2OA2A

Crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
VTDHGPRPFVVNIEDETKRNRAFRRALWTGDHLQVTLMSIQVGEDIGLEIHPHLDQFLRVEEGRGLVQMGHRQDNLHFQEEVFDDYAILIPAGTWHNVRNTGNRPLKLYSIYAPPQHPHGTVHETKAIAMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BH2720 protein
publication title Crystal structure of BH2720 (10175341) from Bacillus halodurans at 1.41 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 29
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oa2A01
2IXIA 3H9AA 4K8FA 4XFGA 1YWKA 4I0BA 4I01A 5FPXA 4F8AA 5FQ0A 1VJ2A 3BALA 4HLTA 2PAKA 2UY8A 1WLTA 4META 5EZWA 3D82A 3LA2A 4Z82A 2FQPA 2Q1ZB 1O3QA 3FFQA 1ZRCA 4XFHA 1YFXA 4LUKA 5F1RA 4I09A 4JV4A 5I8TA 4L11A 4MGZE 5BPXA 4AVBA 5LRRA 3NVCA 2Q4SA 3KGLA 5I0SA 2IXKA 3RZZA 1OI6A 4Q0QA 4I0AA 4KU8A 5FLHA 2EAAA 4IERA 3I54A 4YYOA 3TNQA 4AQ6A 2O1QA 1O5LA 2MNGA 3CL1A 3PVBB 5T3NA 3LAGA 4HN1A 2Q30A 2OZ6A 4LEJA 3C3VA 2UY9A 4UXAA 1UIKA 3FHIB 2BNOA 3EBRA 1DZTA 2XL9A 3NL1A 5FLIA 2BYVE 1L3JA 3SCGA 5JCTA 3FJSA 3SMHA 3UKVA 5KHIA 3IDBB 4AQ2A 1SQ4A 1QXRA 3VHRA 2D93A 1YLLA 2PHLA 3H50A 4OLLA 3MYXA 4QGNA 4QM9A 3CJXA 2VECA 4I2OA 1X7NA 2QDRA 1X82A 3M3IA 2I45A 3S7EA 1GQGA 2ZCWA 5FQ0B 3BU7A 1ZZ9A 3HT2A 4AVCA 2CGPA 1LRHA 4IEOA 3S7IA 2XKPA 3I59A 3IDCB 4XFIA 3CLPA 3U11A 4L2NA 1VR3A 2VPVA 5LEJA 4EROA 5KHJA 1RC6A 1EPZA 1Q5OA 4IEPA 4KWLA 2HKXA 5C6CA 5D1IA 4Q29A 2PYTA 4P9GA 5I0RA 2FMYA 2DCTA 3NSTA 2BNMA 3DN7A 3PNAA 3R6SA 1YFYA 2Z2SB 4IEUA 1UPIA 4YRDA 1DGWA 3GBFA 2GZWA 2IC1A 1QY4A 3MDPA 4HSLA 3OGJA 3E97A 3KSCA 2IXHA 1YHFA 4IETA 2ATFA 1O7FA 1IPKA 4QMAA 5LRSA 5FDBA 4Q0VA 2EVXA 2O8QA 3H3ZA 4XFFA 1I6XA 4J1WA 3QACA 1CAWA 3RDIA 1HW5A 1ZZ8A 5I93A 3ES4A 2Q0AA 3HQXA 4Q0PA 2XKOA 1H1IA 1ZZ6A 1ZRRA 3ROUA 4QGMA 3S0MA 3ZDSA 1OFNA 1FT9A 4AVAA 1YUDA 3LWCA 1G6NA 3USSA 2PAEA 3CF6E 3D0JA 4MGIE 4BH9A 1CAUB 4F7ZA 1WA4A 3E6BA 5I0UA 4JTOA 4YSFA 4Q0SA 5JSRA 3DV8A 4N9IA 4LA2A 3H3UA 2XLAA 4IEVA 4XF0A 2IXLA 4BYYA 2H6BA 1ZX5A 5J48A 1X8EA 4JTNA 5FCCA 2E9QA 3M70A 3HT1A 2B5HA 1FXZA 1Q43A 3HIFA 5JSOA 3KCCA 3OD0A 1NYWA 3E5UA 4I3PA 4BIFA 2K9ZA 4XF1A 2XLFA 4Z07A 3E6CC 1EY2A 5I91A 5C8WA 5EFUA 4IESA 5E1RA 4LLOA 3RPQA 4KU7A 4MH0E 1CAWB 1SEFA 4IEQA 2WC2A 3ACLA 1ZZBA 3ST7A 1EYBA 4LUMA 3O14A 2P17A 3SHRA 3B02A 2OZJA 1YFUA 3FX3A 3L2HA 3NJZA 2QJVA 2UYAA 1X8MA 1XE7A 2CAUA 4MX3A 4LTAA 4ORFA 1CGPA 4YARA 1J1LA 3D0SA 5BY5A 4XFBA 4PIXA 3MPBA 4IEYA 1UCXA 4RD7A 4XFAA 2PQQA 1TQ5A 2QVSB 3OTFA 4HVRA 4FBFA 1UW8A 2D5HA 2GC0A 3OF1A 1XRUA 1O5UA 1ZRFA 1UIJA 1CAVA 3G7DA 1RTVA 5I8SA 4E2QA 3I7DA 1U12A 3LZZA 4ZU5A 4E2GA 4IEZA 4PJYA 3RNSA 3FZ3A 1CAXA 2D5FA 1OD5A 1DZRA 2XGXA 4D7SA 2OPKA 5J3UA 3JZVA 2PHDA 1I5ZA 3IIAA 1WGPA 1RGSA 4MV2A 3H1YA 2PFWA 4MGKE 4O9GA 4UBGA 5CU1A 3TNPB 5J7MA 3EO6A 4R52A 5BXXA 5LEKA 3QOPA 4OFGA 4J1XA 3EHKA 1J3PA 2VQAA 4XETA 5JSPA 4HSJA 4BHPA 3ETQA 1QXJA 5JR7B 1LB2A 3N4MA 1NXMA 3NKTA 4Q0UA 3WW3A 2ET7A 4LULA 2BNNA 3E5XA 4EWAA 1PMIA 4HVQA 1Y3TA 2QCSB 1QWRA 1J58A 3OCPA 3CO2A 4X6QB 2BGCA 3H1MA 3IBMA 3LOIA 3H7YA 3RYRA 1LKNA 3UKNA 3SCFA 4KWKA 1UD1A 5AVPA 3U10A 4HN0A 1RUNA 2KXLA 3WW1A 4E2SA 5CADA 3I59B 2GU9A 2N7GA 5CVRA 4XFCA 1YFWA 3GYDA 1J3QA 1SFNA 4FAHA 5KBFA 1FI2A 4GULA 5FPZA 1H1MA 1GQHA 2K0GA 4EV0A 4CYDA 4DINB 2OA2A 5KHHA 4JVAA 5HI0A 1JUHA 2PTMA 2V09A 2GC2A 3ELNA 3FE5A 1ZNPA 2ET1A 2GH2A 2IXCA 5I8YA 4H7LA 4HZFA 4QX5A 1IPJA 1ZRDA 4N9HA 4XEZA 2PAMA 2XHKA 4ZU4A 3MZHA 2GAUA 2HJIA 2UYBA 3SXWA 4X6RB 4HMZA 4MUVA 1ZREA 2F4PA 2MPFA 4HVOA 4R8HA 1ZVFA 3NW4A 4HBNA 2EA7A 4QXKA 3FWEA 3EJKA 3DL3A 3BB6A 5KHKA 3BPZA 1ZZCA 3DKWA 1Y9QA 3E6DA 3EQEA 2Z69A 3WW2A 4ZU7A 3RYPA 5BV6A 1Q3EA 5E16A 2Y0OA 3CEWA 4AXOA 4FAGA 4WBBA 1O4TA 3LA7A 4KWJA 4PIYA 5I0TA 2ZKLA 4KL1A 3H8UA 2PA7A 3KGZA 3H1WA 4QM8A 2CV6A 4QGLA 2WFPA 3SCHA 2B8MA 2H6CA 4ONUA 1NE6A 4I02A 1RL3A 5BUVA 1RUOA 2GC1A 5FLJA 5JAXA 4D7TA 4PIZA 2H0VA 4WZCA 1NZCA 2XL7A 4A2UA 4WVZA 1V70A 1CAUA 4TLFA 4FT8A 3IWZA 5K8SA 2ETEA 3RYKA 2IXJA 1J3RA 4XF9A 4B29A 3U0ZA 2GC3A 3E5QA 4IEXA 2B9UA 3ES1A 4NVPA 2D40A 2XLGA 1LR5A 1VP6A 5KHGA 1CX4A 4MZUA 1OMIA 4UBHA 4EWEA 3WW4A 2MHFA 4XF4A 3UKTA 1J59A 4IEWA 3H7JA 1DGRA 4LA3A 3LA3A 4EWDA 1EP0A 1O3SA 2QNKA 4YNIA 3KMHA 3BCWA 4XF3A 2C0ZA 1NE4A 3PLQA 1O3TA 2BEOA 4O9EA 2OYZA 1CAVB 1ZZ7A 1XE8A 1O3RA 2CAVA 4MGYE 1PM7A 1CAXB
chains in the Genus database with same CATH superfamily
1ZA4A 2WWUA 1C3HA 4K8FA 2EXJA 2JDMA 1QNYA 4RS5A 3IB3A 4I0BA 1MS1A 3OBRA 1XNCA 3M8LA 1VJ2A 3M3EA 2WNUB 4NMIA 4HLTA 2HWF3 2P6CA 4WVMA 4INDA 4META 5EZWA 1NLRA 3IPVB 1GKBA 3RZGA 1ZRCA 4Z2AA 1YFXA 1FATA 3ILNA 4U2AA 1RHI2 5FXVA 4BCUA 5I8TA 3MPPG 4YFWA 2VMIA 4MGZE 4D6SA 1HB4A 3WNPA 4AAPA 5T50A 5LRRA 2X10A 2Q4SA 1H1AA 3KGLA 4YW7A 1ASJ1 3AZVA 5FK8A 4CCEA 2PMWB 1GP4A 5FLHA 4YVSC 1PO11 4CXYA 3MW2A 4YGEA 1LU1A 1PHMA 4X8NA 5A3NA 2WQZC 1O5LA 3OBTA 3ZXLA 4LBLA 4L0PA 5L36A 3WG1A 3DKQA 4NIIA 2ARXA 4UW4A 4CRQA 3POBA 1HX6A 2OZ6A 2OUJA 3C3VA 2Y6FA 3BOWA 2GP5A 1GLHA 1UAIA 2QTWB 2SBAA 2CDPA 2VULA 2WSVA 1S0EA 5JZGA 4EE2A 4CUGA 4OMCA 4ARYA 1UY1A 3OGGA 1N1YA 4RYDA 1ZA7A 3AZZA 3VBHC 3O1UA 3JD73 4NRMA 4AE2A 2QQWA 2NZ9A 3FJSA 4LBNA 4Y20B 5JOWA 5J37A 4RQPB 4TTGA 3D4KA 1GZCA 