5FZ6A

Crystal structure of the catalytic domain of human jarid1b in complex with maybridge fragment n05859b (ligand modelled based on pandda event map, sgc - diamond i04-1 fragment screening)
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
462
structure length
452
Chain Sequence
SMFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDWQPPFACDVDKLHFTPRIRLNELEAQTRVKRDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEEDVTVEYGADIASKEFGSGFPVRDIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVGMCFSSFCWHIEDHWSYSNYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNTLMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHDEMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCFMSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Catalytic Domain of Human Jarid1B in Complex with Maybridge Fragment N05859B (Ligand Modelled Based on Pandda Event Map, Sgc - Diamond I04-1 Fragment Screening)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC DEMETHYLASE 5B
total genus 140
structure length 452
sequence length 462
ec nomenclature ec 1.14.11.-:
pdb deposition date 2016-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
A PF02928 zf-C5HC2 C5HC2 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 5fz6A01
5A3TA 5FPVA 4AAPA 4QXBA 4CSWA 5FJKA 4XDPA 3LD8A 5CEHA 5E6HA 5FXVA 3RVHA 5A7NA 5FZ7A 5F3CA 4QWNA 2YBKA 3PURA 4EZ4A 5FPBA 4CCNA 4DO0A 5FZ6A 5FY7A 4IGOA 3OPWA 5FZIA 2W2IA 3DXUA 3K3NA 5A7PA 4BISA 4D6RA 5FZOB 5FP4A 3OPTA 5A7OA 2YBPA 5FZEA 5A3PA 5ISLA 3PU3A 5FZ4A 5FZGA 4UF0A 3KVBA 2XUEA 5FZAA 4GJZA 3N9PA 4LITA 2VD7A 5FY5A 4EYUA 5FXWA 5F39A 5IW0A 5FPUA 5IVCA 3NJYA 5FYYA 5F5IA 5FYCA 5LY1A 2XXZA 5LY2A 4V2VA 4HOOA 5FUNA 3KV4A 5F3IA 4LIUA 4QXHA 4E4HA 5FPAA 3PUSA 2XMLA 3PUAA 5F3GA 3N9LA 5FZ0A 5FZKA 5FUPA 3PUQA 5FYIA 2OT7A 5F5AA 5FZLA 3KV6A 5F32A 5FWEA 4IGPA 5FYHA 5FZ9A 5ANQA 3KV9A 4LXLA 5FY1A 5FZFA 3KVAA 4XDOA 3K3OA 5FZMA 4CCLA 5FYVA 4D6QA 5IVBA 3PDQA 5FZ1A 4AI9A 5FJHA 5LW9A 5IVEA 4QXCA 4V2WA 3PU8A 5FZOA 4CUGA 4CCMA 2YU2A 5FP7A 5IWFA 3N9NA 5FPLA 5FYUA 4C8DA 2PXJA 3K2OA 2P5BA 5FYBA 5FXXA 5FP8A 3N9OA 5FZDA 5A3NA 5F2SA 4Y33A 5F3EA 5FZCA 2OQ6A 3DXTA 4URAA 5FY9A 3AL5A 2OX0A 2Q8DA 5IVVA 3U78A 2Q8EA 4GJYA 4GAZA 5F2WA 3N9QA 2XDVA 5FY8A 5A7WA 5FV3A 5K4LA 3ZPOA 4BXFA 5FP3A 3KV5A 4ASKA 4HONA 5FWJA 5A7SA 5FY4A 2Q8CA 4D6SA 5A80A 5FBJA 4Y3OA 5A1LA 5IVJA 4GD4A 4QX7A 4Y4RA 2OS2A 5A7QA 3AVRA 2GP3A 4NUBA 4EZHA 2OQ7A 5FP9A 5LWBA 5A7WB 5KR7A 3LDBA 3PTRB 4TN7A 2YU1A 5F5CA 5IVYA 5FZ3A 5IVFA 5FYMA 5F37A 3N9MA 5FY0A 3AL6A 5FZBA 5FXZA 5FYSA 5FZHA 2WWUA 2WWJA 5A3WA 5FYZA 2YPDA 4CCKA 3ZLIA 4CCJA 4DIQA 3UYJA 1VRBA 3U4SA 2YBSA 4LIVA 4UF0B 5FZ8A 4BU2A 2GP5A 4CCOA 5A1FA 3AVSA 4QU1A 5FYTA 4IGQA 4QX8A
chains in the Genus database with same CATH superfamily
2Y64A 1R093 3RSJA 1V0AA 4LO6B 5E8AA 1XNDA 2HWC1 4GKYA 2CU5A 3ES1A 4FPEA 2X5IB 2B46X 1AL22 3C3VA 4XZPA 3VZOA 3T1LA 3ZIWA 2PQSA 3R6SA 2Y6KA 4HVRA 3RG0A 3DKQA 5A6XA 1VBC3 2W39A 4CCNA 5FZ6A 4B1LA 4E4SA 2RJ2A 1X8EA 2FMDA 1IS4A 4PBOA 5IHRA 1TMF3 5A3PA 1Q43A 1VMHA 5EJZB 5GZDA 4P9JA 4C90A 4Q0UA 4V1PA 5BNPC 4C91A 3IBMA 3S6PA 2YROA 3O5SA 4IXLA 3C7EA 2BFUS 1UZVA 1RUNA 1ZVFA 4LLOA 2ARBA 2C6SA 1X36A 4KWLA 4YFWA 2YGMA 2WBKA 1EAH3 1H4HA 1AJKA 5CADA 1ZBE2 1Y9QA 2RS51 2GMEA 1MZ6A 5ACA3 2FHRA 5DAPA 5JLVA 3VUOA 2Y34A 4XEZA 2W92A 5LCWL 4BIFA 1AX2A 3RI8A 1LODA 4A2UA 4QPIA 1PM7A 1ENQA 4CE8A 2ZEXA 1TG7A 3RRDA 1F35A 5DABA 3SHRA 1SLLA 4QB1A 3GZTB 3PUIA 2D6KA 2E26A 5FAXA 1RUG3 4QPWA 4X8NA 1VRH3 1LGNA 3MO4A 1C8M1 1TE1B 2OVUA 2WT2A 3ZXKA 4CCDA 4CVUA 5GLWA 1QQP1 2R0FA 2VZQA 1PIV2 3OY8A 1W8UA 4META 3IDEA 3T4VA 5FOJB 5JMOA 2P2KA 1BVVA 4TXWA 1VBE2 1DGWX 1YHFA 3W9AA 2JEMA 2ADDA 5GLUA 1MQTA 4X8PA 5K7PA 3N4MA 5L9RA 2RR11 5F3EA 3H50A 4NHXA 1RVF1 4JCKA 1GUIA 3VD9A 3KT7A 1S0BA 3LEIA 4AGGA 4NOTA 1AX0A 1X50A 2GN3A 3U78A 1UF2C 5HCHA 1JHJA 4BA6A 5BNOB 3TOJA 1RITA 1CZTA 5A7WA 3FFZA 5I8TA 1QXJA 5JAXA 3MFAA 1WWYA 3I4IA 1SACA 3W58A 2Q8CA 1XNBA 2NMOA 3J4UH 4YPJA 1OKQA 4AQSA 5JPNB 4CXWA 1JZ5A 4LNVA 4L2NA 3EXUA 2ZGUA 1ULFA 1XE0A 4OHXA 1R081 1UMIA 4IEVA 2A7AA 2XQRA 3O12A 2Z42A 3AMQA 3B3QE 3Q8FA 5A7WB 2P6CA 1UIJA 2YPJA 2ZGNA 2ZXQA 4CYDA 4Y26A 2VCCA 2GMMA 1IG0A 1M4WA 1NX9A 2X8KA 2FCTA 2OYZA 1AR63 2A1XA 1IG3A 5FYZA 3CJIB 5DDJ1 1XU2A 3WDYA 3JQWA 2HWF1 5KHIA 2GALA 4IE0A 4XVHA 2YBSA 2R16A 2Y6HA 2QQVA 2OPKA 2WNUC 4NHLA 4I09A 4QU1A 3CLPA 3ZFEB 1WMEA 1G9FA 5A3TA 3O0WA 1PK6C 1VMJA 3T0BA 2Z4FA 1YUDA 2DTYA 3KCCA 5DAQA 2VQAA 1R64A 4JDNA 4EN7B 1AR62 2V5YA 1COV1 2RR12 2GC3A 4GB32 1HQNA 1O8SA 3IN9A 4OCTA 1H1MA 1O4ZA 2Y6GA 3TEYA 1R1ZA 1WBFA 3WNPA 2YY1A 2YC0A 3KGLA 3LIGA 4J1WA 2IWGB 2XUMA 3AKPA 2DU0A 3H9AA 2YYOA 3ILRA 3OPWA 4YZ3A 3T4HB 3AYDA 4P9GA 1SCRA 4CP1A 1C8M2 2TNFA 4XQ4A 3RYKA 5FP4A 1YQ5A 1KS4A 4ISRA 1CZSA 1VBB1 3VKMA 3VDAA 3ES4A 4AQTA 4PQQA 4ET7A 4B3NA 1H8TA 3WF1A 4YG6A 1RJ7A 1DYPA 2GU9A 2Q5TA 3POBA 4WVWA 3WG3A 5JOXA 3MLJA 2FD8A 2FZ2A 4JC1A 3M70A 5FMOS 1VP6A 4E27A 2JG9A 4IUGA 1HB1A 4CU8A 1S0FA 3LDRA 2AEYA 5JWPA 4UI9L 4N43B 1WBLA 5FPAA 4OFGA 3QACA 5F3GA 3U14A 4H7LA 2VVEA 4OZXA 2XVLA 4KBZA 2Z5WA 5F32A 5EJ3A 3UESA 2XOMA 2ARCA 4NPMA 5FPZA 2EAKA 4GXLA 4LLFA 3VL9A 1GKBA 1W9SA 1GZ9A 3ETPA 4YM0A 1JMUB 1PIV1 1OA3A 4MH0E 1APNA 3KQ4B 4QKNA 5AFBA 4CU7A 3MW4A 1V6LA 4N9IA 3LAGA 4TSVA 4GZ9A 1YQ8A 4LBQD 2Y6FA 4EWEA 1BBT1 3PU8A 5IATA 3ZXJA 1W6NB 3WHTA 3WEZA 1V6IA 2WYSA 1Q5OA 2ZGRA 5BV6A 2IXLA 4XBLA 5JCTA 3NNLA 2WZPP 5HV4A 1MZFA 2JD4A 5L7OA 4FOYA 4W8JA 3VBSC 4Y33A 1R1A3 4Y24A 5JUVA 1XU1A 1Y43B 5A33A 2FCVA 3ZSKA 2B39A 5IFTA 1KITA 4KWJA 2R32A 1DGRA 4Q0QA 3D3AA 5HV0A 2HBTA 2GNMA 2JD9A 2OPWA 3GZAA 4GJYA 1ZM1A 1W3VA 1R091 2A6VA 3RYPA 1JYIA 1G9DA 3MIHA 1RUE3 3INAA 5C3RA 1UIKA 3WP6A 3AJZA 2X29A 3VBHB 4QKDA 2OS2A 1LU1A 2VMFA 1MEC2 4LO8A 4A6SA 1V9U1 1W2OA 3SH5A 1GQGA 3A22A 3WP4A 3E5XA 5K8SA 1TMF2 5D2AA 3NAPB 1AR91 1QNYA 5BNQA 2VVDA 4UFHA 3S5AA 4YLZA 1TQ5A 1MS1A 3F95A 2A6WA 5CFCA 5F5CA 4ARYA 1W2NA 4JKKA 1SBFA 3VKOA 1HRI3 2AZ5A 3WNLA 1PK6A 1N1YA 2ILMA 4XAEA 1CJDA 1JU4A 3BUCA 2VMHA 1AUYA 1NE4A 1V6OA 2Y60A 2DWRA 4FT8A 4XHXA 2GH2A 4CDWA 1FI2A 3TN93 5CBLA 5JSOA 4XILA 1LNSA 3ZSMA 3ZXDA 2ZGTA 1GBGA 3RDIA 3ZDVA 4ZU5A 2D5HA 2AEZA 3H1MA 3CL1A 4YW5A 5DUVA 4YG0A 3K48A 4XDPA 1MR5A 4CDWC 4QKBA 3MZHA 1W0PA 2Q1MA 1X82A 1VLNA 3DYMA 4EV0A 1H2KA 1I1EA 4W50A 5DUXA 1ULDA 5C3QA 2VH9A 1YWKA 4P02B 2QQIA 5C70A 1FMD3 5DAWA 3IAPA 3UGFA 1I5PA 1WW7A 4XFAA 3OPTA 2WRAA 1IQAA 2A75A 2K9ZA 2XVGA 2WZ8A 4X6RB 3W59A 4QDRA 3QD6A 4TLFA 2R1BA 2W3JA 1FPN3 2RM22 2BVBA 2R062 5FZAA 4AVCA 4M0HA 5EJ1B 4NE9A 1VBA3 2CY6A 1YIPA 3B01A 3N35A 2ZMNA 3O7OA 5IW0A 1Q8PA 1E5HA 5JI9A 2W1QA 5FYYA 1V9U2 4ZS2A 1NA1A 3I3MA 3KM5A 5H9SA 3HJRA 3NVCA 4K9SA 4RD7A 4UAPA 5I0DA 3PUSA 2IXKA 3ABZA 2P37A 3DCQA 5FZ0A 4Z92B 3FX3A 4Q4W2 1REEA 3HBKA 3KT4A 1MS0A 2ZBJA 4QAWA 3DECA 4S2GA 2VCMA 5JXIA 2NM1A 4DUWA 4XHBA 3RYRA 2X09A 4NJ4A 3UKTA 4XBQA 1UNBA 3CIHA 2VNOA 1VBC1 1W6OB 4RHV2 4LBQB 2WAOA 1IOAA 2ZHKA 1VJ2A 5JSRA 1D4M1 3ORJA 4EQVA 1TMF1 2CGNA 3H8OA 4ES9A 2G1MA 3U0ZA 2P3IA 3OY8B 5GM0A 4QQOA 4EN0A 1QNWA 2QZ2A 1HJGA 3OBAA 3MV01 1FOD3 1Y4WA 3GZUC 3B9CA 4N43A 3VKFC 3BI3A 2VL4A 5EXOA 4D3WA 1NUKA 2ZX3A 2ZOEB 3AMMA 3K2OA 1BYHA 2UY8A 3W20A 3L9JT 1RVF2 1ASJ3 3BYWA 1RUD3 3VBOA 4Z2WA 1CVNA 1OQDA 2H0VA 5F9TA 1EYBA 4UXAA 5IVVA 1FT9A 3VBFB 4QHOA 2BQPA 3FLPA 1PM4A 1IS3A 3R4SA 3N9QA 1WKYA 1VB4A 3H1WA 3T0AA 3KV5A 3VGIA 2P3JA 4RHV3 2VOVA 5FY4A 4FOVA 1F5FA 1MEC3 2RMU2 1X33A 2BP6A 5L7OC 4JZRA 3RZLA 4XUNA 3R05A 1NZCA 2W46A 4QX0A 5TSWA 3GBFA 5BNNC 2A6ZA 4HSJA 2HKXA 3MF6A 2GP3A 5CFDA 3ZFGC 4YZ5A 5C33A 3BTXA 1RB8G 2OQ7A 2JIJA 1CAWB 2UY9A 3EJKA 4ZZ8A 1G9CA 1QKQA 2PHWA 1LOEA 4LO7A 1LHUA 1WMDA 1VBD1 4DQAA 1B09A 5FXZA 3HBZA 1PMJX 2WWJA 1WCQA 2LRPA 2YPDA 3MEPA 2VVFA 2VTFA 4RQPC 2HLEA 4WVVA 3IDBB 4E8CA 5AVAA 3ZFFB 1QMJA 3ZKYA 3OBRA 1POQA 1KGYA 2JE8A 3F2ZA 4BK4A 3FFQA 2R49A 4QDQA 1H2MA 1EUTA 1YYNA 4UW4A 5LK5A 4YYOA 4G3YC 3P5BA 5A7NA 4HPKA 4JDMA 4CDXB 5B2GB 1H30A 2WJSA 3ILFA 3PURA 1SDWA 1H9WA 3ZDSA 2ZKLA 4LBOA 4AVTA 3HIFA 4COUA 1ALYA 3FHQA 4QB6A 3T2OA 2W1UA 1N1VA 1OFSA 2VQUA 4XFFA 5A7OA 3W5NA 4QM9A 4QXKA 2ID4A 2K2SA 2IXCA 5FZGA 5B4NA 3ZFFA 2PFWA 4FFHA 1AYN1 2PHTA 1J83A 2ZEYA 3GJBA 4FCAA 4Y5TA 1AR61 2VUJA 4ORFA 2VD7A 4CDQB 3AKSA 4HVQA 3ZVXA 5J1XA 4FO9A 5IVCA 1IPSA 2K0GA 4TYSA 5LA9A 1HRI2 3AC0A 4YVSA 4V2VA 3VZNA 1PVC2 3O1TA 4FTBA 1WW4A 4D7YA 1FX5A 2VUCA 5DUUA 4AEJA 1UKGA 2AH2A 3MBWA 3GNEA 1QOOA 2PLV3 2WINB 2G19A 5FWEA 2F6BA 5JOYA 2RJLA 5A3UA 5KHGA 1RUG2 3KV9A 1CAXB 1NLQA 2DVDA 3GJAA 5E1RA 1Q3EA 1QF3A 2VCBA 4S2HA 1RUE2 4RQPB 1B35B 2VOKA 4MGIE 4BYYA 3P1IA 1V9U3 2WAAA 4CP9B 5FJHA 1PO21 4F3JA 3E5UA 5JOZA 5FZOA 1LEDA 4CCCA 3LPGA 3ZYPA 4OZOA 5LB6A 2JICA 4QU2A 1TME3 5B4XA 5FP7A 1LENA 4I02A 5IWFA 1H0BA 4AHZA 4C8DA 4CXXA 4Z2AA 1RUJ2 1JZ4A 1RIRA 2WQ8A 4EN6B 3GF6A 4LEJA 1Y7BA 5FY9A 4AOCA 3K75B 2EIBA 4A4AA 1OA4A 2V4VA 2PLV2 3AXEA 2BBAA 3NV1A 4MADA 5A32B 1JYTA 2VZSA 5DAVA 4JQTA 4Z82A 5BYNA 2B9VA 2RMU3 2CHHA 2CSGA 5D8AB 3KS7A 4LA2A 1LHOA 2DCTA 4XUQA 4I0BA 3GHMA 4DB5A 1K42A 4Y1XA 4B29A 1S0DA 5DZFA 1CZVA 3C7OA 1PZ8A 5C3PA 2XJTA 5A7QA 4N53C 4IE4A 4LPLA 4PIXA 4OQ9A 2BGPA 2BBVA 2PHDA 3WY6A 3H3ZA 4DZGA 3BN6A 3VL8A 1CD3G 1PGL1 2VW2A 3M2MA 1V6NA 1ZRIA 2JDKA 5G04L 2BGCA 2Y26A 3CNAA 3WR0A 5CA6A 4BWOA 5L9VA 2R042 4QQHA 4AFAA 5CKNA 4LKEA 2J1TA 