2OA2A

Crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
VTDHGPRPFVVNIEDETKRNRAFRRALWTGDHLQVTLMSIQVGEDIGLEIHPHLDQFLRVEEGRGLVQMGHRQDNLHFQEEVFDDYAILIPAGTWHNVRNTGNRPLKLYSIYAPPQHPHGTVHETKAIAMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BH2720 protein
publication title Crystal structure of BH2720 (10175341) from Bacillus halodurans at 1.41 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 29
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oa2A01
5J48A 1CAWB 2PFWA 2PAMA 5E1RA 3HIFA 2WC2A 2BGCA 3H1WA 3IWZA 1ZRCA 1ZZBA 3H3ZA 4XFAA 4IETA 4R8HA 4E2GA 2XLFA 3NJZA 3FFQA 2QCSB 5KBFA 4RD7A 3U10A 1IPKA 4LEJA 3E6BA 4QGNA 5BXXA 5I8TA 3H50A 4AXOA 3OF1A 1DZRA 3GYDA 1CAXA 2PTMA 3UKNA 4WZCA 4XFBA 4AVCA 4KWJA 2EAAA 5C6CA 5D1IA 2GH2A 1DGWA 4META 3SHRA 4DINB 3KCCA 2BNNA 3M3IA 1G6NA 4EROA 4H7LA 2XL9A 3IBMA 5I91A 4XEZA 3DL3A 3QACA 2IXKA 4HBNA 4Q0VA 4IEVA 1ZVFA 1Y3TA 3ACLA 1ZREA 1YLLA 4E2QA 1J58A 1RGSA 1EY2A 3EJKA 5I0SA 4MH0E 1FI2A 1VJ2A 4HZFA 1V70A 4P9GA 4EWAA 1LRHA 3S7IA 3SCFA 3EO6A 4FT8A 3M70A 1EPZA 1O3QA 2H0VA 3BU7A 5FCCA 2XL7A 4IESA 4XETA 4HSLA 2Q30A 3GBFA 3FZ3A 4XF0A 2Q4SA 3LA3A 2DCTA 5FQ0B 3SMHA 4Q0PA 2P17A 4IEXA 3OD0A 1CGPA 1YUDA 3IIAA 3DV8A 2OYZA 2PQQA 5BV6A 5JSRA 5E16A 2OPKA 2FQPA 4Q0UA 3BCWA 4MGKE 1NYWA 3RYPA 2UY9A 3N4MA 3ETQA 2XLGA 2IXJA 3UKVA 3CL1A 2V09A 4ZU4A 4I2OA 2GAUA 2IXLA 4E2SA 4LA2A 1XRUA 2Z2SB 1CAVA 1L3JA 1SQ4A 2I45A 3O14A 4LTAA 3SCHA 1EP0A 3WW1A 2N7GA 3RZZA 2QNKA 3OCPA 3EHKA 4QXKA 4BHPA 4QX5A 2ZKLA 3E5XA 1XE7A 4HLTA 5FQ0A 2ATFA 2FMYA 2BNMA 4HSJA 5JSPA 2GU9A 1U12A 2CAUA 2MNGA 3I54A 1J59A 3H1MA 2XGXA 2Q1ZB 4XF4A 1UIKA 2IXHA 2XKPA 4N9HA 5I8SA 3NW4A 1O3SA 3I59B 2HJIA 3ST7A 5I0RA 3MZHA 4AQ2A 4XF1A 4HVOA 5LRRA 1QXRA 5FPXA 4XFGA 1WGPA 4LUMA 2PAKA 1VP6A 5FLIA 5K8SA 1ZRRA 1J3PA 4N9IA 3H3UA 4QGLA 3I7DA 3DN7A 2IC1A 2H6CA 2MPFA 2F4PA 1OI6A 3H7JA 3WW2A 1X8EA 3IDBB 1RUOA 2IXCA 1QXJA 3BB6A 2ZCWA 2OZJA 2ETEA 1YFYA 3H8UA 4WVZA 4I02A 4UBGA 4L11A 4IEQA 3ELNA 3D0JA 5LEKA 3CLPA 1CAWA 2PHLA 3PLQA 3ES1A 3QOPA 4QMAA 3FE5A 3NVCA 4UXAA 3L2HA 1WLTA 2H6BA 3OTFA 4XF9A 4I01A 2XHKA 4Q0QA 1O5UA 4B29A 5J3UA 2CV6A 2B9UA 3LAGA 1FXZA 3WW4A 2QDRA 5FPZA 2CGPA 1ZZCA 2C0ZA 1UPIA 3ROUA 3D82A 1LR5A 1PM7A 3KSCA 5FLHA 4D7TA 1FT9A 3LZZA 1UD1A 4EWDA 3E5UA 3CEWA 3MYXA 1QY4A 4F7ZA 4ONUA 3PVBB 2K9ZA 2BEOA 4A2UA 4Z07A 1ZZ8A 4J1XA 5I93A 2Z69A 2B8MA 4K8FA 3FX3A 4FBFA 4YRDA 1ZX5A 2GC0A 4CYDA 1H1MA 4MZUA 4IEWA 3WW3A 4O9GA 4IEPA 4TLFA 4O9EA 1RUNA 1YWKA 3SCGA 4FAHA 1J3RA 3TNPB 5JCTA 5KHGA 1O7FA 1YFWA 3EQEA 1HW5A 2K0GA 4KU8A 1RL3A 2MHFA 4JVAA 1X8MA 2BNOA 4IEUA 3S7EA 3FWEA 1UCXA 4OLLA 5JSOA 1Y9QA 4OFGA 4ZU5A 4MX3A 2D93A 3HT2A 3MDPA 5JR7B 3LA7A 5CVRA 2XKOA 5KHIA 4QGMA 4IEZA 3UKTA 3H7YA 2WFPA 3HT1A 1O5LA 2D5HA 3RYRA 3U11A 5AVPA 3E6DA 4YYOA 4AVBA 2GC2A 1I5ZA 4PIZA 4KWLA 1UW8A 2PHDA 1OD5A 2PAEA 5LRSA 1OMIA 1EYBA 1CX4A 3VHRA 4IEOA 3JZVA 5J7MA 2QVSB 3IDCB 3HQXA 4KU7A 2O1QA 4MGYE 1XE8A 1GQHA 4ORFA 2XLAA 5BY5A 1DZTA 3LA2A 2IXIA 1CAXB 3CO2A 4HN0A 2GZWA 2HKXA 1NE4A 3RDIA 5I8YA 4YNIA 2EA7A 3LWCA 1O3TA 5F1RA 4D7SA 1NZCA 2GC3A 4J1WA 1SEFA 3G7DA 4QM9A 2VQAA 1Q3EA 4NVPA 1CAUB 3S0MA 4KL1A 2UYAA 3I59A 4ZU7A 4F8AA 3KGZA 2PYTA 4WBBA 1IPJA 1UIJA 4I0BA 5BUVA 4LA3A 4X6QB 4GULA 4EV0A 4HVRA 2UY8A 2GC1A 2QJVA 4LULA 4HMZA 4YARA 4PJYA 5T3NA 3TNQA 1ZNPA 3B02A 2ET1A 3U0ZA 1NE6A 4Q0SA 4XFIA 5FDBA 4I09A 3ES4A 1LB2A 3E5QA 1YFUA 4JTOA 4I3PA 3D0SA 2D5FA 5KHHA 3H9AA 3PNAA 4BIFA 3KGLA 3BALA 4MV2A 1CAUA 1DGRA 1TQ5A 4JTNA 2Y0OA 4BYYA 1VR3A 3E97A 1OFNA 1O4TA 4XFHA 1ZZ6A 2OZ6A 3C3VA 3DKWA 2UYBA 2CAVA 5KHKA 2O8QA 4EWEA 4AVAA 1CAVB 1ZRFA 4XF3A 3BPZA 5KHJA 1RC6A 4PIYA 2KXLA 5JAXA 4X6RB 1H1IA 3E6CC 3SXWA 1X82A 1RTVA 5C8WA 2B5HA 3MPBA 1J1LA 3ZDSA 4IEYA 2EVXA 4MGIE 2ET7A 3RYKA 1YFXA 1WA4A 3CF6E 5HI0A 4UBHA 4XFFA 5FLJA 4XFCA 1Q5OA 1X7NA 3LOIA 2VECA 4MGZE 3RPQA 1J3QA 2PA7A 1YHFA 5LEJA 2OA2A 4BH9A 3RNSA 5CADA 5EFUA 4IERA 2E9QA 4LUKA 3NKTA 3USSA 4Q29A 5I0TA 4I0AA 5BPXA 1NXMA 3H1YA 1O3RA 3NSTA 3OGJA 1ZZ7A 3KMHA 4Z82A 1ZRDA 1Q43A 4FAGA 5I0UA 4YSFA 2Q0AA 1ZZ9A 1SFNA 4HVQA 4AQ6A 3NL1A 1LKNA 4HN1A 3R6SA 1JUHA 3CJXA 3EBRA 4MUVA 4R52A 4LLOA 5EZWA 4QM8A 1QWRA 3FHIB 4PIXA 4JV4A 1I6XA 2VPVA 1PMIA 4L2NA 4KWKA 3FJSA 5CU1A 2D40A 2BYVE 1GQGA
chains in the Genus database with same CATH superfamily
5J48A 2IUWA 1WCKA 1CAWB 3M3EA 2F4LA 1QIQA 1IG0A 1V9U2 2QBXA 5T5OA 4QPIA 3RRDA 3DPRA 1YQ5A 4UF0B 5IT6A 2WC2A 2B45X 5IVCA 4M3CE 3IWZA 5DDJ2 2WWJA 3O0XA 3H3ZA 1LOEA 2R0HA 4A41A 4CTEA 3DXTA 3AP5A 4LBMA 1PO13 4Q4W2 2XVLA 3ZKUA 1YRZA 2X5IA 4CPBA 3OGGA 2YDEA 2PQSA 4QGNA 2IVJA 5BXXA 1DCSA 2HH9A 3VDCA 3KF3A 3J8F3 3SKJE 4AXOA 5EYYA 5IAXA 1BJQA 2JG8C 1JOJA 1BVVA 3NNMA 4WZCA 1QU0A 2DCZA 5J1XA 4B4RA 4RGKA 1Y4WA 1AL21 4Q4V3 5HXVA 5C3PA 2I07B 1NCRA 1RUJ2 1DGWA 4LO6B 3VBUC 1H4HA 2ZAAA 3DYMA 3JCIA 3M3IA 5LASA 2NMNA 3SHRA 3VBFB 4DINB 5J37A 1TZOA 2PXJA 4YVWC 3IBMA 4RSUA 4DIQA 2R30A 1AJKA 4LBLA 1GNHA 3QACA 4H2AA 1VBC1 1OKQA 5CKNA 5FZBA 2XUMA 1UAIA 1W2NA 2P37A 1ZREA 1GNZA 3KV4A 4BMBA 3B01A 1XU2A 1Z0HA 2Y38A 4FPJA 4UW4A 4E2QA 1RGSA 3W9AA 5F9TA 2WUHA 3ON7A 3EJKA 2WNUA 