3VBSA 4RHV3 5KHIA 3BIEA 2ZGNA 1REEA 1SQ4A 3ETPA 2DUQA 1UOFA 3N9OA 1EAH1 4AEDA 3WT3A 4AVVA 4OLLA 3H50A 4K21A 4N53C 5DG1A 4WM7C 2WQ8A 4BJ0A 3WP6A 1YCIA 4BZ4A 2QDRA 1IG3A 5IW0A 1QGLA 2EAKA 2RS13 3M3IA 3PUQA 1F2NA 3GHMA 4PF5A 3S7EA 3B94A 4AVTA 3BTXA 1MS4A 3WP4A 3UGGA 1GFF2 4JC1A 1G9DA 5DAQA 4EN0A 3SNMA 3LOBA 1N1TA 4JZRA 2XKPA 5T55A 1AR92 5A3MA 5LA0A 3M3CA 4YW1A 3V0BA 3U11A 2DF7A 4L2NA 3J7NA 1H2LA 2IFWA 4IE6A 4XPVA 1ENQA 3S5QA 4EROA 3BTYA 2ZGRA 3WEZA 1Q5OA 4IEPA 3VDBA 1BYHA 4C1WA 1G9FA 2CHHA 5K9YA 3N7LA 2PYTA 5I0RA 3B5LB 3ZXDA 1O4YA 1C4RA 1AHSA 2CNAA 4CP9A 2L9LA 4DQAA 4K1ZA 5JOXA 4PLNA 2WLPA 3BOPA 2I74A 3TN92 1K5MC 2Z2SB 1UMIA 3VKLA 4IE7A 5HCFA 5T5OA 2WWJA 1O3TA 2ZGOA 4AZZA 4DUWA 5AC92 1HV1A 1DGWA 2DV9A 2ZGLA 3OEAA 4QX1A 5A32B 2VCMA 4NIAA 3RSJA 2BWCA 2AUYA 2E63A 2G4IA 1IG0A 2WSUA 3W5MA 2JDZA 3FC0A 3KHCA 5KXDA 4XUNA 3E97A 3KSCA 3ZSLA 4CEWB 5IHRA 4FPJA 3O1VA 1FNZA 4IETA 3T2OA 2ATFA 1O7FA 3GALA 4PHZA 1H8TB 1F15A 4AOCA 4QMAA 2RVAA 1C57A 1GSLA 4C91A 1JBCA 5FYMA 1ND2A 4PCRA 5FDBA 2YBKA 2E51A 4DRRA 1OUSA 3T09A 1W0NA 5FXZA 2OQ7A 3ZN5A 1M4WA 2ZX2A 2Y6JA 1KFXL 4Y5SA 3WR0A 4H7MA 3QACA 2D6OX 2J1EA 4YVWA 3LQCA 3THTA 2WBKA 3OYWA 1VB4A 1XXNA 4K1YA 1E5HA 1F4HA 3IIIA 4HETA 4WVVA 3HAGA 2P3KA 1IS3A 2VZRA 4UYBA 3ES4A 2Q0AA 1NCRB 1UO9A 1CQ9A 1JS9A 1NG0A 3NV1A 3UL2A 5FMBA 1WCSA 1H1IA 2XKOA 3CJIC 3KVBA 4XBLA 4RA0A 3ZSMA 1AR62 4IV3A 2Q1MA 3ROUA 3MLKA 4QGMA 3V65A 1LAJA 4DUXA 5JR2A 4M3CA 4CDXB 1SLIA 1YUDA 3NNLA 4GA9A 4XBQA 1G6NA 2CL2A 5FZEA 3USSA 2E7AA 1Z7S2 4SLIA 2HWC1 1N3PA 4MGIE 3WQ0A 1PIV1 2CYFA 1CAUB 2AYHA 1WA4A 5A1LA 3E6BA 3POIA 5F3GA 1SDWA 2JKXA 1RUD2 4JTOA 4YSFA 3VHPA 2W68A 4LA2A 3PU3A 4R9CA 3WNNA 4OHWA 1RIRA 1VBD1 3I3EA 5D21A 5DAPA 1KJLA 2YMZA 4XF0A 2G19A 5JUVA 2Y60A 4LBQA 4BYYA 1ZX5A 1BZWA 5AFBA 4L9BA 4AHXA 1OVPA 3SEPA 5FCCA 2OPWA 1EV13 1OURA 2B5HA 2ZS6B 4XDQA 1OC1A 1Q43A 3KWVA 1DBNA 4BM8A 4HXCA 1H6YA 2ZEYA 1V6MA 3KCCA 2YGLA 1DFQA 3U4XA 3A0NA 5CYYA 3TEYA 4XF1A 3LDKA 1PO21 4QQHA 3T30A 4Q1RA 2F17A 4CEYB 2P34A 3HNYM 3OGVA 3WNXA 2NP0A 1A3KA 5I91A 1QEXA 5HCHA 5F39A 2JEMA 2LALA 4LKSA 3AB0A 1AX0A 4UOJA 3UJQA 4LLOA 3RPQA 1VRH3 1JOBA 2BZDA 5FP9A 3WP3A 2RDQA 5BNNB 1XNKA 2EICA 1XNAA 1CAWB 2WS93 1QJU2 4AFMA 4PDWA 4OI1A 3VZOA 3WNOA 1SBEA 1CR7A 1XYPA 2VXRA 2OZJA 2X5IA 4URAA 2R071 3FX3A 4B4RA 1K3IA 4LHKA 5FUPA 4Z92B 4D8MA 1MS5A 2BGOA 1QJZA 2CAUA 5DAVA 1JYVA 1H0BA 4YLZA 3VD5A 2RS53 5GZGA 4PQQA 4TXWA 1MACA 1AR83 1A8DA 4XUPA 4XFBA 5C9AA 4PIXA 4IEYA 5F9TA 3IDEA 3LIHA 3ZMNA 4RD7A 3HNMA 4XFAA 3VZKA 2PQQA 2BUKA 2JDAA 1ULCA 3I8TA 3GJBA 1YJLA 4HVRA 3VBFA 4DOUA 2BQPA 4BK4A 2D5HA 1EUUA 2GC0A 3OF1A 2D6KA 3AKSA 3HJRA 1LGNA 3I2JA 1VBC1 3WF1A 4NIDA 3I2OA 5A3LA 1QJX1 5CFCC 5C8CC 1RTVA 4HOOA 4X8PA 1V0AA 3LZZA 4LO4B 3VDDA 4GMP1 4M01A 4ZU5A 4LHNA 4XJZA 4E2GA 4PJYA 1RUJ2 5DZEA 5FYTA 4QPGC 3HNBM 4KI5M 1RVF2 5H9RA 4GB32 4QDQA 2OPKA 4MOAA 3WF3A 5FZ8A 4AHWA 3THCA 4YVSB 5DDJ2 1I5ZA 3IIAA 3C7HA 2PFWA 4MGKE 2JG8C 5FZ7A 4EN6B 5J7MA 4JX0A 3LDRA 5M0TA 4K8RB 4LITA 2RG4A 1XNTA 5BXXA 3WDUA 4AGRA 4XJAA 3LB9A 1XSQA 3IPVA 5JXHA 3E1F1 3RJ2X 4AQSA 2WFF2 3W5NA 1RUG3 3HEIA 1L7LA 1ONAA 4BHPA 4DZGA 4PF1A 1PGL1 5JI7A 5FYYA 2WO1A 5D2AA 1AXKA 5LY2A 2VMDA 3EB7A 4Q0UA 4YM1A 3UJOA 3WW3A 1VBB2 2BNNA 3ALQA 4EWAA 1I3HA 3PJYA 1QHDA 2WZ8A 2DURA 2WQ4A 4FP3A 4PBPA 4W65A 4DIQA 4ITCA 3VN4A 2EIEA 4QPIB 4YZ3A 4ZKTB 2JWPA 3ITQA 1C8M2 1D7PM 5T52A 4FVVA 2VZ1A 3WZ1A 1MPXA 3JU9A 1PZ8A 1AZDA 3POWA 5IFTA 3LOIA 5FIXA 3FHQA 4XUTA 1YIPA 3UKNA 4KWKA 2HWF2 5FXWA 4FOVA 1W6MB 2VO5A 3A22A 4HK9A 1H4HA 3OY8B 3PTYA 4Y20A 5JXGA 2AEZA 1TG7A 1ENRA 2GU9A 4RQPA 4D0QA 1UZZA 3DPRC 5IYYA 1PK6B 3D8CA 3OUHA 2VUAA 3MI8A 3AFKA 1JU4A 2R063 4NWVA 1MEC2 1FI2A 4HK8A 3JBG2 4DXZA 3GGLA 1V6JA 1GQHA 3AJZA 5J1XA 3RVHA 1Y4WA 5IUQA 1DQ5A 3ILRA 1ND3B 4FOYA 5DN2A 1JUHA 4R4XA 2PTMA 3DGTA 1J1TA 2WABA 4I3GA 4TWTA 5E89A 1UU5A 2BBAA 1ZNPA 1SFYA 5FZIA 1OLMA 3BPSA 2WNVB 3CKHA 4NPRA 4GH4C 3VBUC 3ZN4A 4AWDA 4Q5OA 4BQYA 2Z42A 4HL0A 2R1DA 3CIHA 1AVBA 1NA1C 1U5IA 2WAAA 3HR9A 3DXTA 4QX5A 1ULEA 2WZR1 4AEKA 4ATEA 1M06G 2JDYA 1BMV1 3JD72 3FFZA 2B4KA 4ZU4A 1MS3A 1W2NA 2HJIA 2BRTA 4X6RB 4LE3A 4HMZA 4MUVA 4FP2A 4QDRA 4RHV2 1DG6A 3BI3A 1HQNA 4HBNA 1DGRN 1KEXA 1LHNA 1OF3A 1C28A 3RZHA 5A32A 4V1PA 5FMCA 3K75B 3DL3A 3HQRA 5KR7A 3BB6A 4JGZC 3O1SA 4ARXA 1RUC2 1OPOA 2I07B 2UU8A 1W0OA 4CDUB 1N47A 1Y9QA 1YQ8A 2QUOA 2XVKA 2Z69A 2RS12 2E53A 4CEWA 2VGDA 3VBRB 5BV6A 1HDKA 3ZDVA 2Y0OA 1H8TA 3CEWA 2WDBA 2C24A 1OPMA 2QQOA 3FLTA 2F4LA 1O59A 5H9QA 3WDYA 2ZZQA 5FYVA 1YI7A 1HB3A 4KL1A 3KB5A 4E4ZA 3K51A 1R091 3H8UA 3NWKA 1POV3 1RXGA 2G9FA 4Q2FA 4QWNA 2ORXA 1BQPA 1BVVA 4QM8A 5IVEA 4UFKA 4TLGA 3GBWA 3CMGA 3NV3A 4QGLA 1TNFA 2VZTA 3ZN6A 2ZGQA 4LO5B 1NCRA 2ZAHA 1HLCA 1DYOA 1NY71 2ZHNA 5FPBA 3VGIA 4CXXA 4MHUA 5I0DA 2EIGA 4B7KA 1BBT2 1JYTA 4QKFA 1T2XA 3AMNA 5JAXA 4FI9A 5LBCA 2R32A 3PIGA 5A7WB 4CDXA 3ZIWA 2VMGA 1GMMA 2VQUA 1MR5A 2IFRA 1WBFA 3AMPA 3H3LA 5LA2A 2W91A 1WUVA 1N3OA 4FPHA 4BISA 1CAUA 5C4WB 4TLFA 1WLDA 2VU9A 2Q8DA 5A1FA 2JIGA 1CESA 1CWPA 5CFDC 3H8XA 1JZ4A 1RUI2 1FNYA 1W6OB 3KF5A 3IWZA 2HWD3 3PU8A 2KA3A 2DVAA 3RYKA 