3G6JB 1VMFA 1ND3A 2R6QA 1WZXA 2Z69A 2WNVB 3ZR6A 4CDUA 5I0TA 1C28A 2GC1A 1ND2B 2FDKA 4UFKA 3SCGA 5DPNA 1O3TA 4Y1YA 1PZ9A 3LA3A 4AAPA 4HSLA 3NKGA 1F5JA 2W68A 4B7EA 5C7GA 3LD8A 2C9AA 1XC6A 3K4AA 1X8MA 3O1RA 4CP2A 1O4YA 2XJRA 1AZDA 4GALA 4K7JA 2LTNA 5J48A 4NRQA 3BU0A 1ZZBA 1CAVB 1NAEA 2WZR2 3OPZA 1ZRFA 3CO2A 2OIIA 4H7MA 2PHRA 2JDNA 4RGAA 2QQJA 3ZFGB 4KWKA 3MV11 5ABJB 2XKPA 3EQEA 2YBPA 1W6MB 4EN8B 5ISLA 3A7QA 2X5IC 3SH4A 2WFF1 3I7DA 3JBG3 5D21A 1IKQA 1KJLA 4IV3A 3WNOA 2EXIA 1GNYA 1U5ZA 5F1RA 2N7GA 1GWLA 4I3GA 2Q4SA 4GJZA 4MGYE 1BZWA 3FHAA 2K46A 3I49A 4CZSA 4O9EA 4XUPA 3MFCA 4XJUA 1LOGA 1YNAA 3M8LA 1LR5A 4M01A 3WP3A 2ZMKA 3USSA 1S0EA 1B35A 3HN3A 4CPBD 4P9YA 3T09A 2R071 2AENA 1RUG1 1US3A 2WFF3 3NJVA 5C3OA 3SC7X 2MHFA 4XTMA 3ITQA 1X9PA 4LUMA 3UV9A 4MOAA 3ZM8A 4ZKTB 3OOXA 4RHV1 5FY1A 3TWIA 1BMV2 1RUF2 3JU9A 4I0WB 4ZU4A 1LB2A 1LHNA 2VMIA 3AP9A 4HKOA 2YC4A 4JTOA 4KQ7A 5FZMA 2HWD2 3AP7A 4HPKB 4UW3A 1XXNA 4D6QA 2VZ3A 4JHTA 1NXMA 2DUOA 5IVEA 1WLWA 5GZGA 5IAXA 3WZ1A 4K8RB 5IAVA 3EHKA 1JYNA 3M3OA 4WM7C 4P9IA 1ZRDA 1RGSA 2MEV3 4NIGA 1VBD3 2ZX4A 3M3IA 3N7MA 5IK5A 4NWWA 1CR7A 5FZCA 3FMGA 2WFPA 4HN1A 4HT1T 4DS0A 1W6NA 1QQP3 3DEMA 2P4EA 1BHGA 2D3RA 2NQYA 5HCFA 2VZRA 1OI6A 3AYAA 3BPSA 4Q4W3 1R083 2MEV1 4HZFA 5LEJA 1OQ1A 3OEAA 1XJAA 2JJ6A 4AL9A 4EROA 2VUDA 4N9HA 4ASKA 4L8QA 2NLRA 4YSFA 4Z8BA 3K51A 4MX3A 5FWJA 2FDIA 4A3ZA 1LKNA 3KGZA 3RZKA 5E88A 2AUYA 4GQ7A 1W8OA 3I59A 4Y4RA 2QJVA 1EV11 1HB3A 1LOCA 1WCUA 3WQ0A 5BNOC 1W2TA 4I0AA 4P9WA 2R041 4KGGA 1ZA4A 3SXWA 2NP0A 4IV1B 2HJIA 3OUJA 4DFSA 3VBRA 1MS9A 4NAOA 3TEXA 4E4DX 5KHKA 1OLMA 2EIEA 1RINA 1VBD2 4FXKB 4Q4Y1 5FZ3A 5FYMA 4COWA 4FOWA 5GZCA 3DV8A 2ZTNA 2R1DA 3KB5A 4CCKA 2JE9A 5BPXA 5L9BA 2ZGKA 4N53B 4DIQA 1OOPC 3D82A 1AR83 2ZGMA 4XC9A 2R30A 2ZZJA 4BQYA 2ZGLA 2YV8A 3WUCA 2W52A 3ZYFA 5F8PA 3VBFA 5I8YA 2RDRA 1RUF3 4KG0A 1S2KA 1VPHA 1N3PA 3AYEA 5FQ0A 4Q0PA 4IV3B 3B93A 5C8WA 2G4IA 2XLFA 1C5IA 3WINE 3O1MA 2FDFA 3RVHA 5C4WA 4OVEA 3GBGA 4CDUB 2YBKA 2D44A 1LHWA 2QQKA 2ZAHA 5AC91 1W6OA 1HRV1 3IWZA 1AR82 1L3JA 3BCWA 3K3NA 1OH3A 4LBLA 3S5QA 4ASLA 4K3UA 2D97A 2DCKA 3BVCA 1FNZA 2O8OA 1C4RA 5ANNA 4IEWA 3O1UA 1Y3TA 1J59A 1CESA 5FZ4A 3UKNA 1DLCA 1W03A 3ZN6A 4QX2A 1UY4A 3MIDA 4IEXA 3HD8B 3K4ZA 2ORXA 1DFQA 2WZEA 3JB8A 3N9PA 4IESA 4RFRB 1PHMA 3UGGA 4AHYA 4FFIA 1ZX5A 1F8VA 2XXZA 3OSDA 4OMCA 1ND3B 5F3IA 1OD5A 4HMZA 3J7NA 4QDSA 4AWDA 4EE2A 3AX4A 1A34A 1YQ6A 2LM3A 3ZXFA 1VB2A 5J3UA 1OXCA 4A7ZA 4Q4Y2 5HXMA 2OT7A 1YO8A 2EXHA 2W91A 1NA1B 2EA7A 1CGPA 3GCWA 3TB0A 2KM2A 1C1FA 1PGW1 2WKKA 3ZYJB 2C24A 2XJSA 3WDWA 2CDOA 2QQWA 3A0NA 1QJU3 2YXSA 4TZDA 1OOPB 5GLZA 5CKQA 4NIDA 4RFT0 1YQ2A 1OLRA 1XBFA 2B45X 2C26A 2YGLA 2OKXA 2SLIA 2CNAA 4AI9A 5C9AA 2QKDA 2JG8C 5CZKA 1YXWA 3U75A 3ZYHA 5FO7B 2HWE1 1W6QA 4DUVA 3GDBA 2JB8A 1I5ZA 4Q4X3 1H4GA 1VE0A 2YU2A 4JQRA 4CUCA 2E53A 2ADEA 1QJU1 2DF7A 2WYFA 1JUIA 3AP5A 3WG2A 5LZ6A 2YMZA 2BTVC 2XR4A 3N7JA 4FFGA 4DY3A 4CTEA 2OQ6A 2VGDA 3WV6A 4OYUA 2GDFA 1NA1C 1SLAA 2GNDA 2OX0A 1KDKA 1BBT3 1CAXA 1VBC2 2A6YA 4XYXA 2CV6A 4LA3A 2XWBB 3PMEA 1H6XA 4JKMA 5CAZA 2I45A 2QTWB 4NO4A 1LRHA 5FY8A 2EICA 1H1AA 4M3CE 5KWRA 2HWC3 2PHFA 3N7KA 4C0BA 4HONA 2ZACA 1AHSA 4ZZ5A 3SMHA 5A1LA 5IVJA 1HX6A 2RG4A 3VBHA 5GZEA 2H6CA 2W08A 3CU7A 4CXYA 3A23A 4HK9A 3ZMNA 5DG1A 3NO8A 4QGLA 4BPZA 1W8FA 1D0GA 1DU3D 3KCYA 2RJKA 2WSUA 3NL1A 5LBCA 3URFA 3WQ7A 5A6ZA 2AGSA 5FY0A 4XTPA 3JBG2 4RR3C 4AW7A 4PF5A 5L7OB 2QUOA 2Y33A 1YFXA 2W1WA 3ZSEA 2QDRA 1DHKB 1K3IA 4OLLA 3HNBM 1RXFA 2EXJA 3QLQA 4CDXA 4UF0B 1DQ2A 3OB8A 3JD72 4FQZA 4U2AA 3U1XA 4QX8A 4R9BA 1URXA 5DMYA 4QT6A 2EIDA 1OPMA 1JBCA 5BUVA 4WM8A 3WNKA 1C1LA 2P6HA 2WSVA 1PGW2 3I54A 2VQ0A 1HV0A 5FKCA 3AKTA 3MUY1 5A33B 1OC1A 5DAXA 2DVAA 5EHDA 5EYXA 4AFMA 4AYUA 2WO3A 4M4RA 5FY7A 2D93A 3LPFA 4WM8B 4RS5B 4NIAA 3V64A 1OUSA 1ZBE3 4QQLA 1MPXA 1RUD2 3U07A 1V00A 4A7YA 1JI6A 1HJFA 2Z2SB 3P3NA 5H9QA 1GYKA 4UF0A 1MZ5A 4MLOA 1H8TC 2ZGQA 1QIQA 3JQXA 4QPGA 1W8HA 2IVJA 2RM21 2WLQA 5FY5A 1VALA 3MLKA 3THTA 1PMIA 2E9QA 2NZ9A 3KCXA 3MIFA 3POJA 1K5MB 2E33A 3OCPA 3P6BA 3HQXA 1NCRA 4XAAA 2NPIA 5LY2A 5T5PA 3VBSA 3WHUA 2RDNA 2VZ1A 1J58A 3BOWA 1LOFA 1Z7S1 3PUAA 3I2OA 5FZKA 2PELA 4BMEA 2JXAA 1WLCA 5DZGA 1GP6A 3OGGA 4RN5A 2WS92 4IGPA 1F4AA 1S4CA 5T5LA 3WNMA 1RUH2 1I9RA 3T30A 5HI0A 1YCIA 2XBO2 1W9YA 2FZ1A 4HG6B 3B00A 2RVAA 1QJX3 4QPIC 3HPNA 1OURA 1PO11 1W8TA 4A44A 2V09A 2D3PA 4HBNA 2XG3A 4QXCA 4V2WA 5DZEA 3VHRA 1OHFA 5LA2A 4BZ4A 4QD2A 4GH4C 4XFHA 4E4ZA 3IIIA 3R4DB 5FYUA 4H55A 2RV9A 5FCCA 5J37A 5FXXA 2D6LX 3PMSA 1EAH1 4WM7B 2G9ZA 3AFKA 5F5QA 2DVFA 4BM8A 4JHZA 1IPJA 2DYCA 3GXUA 1C5HA 3H3LA 4FTEA 2E32A 1REDA 3ROUA 2R0HA 4R9CA 4GAZA 5F2WA 4XE9A 2WO7A 2UU8A 4PF1A 4XOGA 5K0UC 2H0BA 1LECA 1PVC3 4MZUA 4B4PA 3ZN5A 4D6SA 2JG9C 4PDWC 2XJVA 1RXGA 3SNMA 3WVJA 1TNFA 1HRV3 3J26N 1NKGA 2BERA 3E5QA 1LJ7A 1PGSA 3MW3A 1O3SA 5BY5A 4LHLA 3VD7A 4NIIA 1YQCA 1SMVA 2YFUA 2BDRA 3H8UA 4XJZA 1L7LA 2RDQA 2YU1A 2WT0A 4XF9A 4YZ4A 1MEC1 3VHNA 1RUH1 2Z79A 3VDCA 4PLMA 1HXS3 3THCA 3KSCA 2W5FA 3IZOA 5EV7A 3AYCA 4IEZA 2HEWF 3UYJA 2ENRA 3U4SA 4PQ9A 3ZYBA 3JCIA 4MGSA 4QB2A 1Z7S2 3QBQA 2C1FA 3BB6A 5CVRA 4IGQA 4JDOA 2BNOA 2VOTA 4K40A 4PIYA 4NHYA 5FPVA 3AM2A 3QH7A 1LOFC 3LEMA 5FJKA 4FQ4A 3NV3A 1Q8QA 5FXVA 5FMBA 3H7YA 2RS52 5C4WB 2QCSB 4AG4A 1JODA 4NMIA 4A6OA 1PVXA 1QWRA 5FPUA 3OEBA 4WVMA 4M4PA 5A7PA 1JU3A 2LW8A 4YWAA 1G8WA 1MQTB 5G05L 2BYVE 4QPIB 3THDA 4LTAA 4WV8A 3KWVA 3ZSLA 1T6BX 5L19A 1BK1A 3POEA 2H6BA 3DKWA 4N53A 1QJFA 3M3CA 4GB33 4OHVA 5KBFA 5DDJ3 2VZPA 3RFRA 4AGRA 4LULA 5FXWA 4EYUA 4OI2A 1KRIA 2IVIB 4XURA 1AR81 5FYCA 1O91A 3Q8AA 5LY1A 3TEWA 1Q8OA 3WDUA 1BEV2 3J7LA 1O5UA 4ES8A 4AEKA 4L92A 2JDZA 3FN9A 3N9LA 3UL2A 1UWWA 5FLJA 1K5MA 2FCUA 3ELNA 3LB9A 1MVEA 4LK6A 2VR4A 4ZY9A 4UT5A 3B02A 5FZFA 1NQJA 1NCRB 3KVAA 4PCRA 3UT0A 4AZZA 2ES3A 2L9LA 1LEMA 3OGJA 1ZBA2 1U5XA 4M0NA 4ZXEA 4KU7A 4MSVA 4XQWA 4UFMA 1H9PA 2PMWB 4FXGB 5T55A 1UOBA 3V56A 2HWF2 4BE3A 4IERA 4JTNA 4RS5A 2NN8A 2C0ZA 3VBSB 2WQZC 1NG0A 5CISA 3WF0A 2DVGA 4XFIA 4ATFA 2XVKA 4URTA 2GN7A 2PYTA 1IHMA 1LHVA 5T3NA 1RUJ1 4OUEA 1POV1 4XF1A 1AYM1 2GH8A 2GSYA 3AL5A 3QCWA 4KNCA 5FIXA 1KEXA 4NPLA 3TN91 1J3RA 2IC1A 4QPYA 5JOWA 1JUHA 4NVPA 4L11A 1BVP1 3SKJE 1JTZX 3ZFEC 5I91A 5DDJ2 5CB7A 2B9UA 2VXRA 4NIHA 3ENRA 3FJSA 3RPQA 1BQPA 1FYUA 3ZO0B 4EN9B 1O4TA 3HT2A 2CGOA 1NLSA 3CBNA 4PJYA 2BNMA 3GCXA 3PVNA 3AB0A 4AI1A 4Y22A 1VAKA 1VBA2 4LBNA 4TLGA 2QQPA 1GFF2 2WZR3 4Q5OA 1U12A 3T2PA 3ACHA 3VLBB 4S2FA 1LGBA 5FP9A 1XNTA 4EZHA 4LHKA 4D94A 2O14A 4B1MA 1QJX2 3I2FA 3GHNA 4WZFA 4Q0SA 3E6DA 3ECQA 4Y1UA 1Q56A 3I3EA 4KG8A 4E2SA 2BV4A 2JKBA 3ZLIA 5H9PA 2NMNA 3APBA 3S57A 4CPBA 5JXGA 2D40A 4ZU7A 3DYPA 5FO8B 5DUWA 3U11A 1LULA 1WCKA 3UETA 4HL0A 4AQ2A 1XNKA 4AHXA 3AVSA 5FYTA 4XJ8A 4XJWA 3BTAA 2BW8A 3FWEA 5ABJA 1JOJA 2VNGA 2JDPA 5A1AA 1UZZA 3DN7A 2VW0A 3JBG1 2QBXA 1OT5A 4IEQA 1BJQA 2ZKNA 3TRSB 1DCSA 5LEKA 2DCZA 3RS6A 4AEDB 4PIZA 2FBEA 2XJQA 4Q1RA 4XUOA 3ACLA 3T2QA 4ARXA 3PHMA 2VM9A 4BISA 1T2XA 2VMGA 3I8TA 1LOAA 1SFYA 5FPXA 1GZWA 1JYCA 1W6MA 2R073 1W9WA 2E31A 3IM0A 5I0UA 3WCSA 4D8MA 1B35C 5ACA1 3ZX7A 1J1TA 1BXHA 1CPMA 4R4XA 4CUAA 2Q0AA 2JB4A 3ZFEA 2W9XA 3T1MA 2VMEA 1CAVA 5KHJA 3J9SA 4K20A 2BRTA 3WCRA 3FLRA 4KI5M 5JXHA 1IKPA 1ASJ1 4Q4V1 1RUI3 4YZ1A 5FUNA 1ODNA 2I2SA 1AR73 3D8CA 2BJSA 5IJRA 3MF9A 5GALA 2UWCA 4BH9A 2AYHA 1AXKA 3LSEA 4W6YA 4KWUA 3PUQA 1W05A 3MI8A 5FYIA 3VBFC 3ZYIB 5FZLA 3KV6A 1A8MA 2ZMLA 2IFWA 2PHUA 5JZGB 5A3OA 1DP0A 1PVC1 5C4WC 1CN1A 2RS33 3ON7A 1EUUA 3BPZA 5J7MA 4RL7A 1TVGA 4COVA 1GMMA 1WCSA 4CCLA 1ZBE1 3LA7A 3T3YA 5GZFA 1JOPA 3L2YA 5GLTA 4XCAA 4YM1A 1K12A 3T08A 4XW3A 5C8CB 2BFUL 2AREA 2GAUA 3N9NA 5FMCA 2PXJA 2V72A 2QQOA 1YJKA 4DRRA 5FZDA 4AAXA 1G9AA 4OMDA 4AE2A 2J1AA 3ZXAC 3WD5A 1ONAA 4GMP1 2BWCA 2JDAA 1Z7S3 4J1XA 3VDDC 2Y0IA 2JENA 5FREA 3ZFFC 1FATA 4YW7A 4AEMA 1SZBA 5F6LB 1W04A 3ZOIA 2D6OX 2BZDA 2J1EA 1UY1A 1XQNA 5JSPA 1VBE1 1DGRN 1QU0A 2G9GA 3CHXA 3NV2A 4R52A 4W4ZA 3VDDA 1RVF3 4PBPA 4Y3OA 4GMP3 5ERLA 4D0QA 3OTFA 1D4M3 3NNMA 4P9LA 4B4QA 1QJX1 4Y20A 1H1IA 3RQ0A 2VAUA 2JIGA 3ZKUA 1X9TA 1CWPA 3VBRB 4UFJA 5K9YA 3DGTA 1FOD1 3AZZA 1UAIA 4FPGA 4CP9A 4IEOA 2B42B 3MICA 1VBE3 3AKRA 1HW5A 3C7HA 5FLHA 3V0AB 3I2HA 4FP3A 3LQCA 2WFF2 4GB31 4IW3A 3WW3A 3IMNA 5C5TA 4ISQA 2OZ6A 3PJQA 3USUA 1DQ1A 3DL3A 4Y4YA 4IE6A 2WR9A 4LO5B 1NY71 2R061 4QPGB 1XPWA 4MVTA 2KXLA 4Q4Y3 3ETQA 3LE0A 1KJRA 4DRVA 1JYWA 5CYYA 4RGKA 5FMOL 4A45A 1DQ6A 5E6HA 4YVSB 1OLQA 1Z78A 2C4XA 2G9FA 5DN2A 3VKNA 3VV1A 1KS5A 2FMYA 2HWB3 2J42A 3AZXA 5C71A 3H8XA 4FFFA 4MGKE 2WIIB 4CEWC 1OMIA 3CQOA 4IGOA 3MPBA 2R063 3OBZA 4LHSA 1KFUL 3OD4A 2OUHA 4MHUA 3S7IA 5JZGA 1HB2A 1JZ8A 3TNPB 1E5RA 3TEZA 2PAEA 4YZ2A 1FMD2 2X5IA 1O8PA 4COZA 4Q8LA 1ENSA 3A4UA 4YVSC 3SEPA 4ASMB 1TME1 3E1F1 4XZUG 1UOFA 1RJ8A 4P14A 5F39A 4LO4B 2HWC2 4YFZA 1WA6X 1POV3 2DU1A 3AZWA 2YUEA 4E8DA 1AYM3 2EIGA 1VBB3 1UPSA 5KXBA 4E4HA 3RI9A 2ZZQA 2D3SA 3NAPC 1BBT2 1UX6A 3FHIB 1JXNA 2JX9A 1HXS2 3I2IA 3UJQA 2ZHLA 4AVSA 4CRQA 4WM8C 2DCYA 2HWE3 4UWDA 5ANQA 4LXLA 4CEYC 3MPPG 3PUHA 4H14A 3CF6E 4S2DA 3K3OA 3WNXA 4JAAA 4MXWA 3SLIA 1QH6A 1GP5A 2RS13 4Y1VA 1BEV1 3IT8A 1NCQC 4ZPIA 4YRDA 5HPOA 1GANA 1YFYA 2MNGA 2YB7A 3LCPA 3OGVA 4DEVA 1PMHX 1V6MA 4P00B 2VZUA 2HEYF 1PIV3 4MUVA 3LFMA 3ZXLA 2RS11 1MS3A 4PDWA 3PNAA 3EB7A 1GOFA 4HLTA 2VJXA 2EVXA 3CZJA 3ZYRA 4NR1A 2VZTA 1REFA 