2OA2A

Crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
b'VTDHGPRPFVVNIEDETKRNRAFRRALWTGDHLQVTLMSIQVGEDIGLEIHPHLDQFLRVEEGRGLVQMGHRQDNLHFQEEVFDDYAILIPAGTWHNVRNTGNRPLKLYSIYAPPQHPHGTVHETKAIAMAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BH2720 protein
publication title Crystal structure of BH2720 (10175341) from Bacillus halodurans at 1.41 A resolution
rcsb
source organism Bacillus halodurans
molecule tags Structural genomics, unknown function
total genus 29
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2oa2A01
2D5FA 1DZRA 4F7ZA 1ZZ7A 3R6SA 1PMIA 2XLGA 4AXOA 2IXHA 3LA2A 4YRDA 3VHRA 1EY2A 3NJZA 3N4MA 1ZREA 1EYBA 1ZZCA 3BB6A 3ELNA 1YFXA 1UD1A 2PFWA 4MH0E 3FJSA 2H0VA 2CV6A 4LA2A 4D7SA 3OD0A 3WW3A 3CJXA 1ZZ8A 4EWDA 3IBMA 5AVPA 2PAEA 5BXXA 1J58A 5I93A 4NVPA 2PQQA 4Z82A 4R52A 2QDRA 2DCTA 1WA4A 5CU1A 4BHPA 1OI6A 2KXLA 4META 1EP0A 2MHFA 4N9IA 5BV6A 3I59B 4LUKA 1J3PA 2C0ZA 1YFYA 2Q0AA 5HI0A 4KWKA 3EO6A 4HMZA 3TNQA 4QGLA 1DZTA 2XGXA 3ETQA 3MDPA 4TLFA 1OMIA 3RNSA 5CADA 3MZHA 5C6CA 3EHKA 3DL3A 3EQEA 2BNMA 4L11A 4J1WA 4IEXA 4YYOA 4O9GA 1PM7A 5KBFA 3BCWA 5J3UA 1L3JA 3MYXA 2IXKA 2XL7A 5F1RA 3H1MA 2VECA 4BYYA 2PAKA 2UYAA 2D5HA 2VPVA 3FHIB 1LKNA 3ZDSA 5E1RA 3HIFA 3IDBB 3H3ZA 3SXWA 1LRHA 4IEWA 2D93A 2QJVA 1ZVFA 1EPZA 4MV2A 1FI2A 1H1MA 1Y3TA 2PHDA 1VJ2A 3QACA 4KWLA 5FCCA 4LUMA 1CAWB 3ES4A 2P17A 5FLJA 3M70A 1CAUB 3L2HA 1VR3A 5BY5A 1IPJA 3LA3A 3BU7A 2CAUA 3RYRA 1Q3EA 2UY9A 1IPKA 4IEPA 4XEZA 1UCXA 3FFQA 5JSPA 5FQ0B 5I91A 1I6XA 3NSTA 4XETA 2H6CA 3GBFA 4QM9A 1NXMA 4Q0VA 3LA7A 3IWZA 2ATFA 1XE7A 1NZCA 2HKXA 3D82A 3FZ3A 3E6CC 2Z2SB 3I54A 1J1LA 1ZX5A 2GU9A 1LB2A 4L2NA 4AQ6A 1UW8A 3S0MA 1UPIA 4WZCA 2Q4SA 3E97A 4K8FA 3LWCA 2CAVA 5I0SA 4Q0PA 2BYVE 3LAGA 4EROA 4A2UA 4HSLA 4IEYA 4IEZA 3ROUA 2ET1A 5I0UA 3IIAA 2D40A 5LRSA 2I45A 1ZZBA 1FT9A 1GQGA 1ZZ6A 4BH9A 3SMHA 5K8SA 3KGZA 3CEWA 4UXAA 2Q30A 2IXCA 4WBBA 2Z69A 3ST7A 1RUOA 2EAAA 2FQPA 4ZU4A 2BNOA 1O3TA 1O3RA 4XF4A 4MUVA 1DGWA 5JSRA 3UKVA 3WW2A 5JR7B 3RZZA 3KMHA 3H50A 3LZZA 3E6DA 4MGIE 1ZZ9A 4JTNA 3EJKA 1ZRFA 2OZ6A 1U12A 3RPQA 3H8UA 3NKTA 3H1WA 5BPXA 3E5XA 4I01A 4FAHA 1CAVA 2XLFA 5LRRA 4AVBA 1HW5A 3BPZA 4IEQA 4KL1A 2B5HA 2PTMA 2ZKLA 4X6QB 4I0AA 2IC1A 3CL1A 5I0TA 4XFGA 3S7EA 4HVRA 3NVCA 4I09A 4QX5A 5I8YA 3H7JA 2GC0A 3PLQA 1CGPA 5I8TA 4YARA 1Y9QA 4I0BA 4LA3A 3OTFA 5KHHA 2GC3A 3FX3A 4OLLA 3LOIA 3PNAA 1Q43A 1RGSA 3IDCB 3KGLA 1ZNPA 2WC2A 3TNPB 1CAXB 2ETEA 1RUNA 3HT2A 4HSJA 2OZJA 3U0ZA 4PIXA 1G6NA 4RD7A 2K0GA 3UKTA 1TQ5A 3EBRA 5C8WA 1OFNA 3H1YA 4EV0A 2EVXA 4Q0QA 5LEKA 3E5QA 4HBNA 2QNKA 3SHRA 1O3QA 4IEVA 3PVBB 2XKPA 4XF1A 1NYWA 1O7FA 3I59A 3OCPA 4KU7A 4YNIA 2N7GA 1YUDA 1I5ZA 1CX4A 2QCSB 5FPZA 3WW4A 3CF6E 1WLTA 4XFBA 4XFHA 5T3NA 4QXKA 1RTVA 2OYZA 3I7DA 4FT8A 3FWEA 2EA7A 4LLOA 5JSOA 4PIZA 3E5UA 2GC1A 2GZWA 4ONUA 3RYPA 3NL1A 4J1XA 4AQ2A 2PAMA 4IERA 2XHKA 2UY8A 3CLPA 2GC2A 3KSCA 4IEUA 2PYTA 5E16A 3SCHA 1YFWA 4E2SA 4AVCA 2MPFA 2O1QA 5FPXA 4HVOA 1O5LA 1YHFA 3ACLA 1QXRA 4HLTA 1X8EA 4MGZE 2UYBA 2IXIA 2O8QA 2BGCA 4P9GA 5KHIA 4QGNA 4MGKE 5EFUA 4R8HA 1CAWA 2CGPA 2K9ZA 3S7IA 4JV4A 4PJYA 3U11A 5I8SA 1CAUA 4XF9A 4UBHA 4GULA 1RC6A 4FAGA 5JAXA 5KHGA 4LULA 4ZU5A 1JUHA 3U10A 2B9UA 3H3UA 1DGRA 3DV8A 3WW1A 5FQ0A 3DKWA 4BIFA 4MZUA 2GH2A 5FLHA 4QGMA 5D1IA 4D7TA 3B02A 3USSA 5J48A 1J3QA 3FE5A 2HJIA 4QM8A 4E2GA 4IETA 3HQXA 4CYDA 4OFGA 1ZRDA 1OD5A 4XF0A 5BUVA 3D0SA 4LEJA 3HT1A 4Q0SA 2XKOA 3H9AA 4WVZA 5JCTA 4JTOA 2E9QA 3QOPA 1X82A 1X7NA 1O4TA 2V09A 3OF1A 3C3VA 4DINB 2WFPA 4IEOA 4B29A 4YSFA 3GYDA 5EZWA 5FLIA 5KHJA 1J59A 1Q5OA 4XF3A 1LR5A 4XFAA 2Y0OA 4O9EA 1NE4A 3CO2A 5FDBA 1O3SA 3O14A 3H7YA 4JVAA 4UBGA 4IESA 5LEJA 2BEOA 1QXJA 4ORFA 4XFCA 4Z07A 2FMYA 1UIJA 4QMAA 4E2QA 4HVQA 4AVAA 1VP6A 4XFIA 5I0RA 3ES1A 3G7DA 4HN1A 1SQ4A 4I2OA 4HZFA 2OPKA 1H1IA 5KHKA 4HN0A 3UKNA 2B8MA 2PA7A 3M3IA 1UIKA 2OA2A 3MPBA 3JZVA 4MX3A 1SEFA 4MGYE 1ZRCA 2PHLA 2Q1ZB 1XRUA 1V70A 4N9HA 1YLLA 4H7LA 4XFFA 4EWAA 2MNGA 1YWKA 2VQAA 4Q29A 2XLAA 1GQHA 4F8AA 1NE6A 3OGJA 5J7MA 2IXLA 2QVSB 4X6RB 2ET7A 1ZRRA 1FXZA 1O5UA 5CVRA 4PIYA 3RYKA 1QY4A 1X8MA 1XE8A 2H6BA 4I3PA 3RDIA 3SCFA 1J3RA 1SFNA 3BALA 4ZU7A 1YFUA 1QWRA 2F4PA 1CAVB 2IXJA 1CAXA 1RL3A 2GAUA 2XL9A 4KU8A 3KCCA 3E6BA 3NW4A 4KWJA 4I02A 1WGPA 3D0JA 4LTAA 4Q0UA 4FBFA 2BNNA 4EWEA 2ZCWA 3SCGA 3DN7A
chains in the Genus database with same CATH superfamily
