC A;  1S55 A;  3RJR A;  4QX1 A;  2MPF A;  4AOC A;  3FHQ A;  1UYY A;  5KHK A;  4FFG A;  3I54 A;  2A70 A;  3OPT A;  1ULC A;  3HAG A;  5BY5 A;  5B4X A;  3VV1 A;  3WEZ A;  1C28 A;  3MIG A;  1P8J A;  1WCK A;  5KHJ A;  2DUQ A;  5EHD A;  4OCT A;  4QKB A;  5CNA A;  2VMC A;  4QQH A;  1KIT A;  2JDM A;  1X8M A;  1XNC A;  2SBA A;  2VEC A;  5ERL A;  1C1L A;  1GSL A;  2TEP A;  4N9I A;  3S57 A;  2A3W A;  3PMS A;  4JKM A;  5KR7 A;  5A3L A;  1H0B A;  1QGL A;  2BBV A;  1U5X A;  1J1L A;  1V6I A;  3NNM A;  5LEK A;  2QQN A;  4N53 A;  1RJ8 A;  2GC1 A;  5FDB A;  3AMQ A;  5G05 L;  5J98 B;  3UGH A;  3ZYP A;  5ABJ A;  5J1X A;  4XF3 A;  5ACA 1;  3OF1 A;  1JZ8 A;  1UKR A;  3MIH A;  3OBZ A;  3MEP A;  4Y1Y A;  2IFW A;  2C5D A;  1DIW A;  2D6O X;  2GDF A;  4LKF A;  1MEC 3;  2DVB A;  2BWC A;  4P08 A;  3LEK A;  4CUG A;  4LPL A;  1VBA 1;  2TUN A;  3VD7 A;  5FY9 A;  4YG6 A;  5JXI A;  4AHX A;  4QD2 A;  4XIL A;  5IVY A;  4XUT A;  2HLE A;  1UXX X;  2YU1 A;  3B9I A;  1US2 A;  4COU A;  2FMD A;  1TME 1;  2PHR A;  1W2O A;  4RA0 A;  3U4S A;  1DG6 A;  5CG8 A;  1VRH 3;  3MGU A;  5B2G B;  3DGT A;  4AFA A;  2G1M A;  5KC6 A;  1NE4 A;  5CG9 A;  5JPM B;  4YAR A;  3WD5 A;  2JDY A;  3WX5 A;  5JSO A;  4N53 B;  1MEC 1;  1DZR A;  4WVM B;  1E5H A;  4PQQ A;  2J1T A;  4XF4 A;  5DG2 A;  1MS9 A;  3KLS A;  5I0D A;  2JXA A;  4XFH A;  4EN9 B;  4LHK A;  1UZ0 A;  3OCP A;  4BJ0 A;  4ASM B;  4CRQ A;  1CAV A;  3IDB B;  4CU7 A;  1IPK A;  4YGC A;  4M3C B;  3MW3 A;  3TAY A;  2J42 A;  3QAC A;  1V6L A;  3J26 N;  1RTV A;  1DQ1 A;  4V2W A;  1VRH 1;  4LNV A;  4WM8 A;  1HRV 2;  4K20 A;  4R52 A;  4AGG A;  2C9A A;  4I09 A;  4JGY B;  2XJU A;  2IFR A;  1GBG A;  5KXD A;  4RHV 2;  3MID A;  4BK4 A;  4YW3 A;  2E7T A;  3NV4 A;  4J1W A;  2DYC A;  4IGO A;  3ZMO A;  5L7O C;  4ZU7 A;  3NQH A;  4QGL A;  1KFX L;  4HN0 A;  2XJQ A;  1CVN A;  3JQW A;  2VY0 A;  2Q30 A;  3N7J A;  4FP2 A;  3ZDS A;  4A7Y A;  4W6Y A;  3U1X A;  3ENR A;  1RUN A;  5FPA A;  4IGQ A;  3T30 A;  3WQB A;  1S2B A;  1V6J A;  2I74 A;  3OPW A;  3HEI A;  3POW A;  4GB3 2;  4LA2 A;  4DIQ A;  1OQE A;  1OKQ A;  2QQV A;  3CJI B;  3DXU A;  3ZXD A;  5C9A C;  2WA4 A;  1JZ7 A;  1SAC A;  2VMD A;  4A3X A;  2GP5 A;  1W3X A;  3EXU A;  2V5D A;  4WM8 B;  3LF7 A;  4UFM A;  1RUG 3;  2HWF 2;  2QZ3 A;  2WNE A;  3VBU B;  4BXF A;  3TBD A;  5K9Y A;  4GJZ A;  1X7N A;  3AZY A;  4QGM A;  1XNA A;  1HB2 A;  1LOF A;  1G86 A;  3FL7 A;  3ELN A;  1S4C A;  3P5B A;  4Y1U A;  5FFO C;  2Y0O A;  4N43 C;  4U2A A;  1FI2 A;  1HRV 3;  2D7F A;  3ZFE A;  2DVF A;  3MV0 1;  3SMH A;  1W8F A;  1IQD C;  4XUO A;  2GH2 A;  4QMA A;  4W8J A;  2AEZ A;  4H3W A;  2J1U A;  4RHV 3;  1CZV A;  1RMU 1;  3AMP A;  1DYO A;  5FLH A;  5T5L A;  3BU0 A;  3BUC A;  2G19 A;  3NJY A;  2ZHM A;  4WZC A;  4XYX A;  1MPX A;  1RUG 1;  2ZGS A;  4R9D A;  3BIE A;  5T54 A;  2JIC A;  5JR7 B;  5F3I A;  1XYN A;  2DDU A;  2ARC A;  3I2I A;  2MHF A;  1O8S A;  4XF1 A;  3VL9 A;  4Z1V A;  3V56 A;  3WOG A;  2D40 A;  4GB3 3;  1Z78 A;  4ATF A;  3ES4 A;  3FBY A;  4A44 A;  3T0D A;  1F9K A;  1D2Q A;  3VBF C;  1QWR A;  2C9K A;  1REE A;  3I2O A;  1W6P B;  3MIE A;  3AMM A;  3MLJ A;  1UY2 A;  2YFU A;  2BWA A;  3KD4 A;  5DAX A;  5C3S A;  4XC9 A;  4XBL A;  1QOS A;  4QHO A;  1QKQ A;  2R30 A;  5FYU A;  1IS5 A;  2WNO A;  5BNP A;  4CXW A;  1UMH A;  2VQT A;  2XWB B;  4U36 A;  5LY1 A;  1IPS A;  3AC0 A;  4JV4 A;  4IGP A;  3LA7 A;  4IE5 A;  4C8D A;  5FXX A;  1Y9Q A;  5CFD A;  3MFA A;  5FY0 A;  1LTE A;  2PHT A;  4LK6 A;  1PMI A;  2WSU A;  5H9R A;  1CN1 A;  1ZBE 1;  2X05 A;  3E1F 1;  3ZIW A;  3BVC A;  3WZ1 A;  4DXZ A;  4ATE A;  3VGI A;  2EXI A;  1QH7 A;  4TLG A;  3VN4 A;  1X8E A;  4CDX C;  4NPR A;  4HZF A;  1IS4 A;  2VBP A;  3WW4 A;  1XU2 A;  3LDR A;  3THC A;  4CTE A;  5KHI A;  5FPZ A;  1LNS A;  1OD3 A;  1PMJ X;  1WCD J;  2LRO A;  1ZZ7 A;  2VVD