2OA2A

Crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
VTDHGPRPFVVNIEDETKRNRAFRRALWTGDHLQVTLMSIQVGEDIGLEIHPHLDQFLRVEEGRGLVQMGHRQDNLHFQEEVFDDYAILIPAGTWHNVRNTGNRPLKLYSIYAPPQHPHGTVHETKAIAMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords BH2720 protein
publication title Crystal structure of BH2720 (10175341) from Bacillus halodurans at 1.41 A resolution
rcsb
source organism Bacillus halodurans
total genus 29
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oa2A01
2GC2A 2BYVE 2E9QA 3I54A 4IETA 3E5UA 3FFQA 3H9AA 1YFUA 1J3QA 3MDPA 2H6BA 2EAAA 3NL1A 3HIFA 2CGPA 2IXHA 2UYBA 4HVRA 2XKOA 3LZZA 1G6NA 4D7SA 5FDBA 1I6XA 4IEQA 4XEZA 2FQPA 1WGPA 2CV6A 2F4PA 4XFFA 4YYOA 2PAEA 2PHDA 5KHKA 1Y3TA 4XFHA 3ZDSA 3H7JA 2C0ZA 4YARA 1Y9QA 3SMHA 1RUNA 1CAWB 2XGXA 3FE5A 4XETA 1VJ2A 4L11A 3FJSA 1CAXB 4PIXA 1CX4A 4EWEA 1ZZCA 4MX3A 1U12A 2PQQA 4F7ZA 1UW8A 1ZZ7A 2D5HA 3CO2A 5LEJA 2ET1A 5FCCA 2MPFA 1H1IA 5FQ0B 1CGPA 5C8WA 3RYRA 3KCCA 4AVAA 3IWZA 2EA7A 4ONUA 1UCXA 4BH9A 3RPQA 3DV8A 5CVRA 2XLFA 4AVBA 5T3NA 3BU7A 4A2UA 1FXZA 3C3VA 4MUVA 2BNOA 1QXRA 4XF1A 4O9GA 1ZZBA 2K0GA 2B5HA 2HKXA 1GQGA 5I0TA 2ZCWA 4ZU7A 4LEJA 1Q43A 3BCWA 5I8SA 4XFIA 3KSCA 3LA7A 4BHPA 3H50A 4Z07A 1EP0A 1OI6A 4PIZA 1ZZ8A 2B8MA 2GC0A 3PLQA 4IEXA 2XL7A 4PIYA 3BALA 3D0SA 3E6BA 4QM9A 5BY5A 4ZU4A 1CAUB 4JV4A 4XFGA 3FX3A 3SCGA 3USSA 2BNMA 4LTAA 1QY4A 4Q29A 3EJKA 4Z82A 3CLPA 1XE8A 4JVAA 1YHFA 4IEYA 1EPZA 3H8UA 4QGNA 3CEWA 2IXCA 2PHLA 3H1MA 4ZU5A 1WLTA 4IERA 2IXIA 3B02A 4I0BA 1J3RA 2B9UA 4YRDA 3QACA 3ROUA 5I8TA 5BV6A 5I0RA 2IXJA 5BXXA 3G7DA 5FLIA 2QVSB 3RYKA 1O3TA 2Q0AA 1NE4A 4QMAA 4QXKA 3M70A 4XF3A 2N7GA 5KBFA 5LRSA 2ATFA 3BB6A 4XF9A 1OMIA 4HN1A 5LRRA 2GZWA 4AVCA 1DGRA 2D93A 2BGCA 1J3PA 1ZRRA 4K8FA 3CF6E 1L3JA 1NE6A 1YFYA 2XLGA 5E1RA 1NZCA 3RZZA 3U10A 2UYAA 4IEZA 3IDBB 4PJYA 5I8YA 2DCTA 4J1WA 3H1WA 4IEVA 4XF4A 1X7NA 1CAVA 1Q3EA 2OPKA 2IXLA 4EV0A 4LLOA 1WA4A 4NVPA 1TQ5A 3UKVA 2WC2A 2VQAA 1ZZ9A 2I45A 3E5XA 3SXWA 4B29A 4HVOA 2IC1A 4J1XA 2EVXA 4R52A 2XHKA 1ZX5A 1YFWA 4UBGA 1O3RA 4I01A 2CAVA 1J59A 3I59A 2UY9A 2XLAA 3MYXA 2FMYA 3SCHA 3KGZA 3OTFA 5JCTA 3D82A 4XF0A 4HSLA 4WBBA 4JTNA 1IPJA 3BPZA 3WW3A 4XFAA 1LKNA 4QGLA 1IPKA 4MGKE 2HJIA 3ETQA 1Q5OA 3E97A 3GYDA 2BEOA 3ES1A 1RL3A 3DKWA 4MGYE 4MV2A 4AXOA 4EWAA 5CADA 3EBRA 3PNAA 1RC6A 1YFXA 3H3ZA 3MPBA 5C6CA 2H0VA 3DN7A 4N9IA 3EHKA 3CJXA 2GAUA 3E5QA 2OA2A 5JR7B 4FAHA 4GULA 4KU8A 3OGJA 4Q0PA 1CAWA 1O7FA 4MZUA 4META 1CAXA 1DZTA 5KHGA 2P17A 3WW2A 3NKTA 3UKNA 4KU7A 2VECA 4WVZA 1QXJA 2OZJA 5BPXA 1SFNA 3E6DA 5I0UA 2PYTA 4H7LA 3ST7A 3D0JA 4HVQA 3M3IA 1V70A 4UBHA 2PAMA 1X8MA 4HSJA 4HMZA 2KXLA 5CU1A 3ES4A 4MGIE 3R6SA 5J48A 3OCPA 1FT9A 5FPXA 2Q4SA 5I0SA 4BIFA 3NW4A 3ACLA 2Z2SB 1LRHA 3IDCB 4XFCA 2PA7A 4FBFA 3ELNA 3RNSA 1UPIA 1I5ZA 3GBFA 3O14A 4KL1A 5FPZA 2PAKA 1PM7A 1J1LA 3TNPB 1HW5A 3H7YA 4UXAA 2D5FA 1O5UA 4IEOA 3S7EA 3NSTA 1X82A 4IESA 1CAVB 3RYPA 3NJZA 4LUKA 4JTOA 1ZVFA 3E6CC 3FHIB 4Q0SA 4X6RB 2UY8A 1LR5A 4YNIA 1YLLA 3KGLA 1EYBA 4KWJA 1UIKA 2Z69A 5EFUA 1CAUA 3I59B 4IEUA 3OF1A 3N4MA 5JAXA 2MNGA 2PTMA 3S0MA 3EQEA 3HQXA 3H3UA 3VHRA 1FI2A 2GU9A 2Q30A 1JUHA 5FLJA 2GH2A 4IEPA 4I0AA 4QGMA 5D1IA 3LOIA 4R8HA 2V09A 2CAUA 1RTVA 4X6QB 4MH0E 1EY2A 1NYWA 4HBNA 4I09A 3HT2A 5JSPA 5I91A 2BNNA 4XFBA 4ORFA 1YWKA 3RDIA 3WW1A 3H1YA 3SHRA 1RUOA 3QOPA 2ET7A 3U11A 1ZNPA 4TLFA 4N9HA 2GC1A 2O1QA 2ZKLA 1PMIA 3TNQA 1XRUA 3OD0A 4AQ6A 4EWDA 1SQ4A 2VPVA 1O4TA 4LA2A 3HT1A 4RD7A 3EO6A 5EZWA 3IIAA 3DL3A 5I93A 4AQ2A 5LEKA 3S7IA 5KHIA 4QM8A 4E2SA 1H1MA 1O3QA 2GC3A 2D40A 4OFGA 1ZZ6A 1RGSA 1VP6A 3KMHA 4D7TA 4QX5A 3LA2A 3I7DA 4OLLA 5JSRA 3FZ3A 4WZCA 4E2QA 4BYYA 1SEFA 2QNKA 4F8AA 1O5LA 2OZ6A 3IBMA 4I3PA 5F1RA 4Q0UA 2XKPA 5K8SA 2MHFA 5J3UA 4IEWA 5FQ0A 4LUMA 4EROA 1OFNA 1NXMA 1UIJA 1ZRFA 3L2HA 1ZRDA 4KWKA 2QDRA 2PFWA 1ZREA 1O3SA 5AVPA 4Q0QA 5KHHA 2H6CA 4KWLA 4L2NA 3U0ZA 4P9GA 1QWRA 1DGWA 1J58A 4Q0VA 3LAGA 1LB2A 3CL1A 3WW4A 2QCSB 4I02A 4FAGA 4LA3A 4HZFA 3MZHA 4I2OA 2XL9A 5FLHA 1ZRCA 4HN0A 5HI0A 3LWCA 4HLTA 4E2GA 2ETEA 5JSOA 5KHJA 1X8EA 2IXKA 1OD5A 4LULA 2OYZA 4MGZE 1DZRA 2Y0OA 3FWEA 1VR3A 1XE7A 2WFPA 4FT8A 3JZVA 2O8QA 5E16A 3NVCA 3LA3A 5BUVA 2QJVA 3PVBB 3SCFA 1UD1A 2Q1ZB 5J7MA 4YSFA 4O9EA 1YUDA 4DINB 3UKTA 4CYDA 2K9ZA 1GQHA
chains in the Genus database with same CATH superfamily
1MACA 2OKXA 3O1SA 1RYYA 2CDPA 1TMF3 1XNKA 2E9QA 2IZWA 3AL5A 3FFQA 3I54A 1S0CA 5D2AA 1RHI1 3H9AA 5H9QA 5IJRA 3ZXFA 1YFUA 2W92A 1J3QA 4AFDA 2DBNA 2H6BA 5A6QA 4FPLA 1DG6A 1BK1A 2BVBA 4INDA 3DPRC 4ARXA 2IXHA 1JOJA 2OUHA 3KQRA 5LW9A 2XKOA 5F5CA 3ZSEA 3ACHA 1JOBA 3MI8A 1PMJX 1I6XA 2RG4A 1FPN1 3MUZ1 4HANA 4IEQA 5FZ6A 5CA6A 4CP9A 5I0RA 4LBQB 3PHMA 5FY5A 3PVEA 4OHZA 1WGPA 2F4PA 4XFFA 4YYOA 4NPMA 2G9ZA 3WDVA 4CP1A 1UPSA 2P5BA 4AEDB 5IK8A 2QKDA 5KHKA 3JCIA 4ISQA 4A7KA 4PDWA 4G9SB 1POV0 4RFT0 5FPVA 1OSGA 1VRBA 1ZBA1 3PUAA 5F6LB 3WP3A 4DEQA 1YJLA 2C0ZA 2OVUA 1Z7S1 5ABJB 3RWKX 1V9U2 5FP9A 1K45A 2D44A 2W1SA 2XONA 3HBZA 3RFRA 2JDNA 3AFKA 2WNUC 1AHSA 3FJSA 4HXCA 4LBNA 4CU8A 1NCRB 1US2A 5AVAA 4BU2A 4BB3A 4BMEA 4MX3A 1U12A 4ITCA 2VBPA 3ZKUA 2Y64A 4UF0A 