1KITA 2D5FA 2J7MA 2SBAA 1RMU2 2OUHA 2YUEA 3JD72 1EPWA 1AYM3 5FJHA 3N7KA 1EAH1 1UOFA 1C8M1 3AM2A 3U1XA 4GB32 1MS9A 1C1FA 5CB7A 3OJBA 4HOOA 3KHCA 1AX2A 4GWNA 3MV11 2OKXA 4ET7A 1UD1A 3BIEA 1V6OA 4CCEA 3ABZA 3LIHA 4M0NA 1V0AA 4MGSA 4LA2A 3SEEA 3ZSLA 4D7SA 1RUE1 4XQDA 3DPRA 4EWDA 1G9DA 5FPVA 1LOBA 3ZFFB 1QGLA 5AVPA 3TN91 1MVEA 4LBOA 3BOWA 4YGCA 5BXXA 5A3PA 4CDWA 1DQ6A 2D6OX 1SZBA 5I93A 3IN9A 2PQQA 3AMMA 4JQTA 1OPOA 1UXXX 2QDRA 4FTEA 4FOWA 1OLMA 5EYYA 4BHPA 1F8VA 4P14A 1ENSA 2VTXJ 1LESA 3KT7A 3R05A 2XVLA 4AZZA 5BNOC 2MHFA 1FOD2 4CP2A 4XILA 1Q8SA 3K51A 1DYPA 1RUF1 1RUG2 1LEDA 1L7QA 4YZ3A 4DY3A 5HI0A 5FY1A 4QGLA 4NMIA 1W8OA 1UAIA 3ETQA 1GUIA 3UK9A 1MS3A 1COV2 1RIRA 1YXWA 2UWBA 3OYWA 4AL9A 4C1XA 3PUHA 3EHKA 3ZXDA 2ADDA 3DL3A 4BWOA 2BNMA 4QXHA 3PVOA 3IDEA 4MLOA 1HV1A 4IEXA 5A7WA 4RGAA 2V4AA 3THCA 1PM7A 1WMDA 4A3ZA 4AI8A 1CIYA 1NY71 1I5PA 3N36A 2HWE3 2NLRA 3BCWA 3N7LA 1BEV2 1JZ4A 5C8CC 3K2OA 5J3UA 3MYXA 1UPSA 1D7PM 3OGRA 5HPOA 4L92A 5T55A 4NOTA 5C3SA 2W08A 4TTGA 3RRDA 5GLUA 4BYYA 1C57A 4Y20B 3WCSA 5IVVA 2YU2A 2TEPA 3WV6A 3USUB 4LK6A 4HK9A 2A71A 5F3IA 3ZXFA 3ZDSA 5E1RA 3HIFA 5ACA1 1UYZA 3H3ZA 3SXWA 1PK6C 5A70A 1EUUA 1K45A 2D93A 2QJVA 2XQXA 5IW0A 4OMCA 3LQCA 5BNQA 4FFFA 4XAEA 3KHBA 2RS12 5A3OA 4AVSA 1H1MA 3DECA 3QACA 4S2FA 5GALA 2RM21 1H9WA 1CAWB 3T09A 5JIUA 1XPWA 2QQMA 3J8F3 4CCMA 4HL0A 3ES4A 1BHGA 5LK7B 4CUCA 4OI2A 2P17A 3S6PA 2Y8KA 2F6BA 1CAUB 2VQTA 3LE0A 1SBFA 5BNNB 1IPJA 3RS6A 1G8WA 3LA3A 1LOFC 3KD4A 1LTEA 3BPSA 4IV3C 2RJKA 2CAUA 3AZXA 1VB4A 3NAPB 1ASJ2 1QDCA 3BYWA 3RYRA 3WP4A 3ZDVA 1EV12 4LE4A 4BZ4A 1TME3 5JSPA 1GP5A 3K3NA 5C4WB 2BVVA 4RL7A 1B35C 3VUOA 1AXYA 1NCRA 1ACCA 5IK4A 3P5BA 5T5LA 3GBFA 1GP4A 4W50A 4JGYA 3L9JT 3GZUC 1W99A 2WT2A 4QB1A 5F8PA 2X05A 2Q1MA 4ZY9A 4XUOA 3FZ3A 2J1TA 2VE1A 3LSEA 1N3QA 4AE2A 2Z2SB 1H8TB 1O59A 1QJY1 3I54A 4LHNA 2NN8A 4AEDA 4XZPA 1K5MA 3JCIA 3JBG2 1XB9A 1R083 2VCBA 4H14A 4AEMA 3J7NA 2BOJA 3D4KA 4GAZA 2JE8A 1VBB1 1W6MB 1DQ5A 2TBVA 1SFYA 3NNLA 3VBOC 4ASLA 2Q4SA 4Y22A 4EN0A 3V0BA 2VG9A 2DUPA 2GP3A 4Y1VA 3LWCA 3LIGA 1FPN3 3PTRB 2BYVE 1AX0A 2ZGKA 4C1WA 2VNGA 1A8DA 4QPGC 4YW7A 3CZUA 2NPIA 2ZGMA 1ND2C 4GZ9A 1JHNA 3RZMA 3DCQA 3IIAA 2JG8A 5LRSA 4L9BA 2FD8A 2CL2A 2WQ8A 1AR91 5BNPA 1FT9A 1GQGA 1ZZ6A 4M3CA 3SKJE 4QHOA 1S55A 5FYUA 4AWDA 2BW8A 5K8SA 2FDGA 3WT3A 3KGZA 2G9GA 5HCFA 1GU3A 1C4RA 2VOTA 4QPIB 5EYXA 5T54A 3KVBA 4WBBA 3WXPA 1E5SA 2GN7A 4IV1C 1CQ9A 2D6NA 4PQ9A 5GJ6A 2UU8A 4M4PA 3W9AA 3ZIXA 1ZBA3 2VXJA 1UOGA 2R32A 4AI2A 4IQPA 1W8ZA 3A22A 1F9KA 1MZFA 3J4UH 2OT7A 4XQWA 5FWEA 3VD5A 5JR7B 5GLWA 2GNBA 3RZZA 1QIQA 4CCCA 1OPMA 3H50A 5C5TA 1FMD3 3TBDA 1MEC3 4YWAA 3R4DB 4FP2A 3J8F2 3VDCA 4BQXA 3AKPA 5C33A 2D6LX 5FY8A 2VZSA 4JTNA 4D6RA 1ZRFA 2PHRA 1AYN3 1GANA 2JG9C 3CZJA 3ZPOA 3EXUA 2XUMA 3RPQA 2VC9A 2ADEA 1CR7A 3ACFA 5CISA 1NCQB 2VCCA 4DQAA 2WWSA 3LF7A 1CAVA 2JIGA 2WNEA 2XLFA 5LRRA 2FMDA 1QJU1 1TG7A 1ZBE2 1PO12 1JZ8A 4JZRA 4IEQA 4CDQC 4LK7A 1BCXA 5A6XA 1WZXA 1GNZA 4XFGA 4HVRA 2J1EA 3NVCA 3HVDA 1WW7A 3QH7A 5G05L 4B4PA 2GC0A 3HQRA 1RUI2 2ZGQA 3PLQA 4NHKA 2B9VA 2CWMA 3ZX7A 4GJZA 2LM3A 2YPJA 5ISLA 3N35A 1W0OA 2EXJA 1RJ8A 1HLCA 1UQXA 1JW6A 3ON7A 4LA3A 3LDKA 3WG1A 2PXJA 2VMHA 4NUBA 5FFOC 2WRAA 1CZSA 4C8DA 1AL22 4K6BA 2W9XA 2E32A 3G6JB 4AHXA 1R1A2 3IDCB 1R082 2WO3A 3C7HA 3Q8FA 2WC2A 4XAAA 2ZXQA 4QDSA 5F2WA 2ETEA 3VBSC 2VUCA 3OPWA 3MIEA 2OZJA 3BIWE 3VZKA 3U0ZA 1H2MA 4RD7A 1G6NA 3D6EA 3ZFFA 4H7MA 4PF5A 3EBRA 4OHWA 2A6YA 3VBFC 4BQ4A 2MEV1 1FV3A 3N9PA 1FPN2 3VBHB 2AREA 2EVXA 2VW2A 3VD7A 5DXDA 4ZXEA 1AJOA 5FZ1A 4RSUA 3SHRA 1VBD3 1KEXA 2EXIA 4CUAA 1B09A 1CWPA 4UYBA 4RGKA 5I8YA 1KS4A 4WZFA 2WAAA 1Q56A 4JAAA 1IQAA 3HOBA 1CJPA 2QQUA 4KU7A 4N43C 2HWF1 2PHFA 2VMFA 3M3QA 2N7GA 4JGZC 4XHXA 4XJ9A 4YNIA 5IAXA 3TEYA 4XACA 4Y1XA 5LA9A 3MIFA 1WLTA 2HYKA 2KD7A 4JKMA 5FAXA 4YLZA 2X5IB 2AEZA 1ULDA 3I7DA 3FWEA 4UFIA 3RZHA 2NM1A 2QKDA 3LPFA 2VAUA 5JSOA 4DRRA 1PMJX 3OEAA 3E5UA 2GZWA 2WA4A 1OA4A 5LB6A 4AQ2A 2R061 1Z0HA 5J48A 3S30A 3GDBA 3D8CA 2HWB1 2VZPA 2A73B 5JOYA 4OULA 5T50A 1OUXA 4Y20A 2E31A 1DF0A 2UY8A 5A1LA 4XJAA 1YFWA 3USUA 3K46A 1VRH2 1MQTC 5FPXA 4BMBA 4HVOA 5EHDA 3ZN5A 3C7FA 3VBUB 4XJZA 4MGZE 4HLTA 4A7YA 3IDAA 4LLFA 2O8QA 2BDRA 3UJQA 4L8QA 3I2JA 2QZ2A 2VVFA 3ZXEA 1W2OA 4K20A 2XUEA 3AZYA 2P1BA 4R8HA 5D8AB 4YVWB 1CAWA 5FZDA 2JDMA 4JV4A 4CEWC 5IATA 4AHZA 5SV5A 3WNXA 3AKQA 3IM0A 4IDZA 1FAYA 3VGIA 4MVTA 1XJAA 1XNKA 4ZONA 1H2LA 1CAUA 4BU2A 4XF9A 5BNNA 1RC6A 3IT8A 1A34A 4Q4V1 3ZXGA 3J26N 5JAXA 5KHGA 1JUHA 3M8LA 1CD3G 4N53B 2FDKA 1DZQA 5F6LB 3NAPA 4MHUA 1C3HA 1A78A 1IS6A 4FXGB 1FATA 5C4WA 2HWD2 4OUSA 2GH2A 4HT1T 2JDAA 4TXWA 5D1IA 5IVFA 3B02A 2JB8A 2Y64A 4LHSA 3WLUA 4AFMA 5CFDC 2YDEA 4UFLA 3UGHA 1DLLA 3LEKA 1J3QA 1RUH2 5KXDA 4E2GA 4IETA 5LY1A 1GLHA 3HQXA 4OFGA 4WM8C 5ABJB 3WF0A 1DQ1A 3B3QE 3JXSA 3PVEA 4BXFA 5JR2A 4Y4YA 4AYUA 4ARXA 2IFRA 3OBZA 3O1OA 3NV3A 3SITA 1LULA 4YFZA 1H8TA 1SLCA 4V1PA 2GN3A 1VBD2 4BB3A 3MUZ1 4WVZA 1W8NA 2ZKNA 5E8AA 5A3NA 2RMU3 2FDIA 3T08A 4JQRA 5JXIA 2G9ZA 1X7NA 1W6MA 2E63A 2BUKA 2P3IA 3C3VA 4IEOA 2RR13 4YSFA 1A8MA 4OZXA 1QNYA 4SBVA 1AR62 2WO2A 1Y9GA 3AP6A 5HBAA 2UURA 2ZACA 1PIV2 1LR5A 1HQLA 2Y0OA 3AL5A 2XJPA 3WQBA 2QZ3A 3GJAA 3AJZA 1VBA2 4FSJA 5FDBA 1UL9A 4NIHA 4XTMA 1F2NA 3PDQA 3T1LA 2QTWB 4PT6A 3VLBB 1W9SA 4KBBA 4PCRA 4BQYA 3SH5A 4D69A 3PUAA 5F2SA 4QPIA 3FUQA 2VMDA 1S4CA 1UMHA 1TMF1 5F5QA 2PELA 3T2TA 1OUSA 2FMYA 3ZKYA 1JZ6A 1VAKA 4E2QA 1LHUA 5LBBA 5JZGC 2BERA 2ZX3A 4RS5B 1D4M3 4JKKA 2P3JA 2QQJA 3ES1A 4HXCA 3G7DA 1VRBA 2WN3A 4HN1A 1HRI1 3LPGA 1PO21 3CMGA 1W0PA 5LBEA 5A1FA 2X53S 2XPJA 4Y4RA 5F32A 3C2UA 3VZJA 4ASMB 4DXTA 4HN0A 3UKNA 1ENXA 1J1TA 4FOVA 2WABA 1JUIA 1US3A 2OA2A 3P1IA 1H2NA 1LHWA 2B45X 2W87A 1VALA 1X50A 1NCQA 1AX1A 4EZHA 2XBO3 4NO4A 1UOBA 2XOMA 2W0XA 5T5JA 3B01A 1E5HA 4H7LA 5FZ3A 3MW2A 2MNGA 1PNGA 2VQAA 1MACA 2JDPA 4AVTA 1JTZX 