A;  2C4X A;  2QKD A;  4XW3 A;  4ZON A;  4UI9 L;  1QXP A;  3LCP A;  1VBB 3;  3DXT A;  4O61 A;  4Q0Q A;  3RMX A;  1H1A A;  5FZA A;  2B5H A;  4IEP A;  4AVS A;  4NHM A;  1ZBA 3;  4RN5 A;  4R4X A;  4UBH A;  3T2P A;  4BQ4 A;  4IET A;  5FPB A;  5FO9 B;  1UY3 A;  1ND2 A;  1CJD A;  4Y33 A;  4IEY A;  3RZG A;  4MVT A;  3WF1 A;  3V0B A;  3LOB A;  2VCM A;  3WHT A;  5FYH A;  4BQY A;  5K0U A;  1UMZ A;  1LOE A;  4K6B A;  1GQH A;  1EPW A;  1OBN A;  3RZL A;  1VBB 1;  3CZJ A;  1JUH A;  3SEE A;  3VDD A;  3INA A;  4JC1 A;  4MUV A;  3ZYJ B;  4CA9 A;  1DHK B;  4RFR B;  3T1M A;  1ZBA 1;  4LBO A;  5FZE A;  1VRB A;  4IV1 C;  4CCM A;  5JSP A;  3M3I A;  1N1Y A;  1CAU A;  3AXE A;  3OTF A;  5FUN A;  5IVB A;  4Q4X 2;  3SLI A;  4GJY A;  1XNK A;  5CBL A;  4Y1V A;  3AKR A;  1X36 A;  3AMN A;  2HWC 2;  5JOX A;  2ET1 A;  5FTT C;  3AYC A;  1LOC A;  4KH9 A;  4PIX A;  2CHH A;  3OGJ A;  5IFP A;  3EMR A;  5F3G A;  1XYO A;  4JCK A;  3B01 A;  3LQC A;  2JD4 A;  1SQ4 A;  1TNF A;  5K0U B;  2X53 S;  2Y6G A;  1VBD 2;  1DQ2 A;  2NLR A;  1PGL 2;  1W8W A;  3GZA A;  2Y8K A;  5K8S A;  2LRP A;  4JHT A;  1WZX A;  1OMI A;  1GZW A;  5A7W A;  1K45 A;  1QY4 A;  2JG9 A;  3EHK A;  3GBG A;  4QB2 A;  4YW1 A;  1IG0 A;  4LBL A;  4SLI A;  1SLI A;  2F4L A;  4XFC A;  4AVC A;  4CE8 A;  4E2G A;  5M0T A;  3BKZ A;  2XVK A;  3VDB A;  4W6W A;  1CAU B;  2I07 B;  1FPN 2;  1G8W A;  2J22 A;  1AJK A;  5FY5 A;  1W6M A;  2VZ3 A;  1BMV 1;  4QHZ A;  3ZR5 A;  1C8M 1;  2WAA A;  4B7E A;  3SCH A;  3AKP A;  2FBE A;  1XSR A;  4D94 A;  4W4Z A;  3UK9 A;  3B00 A;  3ASI A;  5GLT A;  3ZFF C;  2VZT A;  1BEV 1;  3WNL A;  1F35 A;  5DAQ A;  3T09 A;  1ASJ 1;  2DWR A;  2HWC 3;  3B94 A;  2WNU C;  5C4W C;  2DU0 A;  2AAC A;  4MGZ E;  2QQP A;  5L36 A;  2YG0 A;  1SEF A;  4PDW A;  3QBQ A;  4B7K A;  1XYP A;  4TZD A;  2VW2 A;  1DYK A;  1GP6 A;  1XJA A;  1PK6 B;  3PUQ A;  4FAH A;  4D0Q A;  5A7W B;  4FFH A;  5DDJ 1;  5FUP A;  2Q1Z B;  4R9C A;  1UU5 A;  2WZ8 A;  1DQ5 A;  1RJ7 A;  4JQR A;  5T5O A;  4AXO A;  3NAP B;  4CU6 A;  2WZR 3;  5A33 A;  1KS5 A;  2VL4 A;  1OT5 A;  3GNE A;  3C7G A;  4I30 A;  4L97 A;  4RL7 A;  2KXL A;  5FYZ A;  3UKT A;  4XF9 A;  4FPO B;  1ZX5 A;  1PVC 1;  3O14 A;  4QKF A;  2GP3 A;  3O0W A;  3ZSM A;  2HWE 3;  1RIR A;  3KCC A;  1NAE A;  2YHJ A;  1H8T A;  4I3P A;  1UYP A;  3KGZ A;  4BE3 A;  5A3U A;  2ZGO A;  1AUY A;  5GAL A;  2ORZ A;  5DUW A;  1Z0H A;  4XE9 A;  2UWA A;  4NAM A;  3LIG A;  2UYB A;  2P3J A;  1V6N A;  2WZR 1;  1DF0 A;  3QD6 A;  2JEN A;  4N7I A;  5GJ6 A;  2VZU A;  3N7L A;  5IAT A;  4RQP A;  2E32 A;  1O3T A;  4AAP A;  4FPL A;  1RUF 3;  2HWE 1;  1ULG A;  2D3S A;  3HWJ A;  3BN6 A;  5A33 B;  3CNA A;  4XAB A;  4D7S A;  3ACG A;  3WCR A;  4HAN A;  4QU1 A;  2VW0 A;  4Y26 A;  5CIS A;  1I3H A;  2CAV A;  5EIY B;  2WQ4 A;  4WVZ A;  4GXL A;  3U75 A;  1H8T B;  2ES3 A;  1VMF A;  2XGX A;  3IN9 A;  4EN8 B;  2XVG A;  1VAK A;  2VZQ A;  5FJK A;  1NOV A;  4QQ2 A;  5FZK A;  5I0U A;  2CY6 A;  1RUF 1;  2V72 A;  4HKL A;  4PF5 A;  3BGA A;  5C71 A;  4OZX A;  1VB4 A;  3MYX A;  1W0N A;  2RM2 1;  4GWM A;  1DLL A;  2R6Q A;  2HYX A;  3K3O A;  4LK7 A;  5F5A A;  2W08 A;  2WO3 A;  3Q9O A;  2C1F A;  5ANQ A;  3O1R A;  5GKA C;  2VPV A;  4D3W A;  1VBE 3;  3N35 A;  3VKF C;  1H8V A;  3BTA A;  3WXP A;  1AL2 2;  2WS9 1;  2ZX3 A;  3IM0 A;  3WHU A;  2PHD A;  2Q8E A;  5C3O A;  3FE5 A;  3KT4 A;  1XPW A;  3OYW A;  1COV 2;  1E5I A;  4ZU5 A;  2RS3 3;  1FV3 A;  4L2N A;  1WBL A;  3PVE A;  2FDJ A;  4GA9 A;  4L99 A;  1C5I A;  2YU2 A;  1ENX A;  2DUP A;  1WBF A;  1RED A;  1BCX A;  4CDU C;  4C1X A;  5FZI A;  4QXB A;  4EN7 B;  2OQ7 A;  4IV3 C;  4ZHN A;  2QQJ A;  4M3C F;  3Q8B A;  2HEW F;  3WG2 A;  3QCW A;  1QQP 3;  1VBE 1;  5A1L A;  3S5Q A;  4LQR A;  4XXP A;  4AI9 A;  5FMO L;  4E8C A;  1Q56 A;  2B46 X;  4AFC A;  3GHN A;  2TBV A;  2FCV A;  2P34 A;  