1ND2C 2FDGA 3WG4A 1W6PA 3DF0A 1UOGA 3IIAA 4E2GA 1RUI2 3OJBA 4FPKA 3AP6A 2F17A 2WNVA 1QGLA 3HT1A 4XPVA 5E16A 1QQP2 1NCRC 3AFGA 3JZVA 3N36A 5A7SA 5A3LA 1QXRA 4YW3A 1C8NA 5FBJA 1EP0A 4FOQA 2PAKA 1W8NA 4YW1A 1FAYA 1AYN2 2OUJA 4UOJA 4QX5A 2VBBA 4YW2A 5T5JA 3VD3A 4K6BA 4QHZA 2XBO3 4NUBA 4Q27A 1ZYBA 1RHI3 5A6YA 1Z0HA 2OA2A 5F7UA 3RZGA 5KR7A 2ET1A 2QFEA 4XXAA 2YFZA 5IVFA 1MS5A 2XHNA 4OQ8A 3O1VA 5A3WA 3D0SA 2TUNA 2V5DA 2UWBA 3HQRA 4YW4A 3HR9A 4CDQC 3WDTA 4JGZB 1OBNA 2YZ4A 3WG1A 4MGTA 3D6EA 1AR93 3OYWB 3Q8EA 1QJY2 3CMGA 2ZGOA 3I97A 3NNGA 3TNQA 1RHI2 1PX4A 1H8VA 1U0AA 4RR3B 3IAQA 4QQ2A 1XE7A 1GLHA 1W39A 4CSWA 4XFBA 1RTVA 5HBAA 1ULEA 4KU8A 1EV12 5SV5A 5FR3A 1YFUA 4M00A 1UZWA 3DYOA 5SV8A 4EZ4A 2CGPA 5FPBA 2ORZA 5JPMB 2QQLA 5CFCC 3DXUA 1OF4A 4QPGC 3WW2A 5FZOB 3VD4A 1RC6A 2VBDA 5EPAA 1ZZ9A 3VBRC 5AFEA 2C5DA 4TTGA 1ODMA 2PN5A 2DUQA 2HWB2 2PA7A 1GZWB 4FPYA 5I0SA 3BU7A 4DUXA 3M3EA 3OD0A 3POSA 5CG9A 3OUIA 3ILNA 4QM8A 1SG3A 2E7AA 1F9KA 4GIQA 1R082 2FDJA 4PDWB 4QHBA 3SCHA 1SLTA 1WA4A 4CEWA 4OI4A 3CZUA 2IZWA 4OULA 2WNVC 2PHXA 2RR13 5GJ6A 2CYFA 2LUWA 1IGOA 1DYOA 5DQ0A 3VDBA 3S30A 4FAHA 2IXIA 1P8JA 3HQUA 3B69A 3K4DA 5BXXA 2DCJA 1IQDC 2XLAA 3EYPA 1ZRCA 5F5AA 5JXJA 3PJYA 1O7FA 3DPRB 1UQXA 4BK5A 4GWJA 4M3CA 1UY3A 5FZ9A 3A0KA 3LWCA 1CPNA 1GP4A 1MVQA 4N90A 1XRUA 4PT6A 1GICA 2D98A 1DLLA 1E57A 5CKMA 4GH4A 2Y38A 4YGCA 3VZJA 4K1YA 1PZ7A 4BCUA 4RYDA 1N1SA 4O7XA 5DG2A 4XETA 4CDQA 3WNNA 3BTZA 4JV4A 2BWAA 1UCXA 3NAPA 1EPZA 2TBVA 3LOBA 3DUIA 3NV4A 5EYYA 3H7JA 4Y22B 5T50A 4PLNA 1RMU1 4CEYA 2CTVA 1UW8A 1UX7A 1SQ4A 3FUQA 1YRZA 3IKWA 3N9OA 5A3NA 1ND3C 1RUI1 2VE1A 2HWF3 3POYA 1GU3A 3POWA 2VMCA 4ZONA 4XIOA 1D4M2 2JDUA 2XWJB 2ZX0A 3RNSA 3PL0A 4F8AA 1QJY1 1SCSA 1WGPA 2OZJA 5FBZA 1W9TA 1UZ0A 1IPKA 2VC9A 1W99A 1ZBA3 3O0XA 3VN4A 2P1BA 2XDVA 1LOBA 3LEKA 1RMU3 3WX5A 3ZPOA 1CIWA 4PI2A 4OUMA 1SBEA 4KMQA 4XF4A 2J1UA 2RS31 4FP2A 3AMNA 3ATGA 5T5OA 2DDUA 2UYBA 3T0DA 2HWB1 5KC5A 3M7AA 4QX7A 4HK8A 1IS5A 1RL3A 2QQUA 3KD4A 3T2TA 4DPNA 3NMBA 1D2QA 1C8M3 3WW4A 3AVRA 2WNOA 3VKLA 1QJU2 4LBMA 4QQPA 1XYOA 5T52A 1SDDB 4YGEA 3O1OA 1XNAA 2JG9B 5FOBB 1NXD1 1WCDJ 2XJUA 5FYSA 5FZHA 4EWAA 2A6XA 4WM7A 1QH7A 3QOPA 4SLIA 1LCLA 2ZABA 1H8TB 1JZ3A 1UPIA 4LIVA 2QVSB 1J3PA 3D5OA 1OKOA 1MACA 4XBNA 1TNRA 3CEWA 1CAWA 5EWSA 4Y5SA 2XL7A 2UYAA 3MIBA 5L36A 2CAVA 4OHZA 4Y20B 1RMU2 3U4XA 2QQNA 2VTXJ 3I2GA 3ZFGA 2XGXA 2R072 4AFCA 1KDMA 3AZVA 1EV13 3C7GA 1RYYA 4P5HA 3C2UA 3VBOB 1CAUB 3TBDA 3FLTA 4L97A 3VB9A 4Q2FA 3WQBA 1AR92 1X7NA 1QOTA 5J98B 1NOVA 2ZAAA 3N3HA 1EY2A 5GLVA 1JZ7A 4FSJA 1G86A 2XUEA 3KVBA 3OGSA 4YVWB 1G7YA 1D0HA 3WP5A 2IXHA 3LDKA 2JE7A 2W87A 2HWD1 3RZMA 1H6YA 4MGZE 1AL23 1UO9A 3IPVA 1MQTC 2J22A 1F31A 5JDBA 2W1SA 2JKXA 2Y6JA 4LBQA 1DDLA 1JW6A 2ZCWA 2A3YA 4J25A 2W47A 4QXHA 2B7YA 4XJ9A 3O14A 4L0PA 4NHKA 2F4LA 1AYN3 4Q0VA 5FUPA 3NWKA 1PO23 5FYHA 1TME2 2ZS6B 1YFWA 3THPA 2JG8A 1HV1A 1BLZA 1OVPA 4E2QA 1J84A 2O1QA 4K8FA 1L7RA 4DXZA 4LJHA 5IVBA 4QGMA 4XFCA 1NQDA 1UOJA 3GZEA 1GNHA 3FC0A 4MO3M 4ITCA 3OUHA 4AF9A 1VIWB 2PLV1 1YI9A 2XBO1 5DXDA 3MW2A 4AI3A 4OHWA 3HWJA 1NCQB 4CCMA 1DIWA 3PLQA 1COV2 2A73B 3N7LA 5FPLA 3ZPYA 5A32A 3U10A 3EMRA 4CDXC 5FLIA 2EF6A 3NKTA 4AFBA 2A5ZA 2O8QA 3ACGA 4XIKA 3DXTA 4YM3A 4IDZA 1MS4A 5JI7A 2GNBA 4W6WA 1KQRA 2UWAA 3LEGA 2X53S 4U36A 5F6KA 1PO22 4XACA 4FPOB 2RHPA 4DEQA 4KBBA 2WNUB 4F83A 1UKRA 1RUC3 4IL7A 1PGL2 3WF4A 1K45A 1O3QA 1O59A 1QJEA 4BXFA 5FP3A 3PTYA 2W0XA 3JUUA 2VXJA 3MUZ1 3VHOA 3A21A 4CDWB 3VZLA 4DXTA 3RZZA 5J36A 2DUPA 3H42B 3SCFA 2B4KA 4M3CB 4AI2A 1RUOA 4N7IA 4MYEA 4XXPA 3I3BA 3Q8BA 5CFCB 1ULGA 3BGAA 1RUC1 4UFIA 4BMBA 4H3WA 4QX1A 1I6XA 1NE6A 4Q4X1 2CL2A 5D1IA 5F37A 4GMP0 1FPN1 2E7TA 2VMDA 3VBUA 4N8MA 5FDBA 4OI0A 3H8RA 2WWUA 2R7EB 5JMCA 4Q4V2 2GC2A 1UU6A 3SEEA 4LKFA 2WZR1 5LBFA 1PK6B 3J7HA 1W8ZA 3GALA 1A78A 3D0JA 3LZZA 2WWSA 4A41A 3LKJA 4XMIA 3ZSJA 1F2NA 2D6NA 1CX4A 1GWMA 1DG6A 2JDMA 1N3QA 2XH6A 2D5FA 2QNKA 3CJIC 3EBRA 4AVBA 5EFUA 3E6BA 2CAUA 5HCAA 1HLCA 2VW1A 4AVAA 4JGYA 2XHKA 1SLCA 4UW6A 2TEPA 1CJPA 1GR3A 2GNTA 5GKAC 1XSQA 3FE5A 5LASA 3ZXGA 1JYXA 1GZCA 4A7KA 3ASIA 1US2A 1F4HA 3VZKA 1RHI1 1AR71 2RS53 3PU3A 1GWKA 4MGQA 4YGDA 3E6CC 3OYWA 4MV2A 1UY2A 1YLLA 3KF3A 1KFXL 4F7ZA 2VOXA 3POGA 1MZEA 1OUXA 4Q4V3 1XOYA 4OI1A 1BMV1 3IDCB 5I93A 1HQLA 1W0OA 2Y8KA 4P08A 2XONA 1CX1A 1GOHA 3LOIA 3EO6A 3KV4A 5C3SA 2HH9A 4NPRA 2YG0A 2VOWA 3I3QA 4IV1C 4C1WA 4BXSV 1WD4A 3B5LB 3KMHA 1C57A 1UXXX 2A3XA 2QDNA 1U5YA 3AK0A 3B9IA 4NWVA 2Q1ZB 3IPVB 1WLDA 2UURA 2W94A 4J6GA 2IUWA 3UNPA 3RZJA 4E9KA 1OA2A 3JXSA 1SBDA 1HN0A 3KF5A 1T6GC 4JKLA 4Q4X2 4YVWA 3B7MA 2WC2A 4W6XA 3PDQA 4RA0A 1RUC2 1ZZCA 2P34A 1D2SA 2WO1A 3KHBA 4R8HA 3WLUA 5LW9A 3UK9A 5IT6A 1ENXA 5FQ0B 3K46A 2O0OA 5LK7B 3BODA 4H2AA 3NNFA 4YVWC 3ACFA 4BQ5A 3M4FA 3POIA 3U37A 2D6MA 2ET7A 2KA3A 2PQQA 3NSTA 3MLLA 4ATEA 1HXS1 4I30A 5FP8A 3ZIXA 3MHZA 2WQ4A 1QEXA 1R092 1VRH2 2E6VA 4KL1A 4UFLA 3WF2A 4URAA 1F15A 1MS8A 4A3XA 3ZR5A 2Q8DA 1S0JA 3RJ2X 4AI8A 1OF3A 5CNAA 1GQHA 5EZWA 2BEOA 3TYJA 1ULOA 4LMFA 4MXVA 4LHNA 1VAVA 1XYPA 2Q1FA 2RS32 1AVBA 1ZZ8A 2WUHA 1WW6A 4WVMB 4IEPA 4BJ0A 1HKDA 2PTMA 5CIRA 2LALA 2ZHNA 1UYPA 2YDEA 5LA0A 1QXPA 4JGYC 4GULA 2BUKA 4G4FA 3SITA 4PHZA 1W6QB 4Q4W1 3PIGA 3I2DA 5C9AB 2JECA 3LDBA 3RGBA 2Y6LA 4M3CF 1WUVA 4DMIA 1UYYA 2RE9A 3W5MA 3AL6A 2J1VA 1PNFA 1D7PM 4XF0A 5ACA2 1OOPA 5JIAA 1BKZA 1UD1A 1UL9A 2BNNA 5IFPA 1RUD1 3CJIA 2DFBA 4AGVA 2J1RA 2R043 1UYZA 3LSDA 4FVVA 4JGYB 4JX0A 4NRPA 4HXCA 4CUBA 4KH9A 1OSGA 2JDYA 1LAJA 5HXVA 1STMA 1W90A 1ZBA1 3R4UA 4GWIA 4RS5C 2RDSA 4QKFA 1NY72 5IYYA 3K77A 1AXYA 1N1TA 1OQEA 3HAGA 5CEHA 2DV9A 4Z1VA 5BNOA 5AVPA 4HFSA 4BB3A 5KHHA 4FPFA 3R0RA 5FZ7A 5IK8A 2A3WA 3HNYM 3IDAA 3ZN4A 2VUAA 4FI9A 2BU9A 2GZWA 4LBJA 2E63A 5FZIA 1SLBA 2DTWA 4G9SB 4YM2A 1VBB2 1UU5A 1DZRA 1HQWA 2HEVF 3NNJA 2P17A 4GWNA 1ULPA 1SPPB 2WN3A 4CA9A 3ACIA 5T54A 3MGUA 1EPWA 3O1SA 1C3HA 2YC2A 1COV3 5CFDC 1DZQA 4GH4B 5FFOC 2WABA 2NYYA 3BTYA 4D7SA 2AACA 4LITA 1RUJ3 3MIGA 2KR2A 4BLIA 1IZ3A 2HBUA 1W8WA 4HOOA 4Y5Z0 4CU9A 1GNZA 1LESA 4B4RA 1NZIA 1E5IA 3VBUB 4FPLA 3DPRA 3KQRA 2D7FA 3BALA 3WDVA 4IQPA 4XFGA 1OFNA 4HKWA 4A42A 3AMPA 2BOIA 2IXJA 4HN0A 2ZHMA 4XDOA 3D4KA 1WLTA 2GC0A 2OXBA 2WS93 3P3PA 5BNPB 1GZTA 4IETA 4X6QB 5FMDA 5ABJC 4WBBA 1SLIA 2J1SA 2FDHA 1DGWA 1NCQA 4AVVA 2CWSA 2ZEWA 4IV1A 3CJXA 4YGBA 5C9AC 2ZPXA 2I07B 2WNUA 2XKOA 4HVOA 4PLOA 3WUDA 4BDVB 4BQ4A 3HNMA 4CDUC 1XB9A 5FYBA 4BQWA 1S0IA 3I2KA 2ZEZA 3AP4A 3BIEA 3WW1A 1PNGA 2JWPA 3BIWE 3JB4C 3LF7A 5LATA 3SISA 2I74A 2JG8B 4RR3A 2VNVA 3SH3A 4AR2A 1OPOA 2Q8EA 2DVBA 3POFA 3RWNA 4HKLA 4O9GA 1NLRA 2VY0A 3ME2A 1V6KA 3I2JA 3UGHA 4OUSA 5FV3A 1XE8A 5K4LA 1QOSA 4CU6A 4JGZA 1CQ9A 1N3OA 2XB6C 3V65A 1W06A 1QY4A 3QH6A 4YW6A 1IS6A 1R1A1 2WN2A 3GGLA 4LK7A 4BHPA 2ATFA 4C0HA 3MIEA 4GD4A 3GM8A 4PI0A 5D8AC 3LIHA 4DINB 3NW4A 3SQOA 4AEDC 5J96B 4JGZC 3H3UA 4N43C 3ALQA 4DXSA 2ZGPA 2XJPA 4HANA 1DF0A 3SKVA 4XF3A 4IEUA 3W21A 3FBYA 3KT1A 1W2AX 2A71A 1DYKA 5HCBA 3N9MA 5FZBA 4IE5A 1CAUA 3G7DA 2EXKA 2V73A 3J8F3 4CCJA 1GQPA 1OH4A 4DY5A 3V0BB 2HYXA 1VR3A 4D7TA 1S55A 3UJOA 1H2NA 3I3DA 4N7UA 3X29B 4I2OA 1D4VB 2XQXA 4CCEA 5A1FA 2QZ3A 2Q30A 4LKSA 1HRI1 1GV9A 1ZZ7A 3PIJA 3OG2A 2RMU1 4AFDA 4QXBA 3HOBA 4ZHNA 4R9DA 1LTEA 2PAMA 1FPN2 2VULA 1V6JA 3J8F1 4JRAA 4O65A 2LS6A 4AHWA 3ST7A 1L7QA 4XABA 3S7EA 5CU1A 2BGOA 4ONUA 2HYKA 2DURA 4DO0A 2B5HA 2W2IA 3AMHA 1ZREA 4D6RA 3C8XA 4YNIA 4ZXKA 1AR72 3LFIA 1ST8A 2AR6A 1OD3A 1TEIA 3H0OA 4AQ6A 1POV0 5C6CA 5FZEA 4K21A 5IUQA 3GBWA 3BOPA 5FK7A 5IK4A 1YEWA 1HB4A 3C7FA 1M06G 2BOJA 4LKDA 3GYDA 2C9KA 2QQMA 4TWTA 1KXGA 4R9AA 2WA4A 2P3KA 4LQRA 3NJYA 1FMD1 1H2LA 1ENRA 5F5IA 4XMAA 4JVAA 1S0CA 4BLJA 4MXWB 1YJLA 2EALA 3TN92 1E5SA 4INDA 4LIUA 3WOGA 1W9FA 3J7MA 3MYXA 4LOTA 2XMLA 4WVZA 5JZGC 1HRV2 4P5YA 1ACCA 1ND2A 1VBA1 1UMZA 4MHRA 5E89A 1GSLA 2SBAA 2B8MA 4NHMA 2XLGA 1QDOA 4NAMA 1AXZA 4Q1PA 3L2HA 1CONA 3Q9OA 2AC1A 5FYVA 4CEYB 1KD7A 1Y9MA 3RMXA 2QE3A 1YC61 4MG2A 2D6PA 4Q26A 1XSRA 2ETEA 4GWMA 4XQDA 5FRAA 2E51A 5APAA 2F4PA 2E7QA 2WT1A 1JZ6A 4XUTA 2VNRA 1AX1A 1DQ4A 1N47A 4NROA 3S0MA 3PVBB 2VBPA 2W95A 1WW5A 3NJXA 2XL9A 1UU4A 2D43A 5FO9B 1PO13 2ERFA 5D8AA 4AK3A 1SHWB 2ZJCA 3ZN6B 1R1A2 5K0UA 1CIYA 2BVVA 3NQHA 4Q29A 4YG3A 3UKVA 4BQ3A 4FBFA 5A6QA 5BNNB 1ZA7A 4L99A 4R4ZA 5BNPA 5KC6A 1J1LA 4IV3C 3J8F2 3USUB 4DNYA 5EIYB 1QDCA 2BPA2 4C1XA 1K5JA 3KLSA 1BK0A 5KXCA 1A6CA 5A80A 4FPCA 1RUH3 3NRUA 1JYVA 3V0AA 1QJY3 5C5UA 1VRH1 1ZZ6A 5AC93 4CEWB 4COYA 3KHCA 1DBNA 3FL7A 5LBBA 1XYNA 1Q8SA 3VZMA 2WNEA 1FNYA 1FV3A 2WO2A 1W2UA 4BIOA 2DBIA 1JZ2A 4RGGA 2RS12 3PTRB 5IVYA 1JN2P 2VCAA 5JR7B 1SFNA 3HN1A 3ZYGA 3RJRA 4RQPA 1LGCA 4WZCA 3RZHA 5J09A 3AJYA 3CDZB 2HWE2 4NN0A 2JDHA 1UXZA 1ASJ2 1OVSA 1VRBA 3H1YA 2YHJA 3FZ3A 5KXEA 1W28A 1AJOA 4LORA 2CDPA 2ZA9A 1W0NA 5FZ8A 4B7KA 2GP5A 1Q8VA 3Q8CA 3VDDB 4BU2A 4I3PA 5LRSA 1JS9A 4LE4A 5C8CA 4IEYA 4UBGA 1HIXA 4LT5A 1AF9A 2ZX2A 1JHNA 1S0GA 3FUOA 4LOSA 4GA9A 2VZVA 3WDXA 5EQUA 1UN1A 5BNNA 4UW5A 4FPJA 3I59B 5F3CA 4LBKA 4QWNA 5JVVA 2ARAA 1W3XA 3TAYA 5A3MA 4OHYA 1BCXA 2VO5A 1XNCA 3O0VA 3DPRC 4UYBA 2VQTA 1NYWA 1U5IA 1BEV3 4AXOA 4D69A 3FBMA 4DXRA 1LU2A 4CUGA 2VPVA 3IB3A 4EWDA 1SPPA 4LE3A 1JH5A 3JD73 5K0UB 2WL1A 2P3YA 5A70A 1DGLA 4I01A 4Z07A 1FXZA 4UBHA 3M1HA 5CG8A 2VU9A 1I3HA 3MDPA 2PHLA 5H9RA 3VBOC 4HETA 1DQ0A 3NJZA 1GOGA 3M3QA 2Y0OA 1V70A 3WXPA 3JD71 1QJZA 3B94A 1SFPA 1O6UA 1RUF1 1PX3A 1S2EA 1O5LA 5EP9A 2Q8OA 4BQ2A 2LROA 2CWMA 2IFRA 4LUKA 4XCBA 2XPJA 2HWD3 1AL21 2A70A 4JRLA 2V4AA 1AL0G 1RUE1 3RWKX 3WQ1A 3WSOA 4EJRA 3HMYA 4QGNA 1FOD2 5LBEA 4O61A 3PVOA 4NRMA 1AYM2 3LA2A 3O1PA 3LGRA 4SBVA 5I0RA 1JOBA 5FZ1A 1J3QA 2GMPA 1Y9GA 3IMMA 5FTTC 3AXDA 2DBNA 1UY0A 1G9BA 1SEFA 1A8DA 1ZNPA 4IE7A 5CFDB 4XDQA 1ULCA 2WA3A 3BKZA 2ZGSA 4BQXA 1W6PB 4CP0A 4P9XA 4K1ZA 4AEDA 4L9BA 5LRRA 4QMAA 2WLPA 2P5BA 1UYXA 3VD5A 4FAGA 5AC92 5JIUA 5F2SA 1UZYA 3PVEA 1WD3A 1HN1A 1K5MC 3E97A 3VBUC 2DFCA 3WT3A 5IK7A 5I8SA 5LA1A 3OBTA 1DZTA 1YIFA 4W65A 2X10A 3AZYA 4FTSA 4BOWA 1NT0A 1YI7A 1S1AA 4ZS3A 3VBHC 1HDKA 4Q8KA 1PO12 1OLME 2EAAA 4FPHA 1A3KA 2J7MA 5FK8A 1O3RA 1FV2A 1UMHA 3OF1A 4RSUA 4XJAA 4GKXA 2WS91 4QX3A 4AI0A 3HVDA 1WMFA 5FKBA 5KXDA 5LWBA 2ARXA 2KD7A 2FQPA 5C8CC 4TN7A 2X05A 5JR2A 3KZ4C 2WDBA 2VG9A 2VECA 1G6NA 3OGRA 5L73A 5M0TA 2OW4A 3V0BA 2RM23 1TZOA 2VTXA 4Y1ZA 1QHDA 3ZMOA 1EAH2 3VHPA 4KGQA 4DOUA 3CKHA 4YARA 2VZOA 1S2BA 2MPFA 4LR4A 2MEV2 2ZX1A 1VAMA 3AKQA 1DQ5A 5FUIA 3WF3A 1WMXA 3ZXEA 4B8EA 3HEIA 4BQ1A 4CCOA 1ZRRA 3RMYA
