2XLGA

Structure and metal-loading of a soluble periplasm cupro-protein: cu- cuca-open
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
229
Chain Sequence
IHTFDDIPMPKLADPLLIYTPANEIFDIASCSAKDIGFAIAHAQIPPGGGPMPHIHYFINEWFWTPEGGIELFHSTKQYPNMDELPVVGGAGRGDLYSIQSEPKQLIYSPNHYMHGFVNPTDKTLPIVFVWMRNEVAPDFPYHDGGMREYFQAVGPRITDLNNLPELTAFASEAPKYGINQSSYFMEYVNTISDKLPAQIAKLKNDKDLERMVEVIEAFNRGDKSVTCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SLL1785 PROTEIN
publication title Structure and Metal Loading of a Soluble Periplasm Cuproprotein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
total genus 56
structure length 229
sequence length 234
ec nomenclature
pdb deposition date 2010-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xlgA00
4MGIE 2Q1ZB 4Q0QA 1SEFA 1J3QA 3S0MA 3EHKA 2IXCA 3EBRA 4YNIA 4I0AA 2BNMA 3PNAA 1YFWA 4YSFA 2UY9A 4Q0VA 4I0BA 1IPJA 4JTOA 3CEWA 3M3IA 1SFNA 3JZVA 1DGWA 2B5HA 3NW4A 1O4TA 1Q5OA 3QOPA 4FT8A 5I0SA 4XF4A 3FX3A 3CJXA 3ST7A 4MV2A 1QWRA 1H1MA 2ET1A 2FMYA 2Z69A 2OZ6A 3O14A 4XFCA 3U10A 3UKTA 4HBNA 2EA7A 4AQ6A 4EROA 1OD5A 4DINB 2BNOA 4XF9A 4IEVA 3S7IA 5J48A 3MPBA 4BIFA 1NE6A 3LA3A 5C6CA 3DN7A 1ZX5A 2VECA 1YHFA 1YUDA 1YFXA 2ATFA 3KGZA 2BEOA 3DL3A 3ES1A 2EVXA 2DCTA 4TLFA 2CGPA 1O5UA 3H1WA 4X6QB 3FHIB 3H7JA 4XEZA 4IEYA 3ZDSA 4L11A 4ONUA 5J7MA 4IEZA 2XGXA 5EFUA 1ZRRA 5FCCA 1X8EA 5BY5A 5LRSA 4QGMA 3SXWA 4KU7A 1ZZ9A 2PAMA 4E2GA 4AQ2A 4KWLA 1CAXB 3NVCA 3IWZA 1DZTA 3LA7A 1X8MA 2PFWA 4ZU4A 2KXLA 1NZCA 1WGPA 5LEKA 4WBBA 1U12A 3H1YA 4EWAA 4QGNA 3EJKA 3IDCB 3IIAA 3EQEA 2PAKA 2UYAA 2O8QA 2IXLA 3BALA 3H3UA 2PAEA 1Y3TA 4L2NA 4LA2A 2E9QA 2K9ZA 2Y0OA 3CO2A 4XETA 2BYVE 1IPKA 3D0JA 5CADA 1ZZ7A 2IXIA 3LAGA 1CX4A 2ET7A 3OCPA 4X6RB 4LLOA 4XFAA 5BV6A 4KWKA 3UKVA 5FLIA 4XF3A 1LR5A 1NXMA 4XF1A 4IEQA 1QXJA 4XFGA 5FPXA 3OGJA 3FE5A 1CAVA 3E6DA 4GULA 4QMAA 1OFNA 3CF6E 1HW5A 2P17A 4UBGA 4P9GA 3LZZA 1ZZCA 4PJYA 4PIZA 2D93A 4NVPA 2XLAA 3RZZA 5JSRA 2PA7A 4A2UA 3KCCA 3CL1A 3M70A 3C3VA 4BYYA 1EP0A 2PYTA 2GC3A 2Q0AA 3R6SA 5D1IA 3HIFA 4HLTA 5FQ0A 5FLJA 4F8AA 3VHRA 3NKTA 4AXOA 1J3RA 4MUVA 4HN0A 3CLPA 4IESA 3RDIA 1CAWA 1OI6A 2H6CA 4MGYE 5I91A 1XRUA 3HT2A 3S7EA 5BXXA 1V70A 1ZVFA 1FT9A 1J58A 4FBFA 4MGKE 2OZJA 3I7DA 2ETEA 2WC2A 1J3PA 1UIKA 2PHDA 3BCWA 3ACLA 1YFYA 3H50A 5AVPA 1GQHA 1ZNPA 2FQPA 2XKPA 5FPZA 5FDBA 3MYXA 1VJ2A 4LA3A 3E6BA 5CVRA 1J59A 2H0VA 4MX3A 1YFUA 3HT1A 3PLQA 3GYDA 3SHRA 4PIYA 1G6NA 1CGPA 5J3UA 3BB6A 2C0ZA 4RD7A 4EWDA 4MZUA 1VR3A 4I2OA 1LRHA 3D0SA 3LA2A 3QACA 4UBHA 4Z07A 4KWJA 3FZ3A 1L3JA 3E5QA 2BGCA 4KU8A 1CAUA 4B29A 1RL3A 3RYRA 2B9UA 4QM8A 3OF1A 4LTAA 4BHPA 1J1LA 1DGRA 2GH2A 3FFQA 4LEJA 4AVBA 3PVBB 4Q29A 2VQAA 1PMIA 3BPZA 3I59A 1O3QA 5CU1A 4META 2GZWA 4LUKA 5K8SA 1I5ZA 3H7YA 4D7SA 4CYDA 2QNKA 5E1RA 2CV6A 1RGSA 3G7DA 3BU7A 2GU9A 3SCHA 3LOIA 3ETQA 3NL1A 4IEPA 1LB2A 1NYWA 4WVZA 4BH9A 4JV4A 4OFGA 3FWEA 4HVOA 5FLHA 1UIJA 5C8WA 3KSCA 3I54A 1H1IA 4HVRA 3NJZA 4O9GA 2XLGA 3RPQA 3IDBB 4XFIA 1DZRA 2EAAA 3SCFA 1I6XA 3ES4A 1O3SA 2HJIA 3NSTA 4O9EA 3WW1A 1UPIA 4HVQA 2BNNA 3B02A 1NE4A 2PTMA 2OPKA 2XL9A 3H1MA 3ROUA 3U0ZA 4MGZE 1O5LA 4Q0UA 4FAHA 2B8MA 3USSA 4IEOA 2VPVA 4IEWA 4ZU7A 4PIXA 3SMHA 4AVCA 3OTFA 3ELNA 1RTVA 2V09A 2GC0A 3TNPB 1FI2A 5KHIA 1SQ4A 3IBMA 3WW4A 3LWCA 1RUOA 4YRDA 4KL1A 4J1XA 5JR7B 4K8FA 1O3TA 3RNSA 4E2QA 4QGLA 1QXRA 4MH0E 4E2SA 1WLTA 4LUMA 4XFHA 4IETA 1YWKA 3EO6A 5I93A 1RUNA 2Z2SB 3TNQA 2K0GA 2IXHA 5KHHA 4AVAA 1ZRFA 2IC1A 5I0RA 1Q43A 5KHKA 4UXAA 5JCTA 2XLFA 1X82A 4XFFA 4EV0A 4HN1A 5JAXA 1CAXA 2QVSB 2GC1A 4I3PA 1CAVB 1XE7A 2QJVA 4WZCA 2CAUA 4ORFA 4XFBA 2XKOA 4XF0A 4YYOA 2I45A 3D82A 5E16A 2H6BA 2O1QA 3U11A 2OYZA 5I8SA 3E6CC 2MPFA 3FJSA 4QM9A 5LEJA 4IEXA 1ZRDA 3WW2A 1RC6A 3MZHA 1EYBA 2UYBA 5FQ0B 5EZWA 5JSOA 4F7ZA 1Q3EA 1ZZBA 1O7FA 3MDPA 5I0UA 2Q4SA 2N7GA 1CAWB 1VP6A 1WA4A 3DKWA 2HKXA 3E5XA 2D5HA 1Y9QA 2QCSB 3GBFA 4EWEA 5I8YA 2Q30A 1JUHA 1YLLA 5KHJA 3L2HA 3H8UA 2PHLA 4IERA 3E5UA 1XE8A 5F1RA 1O3RA 1EPZA 2XL7A 4I02A 1PM7A 2PQQA 4HMZA 1EY2A 3KMHA 4QXKA 4J1WA 1FXZA 4R8HA 1ZREA 5KBFA 2QDRA 4OLLA 2XHKA 3WW3A 1ZZ8A 5I8TA 1UCXA 4I01A 3SCGA 5KHGA 4Z82A 4Q0PA 4D7TA 4N9HA 2UY8A 2F4PA 2IXKA 1X7NA 1LKNA 2ZKLA 5LRRA 3N4MA 1CAUB 2GC2A 2MHFA 4JVAA 4FAGA 1ZRCA 2MNGA 4N9IA 2WFPA 4HSJA 5I0TA 2D5FA 2GAUA 4Q0SA 1UD1A 4I09A 5BPXA 3RYPA 5T3NA 3E97A 3OD0A 4R52A 4HSLA 1TQ5A 1ZZ6A 4IEUA 3I59B 5JSPA 3DV8A 3H3ZA 5BUVA 1QY4A 4YARA 5HI0A 2OA2A 3UKNA 1GQGA 2IXJA 4ZU5A 4JTNA 2CAVA 1UW8A 3HQXA 4H7LA 3RYKA 2D40A 1OMIA 3KGLA 4HZFA 2ZCWA 3H9AA 4LULA 4QX5A
chains in the Genus database with same CATH superfamily