4XBQA 2WABA 1OUXA 3N9QA 2ZX3A 1ZZ7A 3CJIB 3CO2A 3RSJA 3ZVXA 5LEJA 2VY0A 2MPFA 1QJFA 1JU4A 5FQ0B 1W2NA 5KC6A 2NM1A 1CGPA 2B42B 2Y8KA 3VZKA 5C8WA 3MO4A 2BTVC 3FN9A 5BNQA 3ZYPA 1WBFA 5DXDA 2JG9B 3I2HA 3X29B 3ZSKA 1FOD2 1LAJA 3I2KA 3GZAA 4X8PA 1NZIA 4AVAA 5GM0A 1RUF1 3O0XA 2WYFA 2WO3A 1GKBA 3DV8A 2E7QA 2JXAA 3AXEA 3VZJA 4FPHA 3C7GA 4AVBA 4D7YA 1QEXA 2ZA9A 2XJSA 3BU7A 4LKDA 1STMA 3ZPOA 2DBIA 1FXZA 1B35B 3A4UA 3WY6A 4QQ2A 4HT1T 1VBA2 2WINB 4UFMA 3C3VA 4MUVA 2VUDA 1JN2P 3D3AA 2ZOEB 2WQZC 2AYHA 2D6OX 3E1F1 4FOQA 4XF1A 4O9GA 3KVAA 3LEMA 3RZHA 4WM7A 4GMP3 3DCQA 1OKOA 1F35A 1WMEA 1YYNA 2B5HA 2W94A 1HQNA 3GCXA 4NMIA 3WT3A 4LBKA 4XIOA 3WNMA 2JDPA 4YVSA 1Z78A 4OI1A 4XFIA 4BHPA 3I3DA 2W47A 3N7JA 1YI7A 1Q8SA 3APBA 5JOXA 4RS5A 1H9WA 4NIAA 4YM2A 5HXMA 2VR4A 3U4XA 1F5JA 2GC0A 5H9SA 3I2IA 1V00A 4XZUG 5FP4A 2IFWA 3AL6A 1D2QA 4LMFA 2ZHKA 3T2TA 2R061 5BY5A 4NN0A 4JV4A 3LDKA 1ND2C 1NG0A 4XJZA 2X8KA 2WWJA 4QHBA 4EQVA 5AFEA 4P9LA 4CU7A 3FMGA 4YZ5A 3SCGA 2WNUB 3CZUA 3HVDA 1OT5A 1AZDA 2JX9A 4BXSV 4XHBA 2FDHA 5ACA3 4QU1A 4XUPA 1UQXA 5FZ0A 1UZ0A 3AP4A 1RUD2 4COVA 1X33A 4CRQA 2VVDA 1GV9A 3L2YA 3ZXJA 4NIGA 3I49A 3MF6A 5DN2A 4JVAA 4CP9B 1EPZA 1ZM1A 5FY4A 4DZGA 1H6XA 1OA2A 2FDJA 2BQPA 2JENA 3KHBA 2MEV3 2X5IA 2ZACA 4KI5M 2BWCA 1N1VA 5G05L 2AH2A 2NN8A 2CSGA 5GJ6A 1QMJA 2FDIA 3NQHA 3WZ1A 2RV9A 2GDFA 4I0BA 4PDWB 4GA9A 4N53A 4GMP0 1X9PA 5LATA 5D8AC 1AR92 4YRDA 3QACA 1V6IA 4JGZA 5I8TA 2YFUA 2WS92 3IKWA 5FK8A 1QJU3 5FZKA 2G9FA 2VNOA 4QHZA 1NQDA 1Q56A 4YW3A 3HNBM 3NWKA 2WZ8A 3RYKA 1F15A 3PU8A 4ASMB 5LBCA 4CUAA 2ATFA 3WUDA 1RUI3 2W39A 3BB6A 3JBG1 4L9BA 4UF0B 3AKTA 3ILNA 4XF9A 1TNRA 1BBT2 5IVJA 2A3XA 2WA4A 3JQWA 4BISA 2ZTNA 1Y9MA 1QIQA 4HK9A 4NJ4A 4K8FA 5C5TA 5A6YA 4Q5OA 4PI0A 1YFYA 2RS12 4LT5A 4JDMA 4K20A 5F3GA 4A4AA 1U5YA 4LQRA 3SLIA 3OJBA 5FOJB 3MV01 1W3XA 2WZR2 5A33A 1CQ9A 4LHLA 2DCTA 4J1WA 4PJYA 5I8YA 4XXAA 3TB0A 1S0GA 4AEMA 1H2LA 1QOTA 2IFRA 2IXLA 4A7ZA 1TQ5A 1DQ1A 2VQAA 3I3EA 3OEAA 5EWSA 3J26N 2BVVA 4B29A 2A6WA 3C7HA 4AI3A 2IC1A 4J1XA 1GANA 4AWDA 1SG3A 1O3RA 1LHVA 4NPLA 3ACGA 3N9PA 5FZ4A 2W68A 1HXS2 4Y5SA 4E9KA 1DIWA 1CZTA 2FMYA 1DBNA 4ZONA 2W52A 4DY5A 1Q8VA 5JCTA 3D82A 4XF0A 1UAIA 2VOWA 3CU7A 4I3GA 1IPJA 2HBTA 4YVSB 3JUUA 3S6PA 3C7FA 2HJIA 2YY1A 2ZGTA 5A3LA 3O1VA 2QQMA 2ID4A 2ZMLA 1RL3A 4MHRA 5APAA 3BUCA 3IIIA 4MV2A 2W2IA 2HYXA 1BCXA 3H3LA 1AL23 1JYVA 3O1TA 2RM23 4FO9A 5EYXA 5A70A 2RR13 5A7QA 2EXIA 1DQ6A 3RJ2X 3K3OA 2HWB3 3H3ZA 5C6CA 2WDBA 1MQTC 3BI3A 2VTFA 3UK9A 1PIV1 1DU3D 2XMLA 3ZFFC 3CJXA 5FZ8A 4N90A 2GAUA 5JPMB 2HWD3 2WFF2 2OA2A 4KU8A 4C91A 5JXHA 1P8JA 3BTYA 5DDJ2 1A3KA 1CAWA 4QPIA 1O7FA 1YC61 1MS8A 4CEWA 1LOEA 1DZTA 2HWF2 2P17A 1TME3 2VCAA 5GZGA 2AREA 4CDXC 3N7LA 1K5JA 5L7OA 2OZJA 1UYYA 2A6XA 2Y6GA 1JTZX 3VL8A 2X5IB 3AM2A 5BPXA 2RHPA 4ZZ5A 4LORA 1AL0G 2VZSA 1EV13 3TEWA 3WNNA 4EN9B 4UW4A 1OH4A 2OQ6A 3E6DA 3QH6A 4Q4Y3 1S2BA 3M4FA 2VE1A 3I2DA 4HVQA 2XVGA 3U14A 4YW2A 4JGZB 3K3NA 1NQJA 1WW7A 1RUH3 4IV1A 4JGYA 1RUE2 5J96B 3PU3A 5EPAA 5CFDC 4HMZA 1QOSA 3RG0A 4MGIE 1FT9A 2WQ8A 3MGUA 4J25A 1W8ZA 1I1EA 1AX2A 1JMUB 4Q4W2 1IHMA 3V65A 1MZEA 3O1MA 4KGGA 2VBDA 2W91A 1UY0A 3GBWA 3IDCB 3VN4A 1G9AA 4XFCA 4FBFA 4LOSA 4LO6B 2VOXA 3QCWA 3AP5A 1I5ZA 5JOWA 1SHWB 1G8WA 1UU6A 1V9U1 4AK3A 4AG4A 2DUPA 3P1IA 5HXVA 1YRZA 4LOTA 1S0JA 2FD8A 3W20A 2KD7A 2WA3A 5C7GA 3K46A 4ZS2A 5A33B 2VMEA 1JW6A 2EIEA 5A7WB 3VBFA 5EIYB 2ZZQA 2EXHA 4KG0A 5FZ3A 5FFOC 3RYPA 1VE0A 3ETPA 1R1A2 3E6CC 3SKVA 1GU3A 4MADA 3B00A 5J37A 3C8XA 4JQRA 2WO1A 3MIHA 4BQWA 2UY8A 3W5MA 3KB5A 1OQEA 4M4PA 3KGLA 4W6YA 4AEKA 1WMFA 1EYBA 1UIKA 1CPMA 1EAH2 1LTEA 1AYM2 1FOD1 2Q8DA 1JYTA 3WD5A 4GB32 2WR9A 5A3OA 1CAUA 1LOFC 2UWAA 1SBFA 2MNGA 2PTMA 3S0MA 2RJKA 2TNFA 3H3UA 2WRAA 3MV11 1ND3A 4UAPA 4YWAA 1DHKB 3MICA 1JUHA 3PUIA 1LEDA 1WD4A 1D4VB 2V4VA 2X10A 3OOXA 1PM4A 1N3PA 2C9KA 1C8M2 2RMU3 4XJUA 3POJA 3KCXA 4QGMA 5D1IA 4K21A 2PN5A 4Y5TA 3VBFC 1JZ6A 4XIKA 1VRH3 5F5AA 5GLUA 4XUTA 5FXWA 1XNCA 1U5ZA 1RTVA 1UO9A 5FMOS 1RVF2 4UI9L 1QGLA 4ZXKA 1GP5A 4HK8A 4HBNA 4RQPA 1GSLA 2JDMA 4OHXA 2X05A 4IQPA 1SACA 5JSPA 2WNOA 1W6PB 3P3NA 3ZSMA 3ZR6A 2VVEA 4XFBA 1GNHA 4DPNA 1PO12 2DU1A 3ZM8A 3ZSJA 5FOBB 4N43A 1JZ4A 1ND3C 5CB7A 3HNMA 3LFIA 4YW7A 2R072 3IZOA 1UKRA 4TLFA 3U11A 3ZOIA 4GH4A 4NR1A 2Q1MA 1Y4WA 2O1QA 3LIHA 3MW2A 5IHRA 1W6NA 4CVUA 3OD0A 4AQ6A 3ZIXA 1ENXA 1SQ4A 2VPVA 1G9CA 1XU2A 1V6LA 2VOVA 4PT6A 1O4TA 4CXWA 3HT1A 1UX7A 4IW3A 4RD7A 3KF3A 5LBFA 4AOCA 5A1AA 5KXCA 4AHZA 1GOHA 2ZJCA 5LK7B 4RHV2 5FUIA 3TN92 4JKMA 5F39A 3F2ZA 3CKHA 4OUEA 1H1MA 4M3CF 2FCUA 1O3QA 3ON7A 1D4M2 1WA6X 3OYWA 2B4KA 1FPN2 1QU0A 1JZ3A 1ZZ6A 5DZEA 5JOZA 3WG4A 4IE7A 5F37A 1OF3A 4XPVA 1WW5A 2ZX2A 3KV4A 4A44A 1LGCA 1YQCA 1SFYA 4LKSA 4QX5A 3ACIA 1AR81 1LOGA 3WF1A 4AFBA 3PTYA 4B7KA 1AR91 1DFQA 1ZBA2 3KWVA 3FFZA 1SFPA 3FLPA 4GH4C 4B1LA 2WS91 1O5LA 3ZXAC 1NLRA 3G6JB 3A7QA 4Q1RA 2PHXA 2QQJA 1COV2 1KDMA 1RMU2 2OS2A 2JE8A 5FMOL 2MHFA 5IVYA 4Q4X2 3SC7X 4N7UA 5F2SA 3N36A 4EROA 4QQLA 2A6ZA 1UIJA 3VBFB 1LNSA 3AMQA 5CKMA 1FX5A 1BBT1 1LGNA 4HETA 1SMVA 3L2HA 1YQ2A 1L7RA 1PO22 3I3QA 3ZYFA 1ZREA 1GFF2 1O3SA 4HFSA 