chains in the Genus database with same CATH topology
5A3TA 5FPVA 4AAPA 4QXBA 4CSWA 5FJKA 4XDPA 3LD8A 5CEHA 5E6HA 5FXVA 3RVHA 5A7NA 5FZ7A 5F3CA 4QWNA 2YBKA 3PURA 4EZ4A 5FPBA 4CCNA 4DO0A 5FZ6A 5FY7A 4IGOA 3OPWA 5FZIA 2W2IA 3DXUA 3K3NA 5A7PA 4BISA 4D6RA 5FZOB 5FP4A 3OPTA 5A7OA 2YBPA 5FZEA 5A3PA 5ISLA 3PU3A 5FZ4A 5FZGA 4UF0A 3KVBA 2XUEA 5FZAA 4GJZA 3N9PA 4LITA 2VD7A 5FY5A 4EYUA 5FXWA 5F39A 5IW0A 5FPUA 5IVCA 3NJYA 5FYYA 5F5IA 5FYCA 5LY1A 2XXZA 5LY2A 4V2VA 4HOOA 5FUNA 3KV4A 5F3IA 4LIUA 4QXHA 4E4HA 5FPAA 3PUSA 2XMLA 3PUAA 5F3GA 3N9LA 5FZ0A 5FZKA 5FUPA 3PUQA 5FYIA 2OT7A 5F5AA 5FZLA 3KV6A 5F32A 5FWEA 4IGPA 5FYHA 5FZ9A 5ANQA 3KV9A 4LXLA 5FY1A 5FZFA 3KVAA 4XDOA 3K3OA 5FZMA 4CCLA 5FYVA 4D6QA 5IVBA 3PDQA 5FZ1A 4AI9A 5FJHA 5LW9A 5IVEA 4QXCA 4V2WA 3PU8A 5FZOA 4CUGA 4CCMA 2YU2A 5FP7A 5IWFA 3N9NA 5FPLA 5FYUA 4C8DA 2PXJA 3K2OA 2P5BA 5FYBA 5FXXA 5FP8A 3N9OA 5FZDA 5A3NA 5F2SA 4Y33A 5F3EA 5FZCA 2OQ6A 3DXTA 4URAA 5FY9A 3AL5A 2OX0A 2Q8DA 5IVVA 3U78A 2Q8EA 4GJYA 4GAZA 5F2WA 3N9QA 2XDVA 5FY8A 5A7WA 5FV3A 5K4LA 3ZPOA 4BXFA 5FP3A 3KV5A 4ASKA 4HONA 5FWJA 5A7SA 5FY4A 2Q8CA 4D6SA 5A80A 5FBJA 4Y3OA 5A1LA 5IVJA 4GD4A 4QX7A 4Y4RA 2OS2A 5A7QA 3AVRA 2GP3A 4NUBA 4EZHA 2OQ7A 5FP9A 5LWBA 5A7WB 5KR7A 3LDBA 3PTRB 4TN7A 2YU1A 5F5CA 5IVYA 5FZ3A 5IVFA 5FYMA 5F37A 3N9MA 5FY0A 3AL6A 5FZBA 5FXZA 5FYSA 5FZHA 2WWUA 2WWJA 5A3WA 5FYZA 2YPDA 4CCKA 3ZLIA 4CCJA 4DIQA 3UYJA 1VRBA 3U4SA 2YBSA 4LIVA 4UF0B 5FZ8A 4BU2A 2GP5A 4CCOA 5A1FA 3AVSA 4QU1A 5FYTA 4IGQA 4QX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A3T A;  5FPV A;  4AAP A;  4QXB A;  4CSW A;  5FJK A;  4XDP A;  3LD8 A;  5CEH A;  5E6H A;  5FXV A;  3RVH A;  5A7N A;  5FZ7 A;  5F3C A;  4QWN A;  2YBK A;  3PUR A;  4EZ4 A;  5FPB A;  4CCN A;  4DO0 A;  5FZ6 A;  5FY7 A;  4IGO A;  3OPW A;  5FZI A;  2W2I A;  3DXU A;  3K3N A;  5A7P A;  4BIS A;  4D6R A;  5FZO B;  5FP4 A;  3OPT A;  5A7O A;  2YBP A;  5FZE A;  5A3P A;  5ISL A;  3PU3 A;  5FZ4 A;  5FZG A;  4UF0 A;  3KVB A;  2XUE A;  5FZA A;  4GJZ A;  3N9P A;  4LIT A;  2VD7 A;  5FY5 A;  4EYU A;  5FXW A;  5F39 A;  5IW0 A;  5FPU A;  5IVC A;  3NJY A;  5FYY A;  5F5I A;  5FYC A;  5LY1 A;  2XXZ A;  5LY2 A;  4V2V A;  4HOO A;  5FUN A;  3KV4 A;  5F3I A;  4LIU A;  4QXH A;  4E4H A;  5FPA A;  3PUS A;  2XML A;  3PUA A;  5F3G A;  3N9L A;  5FZ0 A;  5FZK A;  5FUP A;  3PUQ A;  5FYI A;  2OT7 A;  5F5A A;  5FZL A;  3KV6 A;  5F32 A;  5FWE A;  4IGP A;  5FYH A;  5FZ9 A;  5ANQ A;  3KV9 A;  4LXL A;  5FY1 A;  5FZF A;  3KVA A;  4XDO A;  3K3O A;  5FZM A;  4CCL A;  5FYV A;  4D6Q A;  5IVB A;  3PDQ A;  5FZ1 A;  4AI9 A;  5FJH A;  5LW9 A;  5IVE A;  4QXC A;  4V2W A;  3PU8 A;  5FZO A;  4CUG A;  4CCM A;  2YU2 A;  5FP7 A;  5IWF A;  3N9N A;  5FPL A;  5FYU A;  4C8D A;  2PXJ A;  3K2O A;  2P5B A;  5FYB A;  5FXX A;  5FP8 A;  3N9O A;  5FZD A;  5A3N A;  5F2S A;  4Y33 A;  5F3E A;  5FZC A;  2OQ6 A;  3DXT A;  4URA A;  5FY9 A;  3AL5 A;  2OX0 A;  2Q8D A;  5IVV A;  3U78 A;  2Q8E A;  4GJY A;  4GAZ A;  5F2W A;  3N9Q A;  2XDV A;  5FY8 A;  5A7W A;  5FV3 A;  5K4L A;  3ZPO A;  4BXF A;  5FP3 A;  3KV5 A;  4ASK A;  4HON A;  5FWJ A;  5A7S A;  5FY4 A;  2Q8C A;  4D6S A;  5A80 A;  5FBJ A;  4Y3O A;  5A1L A;  5IVJ A;  4GD4 A;  4QX7 A;  4Y4R A;  2OS2 A;  5A7Q A;  3AVR A;  2GP3 A;  4NUB A;  4EZH A;  2OQ7 A;  5FP9 A;  5LWB A;  5A7W B;  5KR7 A;  3LDB A;  3PTR B;  4TN7 A;  2YU1 A;  5F5C A;  5IVY A;  5FZ3 A;  5IVF A;  5FYM A;  5F37 A;  3N9M A;  5FY0 A;  3AL6 A;  5FZB A;  5FXZ A;  5FYS A;  5FZH A;  2WWU A;  2WWJ A;  5A3W A;  5FYZ A;  2YPD A;  4CCK A;  3ZLI A;  4CCJ A;  4DIQ A;  3UYJ A;  1VRB A;  3U4S A;  2YBS A;  4LIV A;  4UF0 B;  5FZ8 A;  4BU2 A;  2GP5 A;  4CCO A;  5A1F A;  3AVS A;  4QU1 A;  5FYT A;  4IGQ A;  4QX8 A; 
#chains in the Genus database with same CATH topology
 2Y64 A;  1R09 3;  3RSJ A;  1V0A A;  4LO6 B;  5E8A A;  1XND A;  2HWC 1;  4GKY A;  2CU5 A;  3ES1 A;  4FPE A;  2X5I B;  2B46 X;  1AL2 2;  3C3V A;  4XZP A;  3VZO A;  3T1L A;  3ZIW A;  2PQS A;  3R6S A;  2Y6K A;  4HVR A;  3RG0 A;  3DKQ A;  5A6X A;  1VBC 3;  2W39 A;  4CCN A;  5FZ6 A;  4B1L A;  4E4S A;  2RJ2 A;  1X8E A;  2FMD A;  1IS4 A;  4PBO A;  5IHR A;  1TMF 3;  5A3P A;  1Q43 A;  1VMH A;  5EJZ B;  5GZD A;  4P9J A;  4C90 A;  4Q0U A;  4V1P A;  5BNP C;  4C91 A;  3IBM A;  3S6P A;  2YRO A;  3O5S A;  4IXL A;  3C7E A;  2BFU S;  1UZV A;  1RUN A;  1ZVF A;  4LLO A;  2ARB A;  2C6S A;  1X36 A;  4KWL A;  4YFW A;  2YGM A;  2WBK A;  1EAH 3;  1H4H A;  1AJK A;  5CAD A;  1ZBE 2;  1Y9Q A;  2RS5 1;  2GME A;  1MZ6 A;  5ACA 3;  2FHR A;  5DAP A;  5JLV A;  3VUO A;  2Y34 A;  4XEZ A;  2W92 A;  5LCW L;  4BIF A;  1AX2 A;  3RI8 A;  1LOD A;  4A2U A;  4QPI A;  1PM7 A;  1ENQ A;  4CE8 A;  2ZEX A;  1TG7 A;  3RRD A;  1F35 A;  5DAB A;  3SHR A;  1SLL A;  4QB1 A;  3GZT B;  3PUI A;  2D6K A;  2E26 A;  5FAX A;  1RUG 3;  4QPW A;  4X8N A;  1VRH 3;  1LGN A;  3MO4 A;  1C8M 1;  1TE1 B;  2OVU A;  2WT2 A;  3ZXK A;  4CCD A;  4CVU A;  5GLW A;  1QQP 1;  2R0F A;  2VZQ A;  1PIV 2;  3OY8 A;  1W8U A;  4MET A;  3IDE A;  3T4V A;  5FOJ B;  5JMO A;  2P2K A;  1BVV A;  4TXW A;  1VBE 2;  1DGW X;  1YHF A;  3W9A A;  2JEM A;  2ADD A;  5GLU A;  1MQT A;  4X8P A;  5K7P A;  3N4M A;  5L9R A;  2RR1 1;  5F3E A;  3H50 A;  4NHX A;  1RVF 1;  4JCK A;  1GUI A;  3VD9 A;  3KT7 A;  1S0B A;  3LEI A;  4AGG A;  4NOT A;  1AX0 A;  1X50 A;  2GN3 A;  3U78 A;  1UF2 C;  5HCH A;  1JHJ A;  4BA6 A;  5BNO B;  3TOJ A;  1RIT A;  1CZT A;  5A7W A;  3FFZ A;  5I8T A;  1QXJ A;  5JAX A;  3MFA A;  1WWY A;  3I4I A;  1SAC A;  3W58 A;  2Q8C A;  1XNB A;  2NMO A;  3J4U H;  4YPJ A;  1OKQ A;  4AQS A;  5JPN B;  4CXW A;  1JZ5 A;  4LNV A;  4L2N A;  3EXU A;  2ZGU A;  1ULF A;  1XE0 A;  4OHX A;  1R08 1;  1UMI A;  4IEV A;  2A7A A;  2XQR A;  3O12 A;  2Z42 A;  3AMQ A;  3B3Q E;  3Q8F A;  5A7W B;  2P6C A;  1UIJ A;  2YPJ A;  2ZGN A;  2ZXQ A;  4CYD A;  4Y26 A;  2VCC A;  2GMM A;  1IG0 A;  1M4W A;  1NX9 A;  2X8K A;  2FCT A;  2OYZ A;  1AR6 3;  2A1X A;  1IG3 A;  5FYZ A;  3CJI B;  5DDJ 1;  1XU2 A;  3WDY A;  3JQW A;  2HWF 1;  5KHI A;  2GAL A;  4IE0 A;  4XVH A;  2YBS A;  2R16 A;  2Y6H A;  2QQV A;  2OPK A;  2WNU C;  4NHL A;  4I09 A;  4QU1 A;  3CLP A;  3ZFE B;  1WME A;  1G9F A;  5A3T A;  3O0W A;  1PK6 C;  1VMJ A;  3T0B A;  2Z4F A;  1YUD A;  2DTY A;  3KCC A;  5DAQ A;  2VQA A;  1R64 A;  4JDN A;  4EN7 B;  1AR6 2;  2V5Y A;  1COV 1;  2RR1 2;  2GC3 A;  4GB3 2;  1HQN A;  1O8S A;  3IN9 A;  4OCT A;  1H1M A;  1O4Z A;  2Y6G A;  3TEY A;  1R1Z A;  1WBF A;  3WNP A;  2YY1 A;  2YC0 A;  3KGL A;  3LIG A;  4J1W A;  2IWG B;  2XUM A;  3AKP A;  2DU0 A;  3H9A A;  2YYO A;  3ILR A;  3OPW A;  4YZ3 A;  3T4H B;  3AYD A;  4P9G A;  1SCR A;  4CP1 A;  1C8M 2;  2TNF A;  4XQ4 A;  3RYK A;  5FP4 A;  1YQ5 A;  1KS4 A;  4ISR A;  1CZS A;  1VBB 1;  3VKM A;  3VDA A;  3ES4 A;  4AQT A;  4PQQ A;  4ET7 A;  4B3N A;  1H8T A;  3WF1 A;  4YG6 A;  1RJ7 A;  1DYP A;  2GU9 A;  2Q5T A;  3POB A;  4WVW A;  3WG3 A;  5JOX A;  3MLJ A;  2FD8 A;  2FZ2 A;  4JC1 A;  3M70 A;  5FMO S;  1VP6 A;  4E27 A;  2JG9 A;  4IUG A;  1HB1 A;  4CU8 A;  1S0F A;  3LDR A;  2AEY A;  5JWP A;  4UI9 L;  4N43 B;  1WBL A;  5FPA A;  4OFG A;  3QAC A;  5F3G A;  3U14 A;  4H7L A;  2VVE A;  4OZX A;  2XVL A;  4KBZ A;  2Z5W A;  5F32 A;  5EJ3 A;  3UES A;  2XOM A;  2ARC A;  4NPM A;  5FPZ A;  2EAK A;  4GXL A;  4LLF A;  3VL9 A;  1GKB A;  1W9S A;  1GZ9 A;  3ETP A;  4YM0 A;  1JMU B;  1PIV 1;  1OA3 A;  4MH0 E;  1APN A;  3KQ4 B;  4QKN A;  5AFB A;  4CU7 A;  3MW4 A;  1V6L A;  4N9I A;  3LAG A;  4TSV A;  4GZ9 A;  1YQ8 A;  4LBQ D;  2Y6F A;  4EWE A;  1BBT 1;  3PU8 A;  5IAT A;  3ZXJ A;  1W6N B;  3WHT A;  3WEZ A;  1V6I A;  2WYS A;  1Q5O A;  2ZGR A;  5BV6 A;  2IXL A;  4XBL A;  5JCT A;  3NNL A;  2WZP P;  5HV4 A;  1MZF A;  2JD4 A;  5L7O A;  4FOY A;  4W8J A;  3VBS C;  4Y33 A;  1R1A 3;  4Y24 A;  5JUV A;  1XU1 A;  1Y43 B;  5A33 A;  2FCV A;  3ZSK A;  2B39 A;  5IFT A;  1KIT A;  4KWJ A;  2R32 A;  1DGR A;  4Q0Q A;  3D3A A;  5HV0 A;  2HBT A;  2GNM A;  2JD9 A;  2OPW A;  3GZA A;  4GJY A;  1ZM1 A;  1W3V A;  1R09 1;  2A6V A;  3RYP A;  1JYI A;  1G9D A;  3MIH A;  1RUE 3;  3INA A;  5C3R A;  1UIK A;  3WP6 A;  3AJZ A;  2X29 A;  3VBH B;  