1NUK A;  2OZ6 A;  5F2W A;  2XDV A;  2Q4S A;  3P6B A;  4B4Q A;  1R1Z A;  1UOB A;  4HLT A;  1VAM A;  2RS3 1;  2YMZ A;  3LA2 A;  2PLV 1;  4DUX A;  4LBQ D;  1YQC A;  4YW7 A;  1QEX A;  1UIK A;  1O4T A;  1T6G C;  1NA1 A;  3R6S A;  1RHI 2;  4Y5Z 0;  4KWL A;  1NXD 1;  1V6K A;  4A2U A;  4M0H A;  1QQP 1;  1RIN A;  4IL7 A;  2D5H A;  4KI5 M;  2VZP A;  3N9Q A;  4W6X A;  2VOX A;  3H0O A;  4LLO A;  2DV9 A;  1LEN A;  2DBI A;  4CDW C;  4XDO A;  2XLF A;  2WO7 A;  4YW6 A;  3KV6 A;  4K7J A;  1ULE A;  2RS1 2;  4M4P A;  5LBC A;  1KXG A;  5J36 A;  2JEC A;  4PF1 A;  5E8A A;  1HRI 2;  4AHZ A;  5I0R A;  1RUC 3;  5A6Q A;  1RXG A;  2XHN A;  3AL5 A;  2XQX A;  3GF6 A;  1TNR A;  3VBO C;  1SZB A;  1PMH X;  4BQ1 A;  2B4K A;  1Y9M A;  2IXI A;  2R06 2;  3GAL A;  1DGW A;  4XEZ A;  2XON A;  2BP6 A;  4P9L A;  2W1S A;  3FUO A;  4L9B A;  1NA1 B;  5CKM A;  2WL1 A;  1E57 A;  4NAO A;  4HSJ A;  3ZYI B;  5FV3 A;  2QBX A;  3FZ3 A;  3JD7 2;  1HB1 A;  3KV4 A;  1ALY A;  4AI1 A;  4B4P A;  5HBA A;  2JDK A;  3HIF A;  4YZ1 A;  1RHI 3;  1Y7B A;  3VHR A;  1RUC 1;  1HJG A;  3J8F 1;  1U5Z A;  1SDD B;  4Q27 A;  3TN9 1;  5JI7 A;  4CP0 A;  5A3M A;  5J7M A;  5KXC A;  3GXU A;  3M4F A;  3WQ0 A;  3K4A A;  1TEI A;  1G7Y A;  1BVV A;  5HCA A;  1Q8P A;  3D82 A;  3NV1 A;  1HW5 A;  4M0N A;  3RWK X;  2NMN A;  1W6Q A;  1GNH A;  1RUE 2;  5CZK A;  2WWJ A;  4ARY A;  2NPI A;  3ZSE A;  2P5B A;  2CYF A;  5FO7 B;  3IAP A;  4LXL A;  5J96 B;  1J59 A;  3TNP B;  4CXX A;  3PIG A;  1JZ3 A;  4O7X A;  3E97 A;  4PIZ A;  5CFC C;  1QDO A;  3D6E A;  3ES1 A;  2V4V A;  4FOV A;  2HH9 A;  5DXD A;  3O0V A;  2WT0 A;  2JDA A;  3FFQ A;  1C1F A;  4XJU A;  2YBS A;  4NHY A;  2YGL A;  1JHJ A;  2UWC A;  2IC1 A;  2Z69 A;  2QQK A;  5C8C C;  5C5U A;  1C5H A;  2JIJ A;  4N7U A;  1KFU L;  3I2J A;  3DKQ A;  2Y6K A;  3DL3 A;  3MPP G;  3MIC A;  4KG0 A;  4BCU A;  2K0G A;  4CCO A;  3MLL A;  1XE7 A;  2W87 A;  4HK8 A;  4M4R A;  4AFD A;  4P9J A;  3RZM A;  1POV 1;  1W6Q B;  3IMM A;  3FWE A;  1R09 2;  1RUH 2;  2ZBJ A;  4FPK A;  4MET A;  4QPG C;  1AYN 3;  3U07 A;  2JB8 A;  4LR4 A;  3LEM A;  4LE4 A;  1BLZ A;  4N9H A;  1HQW A;  5A80 A;  4EN0 A;  1BQP A;  1RUE 3;  2PAM A;  2ZGM A;  4WM7 C;  4LIV A;  5FLJ A;  5A3N A;  3T4V A;  2IWG B;  2MEV 1;  1GQG A;  3ILR A;  4CEW B;  2YC0 A;  2VTF A;  1IZ3 A;  3BOP A;  5A7Q A;  2Z42 A;  3M3C A;  1MVE A;  3P3P A;  3B93 A;  4BIO A;  4AE2 A;  1ZZ9 A;  5EJ1 B;  2B45 X;  4IDZ A;  4MHU A;  3VD9 A;  3MW4 A;  4FFF A;  2EIB A;  4XIO A;  3I49 A;  4YFZ A;  3POI A;  1AYN 1;  3HBK A;  3JB4 C;  3KQR A;  3OG2 A;  3PVB B;  5FJH A;  2JG8 B;  4CP1 A;  1WW6 A;  2LS6 A;  3A0N A;  3NST A;  3SCG A;  2JDU A;  4TN7 A;  1MZ6 A;  3UGG A;  2R07 1;  1JN2 P;  1V9U 2;  3WW2 A;  1REF A;  2GC0 A;  4FQZ A;  1Z7S 2;  5ABJ C;  3ZXK A;  2PN5 A;  4OHV A;  4PHZ A;  5I0S A;  3KQ4 B;  2Q8O A;  5KC5 A;  2DCK A;  1KD7 A;  3DYM A;  1AR9 3;  2XXZ A;  3AYD A;  4JRL A;  2ZPX A;  3KSC A;  1O5L A;  1OLQ A;  1SLC A;  1ODN A;  1PGS A;  1WD4 A;  3I3Q A;  4QX5 A;  4DO0 A;  1OKO A;  3OGG A;  2P4E A;  3WG4 A;  2R04 3;  4FOW A;  1W0O A;  2BVV A;  4Q4W 2;  4XBN A;  2WR9 A;  2XJT A;  3KS7 A;  4A4A A;  2WFF 2;  1CJP A;  2QTW B;  3OD0 A;  4DRV A;  1GNY A;  2ZGU A;  5BNN B;  4QDR A;  2ZJC A;  4LBQ A;  1KRI A;  2BFU S;  1GR3 A;  3J7L A;  4LHS A;  3WCS A;  1YI7 A;  2DFC A;  2W1U A;  2JX9 A;  1B09 A;  4NPL A;  4AYU A;  1AR9 1;  4PCR A;  5IWF A;  1PGW 1;  3L9J T;  2BBA A;  2ADE A;  4UFJ A;  4OI4 A;  3F95 A;  1EAH 1;  5KWR A;  2R04 1;  3G7D A;  1FYU A;  4IES A;  1YJK A;  5TSW A;  3OGR A;  3IDA A;  5FR3 A;  4LOS A;  5T5P A;  5A6Z A;  1Z7S 3;  3JU9 A;  3AK0 A;  4WM8 C;  1AR6 3;  3ZXF A;  2WRA A;  4YGB A;  1QJU 1;  3TYJ A;  1YEW A;  2A3Y A;  4ZS3 A;  4AEK A;  3B69 A;  4URT A;  1YQ6 A;  2JE8 A;  4Q8L A;  5E88 A;  4CYD A;  1O3Q A;  4YZ2 A;  3ILN A;  4UBG A;  