4Q29A 4GXLA 2C26A 4PLMA 2CGOA 3WR0A 5JI7A 2QQKA 2R072 5FZIA 1QF3A 2WIIB 3ZOIA 2DU1A 1E5IA 1ODNA 1WCKA 1MR5A 4Q4Y1 1ODMA 2RS53 1Q8OA 4X6RB 5KR7A 4XTPA 1JYVA 1KFXL 4S2DA 2WS92 3NWKA 5CVRA 3ZR6A 5JPMB 4IGOA 4LOTA 3EMRA 3V0AB 3BI3A 2NMOA 2ZGRA 4NAOA 2ZABA 3HPNA 2R49A 5K0UC 4ITCA 1XE8A 2BGOA 2GP5A 5C7GA 1ZYBA 3MEPA 1I1EA 4YVSB 1QH7A 1RJ7A 3BALA 1SFNA 4M3CF 1UZYA 2F4PA 3NJYA 1WD4A 4P02B 1AR83 1IKQA 5B2GB 3RJ2X 4TSVA 3OPTA 4DXSA 1PVC2 1TNRA 4XUPA 4DXZA 2RR12 3T0AA 3UGGA 5EP9A 3HJRA 4EJRA 4FVVA 5FY7A 1W6NB 3VKLA 1O6UA 4LTAA 4QKDA 4XUQA 1H6XA 2AEYA 4A6OA 3AP7A 3WX5A 4EWEA 1OA2A 4QWNA 1PGW1 1AXKA 3DN7A 1PGL1 4HPKB 1N47A 2AYHA 1W04A 3SISA 2ZMLA 1T6BX 3O5SA 1ZZ7A 3MFAA 4BK5A 4F7ZA 4MG2A 4RA0A 5BYNA 3LA2A 3VHRA 5K4LA 3PVNA 2ES3A 3K3OA 4EN9B 1EYBA 4X8NA 1YQ6A 2JDZA 2Z5WA 2A3XA 2D98A 4IUGA 3DPRC 2PFWA 2ZHMA 4LBMA 1V6JA 4MH0E 2RE9A 1QH6A 3FJSA 2VR4A 5FZCA 1YCIA 3CJXA 1OKOA 1RUC2 4CDWC 1WBLA 5TSWA 2DVDA 4QAWA 1RYYA 3WVJA 2LS6A 2WNUB 5EWSA 4R9AA 2AUYA 3A23A 3KCXA 4TWTA 4PHZA 4W8JA 5A6YA 2RG4A 4YW6A 4PDWA 1OLME 3B5LB 1IOAA 4R52A 5B4NA 2OW4A 2DCTA 3W58A 3HD8B 3AP4A 5FMOL 1WA4A 2CY6A 5CU1A 5LW9A 1OI6A 2KXLA 2YFUA 3ENRA 4OI0A 4N7IA 4AF9A 5AFEA 5BV6A 1W90A 3I59B 5DAXA 2BVBA 3VBUA 1VAMA 2P5BA 1J3PA 5DDJ1 4RGGA 1YFYA 1FV2A 2JXAA 2Q0AA 3FLPA 4RR3B 3TNQA 2KA3A 1F4HA 4HMZA 3RVHA 1DZTA 1W3XA 2XGXA 5DAVA 3EB7A 1W2NA 1YIFA 2VQ0A 5DG2A 3GBWA 4ISQA 4XVHA 1S0BA 1IGOA 5D8AA 3MLJA 5DABA 3JD73 4YVWA 2VL4A 5FP4A 5FXZA 1H0BA 1ZA7A 3MLKA 1CZVA 5KBFA 1KDKA 1QDOA 2QDNA 4NRMA 1XNDA 2RS52 4AW7A 4ATFA 2WT1A 4AAXA 4NHMA 4UFHA 1AYM1 2ZX4A 3J7HA 4P5HA 4N7UA 3H1MA 1VAVA 4CU6A 5GZEA 4LBKA 5A3TA 4N53A 2VZ3A 5C5UA 2LRPA 4L0PA 2SLIA 4PI0A 2VPVA 4AOCA 5A6ZA 1LKNA 3GXUA 4XW3A 2J1VA 2OIIA 1XOYA 4ASKA 1JZ3A 2WFF2 3CNAA 2IVIB 3WCRA 1F4AA 1ZVFA 2RJLA 1OURA 3GZTB 1LJ7A 2L9LA 4IW3A 1LODA 4Q1RA 4MV2A 1FI2A 1Y3TA 3HNBM 1VJ2A 2AACA 4Q4X2 5ABJA 1HX6A 4YM2A 2JG8B 2FZ1A 2UWCA 3GNEA 4JDMA 5FUPA 1XYPA 2JWPA 5GZCA 1FOD3 3GZAA 1LHNA 3AVSA 1RUG3 3PURA 4OMDA 2PN5A 3I49A 3M70A 4QDRA 1ULEA 3F2ZA 2WNVB 1POQA 2WJSA 3HR9A 3BGAA 2Y38A 3BOPA 3GZEA 3T4VA 5JDBA 1XXNA 2B46X 2UY9A 1NCRC 3TEZA 5LZ6A 4LO6B 2RV9A 4JGYC 3NSTA 1HIXA 2C24A 5KWRA 2HBUA 4XETA 1BEV3 1AUYA 1KJLA 1OT5A 3AX4A 4B1MA 1BLZA 4M00A 2EIGA 2HWE1 3KT4A 4HG6B 1F15A 4ZZ8A 2ZGPA 5CFCB 3BTXA 5FZMA 1KS5A 4HKLA 1AJKA 2ATFA 1NZCA 3BTAA 1S0CA 4AEDC 1OLQA 1K5MC 4MYEA 3KV6A 4A3XA 2VXRA 2A70A 3I97A 2LROA 1ST8A 2JDKA 3RWNA 3ZXJA 3DYPA 1K42A 1NA1B 3ACIA 2JB4A 3VZLA 3VZOA 2BFUL 3MGUA 2RS13 1RHI2 4BPZA 2GU9A 1LB2A 1W6OB 5LCWL 1S1AA 2WQZC 4K7JA 3HBKA 4FPHA 4BXSV 5IFPA 1U5IA 1ULPA 2ZGTA 4FFIA 1UW8A 4UW5A 4RS5A 3ZYRA 5LA1A 2VZ1A 3ZYPA 4RFT0 1SLBA 4AI0A 5AC93 1JYXA 2CAVA 1ND3B 1NQJA 2J1AA 3J8F1 4Q0PA 3LEIA 1LECA 2EALA 4W4ZA 4EROA 3CQOA 1KFUL 5JXGA 1POV3 1IS4A 2DVAA 4IEYA 3ROUA 4DB5A 5BNPC 3W5NA 1ASJ3 2VOWA 1GOFA 1EV13 2D40A 4AI1A 3RGBA 2WZR2 1QJX1 2DU0A 1ZZBA 1DGWX 5FZ7A 4NROA 3WHUA 4EQVA 1JBCA 1S0EA 1FNZA 4KBZA 2JIJA 3A21A 1TME1 3AXEA 4BOWA 2GNTA 3CEWA 3POJA 2Q30A 5CZKA 2Z69A 1W8TA 5A80A 1OF4A 1ALYA 2IVJA 3SQOA 2EAAA 5FYBA 1R092 4LHKA 4ZU4A 4CCLA 5KXCA 1NUKA 4XF4A 1O3TA 4UI9L 5KXEA 1SDWA 2ZAAA 3PHMA 3A0NA 2GNDA 1W8UA 4MUVA 4DOUA 4GH4B 1Q8PA 4AEKA 2W46A 4LO7A 3UESA 1PZ8A 1G9FA 1NOVA 2GMMA 3FFZA 2V4VA 3LZZA 2D7FA 3JBG3 4P9WA 3VL9A 2DFCA 2VZVA 4QT6A 3ZMOA 5A7QA 1ZZ9A 4WVVA 3V0AA 5HCHA 3LOBA 3LKJA 4QX2A 3IPVA 5KXBA 3H8UA 2CDOA 3APBA 3NKTA 1OD3A 3QD6A 5EQUA 4YVSA 3E5XA 5IWFA 2JDNA 2W3JA 1LGCA 2DCYA 3GCXA 3WP5A 2QQLA 4AK3A 1BBT3 2YBSA 2W5FA 1X33A 1HW5A 5EIYB 3TEWA 4K40A 3N7MA 3MI8A 1SCRA 3MICA 2B5HA 4A45A 5JUVA 1W6NA 4G4FA 2R042 3OSDA 2WNOA 4XIKA 1VLNA 3S7EA 2FCUA 4I09A 1WCSA 4DZGA 5FYTA 2YB7A 5FYHA 3VN4A 4E9KA 4HPKA 1CGPA 2W1QA 1SLTA 4XCAA 3ZSEA 4X8PA 5FZBA 1PX4A 1BMV2 4OQ9A 3RWKX 1W05A 1NKGA 2GC3A 2BP6A 3B9CA 2JKXA 3B69A 3PNAA 3PJQA 1XSQA 4BK4A 2JICA 5FKBA 3F95A 1ZBA1 1A6CA 3KLSA 3ZFFC 1JYIA 2EICA 3TNPB 1CAXB 1MPXA 5A33B 1RUNA 3ZN6B 4HSJA 4MADA 3ATGA 2E33A 3DYOA 2QQIA 2Y60A 4PIXA 3VHPA 3VBRB 1FMD1 1MEC1 4PF1A 2WNUA 5AC92 2YMZA 2PHXA 1OFNA 4K1YA 1JYNA 1ULCA 3WY6A 2WINB 1XU1A 3E5QA 1AYN1 1U0AA 2QNKA 1MVQA 5DPNA 4CA9A 5L7OB 1O3QA 2XDVA 3PVBB 1RUD3 1Y4WA 4WVWA 1S0GA 1U5YA 1ZBE3 1PO13 3OUHA 4PQQA 2BJSA 5FY5A 2Z42A 1O7FA 5GKAC 3LB9A 3ZFEB 4A42A 4HFSA 3WNOA 1SDDB 3I59A 3QH6A 1T2XA 4HKOA 2KM2A 4Y1YA 3GCWA 5FYYA 3MIBA 1YUDA 2ZEWA 4RR3A 5IVEA 2VUJA 1LHOA 4A7ZA 5FPZA 4CZSA 1RUI3 2J42A 3CF6E 1AZDA 3NMBA 4P9XA 4XFBA 5T3NA 2Y0IA 2VOXA 4QXKA 3VDDB 4NRQA 2OXBA 3OBAA 2ZAHA 2DVGA 4NHYA 4HKWA 1SLAA 4PIZA 1WUVA 2WZEA 4LMFA 2HLEA 1AR71 2GC1A 3PIJA 1AL23 1CPNA 2ZZQA 4UF0B 5A32B 1SACA 3ZYJB 2A6ZA 4RHV2 2AH2A 2JDHA 2CHHA 1R1A3 2J1RA 1ENRA 4CTEA 2XHKA 5FZKA 1VIWB 5FZGA 2GDFA 3M7AA 2VULA 4COYA 5FZ4A 4IEUA 4LITA 3SCHA 4K8RB 3I2KA 2JDYA 1VBE1 2VUDA 4Z2WA 2BZDA 4GWMA 4BJ0A 1O5LA 2C9AA 4Y3OA 5JVVA 4OQ8A 2IUWA 2X09A 1GV9A 1QXRA 3WDWA 3ZFGB 5FZLA 3THTA 1CONA 2UYBA 4KNCA 1W28A 5FZ0A 1BBT2 4M01A 4S2HA 2BGCA 2ZEYA 5KHIA 2F4LA 1V9U2 1A3KA 5IHRA 2BWCA 1O8PA 3POBA 4EN8B 2K9ZA 3POFA 1SLLA 4GKYA 2ZX2A 4PJYA 1VBD1 4NHXA 3U11A 