4QKD A;  2OS2 A;  1LU1 A;  2VMF A;  1MEC 2;  4LO8 A;  4A6S A;  1V9U 1;  1W2O A;  3SH5 A;  1GQG A;  3A22 A;  3WP4 A;  3E5X A;  5K8S A;  1TMF 2;  5D2A A;  3NAP B;  1AR9 1;  1QNY A;  5BNQ A;  2VVD A;  4UFH A;  3S5A A;  4YLZ A;  1TQ5 A;  1MS1 A;  3F95 A;  2A6W A;  5CFC A;  5F5C A;  4ARY A;  1W2N A;  4JKK A;  1SBF A;  3VKO A;  1HRI 3;  2AZ5 A;  3WNL A;  1PK6 A;  1N1Y A;  2ILM A;  4XAE A;  1CJD A;  1JU4 A;  3BUC A;  2VMH A;  1AUY A;  1NE4 A;  1V6O A;  2Y60 A;  2DWR A;  4FT8 A;  4XHX A;  2GH2 A;  4CDW A;  1FI2 A;  3TN9 3;  5CBL A;  5JSO A;  4XIL A;  1LNS A;  3ZSM A;  3ZXD A;  2ZGT A;  1GBG A;  3RDI A;  3ZDV A;  4ZU5 A;  2D5H A;  2AEZ A;  3H1M A;  3CL1 A;  4YW5 A;  5DUV A;  4YG0 A;  3K48 A;  4XDP A;  1MR5 A;  4CDW C;  4QKB A;  3MZH A;  1W0P A;  2Q1M A;  1X82 A;  1VLN A;  3DYM A;  4EV0 A;  1H2K A;  1I1E A;  4W50 A;  5DUX A;  1ULD A;  5C3Q A;  2VH9 A;  1YWK A;  4P02 B;  2QQI A;  5C70 A;  1FMD 3;  5DAW A;  3IAP A;  3UGF A;  1I5P A;  1WW7 A;  4XFA A;  3OPT A;  2WRA A;  1IQA A;  2A75 A;  2K9Z A;  2XVG A;  2WZ8 A;  4X6R B;  3W59 A;  4QDR A;  3QD6 A;  4TLF A;  2R1B A;  2W3J A;  1FPN 3;  2RM2 2;  2BVB A;  2R06 2;  5FZA A;  4AVC A;  4M0H A;  5EJ1 B;  4NE9 A;  1VBA 3;  2CY6 A;  1YIP A;  3B01 A;  3N35 A;  2ZMN A;  3O7O A;  5IW0 A;  1Q8P A;  1E5H A;  5JI9 A;  2W1Q A;  5FYY A;  1V9U 2;  4ZS2 A;  1NA1 A;  3I3M A;  3KM5 A;  5H9S A;  3HJR A;  3NVC A;  4K9S A;  4RD7 A;  4UAP A;  5I0D A;  3PUS A;  2IXK A;  3ABZ A;  2P37 A;  3DCQ A;  5FZ0 A;  4Z92 B;  3FX3 A;  4Q4W 2;  1REE A;  3HBK A;  3KT4 A;  1MS0 A;  2ZBJ A;  4QAW A;  3DEC A;  4S2G A;  2VCM A;  5JXI A;  2NM1 A;  4DUW A;  4XHB A;  3RYR A;  2X09 A;  4NJ4 A;  3UKT A;  4XBQ A;  1UNB A;  3CIH A;  2VNO A;  1VBC 1;  1W6O B;  4RHV 2;  4LBQ B;  2WAO A;  1IOA A;  2ZHK A;  1VJ2 A;  5JSR A;  1D4M 1;  3ORJ A;  4EQV A;  1TMF 1;  2CGN A;  3H8O A;  4ES9 A;  2G1M A;  3U0Z A;  2P3I A;  3OY8 B;  5GM0 A;  4QQO A;  4EN0 A;  1QNW A;  2QZ2 A;  1HJG A;  3OBA A;  3MV0 1;  1FOD 3;  1Y4W A;  3GZU C;  3B9C A;  4N43 A;  3VKF C;  3BI3 A;  2VL4 A;  5EXO A;  4D3W A;  1NUK A;  2ZX3 A;  2ZOE B;  3AMM A;  3K2O A;  1BYH A;  2UY8 A;  3W20 A;  3L9J T;  1RVF 2;  1ASJ 3;  3BYW A;  1RUD 3;  3VBO A;  4Z2W A;  1CVN A;  1OQD A;  2H0V A;  5F9T A;  1EYB A;  4UXA A;  5IVV A;  1FT9 A;  3VBF B;  4QHO A;  2BQP A;  3FLP A;  1PM4 A;  1IS3 A;  3R4S A;  3N9Q A;  1WKY A;  1VB4 A;  3H1W A;  3T0A A;  3KV5 A;  3VGI A;  2P3J A;  4RHV 3;  2VOV A;  5FY4 A;  4FOV A;  1F5F A;  1MEC 3;  2RMU 2;  1X33 A;  2BP6 A;  5L7O C;  4JZR A;  3RZL A;  4XUN A;  3R05 A;  1NZC A;  2W46 A;  4QX0 A;  5TSW A;  3GBF A;  5BNN C;  2A6Z A;  4HSJ A;  2HKX A;  3MF6 A;  2GP3 A;  5CFD A;  3ZFG C;  4YZ5 A;  5C33 A;  3BTX A;  1RB8 G;  2OQ7 A;  2JIJ A;  1CAW B;  2UY9 A;  3EJK A;  4ZZ8 A;  1G9C A;  1QKQ A;  2PHW A;  1LOE A;  4LO7 A;  1LHU A;  1WMD A;  1VBD 1;  4DQA A;  1B09 A;  5FXZ A;  3HBZ A;  1PMJ X;  2WWJ A;  1WCQ A;  2LRP A;  2YPD A;  3MEP A;  2VVF A;  2VTF A;  4RQP C;  2HLE A;  4WVV A;  3IDB B;  4E8C A;  5AVA A;  3ZFF B;  1QMJ A;  3ZKY A;  3OBR A;  1POQ A;  1KGY A;  2JE8 A;  3F2Z A;  4BK4 A;  3FFQ A;  2R49 A;  4QDQ A;  1H2M A;  1EUT A;  1YYN A;  4UW4 A;  5LK5 A;  4YYO A;  4G3Y C;  3P5B A;  5A7N A;  4HPK A;  4JDM A;  4CDX B;  5B2G B;  1H30 A;  2WJS A;  3ILF A;  3PUR A;  1SDW A;  1H9W A;  3ZDS A;  2ZKL A;  4LBO A;  4AVT A;  3HIF A;  4COU A;  1ALY A;  3FHQ A;  4QB6 A;  3T2O A;  2W1U A;  1N1V A;  1OFS A;  2VQU A;  4XFF A;  5A7O A;  3W5N A;  4QM9 A;  4QXK A;  2ID4 A;  2K2S A;  2IXC A;  5FZG A;  5B4N A;  3ZFF A;  2PFW A;  4FFH A;  1AYN 1;  2PHT A;  1J83 A;  2ZEY A;  3GJB A;  4FCA A;  4Y5T A;  1AR6 1;  2VUJ A;  4ORF A;  2VD7 A;  4CDQ B;  3AKS A;  4HVQ A;  3ZVX A;  5J1X A;  4FO9 A;  5IVC A;  1IPS A;  2K0G A;  4TYS A;  5LA9 A;  1HRI 2;  3AC0 A;  4YVS A;  4V2V A;  3VZN A;  1PVC 2;  3O1T A;  4FTB A;  1WW4 A;  4D7Y A;  1FX5 A;  2VUC A;  5DUU A;  4AEJ A;  1UKG A;  2AH2 A;  3MBW A;  3GNE A;  1QOO A;  2PLV 3;  2WIN B;  2G19 A;  5FWE A;  2F6B A;  5JOY A;  2RJL A;  5A3U A;  5KHG A;  1RUG 2;  3KV9 A;  1CAX B;  1NLQ A;  2DVD A;  3GJA A;  5E1R A;  1Q3E A;  1QF3 A;  2VCB A;  4S2H A;  1RUE 2;  4RQP B;  1B35 B;  2VOK A;  4MGI E;  4BYY A;  3P1I A;  1V9U 3;  2WAA A;  4CP9 B;  5FJH A;  1PO2 1;  4F3J A;  3E5U A;  5JOZ A;  5FZO A;  1LED A;  4CCC A;  3LPG A;  3ZYP A;  4OZO A;  5LB6 A;  2JIC A;  4QU2 A;  1TME 3;  5B4X A;  5FP7 A;  1LEN A;  4I02 A;  5IWF A;  1H0B A;  4AHZ A;  4C8D A;  4CXX A;  4Z2A A;  1RUJ 2;  1JZ4 A;  1RIR A;  2WQ8 A;  4EN6 B;  3GF6 A;  4LEJ A;  1Y7B A;  5FY9 A;  4AOC A;  3K75 B;  2EIB A;  4A4A A;  1OA4 A;  2V4V A;  2PLV 2;  3AXE A;  2BBA A;  3NV1 A;  4MAD A;  5A32 B;  1JYT A;  2VZS A;  5DAV A;  4JQT A;  4Z82 A;  5BYN A;  2B9V A;  2RMU 3;  2CHH A;  2CSG A;  5D8A B;  3KS7 A;  4LA2 A;  1LHO A;  2DCT A;  4XUQ A;  4I0B A;  3GHM A;  4DB5 A;  1K42 A;  4Y1X A;  4B29 A;  1S0D A;  5DZF A;  1CZV A;  3C7O A;  1PZ8 A;  5C3P A;  2XJT A;  5A7Q A;  4N53 C;  4IE4 A;  4LPL A;  4PIX A;  4OQ9 A;  2BGP A;  2BBV A;  2PHD A;  3WY6 A;  3H3Z A;  4DZG A;  3BN6 A;  3VL8 A;  1CD3 G;  1PGL 1;  2VW2 A;  3M2M A;  1V6N A;  1ZRI A;  2JDK A;  5G04 L;  2BGC A;  2Y26 A;  3CNA A;  3WR0 A;  5CA6 A;  4BWO A;  5L9V A;  2R04 2;  4QQH A;  4AFA A;  5CKN A;  4LKE A;  2J1T A;  3G6J B;  1VMF A;  1ND3 A;  2R6Q A;  1WZX A;  2Z69 A;  2WNV B;  3ZR6 A;  4CDU A;  5I0T A;  1C28 A;  2GC1 A;  1ND2 B;  2FDK A;  4UFK A;  3SCG A;  5DPN A;  1O3T A;  4Y1Y A;  1PZ9 A;  3LA3 A;  4AAP A;  4HSL A;  3NKG A;  1F5J A;  2W68 A;  4B7E A;  5C7G A;  3LD8 A;  2C9A A;  1XC6 A;  3K4A A;  1X8M A;  3O1R A;  4CP2 A;  1O4Y A;  2XJR A;  1AZD A;  4GAL A;  4K7J A;  2LTN A;  5J48 A;  4NRQ A;  3BU0 A;  1ZZB A;  1CAV B;  1NAE A;  2WZR 2;  3OPZ A;  1ZRF A;  3CO2 A;  2OII A;  4H7M A;  2PHR A;  2JDN A;  4RGA A;  2QQJ A;  3ZFG B;  4KWK A;  3MV1 1;  5ABJ B;  2XKP A;  3EQE A;  2YBP A;  1W6M B;  4EN8 B;  5ISL A;  3A7Q A;  2X5I C;  3SH4 A;  2WFF 1;  3I7D A;  3JBG 3;  5D21 A;  1IKQ A;  1KJL A;  4IV3 A;  3WNO A;  2EXI A;  1GNY A;  1U5Z A;  5F1R A;  2N7G A;  1GWL A;  4I3G A;  2Q4S A;  4GJZ A;  4MGY E;  1BZW A;  3FHA A;  2K46 A;  3I49 A;  4CZS A;  4O9E A;  4XUP A;  3MFC A;  4XJU A;  1LOG A;  1YNA A;  3M8L A;  1LR5 A;  4M01 A;  3WP3 A;  2ZMK A;  3USS A;  1S0E A;  1B35 A;  3HN3 A;  4CPB D;  4P9Y A;  3T09 A;  2R07 1;  2AEN A;  1RUG 1;  1US3 A;  2WFF 3;  3NJV A;  5C3O A;  3SC7 X;  2MHF A;  4XTM A;  3ITQ A;  1X9P A;  4LUM A;  3UV9 A;  4MOA A;  3ZM8 A;  4ZKT B;  3OOX A;  4RHV 1;  5FY1 A;  3TWI A;  1BMV 2;  1RUF 2;  3JU9 A;  4I0W B;  4ZU4 A;  1LB2 A;  1LHN A;  2VMI A;  3AP9 A;  4HKO A;  2YC4 A;  4JTO A;  4KQ7 A;  5FZM A;  2HWD 2;  3AP7 A;  4HPK B;  4UW3 A;  1XXN A;  4D6Q A;  2VZ3 A;  4JHT A;  1NXM A;  2DUO A;  5IVE A;  1WLW A;  5GZG A;  5IAX A;  3WZ1 A;  4K8R B;  5IAV A;  3EHK A;  1JYN A;  3M3O A;  4WM7 C;  4P9I A;  1ZRD A;  1RGS A;  2MEV 3;  4NIG A;  1VBD 3;  2ZX4 A;  3M3I A;  3N7M A;  5IK5 A;  4NWW A;  1CR7 A;  5FZC A;  3FMG A;  2WFP A;  4HN1 A;  4HT1 T;  4DS0 A;  1W6N A;  1QQP 3;  3DEM A;  2P4E A;  1BHG A;  2D3R A;  2NQY A;  5HCF A;  2VZR A;  1OI6 A;  3AYA A;  3BPS A;  4Q4W 3;  1R08 3;  2MEV 1;  4HZF A;  5LEJ A;  1OQ1 A;  3OEA A;  1XJA A;  2JJ6 A;  4AL9 A;  4ERO A;  2VUD A;  4N9H A;  4ASK A;  4L8Q A;  2NLR A;  4YSF A;  4Z8B A;  3K51 A;  4MX3 A;  5FWJ A;  2FDI A;  4A3Z A;  1LKN A;  3KGZ A;  3RZK A;  5E88 A;  2AUY A;  4GQ7 A;  1W8O A;  3I59 A;  4Y4R A;  2QJV A;  1EV1 1;  1HB3 A;  1LOC A;  1WCU A;  3WQ0 A;  5BNO C;  1W2T A;  4I0A A;  4P9W A;  2R04 1;  4KGG A;  1ZA4 A;  3SXW A;  2NP0 A;  4IV1 B;  2HJI A;  3OUJ A;  4DFS A;  3VBR A;  1MS9 A;  4NAO A;  3TEX A;  4E4D X;  5KHK A;  1OLM A;  2EIE A;  1RIN A;  1VBD 2;  4FXK B;  4Q4Y 1;  5FZ3 A;  5FYM A;  4COW A;  4FOW A;  5GZC A;  3DV8 A;  2ZTN A;  2R1D A;  3KB5 A;  4CCK A;  2JE9 A;  5BPX A;  5L9B A;  2ZGK A;  4N53 B;  4DIQ A;  1OOP C;  3D82 A;  1AR8 3;  2ZGM A;  4XC9 A;  2R30 A;  2ZZJ A;  4BQY A;  2ZGL A;  2YV8 A;  3WUC A;  2W52 A;  3ZYF A;  5F8P A;  3VBF A;  5I8Y A;  2RDR A;  1RUF 3;  4KG0 A;  1S2K A;  1VPH A;  1N3P A;  3AYE A;  5FQ0 A;  4Q0P A;  4IV3 B;  3B93 A;  5C8W A;  2G4I A;  2XLF A;  1C5I A;  3WIN E;  3O1M A;  2FDF A;  3RVH A;  5C4W A;  4OVE A;  3GBG A;  4CDU B;  2YBK A;  2D44 A;  1LHW A;  2QQK A;  2ZAH A;  5AC9 1;  1W6O A;  1HRV 1;  3IWZ A;  1AR8 2;  1L3J A;  3BCW A;  3K3N A;  1OH3 A;  4LBL A;  3S5Q A;  4ASL A;  4K3U A;  2D97 A;  2DCK A;  3BVC A;  1FNZ A;  2O8O A;  1C4R A;  5ANN A;  4IEW A;  3O1U A;  1Y3T A;  1J59 A;  1CES A;  5FZ4 A;  3UKN A;  1DLC A;  1W03 A;  3ZN6 A;  4QX2 A;  1UY4 A;  3MID A;  4IEX A;  3HD8 B;  3K4Z A;  2ORX A;  1DFQ A;  2WZE A;  3JB8 A;  3N9P A;  4IES A;  4RFR B;  1PHM A;  3UGG A;  4AHY A;  4FFI A;  1ZX5 A;  1F8V A;  2XXZ A;  3OSD A;  4OMC A;  1ND3 B;  5F3I A;  1OD5 A;  4HMZ A;  3J7N A;  4QDS A;  4AWD A;  4EE2 A;  3AX4 A;  1A34 A;  1YQ6 A;  2LM3 A;  3ZXF A;  1VB2 A;  5J3U A;  1OXC A;  4A7Z A;  4Q4Y 2;  5HXM A;  2OT7 A;  1YO8 A;  2EXH A;  2W91 A;  1NA1 B;  2EA7 A;  1CGP A;  3GCW A;  3TB0 A;  2KM2 A;  1C1F A;  1PGW 1;  2WKK A;  3ZYJ B;  2C24 A;  2XJS A;  3WDW A;  2CDO A;  2QQW A;  3A0N A;  1QJU 3;  2YXS A;  4TZD A;  1OOP B;  5GLZ A;  5CKQ A;  