2OA2A

Crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
VTDHGPRPFVVNIEDETKRNRAFRRALWTGDHLQVTLMSIQVGEDIGLEIHPHLDQFLRVEEGRGLVQMGHRQDNLHFQEEVFDDYAILIPAGTWHNVRNTGNRPLKLYSIYAPPQHPHGTVHETKAIAMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of BH2720 (10175341) from Bacillus halodurans at 1.41 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
molecule keywords BH2720 protein
total genus 29
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oa2A01
4EWEA 4I2OA 1U12A 4QGNA 2IC1A 2UY9A 4IEZA 3LA7A 2XLFA 2XHKA 1O4TA 2DCTA 4FAHA 5JCTA 3L2HA 4IEWA 3RZZA 4MH0E 1SFNA 3HIFA 1ZRCA 4GULA 3VHRA 4YYOA 3LA2A 2OPKA 1GQGA 4XF0A 4FAGA 4LTAA 1X8MA 1ZZ6A 2UYAA 2ET1A 1O5UA 3BCWA 2BNNA 3PLQA 3U11A 4OLLA 4D7SA 2PAMA 5LRRA 3BPZA 4O9EA 1O5LA 4XF9A 3UKVA 4BHPA 2Z2SB 4B29A 1QXRA 2C0ZA 3MDPA 2OA2A 5I0TA 1OI6A 1RC6A 3KCCA 1EYBA 2Q30A 1ZZCA 4MZUA 1EPZA 4Z82A 1UD1A 1Y3TA 4I3PA 3H7JA 2XL9A 2BGCA 1O3SA 5FLHA 4L2NA 3ETQA 2UY8A 5BPXA 3DKWA 3R6SA 4H7LA 5J3UA 1IPJA 5BUVA 4HN0A 1CX4A 4EV0A 3D0JA 5AVPA 3UKTA 3HT1A 1J3RA 4KU7A 4P9GA 3LWCA 3U0ZA 2K9ZA 4UBGA 3I7DA 3CJXA 3NJZA 4BIFA 3I59B 1TQ5A 4I01A 4I02A 4BYYA 5C6CA 1ZRDA 4IETA 3B02A 4LULA 4KWKA 2VQAA 4LA3A 5KHJA 5I8SA 4ORFA 3E5UA 2H6CA 3LOIA 5LEKA 1DGRA 5E1RA 4XFFA 2ET7A 4QGLA 1V70A 1VJ2A 3E5XA 3RYRA 2XGXA 3FHIB 1CAUB 2PAKA 3GYDA 5FPXA 4QM9A 2B8MA 1X82A 3QOPA 2XL7A 3EBRA 3FZ3A 5I0UA 3MZHA 3H9AA 3DL3A 3OCPA 1J3PA 4FBFA 2CAUA 1Q43A 2FQPA 5E16A 5LRSA 3CF6E 1LKNA 3WW1A 4X6RB 2MHFA 5FLIA 3HT2A 1VR3A 5BV6A 1ZRFA 3EQEA 2VPVA 4FT8A 5FCCA 1YHFA 2EVXA 4IESA 4YNIA 4IEUA 4WVZA 2IXCA 4XETA 3TNQA 3S0MA 3FE5A 4ZU7A 1O3QA 4R52A 4IEYA 2EAAA 3M3IA 3N4MA 2PAEA 3DN7A 4HVOA 4AVCA 4EWAA 4K8FA 1EP0A 4HVQA 2HKXA 1OFNA 1RTVA 1SEFA 1CAVB 2OYZA 3LAGA 1J58A 1J3QA 2BNOA 2OZ6A 2E9QA 1O3RA 1LB2A 1X7NA 4HSLA 1YFUA 2PYTA 5J7MA 5JSRA 1GQHA 4MUVA 3I54A 4UXAA 1ZZBA 3EJKA 1ZZ9A 4Q0UA 2P17A 4HN1A 2BEOA 3CO2A 1CAXA 3EHKA 2Q4SA 3G7DA 3LA3A 2XLAA 3CL1A 3H1YA 3H3UA 1DZRA 3IDCB 3IWZA 1PM7A 3RDIA 4I0BA 4PIZA 3FFQA 3IDBB 1YUDA 5HI0A 4Q0PA 2PA7A 2GH2A 2PHDA 1SQ4A 4HLTA 4A2UA 5D1IA 4UBHA 2D5FA 4J1WA 4QXKA 4WZCA 4MGZE 2I45A 3OTFA 5I93A 1RUNA 5F1RA 3WW4A 4AVAA 4F8AA 3NSTA 4MGIE 1H1IA 4X6QB 5I8TA 2B9UA 1ZRRA 5FQ0A 2IXHA 5C8WA 1XE8A 2XLGA 4BH9A 4XF4A 2GC2A 5CADA 1NXMA 4E2GA 4IEOA 3ES1A 4O9GA 3ACLA 4QGMA 4EWDA 1YLLA 3D0SA 5KHIA 4D7TA 1VP6A 1CAWA 5I0RA 4I0AA 4EROA 1UIJA 3EO6A 3H3ZA 3E6BA 1YFWA 2ATFA 2XKOA 1RUOA 4J1XA 1ZX5A 3FX3A 5EFUA 5CU1A 3USSA 4XFHA 4HVRA 2Q0AA 1X8EA 3MPBA 1LR5A 3NVCA 2B5HA 2IXKA 2Q1ZB 4HBNA 4XFIA 4HMZA 3PNAA 3SHRA 3BB6A 5JAXA 4NVPA 4XF3A 4HSJA 4XEZA 4META 1UIKA 4L11A 2GC0A 5EZWA 1FXZA 3H8UA 3BALA 4XF1A 2H6BA 1CAUA 3KGLA 4OFGA 3JZVA 4E2QA 5I0SA 3UKNA 3WW3A 2BYVE 3BU7A 3SCFA 2Y0OA 2N7GA 1O7FA 2GAUA 2PFWA 1ZVFA 4QMAA 1Q3EA 2O1QA 3H50A 1RGSA 3ZDSA 3HQXA 5KBFA 4MV2A 2QJVA 1UPIA 3FWEA 3OD0A 2QNKA 4KU8A 1PMIA 4LA2A 2IXLA 4AXOA 1QWRA 2K0GA 1Q5OA 4WBBA 2MNGA 3FJSA 1FT9A 4LUMA 4JVAA 2BNMA 1G6NA 2VECA 3RYPA 1I5ZA 3KSCA 2IXIA 3GBFA 4XFGA 4AQ6A 2HJIA 5BXXA 2GU9A 2CV6A 1Y9QA 4XFBA 3NKTA 3KMHA 3RYKA 3SMHA 2Z69A 4TLFA 4LUKA 3SXWA 1ZREA 1XRUA 1WLTA 4Q0SA 1CAXB 2V09A 4KL1A 4YARA 2GC3A 2CAVA 1H1MA 3I59A 5KHHA 5KHKA 2OZJA 1OD5A 4JV4A 4KWLA 4PJYA 3OF1A 4I09A 2FMYA 4PIXA 2PQQA 1XE7A 4LLOA 5T3NA 1J59A 4R8HA 1QY4A 2GZWA 3NW4A 3PVBB 4QM8A 1UW8A 5I8YA 5K8SA 3M70A 1IPKA 4Q0QA 1NYWA 3S7IA 2UYBA 4ZU4A 1J1LA 1LRHA 1I6XA 3S7EA 3H7YA 3QACA 1NE4A 3DV8A 5JSPA 2PHLA 3O14A 1ZZ7A 2ZCWA 3C3VA 3IIAA 4E2SA 5BY5A 4YRDA 2IXJA 1HW5A 2KXLA 1WA4A 4N9IA 1UCXA 1YFXA 4MGYE 1FI2A 4RD7A 4PIYA 5LEJA 4DINB 3KGZA 3IBMA 1JUHA 1L3JA 1O3TA 5J48A 3SCGA 5FDBA 3ST7A 2D93A 4ONUA 1CAWB 2D5HA 4MX3A 3RNSA 4F7ZA 4IERA 3TNPB 2ZKLA 4Z07A 4LEJA 2CGPA 4AQ2A 2QDRA 4IEVA 1OMIA 3ELNA 4IEXA 1QXJA 1CGPA 4ZU5A 3E6CC 1EY2A 5JSOA 3H1MA 2F4PA 3D82A 2H0VA 4CYDA 3E6DA 1YFYA 1DZTA 2WFPA 5KHGA 4Q0VA 2QVSB 2D40A 4JTOA 3ES4A 2QCSB 4MGKE 3CEWA 5FPZA 1CAVA 3SCHA 3U10A 5I91A 5CVRA 4QX5A 5JR7B 4IEPA 1RL3A 3LZZA 1NZCA 3MYXA 4IEQA 1YWKA 3E5QA 4XFCA 3E97A 2ETEA 2EA7A 2O8QA 3NL1A 4YSFA 1WGPA 3OGJA 3CLPA 2GC1A 4JTNA 1NE6A 2PTMA 4N9HA 2MPFA 4KWJA 2WC2A 1DGWA 1ZNPA 4XFAA 4AVBA 3RPQA 5FLJA 3WW2A 1ZZ8A 4Q29A 4HZFA 3H1WA 3ROUA 5FQ0B 2XKPA
chains in the Genus database with same CATH superfamily
4EWEA 1EV11 2TBVA 4QGNA 3CHXA 1JXNA 4XUPA 1RVF3 3I4IA 1LHOA 2CNAA 5JPNB 2JDKA 5JZGB 3LA7A 3MV11 2VY0A 3W58A 4AQ2A 1V9U2 1Q8PA 3V56A 3O7OA 1A34A 2J1VA 5JCTA 5JXGA 4IEWA 1UX7A 1UZ0A 2HWB2 1W3VA 1RUD2 2VMEA 5HCBA 1UL9A 3SEPA 3K2OA 3TBDA 1GR3A 1FATA 1ZRCA 3ZYGA 4COVA 1JH5A 1VBD3 3M3OA 4JKMA 4QB2A 4TSVA 3FLPA 2VUCA 4LTAA 4PF1A 1RUI1 1S0FA 4AFCA 4AEDA 4AI3A 4Y1ZA 1C4RA 5A3OA 2J1RA 1QJFA 1A8MA 4YW7A 4QAWA 3ZXLA 4EE2A 3JB8A 5FZFA 3U11A 4OLLA 5K9YA 2PAMA 1REDA 3KHBA 4SLIA 3UKVA 4BHPA 1NCRA 3K4AA 3KZ4C 3QLQA 4OUMA 4TTGA 4K8RB 4AFBA 4K6BA 5IUQA 2J1SA 4BCUA 1R1A3 1MS4A 3IIIA 3LF7A 3MDPA 4LBLA 4AI0A 1C1LA 3TEWA 2RHPA 5KC6A 1OI6A 1EYBA 2W08A 4B7KA 3UGFA 1KFXL 4AE2A 1ZBE3 4JGYA 4AOCA 3B9CA 1TMF3 4MZUA 5ACA2 1EPZA 1H0BA 4CA9A 3O1OA 3MIGA 3NV2A 3NQHA 1IS5A 5ABJB 3LB9A 