5BNNC 1DP0A 3Q8EA 5I8SA 3NJVA 4V2WA 3NAPC 4YGEA 4UBHA 2WNVA 3SH4A 4S2GA 5FJKA 3MHZA 5C4WC 3BUCA 2HEYF 3WNKA 4JRAA 3N9LA 1VBC1 2B9UA 2W1WA 4COZA 1UF2C 5CYYA 1XU2A 5HV4A 3DV8A 4JHZA 2WN2A 3DEMA 4OYUA 4KMQA 4FPOB 1GWLA 2RJ2A 3AVRA 4MZUA 2FDJA 4D7TA 2R16A 1HXS2 1QQP3 3NV4A 5F3CA 2RDNA 1RUJ2 4QM8A 4ZS2A 1DLCA 2Y6HA 5IFTA 5CFCA 1OD5A 3GHMA 4LIVA 1H8TC 4C0BA 4XF0A 3VV1A 3ZO0B 1VRH3 4E4SA 3AFKA 3D0SA 1AHSA 1W9TA 4EYUA 5G04L 1OVPA 1NA1A 3HN1A 4OHVA 1CIWA 3BU0A 4MGQA 2WYSA 1RUD2 2LTNA 5JCTA 4CVUA 1OFSA 3QOPA 1YJKA 1W6OA 4NIGA 2RS32 1UNBA 5DZGA 2A6XA 3OF1A 5FY0A 4KGQA 4DMIA 4DINB 2VVDA 4B29A 1REFA 3AYAA 3GYDA 3KQRA 2WDBA 4GMP1 1JZ5A 3BVCA 5KHJA 1ND3A 4DIQA 3M3EA 3QLQA 4YW4A 5FXXA 3S5QA 2ARAA 4D6QA 4RYDA 1EAH2 4BISA 1C8M2 1CPMA 1LOEA 2ZS6B 1H4HA 3VL8A 3ZYFA 4IE0A 1W8HA 4CCJA 3AMHA 3OGVA 3LEGA 1V00A 5FZHA 1NE4A 3FUOA 5FYIA 2RVAA 3H7YA 2HWD3 1XNTA 4QPIC 4JVAA 4IE4A 4UBGA 1RUE2 2DWRA 1NLSA 3VKMA 2Q8EA 3URFA 1RUH3 2QE3A 1QXJA 3TN92 3WHTA 4ORFA 2YHJA 1QOSA 4Z8BA 2W95A 1K12A 4F83A 3NRUA 5IVCA 1PVXA 4QMAA 4FPKA 1SFPA 1L7RA 3O7OA 1OBNA 4GH4A 4XFIA 2Q8DA 4LBNA 4CDXB 1XC6A 1SQ4A 4I2OA 3ZPYA 4CDUB 4QU2A 1RUF2 4GMP0 1X9TA 1H1IA 4NPMA 5GLZA 3WUCA 5IVJA 5KHKA 2VVEA 1EUTA 1NCQC 2CTVA 2PA7A 3AL6A 1OH4A 2RHPA 3AZWA 3M3IA 3WNLA 1JYWA 5EPAA 3MPBA 2RMU1 1NLQA 4Y5TA 4QDQA 1IZ3A 4XABA 3JU9A 2PHLA 2Q1ZB 1NQDA 1V70A 1W9WA 1XRUA 2ZHNA 3NNMA 1AR63 1LGNA 2RR11 4QPWA 1NY72 1UKGA 2VO5A 4YPJA 1HB3A 1PIV3 3AZVA 2E7TA 4HK8A 1AL0G 3VHOA 4XXAA 4A44A 5FXVA 1VBA3 1OF3A 4UW3A 4F8AA 1NE6A 1QQP2 5J7MA 3O0WA 1P8JA 4PDWB 5JWPA 1JZ2A 3K77A 4PLOA 1HKDA 3N9MA 3T4HB 5ACA2 1GP6A 2OX0A 3MFCA 3MLLA 3RZJA 2W92A 4CP0A 4PIYA 3WF2A 1YC61 4LQRA 4CRQA 5C3OA 3LSDA 1R64A 4I3PA 3ZLIA 2RM22 2FZ2A 2WKKA 2VD7A 5EJ3A 4MHRA 5LA2A 1JU3A 3POYA 3TB0A 4GKXA 1D4M1 2QBXA 1CAXA 3PUSA 5A33A 2XL9A 3MW3A 4OHXA 5FYMA 4KU8A 3VBHC 3ZN6A 3KCCA 4AFAA 4OVEA 5FR3A 3POSA 5J1XA 3VBRA 3UV9A 2BFUS 4I02A 4KH9A 3ZYGA 3USSA 2XMLA 5AVAA 2ZJCA 3V65A 1RVF3 2NYYA 4W6WA 2C6SA 2ZCWA 5L7OA 1H1AA 1WCQA 3WQ7A 1GBGA 1QJZA 1DZRA 4FP3A 3R6SA 1PMIA 1VMFA 2XBO1 2XQRA 3ZFEA 1H8VA 5CG9A 4AGRA 1K3IA 4W6XA 1KD7A 4YRDA 5FMBA 2ERFA 2R073 1EY2A 3NJZA 2DURA 4JRLA 4QB6A 5FK7A 1ZREA 2X5IC 5FRAA 1DQ4A 4CEYB 5JPNB 2DVBA 5CNAA 5A3UA 2H0VA 2CV6A 2WS93 3LFIA 3OD0A 3VDDA 1QJY2 1ZZ8A 2RS51 3H0OA 1LAJA 4RQPB 2QQVA 5C9AB 2VH9A 2BTVC 3W20A 1JZ7A 4LR4A 3WDVA 1JOPA 4WM7B 5A32A 4NRPA 4UF0A 3SKVA 1J58A 3FLRA 3U75A 3OEBA 2PLV1 1VBB2 2YPDA 4GALA 2IZWA 1UO9A 4G3YC 1SBDA 4BQ1A 3CBNA 2HEVF 3VBUC 3VD4A 3T1MA 4NWVA 3I3QA 1PVC3 2ZGSA 2P34A 1EP0A 4N9IA 1AR81 5LY2A 4D94A 2C0ZA 3ZFGA 1XNBA 2WAOA 2JDUA 1YYNA 4R4ZA 2DCKA 4KWKA 5D8AC 2DTYA 3EO6A 2BRTA 4YVWC 4E8DA 4FOQA 2VW0A 4TLFA 2P3YA 3MZHA 1AR92 3T2PA 1W2AX 3B93A 1HRV1 3IB3A 3TYJA 3U4SA 3ZXKA 3W5MA 3EQEA 4UT5A 2B7YA 4P5YA 5LASA 4YYOA 4C90A 3WUDA 1PM4A 3X29B 1QJEA 5E88A 1QOOA 1GWKA 4N53C 4BDVB 4YW2A 4W6YA 4DEVA 1L3JA 1LU2A 1F31A 4JCKA 1Y43B 3OUJA 3M1HA 5F1RA 1QKQA 2VECA 5CG8A 4BQ5A 3ILFA 4QHBA 1ENQA 2PAKA 3AXDA 5FYCA 2D5HA 1LOCA 1RUC3 5F5AA 1WMFA 2P3KA 1PMHX 1LOAA 3IDBB 4BA6A 4DUXA 3THDA 3KV5A 5ABJC 3HMYA 5FP3A 5J37A 1MS8A 1MS4A 3SC7X 4IE6A 2VOVA 1G9BA 1OC1A 4COVA 4KWLA 4I0WB 5A7SA 1HJFA 3KV4A 1SMVA 3KT1A 1UYPA 2Z79A 4UFJA 5FCCA 4GJYA 3LFMA 2D6KA 1KQRA 1RVF2 5F6KA 4LKEA 3SH3A 4OHYA 4FOYA 5IAVA 4DUVA 1QJU2 3CDZB 3IAPA 1UKRA 3MIDA 1QOTA 1NXD1 2JKBA 2XJUA 3D5OA 3PMEA 4XE9A 1QMJA 2NMNA 4R9CA 5BY5A 5EJ1B 3I2HA 3RJRA 2VBBA 1IS3A 2ZTNA 2D3PA 3R0RA 3O1TA 5IK7A 1Q3EA 4FFHA 3AC0A 4XEZA 5B4XA 1W8FA 5SV8A 2W1SA 1VMJA 2WO7A 5FQ0B 4Q4W3 3NNFA 3RMXA 1RMU1 3DGTA 1CX1A 4EN7B 3JD71 4DS0A 1V6LA 4QM9A 2BOIA 3WG4A 2WT0A 2RDRA 4E4ZA 4FI9A 1ULGA 2ARXA 3ZYBA 1YI9A 5CKMA 4GB31 3LA7A 5A7NA 3IWZA 1QJFA 1XE7A 2WQ4A 2CYFA 2YYOA 2HKXA 1GNHA 2NZ9A 3IPVB 2JE9A 2WFF3 3OOXA 1HN1A 5GZGA 2YGMA 3PIGA 4GWIA 5HXVA 1WMXA 4QPYA 2QQWA 5DUWA 4QXCA 5ANNA 1ZX5A 3RMYA 1J84A 4RS5C 5CBLA 3T3YA 5F9TA 2YC4A 3IIIA 4Q4X3 1VB2A 5JI9A 4XMAA 4CP9B 3S0MA 3O12A 1UPIA 1VE0A 4FPJA 4YGBA 3WNMA 3E97A 2A6WA 2ORXA 1BZWA 1Z7S3 4CDXA 1CN1A 5T52A 5I0SA 2G9FA 2G19A 2I2SA 1FOD1 4CDUA 4HONA 3LAGA 5C3PA 4A2UA 2HWF2 4GQ7A 4NN0A 1RUG1 2E51A 1CVNA 3LDBA 1BYHA 4E4DX 3L2YA 2ET1A 1G7YA 4LKDA 4AHWA 1PZ9A 2I45A 4LOSA 3WNNA 5E89A 1COV1 2JD9A 3AK0A 3OY8B 4BH9A 2EIDA 2WYFA 3SMHA 3U14A 4XJWA 3WNPA 1GYKA 4PBOA 2QUOA 2JECA 3W21A 5EXOA 1RUOA 4QQ2A 2WLPA 1BEV1 2R062 2BBAA 4CU8A 2FQPA 2BNOA 3NNJA 1O3RA 4AGGA 2HWB2 2HWC3 1TE1B 3CKHA 4L97A 3N9NA 2LW8A 4OCTA 4LBLA 5JSRA 3UKVA 3T2QA 2W2IA 2B42B 3T30A 3AKTA 2WL1A 3JUUA 1BVVA 1IG3A 3ZYIB 4ZHNA 5GLVA 4D3WA 1E57A 1RHI3 3FC0A 3FHAA 3E6DA 1SPPB 1XQNA 4YVSC 2VM9A 5FZFA 1GICA 1W0NA 2RS11 1U12A 3BKZA 1RXGA 4XBQA 3ILRA 3D3AA 3H1WA 1PNFA 4A41A 5BPXA 1HJGA 2QQPA 1XYOA 3SLIA 4PLNA 4I01A 1QU0A 1OQEA 1GFF2 3UETA 4LO5B 5F39A 4QX3A 3NQHA 4AVBA 3RZLA 4FXKB 2YBKA 2D6PA 3BPZA 4KL1A 2W39A 2RDSA 5JIAA 4Q4W2 2IC1A 4D8MA 1BJQA 2P6CA 4B4RA 1GOHA 2P6HA 2YROA 4Q4V2 4URTA 5I0TA 2WZR3 4PBPA 2ZMKA 1POV1 3WDXA 5IK5A 2XXZA 1OOPB 1ASJ1 5GZFA 4NPRA 1EV11 1OQDA 3CJIB 4K9SA 4O65A 3VHNA 4ES8A 2XB6C 5J98B 2NQYA 5GM0A 