3JQX A;  1RUJ 1;  2OII A;  2R49 A;  3MPB A;  2R1B A;  3H8X A;  3RS6 A;  1ENR A;  4NRP A;  2WIN B;  2CDO A;  4LBQ B;  1ENQ A;  5FZ6 A;  5JVV A;  4Q4W 3;  4QB1 A;  4Y5S A;  2PTM A;  1LB2 A;  1D4V B;  2V73 A;  3VD5 A;  1LKN A;  1OLR A;  2BEO A;  4J1X A;  4M3C E;  5FYS A;  1SBF A;  1JU3 A;  2W1W A;  3FN9 A;  2O8O A;  1GP5 A;  4CCC A;  1NZI A;  3AYA A;  1AX0 A;  1AR6 1;  2BJS A;  2H6C A;  2YDE A;  3J7N A;  3NRU A;  3P3N A;  4J25 A;  5LAS A;  3PNA A;  1XNB A;  1VBA 2;  4BM8 A;  4MGT A;  4G3Y C;  2VO5 A;  2HWD 3;  2FCT A;  4UW6 A;  3U78 A;  4NRO A;  2RMU 3;  4IEO A;  3OBA A;  3MZH A;  3C8X A;  1O3R A;  5D8A B;  3QH6 A;  4QGN A;  1EUU A;  1TME 2;  2B8M A;  1YQ2 A;  2ARB A;  1UXZ A;  5DAV A;  2W1Q A;  4DY5 A;  2GND A;  1K5M A;  3OGV A;  2J7M A;  5A7N A;  4C91 A;  5FO8 B;  1V0A A;  3PME A;  1LOF C;  1Y9G A;  1IS3 A;  5F39 A;  5FY8 A;  1GOF A;  1ZRF A;  2AEN A;  2VQU A;  1MEC 2;  1U5I A;  1WMD A;  3H7J A;  5LA1 A;  3ZFE C;  2ZGT A;  4DB5 A;  5BYN A;  4FTE A;  2SLI A;  2HWD 1;  3LA3 A;  4Q4V 1;  2RMU 1;  2J1S A;  5C70 A;  4HVO A;  2EID A;  4BME A;  5JOW A;  4LIU A;  4KBB A;  5BNO B;  5ACA 3;  1UD1 A;  1W05 A;  1VRH 2;  3I2G A;  4Y5T A;  1RUO A;  1RUD 3;  5FMB A;  1W8Z A;  4YM2 A;  1JW6 A;  5FPX A;  2YXS A;  1HKD A;  2XLA A;  4MYE A;  1F4H A;  1GWM A;  1NE6 A;  4GIQ A;  4NJ4 A;  2RJ2 A;  4P9G A;  2W95 A;  1J84 A;  1N3Q A;  3WIN E;  5HV4 A;  2DUR A;  4IE0 A;  1Y43 B;  3ZSK A;  4CEY C;  1VBA 3;  4K3U A;  4X6R B;  3HT2 A;  5JXG A;  1K5M B;  4B1L A;  4FTB A;  4Z92 B;  4W50 A;  4WVM A;  5FYC A;  1N1T A;  3ECQ A;  1NT0 A;  1ZA7 A;  1SHW B;  2WN3 A;  1TME 3;  5DG1 A;  5CB7 A;  4Y1X A;  3KMH A;  3RZZ A;  4ZS2 A;  2ZMN A;  2ZGL A;  4RSU A;  1QOO A;  1RUD 1;  3MBW A;  2FZ1 A;  2W92 A;  2CAU A;  5FZ1 A;  4LOR A;  4JGZ A;  4M3C A;  4FAG A;  4ZXE A;  2RS5 3;  5BNP C;  4CU8 A;  1ZRD A;  2ZA9 A;  3I3M A;  2GNB A;  3MO4 A;  2CSG A;  3KT1 A;  4Q0P A;  1CGP A;  2GAU A;  2WKK A;  1RIT A;  2P3Y A;  1YJL A;  2YPJ A;  4YFW A;  5EQU A;  2WA3 A;  5FUI A;  1ODM A;  4JGY A;  1IKQ A;  2ZGP A;  3SHR A;  1YIP A;  2WDB A;  5CFD C;  4IE4 A;  1AVB A;  1UZY A;  3SXW A;  5G04 L;  4XUQ A;  1OOP B;  5FZG A;  1CR7 A;  3ITQ A;  4XZP A;  4NMI A;  1N3P A;  1LHU A;  1ZRR A;  3AX4 A;  2ZGR A;  5T5J A;  1KDK A;  1YFU A;  4Y4Y A;  1QU0 A;  3KZ4 C;  4XIK A;  2RS5 1;  3UJQ A;  4FCA A;  4TLF A;  1NCQ A;  1RMU 2;  5EWS A;  2PHF A;  3D0J A;  4TWT A;  2D98 A;  4DPN A;  1EV1 1;  5A32 A;  3AVR A;  4ERO A;  1ND3 A;  1GOH A;  1RUG 2;  1AX1 A;  2AH2 A;  1VBC 3;  3CJI A;  2ZAA A;  1UZV A;  1BBT 1;  4JTN A;  4MX3 A;  1DGL A;  3VZN A;  2CTV A;  4JGZ B;  4LIT A;  2VG9 A;  1I6X A;  2PFW A;  5F6K A;  4I3G A;  1WLC A;  2Y6J A;  1PIV 3;  4AED B;  3FHI B;  1ND2 C;  1QJY 3;  4Y24 A;  4BOW A;  5ISL A;  3AZZ A;  4JDM A;  4OVE A;  2VW1 A;  4JQT A;  2KD7 A;  3FFZ A;  4RYD A;  1DQ0 A;  2BW8 A;  4MAD A;  5IVJ A;  1JMU B;  2ATF A;  1YHF A;  3IIA A;  2O0O A;  5J48 A;  2IVJ A;  5BV6 A;  5SV8 A;  3I4I A;  2J1A A;  4QPW A;  4AHY A;  5T55 A;  4CSW A;  4YVS A;  5LK7 B;  1HV0 A;  4K1Z A;  4AL9 A;  3IAQ A;  3VDD C;  1LR5 A;  1VBC 1;  3DPR A;  5FZ3 A;  3RJ2 X;  3S6P A;  4KU8 A;  4DNY A;  5I93 A;  1NY7 1;  4EV0 A;  3OUJ A;  5FZB A;  1SDW A;  1NCQ B;  4Q5O A;  4QXK A;  1PIV 1;  1J58 A;  1QJY 1;  2QQI A;  1MZE A;  2WNV C;  2D6L X;  2G4I A;  3MLK A;  5A3O A;  3LZZ A;  4OMC A;  2QJV A;  2BER A;  3HMY A;  4PBP A;  5A32 B;  3M8L A;  1W6O B;  1ND3 B;  1J83 A;  1SCS A;  1OUS A;  4LKS A;  5AC9 3;  3CBN A;  1RMU 3;  3FHA A;  4LHL A;  1LEC A;  4JTO A;  3TEX A;  1ZBE 2;  4RS5 A;  1JTZ X;  4K40 A;  1KS4 A;  3JXS A;  3HNB M;  2R32 A;  2YC4 A;  4QQO A;  3VBS A;  4DEQ A;  5LWB A;  3J9S A;  4ZY9 A;  1W6P A;  5CKQ A;  3WVJ A;  1MQT A;  1CES A;  1YC6 1;  2JE7 A;  2G9F A;  5FZM A;  4YSF A;  3H8R A;  2RDS A;  2QCS B;  2WQ8 