3OPZA 2JWPA 3H42B 2V73A 3POYA 4S2DA 2QQNA 2YYOA 2YG0A 4U2AA 5I0SA 1HN1A 4HZFA 4EWAA 2QZ2A 3MI8A 5JZGA 1IHMA 1YEWA 3AKSA 3S7IA 1VAKA 4CEYC 1O3QA 4YFWA 3SITA 2ZMKA 1VBA2 5DABA 4AI9A 3OGRA 1ULEA 1JU3A 2W1SA 3WHTA 1SPPA 4LBJA 1JYIA 4XETA 1ACCA 1B35A 3Q8FA 3PMEA 1V0AA 1PK6B 3KVAA 4K6BA 2WAAA 1TNRA 5FZAA 4BQWA 1W2AX 4OI2A 2R063 1REDA 4CDQC 4GAZA 3GZTB 4NUBA 5AFEA 4D7YA 3WQ1A 2FCUA 1H6XA 3RI8A 4AI0A 1IG3A 4YVSC 2ZX2A 5I0DA 2E63A 1HRV1 4JGZC 2AGSA 2DWRA 1A8MA 4AK3A 1NYWA 3DYOA 1O8SA 1FNYA 3SKVA 1RIRA 4FPEA 5DAWA 3N4MA 1OPMA 1W8NA 4HG6B 2IXJA 3UKVA 1J84A 4IV3A 1ASJ3 4M4RA 3CJIA 4I2OA 4YZ3A 4K8RB 3AL5A 1C8NA 5F37A 5K0UC 3GGLA 1HB1A 2YB7A 2Z2SB 3JD71 1BKZA 1L3JA 2I45A 3BTZA 1H2KA 3SCHA 1EP0A 3NNGA 2RJ2A 1H2LA 1PX3A 4BM8A 4K1ZA 2VC9A 4UFMA 2W2IA 2ZKLA 1ZYBA 4YG6A 4AEMA 4IV1C 3WDYA 1KD7A 1XE7A 4HLTA 4NIIA 1XNAA 2ATFA 2FMYA 2HWB1 4FPFA 4LBQA 2QQJA 2WFF1 1H0BA 2XBO3 4CCCA 5ACA2 2MNGA 1I1EA 1RXGA 1PO12 4YW6A 1QQP1 2XGXA 2Q1ZB 3AMHA 3MPPG 3M7AA 4XF4A 2IXHA 4R9BA 1BBT1 5D8AB 1Y9GA 2ADDA 1UX7A 3LDKA 3U1XA 4MADA 1MZEA 1VBD3 3QH6A 3NW4A 4QX2A 3I59B 1JODA 5CFDC 4CDXB 1RVF2 3ORJA 4AQ2A 4XF1A 1WCDJ 5FPXA 1POV3 4M3CA 1S0CA 2OUHA 5A7WB 1XYPA 3WUCA 3WX5A 2VNOA 2NN8A 1ZRRA 2PHUA 2VTXA 2Q5TA 1J3PA 4AFBA 4TYSA 1RUE3 1VRBA 2LALA 3ZLIA 4AEDA 4QGLA 1XSQA 5F8PA 2R041 4QXHA 5DZEA 4D3WA 5BNOB 5L7OA 1ZA4A 2VW1A 1V6NA 1AL0G 3POWA 3THPA 3V0BA 2EXIA 2H6CA 2TNFA 3OG2A 1MS5A 3WW2A 2P4EA 2XG3A 4WM7B 1XYNA 1N1YA 4RHV1 5FYUA 4IGQA 1CESA 2VZVA 3C2UA 2VBDA 1S0DA 3POIA 4J25A 2VM9A 3IMMA 5FKBA 4UW6A 4WV8A 5H9QA 4CCLA 1YFYA 1LU1A 3HWJA 4UBGA 1M4WA 4WM8A 4IEQA 4LOSA 1LGCA 1K5JA 1UZWA 2RDNA 1YYNA 2R6QA 3M3CA 1CAWA 2QTWB 2PHLA 3PLQA 5B4XA 3WG1A 1DBNA 4HONA 4UF0A 4PBPA 3FE5A 4YM2A 4IUGA 2VBBA 2D6OX 4DO0A 2DVGA 4GKYA 1AL23 2W52A 1HV1A 4EJRA 1UY1A 5T5JA 2VXRA 3F95A 2R062 1O5UA 1VAMA 4B29A 4NROA 4ZY9A 3NMBA 2GNTA 4BLIA 2BVBA 1DYOA 1ZZCA 1CPNA 3WV6A 2YU1A 2Y8KA 3J7NA 3LB9A 1W05A 1VBC3 2Y26A 1FAYA 2W1UA 1UY3A 2OS2A 1IKQA 2E6VA 4FP3A 4NRMA 4BB3A 4D7TA 5BNPB 1AR62 3RSJA 1XNCA 1PGL1 2J1SA 1ASJ2 1OOPC 1RUC1 4XCAA 4F7ZA 4ONUA 4Q4Y2 3WP5A 4LKFA 4WVWA 1XSRA 1Y7BA 2GMPA 2BEOA 4A2UA 4Z07A 1LJ7A 5FY9A 2JDYA 4LPLA 3VBSB 1LHVA 3POEA 2OUJA 3U4XA 1V6IA 1DQ6A 2LROA 3JBG1 2YBKA 3BUCA 3FX3A 4GH4B 3U4SA 4FBFA 4XJZA 1UO9A 2JD4A 4B1LA 4IEWA 4NRPA 1A3KA 1DF0A 4IEPA 3WLUA 4AGRA 4BQ3A 3LQCA 2WNVB 2VZTA 3ZDVA 4AFAA 1POV0 5FP4A 1R082 2DV9A 1H2NA 2NPIA 4AWDA 5FZ4A 4FAHA 3AYAA 1J3RA 1S2BA 1NT0A 5KHGA 1QJX2 1V6OA 3EQEA 2EICA 2YBPA 2ZZJA 4HPKB 3NKGA 2HEVF 2K0GA 1VLNA 5H9SA 4JVAA 2P1BA 5FZ3A 1KGYA 3RMYA 5C9AB 1HRV3 3LEKA 2BNOA 1VBD2 1NCQC 2DU1A 4NAMA 1V6JA 3WP6A 2Z5WA 4XUQA 1Y9QA 2ZHLA 4OFGA 2WT0A 3SEPA 5L19A 3VD9A 1AYM1 4JGYC 3FFZA 2WQ4A 2FDIA 3C7GA 1Z7S1 4TZDA 4QU1A 4ITCA 5LA1A 2ES3A 4YM0A 2JDUA 2CYFA 4IEZA 1W9TA 4CEWA 5LB6A 3ABZA 3UKTA 1DU3D 3H8XA 3MIFA 3HNBM 3NNFA 4QX3A 3MF9A 1F5FA 3WF0A 4AI1A 5FR3A 3U11A 5GZEA 2OKXA 3E6DA 4AVBA 2GC2A 1AX0A 4TTGA 1I5ZA 1W8HA 2D6MA 4KWLA 1CN1A 1D7PM 1UW8A 2SLIA 1T6BX 1OD5A 1SBEA 4L0PA 3RWKX 2HWB3 1RMU1 2EXJA 1S0EA 1GZ9A 1JS9A 2WFF3 3I3DA 4HK9A 1VE0A 1HB3A 2VQTA 5F3EA 5FZ1A 3WOGA 1OMIA 3F2ZA 2QQMA 5DUWA 1W2OA 5A7OA 1QQP3 5A6YA 3VHRA 3S30A 5FXWA 2QVSB 4YGDA 3IDCB 1BBT3 3HQXA 4KU7A 2G9FA 3NV3A 4HFSA 1WLDA 1C4RA 5BY5A 1DZTA 1JBCA 1J83A 1CAXB 1HLCA 1QH6A 3ACIA 3AMNA 4L8QA 4EN7B 4XHXA 2HKXA 2JEMA 2KA3A 2RHPA 1WLCA 1AL22 3URFA 1U5IA 1NX9A 2ZGLA 4YNIA 3T4VA 1IS4A 3JUUA 3K3OA 4D7SA 1S2EA 4FFHA 2RS11 4X8PA 4AVTA 1DG6A 3I3MA 2WN3A 2R1DA 3TEZA 2E31A 1T6GC 2QQKA 3MIDA 1FV3A 2ERFA 1ULCA 1Q3EA 4N43C 5D8AA 3H3LA 5FXZA 2ILMA 2VO5A 4BISA 2DF7A 1CAUB 3ACFA 1SACA 2UYAA 1WCUA 3I59A 3VD5A 4CDXA 4AHWA 1UIJA 4CP2A 4JDOA 3VBOC 1GLHA 4RHV3 5BUVA 3ZXLA 2RE9A 4EV0A 3WP3A 4PDWB 5AC91 5A7WA 3WNXA 2WO3A 1GOGA 5H9RA 5J36A 3NJVA 2UURA 1BZWA 1DIWA 1RUI1 5A7NA 4PJYA 1NA1B 3I8TA 5DUXA 3VBHB 3POJA 2JB4A 4H3WA 3UGHA 4LK7A 3TNQA 5BNOA 1ZNPA 3B02A 4D6QA 5JLVA 2XB6C 2JIGA 4Q0SA 3B94A 3C7OA 1T2XA 2Y6GA 3HNYM 3POGA 4XZPA 4YWAA 1PX4A 1D0HA 4AL9A 4WM7A 5FOJB 4JTOA 1W9SA 4RS5B 4FPOB 4FPLA 3U37A 3IT8A 1A34A 1MZ5A 3POSA 3VZNA 3D0SA 1APNA 5KHHA 4UFLA 3I97A 2QFEA 3H9AA 2WNEA 1WMDA 4BIFA 3M2MA 5FY1A 2E53A 3R4DB 2EAKA 4XQ4A 3T4HB 1HRV2 2BJSA 2G19A 1O8PA 2GALA 1KEXA 4FSJA 2Y0OA 5A6XA 3RZMA 1OFNA 1W6OB 4QPWA 3LEIA 4G4FA 1RUC3 4AAXA 5HPOA 3AJYA 1UQXA 1O4TA 2Y64A 4XFHA 4BWOA 2YFUA 4QT6A 2UYBA 2CAVA 5FK7A 2ZX1A 4OMDA 2A6YA 3VZMA 5KHKA 1KITA 3JD72 1JYVA 1X9TA 3A21A 2WWUA 1WWYA 3BPZA 4J6GA 4PQQA 4RFRB 3JBG3 1REEA 2KXLA 2YZ4A 4LHLA 4XDOA 1S0BA 3LFMA 4I0WB 3ZFEB 5GLVA 2ZBJA 1X82A 2CL2A 5C8WA 4A42A 1J1LA 3AYCA 4CPBD 3PUSA 2XHNA 5BNPA 1BK0A 3ZR6A 3AMQA 4QHBA 2Q1MA 3ENRA 1X50A 1RYYA 3RYKA 3L9JT 5HI0A 2RS33 2W87A 5GZGA 4UBHA 3ZYGA 5FLJA 3SEEA 1NQDA 4XFCA 3KVBA 5C71A 1WD4A 1X7NA 2XJRA 4YW5A 5CFCB 3L2YA 3LOIA 3RPQA 4DUXA 1J3QA 2PA7A 1RUF2 2WQ8A 5J98B 5LEJA 5IYYA 2OA2A 3O1VA 4BH9A 4GH4A 1OUXA 3NWKA 2J1TA 3OBTA 3VKLA 5JMOA 4CCOA 3N9MA 5JI7A 2RJKA 2G4IA 1AYM3 3ILNA 1ND3C 5DAQA 3N9PA 1CR7A 4AFCA 3FHAA 5AVAA 2D3PA 1L7QA 1YXWA 3IIIA 2VULA 3NNLA 3KLSA 5CA6A 2J22A 