4COWA 1JYCA 4D7YA 5AFBA 4LKSA 1R093 2TUNA 5KHHA 3I3EA 4DPNA 3HWJA 4DFSA 3FX3A 4JHTA 3LOIA 3AMPA 2K2SA 4KI5M 3RI9A 4QKNA 4XQ4A 2XJVA 4CEYA 5C70A 1X9PA 4Y5Z0 3KGLA 1GZWB 2UWAA 2ZOEB 5DN2A 5FMDA 5LATA 3RZKA 1DIWA 2WNUC 3PU8A 3R4SA 3VKNA 3HT2A 2XONA 4Z92B 3UJOA 4RQPA 5C9AA 4INDA 3RI8A 2K0GA 2D3RA 2V5YA 1Z7S2 3H8RA 1IS5A 3JBG1 1JOBA 1UMIA 4WM7A 3WG2A 1JXNA 4EV0A 4FPYA 5CA6A 5LEKA 1MS0A 1UX6A 1Q8QA 1POV0 4LORA 4V2VA 3T2OA 5CAZA 5APAA 3DKQA 3DXTA 2R6QA 2O14A 3AKSA 1GNYA 3ZSKA 2YC2A 1KRIA 4BMEA 4RR3C 3CIHA 1NYWA 3ILNA 2DDUA 3NV2A 3UT0A 1NG0A 5HXMA 2R043 1YQ5A 4N90A 3RSJA 3UNPA 1O91A 1I5ZA 3U07A 1WWYA 5E6HA 1JOJA 3WW4A 1YI7A 1RINA 4KQ7A 4NJ4A 4Y26A 2A5ZA 4A7KA 4XFHA 1DU3D 1RTVA 2OYZA 2HWC2 5C71A 5C3RA 2VMCA 3NKGA 1TMF2 2VZRA 5A6QA 3RFRA 5FO9B 5L36A 1C28A 3RYPA 4Y1UA 2FHRA 5FTTC 2PAMA 3WDYA 1F5JA 3MIHA 1QNWA 2X29A 1LCLA 2VZTA 3THPA 2VU9A 1HRI2 4AVCA 1PO22 1M06G 2Y33A 2MPFA 3KCYA 2O1QA 4FPFA 5IJRA 2QQOA 3C7OA 2ZX0A 1Y9MA 4O7XA 4YZ1A 3WQ0A 1X8EA 2XJQA 1DG6A 4MO3M 2GALA 2GMEA 4MXWB 1WLDA 2JG8C 4K3UA 5BNOB 4LBQA 4DXRA 1W06A 4MGKE 5ANQA 1DGRN 5DZFA 4CUGA 1LNSA 5JMCA 4M3CE 5LWBA 3S7IA 1V6NA 5A3WA 5KC5A 1W8WA 3DF0A 2WNVC 3HAGA 4JDNA 1PGSA 1RUD1 3AB0A 5FP7A 2ZEXA 3V64A 1ZBE1 1PO11 4Z1VA 3H3LA 3GHNA 4GULA 4YW1A 4BE3A 3WZ1A 4ZU5A 3DYMA 3U10A 1IHMA 5C8CB 4Q4Y2 1DGRA 1ULOA 2EAKA 4UW6A 4UWDA 1W2TA 4Y33A 3T0BA 2ZBJA 4D6SA 1RUI1 3POIA 5FQ0A 3DKWA 4BIFA 4MGTA 5FLHA 1URXA 1BQPA 2GH8A 5CFCC 3ACGA 4FFGA 3I3DA 3P6BA 4J6GA 4FPCA 2DF7A 4TN7A 1FNYA 4RFRB 2VW1A 4RHV3 3BTZA 2HJIA 2ZA9A 1UZWA 5H9QA 1AL21 1PK6B 1W03A 3O0VA 4QQPA 4CYDA 1ZRDA 3A7QA 1KDMA 1NA1C 2Y6LA 4IL7A 3WQ1A 3O1VA 1R1A1 2O0OA 5JOXA 1R081 1OA3A 5BUVA 2EIBA 2OVUA 1XBFA 1DYOA 1XE0A 2X10A 1JH5A 3FN9A 3I4IA 4LEJA 4Q2FA 4Q0SA 4XOGA 1ZRIA 3PUIA 1N1TA 3BTYA 3TRSB 2G1MA 4YZ4A 2E9QA 1V9U3 3KS7A 1FPN1 1O4ZA 3A4UA 3Q8CA 4KG8A 3AFGA 3UGFA 4CP9A 1O4TA 5FIXA 1S2KA 1N1YA 1ND3C 2D97A 1PGW2 3AYEA 3OGSA 2QQNA 2WFPA 4IGPA 2K46A 2YU1A 1PGL2 1BK1A 2ZEZA 3KWVA 2E7AA 1IKPA 4IV3B 3C7EA 5JOWA 2OQ6A 2XJRA 5FBZA 5H9SA 5FZEA 1J59A 1Q5OA 4GD4A 2H0BA 3I8TA 1VPHA 4ZKTB 2EF6A 1B35B 5DMYA 2DUQA 3GALA 3SEPA 4XFAA 4YM1A 1UZZA 2JJ6A 5FPUA 3MF6A 4MSVA 4O9EA 4BQWA 2PHWA 3CO2A 2GMPA 3O14A 1Q8VA 1UY3A 1PHMA 3OY8A 5FZOB 1JU4A 1JODA 3NV1A 1DYKA 1RXFA 1HXS3 1D0HA 4IESA 1CJDA 4XXPA 1KJRA 2BEOA 2VY0A 3AKRA 4IXLA 4N8MA 4W65A 2ZHLA 1RUJ3 4CU7A 5FXWA 4GH4C 5FZ8A 1QQP1 4I3GA 2FBEA 5DAWA 4YZ2A 4FTBA 1TVGA 4HVQA 3VKOA 4U2AA 3K4DA 1NT0A 2P4EA 4B7EA 1VP6A 3VB9A 3E1F1 4ARYA 1HV0A 1VRH1 2LUWA 4O61A 3VBOB 1BKZA 1KXGA 4HZFA 4JX0A 3MUY1 2Y6KA 5DDJ2 1W6PB 2OPKA 2VMGA 4P08A 3T0DA 2FDHA 2RS33 1OHFA 2J1UA 1SPPA 4CCNA 1W9FA 3B94A 2B8MA 5H9RA 4QPGB 2E53A 1O8SA 3JZVA 3M3OA 4TLGA 1SEFA 1ND2B 1OKQA 4FQ4A 4N9HA 3UL2A 1OQ1A 2EXHA 3KB5A 1EAH3 1C8M3 3OBTA 5FV3A 4XFFA 1QJX3 3ECQA 1AYM2 4A6SA 2VCAA 2XJTA 3LCPA 4YGDA 3IAQA 4D0QA 3H8XA 3S5AA 3PL0A 2XLAA 1GQHA 3WOGA 4BQ2A 2ZMNA 3J7MA 4IV1B 4LJHA 4LBJA 2ZGOA 2VCMA 1OOPA 1WW6A 1RUE3 3KM5A 4H3WA 4K21A 2B39A 3CJIA 2ET7A 3DUIA 3OGGA 3PTYA 1W6QB 2ZGLA 2ZZJA 1FXZA 2HWD1 4TYSA 3TN93 1O5UA 1Z78A 5FY4A 2W47A 2A1XA 1RITA 4LPLA 3RYKA 1QY4A 1RUH1 1GZ9A 1REDA 1X8MA 3UYJA 2IWGB 3H42B 3RDIA 4OUEA 3SCFA 1J3RA 1GZWA 4P9YA 1O4YA 1J83A 2JG9B 3VBRC 1YFUA 4EE2A 2IXJA 1ZA4A 1RUF3 5CKQA 5DG1A 3RQ0A 2KR2A 3KF3A 2WO1A 2ENRA 1WA6X 3E6BA 3NW4A 4DNYA 1WGPA 3D0JA 5L7OC 5JOZA 1DCSA 1UY0A 4FO9A 4ISRA 4CDQB 3AMNA 2YV8A 1F35A 5FBJA 3ZFEC 3LD8A 4IGQA 1UU6A 2CDPA 3ORJA 4HANA 2XWJB 4FQZA 3JB4C 2FCVA 1YJLA 2XLGA 3J7LA 3HBZA 4Q5OA 4UAPA 4CCKA 1AR61 3K75B 2P37A 4AXOA 2IXHA 4NE9A 2HWE2 3DXUA 4Q1PA 1PIV1 3AP9A 4UFKA 5IUQA 2BPA2 2WZ8A 1GOGA 3N4MA 1ZZCA 3BB6A 1YO8A 3VDDC 3POGA 3ELNA 1VBA1 1YFXA 4AHYA 3TWIA 1SHWB 5JXHA 5ACA3 1BVP1 4YM3A 1JMUB 5C3QA 2DCZA 4P9LA 2PHUA 4CXWA 3WW3A 3AP5A 3QCWA 1GKBA 3FBMA 2V73A 3S57A 3IBMA 5M0TA 1UYYA 4XPVA 3N7JA 4BQ3A 2PAEA 3VBSB 2Y6JA 4XBNA 4AFBA 2JD4A 2RM23 1N1SA 2BBVA 4NVPA 1MS5A 4Z82A 3VBFB 3LGRA 4LHLA 3ZXLA 3ZFGC 5FO8B 1US2A 4AI9A 4META 5FMOS 4B1LA 4XJ8A 3MW4A 4B3NA 2ARCA 4LUKA 1HDKA 4OZOA 2Q8OA 2DYCA 2JE7A 5F3EA 4MXWA 5BNOA 4QU1A 5FP8A 3U4XA 3KZ4C 4IE7A 2ZHKA 1RB8G 1R1ZA 3MDPA 3RNSA 1OMIA 1QJX2 5CADA 4N43B 4JGZB 1DGLA 3BODA 2W94A 5C6CA 1RVF1 2YXSA 1IPSA 2CNAA 1IQDC 3N9OA 2ZGNA 4L11A 4J1WA 2XH6A 1TME2 5DAQA 2IFWA 2VJXA 4O9GA 1H2KA 4XDQA 3NJXA 1D4VB 4AR2A 2OQ7A 2HBTA 5DUXA 3M2MA 1S2BA 1S0DA 1DFQA 5F5CA 2OUJA 2IXKA 2W68A 2XL7A 1D2SA 2VMIA 4AQSA 2WBKA 2WZPP 1GMMA 5DZEA 2R071 5C8CA 4QX1A 3OBRA 2UYAA 1AR73 1QJY3 3FHIB 2CU5A 1I9RA 4B4QA 1H4GA 4Y24A 4CE8A 2R1BA 1U5ZA 2ZX1A 4P9JA 5JXJA 1LRHA 2WS91 4IEWA 4WVMB 2Y6GA 4QD2A 1NX9A 1EPZA 1OH3A 1MQTB 1VBB3 2R0HA 3KV9A 4FTSA 3O1RA 2C4XA 1VBE3 3CHXA 2Q8CA 1PK6A 2DFBA 2PHDA 4EZ4A 1HB4A 4C0HA 4LUMA 1H6YA 1GQPA 1V6IA 4CCOA 4B8EA 4DO0A 1WCDJ 2R0FA 4QX7A 5A7OA 4YFWA 1OSGA 1NLRA 3KF5A 3RG0A 1BK0A 1DHKB 1PVC1 1GWMA 3IZOA 3B7MA 4XUTA 5FLJA 5J36A 1VR3A 3L2HA 4CEWB 2ZPXA 4FPGA 3P3NA 5F7UA 4XHBA 2V5DA 5L9BA 1AR93 1UY1A 2PMWB 3BU7A 3J9SA 1KGYA 3HQUA 4LKFA 4M4RA 1JI6A 5FPLA 3WINE 1IPKA 4IEPA 1UCXA 2HH9A 1UZVA 3FFQA 3PMSA 4CPBD 