A;  3V65 A;  4AG4 A;  5BXX A;  4YVS B;  4BZ4 A;  1QNW A;  3PVO A;  3DPR B;  1QJE A;  2ZKN A;  1PM4 A;  3LD8 A;  3U37 A;  2JG9 C;  5AC9 1;  1A8D A;  2RDR A;  4MGK E;  4YG3 A;  1K12 A;  2Q5T A;  4RR3 A;  3CMG A;  4NRQ A;  5JIU A;  4ZKT B;  3ZFG B;  1SMV A;  3WP3 A;  3VD4 A;  1AX2 A;  1SLL A;  1QHD A;  4FFI A;  3UT0 A;  4OHX A;  1SLB A;  5C5T A;  3RDI A;  4NPM A;  1IQA A;  5LBB A;  5LK5 A;  3Q8C A;  3O1V A;  1YRZ A;  1UPS A;  4KGQ A;  3WDY A;  2A6W A;  1UOJ A;  4Q2F A;  4RS5 B;  3KVA A;  4IQP A;  1VBB 2;  4COW A;  2VZO A;  3VBS B;  4BQ3 A;  2A73 B;  1N47 A;  4CP2 A;  1GNZ A;  1STM A;  1CX4 A;  1MQT B;  4Q1R A;  4BPZ A;  1LJ7 A;  1ZBA 2;  1ZBE 3;  2I45 A;  2VBD A;  1WCU A;  4PDW C;  3ZXL A;  4DUV A;  2RR1 1;  4H7L A;  3WLU A;  2JDN A;  1NLQ A;  2XJS A;  3HQR A;  5FYV A;  4ES9 A;  2XUM A;  3M3Q A;  1AR7 3;  4EQV A;  1H6Y A;  1MZ5 A;  2NMO A;  2VC9 A;  3K4D A;  3TB0 A;  3WP5 A;  2VM9 A;  4O9G A;  4B8E A;  4EWD A;  5JOZ A;  5LA0 A;  4RR3 B;  4IUG A;  5FXV A;  4TTG A;  5GZE A;  3WDT A;  4L0P A;  5FOB B;  1N1V A;  1XE8 A;  5T3N A;  3H42 B;  1PO2 3;  4XFB A;  3VLB B;  3WG3 A;  1HV1 A;  5F3C A;  1WW7 A;  3AMH A;  5C3P A;  4Q0S A;  4RGG A;  4DEV A;  4MXW B;  4PIY A;  2Q8D A;  2LAL A;  2AUY A;  3WDU A;  3LB9 A;  2CGN A;  4DMI A;  1PX4 A;  2VJX A;  5EPA A;  1AR7 1;  2JWP A;  3PTY A;  3OUH A;  5DUV A;  1H8T C;  1VJ2 A;  1UW8 A;  2CNA A;  3E6C C;  4XFI A;  3N3H A;  2QQM A;  1UX7 A;  4E8D A;  1NG0 A;  2XJP A;  5JR2 A;  2Y0I A;  3HQX A;  1PO2 1;  2DCT A;  4B1M A;  5A7S A;  1J3Q A;  4IER A;  4GMP 1;  1BMV 2;  3NL1 A;  4AFM A;  2O1Q A;  4BA6 A;  1C8M 2;  1LGC A;  3I2H A;  4XPV A;  1OPO A;  4RQP C;  5FPU A;  1FNY A;  1KJR A;  3EJK A;  1BEV 2;  2Q1F A;  2JEM A;  1JH5 A;  1LUL A;  4CP9 A;  1ASJ 2;  2IXJ A;  5FY4 A;  3A4U A;  3QH7 A;  4W65 A;  2H6B A;  3WV6 A;  2PYT A;  3JUU A;  4FOQ A;  2D3P A;  4PI2 A;  5E6H A;  4JZR A;  4KGG A;  2VCA A;  5DZE A;  3HVD A;  2P6H A;  3CJX A;  5DDJ 2;  1UL9 A;  4A42 A;  4H55 A;  4HSL A;  1HB3 A;  2QE3 A;  2E33 A;  3E5X A;  4CDQ A;  4GH4 C;  3A7Q A;  3BTX A;  3BCW A;  4TXW A;  2OUH A;  2E7Q A;  5IYY A;  1OF3 A;  1OD5 A;  1YFY A;  4WVW A;  2DUO A;  3O0X A;  3CHX A;  3PIJ A;  3NKT A;  3TEW A;  4K9S A;  1OXC A;  4JKL A;  1G9F A;  3IWZ A;  3TEZ A;  4URA A;  2JD9 A;  3ZSJ A;  1PVC 2;  3WNM A;  1QOT A;  2JB4 A;  1C8M 3;  3IT8 A;  4FP3 A;  4M01 A;  4OMD A;  5DUX A;  3WP4 A;  2ARA A;  2BRT A;  2A75 A;  2DVD A;  3RYP A;  4BHP A;  2FZ2 A;  3K77 A;  3UV9 A;  5T52 A;  2A6V A;  1BEV 3;  1PK6 A;  1FNZ A;  1ASJ 3;  2W9X A;  3NJV A;  1YI9 A;  4XUR A;  1UY4 A;  4BU2 A;  3RGB A;  4DFS A;  3T08 A;  3KV5 A;  1VAL A;  4I02 A;  2EIC A;  2WZR 2;  5IVE A;  1A34 A;  3MHZ A;  5JZG A;  2A6X A;  3GBF A;  1XC6 A;  1OLM E;  1QXR A;  3ZM8 A;  1O91 A;  1POV 0;  3NAP A;  4LO5 B;  2D6N A;  2NN8 A;  1X82 A;  3ATG A;  3VBH C;  2X29 A;  1UOF A;  3J7H A;  1WLD A;  2KR2 A;  4CDQ B;  3III A;  2A7A A;  3NKG A;  5GZF A;  1NQJ A;  3OD4 A;  4CP9 B;  2HWE 2;  1MS3 A;  5DDJ 3;  1NKG A;  1WMF A;  1XSQ A;  4PT6 A;  1DU3 D;  2P17 A;  4FXG B;  1Q3E A;  2HKX A;  4N43 A;  1X33 A;  3HNY M;  4D8M A;  1RUI 3;  2YY1 A;  4CVU A;  4Y1Z A;  2Q0A A;  5L7O B;  3HN3 A;  1XU1 A;  1OUX A;  3N9O A;  4Q0U A;  4Q4Y 3;  4BLI A;  2XL7 A;  2EF6 A;  1AYM 3;  1J1T A;  1H6X A;  4QDQ A;  4FTS A;  2VMI A;  2E6V A;  1WLT A;  5EJ3 A;  1PVC 3;  5JMC A;  1RUF 2;  2YBP A;  1YIF A;  3TWI A;  4CUB A;  3M2M A;  1ZZ6 A;  2AEY A;  5C9A B;  2RM2 2;  3MIB A;  2R0H A;  3EO6 A;  2I2S A;  2ARX A;  1RUI 1;  3LAG A;  4P00 B;  5CIR A;  5JZG B;  4NID A;  5GLW A;  4AEJ A;  3VBF A;  3HNM A;  3WF3 A;  4XDP A;  1XXN A;  1YQ8 A;  1CPN A;  4P5Y A;  4X8P A;  4N43 B;  4Q4Y 1;  3HN1 A;  4CXY A;  2WS9 2;  5F5C A;  1AYM 1;  2Y33 A;  2L9L A;  4S2H A;  3ZLI A;  4MG2 A;  4MGY E;  3UES A;  1NX9 A;  2V4A A;  