3VKMA 3ITQA 4LT5A 1GZCA 1VAVA 4QWNA 3RFRA 4JHZA 3OBRA 4XJ9A 4Z82A 3HQUA 4HPKA 2R042 1JZ2A 1QNYA 4YSFA 1EPWA 2JDHA 2ZEYA 2VE1A 3MEPA 3JU9A 4B4PA 4E8CA 4HVQA 2X5IB 5GLUA 1VB4A 4AQ6A 1LKNA 4HN1A 4DY5A 3BN6A 2WO2A 4N8MA 3CJXA 1MEC1 3IZOA 1IQDC 4P00B 4MXWA 4DXRA 4E4HA 2BZDA 4RHV2 4Y1VA 1RMU3 3CQOA 1H9WA 1UXXX 1VBE1 1YQ8A 1QWRA 4AHYA 1LOBA 2RM21 2EIEA 1TE1B 4DEQA 1TVGA 1UZVA 3ZFFB 1F31A 1JHJA 3KT1A 2ZACA 3FLRA 4FOQA 4NRQA 2D40A 2Y33A 1GQGA 3WQ7A 2PHRA 3TEWA 3LDRA 2PFWA 5E88A 2C9KA 5A33B 3HJRA 1O91A 4BLJA 4OI0A 2BGCA 5JR2A 2VMEA 2ZOEB 2W5FA 4OQ9A 5KC5A 2E7TA 2JXAA 4Y1XA 4LK6A 1W3XA 2RDQA 4IETA 5FMOL 5IATA 3J8F1 5LK7B 3DCQA 5L73A 1QF3A 3NJZA 2RS13 4XXAA 1SBDA 1SDWA 4Q4V1 2WNUB 3U10A 1G9AA 2ZEZA 1JUIA 2PHTA 5GLTA 2BWCA 5I8TA 3BKZA 1QJFA 4CUAA 4CUGA 3O1RA 1PGL2 1CAXA 1OQEA 2PTMA 4NJ4A 2RS53 1H8TC 5FTTC 5C8CC 4YZ4A 1EV11 2XVKA 4U36A 2HEWF 3MBWA 4QKDA 5AC93 5D1IA 2OIIA 1C8M1 2AR6A 1RUI3 5GJ6A 5L9BA 2XL9A 1JYXA 4JZRA 2B39A 4N53C 3RZHA 4AHZA 1JYNA 3J26N 1WA6X 4QB6A 2IFWA 4A3ZA 2Q8OA 5A3OA 3WG3A 2RMU1 4WZFA 5IWFA 3WNPA 2BPA2 1J58A 1OF4A 1W0OA 4C1XA 3K75B 3LEGA 4CDUB 1PGW1 1AR81 3O1TA 4QU2A 2IFRA 1R1A1 1FI2A 3UL2A 5IVEA 2K46A 4KG8A 3B7MA 1OFSA 1V70A 2XJVA 3O1MA 1YC61 1LEDA 4ISRA 1F35A 3EO6A 1NA1A 3M70A 3WNLA 2QE3A 5LK5A 2GH8A 2Z42A 5A3UA 1ZBA1 4M3CF 3KCXA 3ZKYA 2DCYA 1G9CA 1WBFA 2VOKA 1QOOA 1AYM2 4AE2A 4IGPA 3W5NA 1PNGA 1IGOA 5IK4A 3OEAA 1Z7S2 2VJXA 2VNVA 1LHUA 4AYUA 2DCTA 4N90A 1UNBA 2R49A 1S0GA 3SMHA 4JRAA 4YVWA 2OW4A 2ZEXA 3AP4A 1OLRA 1OVPA 4BE3A 4O65A 3IIAA 4H55A 2ZXQA 4MG2A 1VALA 3SH5A 2ZGNA 1SCRA 5KR7A 4ZS3A 3IAPA 4DZGA 3AM2A 3T0AA 3WT3A 4ASMB 1S2KA 1ZBE1 5BNNC 4OUMA 5CNAA 5EJ3A 1W6OA 3CL1A 2D98A 3HPNA 1UZZA 2VMIA 4HKLA 4MHRA 1G9FA 5SV5A 2I2SA 1TNFA 4KGQA 5C33A 3GNEA 1OA4A 1XRUA 4Y24A 2WDBA 3N35A 1SQ4A 1R091 1AR91 3K46A 3N3HA 4V2WA 3ZSLA 3T1MA 2P5BA 3ZYRA 3WW1A 3KB5A 1CJPA 5LBEA 1SDDB 4CEYA 1OQ1A 1WW7A 3ZFEA 2ZMNA 2UWCA 3HAGA 1K5MC 3ZYFA 4MO3M 4QX5A 5L7OB 4FXKB 2OT7A 4AFMA 4DUWA 3O7OA 3HN3A 3AX4A 5IVVA 5C3QA 2BNMA 3ECQA 2VOTA 5FYIA 2GU9A 2BP6A 2XPJA 2VR4A 2WYFA 1YJKA 1DZQA 1HV0A 2B9VA 3I54A 2RS12 4QPYA 2VUJA 2EALA 4QDRA 4RYDA 1K45A 3RJRA 3V64A 1UXZA 3I2JA 4DUVA 3KV9A 3SC7X 5CFCA 1CD3G 1UIKA 1N3OA 2J7MA 4UWDA 3WCSA 1W2UA 3QCWA 1C5HA 1V6LA 4Y5TA 4SLIA 4N9HA 4JGZA 4Y4RA 5I8SA 4C1WA 5FZOB 4BDVB 1FV2A 1MEC3 2HJIA 3ST7A 3WNOA 2VY0A 5LRRA 4FTEA 1VBE3 4XJWA 5AC92 2PAKA 5JXIA 2RM23 1C57A 3I2DA 3AMPA 3ZYIB 3WQBA 5JXJA 1ULFA 1RUI2 2DBNA 4CRQA 5K9YA 3AP7A 2B7YA 2BERA 2IZWA 3CNAA 4LJHA 3VL8A 4DXTA 2BFUS 3I7DA 4QPGB 4QX0A 4EN9B 2WIIB 4M0NA 5FP7A 5JIUA 5A6QA 4A7ZA 4AW7A 2ORZA 4FFFA 5GKAC 3PL0A 4WVVA 4PF5A 5ERLA 5A7QA 3TRSB 1LESA 4CCKA 4CE8A 1HRI1 4IV1A 1X8EA 4OULA 1RUG1 2WO7A 2AREA 5FYMA 5HCAA 2O8OA 5IUQA 3ZPYA 4YW4A 1HX6A 2ZCWA 2QQPA 2GNMA 2OX0A 1UY2A 4GZ9A 2VOWA 4R9CA 4PCRA 1FYUA 3ZFFA 5JVVA 2VCBA 4B1MA 4GQ7A 4W8JA 2QQUA 4PT6A 2C4XA 4FCAA 3BIEA 2ZKNA 3S6PA 2VCCA 3NJYA 2CWSA 3P6BA 2WSUA 2W3JA 4PF1A 4XBLA 4B8EA 1FNZA 1UZ0A 4Y33A 2DCKA 5A33A 3ES1A 4PLNA 3BTXA 5CFDA 1F5JA 1WD3A 1QJU1 3PVEA 1EV13 1NY71 1VIWB 2NM1A 4EZ4A 4DFSA 2CDOA 2WWSA 4QD2A 3ZN6B 1B09A 4QDSA 5B4NA 1C8M3 2XHKA 1E5HA 5A3NA 4Q0QA 4CCNA 5J3UA 4A7KA 4NHLA 2CV6A 2B9UA 2QQLA 3O1SA 3WW4A 2QDRA 2CGPA 2P34A 5DZFA 2CNAA 1YIFA 5FAXA 4GIQA 2BOJA 2YHJA 1PVC3 5FY7A 2HWF1 1PM7A 3KSCA 1QNWA 5IVYA 2BGPA 4LO4B 4DNYA 1CWPA 2RMU3 1STMA 2Y6HA 2W95A 3AXEA 5DG1A 2BFUL 4RQPC 3NV4A 2EIDA 1MS3A 3T0BA 1QDCA 1UYZA 3GZEA 1AR83 4NHYA 1R1A3 4W6WA 4XACA 5FYHA 3WG2A 1S0JA 4MVTA 2QQOA 4J1XA 3WINE 3GHNA 2HWE1 5I93A 5DG2A 2JJ6A 2B8MA 1LHWA 4CEWB 2C1FA 2ZABA 3APBA 1PZ9A 1BYHA 3J4UH 1ZBA3 3OYWB 4IE7A 4Q27A 3ZXGA 2WSVA 4XQDA 1DGWX 4O9GA 3VHOA 4TLFA 4O9EA 1VRH1 5CISA 3SCGA 2TBVA 2D6LX 3P3NA 4YZ1A 3TNPB 1F8VA 3E1F1 1BMV1 4CDUA 1O7FA 1POQA 1YFWA 1XC6A 4ARXA 1OC1A 5KXDA 2W39A 1AYN1 1OT5A 2RVAA 4OZXA 4URTA 1Q8PA 1WCSA 2BOIA 2RR12 4FXGB 5G05L 3AYEA 1I9RA 4LO7A 4RR3C 3RQ0A 1FATA 3P5BA 5HXMA 2PLV1 3SLIA 5T50A 4IEUA 4Q8LA 3WD5A 4BQ1A 1W06A 5JSOA 2AC1A 1ZBE3 2I74A 1QOSA 3HD8B 3SH4A 3N7LA 4MX3A 1OH4A 2VBPA 4AZZA 1UYPA 1VBE2 3MDPA 4DPNA 4AI8A 2RM22 2NZ9A 3WF4A 2ADEA 2XKOA 1N1TA 2XJUA 1R093 1AR93 3OPWA 1BEV1 4QGMA 5KHIA 1NZIA 2VVFA 4QPIC 3DPRC 3OSDA 3H7YA 4JKLA 4Y22A 4Q1PA 3S5AA 2JIJA 2D5HA 5FZHA 4GWIA 4E4SA 2GNBA 3JQXA 5AVPA 4YYOA 1W6PA 3W59A 4PIZA 2HWD1 4NO4A 3Q9OA 4CP9A 4P9IA 3ZYJB 3J8F2 1QJEA 5LRSA 4Q26A 1EYBA 1CX4A 2GSYA 2JECA 3AMMA 1E5IA 4NR1A 2FHRA 4Q4V2 1ULPA 3PIJA 2WQZC 3HMYA 1W90A 5FYBA 5C4WB 2DVFA 2XUEA 2WA4A 3AZWA 3VDAA 4I30A 1XE8A 2E32A 3AYDA 4MGYE 4ORFA 4R9DA 1UWWA 2XLAA 3MW4A 3VZLA 4MHUA 4X8NA 3DXUA 2DURA 1NCRC 3IKWA 1CX1A 1D2QA 2JX9A 2RG4A 4QXCA 4CCDA 4HN0A 1Q56A 2GZWA 4P5HA 1EV12 5DXDA 5F6LB 5I8YA 1S4CA 3N9NA 4JGYA 1KDMA 4P9YA 4XXPA 4CCEA 4IW3A 1O3TA 1UX6A 1W39A 1C8M2 1LOGA 3PU3A 1VB2A 1X9PA 3H0OA 5JOXA 4ET7A 3NV1A 4P02B 1SEFA 4CXXA 2JG9B 4BQ5A 3RZGA 1AR71 3ASIA 4QB2A 2XJTA 5TSWA 2RMU2 4P14A 3VDDB 5FZOA 3S0MA 4ZU7A 5FIXA 4AI2A 1HRI3 4EN8B 1H8VA 4I0BA 5A1AA 1RUG3 4X6QB 1PGW2 3RVHA 2XJPA 4GULA 5JZGC 1AR82 3FBMA 4URAA 1QGLA 1VBB1 2JDAA 