4I3PA 1STMA 2XL9A 3NAPA 2OUHA 2YBPA 1LHVA 1KS4A 3DKQA 3DXUA 3PUAA 2JDNA 3D6EA 4Q4Y2 1O3SA 3ETQA 5JOXA 1M06G 3DKWA 4XILA 1PGSA 1H2LA 1MQTB 3LSDA 4IL7A 4AHYA 1F5JA 2Y6LA 5T5PA 3UNPA 4GH4B 1ZBE1 1VPHA 1IPJA 2ZGOA 3RZHA 1PZ8A 1GZ9A 2XJQA 4YG6A 4A6SA 1ZM1A 3D0JA 4NIDA 4CDQA 5HCHA 1UZZA 2B4KA 2P4EA 4RA0A 1R64A 2KD7A 4NROA 5FZ0A 1C8M3 1SLLA 3LWCA 4JQRA 5KXEA 1HB2A 4UBGA 2PELA 1QJEA 2JG9A 3I7DA 5A6QA 3W20A 4AHZA 1S55A 3I2KA 3NJZA 4EN9B 3SH5A 4MHUA 3HWJA 1D2QA 5JOWA 4BYYA 1ZRDA 4IETA 3B02A 3CQOA 3J8F2 5FAXA 1L7RA 3MIDA 1PIV1 1CJDA 2LTNA 1ULPA 2CYFA 4MSVA 1GP6A 4LBMA 1ENRA 1LEDA 1JZ8A 3BTYA 2WQZC 5E1RA 1ZBE2 4Y1UA 3U07A 1TNFA 3URFA 4XFFA 1B35C 2DTWA 1UAIA 5IVBA 4JQTA 2VTFA 2RS53 2X5IA 5GJ6A 4AFDA 3E5XA 2R6QA 3RYRA 4BQ2A 4AVTA 2V4AA 3N35A 2V5DA 4XABA 3GYDA 4XMAA 2AH2A 1XYNA 1YQ2A 2WS91 2XVLA 2XL7A 5FO7B 1MVEA 2BJSA 1VBB1 1DGWX 4XZUG 1J3PA 3AKPA 3APBA 5FUIA 2D6MA 4YW1A 1W8TA 1RYYA 3LPFA 2HWC1 3DPRA 1FNYA 1UZYA 2MHFA 2ZKNA 3GXUA 5FLIA 2P5BA 2VZ1A 1UY1A 1VR3A 3FN9A 4UOJA 4GKYA 5BV6A 2ADEA 4LBNA 5FZAA 2ZGQA 1HN1A 2JJ6A 4QX2A 3EQEA 4YW3A 4DFSA 1NCQC 2D7FA 2ORXA 2WWJA 2XJPA 1S0CA 1GOFA 2X29A 4BPZA 4YNIA 1ULGA 4IEUA 2JG9C 5IVFA 4OHXA 4JZRA 4NPMA 4DPNA 4QHOA 3FE5A 3JQWA 3VKOA 4ZU7A 1Y43B 1QQP2 5FZ1A 1UY3A 2CU5A 3VD4A 1UY4A 1W39A 2XJRA 4FPFA 2YV8A 4N43A 3B00A 1O6UA 4JRLA 2DUOA 4C1XA 4ZKTB 4PLNA 3THCA 1BKZA 2ORZA 1X50A 1W2AX 4QDRA 4MXWA 1XNTA 5GLVA 1SEFA 4OULA 2VG9A 2E33A 2AUYA 4K7JA 2DFBA 4QPIB 1W9SA 1J58A 1U5IA 4GJYA 3AFGA 4XBLA 2E9QA 2NLRA 4YVWB 3HN3A 3KLSA 2PXJA 3ZFEC 4NPLA 5HPOA 4PF5A 5FZHA 3VBFC 1I5PA 1YI9A 2W47A 4CUBA 1PK6B 4FPHA 5ISLA 3BODA 3I2OA 5FZ6A 2B39A 1HRI2 2ERFA 3ZN6B 3POJA 2RS11 5A7OA 1GOHA 3ZX7A 5GZCA 4XZPA 4BE3A 1CZTA 2ZGUA 2A6VA 1VBA3 4LE3A 3LA3A 2XLAA 3H1YA 1QJX2 4ET7A 3K51A 3U75A 2ZMLA 3ZFGA 5JWPA 1PM7A 1N1VA 1DLLA 1F35A 2VOTA 3P3PA 1PM4A 2C26A 4I0BA 4CDXC 3FFQA 1AVBA 4HL0A 4DEQA 2HLEA 5A70A 3GHMA 4WM8A 2Y6KA 4Y1VA 4XXPA 1FMD3 1UU5A 2XH6A 2PLV1 3A0NA 1R081 2PHDA 3NNLA 4EN8B 1VB4A 2QQJA 5D1IA 2GP3A 4A2UA 4PHZA 3GBGA 3UT0A 4PBOA 1CPMA 4QXKA 2P3JA 4WZCA 4MGZE 2I45A 3OTFA 1RUNA 1JOPA 1W6NB 1XNCA 4MVTA 3AXDA 3WW4A 4AG4A 2A7AA 3A4UA 3J9SA 1H1IA 2VCMA 1C5HA 3USUA 3AJZA 2R1BA 5FZ3A 1ZRRA 1GWLA 1RUF1 3WQBA 4CP1A 1OLQA 4YVSA 3IAQA 4XF4A 2CTVA 3KS7A 2GC2A 2W94A 5CADA 1K42A 2VMCA 1HXS3 4XTPA 3RZKA 1A6CA 2A75A 1GWMA 5FMOL 2Y33A 2Z42A 1NAEA 4NOTA 4QGMA 1XC6A 5CBLA 4KGGA 2JKBA 3ZXDA 2X09A 1COV1 2ZEYA 2XPJA 3O1TA 1ND2B 3D5OA 4EROA 3I3DA 5BNQA 1XYPA 2D3PA 3E6BA 4BQWA 3WQ0A 3PUHA 4Q5OA 4QX3A 4DUWA 1W05A 5LZ6A 1YFWA 2DCZA 2XVKA 5FO8B 4J1XA 1SMVA 5EFUA 4EZHA 3B69A 5EIYB 1OPMA 2Q0AA 4NHLA 4DXTA 5C3QA 3AZZA 4AR2A 3ZDVA 1IS6A 4UFJA 1LR5A 3NVCA 2B5HA 2IVJA 3ILRA 3OUHA 5A33A 2GH8A 5CISA 1RB8G 4XFIA 1RUF2 1CVNA 2VZRA 1RJ7A 3SHRA 1UPSA 5JAXA 1ASJ1 4YGEA 1NZIA 1URXA 2W1SA 4YZ5A 3I2GA 4XJAA 3N36A 1SCSA 5L73A 3WDXA 4MGTA 4WVVA 4G9SB 2V5YA 1VBE3 2GC0A 3H8UA 1F15A 5A7WB 3WHTA 2BBVA 3SLIA 3JB4C 1AXKA 2PLV2 3H3LA 4GA9A 2ENRA 4OI1A 1ULOA 3WINE 2JDAA 4E2QA 1XSQA 4QXCA 5DMYA 5HCAA 3MIBA 3UKNA 3B94A 1CESA 1C8M2 2EICA 5FKCA 2Y0OA 5FPBA 5FOJB 2OQ7A 1CD3G 1OKQA 5BNNA 1V0AA 1Y9GA 2QFEA 1KITA 2RR11 1AR81 3IPVB 3UV9A 1MEC3 1H9PA 2DF7A 3NAPC 2OW4A 2FCVA 5FMBA 1Q3EA 2HWD1 2O1QA 3H50A 4DIQA 3ZDSA 4L97A 2Y0IA 3KVAA 1PGW1 3LPGA 3HQXA 5CKMA 1D4M1 5FZGA 1QH6A 2ZEXA 3AYAA 3OD0A 5LY1A 1H2KA 4XVHA 5FYTA 1UZWA 5FIXA 1LOFC 2HWD2 4U2AA 4YVWA 1QWRA 2WKKA 1CPNA 2PQSA 5FTTC 1FT9A 2RM21 4LUMA 3GBFA 3JD72 1PNGA 1WKYA 3I2IA 4XFGA 5FRAA 2IVIB 2YYOA 4CCLA 4BMEA 4UW5A 1FOD3 2HJIA 3R4SA 1Y9QA 4N43B 1JYNA 1YQCA 5GLTA 4N90A 1CZVA 3HJRA 1DF0A 4CDUB 1H6XA 1QQP1 3RG0A 3GJAA 4XQDA 4Y4RA 1C57A 3ZPOA 1HJGA 1AR73 4DMIA 4LK7A 1XRUA 1QH7A 3LFIA 4OQ9A 5DN2A 1CAXB 5J36A 2UWBA 4JGZA 4K3UA 4L99A 1QDOA 3TEYA 1XNKA 1XOYA 2WZ8A 1H8TC 1WA6X 3IT8A 1H1MA 4RQPC 1RINA 3A7QA 3ABZA 4M4RA 2A3XA 4YZ2A 2OZJA 3CIHA 3OF1A 5A3UA 2FMYA 3WUCA 1OKOA 3G6JB 2PQQA 1UY2A 2EXIA 3VDCA 1H1AA 5DUVA 3WF0A 1J59A 5J96B 3ITQA 3VZKA 5IAXA 3POSA 2IUWA 1QY4A 4ATEA 5I8YA 3CNAA 2VXRA 3M70A 4YVWC 4EN0A 1ND2A 4Q0QA 1G86A 3AKSA 1SLIA 1QJY1 4ZU4A 3S7EA 1P8JA 2L9LA 3H7YA 3JBG1 4MGSA 5GLUA 3UJOA 4AI2A 1EUTA 2EXHA 4AEDC 2XWBB 4XAEA 1QQP3 5FXVA 1EPWA 3IAPA 3ZSLA 1NE4A 3DV8A 3LIHA 4DQAA 1ZZ7A 1PO13 1JMUB 1RUH3 3IIAA 4CP0A 1RMU3 3HPNA 3M8LA 5FYZA 4YVSB 1NCRC 2DU0A 1XB9A 1VAMA 3NJXA 5K0UA 4BA6A 2VBDA 5FOBB 1WA4A 2R49A 5JIAA 3BIWE 5F2SA 3TYJA 3ACIA 1I3HA 3WF3A 2A71A 4JKKA 4RD7A 1H4HA 1W9FA 3I49A 1UOFA 4C91A 1XPWA 2E31A 1WCKA 4UI9L 1OD3A 2RG4A 4U36A 3KGZA 3PUSA 4LO5B 3IBMA 3RMXA 2WDBA 3ZYBA 2GN3A 3HBKA 4GB32 4XACA 4C8DA 4URTA 1W9WA 5J48A 3SCGA 2HBUA 4E4ZA 2Q1MA 3ST7A 2RVAA 2GNMA 1TVGA 4IW3A 5D8AA 4ONUA 3ILNA 1CAWB 4MX3A 3RNSA 4CEYB 4F7ZA 2VNRA 5CZKA 3Q8CA 3KT7A 4A3XA 4C0HA 4DZGA 4LEJA 1Z78A 3CBNA 3OGRA 4JRAA 1DHKB 1J83A 1OMIA 2R32A 4Y5Z0 3VZMA 4G4FA 4IEXA 1X33A 4QXHA 3EXUA 3RI9A 4CCJA 5L36A 3OY8B 1NOVA 3ZFEB 3AMQA 1BVVA 2JIGA 5GALA 5FZ9A 4YZ1A 4ASKA 4WVMB 1Q8QA 3DEMA 1BBT2 4BM8A 1KXGA 2F4PA 2XJTA 3MIEA 1PIV3 3N3HA 4CCCA 5M0TA 2WFPA 4AI1A 1WCSA 2DYCA 4M00A 4JTOA 4QKBA 