1DDLA 4XZUG 1STMA 1LOFA 4GWJA 4KG0A 5FZ9A 1L7LA 4AGVA 1UU5A 4IV3A 1I6XA 4PI2A 4UFMA 5I91A 1UU4A 1REEA 2VMEA 4UW4A 1D0GA 4XJUA 1GZTA 1UMZA 2H6CA 1SG3A 1VBC3 3ZKUA 5IVBA 1NXMA 3ALQA 4Q0VA 1H30A 1H9PA 1LOGA 2PQSA 4QKFA 1B35A 4YG0A 3WD5A 5L9RA 4BCUA 1SCSA 2HYXA 4NHLA 5CFDB 4H2AA 1FX5A 1MZ5A 3K4AA 5CIRA 1ZBA2 5L19A 2W91A 3D82A 2XR4A 3AZZA 3ME2A 3TEXA 5FZOA 3E6CC 1LEMA 1PZ7A 3Q8BA 4WM8B 2VGDA 5H9PA 5D2AA 4L99A 2WWUA 3O1UA 3H8OA 1OLRA 1RUC1 1J1LA 4EN6B 1FMD2 1MEC2 2A75A 4AVVA 2OS2A 3VZNA 5J96B 4L2NA 2X8KA 3WG3A 4CDXC 4QXBA 4AQ6A 1WLWA 4KWUA 2E26A 1AYN2 4CCDA 3VD9A 3O1PA 2W1UA 4WZCA 3POWA 3JQXA 4XIOA 5FMCA 4CDUC 4C91A 1AXZA 3QBQA 4R4XA 3ZN4A 1QJU3 1W39A 2DV9A 3R4UA 4K8FA 2YC0A 4BIOA 1UY2A 2GSYA 5HCAA 2A6VA 1HQWA 2XVGA 3VBOA 4AEJA 5J09A 1LU1A 1W6PA 1WKYA 2Y34A 4HSLA 5FOJB 4IEZA 2VTXA 2D44A 5ERLA 1SBEA 2W52A 5I0UA 1MZ6A 4GMP3 4QPGA 3VZMA 3O1MA 1ND2A 3I2OA 2V72A 3ZSJA 3OB8A 3ZMNA 2WUHA 4UXAA 4E27A 4ZXKA 2VZQA 2F17A 4QKBA 4Q4W1 1AR72 2IXCA 3WSOA 3ST7A 1YIPA 4PDWC 3ZR5A 4DRVA 4URAA 1GSLA 2AGSA 3K48A 1JS9A 2VNRA 3HNYM 4IV1A 4JKLA 1DGWA 4NPLA 1HN0A 5FK8A 5L9VA 3WW2A 2ID4A 1WW4A 4M0HA 5DUVA 5JZGB 3KMHA 1VBE2 5FZAA 1W6QA 1HQNA 3AMQA 2WWJA 2WFF1 3OD4A 2MEV3 3ASIA 2NP0A 2AR6A 3MV01 2A7AA 2TNFA 4ZPIA 2ORZA 4MGIE 4ZS3A 3VDAA 4FPLA 2HEWF 1VMHA 3EJKA 3O1SA 4MOAA 2OZ6A 2A3WA 2G4IA 1JYTA 2O8OA 3LDRA 2VBDA 4Q4X1 4CSWA 3B00A 3JQWA 4YG6A 5FREA 2DBIA 3MPPG 5K7PA 2C5DA 4BLIA 1C5IA 2JG9A 3Q9OA 4Q8KA 1N3PA 4FAHA 3I2GA 5K9YA 2VBPA 2HWF3 1Z7S1 5HCBA 2VNVA 2ZKLA 1NZIA 2PTMA 4X6QB 1U5XA 2XVKA 4I0AA 3CL1A 5T5OA 2Q5TA 3BN6A 4XDOA 1G9AA 1VBC2 5FOBB 1UX7A 3ZM8A 4CDQA 2CSGA 4QX5A 3H7JA 2AC1A 5A3MA 3GBGA 5KC6A 1V6MA 3V56A 2YGLA 4AFDA 4DEQA 1AVBA 5I8TA 4DUWA 4YARA 4NAMA 1LGBA 1WLCA 1Y9QA 4I0BA 2R063 3ETPA 4CEYC 5FO7B 3OTFA 4JDOA 3U37A 4OLLA 2HWB3 4CPBA 2FDFA 5IYYA 5FKCA 4R9DA 4LBQB 1Q43A 1RGSA 5DUUA 4LE3A 1YRZA 4RQPC 5C9AC 1ZNPA 2HWC1 2QFEA 5K0UB 3I3BA 1YQ2A 1DBNA 3JB8A 4NIAA 4WM7C 5IK8A 2XJSA 3M4FA 4RN5A 2FCTA 5F5IA 1XYNA 1TQ5A 2VQUA 3UKTA 5C8WA 3VBSA 3TOJA 1RHI1 2ILMA 4HETA 3C8XA 1F5FA 3IKWA 3H1YA 2WSUA 2E6VA 4Q0QA 1FYUA 5LBFA 5IT6A 1QHDA 3VBFA 2BQPA 2VOKA 1ONAA 3Q8AA 4HBNA 1HB1A 2WLQA 4IEVA 4NIIA 4G9SB 4Q27A 5F37A 2XKPA 4YG3A 4XF1A 4K1ZA 1APNA 1G86A 4NWWA 2DCJA 1NAEA 3FHQA 3OCPA 2XG3A 4U36A 4P9IA 4Q4V3 5FP9A 4YW3A 4NIDA 2BV4A 1CX4A 4BLJA 2QCSB 3WEZA 4TZDA 2EIEA 2I74A 3FLTA 1MZEA 1ZM1A 4N43A 4JGZA 2WZR1 1QEXA 4OHZA 2PHTA 3NNGA 1JN2P 2VTFA 3OUIA 1TEIA 3POEA 4QQHA 1AF9A 1YQCA 5I0DA 2R30A 3DPRB 1K5JA 4FT8A 1GZCA 2EA7A 4LLOA 3EYPA 5LBCA 4Q26A 5L73A 3GJBA 3K4ZA 4ONUA 1DQ2A 4J25A 4XMIA 3NL1A 4J1XA 4CDWB 4JC1A 4LO8A 1R091 2XHNA 2MEV2 4P00B 3WDTA 2DBNA 4AAPA 4GA9A 4IERA 3ZYHA 1W3VA 4LT5A 3CLPA 2GC2A 3KSCA 3PUQA 1UY4A 2PYTA 4QB2A 5E16A 4E2SA 4ZZ5A 4XURA 3WF3A 1W2UA 2PLV3 3ZXAC 1YHFA 3ACLA 4WV8A 3ZIWA 2IXIA 3MF9A 4WVMA 1MQTA 2WA3A 1UN1A 2VZOA 3AJYA 1N1VA 5FUNA 4P9GA 3ZVXA 4CU9A 2RMU2 2Z4FA 4QGNA 2BU9A 5GZDA 3VDBA 3I2IA 4SLIA 3LEMA 3OYWB 5EFUA 4Q8LA 3WF4A 4AQTA 5JLVA 2ARBA 3OPZA 5DQ0A 2CGPA 2C9KA 5A7WB 1W9YA 4XBLA 5FUIA 3WDUA 1YNAA 1V6KA 4R9BA 5CEHA 3WP3A 5EJZB 1XNAA 3B9IA 3VBHA 1HRV3 4CEWA 4LXLA 1S2EA 4FAGA 2R041 5T5PA 4LULA 3ACHA 3AYCA 4I30A 3MO4A 3H3UA 5FYSA 1C1LA 4F3JA 3RZGA 3WW1A 2DVFA 3M3CA 2J22A 4Y5SA 4LBQD 5IVYA 1TMF3 1OXCA 4IE5A 4QGMA 1UYXA 1XNCA 2CGNA 4YM0A 3WP6A 2P2KA 1BMV1 1WBFA 3FE5A 3GF6A 5D21A 5EV7A 2A3YA 2JEMA 2VUAA 3SNMA 1BXHA 4KGGA 2JX9A 3FL7A 5CFDA 2Y6FA 4A4AA 5JMOA 1M4WA 1T6GC 1GR3A 1UXZA 2X5IA 1HRI3 4XDPA 1PO23 2AENA 3CU7A 1D4M2 1N3OA 2XWBB 4GIQA 4WM8A 4XCBA 3PU3A 1C8NA 3HT1A 1YQ8A 5FPBA 2XKOA 3OG2A 3H9AA 1TNFA 4JTOA 5CKNA 3NO8A 1PX3A 2I07B 4OI1A 5AC91 1X82A 1S0FA 1TZOA 5FY9A 4QQOA 2J1SA 3ITQA 4YW5A 2V09A 1E5RA 3PJYA 1IG0A 4CUBA 5DAPA 2GNMA 4CXYA 1CZTA 3N3HA 2DTWA 2YG0A 5EZWA 4YZ5A 5FLIA 1NCRB 2XBO2 1JHJA 4H55A 4COUA 4XF3A 2R7EB 4CXXA 1X36A 3HNMA 4JGYB 4BM8A 3IMNA 3GM8A 5FPAA 4AI3A 4FCAA 4Q4Y3 1RMU3 2VZUA 1O3SA 2B4KA 2YZ4A 4QHZA 1Y7BA 3I2FA 4Z2AA 2YBPA 2LALA 5FZ6A 1WW5A 4CP1A 5LEJA 4GB33 3FBYA 1LHVA 4XUNA 4AEDB 4QX0A 1K5MB 4XFCA 4Z07A 1SLIA 4XYXA 1QXPA 3U78A 1UIJA 2PLV2 3FMGA 4RHV1 4QX8A 2BGPA 4Y22B 4AVAA 2R1DA 5FYZA 1WCUA 3V0BB 5I0RA 4AFCA 4E8CA 3I3MA 2YFZA 2RDQA 2WR9A 5JZGA 1AR82 4DY5A 5FYVA 2VNOA 2Y26A 3A0KA 3HEIA 2E7QA 3INAA 2AZ5A 3C7GA 1BBT1 1UIKA 1G9CA 3TAYA 3P3PA 3WF1A 1V9U1 4UOJA 1CESA 1HRV2 1OVSA 4MX3A 4M3CB 2D3SA 4MGYE 5BNPB 1ZRCA 3VKFC 1HB2A 4Y1ZA 4FPEA 2D6MA 2Q1FA 1YLLA 2WSVA 5HV0A 4ES9A 4EWAA 3ZSMA 1YWKA 1COV3 5A7PA 1OOPC 3W59A 2YY1A 1C5HA 3CJIC 5A1AA 1WD3A 3OGJA 2DUOA 2IXLA 4AG4A 3MBWA 3IMMA 2CWSA 4OUMA 2QVSB 3MIGA 1YEWA 1ZRRA 2BWAA 2ZGUA 3GGLA 4LIUA 2EXKA 3AYDA 1HXS1 3KQ4B 3KVAA 1XSRA 1DQ0A 4E4HA 4XC9A 5LK5A 1RUJ1 5F3GA 1S0JA 5LA0A 3HN3A 2H6BA 1UWWA 4LO4B 4LNVA 1LENA 2D43A 1MS1A 4ZU7A 4ATEA 1QWRA 5K0UA 2OPWA 1CAVB 1ULFA 2C1FA 5DDJ3 1RL3A 1S0IA 2GAUA 2JENA 3I2DA 5FWJA 1UZ0A 1I3HA 4KWJA 1UOJA 1D2QA 1WMEA 4QQLA 5A3LA 4NR1A 4B7KA 4Q0UA 2RS31 3N9QA 4OI4A 4FBFA 5GLTA 3VD3A 2BNNA 3O0XA 3SCGA 4MXVA
chains in the Genus database with same CATH topology