1ZBA3 2VNGA 4Q0QA 1UNBA 4BXFA 2ZX4A 3VBSA 1BBT3 2VJXA 3HN1A 3MFAA 2VOWA 3EHKA 1K5MB 2IXCA 1W05A 3HN3A 1AR71 4RYDA 2BNMA 3PNAA 3GHNA 4GWJA 4IW3A 5DDJ2 1B09A 3VBOB 2PELA 1LESA 1QOSA 3LDRA 4JTOA 1KRIA 3RI8A 4B4PA 2QDNA 1UMHA 3KQRA 2ZX3A 1DGWA 3GALA 4FQ4A 4XJWA 1DQ4A 1O4TA 1PNGA 3T2QA 5J36A 2G4IA 4HK9A 2VZRA 4NAOA 1F8VA 1CWPA 2DCYA 4QWNA 2W91A 3AZVA 1QWRA 3RJ2X 3O12A 3VDBA 1GZCA 1H8VA 1PM4A 1QH6A 2FMYA 3P5BA 2HWD3 2B7YA 5FYUA 3U14A 1KFXL 2JEMA 3VLBB 3AKQA 2WNVC 3O14A 4MYEA 1JHNA 5FZLA 5FYIA 3VZNA 3T4HB 4D94A 3POYA 2R0HA 2HWC3 1SLAA 1YQ8A 1T2XA 3OYWB 4HBNA 4AQ6A 4NO4A 2W47A 4DINB 2D3PA 3S7IA 2BWCA 2VO5A 3JBG2 5FZ4A 5DUUA 3WNOA 4CDQB 3KT4A 1RHI3 3LA3A 4JDOA 1XXNA 2XJPA 1ZX5A 4GZ9A 1AR61 4X8NA 4CSWA 4XC9A 2VZUA 5LZ6A 1PNFA 1YUDA 4RR3C 1PZ9A 2A75A 3KGZA 4A45A 1EAH3 2BEOA 3PVEA 3ZXFA 4QU2A 3DL3A 3JD73 3QBQA 2E7AA 2WNOA 3LCPA 4BJ0A 1Q8PA 4Y26A 2HWB1 1UYYA 5DAVA 3ZDSA 2Y34A 4ONUA 3WNMA 1IKQA 5DN2A 4AK3A 2XGXA 2X8KA 5EFUA 2ZGMA 5J37A 1RMU3 1AYN2 1OOPC 5LRSA 4INDA 3VBSB 2R043 1XNDA 4DUVA 3WP6A 1PIV3 2Q1MA 3FL7A 3S6PA 1ZRIA 4COVA 1XSQA 2VXRA 1ZZ9A 2W9XA 4KWLA 4CPBA 5LBBA 3BGAA 4GB33 1RUC1 4XCBA 5FO8B 2NN8A 2YC0A 3VKOA 1PVC2 5C8CC 1HRV1 4V1PA 1AR93 1OPMA 1VAKA 1U12A 3H1YA 3LD8A 3FLRA 3EJKA 3IDCB 4QGNA 5K0UB 1YI9A 2O8QA 2UYAA 2WLQA 3BALA 4IL7A 3DPRC 1UU4A 3TN91 1R083 1R1A1 3VBFA 2Y0OA 1MPXA 3CO2A 2QFEA 3R0RA 3PL0A 2RR13 1ZYBA 2GN3A 1GU3A 3LAGA 3WUCA 1KS4A 3K4AA 3MV01 1CX4A 3POFA 2ET7A 1WCQA 4AAXA 2G19A 3TEYA 4Q26A 5ABJC 2NP0A 4ITCA 4QHZA 4MOAA 1DFQA 4YZ3A 2RJ2A 5FZ3A 3WCSA 3H8XA 4XCAA 2B9VA 5F37A 1C8M2 1QJZA 4PQ9A 3ZFFC 2R072 3O0XA 3OGJA 2E31A 1JODA 3FE5A 3M3EA 4QDSA 2R30A 4IV3A 2RDSA 4YM0A 5AC91 4AVVA 3NNLA 5GLZA 4GULA 3ZSMA 4QMAA 1E57A 1ZBA2 2ZEWA 1YQ6A 1CZSA 3I2DA 1S0IA 4PDWB 2YGMA 3PU3A 4QPGC 1BBT2 4XUOA 1WCUA 4WVVA 1NCQA 1V6KA 2BFUL 3VB9A 3AC0A 3ZFEB 1H8TB 4FXGB 3ILRA 1SDWA 3BI3A 4W65A 4XABA 3MF6A 4QXHA 5F3EA 2F4LA 2W5FA 3POWA 5A3LA 5IFPA 2W68A 2LW8A 2R063 3CL1A 3NV4A 5FY8A 5BNPC 1ND3C 5FTTC 5FK8A 2CY6A 1WUVA 2R0FA 1NY71 2VQUA 2Q0AA 4BK4A 1JZ4A 3OBZA 4ZXKA 1JU4A 1D4M3 4CUAA 1LODA 1QJX1 2A6YA 5FLJA 5FQ0A 1OKOA 1IS4A 1VAVA 2B45X 1NCRC 4IGOA 3VD3A 1GNHA 3RDIA 2HWD2 5LK5A 3HAGA 1PX3A 3S7EA 2E51A 1SHWB 4GALA 4N43A 2HWC2 5FIXA 2XQXA 3HMYA 5A1FA 3VD9A 4XHBA 3L2YA 3T1LA 4FBFA 3I3MA 4Q4X1 3GGLA 1JYXA 1RHI2 1MS9A 2WZ8A 2ETEA 2ZAAA 4H14A 3H50A 3ACLA 1YFYA 5AVPA 5FZBA 4XPVA 5FZMA 2B42B 4XUNA 1K12A 1S0FA 4IGPA 2XKPA 4Y1YA 1EAH2 2XJSA 4O65A 3ZYPA 2ZX2A 2YPJA 3E6BA 1Z7S3 4RQPA 1U5IA 1QHDA 3JD72 3AMNA 3PLQA 3ZX7A 4YFWA 3GYDA 1VBC3 4IV3B 4QB2A 4XMIA 3RG0A 4ZY9A 3USUB 3BOWA 2D7FA 2JE8A 2GNMA 2XJUA 4HL0A 4ASLA 5JWPA 1CGPA 4A3ZA 2R32A 3OBAA 4QHBA 2FDKA 1RMU2 3THCA 3MIHA 4FPGA 4MXWB 5LEKA 2HWF3 1OKQA 2R042 3G6JB 2BPA2 2MEV1 4YW1A 2RMU1 2VM9A 3FZ3A 1ST8A 4R4XA 4RS5C 4WVWA 1L3JA 4KGQA 5JZGB 1AL21 4CP9A 3ABZA 4AFBA 3MV11 4URAA 1JMUB 4GB32 4B29A 4YG0A 3JB4C 4IE5A 2SLIA 4LTAA 1AR92 2NM1A 2XDVA 3FFQA 2PHRA 4LEJA 2V5YA 5FZAA 3PVBB 5F32A 1R082 2VQAA 2VW2A 4BQ2A 5LBFA 4O7XA 1PMIA 3BPZA 3CKHA 3O1VA 4QB6A 3W20A 2RR12 5CU1A 1O3QA 3OBRA 4LUKA 4FPFA 3ZO0B 1FX5A 5K8SA 1XNKA 1ZBE3 2K46A 3MUY1 3OD4A 4FP3A 5D8AC 3RWNA 3WX5A 4D7SA 2HEYF 2QNKA 3KM5A 5M0TA 1AVBA 3OUJA 4N43B 3NAPC 5E1RA 1OHFA 3ETPA 1DYPA 2OIIA 5CFCA 3OGSA 1O8SA 1Q8OA 3ETQA 1XC6A 1OPOA 2ZTNA 3ZN4A 1H6YA 5L36A 1WW4A 3NL1A 1NYWA 5L7OB 2KR2A 4QDRA 4HXCA 1COV3 1FMD1 3KV4A 2JICA 5CKMA 1HIXA 1V9U1 3VBUB 1W6OB 5FLHA 1WBFA 5ISLA 1H1IA 3M7AA 3GNEA 3NJZA 3HVDA 4EYUA 2C24A 3P3NA 2DU0A 4CDQC 3IDBB 4XFIA 1D2SA 1ND2A 2YFUA 3THPA 2Q1FA 1I6XA 1RB8G 1O3SA 3NSTA 2ERFA 3C7FA 4OHVA 5SV5A 1IZ3A 1SACA 1LOBA 4DUWA 3ORJA 3ZMOA 2BNNA 5IW0A 1E5IA 3VBHA 4PHZA 2P3JA 2R062 3WDYA 5T50A 1BVVA 2OUJA 2WLPA 4GMP3 2K2SA 4N7UA 4E8DA 4QPIA 3U0ZA 4Q0UA 4IE0A 1D4M2 2VOKA 2VW0A 4FI9A 3USSA 1QJEA 3VBSC 4JGYB 2P1BA 3UK9A 4BA6A 1FOD1 1U5XA 4ZU7A 1H1AA 5IHRA 3U75A 4PIXA 2XONA 5C71A 4YZ1A 3T30A 3ELNA 1RTVA 4FPLA 4TXWA 2GC0A 1W9YA 2OPWA 1QJFA 4AI9A 1GNYA 3X29B 1UQXA 4RL7A 1RUOA 4BWOA 3H8OA 5L19A 2ZJCA 2VMHA 1QGLA 3O1SA 1JZ7A 5JR7B 5T55A 1O3TA 2VCAA 2YZ4A 4PCRA 3M4FA 4BLIA 2WZEA 5FZCA 3H0OA 4COUA 4QGLA 1QXRA 2OQ6A 3PVNA 4NHKA 4E2SA 4WM8A 2WS91 4C1WA 5A3OA 4XJAA 4IETA 2EXJA 1Z7S2 3GBGA 4X8PA 5JLVA 2Z2SB 1JYVA 3AFKA 3TNQA 1QJY1 2FZ2A 2K0GA 1F5FA 1MVEA 1UU6A 2ARXA 3ZLIA 1RUH3 1VBC2 2VBDA 5KHKA 2C5DA 2J1RA 2VZTA 3HEIA 2XLFA 1X82A 1R093 3K4ZA 3MW2A 2C26A 4KG8A 4Y22B 4AHZA 2XPJA 1CR7A 1N3PA 2VMGA 2HWF2 1ZA7A 1NQJA 1QMJA 3CJIA 3WP3A 2BBVA 4EV0A 4HN1A 1QDOA 3VZLA 3TBDA 2CU5A 1RJ7A 2WO7A 1MS3A 1XPWA 2VNVA 3ASIA 1F5JA 4XDOA 5E6HA 2HBTA 3ZM8A 1NQDA 2GALA 2YYOA 4LBNA 1ACCA 2QJVA 2WQZC 3LDBA 5FZEA 4B7KA 1W6QB 5FY0A 2EIDA 3DXTA 1MQTB 2BGOA 2X10A 4QB1A 4XFBA 4CRQA 3NO8A 3FC0A 1H8TC 5GLUA 1LECA 4GWNA 5DXDA 4YM2A 5FUPA 4MHRA 2A73B 3IDEA 1QEXA 1H30A 1PGW1 3EMRA 3U11A 4XW3A 2OYZA 2WKKA 3K48A 1F2NA 1ZBE2 1J1TA 3FJSA 4QM9A 3ACIA 4BQWA 2P3IA 4NHMA 4IGQA 3JCIA 3AMHA 1HV0A 2AGSA 3ZN6A 2AREA 2VMIA 5C4WA 1GP6A 1MZEA 1G9FA 4Q4W1 3J7NA 2UWCA 1QF3A 2OKXA 1LULA 3PDQA 3CQOA 3NWKA 4YGEA 5EZWA 5F7UA 1BJQA 1KITA 1LOGA 1Q3EA 1O7FA 1GWKA 1I3HA 1X9TA 2RS51 4HPKB 4NPMA 3ALQA 4CDXA 2Q4SA 3U4XA 1COV2 2EIGA 5FPLA 5JCTA 2X29A 1D2QA 3ACHA 3N7KA 4DO0A 2QE3A 2DCKA 3T4VA 1BEV3 4OHXA 5FZOA 3QH7A 3RZMA 3N9NA 1Y9QA 2D97A 3GBFA 4FQZA 1LAJA 5IK5A 2RS33 3L2HA 3H8UA 1QNYA 2TNFA 3FFZA 2FDFA 3BKZA 1KQRA 5F1RA 1RITA 5LY1A 1EV12 1O3RA 2FD8A 4V2WA 3D3AA 1AXZA 3PUHA 2VVDA 3U4SA 5CB7A 1DGRN 2OW4A 4NWVA 4WVMA 1VBD1 