2W1WA 3ME2A 4PQQA 4Q0QA 4QU2A 1UU5A 4L2NA 5KHHA 2ZBJA 1W6OA 1HRI2 2RS11 2VTXJ 5EYYA 2KA3A 3I2FA 3T1MA 3ZN4A 2R043 2YV8A 1OUSA 1LB2A 3WW4A 1UMZA 4FPKA 1AF9A 1WD3A 4PHZA 5HBAA 2EIBA 2W9XA 2D6NA 1ND3B 2XL9A 1ZBE2 1OPOA 3LB9A 1HN1A 3LEGA 3LPFA 1ZRCA 4RA0A 4JRLA 2JEMA 1D7PM 3T1LA 4CCJA 5G04L 4Z2WA 1QOOA 4MVTA 4Q4V1 1OD5A 5AFBA 1U5XA 1GBGA 2DFCA 4CDUA 1DZRA 2Y0OA 3FWEA 1VR3A 1ULFA 2AEZA 1H1AA 4H2AA 1XE7A 2D3SA 3AP6A 2DURA 1MZ5A 1QJX2 2HWE3 1W39A 4YZ4A 2FDKA 3MIBA 3PVBB 4RQPB 5FZEA 1PNGA 1UY2A 2FHRA 2Q1ZB 2YC0A 4XDOA 5FWEA 4DXZA 1RUF3 1Q8PA 4CTEA 3JXSA 1WKYA 5FO7B 1R083 4K8RB 2JE9A 3VBUC 3POEA 3KHCA 4K1YA 1N1TA 3THTA 3ZYIB 4EV0A 3AZZA 2DTYA 2XXZA 4N43B 3T0DA 2XJUA 3A22A 2YPDA 3VHNA 1QQP2 1OOPA 5J1XA 1CPNA 3OG2A 3MDPA 2P34A 4GH4B 1W9WA 3NL1A 4W6XA 1W6NB 3V64A 2RDSA 3LZZA 1EUTA 4D7SA 5KXBA 1MS0A 2WFF1 2AC1A 3UNPA 3POGA 4B4PA 5JVVA 4BQ3A 4YW5A 4CDQC 2R1BA 4K7JA 1PX4A 2PAEA 5FPAA 2DCKA 2PHDA 1R1ZA 2HWF1 4OMDA 4BE3A 4D8MA 4FPOB 2C9AA 2ZKNA 2W95A 3AP7A 4Y1UA 2DWRA 4WVVA 1NCQC 3K4ZA 2X53S 5CEHA 1IG0A 4IV3C 3CQOA 1A8DA 1RUNA 4Q1PA 2V4AA 4XETA 2YMZA 3B93A 1VJ2A 5IFPA 3W9AA 1CAXB 4PIXA 1KRIA 4RSUA 3RMYA 4EWEA 1VBD3 1OOPC 1GZWA 2DDUA 4KH9A 4EE2A 1OH3A 3C7OA 1GZTA 2J1EA 4AZZA 4DNYA 3V0AA 2EAKA 2XPJA 1XBFA 3USUA 1RUE1 1S0FA 1YO8A 4GJZA 3RZGA 3FLRA 2QQVA 4NE9A 1SZBA 2ET1A 1WCUA 1XOYA 3N7MA 3FL7A 1MVEA 3VKOA 3KV5A 4HONA 5F5QA 1R64A 2VVFA 3JD72 4NO4A 3N3HA 2ZPXA 1HB3A 1JYNA 3JBG2 1PX3A 4WVMB 1VLNA 1JXNA 1PGL2 1W8NA 2XVKA 4MLOA 3AYAA 4XAAA 2D3PA 2Y34A 3RGBA 3GXUA 4ARYA 3THCA 4DEVA 4COWA 3M7AA 2HWC2 1QJEA 2WAOA 4PLMA 1W6OB 4BH9A 4YFZA 3RPQA 3INAA 4FPEA 4P5HA 2J1VA 4CCKA 1A8MA 4N7IA 1OLME 2CTVA 4RL7A 1LOAA 1CIYA 4NRPA 5AC92 3A23A 2ZAAA 1FMD2 4K3UA 4ATFA 4A45A 4YM0A 1DYOA 1GP4A 4CXYA 4DXSA 2BPA2 4YGDA 2K0GA 2VZOA 4QXCA 5H9RA 2HKXA 1GQGA 4WZFA 4AEDC 2ZCWA 2ZABA 3AKSA 4ZU7A 1AYM1 5A80A 1OC1A 4GB31 2JDYA 5IAVA 5DAVA 3LA7A 1DYPA 5FZ7A 2ZX1A 3HD8B 3MLLA 2ZGOA 1W05A 4PIZA 4UYBA 2JG8A 3DECA 2VQUA 4L99A 5K7PA 4HG6B 4PIYA 3BALA 3B69A 1VBB3 3D0SA 2D3RA 3K51A 1C8M1 2XDVA 2VZVA 3R4UA 4XFGA 1NCQB 3HEIA 3MIFA 4IV3B 4EN6B 2NMNA 1LJ7A 3FX3A 5T50A 2BNMA 1QY4A 1RVF1 1OOPB 2QFEA 4XVHA 4Y5Z0 4Q29A 2YBPA 1POQA 5JZGA 5BNPA 4XUQA 3ORJA 4DXRA 5DAPA 1BEV2 2JG9C 4Q26A 1PO11 4L8QA 2VU9A 1WCSA 3OBAA 4FPCA 4P08A 4EZ4A 2ZHMA 1HV1A 1TVGA 3CEWA 4JKLA 4Y20A 5LA0A 3B7MA 3H1MA 2JG8C 2R071 5FYIA 1WLTA 3ZXKA 1YQ5A 2IXIA 1XYNA 2VZ1A 4FQ4A 1J3RA 1TEIA 1QNWA 1LCLA 2B9UA 2JD9A 1HB1A 1K3IA 1VMFA 4LBQD 4GWMA 2IXJA 3H8OA 5BXXA 4JDNA 4M3CA 1V6KA 3OB8A 2D98A 1GZWB 1NA1A 4RHV1 3DF0A 4QMAA 4TXWA 3M70A 2R7EB 2NYYA 1SDDB 3V0AB 2N7GA 4NRMA 3TN91 3AYEA 2VMGA 5FMBA 1AX1A 5LRSA 4RFRB 4GIQA 2AENA 3TEZA 3U75A 4HN1A 5LRRA 3USUB 1SPPA 5JZGC 1D4M1 1J84A 4DUXA 1ZA4A 2WZEA 5A7OA 3VDDA 3PDQA 4AHYA 3WEZA 2R49A 3OBRA 4QHOA 2J1RA 2BRTA 1FNZA 3AJYA 2D6MA 3CF6E 3PUHA 4M4RA 1NE6A 1SBDA 2XLGA 1G9DA 3WF2A 3WQ7A 1XSRA 2RDQA 1DF0A 1N47A 4IEZA 4R4XA 4ZS3A 3U10A 3ZR5A 3W5NA 1GLHA 4OUSA 3H1WA 3WNXA 5FY7A 1COV1 2PLV1 3POYA 4IGOA 5FIXA 2OPKA 1RMU1 2WO2A 3B5LB 2FDGA 2YXSA 3R4DB 4LLOA 3GJAA 4QKFA 4LBOA 4Q4X1 4A41A 4B8EA 1NA1C 1ZZ9A 2I45A 2UURA 3E5XA 4TYSA 3S30A 4V2VA 3WOGA 3AX4A 1WCKA 3OY8A 3IPVA 3POIA 4P5YA 1ZX5A 4UW6A 4P9IA 1PO21 5ISLA 3T3YA 1GZ9A 3OBTA 3TEYA 3WDWA 3VDDC 1NXD1 4Z8BA 3PMSA 4WVWA 1HRI1 2VW2A 4CSWA 3KGZA 3OTFA 3ZO0B 3PL0A 4HSLA 4WBBA 4ES9A 2VZTA 4BQXA 4PDWC 3VBSA 3BPZA 3WW3A 3NV1A 2QBXA 4XFAA 3K4DA 4MGKE 3ETQA 5JXGA 5A32A 2WBKA 2RDRA 4FXKB 4GWJA 4RGKA 1WCDJ 1ZBE1 3DKWA 4MGYE 5DPNA 4BCUA 4FPYA 1AXYA 2JG8B 4LO5B 2C4XA 3AKPA 5CADA 3EBRA 1RC6A 4LIVA 1YFXA 5JXIA 1OD3A 5JUVA 1WBLA 1XSQA 1O8PA 5IK5A 2H0VA 3J8F3 3KM5A 5A3UA 4N9IA 4AYUA 3NV4A 2Y26A 4IXLA 4XURA 3E5QA 2EICA 1KS4A 1QNYA 3EXUA 3POBA 4FAHA 1QJX1 4GULA 2JB4A 4Q0PA 2W1QA 4QX7A 5CISA 4QT6A 3LD8A 5JZGB 5BNPB 4PQ9A 4ISRA 5DG1A 3VZLA 3UKNA 2YZ4A 3AXDA 4KU7A 4OHVA 2VECA 5DG2A 4WVZA 2ZGQA 3KT4A 1XPWA 3T4VA 1KFUL 2XJQA 1WLDA 2VMHA 1QQP1 2DFBA 3U4SA 1VBA3 4GJYA 4MYEA 1UOFA 2PYTA 3KCYA 2Y6HA 4IUGA 1K42A 5K9YA 2XOMA 1AR63 3M3IA 4LBJA 4W50A 1MS4A 5CKNA 5FYYA 2PAMA 2O8OA 2BERA 3A0NA 2FCTA 3ABZA 2VJXA 2ERFA 4HOOA 4M3CB 5IUQA 2FCVA 5FRAA 5ACA2 3ES4A 2GN3A 1W9FA 2E33A 1UZVA 1NA1B 4H3WA 3Q8EA 3KF5A 4WM7C 5FPXA 3MW3A 3VD3A 4E8DA 5I0SA 1XYPA 1W2AX 2Z2SB 1RJ8A 1QXPA 4FP3A 1PZ8A 4QB6A 5C9AA 1SPPB 4WV8A 2PA7A 2E7AA 3NRUA 4YVSC 3ELNA 2PHRA 3NMBA 1F8VA 3VDDB 1SCRA 5IVBA 1M4WA 3GBFA 3ITQA 3O14A 5C4WA 3RI9A 4RS5C 3VD7A 4NWWA 1SLIA 3O0VA 1YXWA 2CDOA 2K46A 2VZRA 3QBQA 4LBMA 5C3SA 4FTBA 4B7EA 1WWYA 1MEC3 2RE9A 2X29A 3C2UA 3J4UH 1AR82 3WF3A 3H7YA 4UXAA 5EXOA 2D5FA 3RZMA 3WP4A 1OXCA 1ST8A 1D2SA 3M3QA 1WZXA 4YGBA 1JYCA 3Q8CA 4TN7A 4QQPA 4YLZA 4V2WA 2BJSA 3ZPYA 3ZXDA 1RUD3 5CFCA 2JIJA 2JDKA 4IESA 5FZAA 4S2GA 2JICA 2D6LX 3NJZA 5FYZA 4JTOA 3O0WA 3JD71 2PELA 4FPJA 2VZ3A 3NNJA 1UZYA 1RUI2 1LR5A 5L9RA 1YLLA 3ILRA 1PGL1 5JMOA 1ODMA 1BZWA 2Z69A 2W1UA 4HPKA 2VOKA 5EFUA 2Y6JA 1UYPA 3QH7A 3N4MA 4QB1A 4GD4A 5C4WC 5JAXA 2HWC1 5HCFA 2I07B 1O59A 2X5IC 4KQ7A 4RGAA 2WZPP 3UJOA 1LESA 2W08A 1GICA 4DUWA 2P6CA 1O4YA 5JDBA 2ZZJA 