4NWV A;  3N7M A;  3GJB A;  3T0A A;  4AI3 A;  1G9C A;  2Y60 A;  3RWN A;  4ZXK A;  3BI3 A;  3DV8 A;  2ZEY A;  1IPJ A;  3H1M A;  1FXZ A;  2NYY A;  1TG7 A;  3APB A;  1UX6 A;  4RGK A;  3W21 A;  4NR1 A;  5IT6 A;  1O8P A;  3W5N A;  3WNK A;  1LGN A;  5KHH A;  3WSO A;  1F31 A;  1S0I A;  2EAA A;  2WJS A;  1W9W A;  2VME A;  2Q8C A;  1NCR C;  1VBE 2;  2W3J A;  1OLM A;  5GZG A;  4Y4R A;  1W90 A;  3POE A;  1H2N A;  4IW3 A;  4CDX A;  1VAV A;  3E6D A;  2HBT A;  3AZW A;  1UY1 A;  2BUK A;  1V70 A;  3I3B A;  3VBF B;  5D1I A;  4E2Q A;  2VU9 A;  2XB6 C;  3WG1 A;  1PO1 1;  2RM2 3;  1NYW A;  4ISR A;  4E9K A;  1D0H A;  2RS3 2;  2WWU A;  3WNN A;  4C1W A;  2PLV 2;  2E31 A;  5JOY A;  2CV6 A;  1GOG A;  3CLP A;  4XFA A;  4DIN B;  1JS9 A;  4MLO A;  3JCI A;  3FC0 A;  4GD4 A;  3LE0 A;  5C3R A;  3TOJ A;  3DKW A;  4LJH A;  4R9B A;  4NIH A;  2VQA A;  1QJX 3;  2Y34 A;  1QQP 2;  4OQ9 A;  3V0A A;  4LE3 A;  2WS9 3;  2OKX A;  5FCC A;  1E5S A;  1UIJ A;  5C6C A;  4QPY A;  1WGP A;  2CL2 A;  1CQ9 A;  1WA6 X;  1HDK A;  5FMO S;  3AP6 A;  3O1U A;  5LA2 A;  3VKO A;  5JSR A;  1JYN A;  4HT1 T;  3FMG A;  4CCE A;  5FQ0 A;  1DZT A;  2B7Y A;  5ANN A;  2PHU A;  4CCJ A;  5F3E A;  1JBC A;  2ZXQ A;  1MS5 A;  4XJW A;  4CDX B;  1W06 A;  4JKK A;  2E7A A;  5L9V A;  1UKG A;  1LHO A;  2VTX A;  1HN0 A;  1ENS A;  1GIC A;  1QJX 1;  5CAD A;  1CPM A;  1AXK A;  2PQQ A;  4IV1 A;  1JXN A;  4GKX A;  3DYO A;  5DZG A;  4B4R A;  3LPG A;  2P3I A;  1K3I A;  1O7F A;  3ALQ A;  3AP9 A;  5GM0 A;  3AL6 A;  1UCX A;  1BZW A;  4QX8 A;  4YW4 A;  3GJA A;  3SCF A;  5F1R A;  3O1T A;  3WW1 A;  1SG3 A;  2ZX1 A;  4IE6 A;  4L92 A;  4NVP A;  1O5U A;  4NHK A;  1JYV A;  1CAW A;  2VOW A;  2PLV 3;  4K8R B;  3V0A B;  2YUE A;  2HBU A;  5J37 A;  4CCK A;  3LKJ A;  1VPH A;  1VLN A;  3AKQ A;  1RUC 2;  2OUJ A;  3J8F 2;  3B3Q E;  5FY7 A;  3TN9 2;  4BXS V;  5A6X A;  1ZA4 A;  1GZT A;  3AZX A;  4UW4 A;  1OFS A;  5FQ0 B;  4C90 A;  3AXD A;  5FP3 A;  1EP0 A;  3O5S A;  4MZU A;  1DQ6 A;  4G9S B;  1MS8 A;  2ARE A;  4P14 A;  3MV1 1;  2OVU A;  4ET7 A;  1GQP A;  4IV1 B;  1W9Y A;  4Q1P A;  4BK5 A;  5J09 A;  2WUH A;  1FOD 1;  3KWV A;  3AFK A;  1OA2 A;  3LSE A;  1LEM A;  1G9A A;  3L2Y A;  4E4H A;  2VUL A;  1BXH A;  3PU8 A;  1CAW B;  2CGO A;  3JZV A;  3ZFF A;  3SQO A;  2ID4 A;  4AHW A;  3U0Z A;  4QXC A;  5IAX A;  2XL9 A;  2BTV C;  2WNU A;  5C4W A;  3AJY A;  2BZD A;  1PVX A;  1LCL A;  4YPJ A;  5CKN A;  4WZF A;  3ZN5 A;  2QNK A;  3FLP A;  4NIA A;  4AVA A;  1JZ4 A;  1O4Y A;  3J8F 3;  4HK9 A;  3TN9 3;  5JMO A;  1PZ7 A;  1WD3 A;  2X5I C;  2WAB A;  4A3Z A;  2JIG A;  2XKO A;  1PNG A;  3ROU A;  1WKY A;  5FZH A;  3VBR C;  1GYK A;  3POB A;  2ZKL A;  4Q29 A;  3KM5 A;  5FZ0 A;  4EE2 A;  3SH3 A;  2HWB 1;  5F32 A;  1DP0 A;  3ACH A;  1F15 A;  4AI0 A;  1UMI A;  3TRS B;  1LOD A;  3TNQ A;  2X10 A;  3BPS A;  2RDN A;  3BYW A;  2W46 A;  2BU9 A;  2C0Z A;  2WYF A;  4I2O A;  1GWL A;  4GWN A;  3WF0 A;  4YW5 A;  4MH0 E;  1QF3 A;  4XQW A;  1GFF 2;  4XJA A;  3SH4 A;  1LOA A;  3ZFF B;  2VMH A;  3ZMN A;  4D6S A;  1OA3 A;  3PUI A;  1AYN 2;  3SKJ E;  3ZVX A;  2WNU B;  5C4W B;  5GLZ A;  3W20 A;  3KHB A;  2Z5W A;  3MFC A;  5FP7 A;  4OHZ A;  4YWA A;  2P6C A;  5HXV A;  2EIE A;  2VQ0 A;  5GLU A;  3K2O A;  4R9A A;  3KHC A;  5IVV A;  3CIH A;  5FOJ B;  2QDR A;  3GM8 A;  3KB5 A;  4UW3 A;  4A41 A;  2DBN A;  3HJR A;  2PA7 A;  1POV 3;  2D97 A;  3CQO A;  1O59 A;  1JU4 A;  2BNN A;  4FXK B;  4XUP A;  5IW0 A;  1L3J A;  3IMN A;  3Q8E A;  2RHP A;  5AVA A;  3VHO A;  4F83 A;  2BQP A;  4QX2 A;  2FDK A;  2VUC A;  3E5Q A;  3LIH A;  2A3X A;  1S0J A;  4XDQ A;  1D4M 1;  1YFW A;  3A22 A;  4JAA A;  3LDB A;  2RDQ A;  1HJF A;  1JHN A;  2E26 A;  3DF0 A;  1UF2 C;  2MEV 3;  2GC3 A;  2Z4F A;  3IDE A;  2XBO 3;  4D7T A;  3NJZ A;  2VTX J;  4AI8 A;  2JG8 A;  3SIS A;  3W5M A;  3U14 A;  1OH4 A;  