5FP9A 2LRPA 2JX9A 4CZSA 2WA3A 1BXHA 4QKBA 5T5JA 3PMEA 4IV3C 4Q1RA 3WDTA 2FDIA 4KI5M 1WMXA 4LLFA 3ZYJB 2QUOA 5DDJ3 2PXJA 2XVGA 4A42A 1UZVA 2HWE3 1FNZA 1S0BA 2RDQA 2W1QA 3BTAA 4Y5Z0 2CTVA 1NCQC 2VMCA 3QD6A 1VMHA 3SCGA 4UFLA 1UWWA 4Z82A 2P6CA 4QXBA 5FBZA 4D7TA 5JZGC 2F4PA 5F3IA 2IXKA 2P3KA 5A6ZA 1X7NA 2EICA 3V65A 2Q5TA 3ZYFA 5LRRA 1CAUB 4LHSA 1A6CA 5JMCA 5FYBA 5I8TA 5FP8A 3WG3A 1ZRCA 5FYCA 4XJ9A 3ZN6B 4M3CA 4Q0SA 3L9JT 1R1ZA 4A3XA 4RFRB 3E97A 4LE3A 4HSLA 4S2HA 3JB8A 1QJU3 5FZFA 4PLOA 3V0BB 4CDXB 5JSPA 1O4ZA 3DV8A 4MGQA 1FV2A 1YEWA 5BUVA 1SPPA 1RUH2 2KD7A 4AF9A 4N43C 1SBFA 2YUEA 3PUIA 3VN4A 2RS13 1VBA1 3I3BA 2AUYA 4L97A 4CCNA 5F5QA 1S2EA 1R092 1W8WA 2G9FA 4H3WA 4Z1VA 1JHJA 1QQP1 1W9WA 4GXLA 4CU8A 1T6BX 2BUKA 2C4XA 3INAA 4RR3B 4UFHA 3AVRA 3VGIA 5L7OC 2FDGA 1N1SA 1UU5A 1LOAA 5CNAA 3QH6A 5FZ1A 3FMGA 2PHWA 4HZFA 3H9AA 2UWAA 4YG6A 4RQPC 2XVKA 4P9XA 3LEKA 1L7RA 4FPOB 1SEFA 2RG4A 4S2FA 4LT5A 1J3QA 2VXJA 1F35A 3VL8A 2ZGPA 4YVSA 2P37A 1RUJ1 5B4XA 3ZYHA 1GSLA 4I0AA 5A7SA 3D5OA 1Y9GA 2VZSA 3LEGA 1JZ8A 2ZZJA 3O5SA 1IPJA 3LE0A 2G9ZA 3O0WA 1QKQA 1YI7A 4YWAA 1SFNA 2VUAA 3NW4A 4AEKA 3HR9A 5C8CB 3T3YA 2ZMKA 3QOPA 1PVXA 2GMMA 2AR6A 5JR2A 1XSRA 5FAXA 1NLQA 3KV5A 1RUI1 1W2AX 3CBNA 3T08A 2E7QA 4IE7A 2WYSA 4MV2A 4L8QA 4FPEA 2A5ZA 4BQ4A 4L9BA 4KBZA 4M00A 2Z69A 5KC6A 3ZR5A 1XU1A 3V0AB 1XB9A 2OZ6A 4HKWA 3K3NA 4LBKA 2PLV1 1BMV1 1CESA 5FPUA 2HYXA 4FSJA 2EA7A 2C9KA 4EROA 1D7PM 1BEV2 1OD5A 1RUG1 1UXXX 3IN9A 4IEVA 4XF9A 5A80A 4CP1A 3CNAA 3LPGA 5A33B 2WAAA 5ABJB 5A3NA 4GJZA 2WZR1 2QQMA 3LIHA 5FJHA 1UOBA 2RS32 3T2TA 2DVFA 2V72A 3B9IA 1YHFA 3N36A 4XUPA 1YQCA 2HYKA 5CFCC 5J09A 4OMCA 1RVF3 1TME1 3K77A 4A41A 3MFCA 1VALA 2DCTA 2CGPA 4ATEA 4JKMA 4CCJA 1C8NA 1DU3D 1O5UA 1UZ0A 2P4EA 4QQHA 3WF0A 1LTEA 3H8RA 5C7GA 3S5QA 1VMFA 2H0BA 2Z4FA 4LBJA 4XEZA 4FFHA 2D6LX 2EXKA 1DLLA 1KGYA 4L11A 4AI2A 4QPGB 2Z5WA 5FCCA 2D6OX 1UF2C 4QQPA 5HCHA 2RM21 1ND2C 2HWE2 2R1BA 4NOTA 1GZWB 2ZMLA 3BIEA 1UKRA 1W0PA 1FPN1 4QGMA 4BK5A 4YVSB 2J22A 3M8LA 4DZGA 4CP0A 1W8TA 1RUD1 4KU7A 4OUEA 5BNPB 4UOJA 4CVUA 1WA6X 1ND3B 4HFSA 3VBHC 4BXSV 3LFMA 4MSVA 3DEMA 1X8MA 1DQ6A 2PFWA 4RGAA 1JYTA 3OEAA 1GBGA 1W2TA 3M3CA 1AR73 2LS6A 3WNLA 4ARXA 2C6SA 2ZS6B 3E1F1 3AL5A 4QPIC 4P9LA 5JXJA 3GBWA 4AAPA 3IIAA 1GKBA 1Q8SA 2IXLA 3H3UA 4C0HA 1NCRB 2VOXA 4LA2A 2E9QA 2JDNA 2RDRA 3AP6A 2FDJA 2VBPA 4JHTA 2CL2A 2QQIA 3WP4A 4B7EA 5AFBA 3WOGA 4DRRA 1XYOA 4XETA 2VOTA 2DURA 1LENA 1ODMA 2VUCA 3D0JA 1QJU2 4QX7A 1SBDA 5CADA 5LY2A 1JW6A 1ZZ7A 2IXIA 5A32A 5JPNB 4QHOA 1ULFA 2JE7A 2VAUA 1KS5A 3OCPA 4XURA 4BQ3A 4D6SA 5AC93 1CPMA 3DXUA 3UJOA 2RS12 1NAEA 1LR5A 3N9MA 4QAWA 1S1AA 4CA9A 4KGGA 4LKEA 1DHKB 5F39A 4AI1A 2ZX1A 4ZKTB 1BQPA 2YROA 2XR4A 3J7MA 2XG3A 3PU8A 1MS5A 1QXJA 2JXAA 4CCEA 5EYYA 1CAVA 3EYPA 4WM8C 3E6DA 4C90A 1RUF1 1CIYA 1TE1B 1US3A 4MADA 2VMFA 4EN6B 2P2KA 1LHVA 2D43A 1OFNA 3CF6E 1HQNA 2WL1A 3OG2A 1ZZCA 2Y26A 3OGGA 4CXXA 1S0EA 1X36A 1H9WA 5FP7A 3RZZA 5GZCA 4R9DA 2VNOA 2YB7A 2JG9A 4JZRA 5JSRA 3IDAA 1OSGA 3OSDA 3GJBA 3FHQA 5AVAA 1CX1A 2HWB3 3CJIC 3M70A 2VW1A 2BQPA 1HXS1 3C3VA 1W0OA 3N7MA 4Y5TA 3OBTA 3OUHA 3VL9A 4BYYA 4CCKA 2PYTA 4OUMA 5D1IA 2VH9A 3OY8B 4F8AA 4W6XA 4QU1A 2BJSA 3JBG1 5F3CA 3U07A 1V6IA 3MIGA 4HKLA 3O0VA 1UY0A 4FTEA 1GANA 4AXOA 3A7QA 1OD3A 4DXTA 1DGLA 2QKDA 4HN0A 3CLPA 4IESA 4NHYA 1BZWA 1OI6A 5LA2A 4MO3M 5I91A 5IVCA 5C9AA 2GMEA 2ZGNA 1RUC3 4P02B 4XBNA 5FZDA 5GZEA 3A0NA 1H2MA 1V70A 1ZVFA 5IUQA 4M4RA 2GMPA 5D8AB 3GZUC 3NNJA 4MGKE 3BU0A 2JECA 4LBQA 3F95A 3NAPB 2RE9A 3LPFA 3TN93 3RZJA 1FATA 1R1A3 2E7TA 4UF0B 1J3PA 4CUCA 1LEDA 3FBMA 4D3WA 4B8EA 1ZNPA 4XQWA 2FCTA 1HQWA 1ULEA 3BPSA 4HANA 5FZ8A 1Q56A 3LKJA 1RVF2 3RZHA 2X5IA 1VJ2A 4CDXC 2ZGUA 5CVRA 1H9PA 2H0VA 3VD4A 1IKPA 3SHRA 2J7MA 4SBVA 3PURA 1OLME 4K1ZA 3WY6A 2C0ZA 2E32A 3Q8EA 4RD7A 4TZDA 4EWDA 2PN5A 2P6HA 1PVC1 1VR3A 4LXLA 1JYWA 1S0DA 1JBCA 5SV8A 1HN1A 2DBIA 3POJA 1N3OA 3QACA 4JCKA 1TNRA 4UBHA 2YBKA 2O0OA 4WV8A 4Z07A 3ZXLA 2ES3A 3E5QA 4K3UA 1N47A 3I49A 1F4AA 1VRH1 1W6MA 2Y64A 2BOIA 4JRAA 4LHLA 4RSUA 3MBWA 5F5AA 2B9UA 2UU8A 4HKOA 4QM8A 1AR72 4H2AA 1J1LA 3MLLA 1DGRA 1O4YA 5F2SA 2CNAA 1OVPA 2GH2A 2VCMA 4JGZA 4B1MA 3LQCA 4AVBA 4YW6A 1CD3G 4Q29A 2JG8A 1OLQA 1TMF3 2DBNA 3RI9A 3I59A 4Y1XA 2R1DA 4META 1W2OA 3VZMA 2R071 1XJAA 3H7YA 1A8MA 2VTXA 4NPLA 4CYDA 1AL0G 3FBYA 5GLWA 4Z2AA 5KXDA 3HD8B 1UL9A 1XBFA 2CWMA 4U2AA 4C91A 1ZBA1 4XMAA 5HXMA 1W3VA 2WT1A 2ADDA 4D6RA 1GP5A 1K3IA 4JAAA 1M06G 1BBT1 1JYCA 1OBNA 2WQ8A 3KV9A 1LB2A 1HN0A 2XXZA 4AR2A 4BH9A 2PHTA 4QQOA 3WV6A 4CCLA 1OLRA 2YC4A 4BQ1A 1X50A 1UIJA 1NG0A 4Q4X3 2BP6A 3I54A 1B35A 3KSCA 4HVRA 5HCBA 4LO5B 1GYKA 4AGVA 2W39A 2JWPA 2VULA 3WNPA 1DQ1A 2WWUA 2EAAA 3APBA 5HPOA 2ZEYA 5T5LA 2Z79A 3DF0A 3OJBA 3B01A 4ASKA 5F5IA 2EIBA 4N7IA 2IFRA 4O9EA 3WW1A 1UPIA 4PBOA 4AG4A 2WUHA 4JQRA 2E63A 4JHZA 1X9PA 2Y0IA 3MLJA 4FFGA 3B02A 5JOYA 2HWB2 4P9WA 1AJOA 1ASJ1 2OPKA 5HCAA 4G4FA 2HWD1 4W50A 3A22A 1K45A 4NIIA 1KFUL 3LB9A 3R05A 2Y6GA 4MGZE 3AVSA 1E5RA 2B8MA 4FAHA 2DU1A 3WR0A 5E89A 1OXCA 4ZZ8A 2MEV3 2VPVA 1UOJA 3UYJA 1RHI1 4YVSC 