1KITA 2D5FA 2SBAA 1RMU2 2OUHA 2YUEA 3JD72 1EPWA 1AYM3 3N7KA 1EAH1 1C8M1 3AM2A 4GB32 1MS9A 1C1FA 5CB7A 3OJBA 1AX2A 4GWNA 1UD1A 1V6OA 4M0NA 3ZSLA 4LA2A 4D7SA 1RUE1 4XQDA 3DPRA 4EWDA 1G9DA 1LOBA 3ZFFB 1QGLA 5AVPA 3TN91 1MVEA 4LBOA 3BOWA 4YGCA 5BXXA 4CDWA 1DQ6A 2D6OX 5I93A 3IN9A 2PQQA 3AMMA 1OPOA 2QDRA 4FTEA 4FOWA 5EYYA 4BHPA 1F8VA 4P14A 1ENSA 1LESA 3KT7A 3R05A 2XVLA 5BNOC 2MHFA 1FOD2 4CP2A 4XILA 1Q8SA 3K51A 1DYPA 1RUF1 1RUG2 1LEDA 4YZ3A 4DY3A 5HI0A 4QGLA 1UAIA 3ETQA 3UK9A 1MS3A 1COV2 1RIRA 1YXWA 2UWBA 3OYWA 4C1XA 3ZXDA 3EHKA 4BWOA 3DL3A 2BNMA 3PVOA 3IDEA 4MLOA 1HV1A 4IEXA 4RGAA 4AI8A 1PM7A 1WMDA 3N36A 1NY71 2HWE3 2NLRA 3BCWA 3N7LA 1BEV2 5C8CC 5J3UA 3MYXA 1UPSA 4L92A 5T55A 4NOTA 2W08A 3RRDA 5GLUA 4BYYA 1C57A 4Y20B 3WCSA 2TEPA 3WV6A 3USUB 4HK9A 2A71A 3ZXFA 3ZDSA 5E1RA 3HIFA 5ACA1 3H3ZA 3SXWA 1PK6C 2D93A 2QJVA 5BNQA 2RS12 4AVSA 1H1MA 4S2FA 3QACA 5GALA 2RM21 1H9WA 1CAWB 5JIUA 3J8F3 4HL0A 3ES4A 5LK7B 4OI2A 2P17A 3S6PA 2F6BA 1CAUB 1SBFA 5BNNB 1IPJA 3RS6A 1G8WA 3LA3A 1LOFC 3KD4A 1LTEA 4IV3C 2RJKA 2CAUA 3AZXA 1VB4A 3NAPB 1ASJ2 1QDCA 3RYRA 3WP4A 4BZ4A 1EV12 4LE4A 1TME3 5JSPA 5C4WB 2BVVA 4RL7A 1B35C 3VUOA 1AXYA 1NCRA 5IK4A 5T5LA 3GBFA 4JGYA 3L9JT 3GZUC 2WT2A 2Q1MA 3FZ3A 3LSEA 1N3QA 4AE2A 2Z2SB 1H8TB 3I54A 1QJY1 4LHNA 2NN8A 4AEDA 4XZPA 1K5MA 3JCIA 3JBG2 1R083 4H14A 4AEMA 3D4KA 1VBB1 1W6MB 1DQ5A 2TBVA 1SFYA 3VBOC 4ASLA 2Q4SA 4Y22A 4EN0A 3V0BA 2VG9A 2DUPA 4Y1VA 3LWCA 1FPN3 2BYVE 1AX0A 2ZGKA 4C1WA 2VNGA 1A8DA 4QPGC 2NPIA 2ZGMA 1ND2C 1JHNA 3IIAA 2JG8A 5LRSA 4L9BA 2CL2A 1AR91 5BNPA 1FT9A 1GQGA 1ZZ6A 4M3CA 4AWDA 1S55A 5K8SA 2BW8A 3WT3A 3KGZA 2G9GA 5HCFA 1C4RA 4QPIB 5EYXA 5T54A 4WBBA 3WXPA 2GN7A 4IV1C 1CQ9A 2D6NA 4PQ9A 5GJ6A 2UU8A 3W9AA 3ZIXA 1ZBA3 2R32A 4AI2A 4IQPA 1F9KA 1MZFA 3J4UH 4XQWA 5JR7B 5GLWA 2GNBA 3RZZA 1OPMA 3H50A 1FMD3 3TBDA 1MEC3 3R4DB 4FP2A 3J8F2 5C33A 3AKPA 2D6LX 4JTNA 1ZRFA 2PHRA 1AYN3 1GANA 2JG9C 3EXUA 2XUMA 3RPQA 1CR7A 1NCQB 4DQAA 2WWSA 1CAVA 2XLFA 2WNEA 5LRRA 2FMDA 1QJU1 1ZBE2 1PO12 4IEQA 4CDQC 1BCXA 4XFGA 1GNZA 4HVRA 3NVCA 1WW7A 3QH7A 5I8YA 4B4PA 2GC0A 4NHKA 1RUI2 2ZGQA 3PLQA 2CWMA 3ZX7A 2LM3A 2YPJA 3N35A 1W0OA 2EXJA 1RJ8A 1HLCA 1JW6A 4LA3A 3WG1A 2VMHA 5FFOC 1AL22 4K6BA 3G6JB 4AHXA 1R1A2 3IDCB 1R082 2WC2A 2ETEA 3VBSC 3MIEA 2OZJA 3BIWE 3VZKA 3U0ZA 1H2MA 4RD7A 1G6NA 3D6EA 3ZFFA 4H7MA 4PF5A 3EBRA 4OHWA 2A6YA 3VBFC 2MEV1 1FV3A 1FPN2 3VBHB 2AREA 2EVXA 2VW2A 5DXDA 1AJOA 4RSUA 3SHRA 1VBD3 2EXIA 1B09A 1KS4A 4WZFA 1Q56A 4JAAA 1IQAA 1CJPA 4KU7A 4N43C 2HWF1 2PHFA 3M3QA 4JGZC 2N7GA 4YNIA 4XHXA 4XJ9A 4Y1XA 3MIFA 1WLTA 2HYKA 5FAXA 4YLZA 2X5IB 1ULDA 3I7DA 3FWEA 2NM1A 2QKDA 5JSOA 4DRRA 3E5UA 2GZWA 2WA4A 1OA4A 4AQ2A 2R061 1Z0HA 3S30A 3D8CA 2HWB1 5JOYA 2A73B 4OULA 5T50A 4Y20A 2UY8A 1DF0A 4XJAA 1YFWA 3USUA 1VRH2 1MQTC 5FPXA 4BMBA 4HVOA 3ZN5A 3VBUB 4XJZA 4MGZE 4HLTA 4A7YA 4LLFA 2O8QA 3UJQA 4L8QA 2QZ2A 2VVFA 3ZXEA 4K20A 3AZYA 4R8HA 5D8AB 4YVWB 1CAWA 4JV4A 4CEWC 4AHZA 5SV5A 3WNXA 3AKQA 3IM0A 1FAYA 3VGIA 4MVTA 1XNKA 1H2LA 1CAUA 4XF9A 5BNNA 1RC6A 3IT8A 4Q4V1 3ZXGA 3J26N 5JAXA 5KHGA 1JUHA 3M8LA 1CD3G 4N53B 1DZQA 5F6LB 3NAPA 1C3HA 1A78A 1IS6A 4FXGB 1FATA 5C4WA 2HWD2 4OUSA 2GH2A 4HT1T 5D1IA 3B02A 3WLUA 4AFMA 5CFDC 2YDEA 1DLLA 1J3QA 1RUH2 5KXDA 4E2GA 4IETA 1GLHA 3HQXA 4OFGA 4WM8C 5ABJB 1DQ1A 3B3QE 3PVEA 4Y4YA 4AYUA 2IFRA 3NV3A 3SITA 1LULA 4YFZA 1H8TA 1SLCA 4V1PA 2GN3A 1VBD2 4WVZA 5E8AA 2ZKNA 2RMU3 4JQRA 1X7NA 1W6MA 2E63A 2BUKA 2P3IA 3C3VA 4IEOA 2RR13 4YSFA 1A8MA 4OZXA 1QNYA 4SBVA 1AR62 3AP6A 5HBAA 2UURA 2ZACA 1PIV2 1LR5A 1HQLA 2Y0OA 2XJPA 2QZ3A 3AJZA 1VBA2 4FSJA 5FDBA 1UL9A 4XTMA 1F2NA 3T1LA 3VLBB 4KBBA 4PCRA 4D69A 3SH5A 4QPIA 3FUQA 5F5QA 1TMF1 2PELA 3T2TA 2FMYA 1VAKA 4E2QA 1LHUA 5JZGC 2ZX3A 4RS5B 1D4M3 2P3JA 3ES1A 3G7DA 4HN1A 1HRI1 1PO21 1W0PA 2X53S 2XPJA 3C2UA 3VZJA 4ASMB 4HN0A 3UKNA 1ENXA 1J1TA 4FOVA 1JUIA 2OA2A 1H2NA 1LHWA 2B45X 1VALA 1X50A 1NCQA 1AX1A 2XBO3 4NO4A 2W0XA 5T5JA 3B01A 4H7LA 3MW2A 2MNGA 1PNGA 2VQAA 1MACA 4AVTA 1JTZX 4Q29A 4GXLA 4PLMA 2CGOA 3WR0A 5JI7A 2R072 1QF3A 2WIIB 2DU1A 1WCKA 4Q4Y1 1MR5A 2RS53 4X6RB 1Q8OA 4XTPA 1KFXL 4S2DA 2WS92 3NWKA 5CVRA 5JPMB 3V0AB 2NMOA 2ZGRA 2ZABA 2R49A 5K0UC 4ITCA 1XE8A 1ZYBA 3MEPA 1I1EA 4YVSB 1QH7A 1RJ7A 3BALA 1SFNA 4M3CF 1UZYA 2F4PA 1WD4A 1AR83 1IKQA 5B2GB 3RJ2X 4TSVA 1PVC2 1TNRA 4DXZA 2RR12 4EJRA 4FVVA 1W6NB 3VKLA 4LTAA 3AP7A 3WX5A 4EWEA 1OA2A 1PGW1 1AXKA 3DN7A 1PGL1 4HPKB 1N47A 2AYHA 3SISA 2ZMLA 3O5SA 4F7ZA 1ZZ7A 3MFAA 4RA0A 5BYNA 3LA2A 3VHRA 3PVNA 2ES3A 4EN9B 1EYBA 4X8NA 2JDZA 2Z5WA 2A3XA 2D98A 3DPRC 2PFWA 2ZHMA 4LBMA 1V6JA 4MH0E 2RE9A 1QH6A 3FJSA 1YCIA 3CJXA 1RUC2 4CDWC 1WBLA 5TSWA 2DVDA 3WVJA 5EWSA 2WNUB 4R9AA 2AUYA 3KCXA 4TWTA 4PDWA 3B5LB 1IOAA 4R52A 2OW4A 2DCTA 3W58A 3HD8B 3AP4A 5FMOL 1WA4A 2CY6A 5CU1A 1OI6A 2KXLA 3ENRA 4OI0A 4N7IA 4AF9A 5AFEA 5BV6A 3I59B 2BVBA 3VBUA 1VAMA 1J3PA 5DDJ1 4RGGA 1YFYA 1FV2A 2JXAA 2Q0AA 3FLPA 4RR3B 3TNQA 2KA3A 4HMZA 1DZTA 2XGXA 1YIFA 2VQ0A 5DG2A 3GBWA 4ISQA 5D8AA 1S0BA 1IGOA 4YVWA 3MLJA 3JD73 1H0BA 3MLKA 5KBFA 1KDKA 1QDOA 2QDNA 1XNDA 2RS52 4AW7A 4ATFA 2WT1A 4NHMA 1AYM1 2ZX4A 4P5HA 4N7UA 3H1MA 1VAVA 5GZEA 4LBKA 4N53A 