2WWUA 3DYOA 4WM8A 3VBSB 4MG2A 1C1LA 4N53C 1V6NA 5EJZB 2IWGB 2XQRA 2ZEZA 5LA9A 1N1YA 1KEXA 1LU2A 1CD3G 2PHUA 4JGZC 3RRDA 5AC91 1VBE3 3K2OA 1FMD1 4LHKA 5CFCC 2QQNA 2IVIB 2ZHLA 1XNTA 2YGLA 2DTWA 3PUSA 4MH0E 1U0AA 2CGOA 4Q4V2 5FXZA 3SEEA 2ZXQA 5A6XA 1MS9A 1HQLA 2IVJA 4BLJA 3MBWA 1FAYA 3ZFGA 1R093 3CIHA 4WM7B 4YZ3A 4M00A 4YGCA 1WMDA 3RDIA 3W59A 3VBOA 3BVCA 1GNYA 2WUHA 2WZR3 3WHTA 3WW1A 3ZX7A 3H1YA 4AFMA 1BLZA 1W06A 3ZXLA 3SKJE 4B4QA 1HRV3 3ZYGA 2ZGSA 3MFAA 5GLZA 5JWPA 3N9OA 2Z42A 4YM3A 1ZNPA 3POSA 2XUEA 5BNOA 2XBO3 2GC1A 1AR71 2DVAA 5A3MA 4RS5B 1PMIA 2VZUA 5IATA 4D94A 4EWDA 4TSVA 1AL22 2RM22 3UGGA 1Y43B 5DAWA 1POV1 1PK6A 3SNMA 3EO6A 2RR12 3IIAA 1DLLA 2WLQA 1MVQA 4YZ2A 4JQTA 5KC5A 1QJY3 5FZDA 4SLIA 1RUG2 1HXS3 1MZ6A 3R05A 1CJDA 3BOPA 4Y1YA 1QJZA 5T52A 1IG3A 3UESA 3S7IA 4NUBA 4NIDA 4LO4B 1BEV1 2HWD2 2RDNA 2ZGLA 4CU9A 1SBEA 3PJQA 4OFGA 2J1TA 5DAQA 2P1BA 3GBGA 3P5BA 5CNAA 1DYKA 2DCJA 2Y0IA 4AEJA 4ZHNA 1RGSA 2XVLA 3KMHA 2ZX4A 1W6QA 2ARCA 3DGTA 2VMFA 4GQ7A 1UOJA 2DU0A 5JLVA 1LOCA 4F83A 3I7DA 4OLLA 2YYOA 4E2QA 3WG3A 1KFXL 2PHWA 2P3KA 2DVFA 5B2GB 3UT0A 5C4WB 2QNKA 3O1PA 4AHXA 4F8AA 2WQ4A 4P14A 1CZSA 4FI9A 1APNA 3FHAA 1EV12 2ADDA 4LR4A 4Y22A 2R30A 1BMV2 2VW0A 4Q0UA 1REFA 4ZY9A 1UZWA 5K8SA 5F9TA 4KBZA 4NWVA 4N53B 2NLRA 2VMDA 2OIIA 5K0UA 4CPBA 3K75B 2GMMA 1IS6A 2WNVA 1UOBA 3AJZA 3GZEA 3EMRA 4IEWA 4K40A 5FP7A 3ASIA 2R16A 1OFNA 4CUBA 4QPGA 5DDJ3 3OGSA 1LECA 1H2KA 1E5HA 5FMDA 5CFCB 4QPYA 3MEPA 2QDRA 2EIGA 2HWF3 2AGSA 4BK4A 5AVPA 2H6CA 4KWLA 3GF6A 2RS33 4C1WA 4QPIC 4CEWC 4OCTA 1DGWA 4W8JA 4M0HA 4QWNA 4AGRA 4HPKB 1ZA7A 1QKQA 3LAGA 4EN8B 3CL1A 1X50A 1HB2A 5HV4A 4C1XA 2QCSB 2VW1A 4I02A 5L7OC 2A73B 4FAGA 1FV3A 2HEYF 5A3WA 5EHDA 5A6ZA 3O5SA 2ZS6B 4R9DA 1YI9A 1W6MA 2VULA 1W8TA 3JU9A 4HN0A 3RZJA 4HLTA 4FFFA 5KHJA 1RJ7A 2NPIA 2AR6A 3KQ4B 2OYZA 1ULCA 1W99A 2ZHNA 4IV1C 4Q4W3 4JGYC 1UMIA 3T2QA 3FHQA 3JZVA 5FYBA 3OBZA 1HKDA 3WDXA 1T6GC 3NVCA 1JHNA 4KMQA 3LA3A 1RITA 1RUJ2 1BXHA 1UD1A 1IKQA 1W8WA 1H30A 4QQHA 2D97A 2GALA 5J7MA 1K12A 4O9EA 1YUDA 4LK6A 4BM8A 1IS5A 4BIOA 2K9ZA 3POFA 5L19A 1KS5A 2D43A 2GC2A 2HLEA 4XJAA 4OI0A 4ATEA 3BGAA 1ASJ3 3E5UA 2C24A 2VGDA 4B1MA 2FMDA 3WVJA 2EF6A 1VALA 1F5FA 4LJHA 1R1A3 2EAAA 2C1FA 3Q8AA 4BXFA 3S57A 5FP3A 1RINA 1PVC3 1W0PA 2UYBA 3ECQA 4HVRA 3VUOA 1G6NA 5FYHA 1S0EA 2QQOA 5FV3A 2UWCA 5T54A 5FDBA 4GMP1 1EAH3 4YVWA 2VCMA 4XEZA 4A6SA 5CG8A 5EV7A 3ZN5A 5LCWL 1IZ3A 2GN7A 4TLGA 3WQBA 4AHWA 1DQ4A 1OPMA 4C0BA 4BZ4A 2EXKA 2R32A 1J1TA 3HQUA 1Y3TA 4XFHA 3H7JA 3J7NA 4YARA 5F6KA 2P3JA 4D0QA 1CAWB 1ALYA 3N35A 4FPFA 1DP0A 2XGXA 4QPIB 3VZMA 4CEWB 1H8VA 2CL2A 3D8CA 4MSVA 3O1UA 4MOAA 1VBC3 2DUOA 1CJPA 4Z1VA 1ZZCA 1S55A 4XBLA 3ZKYA 5LA2A 4XTPA 1FV2A 1RVF3 1AX0A 2PQQA 5L7OB 4D3WA 3ATGA 4BQ1A 5FO8B 3AB0A 1LEMA 4UFLA 5KR7A 5ACA1 4A7YA 3WCRA 3O1OA 1OVPA 1WLCA 5FZIA 2GNDA 4QD2A 5K0UB 1H1IA 2WNVB 3VKLA 5DZFA 1PO13 4PF1A 4RQPC 1OFSA 4DS0A 2E31A 3VL9A 4DRVA 2J7MA 1LHOA 1SLAA 4IV1B 4MO3M 4JGYB 3RYRA 1BVVA 2BGOA 3VHPA 2VOTA 2MEV1 2R073 2J1UA 4B3NA 4QDSA 3FLTA 4COYA 2JJ6A 4BOWA 2EA7A 3B9IA 3SEPA 5JI9A 1UCXA 4CEYA 4N43C 5CBLA 1W2TA 2QZ2A 4LE4A 1ENQA 3MW4A 1TE1B 5CVRA 4GALA 4CCCA 4JRAA 3LSEA 2YPJA 2BWAA 3F95A 1RHI3 2RJ2A 1KJRA 4DUVA 4PBOA 2OUJA 2NP0A 4E4HA 2A1XA 2PLV2 1RIRA 3PVNA 4AVTA 5HV0A 1ZRIA 1OLQA 2BNOA 3B01A 2E53A 3AMPA 4EN0A 2C26A 4H14A 1AVBA 1D4M3 4XQDA 1RUI1 1XC6A 1FPN3 4EYUA 1CESA 1TNFA 5I0TA 3J9SA 5L73A 1V0AA 1MPXA 2Y33A 3BCWA 4LEJA 4XJ9A 1GMMA 1Z0HA 2YG0A 3KSCA 3H50A 2BV4A 1W04A 2QTWB 1ZBA3 1EP0A 1OKQA 2A3WA 1ZZ8A 2B8MA 3VBRA 3PLQA 2ENRA 4IEXA 1Z7S3 2R042 2VZQA 3NAPA 3E6BA 3FC0A 1COV3 3IAPA 4QM9A 4ZU4A 1CAUB 3P3PA 1F4AA 4NHLA 4G3YC 5DZGA 4BLIA 1JUIA 3AFGA 3C7EA 2K2SA 1XNAA 4I0WB 3USSA 1VMHA 1S2EA 4LTAA 5FPLA 1CIWA 2G4IA 2LALA 3NNLA 4BPZA 2GP3A 1PO23 4W6WA 1WW6A 1JYIA 1LHWA 1YJKA 2VNGA 4Z82A 1TZOA 2VXJA 1E5IA 1I9RA 1HRI3 1HV0A 1XXNA 1W9SA 5EJ1B 1H6YA 1XE8A 3CLPA 3WR0A 3LDRA 2HWE2 5FZLA 2I74A 4AR2A 1W0NA 3AKRA 4IEYA 4ASLA 3H8UA 5FTTC 4CCOA 1RUC2 2DYCA 4IE0A 1ENSA 2NZ9A 3J7MA 3LEIA 1CN1A 1R082 2DVDA 3IM0A 4IERA 1ZBE3 4HKLA 5F32A 3B02A 4YFWA 1W3VA 5FPBA 3ZDVA 4AVSA 5J36A 3MIDA 1WCQA 4OZOA 5B4XA 3TEXA 4LXLA 1ULGA 3WP5A 4AE2A 1JYWA 4L92A 3ROUA 1OHFA 3LQCA 1AL21 3VZOA 2V5DA 2RM21 3SH5A 3W58A 1W2UA 3CBNA 5B4NA 5BV6A 5D21A 4L0PA 3U1XA 2YUEA 2RR11 5JI7A 3G7DA 2Z5WA 1H8TA 2QVSB 1PMHX 5FY9A 2KM2A 1DQ2A 1RUG1 2RJLA 4QXKA 2B9VA 2JWPA 2VQ0A 3OUHA 1Y7BA 2A71A 1UU4A 1SDWA 4RR3A 2VG9A 2D6KA 4XZPA 5JIUA 1OMIA 2HWD1 2P3YA 4CDUC 2DF7A 3KLSA 3BTXA 5LA1A 4JKKA 4NHYA 3MIEA 3M2MA 5FP8A 5HCAA 1UWWA 4AAXA 3GJBA 1ZRRA 3JQXA 5IK7A 4OI4A 3VD5A 3DUIA 4HL0A 3WDUA 3HQRA 1IGOA 4P00B 4AF9A 2IUWA 1DCSA 5E1RA 1NZCA 3L9JT 1W03A 4HKWA 3TOJA 3RZZA 3ZYRA 4RGGA 2LUWA 1A78A 3KV9A 3OYWB 4CUGA 4D6SA 4I30A 3IDBB 4V1PA 1EV11 2R063 4IEVA 1VB4A 1J83A 4XF4A 5SV8A 1BMV1 1DDLA 4Q4Y1 5EP9A 5A3NA 3OSDA 1OQDA 1NOVA 4QDRA 1VBD2 4E4ZA 2VQTA 4OI2A 1WA4A 3ZLIA 5IVEA 3UKVA 2WC2A 1JHJA 2CNAA 4MHUA 4BWOA 3SXWA 4BQ2A 2ARBA 2YU2A 1RUH1 4HVOA 3H8XA 2E51A 4A42A 1D0HA 2EVXA 2WIIB 4R52A 1F2NA 4RR3C 5FY0A 4QB2A 1YQ8A 4BA6A 1FYUA 