4XDPA 1J3RA 4UFHA 1SCSA 4KH9A 1HXS2 4DO0A 5FOBB 4P9WA 2GC3A 3U0ZA 2HH9A 2VOWA 3ES1A 3INAA 4QHOA 1KDKA 5EJ1B 3MHZA 4OQ8A 4FPYA 2GN7A 2VOTA 5A7OA 1O8PA 3TN93 4UFIA 4JGYB 2GNTA 3POSA 2ZEZA 4Y1ZA 4MZUA 4CCKA 2OW4A 1OHFA 4UBHA 1UZ0A 4XF4A 1DQ4A 3SH5A 5HXMA 4P02B 3AL5A 3B9IA 3THDA 4CEYA 2ZMNA 3AZXA 4LA3A 2VMHA 4WZFA 2BFUL 5HCBA 4N90A 3ZFGB 1GOGA 2J1AA 3KHBA 1NQJA 5G05L 1US3A 1W9YA 1O3SA 3OOXA 4UW5A 4XF3A 5FUIA 4R9AA 1NE4A 5JXJA 3KM5A 2OYZA 1CAVB 1ZZ7A 1B35C 1X36A 1AJOA 1XNBA 1O3RA 2UWCA 1XNDA 5CFCB 1BLZA 4QQOA 4E27A 1JZ6A 3Q8EA 3ZYIB 1IS5A 1WD4A 4UFLA 5FZOB 1PM7A 3DYOA 1CAXB 5EPAA 1AL21 4DY5A 4KQ7A 3CDZB 4XFGA 1EV12 1AR63 4KMQA 5FPXA 4F8AA 4GXLA 1GP6A 5FQ0A 5LASA 2DVGA 2IWGB 3BALA 1HKDA 2Y34A 1VRH1 3J7MA 3LSDA 3MICA 4NUBA 4BU2A 1XB9A 1WLTA 3NV2A 2D7FA 3LA2A 1PVXA 1AXYA 3AP5A 5LA9A 3TEWA 2W3JA 4Y33A 3FFQA 1Z7S3 4XFHA 2YHJA 3N7JA 1YRZA 3KT7A 3TOJA 5F1RA 4I09A 4N43C 2P3YA 3L9JT 4UFJA 1RUD3 3BIWE 4UF0B 1LU2A 3N3HA 1UYZA 1YO8A 1BEV2 4RS5B 1OI6A 2RS51 4FOWA 1F5JA 1MQTA 1N1SA 1PM4A 2WS92 5SV5A 4EZHA 1W99A 3D3AA 3I54A 5H9SA 2X8KA 3L2YA 1W28A 2A6ZA 4QDSA 1R082 4HONA 3CL1A 1W6QB 3PVBB 1OUXA 5A3PA 3ZSJA 5T3NA 4CCDA 4W6YA 1RMU1 2LUWA 4HN1A 5GLZA 2A71A 2UY9A 3H8OA 2W9XA 4NWWA 2VAUA 1FX5A 1QJY2 4CUCA 2RE9A 3AKPA 2BOIA 4XTMA 3POGA 1QOOA 1NX9A 1DZTA 1ZYBA 3NL1A 1DQ2A 1FOD3 2BYVE 3WNMA 5CA6A 2JXAA 4NPLA 5JCTA 3MIGA 2VOKA 2VTFA 4OHYA 3GF6A 1W8HA 3BODA 3KF3A 3R4DB 4MXVA 1US2A 5FPVA 3WG3A 3MIHA 2A3XA 2BPA2 1QJU3 1YLLA 2A73B 2PHLA 4NAMA 4QPIA 5JI9A 3MYXA 4QGNA 4QM9A 3CJXA 1IHMA 2VECA 2XHNA 2PLV1 2TUNA 5CISA 1HIXA 3JB8A 3HD8B 1X82A 1WCDJ 4CZSA 3POYA 1GQGA 1NKGA 4Q4W2 5L9BA 4JDNA 4XBNA 2XB6C 4K40A 1ZZ9A 3HT2A 4AVCA 4Q4Y2 2NQYA 1LRHA 1W6MA 2XBO2 4R9DA 2XJSA 5FR3A 1W3VA 2FZ2A 3ZFEC 3J4UH 1QH7A 3LEIA 4JHZA 4A3ZA 4LBMA 4GH4B 3H0OA 4D7YA 1VR3A 1PK6A 1UZVA 2VPVA 3PDQA 1RUG2 1LGBA 2XMLA 1GZWA 1C1FA 1D4M2 1EPZA 3K3NA 5FZDA 2PHRA 3ME2A 1UWWA 1W8UA 5C6CA 5D1IA 3JQWA 2C1FA 5D8AB 3GHNA 2D3SA 3N7MA 4EJRA 1SHWB 3LKJA 3AFGA 3ZOIA 2VD7A 1JZ2A 3PNAA 3TAYA 2RS32 1RUJ3 1ND3A 1WD3A 3U37A 1RVF3 4IV1C 4KGQA 4PQ9A 4GB33 1CIYA 4RN5A 4XJUA 5GJ6A 4AI1A 1R1A1 2BGPA 2P4EA 2DDUA 5A6XA 5DDJ3 3MDPA 2FDKA 2B7YA 1GOHA 2O0OA 2WNVA 4HSLA 2WA4A 3RMXA 2YC4A 4FQ4A 2IXHA 1YHFA 3VBOB 5LATA 2R061 2OXBA 1JTZX 4OI4A 5FKBA 3LFIA 2WZPP 5LRSA 2AEYA 2DVFA 1OVSA 1W2UA 1KS4A 3FN9A 4QT6A 5FZLA 3B93A 5A33B 4XTPA 4YZ4A 3ZR5A 4Z8BA 2RJKA 4RGKA 3W9AA 4COYA 5LBBA 2G9ZA 2ZABA 3BTAA 4LORA 4XFFA 4YGDA 1I6XA 4J1WA 4OZXA 3WVJA 4Q27A 3CHXA 4XCAA 2VUDA 3CZJA 3F2ZA 1VBB3 1GZTA 4XJ8A 1S1AA 1ZZ8A 2O14A 3RWKX 4AW7A 1IOAA 2B39A 3HQXA 1LOAA 3O7OA 4CDUA 1VALA 1QJEA 3ZYHA 2V5DA 4OUEA 5A7SA 3VBRA 2XJVA 5ACA3 3UYJA 1WKYA 4P9LA 2ARCA 1C8M3 1ZRRA 2E26A 1DDLA 5C5UA 4XDOA 3ZDSA 2VE1A 2JG9C 3HWJA 1RHI1 1YI9A 4XHXA 5FV3A 1OQEA 5A3WA 4BQWA 2ES3A 4AVAA 3RZJA 4M3CE 4YW5A 3OG2A 5F6KA 1QMJA 5LA1A 2D6MA 1J84A 5LBFA 3VLBB 4UT5A 1OXCA 2HWE1 2P37A 2PHFA 4F7ZA 4CDWA 4IQPA 1OOPC 3B00A 3POFA 1DYPA 1SMVA 2RV9A 3FMGA 1O6UA 5FYBA 5C7GA 4N9IA 3C7OA 1CX1A 4NOTA 5C71A 1W6PB 5CFDB 3H3UA 4MSVA 5F32A 1MEC3 2RMU2 2VTXJ 3JBG3 4COUA 2E33A 1W2AX 1ALYA 1XC6A 2IXLA 2H6BA 1W03A 2HYXA 4QXCA 5FKCA 5J48A 5L19A 2A70A 4B8EA 5A7WA 3AKRA 3A23A 3AYCA 3HT1A 5F5QA 4BLJA 1POV1 1UZWA 3WG2A 3HIFA 1UOGA 4C90A 4JDMA 5EQUA 4M00A 1OLRA 4I3PA 3K77A 4CU9A 5FY9A 5C4WA 1ULGA 4Y26A 4LO8A 3P6BA 4BMEA 4MYEA 3RRDA 2XLFA 3KT4A 3WQ1A 1CJDA 5JVVA 1W6OA 1SACA 2ZGMA 2ENRA 1DLLA 3DYPA 3OPZA 1OF4A 1NLSA 4F83A 1H8VA 2IZWA 2OX0A 2RJ2A 4KU7A 4HPKB 2HBTA 1RXFA 1E5SA 3WHUA 1SEFA 4IEQA 3ACLA 1ZZBA 3ZXAC 3C7GA 5K0UB 1EYBA 2VBDA 2YB7A 3SKJE 5BNPA 1GOFA 3O14A 4JGYA 3CU7A 1YFUA 5DAWA 4EQVA 1JW6A 4L97A 1AR91 4FQZA 4Y22A 5A7PA 1RUC3 3NJZA 5F3IA 2QJVA 1UX7A 3U07A 3WUCA 1FYUA 1XE7A 5BNOB 5FMDA 3OBAA 4ORFA 4OZOA 3N35A 4RR3C 2V4VA 1F5FA 3ZFGA 3D0SA 3T1LA 1U0AA 3MPBA 5FBJA 4S2DA 4BXFA 3EXUA 1VAVA 2AH2A 2VZQA 1TQ5A 3IAPA 3OTFA 2VTXA 1ACCA 2EIBA 2BFUS 4BQ1A 2RR12 3NO8A 3FHAA 1SBDA 1CAVA 5AC91 4DUVA 3NAPC 1O4ZA 2HWD2 3PVNA 1A8MA 4CP1A 3MF6A 4LXLA 5FZOA 5L7OC 1PVC2 4P14A 1S2BA 1CAXA 1U5XA 1AXZA 2D5FA 3WP5A 1FPN2 5C3PA 2XGXA 4D7SA 2ZJCA 1NAEA 1REFA 1W9SA 4EYUA 2V73A 4XC9A 5F37A 1BBT3 2GSYA 4MV2A 5FWJA 4O9GA 3I2KA 4UBGA 3LPGA 4BE3A 4CDQC 5FYZA 4LIVA 1DGLA 5FZBA 1FMD2 2VMEA 2AZ5A 1AJKA 1SLBA 1SG3A 5FYSA 2TBVA 1MS8A 1L7QA 3AZWA 4XETA 4YW2A 3URFA 2VUCA 3VKMA 3LIGA 1P8JA 1UY2A 2HWB2 4HSJA 3WNKA 1UPSA 2W92A 4UF0A 1HRI2 3ETQA 1RUI3 1DP0A 4F3JA 2WKKA 2D44A 2J1SA 4XVHA 4URTA 3N4MA 1MZ5A 1DIWA 2J1VA 4IDZA 1AR61 1KITA 3WSOA 1AYN2 1HXS3 1KQRA 1DCSA 2DTYA 3E5XA 2HEYF 5A80A 4P5HA 5LWBA 5EYYA 1S0JA 3RS6A 4HVQA 4W8JA 4LE4A 1W6QA 1Y3TA 2FCVA 3MIDA 4KWUA 5IVYA 2YUEA 2DBIA 4BA6A 3ZSKA 4AHYA 3T0DA 1QWRA 2A6VA 2JIJA 3IN9A 3OCPA 3CO2A 4Q26A 5IK7A 2BGCA 4WM8B 3H1MA 1UL9A 4BWOA 4AFCA 4CPBA 5H9PA 1B09A 3IBMA 4YM2A 1O91A 2EXHA 4FXKB 5FP4A 4G4FA 5FZMA 1YXWA 1LKNA 4JRAA 1SLCA 1RUD1 1U5ZA 4FFIA 2VVEA 4MHRA 4QQ2A 2OVUA 5AVPA 3UNPA 4HN0A 3TEZA 2KXLA 3WW1A 4E2SA 2WWSA 3I59B 5IK8A 2QQJA 1NXD1 4N7IA 4XFCA 3ZFFC 1UF2C 3VHNA 1L7RA 1Y7BA 1W8OA 5F5AA 5F5IA 3VB9A 