4UOJ A;  1WME A;  3M1H A;  4LO7 A;  3OBR A;  1AR9 2;  4DUW A;  1YNA A;  1PGW 2;  4EWA A;  3KCX A;  1GWK A;  4FPY A;  2VE1 A;  1EAH 2;  2VNR A;  4ONU A;  2R04 2;  3FLR A;  5FZ8 A;  2PXJ A;  1ULP A;  1S1A A;  5A6Y A;  3GCX A;  4JVA A;  2HJI A;  2OS2 A;  2R07 3;  3PUA A;  2CWS A;  2XBO 1;  3AP5 A;  1OC1 A;  3NNJ A;  4H7M A;  4I0A A;  4QAW A;  3RFR A;  1EPZ A;  4QDS A;  1B35 A;  4E4D X;  1UU6 A;  4YM0 A;  2XJV A;  3NNL A;  4HBN A;  5JUV A;  1QJU 2;  4E4S A;  4FBF A;  1XOY A;  4BMB A;  3T3Y A;  1AR8 3;  3T0B A;  1SBE A;  3C3V A;  2ENR A;  5BNN A;  1RUJ 2;  1BYH A;  3GZT B;  3I2K A;  1OVP A;  2HEY F;  3BTY A;  1CD3 G;  1FMD 3;  2DFB A;  2UYA A;  3RI8 A;  2BOI A;  4N53 C;  4X8N A;  1RVF 3;  2XWJ B;  2UUR A;  3N4M A;  4GAZ A;  3WF2 A;  4CDU A;  4DY3 A;  5A3P A;  4K8F A;  4A6S A;  4QQL A;  3S7E A;  1W2N A;  2HEV F;  1LU2 A;  2D3R A;  2K46 A;  1W0P A;  1I9R A;  4H14 A;  4O9E A;  3PUS A;  5EYY A;  5HV0 A;  2NM1 A;  1AR6 2;  4GUL A;  4BH9 A;  1AR8 1;  3OY8 A;  4MXV A;  1LGB A;  1OSG A;  5LA9 A;  4CCD A;  1L7L A;  4JRA A;  3LPF A;  5KHG A;  1B35 B;  3RZJ A;  1EAH 3;  4IEQ A;  4AF9 A;  5K7P A;  1FMD 1;  2O8Q A;  4MOA A;  4OYU A;  4JGY C;  5L73 A;  4V1P A;  5I8S A;  1RVF 1;  1H9P A;  5CEH A;  5IK7 A;  3NO8 A;  3JBG 3;  1SLA A;  2PHL A;  1QJU 3;  1MS4 A;  3M3O A;  3R0R A;  4IND A;  2VVF A;  5FXW A;  3UET A;  3VBU A;  2P37 A;  2VVE A;  2YGM A;  1XQN A;  2HWD 2;  2J1E A;  4Q4V 2;  4QWN A;  2XOM A;  2RMU 2;  4AGV A;  5FWJ A;  1RUJ 3;  4CDU B;  5DUU A;  4OHW A;  2GU9 A;  2BVB A;  3AZV A;  3E6B A;  1YQ5 A;  4IV3 B;  4CDW A;  5A1A A;  2ZZQ A;  5FYY A;  1W8H A;  1LOG A;  3SNM A;  1BKZ A;  3CJI C;  5AFB A;  3THT A;  3ZYG A;  1QH6 A;  3OY8 B;  2Y6H A;  5D8A A;  2X8K A;  2D6M A;  4M00 A;  3JBG 1;  4LA3 A;  1JYC A;  1EY2 A;  1IS6 A;  3IZO A;  1Y4W A;  4K1Y A;  1W8T A;  1HXS 1;  1SPP B;  2VNG A;  5D21 A;  3H3L A;  3Q8F A;  4GMP 0;  1JI6 A;  4IEW A;  2BGP A;  3H50 A;  5IVF A;  3OPZ A;  1R1A 3;  4PLM A;  3TEY A;  4CPB D;  2BDR A;  2YV8 A;  3RI9 A;  4AQT A;  3ZIX A;  5DAP A;  4Q8K A;  4NRM A;  4RFT 0;  4P02 B;  5FK8 A;  1RUD 2;  3D8C A;  4C0B A;  4JDO A;  2ZGQ A;  2BNM A;  4KWU A;  2A71 A;  3IBM A;  2VH9 A;  3CU7 A;  2WZP P;  3KF5 A;  3H9A A;  5FZC A;  1A6C A;  1YO8 A;  2P3K A;  3HBZ A;  1FX5 A;  4CDW B;  4FPF A;  2DF7 A;  4AAX A;  1UWW A;  4Q4V 3;  1UNB A;  1CIW A;  2WZE A;  3THD A;  1GZC A;  3WUD A;  4BQW A;  1TE1 B;  4LBJ A;  1UPI A;  1R1A 1;  5K4L A;  3ZDV A;  1W2T A;  2W39 A;  2VOT A;  5FYI A;  3VBO B;  1H4H A;  2D93 A;  1DZQ A;  2OT7 A;  4XJ8 A;  4XQ4 A;  2ZHL A;  2RS5 2;  4EZH A;  5CFC A;  2JDP A;  3D5O A;  2IUW A;  4Z82 A;  3HQU A;  1PZ9 A;  5FZD A;  4FPE A;  2E53 A;  4QPI A;  2DCY A;  4AR2 A;  1EV1 2;  2AR6 A;  2VUD A;  3KVB A;  5H9P A;  3O1S A;  2J1V A;  1BBT 2;  1VP6 A;  2R0F A;  3I59 B;  4NIG A;  5FP4 A;  4FQ4 A;  1S2K A;  4UF0 A;  1VB2 A;  1XND A;  5LAT A;  2AYH A;  1WW4 A;  1W03 A;  4FOY A;  1UAI A;  2WII B;  4XHX A;  3ZX7 A;  5I8Y A;  5F8P A;  4LO4 B;  4S2D A;  4OI2 A;  1F2N A;  1W3V A;  1W04 A;  2DU1 A;  4WBB A;  2PAE A;  1OOP A;  3AKS A;  5LY2 A;  4BQ5 A;  2PMW B;  5FP9 A;  4Y20 B;  3UYJ A;  5LB6 A;  4IXL A;  1HQN A;  1VBC 2;  4DRR A;  2EA7 A;  1NY7 2;  4WM7 A;  3KF3 A;  3S30 A;  5CFC B;  1G9B A;  3ME2 A;  1CZS A;  4G4F A;  1XB9 A;  1PIV 2;  1Q8S A;  1QJY 2;  4BIF A;  1TMF 3;  1W9F A;  5A70 A;  4QPI B;  1VIW B;  2VMG A;  4MGS A;  2W91 A;  1MZF A;  3MF6 A;  5EP9 A;  4UW5 A;  3BOD A;  5FY1 A;  5A7O A;  1W8O A;  3UL2 A;  2YB7 A;  3ON7 A;  3AKT A;  4AED A;  4EWE A;  5C8C B;  1O3S A;  1IGO A;  1R08 1;  5DN2 A;  3RG0 A;  1NLR A;  3MIF A;  4UF0 B;  1EV1 3;  4XJ9 A;  4QX0 A;  2KA3 A;  1OVS A;  1SFN A;  5A7P A;  1AF9 A;  1BBT 3;  4Z2W A;  3MW2 A;  3WY6 A;  4OI0 A;  5JAX A;  4JX0 A;  1QJZ A;  1G6N A;  3I7D A;  3BAL A;  3NJX A;  5LCW