1AL23 1NA1A 1IS6A 3SMHA 2W0XA 3R4SA 4AZZA 1RUC2 1C57A 4Y4YA 1BHGA 4OZXA 1C3HA 2J1UA 5FYSA 3IMMA 2VCBA 1SZBA 3IBMA 3ZXJA 3LWCA 1W90A 5APAA 2J1SA 3WUDA 4PI2A 3RZKA 2WAOA 1VLNA 2W1SA 3KLSA 4BMEA 4D6QA 5CBLA 3TN92 1MS8A 4NIDA 1R1A2 4J1XA 5FUNA 3SEEA 1DDLA 2EXIA 4E2QA 4CU6A 1OFSA 1UAIA 4MH0E 1LHUA 2WSVA 1OH4A 2QZ2A 2GP5A 5H9SA 2R041 3VBFB 3ZIWA 2DWRA 4DXRA 3EO6A 3KCXA 2W52A 3NQHA 4YM3A 2R6QA 1RUNA 5ACA3 5FFOC 2IXHA 4FOQA 2DCZA 4AVAA 2ID4A 3OB8A 3WQ7A 4RN5A 1AXYA 4LNVA 5G04L 4RHV1 4B4QA 3OPTA 4GB31 3POGA 5CFDA 1I9RA 2PQSA 2HEWF 3I8TA 3VZOA 5IK4A 2W3JA 4EN8B 5FYMA 5LB6A 3J8F1 1AR91 1WW5A 5AC92 1UKGA 4C8DA 5A7WA 4AL9A 1N3QA 1UO9A 3PTRB 1QXPA 2X05A 1CAXA 1RXFA 2VUJA 3HBZA 1R081 4IE6A 1MEC1 2QVSB 2GC1A 3F2ZA 3KHBA 1JZ2A 1KEXA 2ZHMA 1QDCA 2RR11 2W46A 1PO11 4XJUA 5LBEA 3ZFGA 5IWFA 5EJ3A 3AKTA 5F8PA 2WIIB 5FXZA 4ORFA 3CDZB 4OCTA 4AFMA 3O1RA 1IG0A 4SLIA 1YYNA 2JDHA 3D8CA 4XF0A 2WA4A 1NCQB 4NWWA 1PIV2 4AFCA 2ZGKA 2H6BA 3KT1A 2WRAA 1AZDA 1TMF2 4BCUA 1IS3A 1PO21 3VZJA 4DIQA 1NY72 5DUXA 2MPFA 3DYOA 3T2OA 4LOTA 2WO1A 2YMZA 1URXA 5LEJA 1O6UA 4IEXA 1ZRDA 4QKNA 2W1WA 3AYEA 3MZHA 1EYBA 1ULGA 2UYBA 1C28A 5FQ0B 3NJVA 3K4DA 3GCXA 4F7ZA 4QQ2A 1JU3A 2YBPA 3BN6A 5FWJA 5FOJB 2VVEA 1RUE1 2WT0A 2EF6A 3I2FA 2A6VA 3M1HA 4Q4X2 4UI9L 4Y3OA 1GZTA 1SG3A 2R061 3E5XA 2D5HA 4AW7A 2QCSB 3GCWA 1W8HA 4HONA 4EWEA 4ZS2A 5A1LA 5I8YA 3CZJA 3MIEA 1SCRA 3KV6A 2IZWA 3WNNA 2NMOA 1YRZA 4Z92B 1PGSA 2PHLA 4QXCA 4Q8LA 5BNOA 4QX3A 3E5UA 1XE8A 1IOAA 4NMIA 5T52A 3WDXA 5IK7A 3VD5A 1EPZA 3ZVXA 1POV1 4E27A 3ACGA 4JQTA 1PM7A 1QJY3 5DQ0A 3RMYA 3NMBA 2DYCA 2JDMA 3WQ1A 2RJKA 2DUQA 1VB4A 3DYMA 4IQPA 1GOGA 4RQPB 5BYNA 1G9AA 3VHOA 1FXZA 4YGCA 1DP0A 2YBSA 1W04A 2D44A 2VUDA 5F3GA 2QTWB 3U37A 4LK6A 4EJRA 1ZREA 2TUNA 2E6VA 2MEV2 4OLLA 4HT1T 4QPYA 3WZ1A 2XHKA 2JDPA 3BODA 2DVAA 3AYDA 5FMDA 4CTEA 3WG2A 4Q0PA 2JG9C 3C8XA 1F15A 4AEJA 1JI6A 2UY8A 1AX0A 3KF3A 1W2NA 2O8OA 5T5PA 2ZGOA 4LBLA 2R16A 1LKNA 4NHLA 5FY1A 2ZEZA 4XACA 3AKSA 4CP9B 5KHGA 2GC2A 1Z7S1 3HPNA 2W92A 1POV0 4DXZA 1V6MA 2WFPA 4BDVB 2D5FA 5BPXA 3RYPA 4Z8BA 3I3EA 2ZABA 1W03A 2JB4A 2VE1A 5ANQA 1N1VA 4NN0A 1TQ5A 4KBBA 4CU9A 4DRVA 4NIHA 4HK8A 1AX2A 4EZ4A 2DUPA 2LROA 1CVNA 4Q4Y3 2ZGLA 3Q8FA 4CDWA 5C9AC 3UGHA 2DUOA 2DTYA 4AYUA 4BE3A 5ACA2 5FV3A 4LKFA 4YG3A 4Q4W3 3VDDA 5A6QA 4P00B 2OA2A 5GALA 1V0AA 1SCSA 5FYZA 3MEPA 4H55A 2RS53 1IPSA 2TEPA 4FOYA 4JTNA 3WF3A 1BK0A 1HJGA 2B39A 4HG6B 1Y7BA 2A6ZA 4XIOA 4XJ8A 5FXWA 3WT3A 1AR83 5CFCB 5FR3A 4I3GA 5BNOB 3I3DA 4J6GA 3U1XA 5LK7B 2D40A 1OMIA 2ZHKA 1REEA 1HLCA 2X5IC 2ZXQA 4JC1A 3WHUA 3C2UA 3NJXA 3AM2A 2L9LA 3M3QA 5BNNA 2XHNA 3ZPOA 4N53A 1ZBE1 1LCLA 4CP2A 3C7HA 1NKGA 4E8CA 3EBRA 4YNIA 1ND2B 1IS5A 3UETA 1YQ5A 1VBE1 2A6WA 1YFWA 3AJZA 2UY9A 4Q0VA 4I0BA 4YSFA 1WCKA 3T1MA 5KXCA 2YU2A 4DOUA 1LOCA 3W5MA 4LOSA 4A6OA 1DQ2A 1WBLA 3CEWA 3NNGA 3VBHB 1J84A 3M3IA 2AEYA 2B5HA 2JB8A 2Q8EA 3ECQA 3M2MA 1Q5OA 4FT8A 1FYUA 5I0SA 1WW6A 4XF4A 5JIUA 3FX3A 5DAPA 3CJXA 4QPIB 1ENSA 1UX7A 5JXGA 4F83A 4GAZA 1LU2A 2OQ7A 3DUIA 3N9PA 1CZVA 4P5YA 5IVEA 1S0GA 2JG8C 4N90A 4BQXA 4XTPA 2Q8CA 3TYJA 1EV11 4XFCA 3U10A 4OI0A 2J1EA 3PUAA 2NLRA 2FDHA 5KR7A 3AP9A 1LHWA 1W8UA 1VBB1 4NHXA 4XVHA 5FMCA 3ZXAC 2ZBJA 4GMP1 4AOCA 1NE6A 4D7YA 4E4ZA 1W99A 3DN7A 5C6CA 5K9YA 1QOTA 1Q8VA 1Y4WA 1NUKA 2GNTA 3K75B 3RSJA 2EALA 1UMZA 5L73A 5LASA 2YV8A 4ET7A 3IPVA 1FAYA 1QNWA 3RRDA 3HWJA 3VDCA 1YFXA 1UYZA 2ATFA 5A70A 4J25A 4Q4Y1 3VBFC 4MG2A 3ES1A 4R9CA 4WM8B 1U5YA 3H1WA 2BU9A 1VBA3 4X6QB 2D6KA 1Q8QA 3FHIB 2DVGA 2OVUA 2W95A 4IEYA 5JOWA 1CZTA 1QQP3 2Y6FA 5J7MA 5DABA 4B3NA 1ZRRA 5CKQA 1JYIA 1X8EA 1IHMA 4TSVA 5BY5A 4FPJA 1OA2A 2XBO1 3SXWA 4CCMA 3WQ0A 5B2GB 2CDPA 1GOFA 1SFPA 1OT5A 2GDFA 1GICA 3OPWA 3K51A 3ZXGA 4A4AA 4GMP0 4KNCA 5JDBA 3CJIB 4E2GA 4AQ2A 4MVTA 3O1UA 1XNAA 3K2OA 3LA7A 4ZU4A 5I0DA 1UN1A 1W6NA 1KJLA 1NZCA 1RUJ3 1S55A 2KXLA 4XDQA 4YW3A 5A3UA 5KXBA 4UW5A 4EWAA 2WQ4A 3EQEA 5B4NA 3UGFA 1DZQA 2WWJA 5F2WA 1PGW2 3K46A 5GZDA 4XE9A 5FMBA 1S2BA 3IAQA 1ULDA 2BYVE 1IPKA 4YPJA 2YPDA 1NA1C 1XU2A 1DLCA 4AE2A 5EQUA 3MPPG 4Q4W2 3WDVA 1RUI3 4KWKA 5LCWL 5FLIA 1OOPA 5FZKA 4Y1UA 3ZXKA 4YZ2A 5CAZA 2A3YA 2IFWA 1OA4A 5C4WB 2RS52 4AHYA 1V00A 3KF5A 4GH4A 4MGSA 2BGPA 4XF1A 4K9SA 4IEQA 5GJ6A 3AMPA 4Y33A 1AR82 4BB3A 2HBUA 1W3XA 3IPVB 4GKYA 4LBQD 4XFGA 3T0BA 3VDAA 5FPXA 3I2OA 3CHXA 4U36A 5F5CA 1AXKA 1CONA 2CSGA 2WZR3 3N7JA 1HW5A 4IV1A 4P9GA 4E4SA 1W6PA 1OQEA 3FUQA 2P5BA 3B69A 3PHMA 4I0WB 4JRLA 5FZOB 1AYM1 2CWSA 3PIGA 1POQA 1SLIA 4PJYA 1TME3 2BWAA 2XLAA 4XQDA 2Y33A 2EIEA 1BKZA 3VV1A 3WDWA 1MS0A 3NRUA 2PA7A 4LORA 4LR4A 1APNA 5FZ0A 3WNKA 5A3PA 4DEQA 2Y6KA 3SH4A 4JX0A 2ORXA 4YLZA 1OURA 4NPRA 5FZ6A 3TAYA 3ZKUA 1NLRA 1EP0A 4WVMB 2DTWA 4OHZA 3ENRA 2GC3A 5JVVA 4LIVA 3UNPA 3WDUA 2RM23 3AZWA 3C7EA 2V4AA 5L9VA 1A78A 4Y20A 2D98A 1VMJA 3MUZ1 4UW3A 3NKTA 3ZFFA 4MUVA 4HETA 3CMGA 4FVVA 4S2DA 3VBRA 4XIKA 1CAWA 2RS31 1XNBA 5EHDA 2H6CA 1JYNA 3AP7A 5JMOA 1ZM1A 3H3LA 2Y8KA 1L7QA 5FP3A 1I5PA 1D4VB 5A7OA 4K40A 1QOOA 2XMLA 3AMQA 4DY3A 1J58A 2ZZQA 5C3RA 1GWLA 4FOVA 4GA9A 5FKBA 2BDRA 3FLPA 