5FZ0A 2V4AA 5JXIA 2XUMA 4FAHA 5KBFA 1NCQC 4OHXA 1UQXA 5DQ0A 2ZX3A 5T5LA 3VL8A 3O1OA 4GULA 5FPZA 3O1MA 5CG8A 4QQLA 5FZGA 2D98A 4CPBD 2OQ6A 2Q8OA 4LO6B 1UNBA 3BYWA 2QQVA 3KD4A 4DINB 1GU3A 4JVAA 3A7QA 5HI0A 2W0XA 2V09A 4AI2A 2C9KA 2GC2A 2RDRA 4MADA 2VNVA 4BLIA 1C5IA 2QFEA 4JCKA 4XJ9A 5ABJB 4FTEA 3PMSA 1ULFA 3ZXEA 4CDWC 4CUBA 4BQ3A 1OLME 4IL7A 5L9VA 3LD8A 3K48A 3KV9A 4W6XA 2QKDA 5ERLA 4G3YC 1NOVA 3MO4A 1QJU1 2AR6A 4H7LA 3K4AA 3QH6A 1IPJA 5IVCA 3KS7A 1ZRDA 5FP7A 1FOD2 5D8AA 2WIIB 2PAMA 1EPWA 4ZXEA 2XHKA 4AI8A 2W1SA 1Y43B 2UYBA 3LF7A 4OULA 1ZBE2 1BKZA 4EN7B 5FOJB 5FPUA 1LJ7A 1ZREA 3IT8A 5FO8B 1S55A 4R8HA 1U5YA 1BEV3 1MS0A 2DTWA 2EA7A 4BQ2A 4MGSA 3RMYA 1TVGA 3FWEA 5FZ3A 4JAAA 1MZFA 3KLSA 3BPZA 1S0FA 4P00B 1R083 2OS2A 5DUXA 3SISA 4A6OA 4YZ2A 1V6IA 2BWAA 3CQOA 3RYPA 5CKNA 4LBJA 5E16A 3VBOA 3AMHA 3U75A 1UY0A 1W04A 2OIIA 3C7EA 5JZGC 4WBBA 5FPLA 4AI3A 4GWJA 3KCYA 1QJY3 3PIJA 1AX2A 5FZCA 2AREA 5E88A 3PUHA 4FOQA 4A3XA 1PGW2 1RUJ1 3VBSC 4Y1YA 2DCKA 1D4VB 3BTZA 2FDFA 4GB31 1HJGA 1QDOA 2PA7A 5BNPC 4LO7A 3FBYA 3FBMA 5CKQA 1E57A 3USUB 4CXWA 4Q8KA 2WLQA 4AEDC 4YM3A 2WFPA 4FXGB 1LOGA 1TMF2 4CCOA 1RB8G 2GDFA 2B8MA 5EIYB 2MEV2 4QKDA 3WQ7A 3DYMA 2A3YA 2VUJA 3ZMOA 5BUVA 4HFSA 4W50A 3GZUC 2BU9A 3WV6A 1V9U2 2WFF1 3ATGA 4B4QA 2ZMKA 2P3IA 2GNBA 4D7TA 4Q4W3 2H0VA 4XAAA 3O0XA 2WNUA 1JOPA 1NZCA 3WUDA 1D2QA 1OSGA 2BW8A 2XL7A 2ZGPA 4NR1A 4Q4Y3 5FZAA 4COWA 2XBO3 1XU2A 2JKBA 4XILA 3LCPA 1W90A 1VBB1 3W20A 1DU3D 1W05A 3AC0A 4ZPIA 1NUKA 3GM8A 3N7KA 2UURA 4MVTA 4XIOA 5JMOA 1W6PA 1D4M3 3BGAA 2ETEA 2R0HA 4KBZA 5FY5A 3V0AB 4GWIA 3IDAA 4XF9A 1F35A 2GH8A 1C8M1 1UXZA 1Y9GA 2ZXQA 3OJBA 4S2GA 3ZKUA 3VBHB 1AX1A 4IEXA 2PELA 1W8NA 2DFCA 5GZFA 2OUHA 3WG4A 4ES9A 2XLGA 3RJRA 2B46X 2RS33 3K46A 4MXWB 2HWF1 4LHLA 1BVP1 5FREA 1CX4A 1HN0A 1WBLA 4E9KA 2R30A 4EWEA 3JUUA 5ACA2 5F3CA 4Q4V2 1UU4A 4N53B 3WD5A 3M3QA 4WM7B 4JDOA 5E8AA 2VVDA 1ST8A 4KG0A 2Q5TA 1ND2C 3LFMA 4LK6A 1SDDB 1UU6A 3GCWA 1SPPB 3AMQA 1MEC1 2DU0A 2R1BA 4EWDA 4QX8A 3JBG1 4YW4A 4OHZA 5CB7A 1W9WA 4YVWC 1GZ9A 1UYPA 3BCWA 2PHUA 1OFSA 3LSEA 3OPTA 4HPKA 2ARAA 5AFEA 2NMNA 5K0UA 2J1RA 4P9IA 5FY7A 3POJA 1COV3 4EN9B 5F6LB 4AEJA 4Y5TA 4IV3C 4AVSA 1I1EA 4MGYE 4R4ZA 1YYNA 3H42B 2D6LX 3T4HB 2VL4A 4XZUG 5BNOA 4LKFA 5DG2A 4A45A 1V6NA 1NQDA 4I01A 2ZPXA 4Q8LA 5ANQA 3M2MA 5L73A 1K5MB 3T1MA 3WX5A 1E5RA 3JD71 3MLLA 2WJSA 2UY8A 5KWRA 4LNVA 4XUOA 1N3QA 2R49A 4RHV1 4Z82A 1S0CA 2FQPA 2GNMA 2Q1ZB 4P9XA 4AQTA 2XJUA 3IKWA 3PUIA 5FZ1A 4UW6A 4RFT0 3T3YA 4Z1VA 5FK7A 5FY8A 5C3RA 1IQAA 2ZAAA 1F31A 4JV4A 1AR72 4L11A 3ZX7A 3P1IA 3S5AA 1RUC1 4FFFA 5BPXA 4ASMB 4UFMA 1AF9A 3NVCA 1LTEA 3ZYFA 4AFBA 4AR2A 2RS11 1VAKA 2IXKA 4OQ9A 3RZZA 2HEVF 1Z78A 4FPFA 2YC0A 1WA6X 2EAAA 2R0FA 2RMU3 4I0AA 1OLQA 4IERA 1OKQA 2GMMA 4XYXA 5FXXA 2FCTA 4AQ6A 5K7PA 2XDVA 3VV1A 2MNGA 5HV0A 5LB6A 1STMA 5T54A 2VBPA 3J7HA 2Q30A 1K12A 1UY4A 2QQLA 4WVWA 1X9PA 2ERFA 4UXAA 5TSWA 1UKGA 3CJIB 2WNOA 5F2WA 3IAQA 4E4HA 4FTBA 4B7EA 1PX3A 1ULOA 2A7AA 2WO3A 3NNGA 5JIAA 1R64A 1RJ8A 2XL9A 1CZSA 3MIBA 4NIGA 2VXJA 3WF4A 1K45A 2NMOA 1W8ZA 5FJHA 3DECA 4I0WB 3UKVA 4PDWC 3IDBB 3ZFFB 4AQ2A 4C8DA 2WZR2 5JLVA 1JYNA 2X5IC 3VZMA 4Q1PA 2D93A 4PI0A 1YQ6A 4FFGA 1XOYA 2C5DA 4QXHA 4NHYA 4WM8A 2GN3A 5CNAA 4LK7A 5FZ9A 1LOFA 2ZHKA 3R0RA 1H6XA 5KXEA 3WNLA 2I45A 5DUWA 4AFDA 5C9AC 4NJ4A 3LDBA 4TYSA 3T2PA 4MG2A 1RUI1 2XWBB 3BU7A 3PL0A 5GLVA 1S0DA 3UK9A 3MGUA 3VBFC 1QNWA 3I59A 4KBBA 2A6YA 3S6PA 5GLWA 4I30A 3CLPA 3WINE 4DEQA 2FDHA 5LEJA 4GIQA 4EN8B 3I3DA 5IVVA 3U78A 5KHJA 4A42A 1X9TA 3VDDC 1APNA 4KWLA 5G04L 2RR13 3LPFA 5F3EA 5FY1A 2FMYA 4B3NA 2DCTA 3NSTA 1R092 2BNMA 2DCYA 3K3OA 3UT0A 2YXSA 2AENA 1WCUA 1PVC3 3R6SA 5JPMB 5C70A 1FPN3 3J8F2 3ZIXA 4W6WA 1VBE2 4D6QA 3GBFA 5ABJA 2GZWA 2CU5A 2IC1A 1KGYA 2RM22 3MW4A 2R6QA 3IZOA 3M3OA 1YQCA 3OGJA 1WW7A 4XQ4A 5FJKA 3POEA 4DXSA 2H0BA 1OH3A 3AP4A 1FMD3 4YWAA 3VKOA 1PMJX 2XUEA 1DF0A 4H55A 4S2FA 5EHDA 5JZGB 3I49A 2VZ3A 4AGGA 3JQXA 2EVXA 2HWB3 4XIKA 1H9WA 2VVFA 4MGTA 2O8QA 1HRI3 3H3ZA 3WDWA 1JXNA 3T0BA 5BNNA 5LEKA 1EV11 3K4DA 1CAWA 3HPNA 1PGSA 1AYN3 3RDIA 2Y6GA 4AI9A 1H2MA 1HW5A 2VC9A 2CWSA 2ZGKA 3D5OA 4RGGA 4V2VA 4DB5A 5I93A 1URXA 1IGOA 4Q0PA 4UI9L 2Q8CA 3X29B 4BK5A 5C8CB 5HV4A 4FTSA 2VCAA 1G9BA 3AVSA 2UWBA 3AXEA 1VMHA 4QB2A 1RUE2 4QPGB 3S0MA 1QXPA 4YG3A 2TEPA 4XZPA 5FPAA 2VQTA 2DYCA 2QZ3A 4RQPC 4OYUA 2X05A 2JG8B 5FZHA 4GJYA 2QQNA 1BEV1 2PAEA 3CF6E 1NT0A 2BERA 2WS91 2QDNA 3USUA 4XQWA 5I0UA 3AMMA 1YNAA 3UESA 1LECA 2XJPA 1VBA2 4Q0SA 4WV8A 1G8WA 1QJFA 3NNJA 4MGQA 2XQRA 1XYNA 5FYUA 3SEEA 3Q8AA 1GNHA 2X53S 1HRV2 4CU8A 3WDVA 2IVJA 1QJY1 1JUIA 2X09A 2YY1A 1AR81 3HOBA 1KS5A 3ZYGA 1X8EA 4YVSA 1FAYA 3M70A 5IAXA 1Q8OA 2BV4A 3KT1A 3NMBA 3BUCA 5LK7B 4COVA 3QLQA 2QQMA 1T6GC 3B01A 1JYWA 3A21A 2XH6A 4YG6A 2VZUA 1AYM2 3RG0A 2K9ZA 2QQUA 2W2IA 5EV7A 2ZEWA 1W9TA 3J9SA 3RI8A 5LBEA 2W47A 1POQA 3APBA 2WO7A 3I2HA 2NPIA 3C2UA 4Z07A 3LEKA 1EY2A 5CKMA 5C8WA 5EFUA 5IWFA 1OA3A 3V0AA 5T5PA 3AVRA 5EP9A 2ZHMA 2ZGSA 3B7MA 2XVLA 1YEWA 3K4ZA 2C26A 4IESA 5E1RA 3VBHA 4CP2A 2Y8KA 2YGMA 4MH0E 5IK4A 1ZBE3 2JECA 2NYYA 2DFBA 3JXSA 2VBBA 1LEMA 2E7QA 