L;  1TMF 1;  2YRO A;  4XF0 A;  4QPG B;  4AVV A;  1S0E A;  2QQW A;  5L9B A;  1BJQ A;  5H9Q A;  1SBD A;  1LHN A;  4RD7 A;  1KEX A;  3GCW A;  4R8H A;  4NII A;  3T2Q A;  4WVV A;  5AC9 2;  1WCQ A;  3WDX A;  3AYE A;  4WM7 B;  4IE7 A;  1CIY A;  4E2S A;  1W6O A;  2XPJ A;  3OEA A;  3ZXJ A;  4CU9 A;  4XCB A;  3SH5 A;  5IAV A;  4YGD A;  3POJ A;  4HON A;  3F2Z A;  3ZXE A;  3OB8 A;  2FHR A;  3OSD A;  2UWB A;  1HIX A;  3AB0 A;  3M70 A;  1UYZ A;  4KBZ A;  4QT6 A;  2IXC A;  3BTZ A;  2VUA A;  2ZZJ A;  5LRR A;  3GYD A;  5FYT A;  2RJL A;  4YVW A;  5K0U C;  2YPD A;  3FBM A;  3ZPY A;  1X9P A;  1H2L A;  1ZNP A;  4COZ A;  3FUQ A;  3PHM A;  2ZAB A;  3LWC A;  5ABJ B;  2ZML A;  1GV9 A;  1Q8V A;  2RR1 2;  3NWK A;  3ST7 A;  4PJY A;  4HKW A;  3ACL A;  3BOW A;  2ZX2 A;  1MAC A;  3LDK A;  1H1M A;  2EAK A;  1LHW A;  3PL0 A;  4OFG A;  5FZ7 A;  4LO6 B;  3CDZ B;  3ZFG A;  4CDQ C;  3WW3 A;  4YM1 A;  5FBJ A;  4A7K A;  2NZ9 A;  3WDW A;  5FZ9 A;  1ZRE A;  1IG3 A;  2AZ5 A;  1Q43 A;  1VE0 A;  1XRU A;  1KDM A;  1Y3T A;  4QX7 A;  2ZHN A;  2OYZ A;  4MSV A;  1LAJ A;  4CPB A;  3VKL A;  2CGP A;  1AR7 2;  4YVW B;  1ZZ8 A;  2OX0 A;  2PHW A;  1AHS A;  1RYY A;  4DXT A;  4GAL A;  3G6J B;  4HXC A;  2IXK A;  3ZXG A;  1W99 A;  1PK6 C;  1UU4 A;  2OXB A;  2XR4 A;  1T6B X;  1PX3 A;  2ZGK A;  1PO2 2;  2ET7 A;  4P5H A;  4NO4 A;  1CAV B;  1S2E A;  2C24 A;  2GAL A;  5T50 A;  5JZG C;  3RRD A;  2LTN A;  2C26 A;  2RR1 3;  3NAP C;  4ASK A;  3AP7 A;  4D6R A;  3LSD A;  4AGR A;  3GZE A;  1VMH A;  4GWI A;  1UN1 A;  3J4U H;  5A3T A;  2VCB A; 
#chains in the Genus database with same CATH homology
 5F3C A;  3PUR A;  3UYJ A;  5A3P A;  4E4H A;  5FYH A;  3PU8 A;  5FV3 A;  5IWF A;  4IGO A;  2Q8D A;  2OQ6 A;  3KV4 A;  4XDP A;  4AAP A;  3PUS A;  3PDQ A;  3N9M A;  4QXC A;  5FPA A;  5F5C A;  4IGQ A;  5FPV A;  3AVR A;  3ZLI A;  5FZE A;  4EYU A;  1VRB A;  3OPW A;  4QU1 A;  5FY1 A;  5A7O A;  4CCM A;  4DIQ A;  4LIT A;  4NUB A;  2VD7 A;  5FUN A;  3DXU A;  3AVS A;  5FZO B;  5IVB A;  2WWJ A;  5ISL A;  4UF0 B;  5CEH A;  2P5B A;  4GJY A;  5A7S A;  2GP5 A;  5A7P A;  5FJK A;  4LXL A;  5FZH A;  5FP8 A;  5FZ0 A;  5FZK A;  4BXF A;  3PTR B;  5IVJ A;  5LW9 A;  5F32 A;  4GJZ A;  2Q8C A;  5FXW A;  5FPU A;  5FZ6 A;  5F3G A;  4QWN A;  4CSW A;  3KV9 A;  4Y4R A;  5FZG A;  5FWJ A;  5FYS A;  3K3O A;  5FY4 A;  5FZ3 A;  5F37 A;  5F5A A;  3OPT A;  2YBS A;  5FYY A;  4D6Q A;  3PU3 A;  4V2V A;  5ANQ A;  5FZB A;  4D6S A;  4BIS A;  2WWU A;  5E6H A;  3U78 A;  5A7W A;  3NJY A;  3N9L A;  4GD4 A;  5FZF A;  4HON A;  2Q8E A;  4CCO A;  4QXH A;  5F3I A;  5FP7 A;  4CCN A;  5F2S A;  5KR7 A;  5A7N A;  5FY5 A;  5FPL A;  5FY8 A;  5F39 A;  3K2O A;  2YU2 A;  5IVF A;  5IVV A;  2YBK A;  2W2I A;  4QXB A;  3N9N A;  2OQ7 A;  5FYT A;  5FZI A;  5A80 A;  5LWB A;  5IW0 A;  5A3W A;  2YPD A;  5FZL A;  5FWE A;  5FZM A;  4LIV A;  5A3N A;  5A1L A;  4URA A;  4CCJ A;  4AI9 A;  5F3E A;  5A1F A;  5FZC A;  5A7Q A;  5F2W A;  4LIU A;  5FYM A;  3LD8 A;  2XDV A;  3LDB A;  5FYU A;  5FZ7 A;  4CUG A;  5FY9 A;  5IVY A;  3PUQ A;  4BU2 A;  2YU1 A;  5A7W B;  4HOO A;  3KV5 A;  5K4L A;  5FJH A;  3AL6 A;  5IVE A;  5LY1 A;  4QX8 A;  4IGP A;  5IVC A;  5F5I A;  5FUP A;  5FBJ A;  5FYI A;  3U4S A;  4C8D A;  5FXX A;  4TN7 A;  2OT7 A;  2XUE A;  5FZ9 A;  3N9P A;  5FY0 A;  4CCL A;  4QX7 A;  4Y3O A;  3N9Q A;  5FYC A;  4EZH A;  4CCK A;  3K3N A;  5FXZ A;  3KVA A;  5FZ8 A;  4EZ4 A;  5FZD A;  2PXJ A;  5FY7 A;  4XDO A;  2OX0 A;  2OS2 A;  3PUA A;  3KVB A;  5FYZ A;  2XXZ A;  3KV6 A;  5FZ1 A;  5FZ4 A;  4DO0 A;  2GP3 A;  5FP3 A;  5FZO A;  5FP4 A;  3N9O A;  5FYV A;  4UF0 A;  3DXT A;  5FZA A;  3AL5 A;  4V2W A;  3ZPO A;  3RVH A;  4ASK A;  5FPB A;  2YBP A;  4D6R A;  5FXV A;  5LY2 A;  5FYB A;  4Y33 A;  5FP9 A;  2XML A;  5A3T A;  4GAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...