4MGQA 4MSVA 5ANQA 3KQ4B 1JYTA 1AXZA 1KQRA 4S2FA 4LO8A 2UY8A 5AFBA 1XNBA 2ZGMA 1LHOA 3M3QA 3INAA 4HMZA 3I49A 1UL9A 4XURA 4HT1T 3UJOA 1JOPA 2A1XA 1B35C 2WZR1 1ND2C 5KWRA 3MO4A 2C9AA 4QPGA 4ZXEA 3WDVA 2ZMLA 2ET1A 4NN0A 3K51A 4K9SA 4XQWA 1TG7A 2VUAA 3O1UA 1QJU3 4FO9A 4I09A 3ES4A 3E5QA 3VHPA 4D8MA 4XJAA 1WBLA 2E33A 4GB31 2A3XA 3ETPA 3I2OA 4QXBA 4UAPA 5FO7B 5EJ1B 1OSGA 2A73B 2V4VA 3MV01 5A3MA 1BLZA 4AI3A 1GZTA 3KGLA 4MV2A 1JU4A 3FL7A 5FZ6A 4JC1A 1XU1A 5FUNA 1OHFA 1TQ5A 2HWF3 3NAPB 4HKOA 1UOFA 1GV9A 3A22A 4GD4A 4IV3C 4JTNA 3CJIC 3RS6A 3THTA 3TOJA 1ZBE2 1VR3A 3I2FA 1CZSA 3G6JB 3VDBA 2J1EA 1EAH1 4DRRA 1VMFA 4GMP1 1LENA 4JAAA 3VBRB 3VBOA 2BDRA 2GNDA 1Z78A 2A6ZA 3CDZB 3DKWA 3MLLA 3ZN6A 2E7QA 4EWEA 4AVAA 1CAVB 2CY6A 3NQHA 1R092 1AR92 5F32A 4RGAA 1PIV1 4Q2FA 4Y3OA 2HWE3 2VAUA 2RS31 2XBO2 4LE3A 1DFQA 3RJ2X 4JCKA 2F6BA 3RMXA 3E6CC 4F83A 5C5TA 2HWC1 5FP3A 2CHHA 3M4FA 3SXWA 1Q8VA 2B5HA 1HN0A 4IEYA 2EVXA 4ARYA 1VRH3 4CCJA 5FPLA 3A23A 4AHXA 4XBNA 1KJLA 1JMUB 1EUUA 1WA4A 3CF6E 5T5PA 2Y6JA 1H2MA 2ARAA 3VN4A 5F3CA 4MXWB 4XFFA 4G9SB 3ZIXA 1AYN3 1UYYA 2WABA 4XTMA 3SNMA 1EUTA 1Q5OA 4L92A 3JB4C 1RUD1 1RB8G 3AK0A 1CJDA 2VQUA 2Z79A 3N36A 4Q5OA 2PLV3 3A0NA 3OBAA 3BTYA 2WKKA 3GCWA 1WUVA 2XH6A 3ZSMA 1RUE2 5EFUA 4A4AA 5FYYA 3OYWA 2JB8A 1O59A 3T08A 2HBUA 1MQTC 3IN9A 1TEIA 5ABJB 1NXD1 1U0AA 3V56A 2GP5A 3CU7A 4NOTA 1LEMA 2O14A 4AEDC 4CDWB 5I0TA 4GA9A 5BPXA 1SHWB 4JDMA 1L7LA 3ZMNA 1O3RA 3NSTA 2Y6LA 1BEV3 1W99A 3OGJA 4AR2A 3ZFGC 1ZRDA 1Q43A 4OHWA 2E51A 2D7FA 3O5SA 1DHKB 2X8KA 5I0UA 1FX5A 3FUQA 5KXCA 1DQ2A 1SG3A 2D3RA 1SFNA 3AKPA 5CEHA 1W8TA 2VVDA 1LOCA 1QMJA 3V0AB 2HWD3 1K3IA 4FP2A 1HRI2 5K7PA 5IVJA 4MUVA 1H1AA 1RUG2 3ILRA 1TME1 4R52A 3ZXDA 4FFIA 3A4UA 3GBWA 2A71A 4GXLA 3FHIB 1YI7A 2J1AA 2EF6A 4CU8A 4FQ4A 3WY6A 4C0BA 1W6MB 4Z1VA 4KWKA 3FJSA 2Y6KA 4LO5B 1QJY1 2ZEWA 5DAVA 5SV8A 1PM4A 3DKQA 2WYSA 3FHQA 1LOFA 2HYKA 3IM0A 3WCRA 3ZXEA 5E1RA 4GWMA 5FYTA 3TB0A 1COV1 2VW2A 3ZPOA 1VBC2 2WJSA 3AKTA 3N7MA 3S57A 1NY72 1YIPA 2BVVA 4B7EA 1ND3A 3AZZA 1K42A 3HQRA 1N1SA 1SZBA 4CCMA 1W8FA 3K3NA 1UPSA 2XLFA 1YJLA 4GWJA 4E2GA 1JZ3A 4TSVA 4BZ4A 2RS51 2GDFA 4FTSA 1ODMA 1H30A 4NHKA 1QOTA 1SLAA 1GZWA 3X29B 5KBFA 4ZHNA 5C4WA 2XDVA 1IPKA 4A6OA 1AR73 3UETA 2HWF2 4LEJA 3E6BA 4M01A 1FOD1 1D4M1 1UF2C 4JDNA 4XE9A 3IPVA 4FQZA 2EXHA 5FZCA 3VKFC 1DZRA 5A3WA 5L36A 3LD8A 3HEIA 1URXA 5A32B 3UKNA 4XFBA 3VD4A 3VBFC 1L7RA 1CIYA 2WRAA 1WCQA 2EAAA 5FZLA 1VBB3 5GLZA 5LZ6A 2JG8B 3GDBA 3B9IA 5C6CA 1KS4A 4META 5G04L 3KCCA 4CU9A 2B42B 4XUNA 4H7LA 2HWE2 1W9WA 1US3A 3VBUB 1V9U1 3D8CA 4XEZA 3VL9A 4E8DA 1SFPA 2WZR3 3DL3A 1MZFA 2JG9A 2BGOA 4XBQA 4CUCA 5LA0A 4OMCA 4K3UA 1UY4A 4YVWB 5KXEA 1HJFA 3D3AA 4Q0VA 4EYUA 4YFZA 1ZVFA 3ACLA 2V72A 3C7FA 4FTBA 4IE6A 1UOJA 1YLLA 1VRH2 5FYSA 3VDDA 2P6HA 5JWPA 3BIWE 1EY2A 3I2GA 2VZPA 2W0XA 4NIHA 4GB33 3THCA 1RINA 4E27A 3WDUA 1ULOA 2VZRA 2VUCA 3PDQA 3OGSA 2PHFA 4P5YA 4P9GA 3I3QA 1LRHA 1J1TA 3K4AA 3SCFA 4FT8A 4CXWA 1VMJA 3EMRA 4RN5A 1PK6C 1I5PA 1SLIA 1OLME 3BU7A 4L99A 4DMIA 4L97A 5FCCA 5IK8A 2XWJB 4K1YA 5I91A 2XL7A 1YQCA 3TYJA 1EAH3 4CEYB 3N9OA 4GMP3 4QQLA 4Y1ZA 1H8TA 4JKMA 2DVBA 3FZ3A 3AB0A 1JZ7A 3ZM8A 2BBAA 1ENSA 2Q4SA 3LA3A 1RJ7A 5LY2A 4BK5A 1UN1A 5FPAA 2EIBA 1BEV2 1PIV3 2HWB2 4KG0A 1N1VA 2P17A 4IEXA 5GM0A 2WFF2 3PTRB 2B46X 2VNRA 1CGPA 5CIRA 1N3PA 4CDQB 3DV8A 1QQP2 2P2KA 2ZPXA 1SFYA 5BV6A 2HWC3 2D97A 5E16A 2BV4A 2FQPA 3NAPA 2P6CA 2V4AA 4GJZA 4Q0UA 4MGKE 4YVSB 1BBT2 4A3XA 5IFTA 4MLOA 4CU6A 4JGZB 3PURA 3PUIA 2C24A 2W47A 1O4YA 2UY9A 4QB1A 3ETQA 5FMOS 4ZKTB 2V09A 3VBRA 4BQYA 2IXLA 2RDRA 4E2SA 4LA2A 4XABA 3T2PA 2D6NA 4YW1A 5ISLA 2XONA 3WNMA 3RZLA 4XMIA 3VGIA 1CAVA 5F5CA 4DOUA 1RUD3 1G9DA 1VBA1 1JHNA 4LTAA 4R9AA 3ZN4A 5K0UB 1UMIA 3MGUA 2VU9A 1LODA 3RZZA 2A70A 4KI5M 2AENA 3EHKA 4BHPA 2VNGA 3U78A 1YCIA 1IQAA 3E5XA 2AUYA 1XPWA 1ZRIA 3I4IA 2W91A 2VMFA 2IWGB 2E26A 2C5DA 5FQ0A 2X53S 4HSJA 4KQ7A 4TWTA 5JSPA 2W1QA 1F4AA 3AKRA 2CAUA 3BOPA 3DYPA 3HBZA 2GP3A 3NO8A 4IV1B 4XZUG 2ZX3A 2J1VA 3H1MA 5D8AC 4AQTA 4OHYA 1JYWA 4HETA 5FXXA 4FPGA 4EQVA 2YUEA 4CDXC 1LHNA 5FZ8A 4XVHA 2VCAA 3P1IA 4YW2A 3WDXA 1O3SA 1R1ZA 5LBFA 5BNNA 1UMZA 3WF2A 3WQ0A 5JDBA 1TME3 4HVOA 3W58A 1QXRA 3GCXA 2VZ3A 5ABJA 2R073 3QLQA 1LECA 1VBB2 4LUMA 5CFDB 2WBKA 1VP6A 2NQYA 5FLIA 5K8SA 1DGLA 1MS0A 4CDWA 5BNOC 3B93A 2DVAA 1AXYA 1MS4A 4YW7A 3IDAA 4N9IA 4Y20A 4JHTA 3H3UA 1HKDA 1QJY3 2WZR2 2OXBA 1LAJA 2YC2A 2FDGA 4QAWA 3DN7A 5FZ7A 3BODA 2W46A 2QUOA 5F3IA 1COV3 1KFUL 1OQDA 2MPFA 4GMP0 4R4ZA 1XNDA 2F4PA 1K5MA 5DUUA 3ZMOA 4BU2A 5BNQA 5FWJA 3T1LA 4AGGA 3V0AA 5ACA1 2VMHA 5LA2A 3IDBB 1RUOA 2ZAHA 3CHXA 4GB32 3BVCA 3B3QE 3C8XA 3I3EA 2FDKA 2ZS6B 2DBIA 1SLCA 1RUC2 4GKXA 4BK4A 2OQ7A 3FLPA 3AZXA 1HXS1 3B5LB 3K4ZA 4P9LA 1ENRA 4WVZA 5FYCA 4B7KA 4COYA 1W6MA 4L11A 1XOYA 1HJGA 1RITA 3D0JA 1FOD3 1RVF1 3N9QA 1QH7A 5FY8A 5LEKA 1D4M3 2YC4A 3JBG2 4LBQD 3O12A 5FYZA 3CKHA 3QOPA 3ZYHA 5JMCA 2JE9A 2ZGRA 3NVCA 1PVC1 4UXAA 3KHCA 1G86A 4NWWA 4ZZ8A 3L2HA 1WLTA 3T2QA 1FMD1 1PMJX 2VXJA 1D4VB 3MW3A 2R1BA 2TEPA 3ZSJA 1ENXA 5FP8A 5HCHA 3UGFA 2XQRA 3LAGA 3T2OA 2RS32 3JB8A 5JOYA 2C0ZA 1V9U3 