2PHTA 5GZDA 2WC2A 4Q4W1 4DS0A 2VH9A 3DPRB 4MXWA 1RUH2 1JU3A 4LUMA 5J09A 1GWLA 2P17A 5FP8A 3NNMA 4Q4Y1 4CEWC 1QQP2 4PBOA 2WL1A 3BU0A 2PHWA 4QPYA 3LEMA 3L2HA 2B42B 2J7MA 1H8TC 1VBD3 4N53A 4WM7A 1HB1A 1S2EA 5T5JA 1X8MA 1W8TA 5DUUA 1RUG1 1D4M1 4LIUA 4YARA 1SPPA 3OSDA 1JI6A 5B2GB 2XPJA 1Y9MA 2BTVC 1RMU2 2G1MA 3AK0A 4A7ZA 4XURA 3OY8A 4Q4X2 3ZYBA 2VMFA 5LY1A 4CU6A 1GP5A 1JH5A 1UW8A 4ZONA 2KD7A 4HKOA 1O5UA 3VBUB 1UIJA 4LMFA 1WMEA 1NCRC 1IPSA 1ZM1A 2QBXA 3G7DA 5KC5A 4O61A 1XE0A 1AUYA 1NA1B 4XW3A 1U12A 2E32A 3WOGA 1TMF3 4IEZA 3FZ3A 4GMP0 1WLWA 1D2SA 4GD4A 1DZRA 1K5JA 4LBQB 2MEV3 1LOEA 3EYPA 5DUVA 5J3UA 4GKYA 4CDXC 3SKVA 2Y6KA 3ACGA 1IS6A 1K5MA 1V9U3 1WGPA 2VZOA 3H1YA 2OKXA 5A1AA 2WO2A 3WCSA 2PLV2 2Z79A 3EO6A 2GP3A 2VZVA 4JGZB 4R52A 3M7AA 1GYKA 4XOGA 2ZGUA 5ANNA 1ZBA2 4J1XA 3EHKA 4KGGA 4CCCA 1VB2A 1J3PA 2VQAA 3GDBA 5JSRA 3ZXJA 2DVDA 3I2DA 3PHMA 1QKQA 1PMHX 1LB2A 4FPKA 3TEXA 1TME2 4XE9A 1NXMA 3NKTA 5IVBA 2FZ1A 1TZOA 4ISQA 4J25A 4CTEA 4BDVB 1COV2 1SCRA 4GJZA 1LHWA 2QCSB 2V72A 1OA4A 1WLCA 1H9PA 4X6QB 2R042 4DXRA 3FUQA 2FDJA 5IJRA 5BNQA 1CONA 4CEYC 1KXGA 3A4UA 1S4CA 3CJIA 4Q4V3 4XXPA 2DUPA 4TSVA 3RYRA 5ISLA 3SCFA 3MV11 4M0NA 2YROA 4NHLA 5C9AB 2V5YA 1UD1A 2DWRA 4OI2A 2F6BA 4O65A 3O0WA 1LHUA 3PUAA 4NO4A 2R16A 1GNZA 2RMU1 5BNNC 2VCCA 2XJTA 4QAWA 2ILMA 1QOSA 2N7GA 5CIRA 3GYDA 1UOBA 1S0IA 1VAMA 2WT2A 5BYNA 1J3QA 1SFNA 5K4LA 3C8XA 2D3PA 1HB2A 1UX6A 4V2WA 5CZKA 2D6NA 1DHKB 5B4NA 3HBKA 4BOWA 2UWAA 1SLLA 4M4PA 1RUF2 4D3WA 5A6ZA 2LS6A 2WAOA 3ZSEA 4GKXA 5FO7B 4XCBA 1HV0A 3I4IA 5CAZA 1JYXA 2YZ4A 1LCLA 2WN2A 1ULPA 3FE5A 2FHRA 3I2IA 4UWDA 2FDIA 1C5HA 2ET1A 2EXIA 3U4SA 1OA2A 2IXCA 2CY6A 2C6SA 1C1LA 1DGWX 2ADDA 4XEZA 4K3UA 3MZHA 5C33A 1AR73 1MQTC 3SXWA 4OUSA 3AL6A 2HWE2 2F4PA 1GICA 1WWYA 5FZKA 3VKFC 1YQ2A 3FLPA 5EYXA 3ZVXA 3NW4A 2B9VA 4ZHNA 2XJRA 4DXTA 4ES8A 2Z4FA 4ZXKA 1UKRA 1VPHA 1LHVA 4B1LA 5KHKA 1JHNA 1VLNA 1BCXA 1ZZCA 3SC7X 1B35B 2A75A 3EQEA 1VIWB 2LM3A 4JKKA 4ZU7A 1ASJ2 2D97A 4NHXA 5KXBA 2YYOA 3Q8CA 5C5TA 4TZDA 1PO12 4AXOA 2RR11 4RSUA 3VHOA 2W39A 4CCJA 4QHZA 5FAXA 2HWD1 4PIYA 3A0KA 2ZKLA 2J22A 4B4PA 5FYIA 2ZZJA 1PVC1 2HLEA 2XWJB 4NAOA 5EJ3A 3PTRB 1S0BA 2QE3A 1FPN1 2DCZA 1UOJA 4AYUA 2JE8A 3VZJA 4LHSA 3TN91 2CV6A 5DZGA 4A7KA 2VQ0A 3I97A 4QHBA 1BK0A 4QPIC 3MV01 3SCHA 4DY3A 2WZR3 1UN1A 3N36A 4GWMA 2P5BA 2XXZA 4EZ4A 5CFCA 2J1UA 1E5IA 1NE6A 3OEBA 4I02A 1XJAA 4N43B 4QU2A 5GLTA 4D94A 5C8CA 1KDMA 1RL3A 1RUOA 1FMD1 3AX4A 1LGCA 4QD2A 3I3MA 2GC1A 4N7UA 4PT6A 3P5BA 4QPGA 5LZ6A 3ZM8A 5FLJA 5CG9A 1LOBA 2WA3A 4GAZA 3UETA 1EAH2 2HWB1 2PN5A 1PNGA 4PIZA 4WZCA 5C3OA 2VG9A 1HRI1 3O0VA 5LCWL 1XPWA 2JG8A 4A2UA 5FBZA 4M3CF 1BXHA 3O1PA 2WT1A 1PK6C 3N9QA 4WVZA 3T08A 1V6LA 5A3TA 1AYN1 1V70A 4YZ1A 2FCUA 1W06A 2BDRA 2ARBA 4FT8A 1QF3A 5DAXA 3NJYA 1JYCA 2CGOA 4NE9A 4D69A 5K8SA 2P6HA 1JOJA 1H2NA 3F95A 2QQPA 2JDNA 5F5CA 4LBOA 1ND3C 3IMNA 4B29A 2DU1A 2EALA 3E5QA 4YW3A 2B9UA 1W8FA 4NVPA 1R093 2P2KA 4JRLA 1Q8SA 2ZEXA 1TE1B 2CGNA 1F9KA 3NV4A 2VW0A 1PZ7A 1ULDA 1HN1A 2ZX1A 5FWEA 1LR5A 4CCMA 3IMMA 3JB4C 1NZIA 1VE0A 3J8F3 2WNVC 2FD8A 4FSJA 5C3SA 1VBE3 1W3XA 2RM23 2JX9A 4OMDA 1J59A 1JYIA 1CN1A 2W46A 2WYSA 1Z7S1 2VOXA 3H7JA 4IEWA 4SBVA 4XACA 3SH3A 4XHBA 1DGRA 1CIWA 4K6BA 1A6CA 1LEDA 3O1RA 3T0AA 3EMRA 1DLCA 2QNKA 4YNIA 4ZY9A 2CTVA 1MVQA 5IT6A 3KMHA 2XOMA 4AAXA 4BXSV 2C0ZA 4Y1VA 3HVDA 2RHPA 1X33A 3HBZA 1CPMA 2JDUA 3ZFEB 3ZPOA 1GBGA 2IVIB 2VZSA 3AP7A 2BEOA 3G6JB 3AP9A 2LW8A 3OD4A 1CZVA 3DPRA 4QQPA 5F2SA 3WHTA 3ZN6B 4Y1UA 3AKQA 3ZXKA 4CDUC 1XE8A 2A5ZA 3VBRC 2CAVA 2W1QA 3ACHA 3R4UA 4LJHA 4OHVA 4JQTA 2IXIA 3AYDA 3H9AA 1Q8VA 5JOZA 5GZEA 1HQLA 1YWKA 2VCBA 1RUE3 1WCQA 3MUZ1 3ZYRA 3W58A 4IE0A 5E6HA 1FOD1 4IV1B 2JE7A 4Y1XA 5J98B 1AL0G 2PAKA 2ZX0A 3OPWA 1ZBE1 1Q8PA 3ORJA 4BQ4A 1SZBA 3D82A 1Q8QA 3NJXA 1JZ5A 3UGHA 5J96B 1O3QA 3R4SA 2GALA 4GH4A 4QPWA 3VBUA 2YV8A 1R1ZA 2C9AA 4ET7A 4LUKA 5FTTC 1NA1A 2VM9A 4MLOA 5F7UA 3T2TA 3D6EA 1VBA3 4AVBA 1ENXA 2Y38A 1ENSA 3PJQA 5I0SA 4S2HA 4Q0QA 2HWC2 2WRAA 5JMCA 2BJSA 1JN2P 4KU8A 1PIV2 2WN3A 4C0BA 1HRV3 4YYOA 2E7TA 3TNQA 3UGFA 1SLTA 2O1QA 4DRVA 3LE0A 5F8PA 5EJZB 2ID4A 5FRAA 4AG4A 1OT5A 4XUQA 1TEIA 3LAGA 1PGW1 1VBD2 4JGZA 4JKMA 4LEJA 5C4WC 3BVCA 2A3WA 3GBGA 1AL23 1UIKA 2RJLA 3FHIB 2BNOA 1AYM3 4YM0A 1JZ7A 3EBRA 1X50A 5FZ4A 3DEMA 5FO9B 1TMF1 3FLRA 3ZO0B 4FCAA 3LEGA 2JG9B 2X29A 4R9BA 5A33A 5FLIA 1OD3A 4AF9A 2MEV1 4LT5A 1L3JA 4LBQD 1V00A 4H3WA 3SCGA 5FY4A 3SMHA 2VMCA 1UYXA 1RVF1 1W6NB 2YPJA 3ACIA 1V9U1 4JQRA 4P9JA 5CEHA 3BN6A 5GZCA 1PO22 4JGYC 1DQ6A 4YPJA 4CA9A 3PVOA 5DDJ1 1QXRA 3VHRA 3DUIA 1OOPB 2W08A 3I2GA 3VL9A 1RUH3 2W87A 1BHGA 2RDNA 2Y6HA 4N8MA 1CZTA 4ASLA 4C0HA 5KXCA 1X7NA 2SLIA 1G9AA 1QQP3 4E4SA 4I2OA 3M1HA 3ZFGC 3VD7A 2ZCWA 4LR4A 5AVAA 2K46A 3AYAA 5FQ0B 1ODNA 2CGPA 2JB8A 4M0HA 2NN8A 4IEOA 2DCJA 1IQDC 2R072 3S7IA 3W21A 2RDSA 4QX0A 3TBDA 5A3UA 4LKDA 1RMU3 1S0GA 3IDCB 4XFIA 4Q4X3 4BPZA 5FUNA 4GQ7A 1RC6A 3S30A 4PLMA 2HKXA 5C3QA 3O1TA 4Q29A 4P9GA 4QX7A 5CFDA 4NN0A 1EUTA 5ACA1 4Q4V1 5FMOL 3DN7A 1MQTB 4ATFA 1MZ6A 4XJWA 3NNFA 3VZNA 1YFYA 3K2OA 4IEUA 1UPIA 1VBC2 2PHXA 4J6GA 3RQ0A 3GZTB 