4RA0A 2R7EB 5IVFA 2OZJA 2IUWA 3ZYGA 2WC2A 1BYHA 1UIKA 1KXGA 2PHDA 3P6BA 4IE4A 2QQUA 4CEWA 5C3OA 2BBAA 2PHFA 1QH7A 1GQHA 1MZ5A 4AQTA 2SBAA 3LF7A 4M3CB 4BQYA 2FQPA 2VGDA 2HWE1 4GH4B 5FDBA 1VPHA 2ZX0A 2VTXJ 3MYXA 2LALA 1A34A 4MX3A 3ZSEA 1YFUA 5C3SA 5FO9B 1FV3A 3RS6A 3WP5A 1D0HA 2VMDA 5FPVA 4PIYA 1DYOA 1CIWA 3J7HA 1G6NA 1UY3A 2E33A 3KZ4C 4LO7A 4XAAA 1VB2A 5H9RA 1QQP2 5EJ1B 1SPPB 3BB6A 4FO9A 2WFF1 3WD5A 5J3UA 2FBEA 1J83A 3GM8A 3MW4A 4IV1B 4MZUA 3AYAA 5JXIA 1GWMA 5FMOL 3UT0A 1JOPA 3I2GA 4FPHA 3ZSKA 3D0SA 1V6OA 1XNTA 4Q1PA 1JXNA 2ZACA 3LA2A 3UESA 1JOJA 2CGOA 5GM0A 1RUF3 3SKVA 3WLUA 5BNOC 2ARAA 4KWJA 3IM0A 3IZOA 1LGBA 4Q2FA 3MIDA 1PK6A 1N1TA 2IVJA 5L9BA 2F6BA 2QQVA 4P9YA 4AVTA 1RL3A 1HRI1 3B00A 1RUJ2 3OF1A 4XQ4A 4BHPA 4EQVA 2NQYA 3KB5A 2XUEA 3N9LA 3N35A 3WF4A 2GH8A 1YO8A 1WCSA 4BM8A 5C5UA 3LEMA 1CPNA 2WINB 1HXS3 4PQQA 4R4ZA 2ILMA 4DNYA 3GZEA 1OVSA 3VBRB 2GZWA 4CDUA 2ZAHA 5JXHA 3AXEA 1W28A 1TZOA 1VRBA 4OMDA 1V6JA 3BYWA 4QKFA 3GF6A 4UAPA 3P3PA 3BOPA 4NR1A 1S2KA 1RGSA 3ZPYA 3G7DA 3BU7A 3ZXDA 3EB7A 1LGNA 2WWSA 4QX2A 5A3MA 4TWTA 3T0DA 2WYFA 2ZMNA 4IEPA 4UFIA 1GMMA 5FBJA 4WVZA 4DS0A 4JV4A 5HV4A 2GNBA 4ISQA 2W1UA 3AZXA 1BMV2 1WLCA 1WCDJ 4HVOA 5EIYB 4MXVA 4Z2WA 4YGBA 4FXKB 2YGLA 4F3JA 3PIJA 3LSEA 1K42A 4CDWC 2OUHA 1MR5A 2WZR2 4LIUA 4Q4V1 1LOEA 2ZGTA 3RPQA 2JKXA 4R9AA 1K5MA 1ALYA 4XTMA 3RVHA 3VDDC 2NPIA 3W58A 3OOXA 5DUVA 1MZFA 3THTA 3ES4A 4AGGA 2OX0A 1ENXA 3VBOA 4ARYA 4OYUA 1TG7A 2V73A 3FN9A 3CZUA 5JOZA 5DG1A 4HVQA 4ASMB 3KT7A 3WCRA 5DDJ1 1NE4A 2XL9A 5GZFA 2JDKA 4LQRA 3BTXA 2C1FA 2JE9A 2BVVA 3LFIA 1AR63 3RZGA 2RM22 2D6NA 1O5LA 4MGTA 5A7NA 1UYPA 5BNNC 4IEOA 4R9BA 5FY5A 4ZZ5A 3A23A 4N53C 2DCJA 3UJQA 4O61A 4IEWA 2RVAA 3AKRA 2VNRA 4ATFA 1W8OA 1D0GA 2F17A 5JOXA 3MLKA 3JUUA 4AVCA 1VRH3 3OTFA 2DFCA 2BW8A 2VMEA 3PJQA 2A71A 3UL2A 1N1YA 1UZYA 2V09A 3TNPB 2JENA 2AH2A 4AHXA 5KHIA 5IYYA 2B46X 3WW4A 4AEDA 4YGDA 1TVGA 2Y6LA 1HV1A 4YRDA 1O59A 1YJKA 2W08A 4GIQA 1G9BA 4KL1A 2QQLA 3POSA 3GXUA 4KQ7A 2NMNA 2LUWA 5LA1A 1OA3A 5A7PA 5A3TA 3A0KA 3P1IA 4FPYA 3ZN5A 4QDQA 1PGL1 3AP5A 4GWMA 4A7YA 4BISA 1WLTA 2Y6JA 1OQDA 5K4LA 5CEHA 2QQWA 4LUMA 4XFHA 2OT7A 1HRV3 2VCCA 5I93A 5IAXA 4NROA 1NXD1 2A3WA 3R4UA 3SLIA 4XDPA 5KHHA 3ZYBA 5A32B 1RJ8A 2IC1A 3AKPA 2NYYA 3JU9A 2GP3A 4UXAA 2QQKA 2E53A 2VZQA 4RGKA 4AI8A 5DZFA 5BNQA 5C4WC 3HQUA 4BMBA 1HJFA 3GZAA 3MHZA 4XFFA 1SLCA 4COZA 5FMOS 1AYN1 2RV9A 1RUF2 2WSUA 3GJAA 4UW6A 3Q9OA 5JAXA 4DEVA 3BUCA 1M4WA 4FPCA 4RFT0 4XUTA 1ZA4A 4I3PA 1CAVB 3OPZA 1WD4A 2A1XA 1W8NA 5L9RA 1BCXA 1XE7A 1VAMA 2A7AA 4XYXA 2JDYA 2CAUA 5K0UA 4I30A 5CG9A 2WABA 3BVCA 1TNFA 1ULCA 3VKNA 1JZ3A 2XKOA 3FUOA 4LMFA 2FZ1A 4YYOA 2OXBA 3D82A 1ASJ3 5E16A 2HH9A 2O1QA 1HXS2 2JG9B 3C7OA 4YFZA 3E6CC 2DVBA 5KXEA 1O91A 1LNSA 3OEBA 2BVBA 1KJRA 2VZOA 3AZZA 4NRPA 4WZFA 3HBKA 4AEDB 3T0AA 1US2A 5HV0A 2ARCA 5FYTA 4YW2A 4QD2A 1HKDA 3H42B 5JSOA 1H6XA 1MACA 3AK0A 1S0CA 3SITA 4Y1VA 3AFGA 3S5AA 1C8M1 4G9SB 1VP6A 5DG2A 4DB5A 5C9AB 2D3SA 1WA4A 3ZYIB 3DKWA 3J7LA 4PDWA 4XJZA 1UY4A 4Q8KA 1QJX3 1SLTA 3ZSJA 3D6EA 4KH9A 2JD9A 1IQAA 2Q30A 3ZFEA 4LBQB 1UMIA 1H8TA 1JUHA 1YLLA 2Y6HA 4IDZA 5EWSA 5KHJA 5CG8A 1WD3A 3WINE 1OF3A 4ZPIA 2WNEA 2I07B 4YW4A 2XL7A 4GH4C 4I02A 2JKBA 4QX8A 2PQQA 1ULPA 5JIAA 1G9DA 3S57A 1BLZA 1EY2A 1CN1A 2X5IB 3MIBA 1LHOA 4MLOA 5IVYA 4WM7A 1DBNA 4RHV3 5JI7A 4UFMA 3S30A 4J1WA 1AR62 2J1VA 1H2NA 5C3QA 3PMSA 4XXPA 4IV1C 3J8F3 4EE2A 1AJKA 2QQPA 1EUUA 2WBKA 2JDZA 3ZSLA 2VL4A 1WMDA 2WNUA 1ZZ8A 2D6PA 2WR9A 4RGGA 1UCXA 4COWA 1AX1A 1MEC3 5FWEA 4COYA 4DQAA 3VKLA 2Y60A 4OHYA 1O8PA 1GQPA 1VRH2 4AEMA 1PO13 1YCIA 4DPNA 4GJYA 5EP9A 5DZEA 1AUYA 2ZKLA 3I4IA 3N4MA 2VD7A 1W6MB 4Q27A 1OF4A 2HWC1 4FAGA 1REFA 5FY7A 1K5JA 4HSJA 2HLEA 2A6XA 3AX4A 2X53S 2RMU3 3AP4A 4AI0A 2AENA 5GLVA 4E4HA 3HNBM 1PO23 1HB3A 1WW7A 3OD0A 4JGZB 4R52A 2W94A 4M0NA 5EYXA 3SC7X 4EN9B 5DAWA 3C7GA 1DGWX 1IG3A 2JG8B 4W6YA 2A3XA 1ZZ6A 2RDNA 4IEUA 3VBRC 4P5HA 1ONAA 3I59B 1HRV2 5FYHA 3USUA 4E4DX 1EAH1 3TOJA 5ERLA 4A7KA 1OUSA 5IVBA 1BK1A 1QY4A 3JQXA 3HQRA 3ZOIA 4YARA 3JD71 3UKNA 4UWDA 3IT8A 4EN0A 5CYYA 1NX9A 4MXWA 3PUQA 4XXAA 5J1XA 1UYXA 4ZU5A 1JS9A 4MHUA 2CAVA 4CEWC 1RMU1 1UW8A 3HQXA 1RUE3 1RYYA 5CZKA 3ATGA 1C5IA 3LSDA 4H7LA 5JZGA 1LU1A 1PIV1 3KGLA 2ZCWA 1TMF1 4LULA 4QX5A 3VD7A 4PF5A 2TBVA 1B35B 3POBA 1WKYA 1YQ2A 4M01A 2Q1ZB 4MGIE 5G05L 5ANNA 4YW7A 3J4UH 1YIPA 2PHXA 1OC1A 4WM7B 4Y5SA 2ZGSA 3J9SA 3ON7A 3AL6A 2QQJA 3V64A 3S0MA 1IQDC 1H2KA 4L92A 1POV3 1FMD3 1V9U3 5JUVA 2IWGB 3WVJA 4Q5OA 4ZXEA 1ASJ2 4YVWA 5LATA 4M3CF 2WNUB 1PGL2 4W8JA 3JXSA 2P34A 4JDNA 3O1OA 3MICA 4PBPA 1PK6C 5AFEA 2QQNA 2AC1A 3JZVA 4PT6A 2YC2A 3I2HA 4XBQA 3RJRA 1NOVA 4NE9A 3ZIXA 1DG6A 1ENQA 3ST7A 3U78A 2J42A 4OQ8A 3W21A 4A44A 5L7OA 5A1AA 1C1LA 1H1MA 2ET1A 1WMFA 3KCYA 3VBUA 1W6OA 4UW4A 3NKGA 2YHJA 1W2UA 2WDBA 1NA1B 2ZKNA 3ILFA 2PMWB 2VG9A 1PZ7A 3UKTA 1OH3A 4K6BA 4CDUC 3O1MA 1QJX2 5FZHA 2BNOA 2ZHLA 5J48A 2VU9A 3MPBA 1FOD3 4LO4B 4BIFA 2UURA 3I2KA 2VECA 2XVLA 3NNMA 5LWBA 4GD4A 2I74A 2YFZA 4OI2A 2E26A 1LEMA 3WQBA 2VTFA 3BIWE 3LGRA 5FPBA 3SEPA 2AZ5A 2EXHA 