3HNMA 3H8OA 5FXXA 1HV1A 2VNGA 4IV1B 5CNAA 2RS31 4AGVA 4EN6B 4NHMA 3PIGA 5I91A 1Y9MA 4GKXA 5JR7B 1AR63 2WZR2 5AFEA 1NZCA 1W6QB 3VV1A 2GP5A 1W9YA 4XMIA 4UFKA 1W0NA 2BWCA 3E5QA 5AC93 1IOAA 4AEDB 2HBTA 5EXOA 5DUXA 1GWKA 4RHV2 4W6WA 1JHJA 4YSFA 3AVRA 2JB8A 4LJHA 5F3IA 4MYEA 4P9LA 1DP0A 4HANA 4IE7A 1NE6A 3LE0A 4N9HA 3W5NA 4FQ4A 2MPFA 5E89A 3KB5A 3OEBA 2WC2A 3ON7A 4RR3A 4KBBA 3TN92 4DXSA 1ZNPA 3AMNA 3N7KA 5D8AC 3FFZA 3RPQA 3WG4A 4AFMA 2FDGA 3UETA 4OHWA 2P6HA 2DVAA 2F6BA 2VZ3A 2WT0A 5FWJA 5BNOA 4XIKA 2Z4FA 5FFOC 3RFRA 3DPRB 5CYYA 5K4LA 1U12A 1Z7S3 3O0WA 3VDDC 3ZFEA 3TB0A 2JIJA 3VBFA 2F17A 4ZZ5A 1RMU2 4IEZA 4CPBD 5IK4A 2CSGA 5HXMA 4AW7A 2JG8C 3BU0A 2JDUA 4QKFA 4AEJA 2G9FA 2VZQA 3LCPA 2WT1A 1LOGA 4MH0E 1ULCA 4CEYA 1CIYA 2VTXJ 4LKFA 3WSOA 2DV9A 3VHRA 1VBD2 1W6OB 5C5UA 3V64A 1Q8VA 4XF0A 1TEIA 4FAGA 1ZZ6A 2FCTA 3VBHA 5A1AA 1ULFA 2UYAA 1QJU2 1O5UA 5J09A 5JIUA 2EIBA 3PLQA 3PJQA 2Q1FA 3J8F1 1AXYA 1O59A 5LRRA 3BPZA 2A1XA 5ERLA 2ZTNA 3OYWB 4H3WA 4KH9A 5FWEA 2VQUA 3TAYA 3VHPA 4XUQA 5T5OA 4B29A 1YYNA 4CU8A 4OMCA 3WP6A 1VMHA 2D6OX 3DYOA 5ANQA 1F5FA 3OPWA 4URAA 2W9XA 4GWJA 2ZJCA 3PUQA 5F3GA 4FOQA 5B2GB 1VBA1 1RITA 2GNTA 4YM0A 1RC6A 2P6CA 2NPIA 2YFUA 4L92A 1YQ8A 2W1QA 1NQDA 2RS13 5EJ1B 4Z82A 5IVCA 5F7UA 4W6YA 1E57A 2P3YA 4GWNA 3H7JA 2RDNA 1OH4A 5C8CA 5FLHA 3JBG2 2E7QA 2UY8A 1AYN3 5BPXA 3UESA 3H8XA 5F6KA 3T2PA 4H55A 5F8PA 4B3NA 3R6SA 3S6PA 5DZGA 5IW0A 2UWAA 4XJWA 3Q8EA 4CXXA 1CX4A 2FHRA 1I9RA 3C2UA 4LPLA 5FZ7A 4EV0A 5AC91 4QQPA 3K75B 3HT1A 3L2YA 4AHWA 3K3OA 1ENXA 3MIFA 4KU7A 1F31A 5FY5A 4ZPIA 1AR61 1N1TA 2WO7A 4QHBA 3SKVA 5C6CA 1SHWB 4RGKA 2ZBJA 2I74A 4QQOA 1MZEA 3WG2A 5I8SA 4M01A 1POV0 4ORFA 3E5UA 1H6YA 2H6CA 3LOIA 1DQ1A 3GZEA 5LEKA 1K5MC 1OH3A 2DURA 1NXD1 2BOIA 1IPSA 2XUEA 1RUD1 1RUG3 1UY0A 3KM5A 2Y6FA 1KJRA 3PMEA 4UT5A 4UW3A 4Y5TA 5CIRA 3VDDB 2XGXA 2YU1A 2EIEA 4PQQA 4DY5A 4QM9A 1GQPA 2X05A 5HCFA 1X82A 5FPUA 1V9U1 4XUTA 5DAVA 2JD4A 3MW4A 4LO8A 4S2FA 2Q8DA 3H9AA 5FPAA 4IE5A 4YGBA 5IVYA 2RM22 3LOBA 2BZDA 4QU1A 1DLCA 2VCAA 2NMOA 4CU9A 2RS51 3CF6E 1GANA 3RJ2X 1JZ6A 2ILMA 1MS3A 1BJQA 2XJUA 5A1LA 1ZRFA 1KJLA 2QQOA 4OYUA 4IUGA 1W2OA 5HXVA 3U78A 2K2SA 2YZ4A 5FY7A 2VVDA 1BLZA 1PMHX 2VMIA 3OJBA 4FT8A 5FCCA 2EVXA 2RS52 4IESA 2JKXA 1F4AA 1ULEA 3TNQA 4WVZA 1U5XA 3MHZA 3T09A 4HPKB 3IPVA 3LDKA 1FMD1 2GMMA 4Y3OA 3FHAA 1IQDC 4R52A 1SCRA 1SG3A 2GALA 2VR4A 4IEYA 4FTBA 1C8M1 3ACGA 2PAEA 2WNOA 3M3IA 3O5SA 4Q2FA 4P9WA 2FD8A 4S2GA 3O12A 2QQWA 2QQLA 4FXKB 1IKQA 3LEGA 3AP6A 4NHXA 3WNXA 4FXGB 5FP8A 1POV1 2E32A 2LUWA 1DIWA 5IVJA 3AZVA 2BNOA 5FYIA 2G9GA 1AYN1 2WRAA 1Q8OA 1X7NA 3WP5A 5JR2A 4FOVA 3ZYJB 1V6KA 1HB1A 3NJYA 4MUVA 4UXAA 2FDIA 1CR7A 4IE0A 4BZ4A 1UU6A 1AUYA 3PTYA 1GV9A 1ZZ9A 1B35B 4BISA 4HN1A 5FYVA 4JKLA 2QQNA 4Q26A 1KFUL 3CO2A 4Q4W1 5IAVA 2Q4SA 3G7DA 4QXBA 3KVBA 3PIJA 5F5QA 5LASA 2VJXA 3H3UA 3M7AA 5APAA 3MUY1 3IWZA 2W92A 3N7MA 4FI9A 3LDRA 3VLBB 4QDQA 1QU0A 4QWNA 3ZYIB 4PIZA 1JYVA 4FFIA 4WM7C 4A41A 5IATA 4CCMA 3DYPA 4BQXA 3IMMA 1DQ2A 1UN1A 2PA7A 2R063 5T5LA 5IYYA 4R4XA 1ULDA 1PX4A 2GH2A 3OD4A 1SQ4A 4HLTA 4HKOA 3T2TA 2WAOA 4UBHA 2FDKA 3ZYPA 1YRZA 3VKNA 2W39A 4FVVA 4E4HA 4IGPA 1GZWA 3N9NA 1EAH2 3NNJA 4K1ZA 1OLRA 4YW4A 2EALA 1R1A2 3NV1A 2EIGA 1JOBA 2WIIB 3NSTA 4QQHA 4RS5B 5H9QA 3ZMNA 2YXSA 2LROA 3AZYA 3BTZA 1QJX3 2AR6A 5LATA 4LBQD 2Y38A 2IXHA 2ZGKA 5C8WA 3K4DA 3WF4A 1LAJA 4BH9A 1PO11 3I97A 2ZGPA 1KS5A 3DGTA 3ZXGA 1V6JA 4BK4A 2QUOA 2EXKA 1DU3D 1N3QA 2PHTA 1UYYA 1YLLA 1MZ6A 3EYPA 4NJ4A 2FMDA 3OPZA 5KHIA 5EHDA 4O65A 1VP6A 5FZDA 3VBHB 3WP3A 2YUEA 4I3GA 3A23A 1OF3A 5DUUA 5FZ4A 5L7OA 1RUD3 2IWGB 2P34A 5I0RA 1WLWA 1ZRIA 1ND3A 2XQRA 3NRUA 1UIJA 3KWVA 5J1XA 4IV1C 3POBA 2ATFA 2OQ6A 2XKOA 4BU2A 3OBRA 4DS0A 1WZXA 3ZMOA 1RUH2 2VUJA 2VBBA 2WO3A 5CU1A 3USSA 4AF9A 1ODMA 1HRI1 3DPRC 3MPBA 4TYSA 1RUJ2 3HD8B 1NKGA 3POFA 2WNUC 4DRRA 1PK6A 2NQYA 1GSLA 1AX2A 1B09A 2AYHA 3BB6A 4OHYA 2QQIA 5DZEA 4LNVA 4HSJA 4YW2A 4CCEA 3V0AA 1AR71 2RV9A 4META 5IWFA 2JG8B 1HRV2 4E2GA 3D4KA 4TLGA 5FMCA 2VVEA 3BALA 2UURA 3NJVA 2D97A 4A3ZA 4RR3B 4Y1YA 1XNBA 2WNUB 4XYXA 3JCIA 5A6XA 3KGLA 3IDAA 3JZVA 1VBC2 2DVFA 2LS6A 1MZ5A 2XBO2 4NO4A 1Z7S2 4YFWA 4CDWB 4N43C 4QX0A 1W03A 4Y20A 4YW5A 3WW3A 5CA6A 2N7GA 2VD7A 4YG3A 1EAH3 3CJIC 5CEHA 1XYOA 3WCSA 5JMOA 1KDKA 1NLQA 4N7UA 4QMAA 1J1TA 2WZR1 3SKJE 4NIGA 3W21A 2AREA 4CU7A 2QQKA 2WYSA 4IV1A 1YJLA 3UGHA 1YIFA 4W6XA 5KBFA 3PURA 3JQXA 1UF2C 4BWOA 2QJVA 4GAZA 1SFPA 3FWEA 4JHZA 2WZR3 1AR92 3SC7X 3DUIA 1AR62 2HWE1 1GU3A 3KV4A 2HWD3 1AJOA 2GN7A 3A22A 3MGUA 3MUZ1 2IXLA 5A3TA 3O1PA 3T1MA 2K0GA 1Q5OA 4WBBA 4WVMA 1W8FA 3WNOA 2CDPA 5LBEA 5BNOC 3FJSA 3K48A 2FZ1A 2YB7A 3FLTA 2BNMA 3VDAA 3VBUB 3B7MA 3RYPA 1O4YA 5DAXA 5FBJA 2WS92 3N9OA 2EIDA 1RUE1 2GMPA 1R083 5F39A 4GH4C 2XUMA 1YNAA 2ZX3A 5BXXA 5FYUA 2PLV3 3KMHA 3RYKA 4RSUA 2C1FA 3VB9A 5CG9A 2BGPA 4TLFA 1HQLA 3QBQA 1VBE1 4AGGA 1WWYA 3WDUA 4UAPA 1ZREA 1JU4A 5B4NA 4Q0SA 3P3NA 1JODA 1SLAA 1SLCA 2V09A 5FZ8A 3AP7A 1W2NA 4W65A 2GC3A 3ILFA 1LOCA 2WO1A 5KHHA 1DYOA 1OSGA 1JZ5A 1HB3A 1T6GC 5KHKA 1WUVA 2X5IC 1OD5A 3AKRA 4CSWA 3AP5A 1PVC1 2BW8A 4LO6B 3C7FA 3AXEA 4MLOA 