2A5ZA 4COWA 4PI2A 1W04A 4RGGA 4ATEA 5BNPC 2QDNA 1JZ8A 5CKMA 2HWC2 4CVUA 5FMBA 5GZFA 3ROUA 3D82A 3U14A 1LR5A 2OQ6A 4P08A 5C3RA 1QXPA 3ATGA 5FP9A 4ZZ5A 4AEJA 5A32A 1LNSA 3VBSC 4COZA 2JD9A 5EPAA 5IK5A 3WDWA 3DUIA 2JG8A 2K9ZA 3N7JA 1MPXA 4HANA 5DN2A 1AF9A 1OOPB 2ZGQA 1F15A 4GH4C 1ST8A 1ZZ8A 5EP9A 3WNNA 3RZKA 3H8RA 3SQOA 4LHNA 3VBUA 3ZOIA 2WNVC 4QKFA 4YRDA 1ZX5A 2GC0A 1QEXA 3RWNA 5C3SA 1W8UA 4CP1A 4MZUA 1W03A 4Y22B 4M4PA 3WW3A 3AZVA 1MS9A 3M8LA 2H0BA 1DYKA 1JYCA 2DFBA 1RUNA 3J7MA 2QKDA 1W6PB 2OVUA 3PUAA 3OOXA 4PLMA 4W65A 2XOMA 4ASKA 1GP6A 5JCTA 3BPSA 2WN2A 4D6SA 5C9AC 1RMU2 1HW5A 4CP9B 4NIGA 4E9KA 4KBBA 1AR61 1W8ZA 3UGGA 2W1WA 1OA2A 1W2TA 4N7UA 4A45A 3OD4A 3FWEA 1UCXA 1WMFA 3HBKA 3LSDA 4OLLA 2NP0A 4Q4Y1 3POBA 4HK8A 1TME2 2D93A 2VCMA 1NCQB 4QHOA 2NLRA 3MIBA 4RQPA 5IVFA 4UFKA 1Y9MA 2A6WA 3AVSA 1O4ZA 1C28A 1WLWA 3KS7A 5CVRA 4BIOA 4HKWA 4JGYB 2FBEA 2HLEA 3GJBA 4EZHA 1VBA3 2WZPP 3SH3A 4LITA 2UWBA 1QJY2 4FVVA 2ORXA 3J7HA 1JOBA 1LCLA 3DF0A 1O5LA 4JX0A 4YPJA 3VZJA 1DQ5A 4CDQA 4YZ5A 1R081 2G9GA 4YVSA 3LIHA 2PHDA 1QJX1 1UU5A 5EYXA 5EHDA 5IK7A 3ACHA 2WS91 2DDUA 3AFKA 4GWNA 4B4QA 4XTPA 2PAEA 1E57A 4UFJA 2DVDA 2RJLA 4DB5A 1BCXA 2RS52 2L9LA 3D5OA 1JN2P 3KZ4C 4BMEA 4IEOA 2TUNA 4UW5A 2QQVA 5DMYA 2EIGA 1QHDA 3OGVA 4RR3A 1HB4A 2VZOA 4LKSA 5K0UA 1FOD2 3JXSA 1AX1A 3TBDA 4HL0A 5FMCA 3ZIWA 1XBFA 4S2GA 3LA2A 3TAYA 2IXIA 1OKOA 4BQXA 4PHZA 2ZX4A 3MICA 5F5QA 3GXUA 2ZGKA 3WF1A 2VOVA 1SLLA 4NMIA 2WZEA 5FPVA 2K2SA 4BXFA 3WG4A 5J96B 3ZX7A 2G1MA 2ENRA 1HQLA 2JICA 2CDPA 3LFIA 1ZM1A 4XUTA 3ZN5A 3USUB 4NE9A 2PHXA 3G7DA 2YXSA 2VZQA 5F2WA 2AZ5A 2VQAA 1OXCA 5DQ0A 4NVPA 4QKBA 4JRLA 1S0IA 4N43B 4OCTA 4PDWC 4UOJA 3RG0A 4P9JA 4F8AA 5ACA3 4UI9L 4C0HA 2CGNA 2VL4A 1PO21 4ZXKA 4LBNA 5A3PA 1SMVA 1KXGA 4OUEA 2UWAA 5B2GB 1GICA 1H9PA 4QQ2A 4O61A 1NA1C 2V5YA 1A78A 2AYHA 2W9XA 3VBOB 3VBHC 4XAEA 2AACA 2GC1A 1HXS3 2YPJA 4LULA 1E5RA 5FBZA 4AGVA 2X10A 3AC0A 4A44A 1RVF3 2JKBA 2WT1A 1GMMA 2WL1A 3AP9A 1GKBA 1NE6A 4RS5C 4FOYA 3WHUA 5FDBA 3TWIA 4EN0A 4QX8A 1JZ5A 3O1OA 1YFUA 1FMD3 3MUY1 5A3TA 3PVOA 3I2KA 4AEKA 2D5FA 2YC0A 1MZ6A 2Y34A 4OHZA 4AF9A 2WNOA 1GOHA 1S0FA 3A7QA 1W0PA 3BALA 4HOOA 3W20A 4TN7A 4EE2A 4OI4A 2VMCA 1U5YA 3QD6A 4NIDA 5E89A 2DFCA 1N47A 2VG9A 2XR4A 2R7EB 3MIHA 1CPMA 3E97A 2R0FA 2YY1A 1BK1A 2OZ6A 5FZFA 1GR3A 2O8QA 1XB9A 3J7LA 1OLQA 4XJ8A 2BW8A 3BYWA 4XF3A 1XNTA 3KV5A 2P3IA 3ZFEC 1ENQA 4PIYA 1KRIA 5JAXA 4X6RB 2VZSA 3BU0A 1S1AA 3M3OA 4P9WA 5F3GA 1ND2A 5DAXA 5FUIA 3ACGA 2ZX0A 4JQRA 3MPBA 2WR9A 1BXHA 1SLTA 2VUDA 3LGRA 1VPHA 4W4ZA 1CZVA 5GZDA 1GNYA 3GJAA 2ET7A 4QHZA 1UKGA 2ZJCA 3I2IA 1YFXA 5CFCC 1MEC2 1IOAA 3NNJA 1TMF1 1BQPA 2X05A 3WSOA 1OVSA 2JE8A 5A6ZA 1OOPA 4YGCA 4MGZE 1AR63 3ZO0B 3K77A 4LNVA 2J1UA 3RNSA 5FOBB 2ID4A 4LIUA 5CADA 4LORA 3LCPA 2E9QA 2VH9A 3GBGA 4Q4Y3 5FZMA 4OHXA 3NKTA 1OPOA 1DQ0A 3WXPA 2VZ1A 2LS6A 5FJHA 1A8DA 3KM5A 2CU5A 3HN1A 1RHI1 1LGNA 1X33A 2LUWA 4IE5A 1NXMA 1X36A 3H1YA 1ND3B 1W6QB 2PHWA 2X5IC 3A0KA 4FAGA 3LPFA 5A7PA 5CYYA 3AKQA 2Q0AA 3GZAA 1ZZ9A 3LPGA 4UFHA 5FY4A 3UYJA 4KMQA 1R083 4OZOA 1GZWB 4BQ2A 3R6SA 3P3PA 1LULA 1JUHA 2LM3A 3ZXAC 1QJX3 1HQNA 5JPMB 5FZ0A 2WS93 2VTXJ 2KM2A 3IPVB 3D4KA 1NCQA 3ZFFC 4LLOA 5E8AA 2CGOA 3FMGA 4AFDA 4AOCA 1RUF1 4PIXA 3O0VA 1I6XA 4DQAA 2VPVA 4K20A 2NYYA 5A7SA 4UT5A 5T54A 1HXS2 1US2A 3I3BA 3MLKA 2VGDA 5M0TA 5D21A 5CU1A 1OD3A 3MIGA 5F39A 3KT4A 1G6NA 3CBNA 3KQRA 2PAMA 2P3YA 2Q1FA 2Y60A 4QX1A 2PMWB 3CZUA 3HIFA 2AH2A 5IW0A 5LBBA 1PVC2 3H1WA 5LATA 1MQTA 1UYXA 1ZRCA 4NPMA 1ZZBA 5CAZA 3DGTA 1FMD2 4XFAA 4H14A 3B00A 3HNMA 3LDBA 3CMGA 4R8HA 2WNUC 2RDSA 1SCSA 4JKKA 4NIAA 3T09A 1YQ6A 2FDHA 1DGRN 3R4SA 3FFQA 2QCSB 1LTEA 5JPNB 2PN5A 4XMAA 3ZFGA 1R1A2 4RD7A 2P3KA 2V5DA 1W6NB 5IAVA 3H50A 2FCTA 5IFPA 1LGBA 3MW2A 3OF1A 4KNCA 4LHKA 3T3YA 3GYDA 5FWEA 3THDA 4WVMA 3LOBA 4NHMA 1PO23 1YI9A 1ZBA2 3MV11 1MS1A 3U75A 3WP4A 1QKQA 2ZTNA 5IJRA 3WUDA 4KWJA 1GSLA 4AVCA 4LLFA 1CVNA 4FI9A 5GZCA 5LCWL 3OUIA 4YGBA 2GH2A 1IKPA 1Q8SA 5C8CB 1H8TB 1JW6A 2BNNA 4EROA 5A1LA 2GN3A 2R16A 3USUA 3GM8A 3W5MA 3LIGA 1U5ZA 2XMLA 2JDPA 4EN6B 3EB7A 1PHMA 3OB8A 2IXKA 4HBNA 5FZDA 1AJOA 4DXZA 4IEVA 2E7AA 5D2AA 1Y3TA 4CDUC 5HV4A 4N53B 3K4DA 2SBAA 2A75A 4N43A 2Y0IA 4Y5Z0 5FY5A 3W21A 2ZGPA 1PZ7A 5FFOC 5GLWA 2VVEA 5CB7A 2Q8CA 3QBQA 1KS5A 4L9BA 1KJRA 4MH0E 4YG0A 1VJ2A 3UNPA 2YFZA 3BI3A 4D69A 3Q8EA 4UW3A 3VB9A 1RJ8A 2ZA9A 1GYKA 2VTFA 4OUSA 1V00A 4XILA 2DTYA 1EPZA 4QKNA 2O0OA 2H0VA 5FRAA 5FYVA 5T5LA 2FZ2A 3NJXA 4E4DX 5C5UA 2JDNA 1UY0A 2W08A 3TEYA 3HVDA 4IESA 2J1RA 3V65A 1I3HA 3KV6A 4HSLA 4N7IA 2Q30A 4NHXA 5JI9A 3N7KA 3FN9A 3VBFA 4QX7A 3GBFA 3SISA 3PTYA 1IS3A 4FOVA 4XF0A 3U07A 2YV8A 4TLGA 2X29A 4BPZA 2BQPA 4YLZA 2D6KA 2BU9A 3I2HA 4IL7A 2WLPA 5FQ0B 4Q0PA 4KBZA 2MEV1 2ZGTA 4IE0A 2YU2A 1IS6A 3OD0A 1YUDA 1JXNA 2OYZA 2PQQA 3OY8B 4W6XA 4W50A 5JSRA 2OPKA 5EV7A 2J42A 2QQWA 4B3NA 2YGMA 3BCWA 3PJQA 4QQPA 3Q8BA 4PBOA 3RYPA 2WS92 4ZPIA 1V6KA 2XLGA 4A6SA 4Z2WA 4ZU4A 4AAPA 3MLJA 2GAUA 1TMF3 1U5XA 4LR4A 4NPLA 4PI0A 5BNNB 5EXOA 5JOWA 4LMFA 5KHJA 3GHMA 4FOWA 4XDPA 3UJQA 2A7AA 4OHVA 4I3GA 1M06G 2LRPA 4NAOA 3O14A 1W8WA 1QJZA 