2CAVA 4I01A 2GP5A 4Y1XA 3M3EA 4XUOA 1J59A 1UY4A 3WF0A 2XLAA 3NKGA 5FZOA 4W65A 3SCHA 1QHDA 4FVVA 3I2JA 2VC9A 3N9LA 4PCRA 3AZWA 3NV2A 3ZXGA 4XJ8A 4JTNA 1LHNA 1Q8OA 4CU6A 3RZLA 5FYCA 3ZIWA 1LKNA 2BUKA 4QGLA 5FZHA 1HB4A 5J98B 3IMNA 1Q5OA 1E57A 3GYDA 4XMAA 3DYMA 1QDCA 4M01A 1NX9A 4CCDA 3MF9A 4AXOA 1DLCA 4A6OA 4YGEA 3PNAA 3KT7A 2ZGKA 5C71A 4PBPA 3ZYBA 2Q1FA 5SV5A 5JMCA 1CONA 1BJQA 3D5OA 3MPBA 3Q9OA 1JZ8A 1JZ5A 2WN3A 2EIDA 3MFCA 2UU8A 5LB6A 4J6GA 2VNRA 1EUUA 1W28A 3HMYA 2OW4A 4AFAA 3JBG3 3AK0A 1AJKA 2ZEXA 2OXBA 4LK7A 3T09A 3OGJA 4AAPA 1RUJ1 5ABJA 3PMEA 2J1AA 4XJWA 3TWIA 1AYN2 4CDUB 1ULEA 4MZUA 4META 1JYXA 1BKZA 1NCRA 1XE0A 4RN5A 5KHGA 3W21A 4QX2A 4X8NA 1XYOA 4NAMA 3LSDA 3MUY1 1GOGA 2YFZA 2CWSA 3LIGA 5IVVA 1UYZA 2HH9A 2VCBA 3WG1A 4MXWA 2WWSA 1YQ6A 5AC93 3CJIA 5I0UA 4H7LA 1UNBA 3ALQA 3D0JA 2ZGNA 1AR72 2BU9A 2ORZA 5FREA 1T6BX 2CY6A 2QQKA 4LITA 1SCSA 4LO8A 3N9MA 1X8MA 3LGRA 4D69A 1H8TB 3ZFEA 2G19A 5J48A 3DXUA 2ZEYA 3OCPA 4FXGB 5F8PA 1H9PA 2Q4SA 4FOWA 1OA3A 2W87A 3MHZA 2F4LA 4BIFA 3ACLA 3TYJA 4RR3B 4YM1A 1LRHA 2Q8CA 4TTGA 5CAZA 3RNSA 4QKDA 3CNAA 1UPIA 3K77A 2OT7A 4U36A 5C70A 2WT0A 5C33A 1B35A 1N3OA 5FPZA 5GKAC 1YEWA 1W8UA 2YHJA 1OQ1A 5T5LA 3WLUA 1J1LA 2RS52 3HBKA 1XNBA 3D4KA 1HW5A 5CG9A 1HJFA 3IT8A 1S0IA 2QQLA 1RXGA 1TMF2 3DPRA 4FFIA 5LWBA 1PGW1 4JHTA 1PIV3 4R9CA 5BNNA 1ZVFA 4D6QA 5DQ0A 3OD4A 3LCPA 4Q0SA 3WCSA 1UL9A 4AFCA 5BNPC 1VIWB 5IAXA 4UFIA 2ADEA 4JC1A 3VGIA 1IQDC 2B39A 3BN6A 3RJRA 3QLQA 3H8RA 5FZ1A 1BK0A 4DMIA 1GWKA 4KG8A 3EQEA 4XXPA 2AACA 2Q30A 4DXTA 3BU0A 2WNUA 2OQ7A 4FCAA 1DGRN 1JOPA 2GH2A 2BFUS 3N9NA 5FXVA 2W3JA 5DAXA 3U37A 4IEPA 2O0OA 4I0AA 1BHGA 1OVSA 2ARXA 4LBLA 3ZXEA 2BW8A 3IDEA 4P02B 3BYWA 3LOIA 5IK4A 3OPTA 1WLWA 1OBNA 4R8HA 1W2OA 1UY3A 1ONAA 3WXPA 4QXHA 5BNNC 2CAUA 1UXZA 2F6BA 3FBYA 3K4AA 4X6QB 3LF7A 1CX1A 2TUNA 4I09A 3VHOA 5FJKA 5FBZA 5FXXA 1HJGA 5LY2A 3UGHA 2VUJA 5I91A 2BNNA 4BDVB 3SITA 2OX0A 4ORFA 1YWKA 2BBVA 4ASKA 2FZ1A 2V73A 2R041 3VDBA 1DGWX 1V9U3 3NJVA 1GP6A 1RUOA 2C5DA 2WT2A 2VZPA 3QOPA 5LK5A 3FUQA 4N9HA 3LOBA 2L9LA 3BIEA 4H55A 2SBAA 3WUCA 3I4IA 3GCWA 3LEKA 3TNQA 1SLLA 4U2AA 2WKKA 2ZMNA 5DUWA 1UN1A 3M3CA 4MXWB 2HBUA 3WNKA 4ZPIA 4LA2A 4ES8A 5EZWA 1VAKA 2QQIA 4G4FA 4Y33A 2WLPA 4AL9A 3DL3A 1HQWA 3J8F2 5I93A 3TBDA 3VD4A 4Q8LA 4AQ2A 3WNOA 4XCAA 4ZXEA 2VL4A 4QM8A 5A7NA 4E2SA 5KHIA 1JI6A 1MS5A 5L9VA 2GC3A 2HWE1 3DEMA 2WAAA 3AYCA 3ZFEB 1C28A 1FOD3 1RUC1 2VAUA 4QQOA 4ZZ8A 4XW3A 5A3PA 1VP6A 4E4SA 3M3OA 4NROA 4XQ4A 5F2WA 2YB7A 2YROA 1R081 1QF3A 1V6MA 4LE3A 5FZGA 3CMGA 2D6PA 2BFUL 3FZ3A 5FWJA 2E7TA 2RVAA 2CHHA 3VBSC 2VCCA 2AZ5A 4BYYA 3SH4A 1UY1A 3I2OA 1ND2A 2P4EA 1NY71 2BOIA 1SLBA 2OZ6A 2W46A 5FR3A 4NHKA 4Y20B 5CZKA 2ILMA 5C5UA 2XKPA 1S0BA 1LODA 2ES3A 1UMHA 4W4ZA 3AKQA 5IFTA 1AR62 5FPUA 3DXTA 5J3UA 1ZYBA 2WO7A 3HR9A 4GKXA 4LUMA 3DPRB 3TRSB 3WSOA 1NXMA 3ZYHA 4FOVA 1ZRFA 2XQXA 3BTAA 5DUXA 2A75A 3MLJA 5JXJA 3I3MA 4KWKA 3Q8FA 4L97A 5BNNB 4UFKA 3HOBA 4PLNA 2JKBA 3U78A 3U0ZA 2DVBA 4P9GA 1Y9GA 4QPWA 4EJRA 1FNYA 4P9XA 1HLCA 1ULPA 3QD6A 4GWIA 5HCBA 4BQ4A 3UGFA 5I0DA 5D8AA 2MEV2 3T08A 3POWA 3PUQA 4HZFA 2OPWA 2BZDA 1C8NA 4LNVA 4I2OA 1VBD1 1MEC2 1CZVA 1LENA 3RI8A 5GLVA 1L7QA 1H4GA 1XQNA 3LWCA 4UFHA 5HI0A 5JSOA 5L36A 4CUCA 5FYUA 4EN7B 3WHUA 1OLMA 3AMHA 4LULA 1JODA 1QJU2 4MGZE 1G9BA 5FY1A 2JE7A 5GLWA 4Z92B 3WNPA 4FT8A 4LO7A 4P9WA 3VB9A 3T4HB 4IGPA 1VPHA 1C5IA 3HJRA 2UWBA 5FZCA 3OY8B 3IPVB 2QJVA 5C8CA 4OZXA 1GWMA 2BBAA 5C9AC 2DCZA 4YSFA 2B45X 1JS9A 5FZMA 5HPOA 3BOWA 3UKTA 4BQ5A 4MGQA 1AR83 1UKGA 1KITA 1SLCA 4O7XA 1GQHA 1AR93 2PHFA 1U5IA 3S5QA 5DUVA 3OGGA 2BYVE 2VMCA 2WS93 4IETA 5FBJA 2WT1A 5C3OA 4UT5A 4NHMA 4BMBA 5A32B 3HIFA 1VBE2 4COUA 5KWRA 5M0TA 2CGPA 2C6SA 3OEBA 3Q8BA 5IVCA 1E5SA 4GKYA 1BVP1 1BBT3 1PNFA 1QH7A 2WSUA 1LGBA 3GZTB 5FZ9A 5L9BA 2A70A 2FQPA 1AYN1 3ACFA 2ZGUA 2CV6A 5JOYA 1GYKA 4YG6A 2NMOA 5C8CC 4OULA 2E26A 1S4CA 2PHTA 1VB2A 4UWDA 1KGYA 1R092 4NPRA 2RS13 4FQZA 2P37A 4IE4A 2GNBA 4FP2A 3I2GA 2Y6KA 1VAMA 3ZDSA 4CE8A 2ARAA 2LM3A 1YIFA 2JDHA 1Y9QA 1W9TA 3SMHA 4K6BA 3MLKA 5A7WA 1MS1A 1VBB1 4FFHA 1HRV2 1GR3A 3FE5A 3S5AA 5E8AA 4L11A 4Y4RA 3T0BA 1CX4A 4WM8C 2XBO2 3TAYA 2ORXA 3EYPA 3I8TA 4XTMA 1ND2B 4Y4YA 4UOJA 3KS7A 1MQTA 4HKOA 3PTRB 4Y1VA 4S2DA 1LHUA 4IL7A 4Q4V3 3VLBB 1X9TA 3NV3A 3ZFFA 4F7ZA 1UW8A 2CGNA 2VM9A 2ZMKA 2D5HA 3KZ4C 4S2HA 1NUKA 2HWB2 1QJY2 5FCCA 4AI0A 4Q27A 2FDFA 1GUIA 5F3IA 3WV6A 1UF2C 1BQPA 2YGMA 4JDOA 3RS6A 3RWNA 3KCCA 3ZFGC 4CDXA 4YPJA 4P9YA 2GSYA 3I97A 3IWZA 1KJLA 4ONUA 4EZHA 1IOAA 1UX6A 2GMEA 3VBOC 3LFMA 2WYSA 4B4RA 4COZA 3ZMOA 2RS51 1TME2 5C9AB 2A6YA 2XLFA 1C3HA 5FYSA 5T3NA 4E8CA 5BNOC 3GZUC 5D8AB 1TMF1 4A2UA 5C3PA 3UL2A 1W8OA 2Y6LA 4KBBA 1RUG3 4NAOA 4Q4Y2 5F3CA 5CFDA 1PK6C 1W6PA 1QXRA 1W8HA 5E89A 1O4ZA 1AXZA 3VV1A 3GNEA 1N1SA 4CDWA 4JAAA 3ZSLA 2WFF3 1QDOA 4KNCA 4AI8A 1ZZBA 4FTSA 1KDKA 4KGQA 4XILA 1RUH2 2QQPA 3T2OA 4O61A 1RXFA 2QQWA 4QX0A 1Q43A 3AVSA 3BODA 5I8SA 4FSJA 2XB6C 4Y3OA 4CCLA 4GZ9A 1GOFA 3WNLA 2VD7A 4DQAA 2RS32 4PI2A 1OLRA 3GDBA 1K5MA 4Z07A 2WL1A 1OI6A 2XJRA 5LASA 1B09A 5F5IA 3GHMA 5C8CB 2XL7A 2FBEA 1C1FA 2A7AA 3MPPG 4QX3A 