4NID A;  4RFT 0;  1YQ2 A;  1OLR A;  1XBF A;  2B45 X;  2C26 A;  2YGL A;  2OKX A;  2SLI A;  2CNA A;  4AI9 A;  5C9A A;  2QKD A;  2JG8 C;  5CZK A;  1YXW A;  3U75 A;  3ZYH A;  5FO7 B;  2HWE 1;  1W6Q A;  4DUV A;  3GDB A;  2JB8 A;  1I5Z A;  4Q4X 3;  1H4G A;  1VE0 A;  2YU2 A;  4JQR A;  4CUC A;  2E53 A;  2ADE A;  1QJU 1;  2DF7 A;  2WYF A;  1JUI A;  3AP5 A;  3WG2 A;  5LZ6 A;  2YMZ A;  2BTV C;  2XR4 A;  3N7J A;  4FFG A;  4DY3 A;  4CTE A;  2OQ6 A;  2VGD A;  3WV6 A;  4OYU A;  2GDF A;  1NA1 C;  1SLA A;  2GND A;  2OX0 A;  1KDK A;  1BBT 3;  1CAX A;  1VBC 2;  2A6Y A;  4XYX A;  2CV6 A;  4LA3 A;  2XWB B;  3PME A;  1H6X A;  4JKM A;  5CAZ A;  2I45 A;  2QTW B;  4NO4 A;  1LRH A;  5FY8 A;  2EIC A;  1H1A A;  4M3C E;  5KWR A;  2HWC 3;  2PHF A;  3N7K A;  4C0B A;  4HON A;  2ZAC A;  1AHS A;  4ZZ5 A;  3SMH A;  5A1L A;  5IVJ A;  1HX6 A;  2RG4 A;  3VBH A;  5GZE A;  2H6C A;  2W08 A;  3CU7 A;  4CXY A;  3A23 A;  4HK9 A;  3ZMN A;  5DG1 A;  3NO8 A;  4QGL A;  4BPZ A;  1W8F A;  1D0G A;  1DU3 D;  3KCY A;  2RJK A;  2WSU A;  3NL1 A;  5LBC A;  3URF A;  3WQ7 A;  5A6Z A;  2AGS A;  5FY0 A;  4XTP A;  3JBG 2;  4RR3 C;  4AW7 A;  4PF5 A;  5L7O B;  2QUO A;  2Y33 A;  1YFX A;  2W1W A;  3ZSE A;  2QDR A;  1DHK B;  1K3I A;  4OLL A;  3HNB M;  1RXF A;  2EXJ A;  3QLQ A;  4CDX A;  4UF0 B;  1DQ2 A;  3OB8 A;  3JD7 2;  4FQZ A;  4U2A A;  3U1X A;  4QX8 A;  4R9B A;  1URX A;  5DMY A;  4QT6 A;  2EID A;  1OPM A;  1JBC A;  5BUV A;  4WM8 A;  3WNK A;  1C1L A;  2P6H A;  2WSV A;  1PGW 2;  3I54 A;  2VQ0 A;  1HV0 A;  5FKC A;  3AKT A;  3MUY 1;  5A33 B;  1OC1 A;  5DAX A;  2DVA A;  5EHD A;  5EYX A;  4AFM A;  4AYU A;  2WO3 A;  4M4R A;  5FY7 A;  2D93 A;  3LPF A;  4WM8 B;  4RS5 B;  4NIA A;  3V64 A;  1OUS A;  1ZBE 3;  4QQL A;  1MPX A;  1RUD 2;  3U07 A;  1V00 A;  4A7Y A;  1JI6 A;  1HJF A;  2Z2S B;  3P3N A;  5H9Q A;  1GYK A;  4UF0 A;  1MZ5 A;  4MLO A;  1H8T C;  2ZGQ A;  1QIQ A;  3JQX A;  4QPG A;  1W8H A;  2IVJ A;  2RM2 1;  2WLQ A;  5FY5 A;  1VAL A;  3MLK A;  3THT A;  1PMI A;  2E9Q A;  2NZ9 A;  3KCX A;  3MIF A;  3POJ A;  1K5M B;  2E33 A;  3OCP A;  3P6B A;  3HQX A;  1NCR A;  4XAA A;  2NPI A;  5LY2 A;  5T5P A;  3VBS A;  3WHU A;  2RDN A;  2VZ1 A;  1J58 A;  3BOW A;  1LOF A;  1Z7S 1;  3PUA A;  3I2O A;  5FZK A;  2PEL A;  4BME A;  2JXA A;  1WLC A;  5DZG A;  1GP6 A;  3OGG A;  4RN5 A;  2WS9 2;  4IGP A;  1F4A A;  1S4C A;  5T5L A;  3WNM A;  1RUH 2;  1I9R A;  3T30 A;  5HI0 A;  1YCI A;  2XBO 2;  1W9Y A;  2FZ1 A;  4HG6 B;  3B00 A;  2RVA A;  1QJX 3;  4QPI C;  3HPN A;  1OUR A;  1PO1 1;  1W8T A;  4A44 A;  2V09 A;  2D3P A;  4HBN A;  2XG3 A;  4QXC A;  4V2W A;  5DZE A;  3VHR A;  1OHF A;  5LA2 A;  4BZ4 A;  4QD2 A;  4GH4 C;  4XFH A;  4E4Z A;  3III A;  3R4D B;  5FYU A;  4H55 A;  2RV9 A;  5FCC A;  5J37 A;  5FXX A;  2D6L X;  3PMS A;  1EAH 1;  4WM7 B;  2G9Z A;  3AFK A;  5F5Q A;  2DVF A;  4BM8 A;  4JHZ A;  1IPJ A;  2DYC A;  3GXU A;  1C5H A;  3H3L A;  4FTE A;  2E32 A;  1RED A;  3ROU A;  2R0H A;  4R9C A;  4GAZ A;  5F2W A;  4XE9 A;  2WO7 A;  2UU8 A;  4PF1 A;  4XOG A;  5K0U C;  2H0B A;  1LEC A;  1PVC 3;  4MZU A;  4B4P A;  3ZN5 A;  4D6S A;  2JG9 C;  4PDW C;  2XJV A;  1RXG A;  3SNM A;  3WVJ A;  1TNF A;  1HRV 3;  3J26 N;  1NKG A;  2BER A;  3E5Q A;  1LJ7 A;  1PGS A;  3MW3 A;  1O3S A;  5BY5 A;  4LHL A;  3VD7 A;  4NII A;  1YQC A;  1SMV A;  2YFU A;  2BDR A;  3H8U A;  4XJZ A;  1L7L A;  2RDQ A;  2YU1 A;  2WT0 A;  4XF9 A;  4YZ4 A;  1MEC 1;  3VHN A;  1RUH 1;  2Z79 A;  3VDC A;  4PLM A;  1HXS 3;  3THC A;  3KSC A;  2W5F A;  3IZO A;  5EV7 A;  3AYC A;  4IEZ A;  2HEW F;  3UYJ A;  2ENR A;  3U4S A;  4PQ9 A;  3ZYB A;  3JCI A;  4MGS A;  4QB2 A;  1Z7S 2;  3QBQ A;  2C1F A;  3BB6 A;  5CVR A;  4IGQ A;  4JDO A;  2BNO A;  2VOT A;  4K40 A;  4PIY A;  4NHY A;  5FPV A;  3AM2 A;  3QH7 A;  1LOF C;  3LEM A;  5FJK A;  4FQ4 A;  3NV3 A;  1Q8Q A;  5FXV A;  5FMB A;  3H7Y A;  2RS5 2;  5C4W B;  2QCS B;  4AG4 A;  1JOD A;  4NMI A;  4A6O A;  1PVX A;  1QWR A;  5FPU A;  3OEB A;  4WVM A;  4M4P A;  5A7P A;  1JU3 A;  2LW8 A;  4YWA A;  1G8W A;  1MQT B;  5G05 L;  2BYV E;  4QPI B;  3THD A;  4LTA A;  4WV8 A;  3KWV A;  3ZSL A;  1T6B X;  5L19 A;  1BK1 A;  3POE A;  2H6B A;  3DKW A;  4N53 A;  1QJF A;  3M3C A;  4GB3 3;  4OHV A;  5KBF A;  5DDJ 3;  2VZP A;  3RFR A;  4AGR A;  4LUL A;  5FXW A;  4EYU A;  4OI2 A;  1KRI A;  2IVI B;  4XUR A;  1AR8 1;  5FYC A;  1O91 A;  3Q8A A;  5LY1 A;  3TEW A;  1Q8O A;  3WDU A;  1BEV 2;  3J7L A;  1O5U A;  4ES8 A;  4AEK A;  4L92 A;  2JDZ A;  3FN9 A;  3N9L A;  3UL2 A;  1UWW A;  5FLJ A;  1K5M A;  2FCU A;  3ELN A;  3LB9 A;  1MVE A;  4LK6 A;  2VR4 A;  4ZY9 A;  4UT5 A;  3B02 A;  5FZF A;  1NQJ A;  1NCR B;  3KVA A;  4PCR A;  3UT0 A;  4AZZ A;  2ES3 A;  2L9L A;  1LEM A;  3OGJ A;  1ZBA 2;  1U5X A;  4M0N A;  4ZXE A;  4KU7 A;  4MSV A;  4XQW A;  4UFM A;  1H9P A;  2PMW B;  4FXG B;  5T55 A;  1UOB A;  3V56 A;  2HWF 2;  4BE3 A;  4IER A;  4JTN A;  4RS5 A;  2NN8 A;  2C0Z A;  3VBS B;  2WQZ C;  1NG0 A;  5CIS A;  3WF0 A;  2DVG A;  4XFI A;  4ATF A;  2XVK A;  4URT A;  2GN7 A;  2PYT A;  1IHM A;  1LHV A;  5T3N A;  1RUJ 1;  4OUE A;  1POV 1;  4XF1 A;  1AYM 1;  2GH8 A;  2GSY A;  3AL5 A;  3QCW A;  4KNC A;  5FIX A;  1KEX A;  4NPL A;  3TN9 1;  1J3R A;  2IC1 A;  4QPY A;  5JOW A;  1JUH A;  4NVP A;  4L11 A;  1BVP 1;  3SKJ E;  1JTZ X;  3ZFE C;  5I91 A;  5DDJ 2;  5CB7 A;  2B9U A;  2VXR A;  4NIH A;  3ENR A;  3FJS A;  3RPQ A;  1BQP A;  1FYU A;  3ZO0 B;  4EN9 B;  1O4T A;  3HT2 A;  2CGO A;  1NLS A;  3CBN A;  4PJY A;  2BNM A;  3GCX A;  3PVN A;  3AB0 A;  4AI1 A;  4Y22 A;  1VAK A;  1VBA 2;  4LBN A;  4TLG A;  2QQP A;  1GFF 2;  2WZR 3;  4Q5O A;  1U12 A;  3T2P A;  3ACH A;  3VLB B;  4S2F A;  1LGB A;  5FP9 A;  1XNT A;  4EZH A;  4LHK A;  4D94 A;  2O14 A;  4B1M A;  1QJX 2;  3I2F A;  3GHN A;  4WZF A;  4Q0S A;  3E6D A;  3ECQ A;  4Y1U A;  1Q56 A;  3I3E A;  4KG8 A;  4E2S A;  2BV4 A;  2JKB A;  3ZLI A;  5H9P A;  2NMN A;  3APB A;  3S57 A;  4CPB A;  5JXG A;  2D40 A;  4ZU7 A;  3DYP A;  5FO8 B;  5DUW A;  3U11 A;  1LUL A;  1WCK A;  3UET A;  4HL0 A;  4AQ2 A;  1XNK A;  4AHX A;  3AVS A;  5FYT A;  4XJ8 A;  4XJW A;  3BTA A;  2BW8 A;  3FWE A;  5ABJ A;  1JOJ A;  2VNG A;  2JDP A;  5A1A A;  1UZZ A;  3DN7 A;  2VW0 A;  3JBG 1;  2QBX A;  1OT5 A;  4IEQ A;  1BJQ A;  2ZKN A;  3TRS B;  1DCS A;  5LEK A;  2DCZ A;  3RS6 A;  4AED B;  4PIZ A;  2FBE A;  2XJQ A;  4Q1R A;  4XUO A;  3ACL A;  3T2Q A;  4ARX A;  3PHM A;  2VM9 A;  4BIS A;  1T2X A;  2VMG A;  3I8T A;  1LOA A;  1SFY A;  5FPX A;  1GZW A;  1JYC A;  1W6M A;  2R07 3;  1W9W A;  2E31 A;  3IM0 A;  5I0U A;  3WCS A;  4D8M A;  1B35 C;  5ACA 1;  3ZX7 A;  1J1T A;  1BXH A;  1CPM A;  4R4X A;  4CUA A;  2Q0A A;  2JB4 A;  3ZFE A;  2W9X A;  3T1M A;  2VME A;  1CAV A;  5KHJ A;  3J9S A;  4K20 A;  2BRT A;  3WCR A;  3FLR A;  4KI5 M;  5JXH A;  1IKP A;  1ASJ 1;  4Q4V 1;  1RUI 3;  4YZ1 A;  5FUN A;  1ODN A;  2I2S A;  1AR7 3;  3D8C A;  2BJS A;  5IJR A;  3MF9 A;  5GAL A;  2UWC A;  4BH9 A;  2AYH A;  1AXK A;  3LSE A;  4W6Y A;  4KWU A;  3PUQ A;  1W05 A;  3MI8 A;  5FYI A;  3VBF C;  3ZYI B;  5FZL A;  3KV6 A;  1A8M A;  2ZML A;  2IFW A;  2PHU A;  5JZG B;  5A3O A;  1DP0 A;  1PVC 1;  5C4W C;  1CN1 A;  2RS3 3;  3ON7 A;  1EUU A;  3BPZ A;  5J7M A;  4RL7 A;  1TVG A;  4COV A;  1GMM A;  1WCS A;  4CCL A;  1ZBE 1;  3LA7 A;  3T3Y A;  5GZF A;  1JOP A;  3L2Y A;  5GLT A;  4XCA A;  4YM1 A;  1K12 A;  3T08 A;  4XW3 A;  5C8C B;  2BFU L;  2ARE A;  2GAU A;  3N9N A;  5FMC A;  2PXJ A;  2V72 A;  2QQO A;  1YJK A;  4DRR A;  5FZD A;  4AAX A;  1G9A A;  4OMD A;  4AE2 A;  2J1A A;  3ZXA C;  3WD5 A;  1ONA A;  4GMP 1;  2BWC A;  2JDA A;  1Z7S 3;  4J1X A;  3VDD C;  2Y0I A;  2JEN A;  5FRE A;  3ZFF C;  1FAT A;  4YW7 A;  4AEM A;  1SZB A;  5F6L B;  1W04 A;  3ZOI A;  2D6O X;  2BZD A;  2J1E A;  1UY1 A;  1XQN A;  5JSP A;  1VBE 1;  1DGR N;  1QU0 A;  2G9G A;  3CHX A;  3NV2 A;  4R52 A;  4W4Z A;  3VDD A;  1RVF 3;  4PBP A;  4Y3O A;  4GMP 3;  5ERL A;  4D0Q A;  3OTF A;  1D4M 3;  3NNM A;  4P9L A;  4B4Q A;  1QJX 1;  4Y20 A;  1H1I A;  3RQ0 A;  2VAU A;  2JIG A;  3ZKU A;  1X9T A;  1CWP A;  3VBR B;  4UFJ A;  5K9Y A;  3DGT A;  1FOD 1;  3AZZ A;  1UAI A;  4FPG A;  4CP9 A;  4IEO A;  2B42 B;  3MIC A;  1VBE 3;  3AKR A;  1HW5 A;  3C7H A;  5FLH A;  3V0A B;  3I2H A;  4FP3 A;  3LQC A;  2WFF 2;  4GB3 1;  4IW3 A;  3WW3 A;  3IMN A;  5C5T A;  4ISQ A;  2OZ6 A;  3PJQ A;  3USU A;  1DQ1 A;  3DL3 A;  4Y4Y A;  4IE6 A;  2WR9 A;  4LO5 B;  1NY7 1;  2R06 1;  4QPG B;  1XPW A;  4MVT A;  2KXL A;  4Q4Y 3;  3ETQ A;  3LE0 A;  1KJR A;  4DRV A;  1JYW A;  5CYY A;  4RGK A;  5FMO L;  4A45 A;  1DQ6 A;  5E6H A;  4YVS B;  1OLQ A;  1Z78 A;  2C4X A;  2G9F A;  5DN2 A;  3VKN A;  3VV1 A;  1KS5 A;  2FMY A;  2HWB 3;  2J42 A;  3AZX A;  5C71 A;  3H8X A;  4FFF A;  4MGK E;  2WII B;  4CEW C;  1OMI A;  3CQO A;  4IGO A;  3MPB A;  2R06 3;  3OBZ A;  4LHS A;  1KFU L;  3OD4 A;  2OUH A;  4MHU A;  3S7I A;  5JZG A;  1HB2 A;  1JZ8 A;  3TNP B;  1E5R A;  3TEZ A;  2PAE A;  4YZ2 A;  1FMD 2;  2X5I A;  1O8P A;  4COZ A;  4Q8L A;  1ENS A;  3A4U A;  4YVS C;  3SEP A;  4ASM B;  1TME 1;  3E1F 1;  4XZU G;  1UOF A;  1RJ8 A;  4P14 A;  5F39 A;  4LO4 B;  2HWC 2;  4YFZ A;  1WA6 X;  1POV 3;  2DU1 A;  3AZW A;  2YUE A;  4E8D A;  1AYM 3;  2EIG A;  1VBB 3;  1UPS A;  5KXB A;  4E4H A;  