1QJX2 5HBAA 3ABZA 1QY4A 1HQWA 3S57A 2A6XA 2B45X 3FL7A 4IGOA 4BB3A 2WYFA 3ZYPA 3MIEA 4CCLA 3RZMA 1UXXX 4A6SA 2PLV3 4QX3A 1W8WA 3HQUA 4RFRB 3QCWA 1IPKA 2YU1A 4CE8A 1GUIA 4FPEA 1ZBA3 2JE9A 1KJRA 2JDKA 3N9NA 4Q0VA 4RR3B 5HCAA 3GNEA 2W1WA 4RS5C 2WUHA 2VZPA 3OGSA 1LNSA 3RFRA 4YGBA 2LROA 3Q8FA 5DZFA 3V64A 1TME3 3CZUA 2WR9A 4LKEA 3I2FA 2KR2A 3AJYA 3WY6A 4GALA 1DZQA 2I2SA 1F8VA 1GR3A 5GM0A 1WZXA 1PGL2 1B35A 4FO9A 3NAPB 4IE5A 3ECQA 5EXOA 5JPNB 1VMFA 3SQOA 2E6VA 2PQSA 4LPLA 1ZZ6A 5L7OB 2ZOEB 5A6YA 4HG6B 3W59A 2R043 3GZEA 3O5SA 1OFNA 1FT9A 4JHTA 1AR71 2O8OA 3VDAA 1MS9A 1R1A3 3LWCA 4CU7A 5J36A 1YQ5A 4M4RA 2Y33A 3P3NA 4G9SB 3D0JA 4CDQB 4H2AA 4BH9A 3IM0A 3OUJA 4IUGA 2W95A 1GZWB 4QB1A 4P5YA 4GZ9A 4LOTA 3DV8A 4Y24A 1IS4A 5SV8A 2XLAA 4N43A 2R7EB 4IEVA 3HN3A 2ZBJA 3NKGA 1XQNA 4K20A 2YC2A 1W39A 3VD4A 1BJQA 1RUF3 3ASIA 4DEVA 1J83A 2ZKNA 4XMAA 5IVFA 4JTNA 2E9QA 2VJXA 3MIFA 1XU1A 1SBFA 2XR4A 3AYEA 3SITA 2JD4A 1XBFA 1DQ0A 1FXZA 5HXVA 4YFZA 1GWKA 4BIOA 5JSOA 3OD0A 1NYWA 1POV0 3E5UA 2EF6A 3NQHA 4TN7A 3ENRA 4Y4RA 4BIFA 1H4GA 4KG8A 5JDBA 4QKNA 1W0PA 1OQ1A 2J42A 2BVVA 2CDOA 4AK3A 5D8AC 1UZYA 4DNYA 1HJFA 3THPA 2ZA9A 2W5FA 3O12A 1RHI3 2ZHLA 3MF9A 3E6CC 4AEMA 4OI0A 1N1VA 1JMUB 3N9PA 4ZS2A 3U1XA 4U36A 1VRBA 2VOVA 5IATA 2D43A 2HWE3 3AXDA 1BBT1 1WMXA 2FMDA 1GANA 4L99A 2OT7A 1MZEA 3ST7A 2ADEA 3SHRA 4FFHA 5A6QA 1BMV2 2BVBA 2A6WA 3ZXFA 3B02A 3GCXA 1G86A 3T2QA 1NCQB 2CWMA 3VBOC 5FFOC 2ZGTA 4LQRA 4NIHA 1KFUL 2AACA 2UYAA 3N9MA 4MX3A 4XQDA 1ASJ3 4LTAA 2Q1FA 4FPCA 1I5PA 4QXBA 4K9SA 3RWNA 3LGRA 3BKZA 3KVAA 1CGPA 3WF0A 1PO13 1J1LA 4UW3A 2BBVA 4CUAA 5BY5A 1IZ3A 1UCXA 3JCIA 4OUMA 3RGBA 3J7LA 4WVMB 3TRSB 1PX4A 4KNCA 2QVSB 3CNAA 4YW6A 1REDA 1HXS1 4FBFA 2YG0A 4CDWB 2TNFA 3ZFEA 1SFPA 1XRUA 4COZA 2LRPA 1ZRFA 3J8F1 2DUOA 2IUWA 3ACFA 3AZYA 2ORZA 1TNRA 3ZPYA 1VBE1 3KZ4C 1G9CA 4E8DA 2RM21 5I8SA 4E2QA 3I7DA 3VZLA 3WDTA 3VD3A 4YGCA 4QX2A 2EXKA 3RNSA 1PNFA 3ON7A 4C1XA 1OD5A 4W4ZA 1Q56A 4DPNA 2YDEA 2J1TA 4D6RA 3JZVA 2PHDA 2JENA 3CBNA 4A4AA 2WNUC 1RGSA 1W2TA 3KV5A 3TNPB 4IV1A 2BOJA 3FUOA 5CU1A 5GKAC 1QH6A 3NRUA 4P08A 1NY72 4NHMA 1CJPA 1EAH3 4QU1A 3SLIA 4AFAA 4RGAA 2YBPA 3QOPA 4A41A 4LOSA 1AR93 2CSGA 4OFGA 4AHZA 4CSWA 5IVJA 3QH7A 4FPGA 2NLRA 3MW3A 4Y5Z0 1OQDA 3B9CA 2XJQA 4IGQA 3TB0A 5JSPA 3VDCA 3VD9A 4HKWA 2FBEA 2JD9A 1QXJA 2VW2A 3KQRA 2DBNA 2WZEA 1LOCA 2K2SA 4HKLA 5JR7B 1YIFA 4Z2WA 2YU2A 5FZFA 3KV6A 4A44A 2ET7A 1RUE1 4LULA 4NPMA 2AGSA 3VBSB 3ZYJB 1WW5A 1PMIA 3U14A 4K7JA 1DQ1A 1FV2A 5BNPB 2P3JA 5AC93 4AEDB 3KCXA 4Y3OA 2HYKA 1V6KA 1V6OA 2KM2A 4Y22B 4DFSA 1J58A 2YPDA 2XONA 1RYYA 3OB8A 1I9RA 4A7YA 2Y0IA 3RZKA 3HN1A 3ZR6A 3ZXGA 3AKTA 5FP3A 3H7YA 4QKBA 2Y64A 1F4AA 1VBA1 1JODA 1OBNA 1A78A 2JG9A 1FV3A 3MFCA 3U10A 1RITA 1RUNA 5CADA 4Y4YA 5DXDA 2VNRA 1HRV1 1IKPA 2W1UA 5CVRA 3V0BB 5K0UC 1W6NA 1YFWA 2GNDA 2QQKA 4HANA 5APAA 1BK1A 3P3PA 5LW9A 3QD6A 4E4DX 3AP6A 2VNOA 2P1BA 2LTNA 3OUIA 1GWMA 1OOPA 1R081 5IK5A 5A7QA 1H1MA 2VNGA 5IAVA 2K0GA 5GALA 5BNOC 4CP9B 2NM1A 4CYDA 4EV0A 1AYM1 3KV4A 2OA2A 3WF2A 5KHHA 4B1MA 1OKOA 2XG3A 2YBSA 3GXUA 3WDXA 4CVUA 5IFPA 3WCRA 1JZ8A 3QBQA 3TWIA 3B3QE 3VKNA 5DABA 5JWPA 3PVEA 3N9LA 1UMZA 3AM2A 3ELNA 5FYCA 5FZ6A 1A34A 1O8SA 1SLAA 4YG0A 2WINB 2BP6A 1AL22 2GH2A 3WQBA 4E8CA 2Y26A 2VY0A 1WW4A 5I8YA 4HZFA 3PUSA 4L92A 1RUH1 4ZZ8A 2JICA 4XXAA 2AC1A 1ND2B 4N9HA 3KQ4B 1QQP1 1VRH2 2GAUA 4ZZ5A 1UY3A 1QU0A 3OGRA 2W94A 3UV9A 1WCKA 2HEWF 2MPFA 4HVOA 5DPNA 4YVWB 1H30A 1ZVFA 1JZ3A 3OYWB 2HWC3 4QXKA 1DYKA 1PIV3 3EJKA 1UMHA 1CVNA 1LULA 3I3QA 2PXJA 5B4XA 5FMOS 4CCNA 1VMJA 3T4VA 2GMEA 2JDHA 4NRPA 4RL7A 4ASKA 4BQ5A 2XBO1 3DKWA 1KD7A 3E6DA 1MVEA 4LLFA 4Q4X1 5EWSA 5LK5A 3WW2A 1XYOA 3V56A 4PLOA 2EIDA 3TYJA 1H2KA 1Q3EA 2RS52 2ZMLA 3ILFA 4IV3B 4BMBA 1AR82 4MO3M 3VUOA 4FAGA 2D6PA 1O4TA 5KC6A 1QOTA 1LENA 3LA7A 4KWJA 4M3CB 1GNYA 4P9YA 4RR3A 5A7NA 4NROA 5I0TA 1WW6A 2JJ6A 5L9RA 3OBZA 4JKLA 3KGZA 3H1WA 2ZTNA 2RS31 1C8NA 2E31A 1T6BX 5A3OA 1PZ9A 1W2OA 1PO23 1NLQA 1KRIA 1OH4A 2W52A 2VR4A 2Y6LA 4GWNA 4H14A 2H6CA 4HT1T 1S2KA 3M4FA 4LBKA 3NAPA 4ONUA 4OVEA 4WM8C 1GQPA 1LOFC 2QZ2A 1G7YA 4YZ5A 1K42A 2A1XA 4BQXA 5L7OA 3DF0A 2QQIA 4UAPA 1ZBA1 3H8RA 2XVGA 3Q9OA 1CD3G 4IGPA 1LODA 4DMIA 1LHOA 3Q8BA 3ZLIA 4AI0A 4NRQA 1GV9A 3PURA 4XAEA 1TME1 3SH4A 2HBUA 4CDQA 1QDCA 2R073 1CPNA 2VW1A 4QB6A 3RI9A 3WXPA 3ZKYA 2YFUA 4OCTA 1COV1 4O7XA 3HMYA 3MUY1 3B69A 5JIUA 5JOYA 4FPOB 3NJVA 3R05A 4CP0A 3WLUA 2IXJA 5DMYA 2R041 2D3RA 1W9FA 1WMDA 1YJKA 4FPLA 3J26N 3MLJA 4XMIA 2D40A 1ZRIA 1D0GA 5ABJC 4ZS3A 1XSRA 1UYYA 1VP6A 5KHGA 4PDWB 3MEPA 5HPOA 5CBLA 4IE4A 1YC61 1D0HA 1VBC3 1RINA 4PI2A 1OMIA 2X5IB 1QJX3 2YFZA 3WW4A 2ZX4A 2MHFA 3GZAA 3UKTA 4ISRA 2ZACA 4IXLA 1RJ7A 2C4XA 4GMP3 5GLUA 3RZLA 1Z0HA 2WFF3 2XQXA 3GJAA 2G9GA 1R1A2 3LA3A 1EP0A 2FDGA 4XABA 3DXUA 1IKQA 4IW3A 3I3BA 3DCQA 1RUF1 1QIQA 1WMFA 3VBFB 4AL9A 2JB4A 2GMPA 2Q8EA 2DVBA 2R062 3C7FA 3MFAA 3PLQA 4L8QA 3ZFFA 4O9EA 2JDPA 4AGVA 2Z5WA 3PMEA 3MBWA 5FY0A 1JHJA 5A70A 3VDDB 2WNEA 1NCQA 5FYHA 2WT0A 4YRDA 4NHKA 1ODMA 1LESA
chains in the Genus database with same CATH topology