3JB8A 2TBVA 3GGLA 4C8DA 1JZ7A 3THPA 1T2XA 4Q2FA 1D0GA 2VUCA 2WN2A 2O14A 1FATA 1RUE3 3O1RA 4WM8B 4OQ8A 4XYXA 4CDWC 4AVVA 5K0UC 1XB9A 2WNVC 3EJKA 4PF5A 2BOJA 4Q8KA 2B7YA 1F9KA 4LIUA 4QKBA 4XOGA 1ULOA 4E4DX 4OHWA 4FPGA 4QPGC 1C4RA 3H42B 4YZ1A 4Y1ZA 2E63A 4LHSA 1C57A 1YHFA 1LOFA 4KWUA 3WP6A 1US3A 2F17A 2E6VA 1K5MC 3V0BA 4QGNA 1TG7A 1JU3A 2IXCA 2PHLA 4BJ0A 4OYUA 4ZU5A 2ZEWA 3ZFGB 3IDAA 3K48A 1G7YA 1H0BA 5IYYA 1YIPA 3LE0A 2VMIA 2XWJB 5C3RA 4Y24A 1ASJ2 3VBOB 5LY1A 4AGVA 4NOTA 3ENRA 5FLIA 2RMU2 2XHNA 5FKBA 5GZCA 3J8F1 5FMCA 1L7LA 2Q0AA 1NE4A 1O3TA 2BDRA 4XF3A 5FYVA 5BNOB 4OUMA 1PVC2 2JKXA 4H7MA 5KBFA 1MQTB 2EALA 1VRH2 1XJAA 2YU1A 3ZFFB 4MGSA 1RUJ3 3I3BA 1REDA 2A3YA 2GZWA 4XACA 1PK6B 2A6VA 1IPSA 4XHXA 4AVCA 1AXKA 1DGRA 2BP6A 2Y38A 3H0OA 5FK7A 1AYM3 3CHXA 2D93A 2BGCA 4IE5A 4JHZA 1J3PA 4GB33 2VUAA 4OMCA 3PIGA 1L3JA 1W8FA 3HN3A 5EQUA 1DGLA 2JDAA 2LS6A 2UYAA 5FZFA 4CDXB 2HEWF 4QX1A 2G1MA 1C8M3 4YG0A 3O12A 5CKQA 1ODNA 1VBA1 1UXXX 1UYXA 1W6QB 1X7NA 2R1DA 3LKJA 4AI2A 4TWTA 4CPBD 1CAVA 1Q3EA 4LKFA 1VBC2 3SQOA 4R9AA 3OGVA 4NVPA 1AR61 1N3QA 4DIQA 3NNMA 3P6BA 2Y60A 1MZFA 5EJ3A 4A3XA 4YW1A 3OUJA 2XHKA 4XMIA 4Y22B 1YFWA 2ZX0A 4UBGA 1PGW2 4MXVA 4JZRA 4ZKTB 3BTZA 5CFDB 3URFA 4JCKA 2VXRA 1ENRA 3I59A 2J42A 2UY9A 3MYXA 4YVWC 4CDWB 3RVHA 1JBCA 3B3QE 4PLOA 2Q5TA 3WDTA 3WX5A 5FUPA 3OGRA 4QPGB 4Y26A 3FBMA 5A7SA 1WUVA 5T5JA 1F31A 1IQAA 2ZGRA 5BYNA 2PXJA 3ZN6A 2XJVA 3AP9A 1IPKA 4GWNA 1YCIA 4XABA 3E97A 4K1ZA 1K5MB 1F4HA 2BEOA 1GWLA 2H0BA 2V72A 3ES1A 1MEC1 5CIRA 2JB8A 5A1LA 3BKZA 5FY8A 4LKEA 4EWAA 3HN1A 2E32A 1RHI2 3AMNA 3GALA 2GNTA 4QKNA 5J09A 3IMMA 3OUIA 1OURA 2YBKA 3WQ1A 1H4HA 1QJU1 2YBSA 1RUD1 5F3EA 2KR2A 3WG2A 1W90A 3DN7A 1W0OA 4RHV3 4SBVA 3EHKA 3LPGA 1E5RA 1W6MB 3TN93 4YW4A 4AW7A 1V6OA 2VO5A 1EPWA 3ZYJB 2Z4FA 5JR7B 1H2NA 2EXJA 3AZVA 4CP0A 5HCHA 1MS3A 2LRPA 5GZFA 1X36A 5GZDA 1GZCA 2PMWB 2WSVA 2SLIA 4ET7A 2W0XA 1CAXA 2CWMA 3WW2A 3NKTA 1PZ7A 3UYJA 1URXA 5FZBA 4GXLA 1QXJA 2ZGPA 2XG3A 4XE9A 5T55A 1Z7S2 4CEYC 3V0BB 1ACCA 2AEYA 1XNDA 2JDZA 2G9GA 3AZYA 3PVOA 1SFNA 4M3CE 4YG3A 3T0AA 4AQSA 4TZDA 2PLV3 5A7PA 2QUOA 4JX0A 1RMU3 2VBBA 4CCEA 3ST7A 3AVRA 5CYYA 1VBE1 5IVFA 1UOGA 4Q4X3 1I5PA 1S2KA 1V70A 1O6UA 5FAXA 4UBHA 3NO8A 2XR4A 4WVMA 3AZXA 4HSJA 2XH6A 4NHXA 4C0HA 2KXLA 4N8MA 5CU1A 4XC9A 3R6SA 3J7HA 5DMYA 3NNGA 4LPLA 1QH6A 2CYFA 3NW4A 5ANNA 5FJHA 1XU1A 3VBHA 4CXXA 4S2FA 3PIJA 5FUNA 1R091 3FUOA 1G86A 3VBUA 3WINE 2Z79A 4QXBA 4YVWB 4DRRA 4KL1A 2WZR1 1LOBA 4FFGA 3OPWA 1A6CA 2PAKA 1HRV1 3U07A 3RQ0A 1RUF2 1PM7A 5FYMA 3M1HA 3VBRC 1H2MA 3B94A 2XBO1 3NAPC 5GALA 3TNPB 1M06G 2HYKA 4CZSA 1O91A 2B46X 1O5UA 3R4SA 4IEOA 3NSTA 3S7EA 1NLSA 2R0FA 4XQWA 4C90A 1NY72 5JPNB 4UW3A 1X82A 3V56A 4XDPA 5JIAA 4CP2A 1CAVB 3IAQA 2NQYA 4LUKA 2HWB1 1QJY1 4XUNA 1HXS1 1CWPA 3FHIB 2R0HA 4CDQA 2AUYA 3A0KA 4X6RB 1QJX3 1REEA 2JIGA 4YNIA 2VH9A 3VBHC 1RUC3 3OPZA 3T2PA 5IT6A 4KWJA 5IWFA 3WQ0A 3VDCA 2P3IA 1G9FA 3GHNA 4UW5A 1NT0A 3I59B 4IEUA 4DY3A 3OF1A 1NCQA 1HX6A 2CU5A 3JB4C 4IV3A 3HQXA 3SH3A 3VHRA 1GQPA 1FI2A 2DV9A 1W9YA 1TME1 2GU9A 4OVEA 1LULA 5FKCA 2Q8OA 5FLJA 5A1FA 4XBNA 3THDA 1QQP3 4UFJA 5ANQA 1ULDA 4FOYA 5GZEA 3UV9A 2R062 3ZN6B 5LZ6A 2LTNA 3KD4A 3RMXA 3T30A 4CEYB 5E6HA 5KXDA 2PQSA 2V09A 4AQTA 3EB7A 3LDBA 4BQYA 1H8TC 4O65A 5T5PA 4DFSA 2TEPA 4QDQA 1EY2A 1NYWA 1S0DA 2DUQA 2XJTA 1CVNA 2YDEA 2JDUA 3B9CA 3IB3A 3O7OA 4XCBA 2V5YA 5DDJ1 3HT2A 5TSWA 2HEVF 1GNZA 2JD4A 1V6JA 4YW6A 3KVBA 4QX8A 2RS31 2QQUA 1JZ2A 1IS3A 2J22A 4P9JA 3KT1A 2VTXA 4AI1A 4Z2AA 2YC4A 1NAEA 1KD7A 5LBBA 1CR7A 1O8SA 1PGSA 1UZZA 1KQRA 3SHRA 1WMXA 2ET7A 1SLTA 2I2SA 3HPNA 1DQ5A 1OF4A 1RB8G 5LBEA 1HIXA 4LLFA 3UJQA 2ZKLA 3CZJA 1XRUA 4R9BA 3VZNA 3VBRB 1DQ0A 1LU1A 4D6RA 4DB5A 1IS4A 1IKPA 4NIIA 2YC2A 4AGGA 3NAPB 1BYHA 3BIWE 1DZQA 4LBQA 3A21A 2XJPA 4Q4W1 5GLTA 5C3QA 3JD73 2R6QA 1NLQA 2FZ2A 4AEDA 5LEKA 5K4LA 5FYTA 1A34A 3VD9A 2D40A 2Y6FA 2JECA 4XAEA 4MGTA 1I3HA 3GM8A 4D7TA 2J1SA 2XWBB 3VBHB 2HWC3 1OA4A 3LA2A 2Q8EA 4DO0A 2DVGA 4URAA 5JSRA 5KXEA 3NJYA 4WZCA 3VBUB 2D7FA 4F3JA 1SEFA 3DYPA 1PVXA 1PHMA 3N7KA 1ASJ1 4IDZA 3IBMA 2LW8A 2ZGMA 4I3PA 1VBB2 3NJXA 5H9PA 1S1AA 1WW4A 4GAZA 5F1RA 2RMU1 1R1A1 1KXGA 1FMD3 3CDZB 4URTA 5FO9B 4M0NA 3BPSA 1VMJA 1PVC1 2GH8A 4OHYA 3SISA 3MIGA 5FQ0A 1VRH1 3NNFA 1VAVA 4FTEA 1MR5A 2XUMA 4E27A 5IW0A 1EAH1 1AYN3 3VKNA 2JG9A 4BK5A 1ZRDA 2W5FA 3VKFC 3ILFA 1PZ9A 2P6HA 2QZ3A 2PFWA 3DKQA 2QDNA 3IN9A 4XDQA 2X09A 1JH5A 4LHNA 4CDQB 1C5HA 5ABJC 1AJOA 1Q8QA 2ZAHA 4K9SA 2P2KA 1QWRA 4CCNA 3HWJA 1J58A 1NCRC 4Q0VA 4OQ9A 5A3TA 1NKGA 1AUYA 2GNMA 5DUUA 3AC0A 3AYDA 3VDAA 4LA3A 2LROA 3MZHA 1AR73 1VBC1 3R0RA 5FLHA 3D6EA 3CJIC 2VNVA 4E2GA 2ETEA 3PJYA 1X8EA 1POV3 2IXKA 5DABA 3HAGA 2WJSA 4CCMA 3WDYA 4R4ZA 5E88A 2WNEA 4DOUA 3HNYM 5ERLA 1HDKA 1PIV2 5JR2A 3AMMA 5T5OA 2QE3A 2BGPA 2WFPA 4CA9A 3ZFEC 1BEV3 1YNAA 2O8QA 2A5ZA 3J7LA 4NRQA 1HN0A 3PURA 5E16A 3ZMNA 4QAWA 2GMPA 4IE6A 5BUVA 4IGQA 3SCFA 3WF4A 3KV6A 4AI9A 4NIHA 3UETA 4A3ZA 3M8LA 3VKMA 2RS53 2DCYA 4DINB 4CYDA 3RZKA 5F7UA 5FZOB 4RYDA 1B35C
chains in the Genus database with same CATH topology