5HBAA 5FK7A 4D8MA 5A3LA 2P3IA 4GZ9A 3QCWA 4LLOA 3ZM8A 2OIIA 1VBE2 3FL7A 2GZWA 4FPJA 2R0HA 4Q1RA 4QM8A 1UW8A 4LO7A 2EXJA 2Z79A 4A6OA 3S7IA 1GLHA 3MFAA 1OC1A 2K46A 2KR2A 4CE8A 2UYBA 1J1LA 5B4XA 1I6XA 1RJ8A 4EN7B 4Q4Y1 1HRV3 5FZEA 1K5JA 1O8SA 3PU3A 3RQ0A 3VBSC 4JDOA 4N53B 1S0DA 4Z92B 2VOXA 1XNAA 3NNMA 3VBUA 3DYMA 1QF3A 4M0NA 3RRDA 2PHLA 3O14A 4AEMA 3C3VA 1O8PA 4V2WA 4E2SA 1ALYA 1K5MB 1HQWA 1AX1A 4RN5A 3F95A 4YW6A 4ES9A 2D6NA 1O4ZA 2PHXA 3AKTA 4JAAA 4KQ7A 5L19A 2IXJA 4CZSA 3RZLA 1H9WA 2QQMA 4YLZA 4CXWA 1T2XA 3J7HA 2ADDA 1UOJA 1YFXA 4MGYE 4OVEA 5F37A 5ABJC 4GMP0 4N8MA 4XHBA 2FZ2A 4JGZB 3TRSB 5FO9B 2VU9A 1WMEA 1E5SA 5EYXA 4LLFA 3MLKA 2R061 4OCTA 4XDOA 2XJVA 4BDVB 3WF1A 2O14A 4CEWA 4FSJA 4UW6A 4CDUA 2WT2A 1YEWA 5FDBA 2EF6A 2HYXA 3I2HA 4XQWA 4HT1T 4RHV1 5FK8A 4Q4W3 3WDYA 4AYUA 1RXGA 1Z7S1 4K40A 2D3SA 2WS93 1AZDA 1JS9A 1JN2P 1LGCA 2XB6C 2MEV3 4ZXEA 3TNPB 1W28A 2A6ZA 3B01A 3KQRA 4Z07A 1EUUA 2JE9A 3JD71 3K4ZA 4IEVA 1V6MA 1DQ5A 4Y1XA 2ZEZA 3KV5A 2AACA 4QPGA 4W8JA 1BCXA 2RS32 3R05A 1AR72 3TEZA 1WD3A 1EV12 2DU1A 4H7MA 3VBSA 4RFT0 4WM7A 3H1MA 4BJ0A 3D82A 2H0VA 2VBPA 3E6DA 5G04L 3KV9A 5T55A 3LGRA 2XDVA 1XE0A 1JHNA 5D21A 1G9CA 4OI0A 2BFUL 2DFCA 2JWPA 2QVSB 3ACFA 1RUJ1 4GB33 3ES4A 4XHXA 2RJ2A 2WNVB 4LHSA 1QHDA 4KWUA 1C5IA 1POV3 5FPZA 2W2IA 3UK9A 1CAVA 2IZWA 2PHWA 2XWJB 3OY8A 2OUJA 4R9AA 3SCHA 3U10A 2C4XA 2UU8A 5JZGC 2CWSA 5JOYA 1ACCA 5CVRA 3AX4A 1WBLA 3MYXA 2VQ0A 1HJFA 1AR82 4IEQA 1YWKA 1VB2A 3WG1A 4AZZA 2BVVA 1UQXA 3MI8A 5D8AB 2O8QA 3MF9A 3NL1A 2RS33 2ZHMA 1GUIA 4QPWA 3WNPA 1TZOA 2WQ4A 4A45A 1W6PA 1LGNA 1LENA 2YG0A 4GB31 1G9AA 1LECA 1BYHA 1GNYA 2DDUA 4YVSC 4FTEA 4PQ9A 3ZR5A 1NLSA 4KNCA 1UXXX 4SBVA 1S0BA 2YY1A 4IGOA 3VBOB 2WN3A 4AVBA 1DFQA 1PO22 2F4LA 3MW2A 1POQA 3ATGA 4RQPA 3WG3A 4AVVA 1PO12 2VMDA 1VAVA 3N9MA 4NIAA 2OVUA 2Q8CA 1RUC2 1FX5A 3AC0A 3WW2A 1BZWA 3AB0A 5IHRA 4XXAA 5KC5A 1IGOA 1NQJA 2VOWA 3NO8A 1W99A 1ND3C 4PT6A 4XJ9A 3IKWA 5LB6A 1R1A1 1S2KA 1TME2 4B8EA 1QGLA 4IV3B 3WV6A 2UY9A 1NX9A 3B5LB 4X8NA 4PDWC 5A32A 4P5YA 2D6KA 5IVVA 3M2MA 1O4TA 2DCTA 2A3YA 2A5ZA 4Y5SA 1RUF3 5GZDA 3AK0A 5ANNA 1DYPA 1UMHA 4AEKA 4FAHA 3W5MA 4CXYA 4FPEA 1E5HA 1ND2C 2VMFA 4MOAA 1RUG1 2VCCA 1SFNA 1QJY2 5FKBA 3TWIA 4AL9A 5LA1A 4MG2A 1SLTA 1R092 3ZIWA 4GULA 4YYOA 3FUQA 2J1TA 2OPKA 2R30A 4JGZC 1X8MA 3VHNA 3P1IA 5FYYA 2ZABA 4DRVA 1D2SA 2Y6HA 2GMEA 2CGOA 2VNOA 1ZBA2 4TXWA 2QBXA 1FV3A 4D7SA 2J42A 2J1AA 2OT7A 2VW2A 2BV4A 2W46A 4RGAA 5DG1A 1JYTA 5JPMB 1J84A 3POYA 2WNVC 1DZQA 1ODNA 3UGGA 4BLJA 3BN6A 2X53S 3SNMA 1QXRA 1LHNA 3NV3A 1YQ6A 4NRQA 5DZFA 3WT3A 1CIWA 3ZXFA 2C0ZA 5A3MA 1WMFA 1S0EA 3AZWA 3ZYHA 4MO3M 3TN93 5I0TA 1HXS2 3KCCA 5BNNC 5FY8A 3KF3A 1GNZA 1ZZCA 2NM1A 3HR9A 1Y3TA 2XMLA 3KT1A 1C8NA 3JXSA 3PVEA 2RR13 5EPAA 3C7EA 4KGQA 3GZAA 5KXBA 3I3EA 2YU2A 1OUSA 2FDFA 4L2NA 2YBSA 4C90A 3H0OA 3O1UA 4HXCA 4ZY9A 4ARYA 4Y24A 3KF5A 4DNYA 1PVC3 3WX5A 3FHQA 4FPKA 3ZPYA 4CDWA 3ZFFC 5C3PA 2DCYA 5BUVA 2JEMA 1FMD2 1W8ZA 2BDRA 3OPTA 5FZOA 4COYA 1OXCA 3IMNA 4FPCA 4JHTA 3VDBA 2E6VA 3T0BA 1S0GA 4PI0A 4YPJA 1J3RA 1DYKA 1AYM1 3RI8A 3LKJA 2B7YA 1SPPA 4JDNA 1OOPC 4P9GA 4K21A 2K9ZA 3JUUA 1M4WA 2X10A 2XXZA 1W0OA 1KD7A 2TUNA 4MHRA 3OUIA 4BIFA 1PGW2 2RJKA 3I59B 3UYJA 2WUHA 4R9DA 1TQ5A 2C9AA 2YROA 4I02A 2PHRA 4WM7B 4IE6A 3VBSB 1DGLA 3AMPA 4LULA 1QOOA 2JDYA 4LMFA 2VQAA 3HNYM 2W1WA 1AF9A 4RFRB 4WV8A 4Q8KA 5KHJA 1GP5A 1NA1A 4BK5A 1HDKA 3O1MA 1GFF2 4LKEA 2RR12 1ST8A 3VBRC 2VOKA 4Q4V2 5D2AA 3BTAA 1C28A 2ZX2A 2WNEA 1WCDJ 4S2DA 1YI7A 3O1SA 2HWF3 4JGYC 1V70A 4QGLA 4KI5M 1VJ2A 3B3QE 4P9JA 2BP6A 2FCUA 2B8MA 2WQ8A 4TN7A 5FYCA 4B7EA 3S30A 3T2QA 4BOWA 1K45A 1R093 5L9BA 1D4M3 2XR4A 3DL3A 4YZ4A 1BK1A 1ZBA3 1QOTA 5E16A 4UFIA 1LKNA 3WW1A 4CP9B 1ASJ2 3A0KA 3GGLA 3ZFFA 3E1F1 4X6RB 1W9TA 3RVHA 3HT2A 5E8AA 1PK6C 1VMJA 5A33B 5C70A 5IFTA 2ZHKA 5EQUA 3BVCA 4LBJA 2VUDA 2VPVA 3HAGA 4CDXA 1D0GA 1YHFA 2I07B 1MS5A 4BQYA 1BEV2 2IXCA 3WDTA 4H14A 4CU6A 4F3JA 4P9YA 2LM3A 4ZS2A 1O91A 3K3NA 2R1DA 2G19A 4IQPA 4F83A 1KQRA 4M3CF 3WCRA 5KR7A 3N4MA 4CUAA 4CYDA 1N3PA 4XDPA 4HVOA 2X5IB 4XC9A 1N47A 4K8FA 2G9ZA 5DQ0A 5A7SA 2GDFA 1EP0A 3CJIA 4HVQA 2DWRA 1YCIA 5K7PA 5C8CB 3DF0A 4AK3A 2HEYF 3OEAA 3KCYA 2QZ3A 2VTXA 1OFNA 1S2BA 4QKDA 2OYZA 1W8HA 4FP2A 1L7QA 3LAGA 4WZFA 1XQNA 3AYEA 1LOEA 1QNWA 1SZBA 1TME1 2OZ6A 3OBTA 5L9RA 3LEKA 4CDUC 1O3RA 4HSLA 3VN4A 3USUB 2ARXA 4MADA 3RWKX 1S0IA 5CFDC 4FP3A 3I54A 3JD73 1ZZBA 3MV01 2ZGSA 1PO21 4RQPB 4BQ3A 2AEZA 1COV3 4ISRA 2WAAA 3NMBA 2VZPA 2YGLA 3CL1A 1KRIA 1UOGA 2VE1A 1DZRA 3RS6A 1CQ9A 4WM8B 4GMP3 3VBHC 3RDIA 3WUDA 5CFDB 2JENA 4GH4A 3HQRA 1W6OA 1YUDA 5HI0A 1QOSA 4Q0PA 2R16A 3H8RA 3IDEA 3ZKUA 1V6LA 3CZJA 3ZSKA 5CFCA 4COWA 1QJX1 3AJYA 2HH9A 4W50A 2CGNA 2QE3A 4INDA 5DAPA 3NV4A 2I2SA 2D5FA 1H8TB 3VZJA 4J1WA 3B93A 3THPA 3POGA 1V6NA 4JGYB 1H2MA 1BQPA 3HMYA 1LJ7A 3VBUC 1A3KA 4AVAA 4MGIE 3S57A 4X6QB 1GBGA 1QJU3 2YPJA 5I8TA 2JDZA 5GM0A 3WF2A 3MBWA 1WW6A 4CVUA 2HWC3 3M3CA 1S4CA 2BQPA 5DDJ3 2KM2A 5FY4A 5LW9A 4QPIA 1FPN3 1NCRB 2ZAHA 4Q4Y3 1E5IA 4QPGB 4L0PA 5A7NA 3ACLA 2E51A 1REFA 4LBQB 5LA0A 2WWUA 3DCQA 1ZA7A 4AQSA 2W87A 3ZO0B 3I3QA 3RZGA 