1ZA4A 4K8FA 1C3HA 2EXJA 1QNYA 4I0BA 1MS1A 3OBRA 1XNCA 3M8LA 1VJ2A 3M3EA 2WNUB 4HLTA 2HWF3 4WVMA 4INDA 4META 5EZWA 1NLRA 3IPVB 1GKBA 1ZRCA 1YFXA 1FATA 3ILNA 4U2AA 1RHI2 4BCUA 5I8TA 3MPPG 4YFWA 2VMIA 4MGZE 5T50A 5LRRA 2Q4SA 1H1AA 3KGLA 1ASJ1 3AZVA 5FLHA 4YVSC 1PO11 3MW2A 4YGEA 1LU1A 1PHMA 4X8NA 2WQZC 1O5LA 3OBTA 3ZXLA 4LBLA 5L36A 3WG1A 2ARXA 4UW4A 4CRQA 1HX6A 2OZ6A 2OUJA 3C3VA 3BOWA 1GLHA 1UAIA 2SBAA 2VULA 2WSVA 1S0EA 5JZGA 3OGGA 1N1YA 3VBHC 3AZZA 3JD73 4AE2A 2NZ9A 4LBNA 3FJSA 4Y20B 5JOWA 5J37A 4RQPB 3D4KA 1GZCA 3VBSA 4RHV3 5KHIA 2ZGNA 1REEA 1SQ4A 2DUQA 1EAH1 4AEDA 3WT3A 4AVVA 4OLLA 3H50A 4K21A 4N53C 5DG1A 4WM7C 3WP6A 1YCIA 4BZ4A 2QDRA 1QGLA 2EAKA 2RS13 3M3IA 1F2NA 3GHMA 4PF5A 3S7EA 3B94A 4AVTA 1MS4A 3WP4A 1GFF2 4JC1A 1G9DA 4EN0A 3SNMA 3LOBA 1N1TA 2XKPA 5T55A 1AR92 5A3MA 3M3CA 4YW1A 3V0BA 3U11A 2DF7A 4L2NA 1H2LA 2IFWA 4EROA 4XPVA 1ENQA 2ZGRA 1Q5OA 4IEPA 1BYHA 4C1WA 1G9FA 5K9YA 3N7LA 2PYTA 5I0RA 3B5LB 3ZXDA 1O4YA 1C4RA 1AHSA 2CNAA 4DQAA 4K1ZA 5JOXA 4PLNA 2WLPA 3BOPA 2I74A 3TN92 1K5MC 2Z2SB 3VKLA 5HCFA 5T5OA 2ZGOA 5AC92 1HV1A 1DGWA 2DV9A 2ZGLA 5A32B 3RSJA 2BWCA 2AUYA 2E63A 2G4IA 2WSUA 2JDZA 3FC0A 5KXDA 3E97A 3KSCA 3ZSLA 4CEWB 4FPJA 1FNZA 4IETA 2ATFA 1O7FA 3GALA 1H8TB 4QMAA 1C57A 1GSLA 4C91A 1JBCA 1ND2A 4PCRA 5FDBA 2E51A 4DRRA 3ZN5A 1M4WA 2ZX2A 1KFXL 3WR0A 4H7MA 3QACA 2D6OX 4YVWA 3THTA 3OYWA 1VB4A 1XXNA 4K1YA 4HETA 4WVVA 3HAGA 2P3KA 1IS3A 3ES4A 2Q0AA 1NCRB 1CQ9A 1NG0A 3NV1A 3UL2A 1WCSA 1H1IA 2XKOA 3CJIC 4XBLA 3ZSMA 4RA0A 1AR62 4IV3A 2Q1MA 3ROUA 3MLKA 4QGMA 3V65A 4M3CA 4CDXB 1SLIA 1YUDA 4GA9A 4XBQA 1G6NA 2CL2A 3USSA 2E7AA 1Z7S2 4SLIA 2HWC1 1N3PA 4MGIE 3WQ0A 1PIV1 2CYFA 1CAUB 2AYHA 1WA4A 3E6BA 1SDWA 4JTOA 1RUD2 4YSFA 3VHPA 2W68A 4LA2A 4R9CA 4OHWA 1RIRA 1VBD1 1KJLA 2YMZA 4XF0A 4LBQA 4BYYA 1ZX5A 1BZWA 5AFBA 4L9BA 4AHXA 5FCCA 1EV13 2B5HA 2ZS6B 4XDQA 1Q43A 1DBNA 4BM8A 1V6MA 3KCCA 2YGLA 1DFQA 3U4XA 3A0NA 4XF1A 1PO21 4QQHA 4Q1RA 4CEYB 2P34A 3WNXA 2NP0A 1A3KA 5I91A 2JEMA 2LALA 3AB0A 1AX0A 3UJQA 4LLOA 3RPQA 1VRH3 3WP3A 5BNNB 1XNKA 1CAWB 2WS93 1QJU2 4AFMA 4PDWA 4OI1A 3VZOA 1SBEA 2VXRA 1CR7A 1XYPA 2OZJA 2X5IA 2R071 3FX3A 4B4RA 4LHKA 4Z92B 1MS5A 1QJZA 2CAUA 1H0BA 4YLZA 2RS53 5GZGA 1MACA 1AR83 1A8DA 4XFBA 5C9AA 4PIXA 4IEYA 5F9TA 3IDEA 3ZMNA 4RD7A 3VZKA 4XFAA 2PQQA 2BUKA 1ULCA 3I8TA 3VBFA 1YJLA 4HVRA 4DOUA 2BQPA 2D5HA 2GC0A 3OF1A 2D6KA 3AKSA 1LGNA 1VBC1 5A3LA 1QJX1 5CFCC 5C8CC 1RTVA 4X8PA 3VDDA 3LZZA 4LO4B 4GMP1 4M01A 4ZU5A 4LHNA 4XJZA 4E2GA 4PJYA 1RUJ2 5DZEA 4QPGC 1RVF2 5H9RA 4GB32 2OPKA 4AHWA 4YVSB 5DDJ2 1I5ZA 3IIAA 2PFWA 4MGKE 2JG8C 4EN6B 5J7MA 5BXXA 3WDUA 4AGRA 4XJAA 3LB9A 3IPVA 3RJ2X 4AQSA 2WFF2 1RUG3 1ONAA 4BHPA 4DZGA 1PGL1 5JI7A 1AXKA 4Q0UA 4YM1A 3UJOA 3WW3A 1VBB2 2BNNA 3ALQA 4EWAA 1I3HA 3PJYA 1QHDA 4FP3A 2DURA 2WQ4A 4PBPA 4W65A 4ITCA 3VN4A 4QPIB 4YZ3A 4ZKTB 3WZ1A 1C8M2 5T52A 4FVVA 3JU9A 1PZ8A 1AZDA 3POWA 3LOIA 1YIPA 3UKNA 4KWKA 2HWF2 4FOVA 1W6MB 4HK9A 1H4HA 3OY8B 3PTYA 4Y20A 1ENRA 2GU9A 4RQPA 1UZZA 3DPRC 1PK6B 3D8CA 2VUAA 3MI8A 3AFKA 2R063 4NWVA 1MEC2 1FI2A 4HK8A 3JBG2 4DXZA 1V6JA 1GQHA 3AJZA 5IUQA 1DQ5A 3ILRA 1ND3B 4FOYA 1JUHA 4R4XA 2PTMA 3DGTA 1J1TA 4I3GA 4TWTA 5E89A 1UU5A 1ZNPA 1SFYA 2WNVB 4NPRA 4GH4C 3VBUC 3ZN4A 4AWDA 2Z42A 4HL0A 2R1DA 1AVBA 1NA1C 1U5IA 3HR9A 4QX5A 1ULEA 2WZR1 4AEKA 4ATEA 1M06G 1BMV1 3JD72 3FFZA 4ZU4A 1MS3A 2HJIA 4X6RB 4LE3A 4HMZA 4MUVA 4FP2A 4RHV2 1DG6A 1HQNA 4HBNA 1DGRN 1LHNA 1C28A 5A32A 4V1PA 3DL3A 3BB6A 4JGZC 1RUC2 1OPOA 2UU8A 2I07B 1W0OA 4CDUB 1N47A 1Y9QA 2QUOA 2XVKA 2Z69A 2RS12 2E53A 4CEWA 2VGDA 3VBRB 5BV6A 1HDKA 2Y0OA 1H8TA 3CEWA 5H9QA 1OPMA 3FLTA 3WDYA 2ZZQA 1YI7A 4KL1A 3KB5A 4E4ZA 3K51A 1R091 3H8UA 3NWKA 1POV3 2G9FA 4Q2FA 1BQPA 1BVVA 4QM8A 3GBWA 3NV3A 4QGLA 1TNFA 3ZN6A 2ZGQA 4LO5B 1NCRA 2ZAHA 1HLCA 2ZHNA 1NY71 3VGIA 2EIGA 4B7KA 1BBT2 3AMNA 5JAXA 2R32A 4CDXA 3ZIWA 2VMGA 1MR5A 2IFRA 1WBFA 3AMPA 1WUVA 1N3OA 4FPHA 1CAUA 5C4WB 4TLFA 1WLDA 2VU9A 1CESA 5CFDC 1RUI2 1FNYA 1W6OB 3IWZA 2HWD3 2KA3A 2DVAA 3RYKA 1J3RA 1SCSA 4KH9A 1HXS2 5FOBB 4P9WA 2GC3A 3U0ZA 2VOWA 3ES1A 3INAA 1KDKA 4FPYA 2GN7A 3TN93 4JGYB 2GNTA 3POSA 4Y1ZA 4MZUA 2OW4A 1OHFA 4UBHA 4XF4A 1DQ4A 3SH5A 3B9IA 4CEYA 2ZMNA 3AZXA 4LA3A 2VMHA 4WZFA 2BFUL 5HCBA 4N90A 3ZFGB 1NQJA 1O3SA 4UW5A 4XF3A 4R9AA 1NE4A 3KM5A 2OYZA 1CAVB 1ZZ7A 1B35C 1X36A 1AJOA 1XNBA 1O3RA 2UWCA 1XNDA 5CFCB 4QQOA 4E27A 3ZYIB 1IS5A 1WD4A 1PM7A 1CAXB 4DY5A 1AL21 4KQ7A 4XFGA 1EV12 1AR63 5FPXA 4F8AA 4GXLA 5FQ0A 2DVGA 2IWGB 3BALA 1HKDA 3MICA 1VRH1 3LSDA 3NV2A 1WLTA 2D7FA 3LA2A 1PVXA 1AXYA 3AP5A 3FFQA 1Z7S3 4XFHA 2YHJA 3N7JA 1YRZA 3KT7A 3TOJA 5F1RA 4I09A 4N43C 3L9JT 1RUD3 3BIWE 1LU2A 3N3HA 1YO8A 1BEV2 4RS5B 1OI6A 2RS51 4FOWA 1F5JA 1MQTA 1N1SA 2WS92 5SV5A 5H9SA 3I54A 2X8KA 3L2YA 2A6ZA 1R082 3CL1A 1W6QB 3PVBB 3ZSJA 5T3NA 4W6YA 1RMU1 2LUWA 4HN1A 5GLZA 2A71A 2UY9A 4NWWA 1FX5A 1QJY2 2RE9A 3AKPA 4XTMA 1QOOA 1DZTA 1ZYBA 3NL1A 1DQ2A 1FOD3 2BYVE 5CA6A 2JXAA 5JCTA 3MIGA 2VOKA 4OHYA 3GF6A 3BODA 4MXVA 3R4DB 3WG3A 3MIHA 2A3XA 2BPA2 1QJU3 1YLLA 2A73B 2PHLA 4QPIA 3MYXA 4QGNA 4QM9A 3CJXA 1IHMA 2VECA 2PLV1 2TUNA 1HIXA 3JB8A 3HD8B 1X82A 1WCDJ 4CZSA 3POYA 1GQGA 4Q4W2 