2WO3A 3SH5A 2EVXA 4TLFA 4CU7A 5J96B 2P3YA 1QIQA 3FHAA 2ZGRA 4FCAA 2XJQA 3H7JA 4RHV2 1OUXA 4OVEA 3GDBA 4H7MA 5FY4A 4CUBA 4ZHNA 3IMNA 5FRAA 2CDOA 1T6GC 4IEZA 1L7LA 2GNDA 2JIJA 4JGYA 3J8F2 4PF1A 1V6NA 1K5MC 2WS93 3ZR6A 1C4RA 3VUOA 5CFDB 5GKAC 1D4M1 1ULOA 2V5DA 5D21A 3VBOC 1MEC2 1NLSA 3WG4A 2PAMA 3POEA 3ZKYA 4ZS3A 1PO12 4YVWB 5A7WB 2ENRA 1JZ5A 1CAXB 3NVCA 3IWZA 1DZTA 3NJYA 4L99A 2B4KA 3B5LB 4OHWA 4K1YA 1WGPA 5FZ9A 5FZGA 4WBBA 2WN3A 2QBXA 1VBE3 4LO8A 4XOGA 4K8RB 4CEYA 5ACA1 1G9CA 1H4HA 3IKWA 5K7PA 2PAKA 4LLOA 3I2JA 4PIZA 2RMU2 2AACA 1Y3TA 2PAEA 4L2NA 1PO22 1LOFA 1JN2P 2K9ZA 3DECA 4L0PA 1AL22 5KWRA 4CCCA 1UY2A 2EAKA 4FFFA 2XWJB 2ZA9A 1W9TA 4NIAA 4AGRA 1PMJX 2CYFA 4URTA 4X6RB 4XFAA 5BV6A 3V56A 4AQSA 1SMVA 3UKVA 4Y22A 3POIA 4AEDC 4XF3A 1XQNA 1VBC1 1MZ6A 4JDMA 5F9TA 1NXMA 3NV2A 4LPLA 3URFA 3KWVA 4FOWA 1EV13 1QU0A 1RUE2 2BFUS 3LIGA 4OUSA 4V2VA 5IK8A 2HWF1 2ARBA 1VBB3 2XQRA 3B9CA 3ZXEA 3ACFA 4Y1ZA 1YXWA 2VZ1A 1W6QA 2ZHNA 1UPSA 4P9IA 2P17A 4UBGA 1MQTA 3LZZA 3R4DB 2FCVA 4B1LA 1JH5A 1Z78A 2LM3A 1S0JA 3UGGA 3KHCA 4G3YC 3VZKA 1U5ZA 1JOBA 1FMD2 3PVOA 1H4GA 1WZXA 1V9U2 1XYPA 1GLHA 2D93A 2AEZA 1F31A 3N7LA 3NV1A 4NVPA 3TB0A 4OULA 5FJKA 4B4RA 5C33A 3ZFGB 4A2UA 3OGRA 3KVAA 3ZYRA 3KCCA 5EPAA 5LA9A 4TTGA 1RINA 1RXGA 1STMA 1BVP1 3D4KA 3R6SA 1IGOA 5E88A 3WSOA 2XBO3 3HIFA 4HLTA 3SQOA 2XB6C 4FTSA 3I3QA 2W87A 2VVFA 1TEIA 1UXZA 2O14A 3VHRA 5K0UC 4CEYB 4HPKA 3QLQA 1G86A 1J3RA 1VBD3 3PJYA 4MGYE 1XRUA 1F9KA 1XOYA 3HT2A 3AB0A 5BXXA 4C0BA 2VBBA 1V6LA 1COV1 1FT9A 2JD4A 4OI4A 1MVQA 4M0HA 3WEZA 2A70A 2DFBA 4K21A 2DF7A 3I7DA 1FOD2 5FYVA 4IXLA 2WN2A 3BCWA 2FHRA 3IIIA 3RGBA 1E5SA 4BOWA 1Z0HA 4JGZC 1W8ZA 3DKQA 2YU1A 3A21A 5FPZA 5CISA 3J26N 4LA3A 4UFJA 4LHKA 4KG0A 1VIWB 5FOBB 1J59A 1XE0A 3OUIA 3TEZA 3HT1A 5A6YA 4CCDA 2D3RA 4CDWB 1ODNA 3LDKA 3KS7A 3MIFA 4PDWC 4XBLA 3SH3A 5IAVA 1GR3A 3VDDB 1WLDA 4TYSA 3N9OA 2VQTA 2WS92 1LRHA 4I2OA 1KDMA 3ZFEC 4LKSA 1P8JA 3ITQA 4Y24A 3SISA 1QJY2 3KVBA 3VKMA 2BZDA 5DMYA 1GV9A 4DY5A 2BGCA 5CKNA 3ME2A 4NRQA 4GQ7A 4KU8A 2FMDA 1CAUA 4KWUA 3PTYA 2KM2A 3PUSA 3Q8CA 1ENRA 1B35C 5DZGA 1HQLA 4LKDA 4OZOA 4WM7C 1AYM3 3RYRA 2BERA 1JZ6A 1VBE2 4HOOA 4FFIA 4NAMA 5BNNB 3O1PA 4N53B 5IJRA 4XZPA 3SKJE 5LBCA 4ZONA 2Q8DA 3WHTA 3V0BA 5FZIA 2WNVA 1PZ8A 2WNUC 4EZHA 4LITA 3IB3A 3UV9A 4W6WA 2UWBA 1UY1A 1AR81 4UYBA 1LHNA 1I5ZA 2G1MA 1W0NA 4XILA 3AYCA 4AWDA 2CV6A 4ES9A 1RUH1 2YXSA 4AHWA 3HNYM 4RR3A 1YJLA 1REDA 2GU9A 3GHMA 3SCHA 1MS4A 3LOIA 1R091 2VY0A 5JPMB 4NRMA 1GZ9A 4OFGA 3FWEA 1HB4A 5FO7B 1VBB2 5C8WA 2VZ3A 2W2IA 5A3WA 4FTBA 4O9GA 4YZ4A 1DF0A 4XUQA 3AMMA 4QPWA 2XLGA 5EV7A 3I97A 1DZRA 1DCSA 1UX6A 3SCFA 2BTVC 2HJIA 3HNMA 4A6SA 5H9PA 4Q4Y2 3N3HA 5CIRA 3RFRA 4CE8A 4XHXA 2PLV3 1GUIA 2Y38A 3RZLA 1FNYA 2JDUA 2YG0A 2ZGQA 3MW3A 1RUG3 5CA6A 2PTMA 2HEVF 5C8CA 1JUIA 3H1MA 3DGTA 2WFF3 5T54A 3WNXA 2ZEXA 3WXPA 4CCOA 3ROUA 1HB1A 3BTZA 1CJPA 2XBO2 5HBAA 4LO6B 1I1EA 3AJYA 2VQ0A 3DPRA 2X09A 3LOBA 5CFDC 1VE0A 4LE4A 4YM1A 3V0AA 1VBD2 2XWBB 2Q8OA 2YY1A 5FXVA 1LJ7A 5IVJA 3B3QE 1GFF2 4YVWC 1XYNA 2WNVB 2D6MA 1FI2A 1HRI3 1HX6A 5ABJA 2JJ6A 1NT0A 5A33A 1S4CA 4ISRA 1SQ4A 3ZFGC 2DDUA 3MGUA 3T09A 3SNMA 4IUGA 1FPN3 2WO2A 2LTNA 2OS2A 1BEV1 5C5TA 1W6NB 2JDAA 5H9QA 5HCFA 2G9GA 4K8FA 1W39A 2V4VA 3RNSA 1RUD3 4BPZA 4LHNA 3THDA 1GP4A 3TRSB 4AFDA 2FCUA 5E8AA 4ES8A 2VOVA 5KC5A 2ZPXA 2VZPA 3VBUC 2RJLA 3B94A 4AI3A 1W9FA 1YWKA 3WF1A 1SDDB 1F4HA 1GOHA 4QPGA 4A7ZA 1ZRFA 4K20A 5I0RA 1Q43A 4FP2A 1JTZX 4BIOA 5IATA 3O7OA 1GZWA 4LBOA 3VHPA 4AFAA 1OOPB 5FY9A 5DPNA 1DYKA 4YW5A 4UT5A 4QQLA 2BRTA 2XOMA 3B7MA 5BNPA 1Y43B 1ND3A 2AYHA 4Q4V3 1UZWA 5D2AA 4CXWA 2DV9A 1AHSA 5GZGA 2XJVA 1VBA2 2XH6A 4WZCA 1AYM2 4LK7A 1R64A 1SLBA 5FZ7A 3LEIA 1W6PB 3JQWA 1NCRA 4JGYC 3K3OA 1W06A 3DCQA 4CPBD 1CJDA 3MO4A 4FPKA 1SBEA 2QZ3A 3DPRB 4NJ4A 1KDKA 2DVDA 2I45A 3RMXA 5DUWA 4LJHA 2J1AA 3ZMNA 3NNFA 5LW9A 5F6KA 1DIWA 2VZVA 5I8SA 2I2SA 2GN7A 3MF9A 1QJU1 1WMEA 3I2IA 5FYYA 3DYPA 4BU2A 1W8FA 5EXOA 3VKFC 4PLNA 4TN7A 3WW2A 1RC6A 1NZIA 3MI8A 3T2PA 4DMIA 1RIRA 4DXSA 1DQ5A 3TEXA 4CEYC 3O1TA 2RS11 5HXVA 4QX0A 2VC9A 3Q8BA 2CHHA 3TEWA 1C5HA 4Y20B 1ZZBA 1KD7A 1YIFA 3MDPA 1OLMA 5I0UA 3ZFFB 2N7GA 1LOFC 1A8DA 2RHPA 5TSWA 1PMHX 4JKLA 5JI9A 1CAWB 5J98B 1YC61 2CGNA 4EN7B 2PHUA 1EPWA 3W5NA 3AXDA 4QKDA 4DFSA 2HKXA 4Y4RA 1H0BA 1RUI2 3A4UA 3JBG3 4NUBA 2WT2A 1UZZA 2XUMA 2R49A 4DUXA 4P9JA 1UOGA 5FREA 1WLWA 3KQ4B 2WZPP 1AF9A 1SFYA 1XNCA 4AVSA 3RWKX 4IERA 5F6LB 4CEWB 4RS5A 1UOFA 2KA3A 4E9KA 2PLV2 5FKCA 4CUGA 4BLJA 2BV4A 1OQ1A 1WWYA 5A6XA 1RUG2 4HMZA 1MS1A 4M3CE 4D8MA 3HJRA 3CU7A 3HOBA 3GZTB 5A7QA 3KMHA 4QXKA 2WFF2 3FLTA 3OY8A 4XAEA 4OI1A 2XJRA 2VR4A 2Z42A 1C1FA 4R8HA 1EUTA 1MQTC 2BOJA 1AYN3 4BQ5A 4YZ5A 3WG1A 5KBFA 3TWIA 5FUIA 2QDRA 1PHMA 1TME2 3KD4A 4GKXA 1SLLA 3WW3A 3CIHA 5C70A 1U0AA 3B93A 1YNAA 3W59A 3IAPA 3NV3A 2ORZA 4I01A 1E5HA 4P14A 4N8MA 4PLMA 2XJTA 4P08A 4TLGA 5DAXA 4N9HA 5DAQA 5D8AA 4LBMA 4BZ4A 5IVVA 1PK6B 1HRI2 1A3KA 4S2GA 3NAPA 3QCWA 1PVC3 5FP4A 2MHFA 4C1XA 3BTYA 4JVAA 1PX4A 4UF0A 4KMQA 2C9AA 3ILNA 3OGVA 1FPN2 2MNGA 5C3PA 4N9IA 5EJZB 2ZOEB 4D69A 5I0TA 2GAUA 3EXUA 1LGCA 3AZYA 1UD1A 4I09A 2J1TA 1RUD2 5T3NA 1G7YA 5FXXA 3WF2A 4K7JA 4NIGA 3Q8AA 2WJSA 3VHNA 1X33A 4UFKA 3OYWA 3M3OA 1W9SA 4M4PA 3H3ZA 1RVF1 1DQ0A 4CDUB 5IT6A 4CDQA 5HI0A 4D0QA 1GNZA 4XZUG 1GQGA 2IXJA 3N9QA 1G8WA 4JKKA 2IVIB 2GSYA 2QQOA 5GLTA 5T5OA 5IFTA 3ZDVA 4CXYA 1HDKA 5LA0A 1Y9MA 4QT6A 1C8M3 1HB2A 1H2LA 2JIGA 2NZ9A 2R073 4GWIA 1CQ9A 5FK7A 5FPAA 4W4ZA 3RQ0A 3RYKA 4PI0A 2YDEA 4OQ9A 4QX1A 4RS5B 3W9AA 4Q4V2 2ADEA