3RI9 A;  2ZZQ A;  2D3S A;  3NAP C;  1BBT 2;  1UX6 A;  3FHI B;  1JXN A;  2JX9 A;  1HXS 2;  3I2I A;  3UJQ A;  2ZHL A;  4AVS A;  4CRQ A;  4WM8 C;  2DCY A;  2HWE 3;  4UWD A;  5ANQ A;  4LXL A;  4CEY C;  3MPP G;  3PUH A;  4H14 A;  3CF6 E;  4S2D A;  3K3O A;  3WNX A;  4JAA A;  4MXW A;  3SLI A;  1QH6 A;  1GP5 A;  2RS1 3;  4Y1V A;  1BEV 1;  3IT8 A;  1NCQ C;  4ZPI A;  4YRD A;  5HPO A;  1GAN A;  1YFY A;  2MNG A;  2YB7 A;  3LCP A;  3OGV A;  4DEV A;  1PMH X;  1V6M A;  4P00 B;  2VZU A;  2HEY F;  1PIV 3;  4MUV A;  3LFM A;  3ZXL A;  2RS1 1;  1MS3 A;  4PDW A;  3PNA A;  3EB7 A;  1GOF A;  4HLT A;  2VJX A;  2EVX A;  3CZJ A;  3ZYR A;  4NR1 A;  2VZT A;  1REF A;  1ND2 C;  2FDG A;  3WG4 A;  1W6P A;  3DF0 A;  1UOG A;  3IIA A;  4E2G A;  1RUI 2;  3OJB A;  4FPK A;  3AP6 A;  2F17 A;  2WNV A;  1QGL A;  3HT1 A;  4XPV A;  5E16 A;  1QQP 2;  1NCR C;  3AFG A;  3JZV A;  3N36 A;  5A7S A;  5A3L A;  1QXR A;  4YW3 A;  1C8N A;  5FBJ A;  1EP0 A;  4FOQ A;  2PAK A;  1W8N A;  4YW1 A;  1FAY A;  1AYN 2;  2OUJ A;  4UOJ A;  4QX5 A;  2VBB A;  4YW2 A;  5T5J A;  3VD3 A;  4K6B A;  4QHZ A;  2XBO 3;  4NUB A;  4Q27 A;  1ZYB A;  1RHI 3;  5A6Y A;  1Z0H A;  2OA2 A;  5F7U A;  3RZG A;  5KR7 A;  2ET1 A;  2QFE A;  4XXA A;  2YFZ A;  5IVF A;  1MS5 A;  2XHN A;  4OQ8 A;  3O1V A;  5A3W A;  3D0S A;  2TUN A;  2V5D A;  2UWB A;  3HQR A;  4YW4 A;  3HR9 A;  4CDQ C;  3WDT A;  4JGZ B;  1OBN A;  2YZ4 A;  3WG1 A;  4MGT A;  3D6E A;  1AR9 3;  3OYW B;  3Q8E A;  1QJY 2;  3CMG A;  2ZGO A;  3I97 A;  3NNG A;  3TNQ A;  1RHI 2;  1PX4 A;  1H8V A;  1U0A A;  4RR3 B;  3IAQ A;  4QQ2 A;  1XE7 A;  1GLH A;  1W39 A;  4CSW A;  4XFB A;  1RTV A;  5HBA A;  1ULE A;  4KU8 A;  1EV1 2;  5SV5 A;  5FR3 A;  1YFU A;  4M00 A;  1UZW A;  3DYO A;  5SV8 A;  4EZ4 A;  2CGP A;  5FPB A;  2ORZ A;  5JPM B;  2QQL A;  5CFC C;  3DXU A;  1OF4 A;  4QPG C;  3WW2 A;  5FZO B;  3VD4 A;  1RC6 A;  2VBD A;  5EPA A;  1ZZ9 A;  3VBR C;  5AFE A;  2C5D A;  4TTG A;  1ODM A;  2PN5 A;  2DUQ A;  2HWB 2;  2PA7 A;  1GZW B;  4FPY A;  5I0S A;  3BU7 A;  4DUX A;  3M3E A;  3OD0 A;  3POS A;  5CG9 A;  3OUI A;  3ILN A;  4QM8 A;  1SG3 A;  2E7A A;  1F9K A;  4GIQ A;  1R08 2;  2FDJ A;  4PDW B;  4QHB A;  3SCH A;  1SLT A;  1WA4 A;  4CEW A;  4OI4 A;  3CZU A;  2IZW A;  4OUL A;  2WNV C;  2PHX A;  2RR1 3;  5GJ6 A;  2CYF A;  2LUW A;  1IGO A;  1DYO A;  5DQ0 A;  3VDB A;  3S30 A;  4FAH A;  2IXI A;  1P8J A;  3HQU A;  3B69 A;  3K4D A;  5BXX A;  2DCJ A;  1IQD C;  2XLA A;  3EYP A;  1ZRC A;  5F5A A;  5JXJ A;  3PJY A;  1O7F A;  3DPR B;  1UQX A;  4BK5 A;  4GWJ A;  4M3C A;  1UY3 A;  5FZ9 A;  3A0K A;  3LWC A;  1CPN A;  1GP4 A;  1MVQ A;  4N90 A;  1XRU A;  4PT6 A;  1GIC A;  2D98 A;  1DLL A;  1E57 A;  5CKM A;  4GH4 A;  2Y38 A;  4YGC A;  3VZJ A;  4K1Y A;  1PZ7 A;  4BCU A;  4RYD A;  1N1S A;  4O7X A;  5DG2 A;  4XET A;  4CDQ A;  3WNN A;  3BTZ A;  4JV4 A;  2BWA A;  1UCX A;  3NAP A;  1EPZ A;  2TBV A;  3LOB A;  3DUI A;  3NV4 A;  5EYY A;  3H7J A;  4Y22 B;  5T50 A;  4PLN A;  1RMU 1;  4CEY A;  2CTV A;  1UW8 A;  1UX7 A;  1SQ4 A;  3FUQ A;  1YRZ A;  3IKW A;  3N9O A;  5A3N A;  1ND3 C;  1RUI 1;  2VE1 A;  2HWF 3;  3POY A;  1GU3 A;  3POW A;  2VMC A;  4ZON A;  4XIO A;  1D4M 2;  2JDU A;  2XWJ B;  2ZX0 A;  3RNS A;  3PL0 A;  4F8A A;  1QJY 1;  1SCS A;  1WGP A;  2OZJ A;  5FBZ A;  1W9T A;  1UZ0 A;  1IPK A;  2VC9 A;  1W99 A;  1ZBA 3;  3O0X A;  3VN4 A;  2P1B A;  2XDV A;  1LOB A;  3LEK A;  1RMU 3;  3WX5 A;  3ZPO A;  1CIW A;  4PI2 A;  4OUM A;  1SBE A;  4KMQ A;  4XF4 A;  2J1U A;  2RS3 1;  4FP2 A;  3AMN A;  3ATG A;  5T5O A;  2DDU A;  2UYB A;  3T0D A;  2HWB 1;  5KC5 A;  3M7A A;  4QX7 A;  4HK8 A;  1IS5 A;  1RL3 A;  2QQU A;  3KD4 A;  3T2T A;  4DPN A;  3NMB A;  1D2Q A;  1C8M 3;  3WW4 A;  3AVR A;  2WNO A;  3VKL A;  1QJU 2;  4LBM A;  4QQP A;  1XYO A;  5T52 A;  1SDD B;  4YGE A;  3O1O A;  1XNA A;  2JG9 B;  5FOB B;  1NXD 1;  1WCD J;  2XJU A;  5FYS A;  5FZH A;  4EWA A;  2A6X A;  4WM7 A;  1QH7 A;  3QOP A;  4SLI A;  1LCL A;  2ZAB A;  1H8T B;  1JZ3 A;  1UPI A;  4LIV A;  2QVS B;  1J3P A;  3D5O A;  1OKO A;  1MAC A;  4XBN A;  1TNR A;  3CEW A;  1CAW A;  5EWS A;  4Y5S A;  2XL7 A;  2UYA A;  3MIB A;  5L36 A;  2CAV A;  4OHZ A;  4Y20 B;  1RMU 2;  3U4X A;  2QQN A;  2VTX J;  3I2G A;  3ZFG A;  2XGX A;  2R07 2;  4AFC A;  1KDM A;  3AZV A;  1EV1 3;  3C7G A;  1RYY A;  4P5H A;  3C2U A;  3VBO B;  1CAU B;  3TBD A;  3FLT A;  4L97 A;  3VB9 A;  4Q2F A;  3WQB A;  1AR9 2;  1X7N A;  1QOT A;  5J98 B;  1NOV A;  2ZAA A;  3N3H A;  1EY2 A;  5GLV A;  1JZ7 A;  4FSJ A;  1G86 A;  2XUE A;  3KVB A;  3OGS A;  4YVW B;  1G7Y A;  1D0H A;  3WP5 A;  2IXH A;  3LDK A;  2JE7 A;  2W87 A;  2HWD 1;  3RZM A;  1H6Y A;  4MGZ E;  1AL2 3;  1UO9 A;  3IPV A;  1MQT C;  2J22 A;  1F31 A;  5JDB A;  2W1S A;  2JKX A;  2Y6J A;  4LBQ A;  1DDL A;  1JW6 A;  2ZCW A;  2A3Y A;  4J25 A;  2W47 A;  4QXH A;  2B7Y A;  4XJ9 A;  3O14 A;  4L0P A;  4NHK A;  2F4L A;  1AYN 3;  4Q0V A;  5FUP A;  3NWK A;  1PO2 3;  5FYH A;  1TME 2;  2ZS6 B;  1YFW A;  3THP A;  2JG8 A;  1HV1 A;  1BLZ A;  1OVP A;  4E2Q A;  1J84 A;  2O1Q A;  4K8F A;  1L7R A;  4DXZ A;  4LJH A;  5IVB A;  4QGM A;  4XFC A;  1NQD A;  1UOJ A;  3GZE A;  1GNH A;  3FC0 A;  4MO3 M;  4ITC A;  3OUH A;  4AF9 A;  1VIW B;  2PLV 1;  1YI9 A;  2XBO 1;  5DXD A;  3MW2 A;  4AI3 A;  4OHW A;  3HWJ A;  1NCQ B;  4CCM A;  1DIW A;  3PLQ A;  1COV 2;  2A73 B;  3N7L A;  5FPL A;  3ZPY A;  5A32 A;  3U10 A;  3EMR A;  4CDX C;  5FLI A;  2EF6 A;  3NKT A;  4AFB A;  2A5Z A;  2O8Q A;  3ACG A;  4XIK A;  3DXT A;  4YM3 A;  4IDZ A;  1MS4 A;  5JI7 A;  2GNB A;  4W6W A;  1KQR A;  2UWA A;  3LEG A;  2X53 S;  4U36 A;  5F6K A;  1PO2 2;  4XAC A;  4FPO B;  2RHP A;  4DEQ A;  4KBB A;  2WNU B;  4F83 A;  1UKR A;  1RUC 3;  4IL7 A;  1PGL 2;  3WF4 A;  1K45 A;  1O3Q A;  1O59 A;  1QJE A;  4BXF A;  5FP3 A;  3PTY A;  2W0X A;  3JUU A;  2VXJ A;  3MUZ 1;  3VHO A;  3A21 A;  4CDW B;  3VZL A;  4DXT A;  3RZZ A;  5J36 A;  2DUP A;  3H42 B;  3SCF A;  2B4K A;  4M3C B;  4AI2 A;  1RUO A;  4N7I A;  4MYE A;  4XXP A;  3I3B A;  3Q8B A;  5CFC B;  1ULG A;  3BGA A;  1RUC 1;  4UFI A;  4BMB A;  4H3W A;  4QX1 A;  1I6X A;  1NE6 A;  4Q4X 1;  2CL2 A;  5D1I A;  5F37 A;  4GMP 0;  1FPN 1;  2E7T A;  2VMD A;  3VBU A;  4N8M A;  5FDB A;  4OI0 A;  3H8R A;  2WWU A;  2R7E B;  5JMC A;  4Q4V 2;  2GC2 A;  1UU6 A;  3SEE A;  4LKF A;  2WZR 1;  5LBF A;  1PK6 B;  3J7H A;  1W8Z A;  3GAL A;  1A78 A;  3D0J A;  3LZZ A;  2WWS A;  4A41 A;  3LKJ A;  4XMI A;  3ZSJ A;  1F2N A;  2D6N A;  1CX4 A;  1GWM A;  1DG6 A;  2JDM A;  1N3Q A;  2XH6 A;  2D5F A;  2QNK A;  3CJI C;  3EBR A;  4AVB A;  5EFU A;  3E6B A;  2CAU A;  5HCA A;  1HLC A;  2VW1 A;  4AVA A;  4JGY A;  2XHK A;  1SLC A;  4UW6 A;  2TEP A;  1CJP A;  1GR3 A;  2GNT A;  5GKA C;  1XSQ A;  3FE5 A;  5LAS A;  3ZXG A;  1JYX A;  1GZC A;  4A7K A;  3ASI A;  1US2 A;  1F4H A;  3VZK A;  1RHI 1;  1AR7 1;  2RS5 3;  3PU3 A;  1GWK A;  4MGQ A;  4YGD A;  3E6C C;  3OYW A;  4MV2 A;  1UY2 A;  1YLL A;  3KF3 A;  1KFX L;  4F7Z A;  2VOX A;  3POG A;  1MZE A;  1OUX A;  4Q4V 3;  1XOY A;  4OI1 A;  1BMV 1;  3IDC B;  5I93 A;  1HQL A;  1W0O A;  2Y8K A;  4P08 A;  2XON A;  1CX1 A;  1GOH A;  3LOI A;  3EO6 A;  3KV4 A;  5C3S A;  2HH9 A;  4NPR A;  2YG0 A;  2VOW A;  3I3Q A;  4IV1 C;  4C1W A;  4BXS V;  1WD4 A;  3B5L B;  3KMH A;  1C57 A;  1UXX X;  2A3X A;  2QDN A;  1U5Y A;  3AK0 A;  3B9I A;  4NWV A;  2Q1Z B;  3IPV B;  1WLD A;  2UUR A;  2W94 A;  4J6G A;  2IUW A;  3UNP A;  3RZJ A;  4E9K A;  1OA2 A;  3JXS A;  1SBD A;  1HN0 A;  3KF5 A;  1T6G C;  4JKL A;  4Q4X 2;  4YVW A;  3B7M A;  2WC2 A;  4W6X A;  3PDQ A;  4RA0 A;  1RUC 2;  1ZZC A;  2P34 A;  1D2S A;  2WO1 A;  3KHB A;  4R8H A;  3WLU A;  5LW9 A;  3UK9 A;  5IT6 A;  1ENX A;  5FQ0 B;  3K46 A;  2O0O A;  5LK7 B;  3BOD A;  4H2A A;  3NNF A;  4YVW C;  3ACF A;  4BQ5 A;  3M4F A;  3POI A;  3U37 A;  2D6M A;  2ET7 A;  2KA3 A;  2PQQ A;  3NST A;  3MLL A;  4ATE A;  1HXS 1;  4I30 A;  5FP8 A;  3ZIX A;  3MHZ A;  2WQ4 A;  1QEX A;  1R09 2;  1VRH 2;  2E6V A;  4KL1 A;  4UFL A;  3WF2 A;  4URA A;  1F15 A;  1MS8 A;  4A3X A;  3ZR5 A;  2Q8D A;  1S0J A;  3RJ2 X;  4AI8 A;  1OF3 A;  5CNA A;  1GQH A;  5EZW A;  2BEO A;  3TYJ A;  1ULO A;  4LMF A;  4MXV A;  4LHN A;  1VAV A;  1XYP A;  2Q1F A;  2RS3 2;  1AVB A;  1ZZ8 A;  2WUH A;  1WW6 A;  4WVM B;  4IEP A;  4BJ0 A;  1HKD A;  2PTM A;  5CIR A;  2LAL A;  2ZHN A;  1UYP A;  2YDE A;  5LA0 A;  1QXP A;  4JGY C;  4GUL A;  2BUK A;  4G4F A;  3SIT A;  4PHZ A;  1W6Q B;  4Q4W 1;  3PIG A;  3I2D A;  5C9A B;  2JEC A;  3LDB A;  3RGB A;  2Y6L A;  4M3C F;  1WUV A;  4DMI A;  1UYY A;  2RE9 A;  3W5M A;  3AL6 A;  2J1V A;  1PNF A;  1D7P M;  4XF0 A;  5ACA 2;  1OOP A;  5JIA A;  1BKZ A;  1UD1 A;  1UL9 A;  2BNN A;  5IFP A;  1RUD 1;  3CJI A;  2DFB A;  4AGV A;  2J1R A;  2R04 3;  1UYZ A;  3LSD A;  4FVV A;  4JGY B;  4JX0 A;  4NRP A;  4HXC A;  4CUB A;  4KH9 A;  1OSG A;  2JDY A;  1LAJ A;  5HXV A;  1STM A;  1W90 A;  1ZBA 1;  3R4U A;  4GWI A;  4RS5 C;  2RDS A;  4QKF A;  1NY7 2;  5IYY A;  3K77 A;  1AXY A;  1N1T A;  1OQE A;  3HAG A;  5CEH A;  2DV9 A;  4Z1V A;  5BNO A;  5AVP A;  4HFS A;  4BB3 A;  5KHH A;  4FPF A;  3R0R A;  5FZ7 A;  5IK8 A;  2A3W A;  3HNY M;  3IDA A;  3ZN4 A;  2VUA A;  4FI9 A;  2BU9 A;  2GZW A;  4LBJ A;  2E63 A;  5FZI A;  1SLB A;  2DTW A;  4G9S B;  