1MACA 1TMF3 1XNKA 2E9QA 2IZWA 3I54A 3FFQA 5H9QA 1S0CA 4AGGA 1RHI1 3H9AA 3ZXFA 1YFUA 1J3QA 4AFDA 2H6BA 4FPLA 1DG6A 1BK1A 2BVBA 4INDA 3DPRC 2IXHA 1JOJA 2OUHA 3KQRA 2XKOA 3ZSEA 3MI8A 1I6XA 1FPN1 4HANA 4IEQA 5CA6A 4LBQB 3PHMA 3PVEA 4OHZA 1WGPA 2F4PA 4XFFA 4YYOA 3WDVA 4CP1A 1UPSA 4AEDB 5IK8A 2QKDA 5KHKA 3JCIA 4ISQA 4A7KA 4PDWA 4G9SB 1POV0 4RFT0 1OSGA 1ZBA1 5F6LB 3WP3A 1YJLA 2C0ZA 2OVUA 1Z7S1 5ABJB 1V9U2 2D44A 3HBZA 3AFKA 2WNUC 1AHSA 3FJSA 4LBNA 1NCRB 5AVAA 4BMEA 4MX3A 1U12A 4ITCA 4XBQA 2ZX3A 1ZZ7A 3CJIB 3CO2A 3RSJA 3ZVXA 5LEJA 2VY0A 2MPFA 5FQ0B 5KC6A 1CGPA 2NM1A 2B42B 3VZKA 5C8WA 2BTVC 5BNQA 3ZYPA 1WBFA 5DXDA 2JG9B 3X29B 3ZSKA 1FOD2 3GZAA 4X8PA 4AVAA 5GM0A 1RUF1 3O0XA 1GKBA 3DV8A 2E7QA 2JXAA 3AXEA 3VZJA 4FPHA 4AVBA 4D7YA 2ZA9A 2XJSA 3BU7A 1FXZA 1B35B 3A4UA 3WY6A 4QQ2A 4HT1T 1VBA2 2WINB 3C3VA 4MUVA 1JN2P 2ZOEB 2WQZC 2AYHA 2D6OX 4FOQA 4XF1A 4O9GA 4WM7A 4GMP3 1WMEA 1YYNA 2B5HA 1HQNA 3WT3A 4LBKA 4XIOA 4YVSA 1Z78A 4OI1A 4XFIA 4BHPA 3N7JA 1YI7A 1Q8SA 3APBA 5JOXA 4RS5A 1H9WA 4YM2A 3U4XA 1F5JA 2GC0A 5H9SA 1V00A 2IFWA 1D2QA 2ZHKA 3T2TA 2R061 5BY5A 4NN0A 4JV4A 1ND2C 1NG0A 4XJZA 2X8KA 4QHBA 5AFEA 4P9LA 3FMGA 4YZ5A 3SCGA 2WNUB 1AZDA 2JX9A 4XHBA 5ACA3 3AP4A 1RUD2 4COVA 1X33A 4CRQA 2VVDA 1GV9A 3L2YA 3ZXJA 3MF6A 4JVAA 1EPZA 1ZM1A 4DZGA 1OA2A 2JENA 2BQPA 2MEV3 2X5IA 2ZACA 2BWCA 1N1VA 2AH2A 2NN8A 5GJ6A 1QMJA 3WZ1A 4PDWB 2GDFA 4I0BA 4GA9A 4N53A 4GMP0 5D8AC 1AR92 4YRDA 3QACA 1V6IA 4JGZA 5I8TA 3IKWA 2WS92 1QJU3 2G9FA 2VNOA 1NQDA 1Q56A 4YW3A 3NWKA 3RYKA 4ASMB 2ATFA 3WUDA 1RUI3 2W39A 3BB6A 3JBG1 4L9BA 4XF9A 3AKTA 3ILNA 1TNRA 1BBT2 2A3XA 2WA4A 3JQWA 2ZTNA 4HK9A 4K8FA 1YFYA 2RS12 4LT5A 4JDMA 4K20A 1U5YA 3SLIA 3OJBA 5FOJB 2WZR2 5A33A 1CQ9A 4LHLA 2DCTA 4J1WA 4PJYA 5I8YA 4XXAA 3TB0A 1S0GA 4AEMA 1H2LA 1QOTA 2IFRA 2IXLA 4A7ZA 1TQ5A 1DQ1A 2VQAA 5EWSA 3J26N 2BVVA 4B29A 2A6WA 4AI3A 2IC1A 4J1XA 1GANA 4AWDA 1O3RA 1LHVA 2W68A 1HXS2 4E9KA 1DIWA 2FMYA 1DBNA 2W52A 4DY5A 1Q8VA 5JCTA 3D82A 4XF0A 1UAIA 2VOWA 3CU7A 4I3GA 1IPJA 4YVSB 3JUUA 3S6PA 2HJIA 2YY1A 2ZGTA 5A3LA 2ZMLA 1RL3A 4MV2A 1BCXA 1AL23 2RM23 4FO9A 5EYXA 2RR13 2EXIA 1DQ6A 3RJ2X 2HWB3 3H3ZA 5C6CA 1MQTC 3UK9A 1PIV1 1DU3D 3ZFFC 3CJXA 4N90A 2GAUA 5JPMB 2HWD3 2WFF2 2OA2A 4KU8A 4C91A 5DDJ2 1A3KA 1CAWA 4QPIA 1O7FA 4CEWA 1MS8A 1LOEA 1DZTA 2HWF2 2P17A 1TME3 5GZGA 2AREA 4CDXC 3N7LA 5L7OA 2OZJA 2A6XA 3VL8A 1JTZX 2X5IB 3AM2A 5BPXA 2RHPA 1AL0G 1EV13 4EN9B 4UW4A 3E6DA 3QH6A 4Q4Y3 1S2BA 3M4FA 3I2DA 4HVQA 2XVGA 4YW2A 4JGZB 1NQJA 1WW7A 1RUH3 4IV1A 4JGYA 1RUE2 5J96B 5CFDC 4HMZA 1QOSA 3RG0A 4MGIE 1FT9A 1I1EA 3MGUA 1AX2A 4Q4W2 1IHMA 3V65A 1MZEA 4KGGA 3GBWA 3IDCB 3VN4A 1G9AA 4XFCA 4FBFA 4LO6B 2VOXA 3QCWA 3AP5A 1I5ZA 5JOWA 1G8WA 1UU6A 1V9U1 4AK3A 4AG4A 2DUPA 5HXVA 1YRZA 1S0JA 2WA3A 5A33B 3VBFA 1JW6A 2ZZQA 2EXHA 4KG0A 5FFOC 3RYPA 1R1A2 3E6CC 5J37A 3B00A 4JQRA 3MIHA 2UY8A 3KB5A 1OQEA 3KGLA 4W6YA 4AEKA 1WMFA 1EYBA 1UIKA 1CPMA 1EAH2 1LTEA 1AYM2 1FOD1 3WD5A 4GB32 1CAUA 1LOFC 2UWAA 1SBFA 2MNGA 2PTMA 3S0MA 2RJKA 2TNFA 3H3UA 1ND3A 1DHKB 3MICA 1JUHA 1LEDA 1WD4A 1D4VB 1N3PA 1C8M2 2RMU3 4XJUA 3KCXA 4QGMA 5D1IA 4K21A 2PN5A 3VBFC 4XIKA 1VRH3 5GLUA 1XNCA 1U5ZA 1RTVA 5FMOS 1RVF2 1QGLA 4ZXKA 4HK8A 4HBNA 4RQPA 1GSLA 4OHXA 4IQPA 1SACA 5JSPA 1W6PB 3P3NA 3ZSMA 2VVEA 4XFBA 1GNHA 4DPNA 1PO12 2DU1A 3ZSJA 5FOBB 4N43A 1ND3C 5CB7A 2R072 1UKRA 4TLFA 3U11A 4GH4A 4NR1A 2Q1MA 2O1QA 3MW2A 1W6NA 3OD0A 4AQ6A 3ZIXA 1ENXA 1SQ4A 2VPVA 1G9CA 1XU2A 1V6LA 2VOVA 1O4TA 3HT1A 4RD7A 5KXCA 4AHZA 2ZJCA 5LK7B 4RHV2 3TN92 1H1MA 4M3CF 1O3QA 1D4M2 3OYWA 1FPN2 1QU0A 1ZZ6A 5DZEA 5JOZA 3WG4A 4XPVA 1WW5A 2ZX2A 1LGCA 4QX5A 1SFYA 1AR81 1LOGA 4AFBA 3PTYA 4B7KA 1AR91 1DFQA 1ZBA2 4GH4C 3FFZA 3FLPA 2WS91 1O5LA 3ZXAC 1NLRA 3G6JB 4Q1RA 2PHXA 1COV2 1KDMA 1RMU2 5FMOL 2MHFA 4Q4X2 4N7UA 3N36A 4EROA 4QQLA 2A6ZA 1UIJA 3VBFB 3AMQA 1FX5A 1LGNA 1BBT1 4HETA 1SMVA 3L2HA 1PO22 1ZREA 1GFF2 1O3SA 4HFSA 4Q0QA 3ME2A 5KHHA 4QU2A 1UU5A 4L2NA 2ZBJA 1W6OA 1HRI2 2RS11 5EYYA 2KA3A 3T1MA 3ZN4A 2R043 2YV8A 1LB2A 3WW4A 1UMZA 4FPKA 1AF9A 1WD3A 5HBAA 1ND3B 2XL9A 2D6NA 1ZBE2 1OPOA 3LB9A 1ZRCA 4RA0A 4JRLA 2JEMA 3T1LA 4Z2WA 1QOOA 4MVTA 4Q4V1 1OD5A 5AFBA 1U5XA 1GBGA 2DFCA 4CDUA 1DZRA 2Y0OA 3FWEA 1VR3A 1ULFA 1H1AA 1XE7A 2D3SA 3AP6A 2DURA 1MZ5A 1QJX2 2HWE3 1W39A 4YZ4A 3MIBA 3PVBB 4RQPB 1PNGA 2YC0A 2FHRA 2Q1ZB 4DXZA 1RUF3 1Q8PA 4CTEA 5FO7B 1R083 3VBUC 2JE9A 4K1YA 1N1TA 3THTA 3ZYIB 4EV0A 3AZZA 2DTYA 4N43B 2XJUA 3VHNA 1QQP2 1OOPA 1CPNA 3MDPA 2P34A 4GH4B 3NL1A 4W6XA 1W6NB 3V64A 3LZZA 4D7SA 5KXBA 1MS0A 2WFF1 4B4PA 5JVVA 4YW5A 4CDQC 2R1BA 4K7JA 2PAEA 2DCKA 2PHDA 1R1ZA 2HWF1 4BE3A 4FPOB 2C9AA 2ZKNA 3AP7A 4Y1UA 2DWRA 4WVVA 1NCQC 2X53S 4IV3C 1A8DA 1RUNA 4Q1PA 4XETA 2YMZA 3B93A 1VJ2A 3W9AA 1CAXB 4PIXA 1KRIA 4RSUA 3RMYA 4EWEA 1VBD3 1OOPC 1GZWA 4KH9A 2XPJA 4DNYA 3V0AA 2EAKA 3USUA 1RUE1 1S0FA 1YO8A 3FLRA 2ET1A 3N7MA 1MVEA 3VKOA 5F5QA 2VVFA 3JD72 4NO4A 3N3HA 2ZPXA 3JBG2 4WVMB 1VLNA 1JXNA 1PGL2 2XVKA 4MLOA 3AYAA 2D3PA 4COWA 3M7AA 2HWC2 4PLMA 1W6OB 4BH9A 4YFZA 3RPQA 3INAA 4FPEA 4P5HA 1A8MA 4N7IA 2CTVA 4RL7A 1LOAA 5AC92 2ZAAA 1FMD2 4K3UA 4ATFA 4YM0A 2BPA2 4YGDA 2K0GA 5H9RA 2HKXA 1GQGA 4WZFA 