chains in the Genus database with same CATH topology
1ZBA3 2VNGA 4Q0QA 2ZX4A 3VBSA 1BBT3 3HN1A 3MFAA 2VOWA 3EHKA 1K5MB 2IXCA 1AR71 2BNMA 3PNAA 3GHNA 5DDJ2 1B09A 3VBOB 2PELA 1LESA 1QOSA 4JTOA 1KRIA 3RI8A 4B4PA 2QDNA 3KQRA 4FQ4A 2ZX3A 1DGWA 3GALA 4XJWA 1DQ4A 1O4TA 1PNGA 5J36A 2G4IA 4HK9A 2DCYA 3AZVA 1QWRA 3RJ2X 3O12A 1GZCA 1H8VA 1QH6A 2FMYA 2HWD3 2B7YA 1KFXL 2JEMA 3VLBB 3AKQA 2WNVC 3O14A 4MYEA 1JHNA 3VZNA 4D94A 3POYA 2R0HA 2HWC3 1SLAA 4HBNA 3OYWB 4AQ6A 4NO4A 4DINB 2D3PA 3S7IA 2BWCA 3JBG2 5DUUA 4CDQB 3KT4A 1RHI3 3LA3A 4JDOA 1XXNA 2XJPA 1ZX5A 4X8NA 1AR61 1PGL2 1PNFA 1YUDA 4RR3C 1PZ9A 2A75A 3KGZA 1EAH3 2BEOA 3PVEA 3ZXFA 4QU2A 3DL3A 3JD73 3QBQA 2E7AA 3LCPA 1Q8PA 4Y26A 2HWB1 3ZDSA 4ONUA 1IKQA 4AK3A 2XGXA 2X8KA 5EFUA 2ZGMA 5J37A 1RMU3 1AYN2 1OOPC 5LRSA 4INDA 3VBSB 2R043 1XNDA 1PIV3 2Q1MA 3S6PA 4COVA 2VXRA 1ZZ9A 4KWLA 4GB33 1RUC1 5FO8B 2NN8A 2YC0A 3VKOA 1PVC2 5C8CC 1HRV1 4V1PA 1AR93 1OPMA 1VAKA 1U12A 3H1YA 3FLRA 3EJKA 3IDCB 4QGNA 5K0UB 1YI9A 2O8QA 2UYAA 2WLQA 3BALA 4IL7A 3DPRC 1UU4A 3TN91 1R083 1R1A1 3VBFA 2Y0OA 3CO2A 2QFEA 3R0RA 2RR13 1ZYBA 2GN3A 3LAGA 3WUCA 1KS4A 1CX4A 2ET7A 4Q26A 5ABJC 2NP0A 4ITCA 4YZ3A 1DFQA 3WCSA 1C8M2 1QJZA 4PQ9A 3ZFFC 2R072 3O0XA 3OGJA 4YM0A 3FE5A 3M3EA 2R30A 4IV3A 5AC91 4AVVA 5GLZA 4GULA 3ZSMA 4QMAA 1E57A 1ZBA2 3I2DA 1S0IA 4PDWB 2YGMA 4QPGC 1BBT2 4WVVA 1NCQA 1V6KA 2BFUL 3ZFEB 1H8TB 4FXGB 3ILRA 1SDWA 4W65A 3MF6A 5A3LA 3POWA 2W68A 2R063 3NV4A 3CL1A 5BNPC 1ND3C 5FTTC 2CY6A 1WUVA 2R0FA 1NY71 2Q0AA 4ZXKA 1D4M3 5FQ0A 1LODA 1QJX1 2A6YA 5FLJA 1IS4A 1VAVA 2B45X 1NCRC 1GNHA 3RDIA 2HWD2 5LK5A 3HAGA 3S7EA 2E51A 4GALA 4N43A 2HWC2 3HMYA 4XHBA 3L2YA 3T1LA 4FBFA 4Q4X1 1RHI2 1MS9A 2ZAAA 2ETEA 4H14A 3H50A 3ACLA 1YFYA 5AVPA 4XPVA 2B42B 1S0FA 2XKPA 4Y1YA 1EAH2 2XJSA 3ZYPA 2ZX2A 2YPJA 3E6BA 1Z7S3 4RQPA 1U5IA 1QHDA 3JD72 3AMNA 3PLQA 3ZX7A 4YFWA 3GYDA 1VBC3 4IV3B 4XMIA 3RG0A 3USUB 3BOWA 2D7FA 2XJUA 2GNMA 4HL0A 5JWPA 4ASLA 1CGPA 2R32A 4QHBA 1RMU2 3MIHA 4FPGA 4MXWB 2HWF3 1OKQA 2R042 3G6JB 2BPA2 2MEV1 4YW1A 2RMU1 3FZ3A 4RS5C 4WVWA 4R4XA 1L3JA 4KGQA 5JZGB 1AL21 4AFBA 4GB32 4B29A 4YG0A 3JB4C 2SLIA 4LTAA 1AR92 2NM1A 3FFQA 2PHRA 4LEJA 2V5YA 3PVBB 1R082 2VQAA 2VW2A 1PMIA 3BPZA 1O3QA 2RR12 5CU1A 3OBRA 4LUKA 4FPFA 3ZO0B 1FX5A 5K8SA 1XNKA 1ZBE3 3OD4A 3RWNA 4FP3A 5D8AC 3WX5A 4D7SA 2HEYF 2QNKA 3KM5A 1AVBA 4N43B 3NAPC 5E1RA 1OHFA 1DYPA 2OIIA 5CFCA 1Q8OA 3ETQA 1OPOA 2ZTNA 3ZN4A 5L36A 1WW4A 3NL1A 1NYWA 5L7OB 1COV3 1FMD1 3VBUB 2JICA 1HIXA 1V9U1 1W6OB 5FLHA 1WBFA 1H1IA 3M7AA 3GNEA 3NJZA 3P3NA 2DU0A 4CDQC 3IDBB 4XFIA 1D2SA 1ND2A 3THPA 1I6XA 1RB8G 1O3SA 3NSTA 2ERFA 4OHVA 5SV5A 1IZ3A 1SACA 1LOBA 3ZMOA 2BNNA 3WDYA 3VBHA 2P3JA 2R062 5T50A 1BVVA 2OUJA 2WLPA 4GMP3 2K2SA 4N7UA 4QPIA 3U0ZA 4Q0UA 1D4M2 2VOKA 2VW0A 3USSA 3VBSC 4JGYB 3UK9A 4BA6A 1FOD1 1U5XA 4ZU7A 1H1AA 4PIXA 4YZ1A 3ELNA 1RTVA 4FPLA 2GC0A 3X29B 4RL7A 1RUOA 4BWOA 5L19A 2ZJCA 2VMHA 1QGLA 5JR7B 5T55A 1O3TA 4PCRA 2YZ4A 4BLIA 3M4FA 4COUA 3H0OA 4QGLA 1QXRA 3PVNA 4NHKA 4E2SA 4WM8A 2WS91 4C1WA 4XJAA 4IETA 2EXJA 1Z7S2 3GBGA 4X8PA 5JLVA 2Z2SB 2FZ2A 3AFKA 3TNQA 1QJY1 2K0GA 1F5FA 1MVEA 1UU6A 2ARXA 1RUH3 1VBC2 5KHKA 2C5DA 3MW2A 2XLFA 1X82A 1R093 4KG8A 4Y22B 4AHZA 2XPJA 1CR7A 1N3PA 2VMGA 2HWF2 1NQJA 1QMJA 3CJIA 3WP3A 2BBVA 4EV0A 4HN1A 1QDOA 3VZLA 3TBDA 1RJ7A 3ASIA 1MS3A 1F5JA 1NQDA 2GALA 2YYOA 4LBNA 2QJVA 2WQZC 4B7KA 1W6QB 1MQTB 4XFBA 4CRQA 3NO8A 3FC0A 1H8TC 5GLUA 1LECA 4GWNA 5DXDA 4YM2A 2A73B 3IDEA 1H30A 1PGW1 3U11A 4XW3A 2OYZA 2WKKA 3K48A 1F2NA 1ZBE2 1J1TA 3FJSA 4QM9A 2P3IA 4NHMA 3JCIA 3AMHA 1HV0A 2AGSA 3ZN6A 2AREA 2VMIA 5C4WA 1MZEA 1G9FA 4Q4W1 2UWCA 1QF3A 1LULA 3NWKA 4YGEA 5EZWA 1BJQA 1KITA 1LOGA 1Q3EA 1O7FA 2RS51 1I3HA 4CDXA 4HPKB 3U4XA 3ALQA 2Q4SA 1COV2 2EIGA 2X29A 1D2QA 3N7KA 2QE3A 2DCKA 1BEV3 4OHXA 3QH7A 1Y9QA 2D97A 3GBFA 4FQZA 5IK5A 2RS33 3L2HA 3H8UA 1QNYA 2TNFA 3FFZA 1KQRA 5F1RA 1RITA 1O3RA 1EV12 1AXZA 2VVDA 5CB7A 1DGRN 2OW4A 4NWVA 4WVMA 1VBD1 4CZSA 2JX9A 2WA3A 1BXHA 5T5JA 3PMEA 4IV3C 4Q1RA 3WDTA 4LLFA 3ZYJB 2QUOA 2XVGA 2HWE3 1FNZA 1S0BA 3BTAA 4Y5Z0 2CTVA 1NCQC 3QD6A 3SCGA 4Z82A 5FBZA 4D7TA 5JZGC 2F4PA 2IXKA 2P3KA 1X7NA 3V65A 2Q5TA 5LRRA 1CAUB 5JMCA 1A6CA 1ZRCA 3WG3A 4XJ9A 3ZN6B 4M3CA 4Q0SA 3L9JT 1R1ZA 4A3XA 3E97A 4LE3A 4HSLA 4S2HA 3JB8A 1QJU3 4PLOA 3V0BB 4CDXB 5JSPA 1O4ZA 3DV8A 1FV2A 5BUVA 1RUH2 4AF9A 4N43C 1SBFA 2YUEA 3VN4A 2RS13 1VBA1 2AUYA 4L97A 5F5QA 1R092 2G9FA 4H3WA 4Z1VA 1QQP1 4GXLA 2BUKA 4RR3B 3INAA 3VGIA 5L7OC 1N1SA 1UU5A 1LOAA 5CNAA 3QH6A 3FMGA 2PHWA 4HZFA 3H9AA 2UWAA 4YG6A 4RQPC 2XVKA 4P9XA 4FPOB 1SEFA 4S2FA 4LT5A 1J3QA 3VL8A 