4YM2 A;  1VBB 2;  1UU5 A;  1DZR A;  1HQW A;  2HEV F;  3NNJ A;  2P17 A;  4GWN A;  1ULP A;  1SPP B;  2WN3 A;  4CA9 A;  3ACI A;  5T54 A;  3MGU A;  1EPW A;  3O1S A;  1C3H A;  2YC2 A;  1COV 3;  5CFD C;  1DZQ A;  4GH4 B;  5FFO C;  2WAB A;  2NYY A;  3BTY A;  4D7S A;  2AAC A;  4LIT A;  1RUJ 3;  3MIG A;  2KR2 A;  4BLI A;  1IZ3 A;  2HBU A;  1W8W A;  4HOO A;  4Y5Z 0;  4CU9 A;  1GNZ A;  1LES A;  4B4R A;  1NZI A;  1E5I A;  3VBU B;  4FPL A;  3DPR A;  3KQR A;  2D7F A;  3BAL A;  3WDV A;  4IQP A;  4XFG A;  1OFN A;  4HKW A;  4A42 A;  3AMP A;  2BOI A;  2IXJ A;  4HN0 A;  2ZHM A;  4XDO A;  3D4K A;  1WLT A;  2GC0 A;  2OXB A;  2WS9 3;  3P3P A;  5BNP B;  1GZT A;  4IET A;  4X6Q B;  5FMD A;  5ABJ C;  4WBB A;  1SLI A;  2J1S A;  2FDH A;  1DGW A;  1NCQ A;  4AVV A;  2CWS A;  2ZEW A;  4IV1 A;  3CJX A;  4YGB A;  5C9A C;  2ZPX A;  2I07 B;  2WNU A;  2XKO A;  4HVO A;  4PLO A;  3WUD A;  4BDV B;  4BQ4 A;  3HNM A;  4CDU C;  1XB9 A;  5FYB A;  4BQW A;  1S0I A;  3I2K A;  2ZEZ A;  3AP4 A;  3BIE A;  3WW1 A;  1PNG A;  2JWP A;  3BIW E;  3JB4 C;  3LF7 A;  5LAT A;  3SIS A;  2I74 A;  2JG8 B;  4RR3 A;  2VNV A;  3SH3 A;  4AR2 A;  1OPO A;  2Q8E A;  2DVB A;  3POF A;  3RWN A;  4HKL A;  4O9G A;  1NLR A;  2VY0 A;  3ME2 A;  1V6K A;  3I2J A;  3UGH A;  4OUS A;  5FV3 A;  1XE8 A;  5K4L A;  1QOS A;  4CU6 A;  4JGZ A;  1CQ9 A;  1N3O A;  2XB6 C;  3V65 A;  1W06 A;  1QY4 A;  3QH6 A;  4YW6 A;  1IS6 A;  1R1A 1;  2WN2 A;  3GGL A;  4LK7 A;  4BHP A;  2ATF A;  4C0H A;  3MIE A;  4GD4 A;  3GM8 A;  4PI0 A;  5D8A C;  3LIH A;  4DIN B;  3NW4 A;  3SQO A;  4AED C;  5J96 B;  4JGZ C;  3H3U A;  4N43 C;  3ALQ A;  4DXS A;  2ZGP A;  2XJP A;  4HAN A;  1DF0 A;  3SKV A;  4XF3 A;  4IEU A;  3W21 A;  3FBY A;  3KT1 A;  1W2A X;  2A71 A;  1DYK A;  5HCB A;  3N9M A;  5FZB A;  4IE5 A;  1CAU A;  3G7D A;  2EXK A;  2V73 A;  3J8F 3;  4CCJ A;  1GQP A;  1OH4 A;  4DY5 A;  3V0B B;  2HYX A;  1VR3 A;  4D7T A;  1S55 A;  3UJO A;  1H2N A;  3I3D A;  4N7U A;  3X29 B;  4I2O A;  1D4V B;  2XQX A;  4CCE A;  5A1F A;  2QZ3 A;  2Q30 A;  4LKS A;  1HRI 1;  1GV9 A;  1ZZ7 A;  3PIJ A;  3OG2 A;  2RMU 1;  4AFD A;  4QXB A;  3HOB A;  4ZHN A;  4R9D A;  1LTE A;  2PAM A;  1FPN 2;  2VUL A;  1V6J A;  3J8F 1;  4JRA A;  4O65 A;  2LS6 A;  4AHW A;  3ST7 A;  1L7Q A;  4XAB A;  3S7E A;  5CU1 A;  2BGO A;  4ONU A;  2HYK A;  2DUR A;  4DO0 A;  2B5H A;  2W2I A;  3AMH A;  1ZRE A;  4D6R A;  3C8X A;  4YNI A;  4ZXK A;  1AR7 2;  3LFI A;  1ST8 A;  2AR6 A;  1OD3 A;  1TEI A;  3H0O A;  4AQ6 A;  1POV 0;  5C6C A;  5FZE A;  4K21 A;  5IUQ A;  3GBW A;  3BOP A;  5FK7 A;  5IK4 A;  1YEW A;  1HB4 A;  3C7F A;  1M06 G;  2BOJ A;  4LKD A;  3GYD A;  2C9K A;  2QQM A;  4TWT A;  1KXG A;  4R9A A;  2WA4 A;  2P3K A;  4LQR A;  3NJY A;  1FMD 1;  1H2L A;  1ENR A;  5F5I A;  4XMA A;  4JVA A;  1S0C A;  4BLJ A;  4MXW B;  1YJL A;  2EAL A;  3TN9 2;  1E5S A;  4IND A;  4LIU A;  3WOG A;  1W9F A;  3J7M A;  3MYX A;  4LOT A;  2XML A;  4WVZ A;  5JZG C;  1HRV 2;  4P5Y A;  1ACC A;  1ND2 A;  1VBA 1;  1UMZ A;  4MHR A;  5E89 A;  1GSL A;  2SBA A;  2B8M A;  4NHM A;  2XLG A;  1QDO A;  4NAM A;  1AXZ A;  4Q1P A;  3L2H A;  1CON A;  3Q9O A;  2AC1 A;  5FYV A;  4CEY B;  1KD7 A;  1Y9M A;  3RMX A;  2QE3 A;  1YC6 1;  4MG2 A;  2D6P A;  4Q26 A;  1XSR A;  2ETE A;  4GWM A;  4XQD A;  5FRA A;  2E51 A;  5APA A;  2F4P A;  2E7Q A;  2WT1 A;  1JZ6 A;  4XUT A;  2VNR A;  1AX1 A;  1DQ4 A;  1N47 A;  4NRO A;  3S0M A;  3PVB B;  2VBP A;  2W95 A;  1WW5 A;  3NJX A;  2XL9 A;  1UU4 A;  2D43 A;  5FO9 B;  1PO1 3;  2ERF A;  5D8A A;  4AK3 A;  1SHW B;  2ZJC A;  3ZN6 B;  1R1A 2;  5K0U A;  1CIY A;  2BVV A;  3NQH A;  4Q29 A;  4YG3 A;  3UKV A;  4BQ3 A;  4FBF A;  5A6Q A;  5BNN B;  1ZA7 A;  4L99 A;  4R4Z A;  5BNP A;  5KC6 A;  1J1L A;  4IV3 C;  3J8F 2;  3USU B;  4DNY A;  5EIY B;  1QDC A;  2BPA 2;  4C1X A;  1K5J A;  3KLS A;  1BK0 A;  5KXC A;  1A6C A;  5A80 A;  4FPC A;  1RUH 3;  3NRU A;  1JYV A;  3V0A A;  1QJY 3;  5C5U A;  1VRH 1;  1ZZ6 A;  5AC9 3;  4CEW B;  4COY A;  3KHC A;  1DBN A;  3FL7 A;  5LBB A;  1XYN A;  1Q8S A;  3VZM A;  2WNE A;  1FNY A;  1FV3 A;  2WO2 A;  1W2U A;  4BIO A;  2DBI A;  1JZ2 A;  4RGG A;  2RS1 2;  3PTR B;  5IVY A;  1JN2 P;  2VCA A;  5JR7 B;  1SFN A;  3HN1 A;  3ZYG A;  3RJR A;  4RQP A;  1LGC A;  4WZC A;  3RZH A;  5J09 A;  3AJY A;  3CDZ B;  2HWE 2;  4NN0 A;  2JDH A;  1UXZ A;  1ASJ 2;  1OVS A;  1VRB A;  3H1Y A;  2YHJ A;  3FZ3 A;  5KXE A;  1W28 A;  1AJO A;  4LOR A;  2CDP A;  2ZA9 A;  1W0N A;  5FZ8 A;  4B7K A;  2GP5 A;  1Q8V A;  3Q8C A;  3VDD B;  4BU2 A;  4I3P A;  5LRS A;  1JS9 A;  4LE4 A;  5C8C A;  4IEY A;  4UBG A;  1HIX A;  4LT5 A;  1AF9 A;  2ZX2 A;  1JHN A;  1S0G A;  3FUO A;  4LOS A;  4GA9 A;  2VZV A;  3WDX A;  5EQU A;  1UN1 A;  5BNN A;  4UW5 A;  4FPJ A;  3I59 B;  5F3C A;  4LBK A;  4QWN A;  5JVV A;  2ARA A;  1W3X A;  3TAY A;  5A3M A;  4OHY A;  1BCX A;  2VO5 A;  1XNC A;  3O0V A;  3DPR C;  4UYB A;  2VQT A;  1NYW A;  1U5I A;  1BEV 3;  4AXO A;  4D69 A;  3FBM A;  4DXR A;  1LU2 A;  4CUG A;  2VPV A;  3IB3 A;  4EWD A;  1SPP A;  4LE3 A;  1JH5 A;  3JD7 3;  5K0U B;  2WL1 A;  2P3Y A;  5A70 A;  1DGL A;  4I01 A;  4Z07 A;  1FXZ A;  4UBH A;  3M1H A;  5CG8 A;  2VU9 A;  1I3H A;  3MDP A;  2PHL A;  5H9R A;  3VBO C;  4HET A;  1DQ0 A;  3NJZ A;  1GOG A;  3M3Q A;  2Y0O A;  1V70 A;  3WXP A;  3JD7 1;  1QJZ A;  3B94 A;  1SFP A;  1O6U A;  1RUF 1;  1PX3 A;  1S2E A;  1O5L A;  5EP9 A;  2Q8O A;  4BQ2 A;  2LRO A;  2CWM A;  2IFR A;  4LUK A;  4XCB A;  2XPJ A;  2HWD 3;  1AL2 1;  2A70 A;  4JRL A;  2V4A A;  1AL0 G;  1RUE 1;  3RWK X;  3WQ1 A;  3WSO A;  4EJR A;  3HMY A;  4QGN A;  1FOD 2;  5LBE A;  4O61 A;  3PVO A;  4NRM A;  1AYM 2;  3LA2 A;  3O1P A;  3LGR A;  4SBV A;  5I0R A;  1JOB A;  5FZ1 A;  1J3Q A;  2GMP A;  1Y9G A;  3IMM A;  5FTT C;  3AXD A;  2DBN A;  1UY0 A;  1G9B A;  1SEF A;  1A8D A;  1ZNP A;  4IE7 A;  5CFD B;  4XDQ A;  1ULC A;  2WA3 A;  3BKZ A;  2ZGS A;  4BQX A;  1W6P B;  4CP0 A;  4P9X A;  4K1Z A;  4AED A;  4L9B A;  5LRR A;  4QMA A;  2WLP A;  2P5B A;  1UYX A;  3VD5 A;  4FAG A;  5AC9 2;  5JIU A;  5F2S A;  1UZY A;  3PVE A;  1WD3 A;  1HN1 A;  1K5M C;  3E97 A;  3VBU C;  2DFC A;  3WT3 A;  5IK7 A;  5I8S A;  5LA1 A;  3OBT A;  1DZT A;  1YIF A;  4W65 A;  2X10 A;  3AZY A;  4FTS A;  4BOW A;  1NT0 A;  1YI7 A;  1S1A A;  4ZS3 A;  3VBH C;  1HDK A;  4Q8K A;  1PO1 2;  1OLM E;  2EAA A;  4FPH A;  1A3K A;  2J7M A;  5FK8 A;  1O3R A;  1FV2 A;  1UMH A;  3OF1 A;  4RSU A;  4XJA A;  4GKX A;  2WS9 1;  4QX3 A;  4AI0 A;  3HVD A;  1WMF A;  5FKB A;  5KXD A;  5LWB A;  2ARX A;  2KD7 A;  2FQP A;  5C8C C;  4TN7 A;  2X05 A;  5JR2 A;  3KZ4 C;  2WDB A;  2VG9 A;  2VEC A;  1G6N A;  3OGR A;  5L73 A;  5M0T A;  2OW4 A;  3V0B A;  2RM2 3;  1TZO A;  2VTX A;  4Y1Z A;  1QHD A;  3ZMO A;  1EAH 2;  3VHP A;  4KGQ A;  4DOU A;  3CKH A;  4YAR A;  2VZO A;  1S2B A;  2MPF A;  4LR4 A;  2MEV 2;  2ZX1 A;  1VAM A;  3AKQ A;  1DQ5 A;  5FUI A;  3WF3 A;  1WMX A;  3ZXE A;  4B8E A;  3HEI A;  4BQ1 A;  4CCO A;  1ZRR A;  3RMY A; 
#chains in the Genus database with same CATH homology
 5A3T A;  5FPV A;  4AAP A;  4QXB A;  4CSW A;  5FJK A;  4XDP A;  3LD8 A;  5CEH A;  5E6H A;  5FXV A;  3RVH A;  5A7N A;  5FZ7 A;  5F3C A;  4QWN A;  2YBK A;  3PUR A;  4EZ4 A;  5FPB A;  4CCN A;  4DO0 A;  5FZ6 A;  5FY7 A;  4IGO A;  3OPW A;  5FZI A;  2W2I A;  3DXU A;  3K3N A;  5A7P A;  4BIS A;  4D6R A;  5FZO B;  5FP4 A;  3OPT A;  5A7O A;  2YBP A;  5FZE A;  5A3P A;  5ISL A;  3PU3 A;  5FZ4 A;  5FZG A;  4UF0 A;  3KVB A;  2XUE A;  5FZA A;  4GJZ A;  3N9P A;  4LIT A;  2VD7 A;  5FY5 A;  4EYU A;  5FXW A;  5F39 A;  5IW0 A;  5FPU A;  5IVC A;  3NJY A;  5FYY A;  5F5I A;  5FYC A;  5LY1 A;  2XXZ A;  5LY2 A;  4V2V A;  4HOO A;  5FUN A;  3KV4 A;  5F3I A;  4LIU A;  4QXH A;  4E4H A;  5FPA A;  3PUS A;  2XML A;  3PUA A;  5F3G A;  3N9L A;  5FZ0 A;  5FZK A;  5FUP A;  3PUQ A;  5FYI A;  2OT7 A;  5F5A A;  5FZL A;  3KV6 A;  5F32 A;  5FWE A;  4IGP A;  5FYH A;  5FZ9 A;  5ANQ A;  3KV9 A;  4LXL A;  5FY1 A;  5FZF A;  3KVA A;  4XDO A;  3K3O A;  5FZM A;  4CCL A;  5FYV A;  4D6Q A;  5IVB A;  3PDQ A;  5FZ1 A;  4AI9 A;  5FJH A;  5LW9 A;  5IVE A;  4QXC A;  4V2W A;  3PU8 A;  5FZO A;  4CUG A;  4CCM A;  2YU2 A;  5FP7 A;  5IWF A;  3N9N A;  5FPL A;  5FYU A;  4C8D A;  2PXJ A;  3K2O A;  2P5B A;  5FYB A;  5FXX A;  5FP8 A;  3N9O A;  5FZD A;  5A3N A;  5F2S A;  4Y33 A;  5F3E A;  5FZC A;  2OQ6 A;  3DXT A;  4URA A;  5FY9 A;  3AL5 A;  2OX0 A;  2Q8D A;  5IVV A;  3U78 A;  2Q8E A;  4GJY A;  4GAZ A;  5F2W A;  3N9Q A;  2XDV A;  5FY8 A;  5A7W A;  5FV3 A;  5K4L A;  3ZPO A;  4BXF A;  5FP3 A;  3KV5 A;  4ASK A;  4HON A;  5FWJ A;  5A7S A;  5FY4 A;  2Q8C A;  4D6S A;  5A80 A;  5FBJ A;  4Y3O A;  5A1L A;  5IVJ A;  4GD4 A;  4QX7 A;  4Y4R A;  2OS2 A;  5A7Q A;  3AVR A;  2GP3 A;  4NUB A;  4EZH A;  2OQ7 A;  5FP9 A;  5LWB A;  5A7W B;  5KR7 A;  3LDB A;  3PTR B;  4TN7 A;  2YU1 A;  5F5C A;  5IVY A;  5FZ3 A;  5IVF A;  5FYM A;  5F37 A;  3N9M A;  5FY0 A;  3AL6 A;  5FZB A;  5FXZ A;  5FYS A;  5FZH A;  2WWU A;  2WWJ A;  5A3W A;  5FYZ A;  2YPD A;  4CCK A;  3ZLI A;  4CCJ A;  4DIQ A;  3UYJ A;  1VRB A;  3U4S A;  2YBS A;  4LIV A;  4UF0 B;  5FZ8 A;  4BU2 A;  2GP5 A;  4CCO A;  5A1F A;  3AVS A;  4QU1 A;  5FYT A;  4IGQ A;  4QX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...