5L7OC 2N7GA 4FPYA 5EJZB 5A3LA 1AHSA 5LW9A 4OI1A 2QNKA 3T0DA 1GU3A 3OCPA 4ATFA 3KHBA 4QXKA 1PK6A 3HR9A 4Y20B 2FMDA 5FBJA 5FZEA 2Q8EA 3EYPA 5CG9A 1GFF2 5HCFA 3K48A 1OF3A 5C7GA 1Q8QA 3JD73 1AUYA 4XYXA 2DYCA 5JOZA 4XUPA 3ZR5A 1FPN1 4OQ8A 1RUH1 1K5MB 5ANNA 1RHI3 4BXSV 1ODNA 1U12A 1J59A 4Y1UA 1XYOA 5C9AA 2WT2A 3PUQA 4ASLA 5EWSA 2QZ3A 3PU8A 2R071 3JQWA 4WM8C 2YBSA 5F5AA 5GALA 2DTWA 2KR2A 3OUJA 4E4ZA 3AZYA 2XKPA 5F6KA 5EIYB 1JZ4A 2BWAA 5F7UA 4IXLA 3FBYA 1XNKA 3NV2A 4FPHA 2VZUA 5I0RA 3RI9A 2G9ZA 3CZJA 3MZHA 4XDQA 1PNFA 1PO22 1VMHA 2FDFA 4CZSA 4XC9A 3OPTA 1WGPA 4XFGA 3WVJA 5LA9A 4K21A 1RUF3 1Q8OA 4FPCA 4LKDA 1QJU2 3VLBB 1G9BA 1KFXL 4ES9A 2F17A 4LXLA 4QPGC 3ZSEA 1W6QA 4C8DA 5FPBA 4Q4X1 4D6RA 1NG0A 3MF6A 2IC1A 4IQPA 4W6YA 4QQOA 1AVBA 4Y4YA 3O0WA 2D6PA 3TN91 1GP4A 1OI6A 3H7JA 2VOXA 4XOGA 5FK8A 2IXCA 3N9LA 5FZGA 4M0HA 1W9YA 1DQ1A 4IE4A 2R043 1QXJA 3BB6A 4ES8A 4BQ4A 1WMXA 5IVBA 2JDKA 1UMHA 2OZJA 2ETEA 2LW8A 3H8UA 4I02A 3ALQA 4KGGA 3GZUC 2FZ1A 1IS5A 3ELNA 4GJYA 4XCBA 2ZHKA 4MGTA 5CBLA 4CXYA 3CLPA 5T52A 2ZHNA 1AXKA 1DLLA 4COUA 4ZONA 2VQ0A 4QMAA 2JE7A 4Q1RA 1GWLA 2OPWA 4M00A 1CZTA 5DDJ1 2H6BA 3OTFA 4XF9A 4I01A 3WF3A 4LKEA 4FFGA 3B69A 4OVEA 1JZ6A 4MXVA 1XXNA 1FXZA 3IMNA 3UESA 1PGSA 4K40A 4Q4W1 5FPZA 1BMV2 3WEZA 1UPIA 3AP6A 3PMSA 3MFCA 1N3QA 3OBZA 1AYN2 2VD7A 3KWVA 2JDZA 1UZYA 4F3JA 2ARBA 5FLHA 1W6NA 3FC0A 1FT9A 2PLV2 3LZZA 1UD1A 2A3WA 4EWDA 3E5UA 3CEWA 4D0QA 3MYXA 3KCYA 1C1FA 1DQ4A 5T55A 4DRVA 1QY4A 3BTAA 1H6YA 1TMF2 2YPDA 5E6HA 2XJSA 3PVBB 3EXUA 3WDTA 4PLOA 1JH5A 4RQPB 1RUJ1 4DY3A 5C8CA 5CG8A 4CEWC 1F9KA 3AFGA 4RL7A 1D2SA 3J9SA 5L9VA 4Z8BA 3ZVXA 2KD7A 2Z69A 4XUOA 4K8FA 2PELA 4G3YC 2CWMA 2NMOA 4FPKA 1H1MA 1ZA7A 1NOVA 5APAA 1YQ2A 4CYDA 5JXGA 1CIWA 2XJQA 5FO9B 1WKYA 1G7YA 3VHNA 3BGAA 3KT7A 3IAQA 4N53A 1YWKA 2ZGOA 1WW4A 3DEMA 3LE0A 3IB3A 4UYBA 1RHI2 1XQNA 4QQHA 3ZXJA 1WW5A 2HWD2 4MGSA 1NLRA 1NKGA 3CIHA 2MEV3 3MIEA 4XIKA 2GMMA 4ZS2A 1XJAA 4KU8A 1RL3A 2MHFA 4DXSA 4INDA 1V6MA 1PMHX 2A6XA 4XJUA 1PVXA 1X8MA 4XHBA 3R0RA 2JDMA 2YGLA 2B4KA 3S7EA 4RR3B 2DU0A 2P3JA 2RV9A 3VUOA 3WNKA 2Q8DA 2VMGA 2WINB 3LSEA 4ZU5A 5H9PA 3HT2A 4CSWA 5JR7B 1SLBA 3VZKA 3LA7A 1D0GA 1GOFA 1W8OA 4TXWA 4IDZA 3PJYA 3VBSA 1O6UA 3VV1A 3HOBA 4AVVA 4PQ9A 1LOFC 4LHSA 1YNAA 3ME2A 2WFPA 1JI6A 3HT1A 3POFA 1NLQA 1BVP1 2WNVA 1DLCA 5FY0A 2Y6FA 3OY8A 4QPIB 3RYRA 3DPRB 2ZHMA 2ZZQA 1GP5A 1QDOA 2BTVC 2GN7A 3UV9A 5C70A 5KC6A 2A3YA 1Z7S3 3TEXA 1AR72 1GQPA 2ARCA 4R4XA 5LY1A 5K4LA 1CONA 4LBKA 2HYXA 1IPSA 2D43A 1FPN3 1RUH3 1NLSA 4KH9A 1UU4A 2RR11 2VW0A 5L9RA 5C4WC 2XXZA 4AQSA 1P8JA 2WO1A 5A1FA 4YM1A 1MACA 2WLQA 2WZ8A 1WZXA 2XVGA 3PVNA 3JZVA 2R32A 1NUKA 1K12A 5J7MA 2C26A 4BOWA 3VD7A 4BCUA 1MR5A 2O1QA 3DECA 3ZXFA 3FUOA 3MHZA 1GQHA 1C3HA 3Q8CA 1S55A 4UFIA 3MFAA 5A80A 3AJZA 1LOAA 5LBCA 4A7YA 5FXVA 3H8OA 5DZGA 1H4GA 4Y5SA 2XWBB 3CO2A 5F2SA 1W28A 1NE4A 3M1HA 5JIAA 3RDIA 3BOWA 4WM7C 3VZOA 5FZIA 3KF5A 1NCRB 2EA7A 3LWCA 4LBOA 4BJ0A 5F1RA 2IVIB 2JG9C 1NZCA 3K2OA 1GUIA 2GC3A 1F4HA 3B9CA 3LF7A 4YGEA 1PO11 4J1WA 4XW3A 4Q4X3 5BYNA 3ZYBA 4QM9A 3VDDC 1OA3A 1C5IA 4XPVA 1ALYA 3OUHA 3TN93 5A70A 4KL1A 4S2HA 1JTZX 1UOBA 1HQWA 3KGZA 3MUZ1 2PYTA 4YZ2A 4WBBA 1IPJA 1UKRA 4LA3A 5JXHA 4LE4A 2DUQA 2GMEA 2C6SA 2D44A 1ULGA 1EAH2 2Z4FA 3VKOA 4DEVA 3AVRA 1BHGA 3S5QA 4HVRA 2YMZA 2QJVA 5JZGB 4YARA 4IGOA 2BRTA 2W68A 5FUPA 3R4UA 4KWUA 2ZGSA 1PIV2 1REFA 4SBVA 5T3NA 5F5IA 4BA6A 3U0ZA 3VKNA 1SPPB 1OH3A 1NAEA 1YO8A 4XFIA 1B35B 4D94A 1ND2B 2HBTA 2AEZA 2JENA 2W94A 2ZGUA 2BBVA 1W3VA 3C7HA 5DDJ3 1LB2A 1AZDA 1MS8A 1Y43B 4I3PA 4RA0A 3R05A 1OLMA 1UOGA 1OUSA 2LTNA 2MEV2 4COVA 4Q8KA 1C1LA 3NAPC 4OYUA 3PNAA 3VD3A 2DUPA 3GF6A 4Q4W3 1SBFA 4YG3A 2BUKA 2ARXA 4Z2AA 3PIGA 4JQTA 4Y26A 1CAUA 1KDKA 1DGRA 1RUD2 5C3OA 3VBRC 5FKCA 4BYYA 4YW3A 2WAOA 4CP0A 1IZ3A 4PDWA 3ZYPA 2W92A 4K7JA 5FMDA 1E5SA 4IV3B 4AVSA 1GBGA 3CJIB 4LIVA 2FD8A 5FZKA 1ZZ6A 3C3VA 5FJKA 3ILFA 5KXBA 1RUJ3 2CTVA 1DYPA 2D3SA 2FDJA 1GANA 2R061 2XQXA 5HBAA 3RGBA 3VBHA 1ZRFA 2CSGA 5DPNA 3AXDA 4V1PA 1UU6A 1RC6A 3C7EA 1GWMA 2DCJA 4ISQA 1H1IA 4YM3A 2A6VA 4H7MA 2QQIA 1RTVA 2UU8A 2DUOA 3QH7A 1ULDA 2JKXA 4MYEA 4P9XA 4RS5A 5DAPA 4XIOA 3ZDSA 4CUBA 4MGIE 3WZ1A 1AX2A 1FPN2 1RUH2 1HDKA 1PZ8A 4LBQB 3LEMA 3OJBA 4O7XA 3UK9A 1ASJ1 1HIXA 1OURA 3KD4A 2VMDA 3GALA 1WW6A 4DS0A 2R072 2VECA 3O1PA 1W9FA 4NWVA 3NRUA 3FLTA 5CZKA 1YHFA 2FCVA 5JUVA 4Z92B 3ZXKA 3D6EA 1R64A 5CKQA 5ABJC 3T2TA 5FPUA 2WA3A 4IERA 2EXKA 5FREA 3IDEA 4LUKA 4CDWC 1F2NA 3USSA 4M3CB 4HXCA 1COV2 4MOAA 4CA9A 1LU2A 5LWBA 4Q29A 4C90A 3RZJA 1GWKA 1MQTB 2XBO1 4I0AA 3AL6A 5J09A 4GALA 5HCBA 1DDLA 4XAAA 1XE0A 1ZZ7A 5EQUA 1CQ9A 1ONAA 1WMEA 3KMHA 4LOTA 4Q4X2 4V2VA 5FV3A 4AEDB 2AEYA 4Y1YA 3PUHA 5DUVA 3PHMA 1A6CA 5IHRA 3V0BB 3ZFGB 1MVEA 3UT0A 3NL1A 1RXFA 1VBD1 3TN92 1HB2A 1MVQA 3LKJA 2HEYF 3EBRA 1W0NA 3Q8AA 1D4M2 1NQJA 4LQRA 4NPRA 5HV0A 2RR13 5EZWA 1POV1 2X09A 4QM8A 4WVMB 1G8WA 4RFT0 3WR0A 1DP0A 4JV4A 4CU7A 5FZ9A 2YROA 3T30A 3ZSKA 1PMIA 4AG4A 3OEBA 4WM8B 4L2NA 1RUE1 4QDQA 1OBNA 4C91A 5FO8B 2BYVE
chains in the Genus database with same CATH topology