2SLIA 2VPVA 1LKNA 4XW3A 2OIIA 2WFF2 3CNAA 3WCRA 1ZVFA 2RJLA 3GZTB 1LJ7A 1LODA 4Q1RA 4MV2A 1FI2A 1Y3TA 4Q4X2 1VJ2A 5ABJA 1HX6A 4YM2A 2JG8B 2FZ1A 2UWCA 3GNEA 4JDMA 1XYPA 5GZCA 1FOD3 3GZAA 1LHNA 1RUG3 2PN5A 3M70A 1ULEA 2WNVB 3HR9A 2WJSA 2Y38A 3BOPA 5JDBA 1XXNA 2B46X 2UY9A 1NCRC 4LO6B 4JGYC 3NSTA 1HIXA 5KWRA 4XETA 1BEV3 1AUYA 1KJLA 3AX4A 4M00A 2EIGA 2HWE1 3KT4A 2ZGPA 5CFCB 1KS5A 4HKLA 1AJKA 2ATFA 1NZCA 3BTAA 1S0CA 4AEDC 1OLQA 1K5MC 4MYEA 4A3XA 2VXRA 2A70A 3ZXJA 3RWNA 1NA1B 3VZLA 3VZOA 2BFUL 3MGUA 2RS13 1RHI2 4BPZA 2GU9A 1LB2A 1W6OB 1S1AA 2WQZC 4K7JA 4FPHA 1U5IA 2ZGTA 1UW8A 4UW5A 4RS5A 3ZYRA 3ZYPA 4RFT0 1SLBA 4AI0A 5AC93 2CAVA 1ND3B 1NQJA 3J8F1 4Q0PA 1LECA 2EALA 4EROA 1KFUL 1POV3 1IS4A 2DVAA 4IEYA 3ROUA 4DB5A 5BNPC 1ASJ3 2VOWA 1EV13 2D40A 4AI1A 2WZR2 1QJX1 2DU0A 1ZZBA 1DGWX 3WHUA 1JBCA 1S0EA 1FNZA 1TME1 3AXEA 4BOWA 2GNTA 3CEWA 2Q30A 2Z69A 1ALYA 2EAAA 1R092 4LHKA 4ZU4A 1O3TA 5KXCA 4XF4A 5KXEA 1SDWA 2ZAAA 3PHMA 3A0NA 2GNDA 4MUVA 4DOUA 4GH4B 1Q8PA 4AEKA 4LO7A 1PZ8A 1G9FA 1NOVA 2GMMA 3FFZA 3LZZA 2D7FA 3JBG3 4P9WA 3VL9A 2DFCA 4QT6A 3ZMOA 3V0AA 1ZZ9A 4WVVA 3LOBA 3LKJA 3IPVA 5KXBA 3H8UA 3APBA 3NKTA 3QD6A 4YVSA 3E5XA 1LGCA 2DCYA 3WP5A 4AK3A 1BBT3 1X33A 1HW5A 4K40A 3N7MA 3MI8A 1SCRA 3MICA 2B5HA 1W6NA 4G4FA 2R042 4XIKA 1VLNA 3S7EA 4I09A 1WCSA 4DZGA 3VN4A 4E9KA 4HPKA 1CGPA 1SLTA 3ZSEA 4X8PA 1BMV2 2GC3A 3B9CA 3B69A 3PNAA 3PJQA 2JICA 1ZBA1 1A6CA 3KLSA 3ZFFC 1JYIA 3TNPB 1CAXB 5A33B 1RUNA 3ZN6B 4HSJA 3ATGA 4PIXA 3VHPA 3VBRB 1FMD1 1MEC1 5AC92 2WNUA 2YMZA 2PHXA 1OFNA 4K1YA 1ULCA 3WY6A 2WINB 1XU1A 3E5QA 1AYN1 1U0AA 2QNKA 1MVQA 1O3QA 5L7OB 3PVBB 1RUD3 4WVWA 1S0GA 1U5YA 1ZBE3 1PO13 5GKAC 2Z42A 1O7FA 3LB9A 3ZFEB 4HFSA 3I59A 3QH6A 4HKOA 2KM2A 4Y1YA 3MIBA 1YUDA 4RR3A 2VUJA 1LHOA 4A7ZA 5FPZA 4CZSA 1RUI3 3CF6E 1AZDA 4P9XA 4XFBA 5T3NA 2Y0IA 2VOXA 4QXKA 3VDDB 2ZAHA 2DVGA 4HKWA 1SLAA 4PIZA 1WUVA 1AR71 2GC1A 5A32B 1AL23 1CPNA 2ZZQA 1SACA 3ZYJB 2A6ZA 4RHV2 2AH2A 1R1A3 1ENRA 4CTEA 2XHKA 1VIWB 2GDFA 3M7AA 2VULA 4COYA 4IEUA 3SCHA 1VBE1 4Z2WA 4GWMA 1O5LA 2C9AA 5JVVA 3ZFGB 1GV9A 1QXRA 3WDWA 3THTA 1CONA 2UYBA 4KNCA 1BBT2 4M01A 4S2HA 2BGCA 5KHIA 1V9U2 1A3KA 2BWCA 4EN8B 2K9ZA 1SLLA 4GKYA 2ZX2A 4PJYA 1VBD1 3U11A 5BNNC 5I8SA 3NAPC 4YGEA 4UBHA 2WNVA 3SH4A 4S2GA 5C4WC 2HEYF 4JRAA 1VBC1 2B9UA 4COZA 1UF2C 1XU2A 3DV8A 4FPOB 4MZUA 4D7TA 2R16A 1HXS2 1QQP3 3NV4A 1RUJ2 4QM8A 5CFCA 1OD5A 3GHMA 1H8TC 4C0BA 4XF0A 3VV1A 3ZO0B 1VRH3 4E4SA 3AFKA 3D0SA 1AHSA 1NA1A 3HN1A 4OHVA 1CIWA 1RUD2 2LTNA 5JCTA 1OFSA 3QOPA 1YJKA 1W6OA 2RS32 5DZGA 2A6XA 3OF1A 4KGQA 4DMIA 4DINB 2VVDA 4B29A 1REFA 3AYAA 3GYDA 3KQRA 4GMP1 5KHJA 1ND3A 3M3EA 3QLQA 4YW4A 1EAH2 1C8M2 1CPMA 1LOEA 2ZS6B 1H4HA 3VL8A 3AMHA 1V00A 1NE4A 3FUOA 3H7YA 4QPIC 2HWD3 4JVAA 4UBGA 1RUE2 2DWRA 1NLSA 3VKMA 3URFA 1RUH3 2QE3A 1QXJA 3TN92 3WHTA 4ORFA 2YHJA 1QOSA 4Z8BA 4F83A 1PVXA 4QMAA 4FPKA 3O7OA 4GH4A 4XFIA 4LBNA 4CDXB 1SQ4A 4I2OA 3ZPYA 4CDUB 4QU2A 1RUF2 4GMP0 1H1IA 3WUCA 5GLZA 5KHKA 2VVEA 1NCQC 2CTVA 2PA7A 2RHPA 3AZWA 3M3IA 3MPBA 2RMU1 1IZ3A 3JU9A 2PHLA 2Q1ZB 1NQDA 1V70A 1XRUA 2ZHNA 1AR63 1LGNA 2RR11 1NY72 1UKGA 1PIV3 3AZVA 2E7TA 4HK8A 1AL0G 3VHOA 4XXAA 1VBA3 4UW3A 4F8AA 1NE6A 1QQP2 5J7MA 3O0WA 4PDWB 5JWPA 4PLOA 1HKDA 5ACA2 3MFCA 3MLLA 4CP0A 4PIYA 4CRQA 3LSDA 4I3PA 2FZ2A 2RM22 2WKKA 5EJ3A 3TB0A 3POYA 4GKXA 1D4M1 1CAXA 5A33A 2XL9A 3MW3A 4OHXA 3VBHC 4KU8A 3ZN6A 3KCCA 4AFAA 4OVEA 3POSA 3VBRA 3UV9A 2BFUS 4I02A 4KH9A 3ZYGA 5AVAA 2ZJCA 3V65A 1RVF3 2NYYA 4W6WA 2ZCWA 5L7OA 1H1AA 3WQ7A 1GBGA 1QJZA 1DZRA 4FP3A 3R6SA 1PMIA 2XBO1 3ZFEA 1H8VA 5CG9A 4AGRA 4W6XA 1KD7A 4YRDA 2ERFA 2R073 1EY2A 3NJZA 2DURA 4JRLA 1ZREA 2X5IC 5FRAA 1DQ4A 4CEYB 5JPNB 2DVBA 5CNAA 2H0VA 2CV6A 2WS93 3OD0A 3VDDA 1QJY2 1ZZ8A 2RS51 3H0OA 4RQPB 5C9AB 2VH9A 2BTVC 4LR4A 3WDVA 4WM7B 5A32A 1J58A 3FLRA 2PLV1 1VBB2 4GALA 2IZWA 4G3YC 1SBDA 4BQ1A 2HEVF 3VBUC 3T1MA 4NWVA 1PVC3 2ZGSA 2P34A 1EP0A 4N9IA 1AR81 4D94A 2C0ZA 3ZFGA 1XNBA 4R4ZA 1YYNA 2DCKA 4KWKA 5D8AC 2DTYA 3EO6A 4YVWC 4FOQA 2VW0A 4TLFA 3MZHA 1AR92 3B93A 1HRV1 3TYJA 3ZXKA 3EQEA 2B7YA 4C90A 4YYOA 3WUDA 3X29B 5E88A 1QOOA 4N53C 4YW2A 4W6YA 1L3JA 1LU2A 1F31A 4JCKA 1Y43B 3M1HA 5F1RA 1QKQA 2VECA 5CG8A 3ILFA 4QHBA 1ENQA 2PAKA 3AXDA 2D5HA 1LOCA 1RUC3 1WMFA 2P3KA 1LOAA 3IDBB 4BA6A 5ABJC 3HMYA 5J37A 1MS8A 1MS4A 1G9BA 2VOVA 4COVA 4KWLA 4I0WB 5FCCA 3KT1A 1SMVA 2Z79A 2D6KA 1KQRA 1RVF2 5F6KA 3SH3A 4OHYA 4FOYA 1QJU2 1UKRA 3MIDA 1QOTA 1NXD1 2JKBA 2XJUA 3D5OA 3PMEA 4XE9A 1QMJA 2NMNA 4R9CA 5BY5A 3RJRA 1IS3A 2ZTNA 2D3PA 3R0RA 5IK7A 1Q3EA 4XEZA 5SV8A 5FQ0B 4Q4W3 3RMXA 1RMU1 3DGTA 4EN7B 3JD71 4DS0A 1V6LA 4QM9A 3WG4A 2WT0A 4E4ZA 1ULGA 2ARXA 1YI9A 4GB31 3LA7A 3IWZA 1XE7A 2WQ4A 2CYFA 2YYOA 2HKXA 1GNHA 2NZ9A 3IPVB 2JE9A 2WFF3 5GZGA 2YGMA 5HXVA 4QPYA 5DUWA 1ZX5A 3RMYA 4RS5C 5CBLA 5F9TA 4Q4X3 1VB2A 5JI9A 4XMAA 3S0MA 3O12A 1UPIA 4FPJA 4YGBA 3E97A 2A6WA 1BZWA 1Z7S3 4CDXA 1CN1A 5T52A 5I0SA 2G9FA 2I2SA 1FOD1 4CDUA 3LAGA 4A2UA 2HWF2 4GQ7A 4NN0A 1RUG1 2E51A 1CVNA 4E4DX 1BYHA 3L2YA 2ET1A 1G7YA 4AHWA 1PZ9A 2I45A 5E89A 1COV1 3AK0A 3OY8B 4BH9A 3SMHA 4XJWA 1GYKA 4PBOA 2QUOA 2JECA 5EXOA 1RUOA