4OZOA 3AP9A 4W4ZA 1N3OA 1BEV3 4CDWC 3MO4A 2QKDA 4LITA 1RHI1 5I0DA 1RHI2 3WZ1A 1KGYA 2V72A 3SEEA 2CL2A 2RDRA 4LT5A 4PLOA 5FMDA 5BNPB 4GXLA 5JDBA 3FMGA 2ZA9A 4LBQA 4AI9A 1ZX5A 3FX3A 5FP4A 4FCAA 4QDSA 1SLBA 4R9BA 1W0PA 4XFHA 4HVRA 3I3MA 1LOFA 4Q4X2 5EP9A 5FBZA 1MS9A 2JG8A 3V0AB 5LCWL 3ZIXA 1X8EA 2Q8EA 4ASLA 4G3YC 4D0QA 4XBNA 5FXWA 2Q1ZB 4HBNA 3IM0A 3PNAA 4HMZA 4XW3A 1A8DA 3LEMA 4IV3C 2SLIA 3WP4A 3WLUA 2Y6JA 1K5MA 4DOUA 2VZSA 1OVSA 3KD4A 4XEZA 4M3CE 3RJRA 3W9AA 3WNMA 2DVBA 2LALA 1OT5A 1FXZA 5EZWA 3J8F3 2DCKA 1WLDA 5F5IA 4M3CB 2ZXQA 2H6BA 4NWVA 4BQ5A 5CKQA 3NNFA 4OFGA 1WW5A 4R4ZA 5CFCB 1YJKA 3AMHA 4Z2AA 4OQ8A 5I0SA 1LU1A 1ND3B 2WJSA 5F2WA 4Z1VA 2WZEA 2RM23 5IK8A 1WBFA 1O7FA 2Y64A 1SBEA 2GAUA 3ZSEA 3POEA 2PFWA 3V0BA 4FQZA 2WZPP 4TZDA 1JZ2A 1PIV2 3N7JA 1UMZA 3I2JA 4P14A 3M3QA 4HK9A 2IFRA 5EJZB 1Y4WA 3N9PA 1PVC2 1RGSA 1HLCA 1W6MB 4XPVA 5FYBA 2HEVF 5FR3A 3ASIA 1JZ7A 4A42A 4MV2A 4NUBA 5AFBA 2JG9B 5IJRA 5LBFA 3T1LA 5KWRA 1PMIA 1RXFA 2D44A 3WD5A 2R7EB 4RS5A 3QH7A 1EAH1 2MNGA 2V73A 2YHJA 1AR83 3LEIA 5J98B 4CCOA 1W8WA 4CDQB 4JVAA 4DUVA 1G6NA 3ZN5A 2X8KA 4NRPA 2VMGA 1I5ZA 3KSCA 3QH6A 1H8VA 5G05L 4AQ6A 1W8NA 1CZSA 3WR0A 1LGBA 4P08A 2BPA2 2R071 4E4DX 1VRH3 2JB4A 3J7MA 4LOTA 2WLPA 1QEXA 3OSDA 4XFBA 5GLZA 3VZNA 3OGSA 5DAQA 4XURA 3SMHA 2R042 2Z69A 1PHMA 2YC4A 5FMOS 5FZLA 3PJYA 1TG7A 1UZVA 2MEV2 2RE9A 3HOBA 4XJUA 1NT0A 5ACA1 1WLTA 2YC2A 5C3SA 4Q4W2 4XCBA 1JW6A 1L7LA 1IS3A 2ZGNA 5JXIA 4KL1A 3VL9A 4HG6B 4E8CA 3NNGA 1KDMA 1B35A 2CAVA 4XIOA 1S1AA 3THTA 4QU2A 2WN2A 4QX8A 5C9AA 1VLNA 3OBZA 1G7YA 4AHXA 4HK8A 1WD4A 2JE8A 3R4UA 1Z0HA 4KWLA 2NYYA 1F4HA 4Q4X1 3ZFFB 1SBFA 4I09A 2VC9A 5DXDA 2DVGA 5GZGA 4E9KA 2OS2A 4D6SA 4FFHA 3R4DB 3Q9OA 3S5QA 4A7YA 1IKPA 1XE7A 4FFGA 2ZGTA 3J26N 2Q5TA 4N53C 5BNPA 1SACA 2WINB 3AMMA 4R8HA 1TME3 2XQXA 2WSVA 3NW4A 3SISA 3PUIA 4LQRA 1IPKA 3TEXA 1RIRA 1NYWA 1OUXA 2O8OA 5GLWA 2VMHA 3V65A 3EMRA 1LRHA 3Q8FA 1NCQA 2P1BA 4LKSA 3N7LA 4P9XA 3CZUA 3M1HA 3ECQA 4Q4V1 5CKNA 1JYIA 5FY1A 1OBNA 2G4IA 2VXJA 4M0HA 5DPNA 5FP3A 3T0AA 3QACA 4FFFA 2NMNA 2YPDA 5JVVA 2BBAA 2EAKA 5FYHA 2YMZA 4CP2A 3SH3A 5FPVA 4CDQC 3WY6A 3OB8A 1MS0A 4LKDA 5TSWA 5C5TA 4ZS3A 1D4M2 1UO9A 1OA4A 4N9IA 1TNRA 2O0OA 3DXTA 1H8TA 1AYM2 4CPBA 4GWMA 1RUH1 1S2EA 2VAUA 2ZX4A 4NMIA 1REEA 4GIQA 3THDA 2BUKA 1JTZX 2A73B 4DINB 2WFF1 3Q8AA 4Q1PA 5FZOB 4K9SA 4NWWA 4XJZA 4Y22A 1JUHA 2AEYA 2A6XA 4KG0A 4YZ3A 2ZMKA 1O3TA 1X9TA 1VRH2 1KEXA 1MVQA 4RR3C 5JI7A 5A80A 4C0BA 4B4QA 2ARBA 2AGSA 5CFDA 1XNDA 5A7QA 1EV13 3RGBA 2D5HA 3OGVA 5IT6A 4IERA 2ZHLA 2ZKLA 4N7IA 2JD9A 1LESA 2VZVA 2NN8A 2Z5WA 2C24A 2Y26A 3FLRA 3NWKA 4J25A 3ELNA 1XU2A 4NAOA 5AVAA 5FREA 4A4AA 2VZUA 2P2KA 4OZXA 1R1ZA 1IG0A 4ZU5A 4NAMA 3AL6A 4Q27A 3ZFGC 3E6CC 4QB1A 5JSOA 1JZ4A 1MEC2 3P5BA 3QD6A 1YFYA 2E53A 4NHKA 5JMCA 5KHGA 3HEIA 2WL1A 1LOAA 3AM2A 1LULA 2D40A 5FYMA 5HV4A 3K46A 2QCSB 1MS1A 3I8TA 3LFMA 5FZCA 3VGIA 4AFAA 4AWDA 5FP9A 1AJKA 3UJQA 3WVJA 4QX5A 3WXPA 3INAA 4IEPA 3VHOA 3CJIB 4KBZA 5KXDA 1UX6A 3VBRA 2JICA 3AZXA 5T5JA 4LORA 2YFZA 3CU7A 3VKMA 4M4PA 2ETEA 1T6BX 3VZOA 3OGJA 4XOGA 5DUWA 5C3OA 5CB7A 2GNDA 2GC1A 1HV0A 1COV2 2XONA 1LHWA 4H2AA 4JTNA 4CRQA 2PTMA 1QKQA 5LWBA 1SDWA 3POIA 4P00B 3U14A 1DGWA 2VGDA 5A32B 4HONA 3S5AA 4XFAA 5FY9A 1DQ4A 4Q4X3 4DB5A 5FLJA 2OPWA 3SITA 1JZ3A 1ZZ8A 1G9FA 3H1WA 2RDSA 3ROUA 4BB3A 1IQAA 3GZTB 3WDVA 2XKPA 1SBDA 2XHNA 3MICA 4ZHNA 1RUC1 4I2OA 1W6NA 2ZGMA 1LEMA 1V9U3 1ONAA 3H42B 3J7LA 4MXVA 3RZJA 2B42B 1FPN1 1BK0A 2XJSA 1WCQA 2IC1A 4XUNA 1W06A 2XG3A 1JU3A 4AGRA 5A3PA 2XLFA 2TNFA 2XHKA 3GF6A 2D43A 1QJU1 3L2HA 4QD2A 4E4SA 2ZZQA 3RZZA 4XCAA 5A6YA 3HIFA 1E5RA 3IB3A 3U4XA 2VVFA 4LE4A 1DG6A 3O0XA 5EYYA 1VBD1 3LA2A 3T08A 1GQGA 3R0RA 3WNLA 4NHYA 3WHUA 3ZYFA 3ZFGB 2J1EA 4D69A 1DQ6A 5GZEA 2VW0A 4Y22B 2ET1A 1DCSA 1NA1B 2JECA 2VO5A 1XU1A 2BNNA 3BCWA 3OUJA 4QX7A 3C7GA 2IFWA 4QT6A 3Q8BA 5FV3A 1RMU1 4O9EA 4PLMA 1O5LA 3VD7A 4XF9A 3VBFB 4BXSV 1K12A 2Z2SB 1W3XA 2TEPA 5IK5A 1ASJ3 2W3JA 5JUVA 3F2ZA 2DBIA 2ZPXA 2BU9A 1YQ5A 2FDJA 2CWMA 2D3RA 2WA3A 2OA2A 5LA9A 4AQTA 2YC0A 1RUC3 2W1UA 5F3CA 2Q30A 5F32A 1YXWA 1HIXA 1QDCA 3ZLIA 1PO23 1WLCA 2BERA 4UFHA 1UD1A 1BMV2 1S0JA 4L8QA 3U1XA 1UKRA 3HNBM 1U0AA 4MXWB 3BTXA 5FJHA 1V6IA 1OHFA 2BGCA 4A7KA 1NCQB 3C7HA 3AVSA 3T4HB 1LNSA 3VDDA 2Y6GA 3OG2A 2C6SA 5GZFA 1OOPB 2B9VA 4H7LA 1TMF1 4GWIA 3ZVXA 5J3UA 3BI3A 2ZS6B 3WQ1A 4Y33A 4B1LA 4IXLA 4GALA 4HN0A 5C7GA 4Q8LA 3MW3A 5FPLA 2R062 3GM8A 4CEYC 3RWNA 1D0HA 1W6QA 2D6LX 1VRBA 3PDQA 4YFZA 5AVPA 3UKTA 1OLMA 4BQ4A 2ZGLA 1HXS1 2VW1A 3ZSMA 1CONA 3ORJA 4TWTA 1YC61 4LIUA 3D3AA 4XJ8A 5H9SA 3WNNA 4ZONA 3MIHA 4V2VA 1QXPA 1YO8A 3U0ZA 5IVEA 3WOGA 3IZOA 4JC1A 5A1FA 3CJXA 3WNKA 5C9AB 3N9QA 3B9IA 3ZSJA 4LOSA 4I01A 3EB7A 1F2NA 5KXCA 2W95A 1RUI3 4CEWC 2XVGA 1U5YA 4KWKA 4RYDA 3WQ7A 3ZN4A 1FOD1 2VH9A 4LA3A 5A3NA 5A3WA 5JOZA 3GZUC 1VBB2 4KMQA 2WSUA 3M3EA 1XSRA 2RMU1 4ARXA 5T52A 1DGRA 3U4SA 4YM3A 4P9IA 5IK7A 2R041 5DABA 5C9AC 2JXAA 1IHMA 2ET7A 1MACA 2WR9A 4UYBA 2OKXA 2R072 3KT4A 2ZGRA 5EWSA 3FHIB 1CAUB 2PAKA 5FPXA 5FP7A 4LHLA 3MF6A 3QOPA 2HYKA 3AYDA 3EBRA 3FZ3A 5I0UA 5C8CC 3MZHA 3AYCA 