5J48A 3M3EA 1WCKA 1CAWB 5T5OA 1V9U2 4QPIA 3RRDA 3DPRA 5IT6A 2WC2A 2B45X 4M3CE 3IWZA 5DDJ2 3O0XA 3H3ZA 1LOEA 2R0HA 4CTEA 3AP5A 4LBMA 1PO13 4Q4W2 2XVLA 1YRZA 2X5IA 3OGGA 2YDEA 4QGNA 5BXXA 3J8F3 4AXOA 5EYYA 1BJQA 2JG8C 1JOJA 1BVVA 4WZCA 1QU0A 2DCZA 4B4RA 1AL21 4Q4V3 5HXVA 2I07B 1NCRA 1RUJ2 1DGWA 4LO6B 3VBUC 1H4HA 2ZAAA 3JCIA 3SHRA 3M3IA 3VBFB 2NMNA 4DINB 5J37A 4YVWC 3IBMA 4RSUA 2R30A 1AJKA 4LBLA 1GNHA 3QACA 1VBC1 1OKQA 2XUMA 1UAIA 2P37A 1ZREA 1GNZA 4BMBA 3B01A 1XU2A 1Z0HA 2Y38A 4FPJA 4UW4A 4E2QA 1RGSA 3W9AA 5F9TA 3OPZA 3EJKA 2WNUA 3POYA 2V73A 4S2DA 2YYOA 4U2AA 5I0SA 4HZFA 4EWAA 2QZ2A 3MI8A 5JZGA 1IHMA 3AKSA 3S7IA 4CEYC 1VAKA 1O3QA 4YFWA 3SITA 2ZMKA 1VBA2 1ULEA 3WHTA 4LBJA 1JYIA 4XETA 1B35A 4K6BA 3PMEA 1PK6B 1TNRA 4CDQC 4OI2A 2R063 1REDA 3GZTB 5AFEA 4D7YA 3WQ1A 3RI8A 4AI0A 4YVSC 2ZX2A 2E63A 1HRV1 4JGZC 2AGSA 2DWRA 1A8MA 4AK3A 1NYWA 1FNYA 1RIRA 4FPEA 3N4MA 1OPMA 2IXJA 3UKVA 4IV3A 1ASJ3 3CJIA 4I2OA 4YZ3A 1C8NA 5K0UC 2Z2SB 3JD71 1L3JA 1BKZA 2I45A 1H2KA 3SCHA 1EP0A 1H2LA 4BM8A 4K1ZA 2ZKLA 1ZYBA 4YG6A 4AEMA 4IV1C 3WDYA 1KD7A 1XE7A 4HLTA 2ATFA 2FMYA 4FPFA 2HWB1 4LBQA 2WFF1 1H0BA 2XBO3 1I1EA 5ACA2 2MNGA 1PO12 1QQP1 2XGXA 2Q1ZB 3AMHA 3MPPG 3M7AA 4XF4A 2IXHA 4R9BA 1BBT1 5D8AB 1MZEA 1VBD3 3QH6A 3NW4A 3I59B 5CFDC 4CDXB 1RVF2 4AQ2A 4XF1A 1WCDJ 5FPXA 1POV3 4M3CA 1S0CA 2OUHA 3WUCA 1XYPA 3WX5A 2VNOA 2NN8A 1ZRRA 2PHUA 2Q5TA 1J3PA 4AFBA 4TYSA 1RUE3 2LALA 4AEDA 4QGLA 2R041 4D3WA 5DZEA 5BNOB 5L7OA 1ZA4A 2VW1A 1V6NA 1AL0G 3POWA 3THPA 3V0BA 2EXIA 2H6CA 2TNFA 1MS5A 3WW2A 2XG3A 4WM7B 1XYNA 1N1YA 4RHV1 1CESA 3C2UA 1S0DA 4UW6A 4WV8A 5H9QA 1YFYA 1LU1A 3HWJA 4UBGA 1M4WA 4WM8A 4IEQA 1LGCA 1YYNA 2R6QA 3M3CA 1CAWA 3WG1A 2PHLA 3PLQA 1DBNA 4PBPA 3FE5A 4YM2A 2D6OX 2DVGA 4GKYA 1AL23 2W52A 1HV1A 4EJRA 5T5JA 2VXRA 2R062 1O5UA 1VAMA 4B29A 2GNTA 4BLIA 2BVBA 1ZZCA 1CPNA 3WV6A 3LB9A 1VBC3 2Y26A 1FAYA 1AR62 4FP3A 1IKQA 2E6VA 4D7TA 5BNPB 3RSJA 1XNCA 1PGL1 1ASJ2 1OOPC 1RUC1 4F7ZA 4ONUA 4Q4Y2 3WP5A 4WVWA 1Y7BA 2GMPA 2BEOA 4A2UA 4Z07A 1LJ7A 3VBSB 1LHVA 3U4XA 2OUJA 1V6IA 1DQ6A 3JBG1 3FX3A 4GH4B 4FBFA 4XJZA 2JD4A 4IEWA 1A3KA 1DF0A 4IEPA 3WLUA 4AGRA 4DPNA 4AFAA 2WNVB 1POV0 1R082 2DV9A 1H2NA 2NPIA 4AWDA 4FAHA 3AYAA 1J3RA 1S2BA 5KHGA 1QJX2 1V6OA 3EQEA 2ZZJA 4HPKB 3NKGA 2HEVF 2K0GA 1VLNA 5H9SA 4JVAA 3RMYA 5C9AB 1HRV3 2BNOA 1VBD2 1NCQC 2DU1A 1V6JA 3WP6A 2Z5WA 1Y9QA 2ZHLA 4OFGA 2WT0A 5L19A 1AYM1 4JGYC 3FFZA 2WQ4A 1Z7S1 4TZDA 4ITCA 2ES3A 4YM0A 2CYFA 4IEZA 4CEWA 3UKTA 1DU3D 3MIFA 3MF9A 1F5FA 4AI1A 3U11A 5GZEA 3E6DA 4AVBA 2GC2A 1AX0A 1I5ZA 2D6MA 4KWLA 1CN1A 1UW8A 2SLIA 1OD5A 1SBEA 2EXJA 1RMU1 2HWB3 1S0EA 1GZ9A 4HK9A 2WFF3 3WOGA 1OMIA 5DUWA 1QQP3 3VHRA 3S30A 2QVSB 4YGDA 3IDCB 1BBT3 3HQXA 4KU7A 2G9FA 3NV3A 4HFSA 1WLDA 1C4RA 5BY5A 1DZTA 1JBCA 1HLCA 1CAXB 4L8QA 1QH6A 3AMNA 4EN7B 4XHXA 2HKXA 2JEMA 2KA3A 2RHPA 1WLCA 1AL22 3URFA 1U5IA 2ZGLA 4YNIA 1IS4A 3JUUA 4D7SA 4X8PA 2RS11 4AVTA 1DG6A 2R1DA 1T6GC 3MIDA 1FV3A 2ERFA 1ULCA 1Q3EA 4N43C 5D8AA 2ILMA 2DF7A 1CAUB 1SACA 2UYAA 3I59A 4CDXA 4AHWA 1UIJA 4CP2A 4JDOA 3VBOC 1GLHA 4RHV3 5BUVA 3ZXLA 2RE9A 4EV0A 3WP3A 4PDWB 5AC91 3WNXA 5H9RA 5J36A 2UURA 1BZWA 1DIWA 1RUI1 4PJYA 1NA1B 3I8TA 5DUXA 3VBHB 4H3WA 5BNOA 3TNQA 1ZNPA 3B02A 5JLVA 2XB6C 4Q0SA 3B94A 4XZPA 5FOJB 1D0HA 4WM7A 4JTOA 4RS5B 4FPOB 4FPLA 3IT8A 1MZ5A 3POSA 3VZNA 3D0SA 1APNA 5KHHA 2QFEA 3H9AA 2WNEA 1WMDA 4BIFA 3M2MA 2E53A 3R4DB 2EAKA 4XQ4A 1HRV2 2GALA 4FSJA 2Y0OA 1OFNA 1W6OB 4G4FA 1RUC3 3AJYA 1O4TA 4XFHA 4BWOA 4QT6A 2UYBA 2CAVA 3VZMA 2ZX1A 5KHKA 2A6YA 1KITA 3JD72 4J6GA 3BPZA 5KHJA 3JBG3 1REEA 2KXLA 2YZ4A 4LHLA 1S0BA 4I0WB 3ZFEB 5GLVA 2ZBJA 1X82A 2CL2A 5C8WA 1J1LA 3AYCA 5BNPA 3AMQA 4QHBA 2Q1MA 3ENRA 1X50A 3RYKA 3L9JT 5HI0A 2RS33 5GZGA 4UBHA 3ZYGA 5FLJA 1NQDA 4XFCA 1WD4A 1X7NA 2XJRA 4YW5A 5CFCB 3L2YA 3LOIA 3RPQA 1J3QA 2PA7A 1RUF2 5J98B 5LEJA 2OA2A 4BH9A 4GH4A 3NWKA 3OBTA 3VKLA 5JI7A 2RJKA 2G4IA 1AYM3 3ILNA 1ND3C 1CR7A 4AFCA 5AVAA 2D3PA 1YXWA 2VULA 3KLSA 5CA6A 3VKMA 4LT5A 1GZCA 1VAVA 3OBRA 4XJ9A 4Z82A 4HPKA 2R042 1QNYA 4YSFA 1EPWA 5C9AA 4B4PA 3MEPA 3JU9A 4HVQA 2X5IB 5GLUA 1VB4A 4AQ6A 1LKNA 4HN1A 4DY5A 3CJXA 1MEC1 4MXWA 4Y1VA 4RHV2 1RMU3 1H9WA 1VBE1 1QWRA 4AHYA 1LOBA 2RM21 1TE1B 3ZFFB 1F31A 3KT1A 2ZACA 3FLRA 4FOQA 2D40A 1GQGA 3WQ7A 2PHRA 2PFWA 5E88A 5A33B 1O91A 4BLJA 4OI0A 2BGCA 2ZOEB 5KC5A 2E7TA 2JXAA 4Y1XA 5FMOL 4IETA 3J8F1 5LK7B 5L73A 1QF3A 3NJZA 2RS13 4XXAA 1SBDA 1SDWA 4Q4V1 2WNUB 3U10A 1G9AA 1JUIA 2PHTA 5GLTA 2BWCA 5I8TA 1PGL2 1CAXA 1OQEA 2PTMA 5C8CC 2RS53 1H8TC 5FTTC 4YZ4A 1EV11 2XVKA 4U36A 2HEWF 5AC93 5D1IA 2OIIA 1C8M1 2AR6A 1RUI3 5GJ6A 2XL9A 2B39A 4N53C 4AHZA 3J26N 2IFWA 2Q8OA 3WG3A 2RMU1 4WZFA 2BPA2 1J58A 1W0OA 4C1XA 4CDUB 1PGW1 1AR81 4QU2A 2IFRA 1R1A1 1FI2A 3UL2A 4KG8A 3B7MA 1OFSA 1V70A 2XJVA 1LEDA 4ISRA 3EO6A 1NA1A 3M70A 2QE3A 5LK5A 2GH8A 2Z42A 1ZBA1 4M3CF 3KCXA 2DCYA 1G9CA 1WBFA 2VOKA 1QOOA 1AYM2 4AE2A 1PNGA 1IGOA 5IK4A 1Z7S2 1LHUA 4AYUA 2DCTA 4N90A 2R49A 1S0GA 3SMHA 4JRAA 4YVWA 2OW4A 4BE3A 3AP4A 1OLRA 3IIAA 4H55A 1VALA 3SH5A 2ZGNA 1SCRA 4DZGA 3AM2A 3WT3A 4ASMB 1S2KA 1ZBE1 5BNNC 4OUMA 5CNAA 5EJ3A 1W6OA 3CL1A 2D98A 1UZZA 2VMIA 4HKLA 1G9FA 