4JDNA 4XBNA 2XB6C 4K40A 1ZZ9A 3HT2A 4AVCA 4Q4Y2 2NQYA 1LRHA 1W6MA 2XBO2 4R9DA 2XJSA 2FZ2A 3ZFEC 3J4UH 1QH7A 4LBMA 4GH4B 3H0OA 1VR3A 1PK6A 2VPVA 1RUG2 1LGBA 1GZWA 1C1FA 1D4M2 1EPZA 2PHRA 3ME2A 5C6CA 5D1IA 3JQWA 2C1FA 5D8AB 3GHNA 2D3SA 3N7MA 4EJRA 3LKJA 3AFGA 3PNAA 3TAYA 2RS32 1RUJ3 1ND3A 1WD3A 1RVF3 4IV1C 4KGQA 4PQ9A 4GB33 4XJUA 5GJ6A 4AI1A 1R1A1 5DDJ3 3MDPA 2B7YA 2O0OA 2WNVA 4HSLA 2WA4A 3RMXA 4FQ4A 2IXHA 1YHFA 3VBOB 2R061 1JTZX 4OI4A 2WZPP 5LRSA 2DVFA 1W2UA 1KS4A 5A33B 4QT6A 3B93A 4XTPA 4YZ4A 4Z8BA 2RJKA 3W9AA 4COYA 2ZABA 3BTAA 4XFFA 4YGDA 1I6XA 4J1WA 4OZXA 3WVJA 4Q27A 1VBB3 4XJ8A 1S1AA 1ZZ8A 4AW7A 1IOAA 2B39A 3HQXA 1LOAA 3O7OA 4CDUA 1VALA 3VBRA 2XJVA 5ACA3 4P9LA 1C8M3 1ZRRA 1DDLA 3ZDSA 2JG9C 3HWJA 1RHI1 1YI9A 4XHXA 1OQEA 2ES3A 4AVAA 4M3CE 4YW5A 5F6KA 1QMJA 2D6MA 3VLBB 2HWE1 2P37A 2PHFA 4F7ZA 4CDWA 4IQPA 1OOPC 3B00A 5JSRA 1DYPA 1SMVA 3FMGA 4N9IA 4NOTA 5CFDB 1W6PB 3H3UA 4MSVA 1MEC3 2RMU2 3JBG3 4COUA 1ALYA 2IXLA 2H6BA 5J48A 5L19A 2A70A 4B8EA 3AKRA 3AYCA 3HT1A 5F5QA 4BLJA 1POV1 3WG2A 3HIFA 4C90A 4JDMA 4M00A 1OLRA 4I3PA 5C4WA 1ULGA 4Y26A 4LO8A 4BMEA 4MYEA 3RRDA 2XLFA 3KT4A 3WQ1A 1CJDA 5JVVA 1W6OA 1SACA 2ZGMA 2ENRA 1DLLA 3OPZA 1NLSA 4F83A 1H8VA 2IZWA 4KU7A 4HPKB 3WHUA 1SEFA 4IEQA 3ACLA 1ZZBA 3ZXAC 5K0UB 1EYBA 5BNPA 3O14A 4JGYA 3CU7A 1YFUA 1JW6A 4L97A 1AR91 4FQZA 4Y22A 1RUC3 3NJZA 2QJVA 3U07A 3WUCA 1FYUA 1XE7A 5BNOB 4ORFA 3N35A 4RR3C 1F5FA 3ZFGA 3D0SA 3T1LA 1U0AA 3MPBA 4S2DA 3EXUA 1VAVA 2AH2A 1TQ5A 3OTFA 2BFUS 4BQ1A 2RR12 3NO8A 1SBDA 1CAVA 5AC91 3NAPC 1O4ZA 2HWD2 3PVNA 1A8MA 4CP1A 3MF6A 5L7OC 1PVC2 4P14A 1S2BA 1CAXA 1U5XA 1AXZA 2D5FA 3WP5A 1FPN2 2XGXA 4D7SA 2ZJCA 1REFA 2V73A 1BBT3 2GSYA 4MV2A 4O9GA 4UBGA 4BE3A 4CDQC 1DGLA 1FMD2 2AZ5A 1AJKA 1SLBA 2TBVA 1MS8A 3AZWA 4XETA 4YW2A 3URFA 3VKMA 2HWB2 4HSJA 1UPSA 1HRI2 3ETQA 1RUI3 4F3JA 2WKKA 2D44A 4URTA 3N4MA 1MZ5A 1DIWA 1AR61 1KITA 1AYN2 1HXS3 1KQRA 2DTYA 3E5XA 2HEYF 4P5HA 5EYYA 1S0JA 3RS6A 4HVQA 4LE4A 1W6QA 1Y3TA 3MIDA 2YUEA 4BA6A 3ZSKA 4AHYA 1QWRA 2A6VA 3IN9A 4Q26A 3OCPA 3CO2A 5IK7A 2BGCA 4WM8B 3H1MA 1UL9A 4BWOA 4AFCA 5H9PA 1B09A 3IBMA 4YM2A 1O91A 2EXHA 4FXKB 4G4FA 1YXWA 1LKNA 4JRAA 1SLCA 1RUD1 1U5ZA 2VVEA 4QQ2A 2OVUA 5AVPA 4HN0A 2KXLA 3WW1A 4E2SA 2WWSA 3I59B 5IK8A 1NXD1 4N7IA 4XFCA 3ZFFC 1UF2C 3VHNA 1Y7BA 2XUMA 4FAHA 5KBFA 1NCQC 4OHXA 5T5LA 2ZX3A 3VL8A 5CG8A 4GULA 5FPZA 4QQLA 2D98A 2Q8OA 4LO6B 4DINB 3KD4A 4JVAA 5HI0A 2W0XA 2V09A 4AI2A 4BLIA 2GC2A 1C5IA 2QFEA 4JCKA 4XJ9A 5ABJB 4FTEA 3PMSA 1ULFA 3ZXEA 4CDWC 4IL7A 3K48A 4W6XA 2QKDA 4G3YC 1NOVA 4H7LA 1QJU1 2AR6A 3QH6A 1IPJA 3KS7A 1ZRDA 1FOD2 5D8AA 2WIIB 2PAMA 1EPWA 4AI8A 2XHKA 1Y43B 2UYBA 4OULA 4EN7B 1ZBE2 1BKZA 5FOJB 1LJ7A 1ZREA 3IT8A 5FO8B 1S55A 4R8HA 1U5YA 1BEV3 1MS0A 2DTWA 2EA7A 3RMYA 3FWEA 4JAAA 1MZFA 3KLSA 3BPZA 1S0FA 1R083 5DUXA 3SISA 4YZ2A 1V6IA 2BWAA 3RYPA 4LBJA 5E16A 3VBOA 3AMHA 2OIIA 5JZGC 4WBBA 4AI3A 3KCYA 1QJY3 1AX2A 2AREA 5E88A 4FOQA 4A3XA 1PGW2 1RUJ1 3VBSC 4Y1YA 2DCKA 1D4VB 4GB31 2PA7A 1QDOA 5BNPC 4LO7A 3FBYA 3FBMA 1E57A 3USUB 4Q8KA 2WLQA 4AEDC 4YM3A 2WFPA 4FXGB 1LOGA 1TMF2 1RB8G 2GDFA 2B8MA 2MEV2 3WQ7A 2A3YA 2VUJA 3ZMOA 5BUVA 4HFSA 3GZUC 3WV6A 1V9U2 2WFF1 3ATGA 4B4QA 2ZMKA 2P3IA 2GNBA 4D7TA 4Q4W3 2H0VA 3O0XA 2WNUA 1NZCA 3WUDA 1D2QA 1OSGA 2BW8A 2XL7A 2ZGPA 4NR1A 4Q4Y3 4COWA 2XBO3 1XU2A 2JKBA 4XILA 3LCPA 1VBB1 1DU3D 3N7KA 2UURA 4MVTA 4XIOA 1W6PA 1D4M3 2ETEA 2R0HA 3V0AB 4XF9A 3OJBA 2GH8A 1C8M1 4S2GA 3VBHB 1AX1A 4IEXA 2PELA 2DFCA 5GZFA 2OUHA 3WG4A 4ES9A 2XLGA 3RJRA 2B46X 2RS33 4MXWB 2HWF1 4LHLA 1BVP1 5FREA 1CX4A 1WBLA 4E9KA 2R30A 4EWEA 3JUUA 5ACA2 4Q4V2 1UU4A 4N53B 3WD5A 3M3QA 4WM7B 4JDOA 5E8AA 2VVDA 4KG0A 2Q5TA 1ND2C 1UU6A 3AMQA 1MEC1 2DU0A 2R1BA 4EWDA 4YW4A 3JBG1 4OHZA 5CB7A 4YVWC 1GZ9A 3BCWA 3LSEA 2PHUA 1OFSA 4HPKA 5AFEA 2NMNA 5K0UA 4P9IA 1COV3 4EN9B 5F6LB 4AEJA 4IV3C 4AVSA 1I1EA 4MGYE 4R4ZA 1YYNA 2D6LX 5BNOA 5DG2A 1V6NA 1NQDA 4I01A 2ZPXA 4Q8LA 5L73A 3M2MA 3WX5A 1K5MB 3T1MA 3JD71 3MLLA 2WJSA 2UY8A 5KWRA 4LNVA 1N3QA 2R49A 4RHV1 4Z82A 1S0CA 2FQPA 2GNMA 2Q1ZB 4P9XA 4AQTA 2XJUA 3IKWA 4UW6A 4RFT0 4Z1VA 1IQAA 2ZAAA 1F31A 4JV4A 1AR72 4L11A 3ZX7A 1RUC1 4ASMB 5BPXA 1AF9A 3NVCA 1LTEA 4AFBA 2RS11 1VAKA 2IXKA 3RZZA 2HEVF 1Z78A 4FPFA 2YC0A 4I0AA 2EAAA 2R0FA 2RMU3 1OLQA 4IERA 1OKQA 2GMMA 4XYXA 4AQ6A 5K7PA 3VV1A 2MNGA 5T54A 2Q30A 4WVWA 2ERFA 4UXAA 5TSWA 1UKGA 3CJIB 4FTBA 4B7EA 2A7AA 5JIAA 1RJ8A 2XL9A 3MIBA 2NMOA 4I0WB 3UKVA 4PDWC 3IDBB 3ZFFB 4AQ2A 2WZR2 5JLVA 2X5IC 3VZMA 4Q1PA 2D93A 2C5DA 4WM8A 2GN3A 5CNAA 1LOFA 2ZHKA 3R0RA 5KXEA 2I45A 5DUWA 4AFDA 5C9AC 4TYSA 1RUI1 2XWBB 3BU7A 5GLVA 1S0DA 3UK9A 3MGUA 3VBFC 1QNWA 3I59A 4KBBA 2A6YA 3S6PA 5GLWA 4I30A 3CLPA 3WINE 5LEJA 4GIQA 4EN8B 5KHJA 3VDDC 1APNA 4KWLA 2RR13 2FMYA 4B3NA 2DCTA 3NSTA 1R092 2BNMA 2DCYA 2YXSA 2AENA 1PVC3 3R6SA 5JPMB 1FPN3 3J8F2 3ZIXA 4W6WA 1VBE2 3GBFA 5ABJA 2GZWA 2IC1A 2RM22 3MW4A 2R6QA 3M3OA 3OGJA 1WW7A 4XQ4A 2H0BA 3AP4A 1FMD3 3VKOA 4H55A 5JZGB 1DF0A 4S2FA 4AGGA 3JQXA 2EVXA 2HWB3 4XIKA 1H9WA 2VVFA 2O8QA 1HRI3 3H3ZA 3WDWA 1JXNA 5BNNA 1EV11 1CAWA 1PGSA 1AYN3 3RDIA 1H2MA 1HW5A 2CWSA 2ZGKA 3D5OA