2BRTA 4UW4A 3OCPA 3LD8A 2NZ9A 4FBFA 4ISQA 4ASMB 2CAUA 1Q43A 2FQPA 5LRSA 1GMMA 1PZ9A 1Q8SA 5DDJ1 3BPSA 3AP4A 2DCJA 3VBOC 5C4WA 2AC1A 2VL4A 2RJLA 1FNZA 1QIQA 1BXHA 3NKGA 4K20A 3SH4A 4DEVA 1W6MA 2Y34A 5K0UB 1X36A 3PMSA 4BIOA 3ZYRA 3LQCA 1UOBA 2NP0A 3N9LA 4XETA 4HOOA 1OPOA 3C7OA 3CKHA 3S0MA 4D7YA 2FDHA 4UF0A 4EJRA 4MGQA 3V0BB 3ZXKA 4LBOA 1W6PB 3OGGA 1O3QA 1G9BA 2HWB3 5DG2A 4BLIA 4PCRA 3RSJA 2VQTA 2EAAA 5FZIA 2BTVC 5K0UC 2HWF2 3DN7A 2WWSA 1PMJX 1MQTA 4AVCA 4EWAA 5C71A 1US2A 1ZA4A 1JYWA 4Q4V3 2E7AA 3J7NA 4E8DA 1RUE2 1U5ZA 4K1YA 3MLJA 4OMDA 4GD4A 4FPYA 3NAPB 4COUA 2HKXA 1VIWB 4LR4A 5ABJA 2QDNA 2RMU2 1RTVA 2BWAA 1CAVB 1AXZA 1H30A 2WNVA 3ZOIA 1J3QA 2VM9A 3X29B 1CWPA 3BGAA 1GYKA 1MPXA 1LB2A 4PBPA 3VKLA 1IG3A 4CUCA 1GZCA 1YFUA 1AR91 2PYTA 4YM1A 1UU4A 4QQLA 2E26A 5BNOB 5J7MA 5GKAC 4LHKA 5JSRA 1GQHA 5HV0A 1LOBA 3FC0A 3EJKA 2V4VA 2ZAAA 4Q0UA 2P17A 1DGRN 3VZLA 2BEOA 4FPLA 5C4WC 1LCLA 3EHKA 1CAXA 3TN91 5F9TA 5FYSA 1UYPA 1XJAA 1VBB3 4UFLA 1I1EA 1YIPA 2BVBA 1W8UA 3KCXA 3KQ4B 3IDCB 5EV7A 3VD5A 1RUI2 2W52A 4OUSA 1ENQA 1K3IA 1TMF2 5FXZA 3IDBB 4ZZ8A 5ACA3 4I30A 2GNBA 4QPYA 1N1YA 4Y20B 4CEWB 4L9BA 1QMJA 2VULA 2HWB1 5IFPA 4XBQA 2QTWB 1GZTA 1BBT3 1VBC1 4HKWA 4JX0A 2QQPA 2WNUA 3ACHA 2RMU3 2JE7A 2LRPA 3FBYA 4QB6A 1NUKA 5JZGA 1SDDB 1RUE3 3AL5A 1MZFA 1PNFA 1VE0A 4LXLA 3O0VA 3W59A 5I93A 1US3A 2Q8OA 4NRMA 5EJ3A 5F1RA 4QX1A 2ZHNA 4ATFA 4F8AA 2D98A 2ZOEB 3ENRA 2B9UA 3JU9A 5FQ0A 1BBT1 1VBC3 4UWDA 1WCUA 1XE8A 5A7PA 2XLGA 4OUEA 1D7PM 1N1SA 1OQEA 1CJPA 4LBKA 3ALQA 5FUPA 1NXMA 2HWE3 2DUPA 3JBG3 3KV6A 4IEOA 4NN0A 1NA1C 4B1MA 1V6OA 4KG8A 3ES1A 3ETPA 5BYNA 4O9GA 1QJY3 2UWCA 5LA2A 1NG0A 2P37A 2PMWB 1PX3A 2QZ2A 4N53A 4XAAA 5LY2A 4AAPA 4EWDA 5BNPC 4LK6A 1JYXA 3D0SA 4D7TA 4E27A 2J7MA 4O7XA 3FUOA 1CAWA 2SBAA 2YGMA 2C5DA 4P5HA 4DY3A 4R9CA 5FZBA 1GNHA 2HWF1 5JI9A 3RZMA 4I0AA 4QQ2A 2AENA 1AL21 3EO6A 2W68A 4OHVA 3H3ZA 1H2NA 3BIEA 1JBCA 4ZXKA 4UF0B 2DBNA 2PN5A 2E7TA 4LIVA 3U37A 4HKLA 1RUOA 1GP4A 4OI2A 3PHMA 4QKNA 5FJKA 4PDWA 3GCWA 1BVP1 3HVDA 1FYUA 3LSEA 3WEZA 4NR1A 5L9VA 2IXKA 2VNVA 1DBNA 2ARCA 5C4WB 1PGL2 5LK5A 4HETA 3CMGA 2QQVA 4NVPA 5DDJ2 1UYZA 4XF3A 1GICA 5FY0A 1OF4A 4BQ1A 2WABA 1GZWB 3WDWA 1UIKA 4L11A 5C33A 1G8WA 3HN1A 1XBFA 4O61A 4XF1A 1AHSA 1APNA 3BOPA 5F5CA 1A78A 2D6PA 1IZ3A 2VUAA 4CUGA 1CAUA 3BOWA 4I0WB 2JDHA 1HB4A 2BGOA 4LHNA 3BKZA 1AX0A 3IN9A 3T2OA 2WO2A 1AL23 2BYVE 2YDEA 3BU7A 1OA3A 4NE9A 3SCFA 1GOGA 2E63A 5JLVA 1FAYA 2CHHA 3VL8A 4EYUA 1ZVFA 5E6HA 5FUNA 3M4FA 1VALA 1X9PA 4P02B 1CX1A 5L7OC 1FOD2 2C9KA 1BEV1 1VAKA 3HQUA 1LHUA 4CDXB 3KHCA 3GDBA 4RHV3 1RVF1 2A3WA 2QQUA 3A21A 4X8PA 2HWE2 5F6LB 2LW8A 3GALA 4A7ZA 1W04A 3RMYA 4NIIA 1XXNA 2CDOA 1UPIA 2RDQA 2QNKA 4ITCA 4KU8A 4XQ4A 4DUXA 2Y8KA 4S2HA 1MEC1 1H4GA 2P3KA 4LA2A 4Z8BA 2A6WA 4AXOA 4CP9A 4GQ7A 4RL7A 5FZMA 2ES3A 3TOJA 2ZX0A 2ZZJA 4FPOB 1LTEA 1LODA 2VECA 2VZTA 1F9KA 2IXIA 1R082 5LBBA 1UNBA 4LO4B 3MEPA 1OOPA 3BUCA 2AZ5A 2GU9A 2CV6A 2W5FA 4BXFA 2DTYA 2XBO1 3BYWA 4WM8C 3D8CA 1PZ7A 3NKTA 2DVDA 1Q56A 4DXRA 3FBMA 2BFUS 5T54A 4LUKA 3I3BA 2J1UA 4GMP1 3SXWA 2FBEA 1BMV1 1OQDA 3VUOA 1HRV1 4HPKA 2VCBA 1MR5A 3AKQA 1C1FA 4EQVA 4B4RA 1OURA 4CTEA 4YARA 1NY71 3T3YA 1MS8A 4D6QA 2ID4A 3I59A 1W2UA 3T0DA 3ZN6A 1TE1B 2WBKA 3MLLA 3MPPG 2ZACA 3ZKYA 5FZKA 5LBCA 1HX6A 4FPGA 2ARAA 4JV4A 4BMBA 4PJYA 1SPPB 4PI2A 1UMIA 3P6BA 4PIXA 1NY72 3GHNA 1OLME 1HQNA 1V00A 2BOJA 2CY6A 5T3NA 1OVPA 4DXZA 4AAXA 3PVBB 4A44A 4JCKA 5BNNB 5K8SA 1OQ1A 1RHI3 2JX9A 2ZEWA 1Y7BA 1FV2A 2A70A 4XUOA 5F3EA 5L7OB 2WLQA 1HN0A 4NPRA 5E88A 1DDLA 4HFSA 4WVWA 4GJZA 1JOJA 1AL0G 1IS4A 2G1MA 1QNYA 3PVNA 5J37A 2OX0A 5A7WA 3GCXA 1JI6A 2VOVA 3CDZB 1FPN2 4COZA 5JSPA 2ZCWA 4AVSA 1PVXA 5SV5A 1ZYBA 1WMDA 1RUJ3 2R073 1D4VB 3LDBA 5BY5A 1LU2A 4QPIC 4YRDA 5CAZA 1HW5A 2B46X 4QHZA 3ZXAC 2J22A 2KXLA 3O1VA 4Y4YA 4V1PA 3OBAA 1UCXA 2XOMA 4D6RA 1W90A 1RVF2 1OFSA 2DUQA 2HWC2 3K77A 3UL2A 1FI2A 1C3HA 3C8XA 3PU8A 3HBZA 2OXBA 1NLRA 1WW4A 4PIYA 5LEJA 1ZBA1 4J6GA 2JDPA 2KA3A 5AC92 3GNEA 5LK7B 2MEV1 1L3JA 1UKGA 3VKFC 2VZOA 3O1RA 2Y60A 4YM2A 4YGDA 4IGQA 1R091 2D93A 1WW7A 3GBWA 1RUG2 3I2FA 1VMFA 1WMXA 4FO9A 4YGCA 5H9RA 3VBRB 4D3WA 5A6ZA 3PVOA 1JYCA 2WFF3 3ZXJA 2CGPA 2QDRA 2R043 1UYXA 3AFKA 4CCKA 4OI4A 2WYFA 1OA2A 5H9PA 4CCDA 1QXJA 1UXZA 3PL0A 4Z2WA 1CGPA 4IV3A 4UFMA 5JXHA 1CN1A 1ENSA 1EY2A 4JDMA 1AR93 1SFYA 1VBA2 1W8OA 4D94A 1PGL1 1DZTA 2JDMA 1AYN2 4FOWA 4Q0VA 2H0BA 4YG0A 4RS5C 5DAWA 4MGKE 4ES8A 3CEWA 2HEWF 2YBKA 4XTMA 2WA4A 5SV8A 1BHGA 5CFCC 3VBOA 1JUIA 3OYWA 2B45X 4YWAA 5F5AA 4NIHA 2PHUA 4PDWB 1AYM3 3I2DA 1RL3A 4CCNA 3LZZA 3J4UH 3PTRB 4XE9A 4B4PA 3MFCA 5CG8A 4EZ4A 1DQ0A 3SQOA 3LIGA 1QJZA 1AL22 4XFCA 3T30A 3T4VA 4FTSA 1HRI3 3E97A 5T50A 2EA7A 2XBO3 1WGPA 1VRH1 3ME2A 3OOXA 4FOYA 3CLPA 3GJBA 4AI8A 4Y26A 2ZX1A 4DO0A 3DECA 2WFF2 4KWJA 1G9DA 4M3CA 1MQTC 2GSYA 3VD9A 3ZR6A 5C3RA 4RGGA 4C1WA 2R0FA 3L9JT 2RS12 1HKDA 2PHFA 4IDZA 4XDQA 3ZXEA 2W0XA 1F8VA 1W2TA 2W91A 4Q29A 4HZFA 1UWWA 2A6YA 5FQ0B 3VD3A 2ZMNA 5JXJA 3POWA 4OHZA 1GKBA 4IE4A 4QPGC
chains in the Genus database with same CATH topology