4AEDC 2ZCWA 2ZABA 3AKSA 4ZU7A 1AYM1 4GB31 3LA7A 1DYPA 2ZX1A 3HD8B 3MLLA 2ZGOA 4PIZA 2JG8A 4L99A 5K7PA 4PIYA 3BALA 3B69A 1VBB3 3D0SA 2D3RA 3K51A 1C8M1 3R4UA 4XFGA 1NCQB 3MIFA 4IV3B 4EN6B 2NMNA 1LJ7A 3FX3A 5T50A 2BNMA 1QY4A 1RVF1 1OOPB 2QFEA 4Y5Z0 4Q29A 5JZGA 5BNPA 1BEV2 2JG9C 4Q26A 1PO11 4L8QA 2VU9A 1WCSA 4FPCA 2ZHMA 1HV1A 3CEWA 4Y20A 3B7MA 3H1MA 2JG8C 2R071 1WLTA 3ZXKA 2IXIA 1XYNA 4FQ4A 1J3RA 1TEIA 1QNWA 1LCLA 2B9UA 4LBQD 4GWMA 2IXJA 5BXXA 4JDNA 4M3CA 1V6KA 2D98A 1GZWB 1NA1A 4RHV1 3DF0A 4QMAA 3M70A 3V0AB 2NYYA 2N7GA 3TN91 3AYEA 2VMGA 5LRSA 1AX1A 4GIQA 2AENA 3USUB 4HN1A 5LRRA 5JZGC 1D4M1 1ZA4A 3VDDA 4AHYA 2R49A 3OBRA 1FNZA 3AJYA 2D6MA 3CF6E 1NE6A 1SBDA 2XLGA 1G9DA 3WQ7A 3U10A 1DF0A 1N47A 4IEZA 4R4XA 1GLHA 4OUSA 3H1WA 3WNXA 1COV1 2PLV1 3POYA 2OPKA 1RMU1 3B5LB 2YXSA 3R4DB 4LLOA 4LBOA 4Q4X1 4B8EA 1NA1C 1ZZ9A 2I45A 2UURA 3E5XA 4TYSA 3S30A 3WOGA 3AX4A 1WCKA 3OY8A 3IPVA 1ZX5A 4UW6A 4P9IA 1PO21 1GZ9A 3OBTA 3WDWA 3VDDC 1NXD1 4Z8BA 3PMSA 4WVWA 1HRI1 2VW2A 3KGZA 3OTFA 3ZO0B 4HSLA 4WBBA 4ES9A 4PDWC 3VBSA 3BPZA 3WW3A 3NV1A 4XFAA 4MGKE 3ETQA 5A32A 4BCUA 4FXKB 1WCDJ 1ZBE1 3DKWA 4MGYE 4FPYA 1AXYA 2JG8B 4LO5B 3AKPA 5CADA 3EBRA 1RC6A 1YFXA 5IK5A 1WBLA 2H0VA 3J8F3 3KM5A 4N9IA 4AYUA 3NV4A 2Y26A 4IXLA 3E5QA 1KS4A 1QNYA 3EXUA 4FAHA 1QJX1 4GULA 4Q0PA 4QT6A 5JZGB 5BNPB 4PQ9A 4ISRA 5DG1A 3VZLA 3UKNA 2YZ4A 3AXDA 4KU7A 4OHVA 2VECA 5DG2A 4WVZA 2ZGQA 3KT4A 1KFUL 2XJQA 1WLDA 2VMHA 1QQP1 2DFBA 1VBA3 4MYEA 2PYTA 3KCYA 5K9YA 1AR63 3M3IA 4LBJA 1MS4A 2PAMA 2O8OA 3A0NA 5IUQA 2ERFA 4M3CB 5ACA2 5FRAA 3ES4A 2GN3A 1NA1B 4H3WA 5FPXA 4WM7C 3MW3A 5I0SA 1XYPA 2Z2SB 1RJ8A 1QXPA 4FP3A 1PZ8A 5C9AA 4WV8A 2PA7A 2E7AA 4YVSC 3ELNA 2PHRA 1F8VA 3VDDB 1SCRA 1M4WA 3GBFA 5C4WA 3O14A 3RI9A 4RS5C 4NWWA 1SLIA 3O0VA 1YXWA 4FTBA 3QBQA 4LBMA 4B7EA 2RE9A 1MEC3 2X29A 3C2UA 4C1WA 3J4UH 1AR82 3H7YA 4UXAA 5EXOA 2D5FA 3WP4A 1D2SA 3M3QA 4YGBA 1JYCA 4QQPA 4YLZA 3ZPYA 3ZXDA 1RUD3 5CFCA 4IESA 4S2GA 2JICA 2D6LX 3NJZA 4JTOA 3O0WA 3JD71 2PELA 4FPJA 1UZYA 1RUI2 1LR5A 1YLLA 3ILRA 1PGL1 1BZWA 2Z69A 4HPKA 2VOKA 5EFUA 3QH7A 3N4MA 5C4WC 5JAXA 2HWC1 5HCFA 2I07B 2X5IC 4KQ7A 4RGAA 3UJOA 2WZPP 1LESA 2W08A 1GICA 1O4YA 5JDBA 2ZZJA 4WM8A 3VBSB 1C1LA 4N53C 1V6NA 2IWGB 1N1YA 2PHUA 1LU2A 1CD3G 4JGZC 3RRDA 5AC91 1VBE3 1FMD1 4LHKA 5CFCC 2ZHLA 2YGLA 2DTWA 4MH0E 1U0AA 2CGOA 4Q4V2 1MS9A 1HQLA 4BLJA 1FAYA 3ZFGA 1R093 4WM7B 4YZ3A 4M00A 4YGCA 1WMDA 3RDIA 3W59A 3VBOA 3WW1A 3WHTA 2WZR3 3ZX7A 4AFMA 3H1YA 4B4QA 3ZXLA 1HRV3 3ZYGA 2ZGSA 3MFAA 5GLZA 5JWPA 2Z42A 4YM3A 1ZNPA 3POSA 5BNOA 2XBO3 2GC1A 1AR71 2DVAA 5A3MA 4RS5B 1PMIA 4D94A 4EWDA 4TSVA 1AL22 2RM22 1Y43B 1POV1 1PK6A 3SNMA 3EO6A 2RR12 3IIAA 1DLLA 2WLQA 1MVQA 4YZ2A 5KC5A 1QJY3 4SLIA 1RUG2 1HXS3 1MZ6A 3R05A 1CJDA 3BOPA 4Y1YA 1QJZA 5T52A 3S7IA 4LO4B 1BEV1 2HWD2 2ZGLA 1SBEA 3PJQA 4OFGA 3GBGA 5CNAA 1DYKA 2DCJA 2Y0IA 4AEJA 1RGSA 2XVLA 3KMHA 2ZX4A 1W6QA 3DGTA 4GQ7A 5JLVA 2DU0A 1LOCA 4F83A 3I7DA 4OLLA 2YYOA 4E2QA 3WG3A 1KFXL 2PHWA 2P3KA 2DVFA 5B2GB 5C4WB 2QNKA 4AHXA 4F8AA 2WQ4A 4P14A 1APNA 1EV12 4LR4A 4Y22A 2R30A 1BMV2 2VW0A 4Q0UA 1REFA 5K8SA 5F9TA 4NWVA 4N53B 2NLRA 2OIIA 5K0UA 2GMMA 1IS6A 2WNVA 3AJZA 4IEWA 4K40A 3ASIA 2R16A 1OFNA 4QPGA 5DDJ3 5CFCB 1H2KA 1LECA 4QPYA 3MEPA 2QDRA 2EIGA 2HWF3 2AGSA 5AVPA 2H6CA 4KWLA 3GF6A 2RS33 4QPIC 4CEWC 1DGWA 4M0HA 4AGRA 4HPKB 4EN8B 1QKQA 3LAGA 3CL1A 1X50A 4C1XA 2QCSB 2VW1A 4I02A 5L7OC 2A73B 4FAGA 1FV3A 2HEYF 3O5SA 2ZS6B 4R9DA 1W6MA 1YI9A 2VULA 3JU9A 4HN0A 4HLTA 5KHJA 1RJ7A 2NPIA 2AR6A 2OYZA 1ULCA 2ZHNA 4IV1C 4Q4W3 4JGYC 3JZVA 1HKDA 3WDXA 1T6GC 3NVCA 1JHNA 3LA3A 1RITA 1RUJ2 1BXHA 1UD1A 1IKQA 4QQHA 1H30A 5J7MA 2D97A 2GALA 4O9EA 1YUDA 4BM8A 1IS5A 4BIOA 2K9ZA 5L19A 1KS5A 2D43A 2GC2A 4XJAA 4OI0A 4ATEA 1ASJ3 3E5UA 2VGDA 2FMDA 3WVJA 2EF6A 1VALA 1F5FA 1R1A3 2EAAA 2C1FA 1RINA 1PVC3 1W0PA 2UYBA 3ECQA 4HVRA 3VUOA 1G6NA 5FDBA 1S0EA 2UWCA 5T54A 4GMP1 1EAH3 4YVWA 4XEZA 5CG8A 5EV7A 3ZN5A 1IZ3A 2GN7A 4AHWA 1DQ4A 1OPMA 4C0BA 4BZ4A 2EXKA 2R32A 1J1TA 1Y3TA 4XFHA 3H7JA 4YARA 5F6KA 2P3JA 1CAWB 1ALYA 3N35A 4FPFA 3VZMA 2XGXA 4QPIB 4CEWB 1H8VA 2CL2A 3D8CA 4MSVA 1VBC3 2DUOA 1CJPA 4Z1VA 1ZZCA 1S55A 4XBLA 4XTPA 1FV2A 1RVF3 1AX0A 2PQQA 5L7OB 4D3WA 3ATGA 4BQ1A 5FO8B 3AB0A 1LEMA 5ACA1 4A7YA 3WCRA 1WLCA 2GNDA 4QD2A 5K0UB 1H1IA 2WNVB 3VKLA 5DZFA 1PO13 4DS0A 4RQPC 1OFSA 3VL9A 4DRVA 1LHOA 1SLAA 4IV1B 4JGYB 3RYRA 1BVVA 3VHPA 2MEV1 2R073 4B3NA 3FLTA 4COYA 2JJ6A 4BOWA 2EA7A 3B9IA 5JI9A 1UCXA 4CEYA 4N43C 5CBLA 2QZ2A 4LE4A 1ENQA 3MW4A 1TE1B 5CVRA 4GALA 4JRAA 3LSEA 2YPJA 2BWAA 1RHI3 1KJRA 4PBOA 2OUJA 2NP0A 2PLV2 1RIRA 3PVNA 4AVTA 1OLQA 2BNOA 3B01A 2E53A 3AMPA 4EN0A 4H14A 1AVBA 1D4M3 4XQDA 1RUI1 1FPN3 1CESA 1TNFA 5I0TA 3J9SA 5L73A 4LEJA 3BCWA 4XJ9A 1Z0HA 3KSCA 3H50A 1ZBA3 1EP0A 1OKQA 2A3WA 1ZZ8A 2B8MA 3VBRA 3PLQA 2ENRA 4IEXA 1Z7S3 2R042 3NAPA 3E6BA 3FC0A 1COV3 4QM9A 4ZU4A 1CAUB 3P3PA 4NHLA 4BLIA 4G3YC 5DZGA 1JUIA 3AFGA 2K2SA 4I0WB 3USSA 4LTAA 1CIWA 2G4IA 2LALA 4BPZA 1PO23 4W6WA 1WW6A 1JYIA 1LHWA 1YJKA 2VNGA 4Z82A 1I9RA 1HRI3 1HV0A 1XXNA 3WR0A 3CLPA 1XE8A 2HWE2 2I74A 4ASLA 3AKRA 4IEYA 3H8UA 5FTTC 1RUC2