5SV5A 2I2SA 1TNFA 4KGQA 5C33A 3GNEA 1OA4A 1XRUA 4Y24A 3N35A 1SQ4A 1R091 1AR91 3N3HA 3ZSLA 3T1MA 3ZYRA 3WW1A 3KB5A 1CJPA 4CEYA 1OQ1A 1WW7A 3ZFEA 2ZMNA 2UWCA 3HAGA 1K5MC 5L7OB 4QX5A 4FXKB 4AFMA 3O7OA 3AX4A 2BNMA 3ECQA 2XPJA 2GU9A 1YJKA 1DZQA 1HV0A 3I54A 4QPYA 2RS12 3RJRA 2VUJA 2EALA 3V64A 5CFCA 1CD3G 1UIKA 1N3OA 3WCSA 1W2UA 3QCWA 1C5HA 1V6LA 4SLIA 4N9HA 4JGZA 5I8SA 4C1WA 1FV2A 1MEC3 2HJIA 3ST7A 2VY0A 5LRRA 4FTEA 1VBE3 4XJWA 5AC92 2PAKA 2RM23 1C57A 3I2DA 3AMPA 3ZYIB 1ULFA 1RUI2 4CRQA 5K9YA 3AP7A 2B7YA 2IZWA 3CNAA 3VL8A 2BFUS 3I7DA 4QPGB 4EN9B 2WIIB 4M0NA 5JIUA 4A7ZA 4AW7A 5GKAC 4WVVA 4PF5A 3TRSB 1LESA 1HRI1 4IV1A 1X8EA 4OULA 1RUG1 2AREA 5HCAA 2O8OA 5IUQA 3ZPYA 4YW4A 1HX6A 2ZCWA 2QQPA 2GNMA 2VOWA 4R9CA 4PCRA 1FYUA 3ZFFA 5JVVA 4GQ7A 4FCAA 2ZKNA 3S6PA 2CWSA 2WSUA 4XBLA 4B8EA 1FNZA 2DCKA 5A33A 3ES1A 4PLNA 5CFDA 1F5JA 1WD3A 1QJU1 3PVEA 1EV13 1NY71 1VIWB 2NM1A 4DFSA 2WWSA 4QD2A 3ZN6B 1B09A 1C8M3 2XHKA 4Q0QA 5J3UA 4A7KA 4NHLA 2CV6A 2B9UA 3WW4A 2QDRA 2CGPA 2P34A 5DZFA 2CNAA 1YIFA 5FAXA 4GIQA 2YHJA 1PVC3 2HWF1 1PM7A 3KSCA 1QNWA 4LO4B 4DNYA 2RMU3 3AXEA 5DG1A 2BFUL 4RQPC 3NV4A 1MS3A 1QDCA 1AR83 1R1A3 4W6WA 3WG2A 1S0JA 4MVTA 3WINE 4J1XA 3GHNA 2HWE1 5I93A 5DG2A 2JJ6A 2B8MA 1LHWA 4CEWB 2C1FA 2ZABA 3APBA 1PZ9A 1BYHA 3J4UH 1ZBA3 3OYWB 4Q27A 3ZXGA 2WSVA 4XQDA 1DGWX 4O9GA 3VHOA 4TLFA 4O9EA 1VRH1 3SCGA 2TBVA 2D6LX 3P3NA 4YZ1A 3TNPB 1F8VA 1BMV1 4CDUA 1O7FA 1YFWA 5KXDA 2W39A 1AYN1 4OZXA 4URTA 1Q8PA 1WCSA 2RR12 4FXGB 3AYEA 1I9RA 4LO7A 4RR3C 3RQ0A 1FATA 2PLV1 3SLIA 5T50A 4IEUA 4Q8LA 3WD5A 4BQ1A 5JSOA 1ZBE3 2I74A 1QOSA 3HD8B 3SH4A 3N7LA 4MX3A 1VBE2 3MDPA 4AI8A 2RM22 2NZ9A 2XKOA 1N1TA 2XJUA 1R093 1AR93 4QGMA 1BEV1 5KHIA 2VVFA 4QPIC 3DPRC 3H7YA 4Y22A 4Q1PA 2D5HA 4E4SA 2GNBA 3JQXA 5AVPA 4YYOA 1W6PA 3W59A 4PIZA 2HWD1 4NO4A 3Q9OA 4P9IA 3ZYJB 3J8F2 5LRSA 4Q26A 1EYBA 1CX4A 2GSYA 2JECA 3AMMA 4NR1A 2FHRA 4Q4V2 2WQZC 3HMYA 5C4WB 2DVFA 3AZWA 2WA4A 4I30A 1XE8A 4MGYE 3AYDA 4ORFA 4R9DA 2XLAA 3MW4A 3VZLA 4X8NA 2DURA 1NCRC 3IKWA 1D2QA 2JX9A 4HN0A 1Q56A 2GZWA 4P5HA 1EV12 5DXDA 5F6LB 5I8YA 4JGYA 1KDMA 4P9YA 4XXPA 1O3TA 1UX6A 1W39A 1C8M2 1LOGA 1VB2A 3H0OA 5JOXA 3NV1A 1SEFA 2JG9B 1AR71 3ASIA 2XJTA 5TSWA 2RMU2 4P14A 3VDDB 3S0MA 4ZU7A 4AI2A 1HRI3 4EN8B 1H8VA 4I0BA 1RUG3 4X6QB 1PGW2 2XJPA 4GULA 5JZGC 1AR82 3FBMA 1QGLA 1VBB1 4MSVA 1AXZA 1KQRA 4S2FA 4LO8A 2UY8A 5AFBA 1XNBA 2ZGMA 1LHOA 3M3QA 3INAA 4HMZA 1UL9A 4HT1T 3UJOA 1B35C 2WZR1 1ND2C 5KWRA 2C9AA 4QPGA 3WDVA 2ZMLA 2ET1A 4NN0A 3K51A 4K9SA 4XQWA 2VUAA 1QJU3 4FO9A 4I09A 3ES4A 3E5QA 3VHPA 4XJAA 1WBLA 4GB31 2A3XA 5FO7B 1OSGA 2A73B 5A3MA 4AI3A 3KGLA 4MV2A 4JC1A 1XU1A 1OHFA 1TQ5A 2HWF3 3NAPB 4HKOA 1GV9A 4IV3C 4JTNA 3THTA 3CJIC 3RS6A 3TOJA 1ZBE2 1VR3A 3G6JB 1EAH1 4DRRA 4GMP1 1LENA 4JAAA 3VBRB 3VBOA 2GNDA 1Z78A 2A6ZA 3DKWA 3MLLA 3ZN6A 2E7QA 4EWEA 4AVAA 1CAVB 2CY6A 1R092 1AR92 4RGAA 1PIV1 4Q2FA 2HWE3 2RS31 2XBO2 4LE3A 1DFQA 3RJ2X 4JCKA 2F6BA 3RMXA 3E6CC 4F83A 2HWC1 3SXWA 3M4FA 1Q8VA 2B5HA 4IEYA 2EVXA 1VRH3 4AHXA 4XBNA 1KJLA 1WA4A 3CF6E 5T5PA 1H2MA 3VN4A 4MXWB 4XFFA 4G9SB 3ZIXA 1AYN3 4XTMA 3SNMA 1Q5OA 4L92A 3JB4C 1RUD1 1RB8G 3AK0A 1CJDA 2Z79A 3N36A 2PLV3 3A0NA 2WKKA 1WUVA 2XH6A 3ZSMA 1RUE2 5EFUA 3OYWA 1MQTC 3IN9A 1TEIA 5ABJB 1NXD1 1U0AA 3V56A 3CU7A 4NOTA 1LEMA 4AEDC 4CDWB 5I0TA 4GA9A 5BPXA 1O3RA 4JDMA 3ZMNA 3NSTA 1BEV3 3OGJA 3ZFGC 1ZRDA 1Q43A 4OHWA 2E51A 2D7FA 3O5SA 1DHKB 2X8KA 5I0UA 1FX5A 3FUQA 5KXCA 1DQ2A 2D3RA 1SFNA 3AKPA 2VVDA 1LOCA 1QMJA 3V0AB 2HWD3 4FP2A 1HRI2 5K7PA 4MUVA 1H1AA 1RUG2 3ILRA 1TME1 4R52A 3ZXDA 3A4UA 3GBWA 2A71A 4GXLA 3FHIB 1YI7A 2EF6A 4FQ4A 3WY6A 4C0BA 1W6MB 4Z1VA 4KWKA 3FJSA 4LO5B 1QJY1 5SV8A 3IM0A 1LOFA 2HYKA 3WCRA 3ZXEA 5E1RA 4GWMA 3TB0A 1COV1 2VW2A 1VBC2 2WJSA 3AKTA 3N7MA 1NY72 1YIPA 2BVVA 4B7EA 1ND3A 3AZZA 1N1SA 4E2GA 1UPSA 2XLFA 1YJLA 4TSVA 4BZ4A 2RS51 2GDFA 4FTSA 1H30A 4NHKA 1QOTA 1SLAA 1GZWA 3X29B 5KBFA 5C4WA 1IPKA 1AR73 2HWF2 4LEJA 3E6BA 4M01A 1FOD1 1D4M1 1UF2C 4JDNA 4XE9A 3IPVA 4FQZA 2EXHA 3VKFC 1DZRA 5L36A 1URXA 5A32B 3UKNA 4XFBA 3VBFC 2EAAA 1VBB3 5GLZA 2JG8B 5C6CA 3B9IA 1KS4A 4META 3KCCA 2B42B 4H7LA 2HWE2 3VBUB 1V9U1 3D8CA 4XEZA 3VL9A 5I91A 2WZR3 3DL3A 1MZFA 2JG9A 4XBQA 4K3UA 4YVWB 5KXEA 4Q0VA 4YFZA 1ZVFA 3ACLA 4FTBA 1YLLA 1VRH2 3VDDA 5JWPA 3BIWE 1EY2A 2W0XA 4GB33 4E27A 1RINA 3WDUA 2PHFA 4P9GA 1LRHA 1J1TA 3SCFA 4FT8A 1PK6C 1SLIA 3BU7A 4L99A 4DMIA 4L97A 5FCCA 5IK8A 2XWJB 4K1YA 2XL7A 3TYJA 4CEYB 1EAH3 4GMP3 4QQLA 4Y1ZA 1H8TA 2DVBA 3FZ3A 3AB0A 1ENSA 2Q4SA 3LA3A 1RJ7A 1UN1A 1BEV2 1PIV3 2HWB2 4KG0A 1N1VA 2P17A 4IEXA 5GM0A 2WFF2 2B46X 2VNRA 1CGPA 5CIRA 1N3PA 4CDQB 3DV8A 1QQP2 2P2KA 2ZPXA 1SFYA 5BV6A 2HWC3 2D97A 5E16A 2FQPA 3NAPA 4Q0UA 4MGKE 4YVSB 1BBT2 4A3XA 4MLOA 4JGZB 1O4YA 2UY9A 3ETQA 5FMOS 4ZKTB 2V09A 3VBRA 2IXLA 4E2SA 4LA2A 2D6NA 4YW1A 4XMIA 3VGIA 1CAVA 4DOUA 1RUD3 1G9DA 1VBA1 1JHNA 4LTAA 4R9AA 3ZN4A 5K0UB 3MGUA 2VU9A 1LODA 3RZZA 2A70A 2AENA 3EHKA 4BHPA 2VNGA 1YCIA 1IQAA 3E5XA 2AUYA 3I4IA 2IWGB 2C5DA 5FQ0A 2X53S 4HSJA 4KQ7A 4TWTA 5JSPA 3AKRA 3BOPA 3NO8A 2CAUA 3HBZA 4PQ9A 4IV1B 5D8AC 2ZX3A 3H1MA 4AQTA 4OHYA 4HETA 4FPGA