4EWEA 1EV11 2TBVA 4QGNA 1JXNA 1RVF3 3I4IA 1LHOA 2CNAA 5JPNB 5JZGB 3LA7A 2VY0A 3W58A 1V9U2 1Q8PA 3V56A 3O7OA 5JCTA 4IEWA 2HWB2 1RUD2 5HCBA 1UL9A 3TBDA 1ZRCA 1GR3A 1FATA 3ZYGA 4COVA 1JH5A 1VBD3 3M3OA 4TSVA 3FLPA 4LTAA 4AFCA 1RUI1 1S0FA 4AEDA 4AI3A 4Y1ZA 1C4RA 3ZXLA 1A8MA 3JB8A 3U11A 4OLLA 5K9YA 2PAMA 1REDA 4SLIA 3UKVA 4BHPA 1NCRA 3KZ4C 3QLQA 4OUMA 4AFBA 4K6BA 5IUQA 4BCUA 1R1A3 1MS4A 3MDPA 4AI0A 4LBLA 1C1LA 2RHPA 5KC6A 1OI6A 1EYBA 2W08A 4B7KA 1KFXL 4AE2A 1ZBE3 4JGYA 3B9CA 1TMF3 4MZUA 5ACA2 1EPZA 1H0BA 3MIGA 3NV2A 1IS5A 5ABJB 3LB9A 4I3PA 2XL9A 3NAPA 2OUHA 1LHVA 1KS4A 1O3SA 3D6EA 4Q4Y2 1M06G 3ETQA 5JOXA 3DKWA 4XILA 1PGSA 1H2LA 1MQTB 3LSDA 4IL7A 4AHYA 1F5JA 5T5PA 4GH4B 1ZBE1 1IPJA 2ZGOA 1PZ8A 1GZ9A 2XJQA 4YG6A 1ZM1A 3D0JA 4CDQA 1UZZA 4RA0A 1C8M3 1SLLA 3LWCA 4JQRA 5KXEA 4UBGA 2PELA 3I7DA 2JG9A 4AHZA 1S55A 3NJZA 4EN9B 3SH5A 3HWJA 1D2QA 5JOWA 4BYYA 1ZRDA 4IETA 3B02A 3J8F2 5FAXA 3MIDA 1PIV1 1CJDA 2LTNA 2CYFA 4MSVA 4LBMA 1ENRA 1LEDA 2WQZC 5E1RA 1ZBE2 4Y1UA 3U07A 1TNFA 3URFA 4XFFA 1B35C 2DTWA 1UAIA 4AFDA 2RS53 2X5IA 5GJ6A 3E5XA 2R6QA 3RYRA 4AVTA 3N35A 3GYDA 4XMAA 2AH2A 1XYNA 2WS91 2XVLA 2XL7A 5FO7B 1MVEA 1VBB1 1DGWX 1J3PA 3AKPA 3APBA 2D6MA 4YW1A 2HWC1 3DPRA 1FNYA 1UZYA 2MHFA 2ZKNA 5FLIA 1VR3A 5BV6A 4GKYA 4LBNA 2ZGQA 2JJ6A 3EQEA 4YW3A 4DFSA 1NCQC 2D7FA 2XJPA 1S0CA 2X29A 4BPZA 4YNIA 1ULGA 4IEUA 2JG9C 4OHXA 4DPNA 3FE5A 3JQWA 3VKOA 4ZU7A 1Y43B 1QQP2 1W39A 2XJRA 4FPFA 2YV8A 4N43A 3B00A 4JRLA 2DUOA 4C1XA 4ZKTB 4PLNA 1BKZA 1X50A 4MXWA 5GLVA 1SEFA 4OULA 2VG9A 2AUYA 4K7JA 2DFBA 4QPIB 1J58A 1U5IA 3AFGA 4XBLA 2E9QA 2NLRA 4YVWB 3KLSA 3ZFEC 4PF5A 3VBFC 1YI9A 1PK6B 4FPHA 3BODA 2B39A 1HRI2 2ERFA 3ZN6B 2RS11 3ZX7A 5GZCA 4XZPA 4BE3A 2ZGUA 2A6VA 1VBA3 4LE3A 3LA3A 2XLAA 3H1YA 1QJX2 3K51A 2ZMLA 3ZFGA 5JWPA 1PM7A 1N1VA 1DLLA 3P3PA 4I0BA 4CDXC 3FFQA 1AVBA 4HL0A 3GHMA 4WM8A 4Y1VA 4XXPA 1FMD3 1UU5A 2XH6A 2PLV1 3A0NA 1R081 2PHDA 4EN8B 1VB4A 4A2UA 5D1IA 3GBGA 4PBOA 1CPMA 4QXKA 2P3JA 4WZCA 4MGZE 2I45A 3OTFA 1RUNA 1W6NB 1XNCA 4MVTA 4AG4A 3AXDA 3WW4A 2A7AA 3A4UA 3J9SA 1H1IA 3USUA 1C5HA 3AJZA 2R1BA 1ZRRA 1RUF1 4CP1A 1OLQA 4YVSA 4XF4A 2CTVA 3KS7A 2GC2A 5CADA 1HXS3 4XTPA 1A6CA 2A75A 5FMOL 2Z42A 4NOTA 4QGMA 5CBLA 4KGGA 2JKBA 3ZXDA 1COV1 2XPJA 1ND2B 3D5OA 4EROA 5BNQA 1XYPA 2D3PA 3E6BA 3WQ0A 1YFWA 2DCZA 2XVKA 5FO8B 4J1XA 1SMVA 5EFUA 3B69A 1OPMA 2Q0AA 4NHLA 3AZZA 1IS6A 1LR5A 3NVCA 2B5HA 3ILRA 5A33A 1RB8G 2GH8A 4XFIA 1RUF2 1CVNA 1RJ7A 3SHRA 1UPSA 5JAXA 1ASJ1 4YGEA 1URXA 4YZ5A 4XJAA 3N36A 1SCSA 5L73A 3WDXA 4WVVA 4G9SB 2V5YA 1VBE3 2GC0A 3H8UA 3WHTA 2BBVA 3SLIA 3JB4C 1AXKA 2PLV2 4GA9A 2ENRA 4OI1A 3WINE 4E2QA 5HCAA 3MIBA 3UKNA 3B94A 1CESA 1C8M2 5FOJB 2Y0OA 1CD3G 1OKQA 5BNNA 2QFEA 1KITA 2RR11 1AR81 3IPVB 3UV9A 1MEC3 1H9PA 2DF7A 3NAPC 2OW4A 1Q3EA 2HWD1 2O1QA 3H50A 3ZDSA 4L97A 2Y0IA 1PGW1 3HQXA 1D4M1 1QH6A 3AYAA 3OD0A 1H2KA 1LOFC 2HWD2 4U2AA 4YVWA 1QWRA 2WKKA 1CPNA 5FTTC 1FT9A 2RM21 4LUMA 3GBFA 3JD72 1PNGA 4XFGA 5FRAA 2YYOA 4BMEA 4UW5A 1FOD3 2HJIA 3R4SA 1Y9QA 4N43B 5GLTA 4N90A 1DF0A 4CDUB 1QQP1 3RG0A 4XQDA 1C57A 1AR73 4DMIA 1XRUA 1QH7A 1CAXB 5J36A 2UWBA 4JGZA 4K3UA 4L99A 1QDOA 1XNKA 4RQPC 1H8TC 3IT8A 1H1MA 1RINA 2A3XA 4YZ2A 2OZJA 3OF1A 2FMYA 3WUCA 3G6JB 2PQQA 2EXIA 1H1AA 5DUVA 1J59A 5J96B 3VZKA 3POSA 1QY4A 4ATEA 5I8YA 3CNAA 2VXRA 3M70A 4YVWC 4EN0A 1ND2A 4Q0QA 1G86A 3AKSA 1SLIA 1QJY1 4ZU4A 3S7EA 3JBG1 3H7YA 5GLUA 3UJOA 4AI2A 2EXHA 4AEDC 2XWBB 1QQP3 1EPWA 3ZSLA 1NE4A 3DV8A 4DQAA 1ZZ7A 1PO13 1RUH3 3IIAA 4CP0A 1RMU3 3M8LA 4YVSB 1NCRC 2DU0A 1VAMA 5K0UA 4BA6A 5FOBB 1WA4A 2R49A 5JIAA 3BIWE 3TYJA 1I3HA 2A71A 4RD7A 1H4HA 4C91A 1WCKA 4U36A 3KGZA 4LO5B 3IBMA 3RMXA 2GN3A 4GB32 4URTA 5J48A 3SCGA 4E4ZA 2Q1MA 3ST7A 2GNMA 5D8AA 4ONUA 3ILNA 1CAWB 4MX3A 3RNSA 4CEYB 4F7ZA 2VNRA 4DZGA 3KT7A 4A3XA 4C0HA 4LEJA 1Z78A 4AQ2A 4JRAA 1DHKB 2R32A 1OMIA 4Y5Z0 3VZMA 5L36A 4G4FA 4IEXA 1X33A 3RI9A 3EXUA 3OY8B 1NOVA 3ZFEB 3AMQA 1BVVA 5GALA 4YZ1A 4WVMB 1Q8QA 1BBT2 4BM8A 1KXGA 2F4PA 2XJTA 3MIEA 1PIV3 3N3HA 2WFPA 4AI1A 1WCSA 2DYCA 4M00A 4JTOA 1HV1A 2VNGA 4IV1B 5CNAA 2RS31 4AGVA 4EN6B 4NHMA 5I91A 4GKXA 5JR7B 1AR63 2WZR2 5AFEA 1NZCA 1W6QB 3VV1A 4XMIA 2BWCA 3E5QA 5AC93 1IOAA 4AEDB 5EXOA 5DUXA 4RHV2 4W6WA 4YSFA 4MYEA 4P9LA 4HANA 1NE6A 4N9HA 4FQ4A 2MPFA 5E89A 3KB5A 3TN92 2WC2A 4RR3A 4KBBA 1ZNPA 3AMNA 3N7KA 5D8AC 3FFZA 3RPQA 3WG4A 4AFMA 4OHWA 2DVAA 2F6BA 2WT0A 5BNOA 4XIKA 5FFOC 3DPRB 1U12A 1Z7S3 3O0WA 3VDDC 3ZFEA 3TB0A 3VBFA 1RMU2 4IEZA 5IK4A 4AW7A 2JG8C 4AEJA 2G9FA 3LCPA 2WT1A 1LOGA 4MH0E 1ULCA 4CEYA 2DV9A 3VHRA 1VBD2 1W6OB 3V64A 1Q8VA 4XF0A 1TEIA 4FAGA 1ZZ6A 3VBHA 1ULFA 2UYAA 1QJU2 1O5UA 5J09A 5JIUA 3PLQA 3PJQA 3J8F1 1AXYA 5LRRA 3BPZA 2ZTNA 3OYWB 4H3WA 4KH9A 3TAYA 3VHPA 5T5OA 4B29A 1YYNA 3WP6A 2D6OX 1F5FA 2ZJCA 4FOQA 5B2GB 1VBA1 1RITA 2GNTA 4YM0A 1RC6A 2NPIA 4L92A 1NQDA 2RS13 4Z82A 4W6YA 1E57A 4GWNA 3H7JA 5C8CA 5FLHA 3JBG2 2E7QA 2UY8A 1AYN3 5BPXA 5F6KA 4H55A 4B3NA 3R6SA 3S6PA 5DZGA 2UWAA 4XJWA 1CX4A 2FHRA 1I9RA 3C2UA 4EV0A 5AC91 4QQPA 3HT1A 3L2YA 4AHWA 1ENXA 3MIFA 4KU7A 1F31A 1AR61 1N1TA 4QHBA 5C6CA 2ZBJA 2I74A 4QQOA 1MZEA 3WG2A 5I8SA 4M01A 1POV0 4ORFA 3E5UA 2H6CA 3LOIA 1DQ1A 5LEKA 1K5MC 2DURA 1NXD1 1RUD1 1RUG3 3KM5A 3PMEA 5CIRA 1KJRA 4UW3A 4CDWA 3VDDB 2XGXA 4DY5A 4QM9A 5HCFA 1X82A 1V9U1 2JD4A 3MW4A 4LO8A 4S2FA 3H9AA 4YGBA 2RM22 3LOBA 2NMOA 2RS51 3CF6E 1GANA 3RJ2X 2ILMA 1MS3A 1BJQA 2XJUA 1ZRFA 1KJLA 5HXVA 2K2SA 2YZ4A 2VVDA 2VMIA 3OJBA 4FT8A 5FCCA 2EVXA 2RS52 4IESA 1ULEA 3TNQA 4WVZA 1U5XA 4HPKB 3IPVA 1FMD1 2GMMA 4R52A 1SCRA 4FTBA 2GALA 4IEYA 1C8M1 3M3IA 2PAEA 3O5SA 4Q2FA 4P9WA 4S2GA 3O12A 4FXKB 1IKQA 3AP6A 3WNXA 4FXGB 1POV1 2LUWA 1DIWA 3AZVA 2BNOA 2G9GA 1AYN1 1Q8OA 1X7NA 3WP5A 4FOVA 3ZYJB 1V6KA 4MUVA 4UXAA 1CR7A 4BZ4A 1UU6A 1AUYA 3PTYA 1GV9A 1ZZ9A 1B35B 4HN1A 4Q26A 1KFUL 3CO2A 4Q4W1 2Q4SA 3G7DA 5F5QA 3H3UA 3M7AA 3IWZA 3N7MA 3VLBB 1QU0A 3ZYIB 4PIZA 4WM7C 1DQ2A 1UN1A 2PA7A 2R063 5T5LA 4R4XA 1ULDA 2GH2A 3OD4A 1SQ4A 4HLTA 4HKOA 3T2TA 4UBHA 3ZYPA 1YRZA 3VKNA 2W39A 4FVVA 1GZWA 1EAH2 4K1ZA 1OLRA 4YW4A 2EALA 1R1A2 3NV1A 2EIGA 2WIIB 3NSTA 4QQHA 4RS5B 5H9QA 3ZMNA 2YXSA 3AZYA 1QJX3 2AR6A 4LBQD 2Y38A 2IXHA 2ZGKA 5C8WA 4BH9A 1PO11 2ZGPA 1KS5A 3DGTA 3ZXGA 1V6JA 2QUOA 2EXKA 1DU3D 1N3QA 2PHTA 1YLLA 1MZ6A 2FMDA 3OPZA 5KHIA 1VP6A 3VBHB 3WP3A 2YUEA 4I3GA 5DUUA 5L7OA 1RUD3 2IWGB 2P34A 5I0RA 1WLWA 1ND3A 1UIJA 4IV1C 2ATFA 2XKOA 3OBRA 4DS0A 3ZMOA 1RUH2 2VUJA 5CU1A 3USSA 4AF9A 1HRI1 3DPRC 3MPBA 4TYSA 1RUJ2 3HD8B 2WNUC 4DRRA 1PK6A 2NQYA 1GSLA 1AX2A 1B09A 2AYHA 3BB6A 4OHYA 5DZEA 4LNVA 4HSJA 4YW2A 3V0AA 1AR71 4META 2JG8B 1HRV2 3D4KA 2VVEA 3BALA 2UURA 2D97A 4RR3B 4Y1YA 1XNBA 2WNUB 4XYXA 3JCIA 3KGLA 3JZVA 1VBC2 2DVFA 4NO4A 1MZ5A 2XBO2 1Z7S2 4YFWA 4CDWB 4N43C 4Y20A 4YW5A 3WW3A 5CA6A 2N7GA 4YG3A 1EAH3 3CJIC 1XYOA 3WCSA 1KDKA 4N7UA 4QMAA 1J1TA 2WZR1 2AREA 4IV1A 1YJLA 1YIFA 4W6XA 5KBFA 3JQXA 1UF2C 4BWOA 2QJVA 3FWEA 2WZR3 1AR92 1AR62 3DUIA 2HWE1 2HWD3 1AJOA 2GN7A 3MGUA 2IXLA 3T1MA 2K0GA 1Q5OA 4WBBA 4WVMA 5BNOC 3FJSA 3K48A 2FZ1A 3FLTA 2BNMA 3VBUB 3B7MA 3RYPA 1O4YA 2WS92 1RUE1 2GMPA 1R083 4GH4C 2XUMA 1YNAA 2ZX3A 5BXXA 2PLV3 3KMHA 3RYKA 4RSUA 2C1FA 5CG9A 4TLFA 1HQLA 3QBQA 1VBE1 4AGGA 3WDUA 1ZREA 4Q0SA 3P3NA 1SLAA 1SLCA 2V09A 3AP7A 4W65A 2GC3A 3ILFA 1LOCA 5KHHA 1OSGA 1T6GC 5KHKA 1WUVA 2X5IC 1OD5A 3AKRA 3AP5A 1PVC1 2BW8A 4LO6B 3AXEA 4MLOA 5HBAA 5A3LA 2P3IA 3QCWA 4LLOA 2OIIA 1VBE2 2GZWA 4FPJA 2R0HA 4Q1RA 4QM8A 1UW8A 4LO7A 2Z79A 2EXJA 3S7IA 1GLHA 3MFAA 2UYBA 1J1LA 1I6XA 1RJ8A 4EN7B 4Q4Y1 1HRV3 3RQ0A 3VBSC 4JDOA 4N53B 1S0DA 2VOXA 3VBUA 4M0NA 1QF3A 3RRDA 2PHLA 3O14A 4AEMA 3C3VA 4E2SA 1ALYA 1K5MB 1HQWA 1AX1A 4ES9A 2D6NA 1O4ZA 2PHXA 3AKTA 4JAAA 4KQ7A 5L19A 2IXJA 4CZSA 1H9WA 4YLZA 1YFXA 4MGYE 4OVEA 5ABJC 4GMP0 4XHBA 2FZ2A 4JGZB 3TRSB 5FO9B 2VU9A 1WMEA 5EYXA 4LLFA 3MLKA 2R061 2XJVA 4CEWA 4FSJA 4UW6A 4CDUA 2WT2A 5FDBA 2EF6A 4XQWA 4HT1T 4RHV1 4Q4W3 3WDYA 4AYUA 4K40A 1Z7S1 2D3SA 2WS93 1AZDA 1LGCA 1JN2P 2XB6C 2MEV3 3TNPB 2A6ZA 3B01A 3KQRA 4Z07A 2JE9A 3JD71 4IEVA 1V6MA 1DQ5A 4Y1XA 4QPGA 1BCXA 2RS32 3R05A 1AR72 1WD3A 1EV12 2DU1A 4H7MA 3VBSA 4RFT0 4WM7A 3H1MA 3D82A 2H0VA 4CYDA 3E6DA 5T55A 4OI0A 1G9CA 3LGRA 1JHNA 2BFUL 2DFCA 2QVSB 4GB33 4XHXA 1RUJ1 3ES4A 2WNVB 1QHDA 1C5IA 1POV3 5FPZA 3UK9A 1CAVA 2IZWA 2PHWA 2XWJB 3OY8A 2OUJA 4R9AA 3SCHA 3U10A 2UU8A 5JZGC 2CWSA 5JOYA 5CVRA 3AX4A 1WBLA 3MYXA 2VQ0A 1AR82 4IEQA 1YWKA 1VB2A 3WG1A 2BVVA 3MI8A 5D8AB 2O8QA 3MF9A 3NL1A 2RS33 2ZHMA 2WQ4A 1W6PA 1LGNA 1LENA 4GB31 1G9AA 1LECA 1BYHA 4YVSC 4FTEA 4PQ9A 1NLSA 4KNCA 4SBVA 1S0BA 2YY1A 3VBOB 4AVBA 1DFQA 1PO22 3MW2A 4RQPA 3ATGA 3WG3A 4AVVA 1PO12 1VAVA 3WW2A 2OVUA 1RUC2 1FX5A 5KC5A 1BZWA 3AB0A 4XXAA 1IGOA 1NQJA 2VOWA 3NO8A 1ND3C 4XJ9A 3IKWA 1R1A1 1S2KA 1TME2 4B8EA 1QGLA 4IV3B 3WV6A 2UY9A 3B5LB 4X8NA 4PDWC 5A32A 2D6KA 3M2MA 1O4TA 2DCTA 2A3YA 2A5ZA 1RUF3 5GZDA 3AK0A 4FAHA 1DYPA 4AEKA 4FPEA 1ND2C 1RUG1 1SFNA 1QJY2 3TWIA 1SLTA 1R092 3ZIWA 4GULA 4YYOA 3FUQA 2OPKA 2R30A 4JGZC 1X8MA 3VHNA 4DRVA 2ZABA 1D2SA 2GMEA 2CGOA 2VNOA 1ZBA2 1FV3A 4D7SA 4RGAA 2VW2A 5DG1A 5JPMB 3POYA 2WNVC 1DZQA 4BLJA 2X53S 3SNMA 1QXRA 1LHNA 3NV3A 5DZFA 3WT3A 1CIWA 3ZXFA 2C0ZA 5A3MA 1WMFA 1S0EA 3AZWA 3TN93 5I0TA 1HXS2 3KCCA 5BNNC 1GNZA 1ZZCA 2NM1A 3HR9A 1Y3TA 3KT1A 1C8NA 3PVEA 2RR13 4KGQA 3GZAA 5KXBA 4L2NA 4C90A 3H0OA 4Y24A 4DNYA 1PVC3 3WX5A 4FPKA 3ZPYA 3ZFFC 2DCYA 5BUVA 2JEMA 1FMD2 4COYA 3IMNA 4FPCA 2E6VA 1S0GA 1J3RA 1DYKA 1AYM1 3RI8A 3LKJA 2B7YA 4JDNA 1OOPC 4P9GA 4K21A 2K9ZA 3JUUA 1M4WA 1W0OA 1KD7A 2TUNA 4BIFA 1PGW2 2RJKA 3I59B 4R9DA 1TQ5A 2C9AA 2YROA 4I02A 2PHRA 4WM7B 3VBSB 1DGLA 3AMPA 4LULA 1QOOA 4Q8KA 2VQAA 1AF9A 4WV8A 5KHJA 1NA1A 1HDKA 1GFF2 2RR12 3VBRC 2VOKA 4Q4V2 3BTAA 1C28A 2ZX2A 2WNEA 1WCDJ 4S2DA 1YI7A 2HWF3 4JGYC 1V70A 4QGLA 1VJ2A 3B3QE 4P9JA 2B8MA 4B7EA 3S30A 4BOWA 1R093 1D4M3 3DL3A 4YZ4A 1BK1A 1ZBA3 1QOTA 5E16A 1LKNA 3WW1A 1ASJ2 3A0KA 3ZFFA 4X6RB 3HT2A 5E8AA 1PK6C 5A33B 2ZHKA 4LBJA 3HAGA 2VPVA 4CDXA 1D0GA 1YHFA 2I07B 1MS5A 1BEV2 2IXCA 3WDTA 4H14A 4F3JA 4P9YA 2LM3A 1O91A 2R1DA 4IQPA 4F83A 1KQRA 4M3CF 3WCRA 3N4MA 1N3PA 4HVOA 2X5IB 1N47A 4K8FA 2GDFA 1EP0A 3CJIA 4HVQA 2DWRA 1YCIA 5K7PA 5C8CB 3DF0A 4AK3A 2HEYF 3KCYA 2QZ3A 1OFNA 1S2BA 2OYZA 4FP2A 3LAGA 4WZFA 1XQNA 3AYEA 1LOEA 1QNWA 4CDUC 1TME1 2OZ6A 3OBTA 1O3RA 4HSLA