2ZGPA 4YVSA 2P37A 1RUJ1 1GSLA 4I0AA 3D5OA 2ZZJA 3O5SA 1IPJA 3O0WA 1QKQA 1YI7A 1SFNA 2VUAA 3NW4A 4AEKA 3HR9A 5C8CB 2ZMKA 3QOPA 1PVXA 2GMMA 2AR6A 5FAXA 1RUI1 2E7QA 4MV2A 4L8QA 4FPEA 2A5ZA 4L9BA 4M00A 2Z69A 5KC6A 3V0AB 1XU1A 2OZ6A 4HKWA 4LBKA 2PLV1 1BMV1 1CESA 4FSJA 2EA7A 4EROA 1OD5A 1BEV2 1RUG1 4XF9A 3IN9A 4IEVA 4CP1A 5A33B 5ABJB 3CNAA 2WZR1 2RS32 3T2TA 2DVFA 3B9IA 1YHFA 3N36A 2HYKA 5CFCC 5J09A 1RVF3 1TME1 3MFCA 1VALA 2DCTA 2CGPA 4ATEA 1C8NA 1DU3D 1O5UA 4QQHA 1LTEA 2H0BA 4LBJA 4XEZA 2D6LX 2EXKA 1DLLA 4L11A 4AI2A 4QPGB 2Z5WA 5FCCA 2D6OX 1UF2C 4QQPA 2RM21 1ND2C 2HWE2 2R1BA 4NOTA 1GZWB 2ZMLA 1UKRA 1W0PA 1FPN1 4QGMA 4YVSB 3M8LA 4DZGA 4CP0A 1RUD1 4KU7A 5BNPB 1ND3B 4HFSA 3VBHC 4MSVA 4RGAA 1X8MA 1DQ6A 2PFWA 1GBGA 3M3CA 1AR73 2ZS6B 4QPIC 4P9LA 3GBWA 3IIAA 1GKBA 1Q8SA 2IXLA 3H3UA 4C0HA 2VOXA 1NCRB 4LA2A 2E9QA 3AP6A 4B7EA 3WP4A 2CL2A 5AFBA 3WOGA 4DRRA 1XYOA 4XETA 2DURA 1LENA 3D0JA 1QJU2 5CADA 1SBDA 1JW6A 1ZZ7A 2IXIA 5A32A 5JPNB 1ULFA 2JE7A 1KS5A 3OCPA 1CPMA 3UJOA 2RS12 1LR5A 1S1AA 4KGGA 1DHKB 4AI1A 4ZKTB 2ZX1A 1BQPA 2YROA 2XG3A 1MS5A 1QXJA 2JXAA 5EYYA 1CAVA 4WM8C 4C90A 3E6DA 1RUF1 1TE1B 4EN6B 2P2KA 1LHVA 1OFNA 2D43A 3CF6E 1HQNA 2WL1A 1ZZCA 2Y26A 3OGGA 1S0EA 1X36A 1H9WA 3RZZA 4R9DA 2VNOA 2JG9A 5JSRA 1OSGA 5AVAA 2HWB3 3CJIC 3M70A 2VW1A 2BQPA 1HXS1 3C3VA 1W0OA 3N7MA 4BYYA 3OBTA 3VL9A 2PYTA 4OUMA 5D1IA 2VH9A 3OY8B 4F8AA 4W6XA 3JBG1 3U07A 1V6IA 3MIGA 4HKLA 3O0VA 4FTEA 1GANA 4AXOA 1DGLA 2QKDA 4HN0A 3CLPA 4IESA 1BZWA 1OI6A 5I91A 5C9AA 2GMEA 2ZGNA 1RUC3 4XBNA 5GZEA 3A0NA 1H2MA 1V70A 1ZVFA 5IUQA 5D8AB 2GMPA 3GZUC 4MGKE 2JECA 4LBQA 3NAPB 2RE9A 3TN93 1FATA 1R1A3 2E7TA 1J3PA 1LEDA 3FBMA 4D3WA 4B8EA 1ZNPA 4XQWA 1HQWA 1ULEA 4HANA 1Q56A 3LKJA 1RVF2 2X5IA 1VJ2A 4CDXC 2ZGUA 5CVRA 1H9PA 2H0VA 1IKPA 3SHRA 4SBVA 4K1ZA 3WY6A 2C0ZA 4RD7A 4TZDA 4EWDA 2PN5A 1PVC1 1VR3A 1S0DA 1JBCA 5SV8A 3QACA 4JCKA 4UBHA 1N3OA 4WV8A 4Z07A 1TNRA 3ZXLA 5AC93 2O0OA 2ES3A 3E5QA 4K3UA 1N47A 1VRH1 1W6MA 4JRAA 4LHLA 4RSUA 2B9UA 2UU8A 4HKOA 4QM8A 1AR72 1J1LA 3MLLA 1DGRA 1O4YA 2CNAA 2GH2A 4JGZA 4AVBA 1CD3G 4Q29A 2JG8A 1OLQA 1TMF3 3RI9A 3I59A 4Y1XA 2R1DA 4META 3VZMA 2R071 3H7YA 1A8MA 4CYDA 1AL0G 3FBYA 5GLWA 5KXDA 3HD8B 1UL9A 2CWMA 4U2AA 4C91A 1ZBA1 4XMAA 2WT1A 4JAAA 1M06G 1BBT1 1JYCA 1LB2A 4BH9A 2PHTA 4QQOA 3WV6A 1OLRA 4BQ1A 1X50A 1UIJA 1NG0A 4Q4X3 3KSCA 3I54A 1B35A 4HVRA 5HCBA 4LO5B 1GYKA 4AGVA 2W39A 2VULA 1DQ1A 2EAAA 3APBA 5T5LA 2Z79A 3DF0A 3OJBA 3B01A 4AG4A 4O9EA 4N7IA 2IFRA 3WW1A 1UPIA 4PBOA 4JQRA 2E63A 2Y0IA 3MLJA 5JOYA 3B02A 2HWB2 4P9WA 1AJOA 1ASJ1 2OPKA 5HCAA 4G4FA 2HWD1 1KFUL 3LB9A 3R05A 4MGZE 4FAHA 2B8MA 2DU1A 3WR0A 5E89A 2MEV3 2VPVA 1RHI1 4YVSC 1AL23 1NA1A 1IS6A 3SMHA 2W0XA 3R4SA 1RUC2 1C57A 4Y4YA 4OZXA 1C3HA 3IBMA 3ZXJA 3LWCA 3WUDA 1VLNA 3KLSA 4BMEA 5CBLA 3TN92 1MS8A 1R1A2 4J1XA 1DDLA 2EXIA 4E2QA 1OFSA 1UAIA 4MH0E 1LHUA 2WSVA 2QZ2A 5H9SA 3VBFB 2R041 3ZIWA 2DWRA 3EO6A 3KCXA 2W52A 1RUNA 4YM3A 2R6QA 5ACA3 5FFOC 2IXHA 4FOQA 2DCZA 4AVAA 3WQ7A 1AXYA 4LNVA 4RHV1 4B4QA 4GB31 5CFDA 1I9RA 3I8TA 2HEWF 3VZOA 5IK4A 4EN8B 3J8F1 1AR91 1WW5A 5AC92 1UKGA 1N3QA 1QXPA 1CAXA 2VUJA 3HBZA 1R081 1MEC1 2QVSB 2GC1A 2ZHMA 1QDCA 2RR11 3ZFGA 1PO11 4XJUA 5EJ3A 3AKTA 2WIIB 4ORFA 4AFMA 4SLIA 1YYNA 3D8CA 4XF0A 2WA4A 1NCQB 4NWWA 1PIV2 4AFCA 2ZGKA 2H6BA 3KT1A 1AZDA 1TMF2 4BCUA 1IS3A 1PO21 3VZJA 1NY72 5DUXA 2MPFA 2YMZA 1URXA 5LEJA 4IEXA 1ZRDA 3AYEA 3MZHA 1EYBA 1ULGA 2UYBA 1C28A 5FQ0B 4F7ZA 4QQ2A 5FOJB 2VVEA 1RUE1 2WT0A 2EF6A 3M1HA 2A6VA 4Q4X2 2R061 3E5XA 2D5HA 4AW7A 2QCSB 4EWEA 5I8YA 3MIEA 1SCRA 4Z92B 2IZWA 2NMOA 1YRZA 1PGSA 2PHLA 4Q8LA 5BNOA 3E5UA 1XE8A 1IOAA 5T52A 5IK7A 1EPZA 3ZVXA 1POV1 4E27A 1PM7A 1QJY3 3RMYA 2DYCA 3WQ1A 2RJKA 2DUQA 1VB4A 4IQPA 4RQPB 5BYNA 1G9AA 3VHOA 1FXZA 4YGCA 1ZREA 2D44A 4EJRA 2TUNA 2E6VA 2MEV2 4OLLA 4HT1T 4QPYA 3WZ1A 2XHKA 3BODA 2DVAA 3AYDA 4CTEA 5KHGA 3WG2A 4Q0PA 2JG9C 4AEJA 2UY8A 1AX0A 2O8OA 5T5PA 2ZGOA 4LBLA 2R16A 1LKNA 4NHLA 3AKSA 2GC2A 1Z7S1 1POV0 4DXZA 1V6MA 2WFPA 2D5FA 5BPXA 3RYPA 4Z8BA 2ZABA 1N1VA 4NN0A 1TQ5A 4KBBA 4DRVA 4HK8A 1AX2A 2DUPA 1CVNA 2ZGLA 4CDWA 5C9AC 2DUOA 2DTYA 4AYUA 4BE3A 5ACA2 4YG3A 4Q4W3 3VDDA 2OA2A 5GALA 1SCSA 3MEPA 4H55A 2RS53 4FOYA 2TEPA 4JTNA 2B39A 4XIOA 1Y7BA 2A6ZA 4XJ8A 3WT3A 5CFCB 1AR83 4I3GA 5BNOB 4J6GA 5LK7B 2D40A 1OMIA 2ZHKA 1REEA 1HLCA 2X5IC 4JC1A 3WHUA 3C2UA 3AM2A 3M3QA 5BNNA 4N53A 1ZBE1 1LCLA 4CP2A 3EBRA 4YNIA 1ND2B 1IS5A 1VBE1 2A6WA 1YFWA 3AJZA 2UY9A 4Q0VA 4I0BA 4YSFA 1WCKA 3T1MA 5KXCA 4DOUA 1LOCA 1DQ2A 1WBLA 3CEWA 3VBHB 3M3IA 2B5HA 3ECQA 3M2MA 1Q5OA 4FT8A 1FYUA 5I0SA 1WW6A 4XF4A 5JIUA 3FX3A 3CJXA 4QPIB 1ENSA 4F83A 1LU2A 3DUIA 1S0GA 2JG8C 4N90A 4XTPA 3TYJA 1EV11 4XFCA 3U10A 4OI0A 2NLRA 3AP9A 1LHWA 1VBB1 3ZXAC 2ZBJA 4GMP1 4E4ZA 1NE6A 4D7YA 5C6CA 3DN7A 5K9YA 1QOTA 1Q8VA 3RSJA 2GNTA 2EALA 1UMZA 5L73A 2YV8A 3IPVA 1FAYA 1QNWA 3RRDA 3HWJA 1YFXA 2ATFA 4Q4Y1 3VBFC 3ES1A 4R9CA 4WM8B 1U5YA 3H1WA 1VBA3 4X6QB 2D6KA 1Q8QA 3FHIB 2DVGA 2OVUA 4IEYA 5JOWA 5J7MA 1QQP3 4B3NA 1ZRRA 1JYIA 1X8EA 1IHMA 4TSVA 5BY5A 4FPJA 1OA2A 2XBO1 3SXWA 3WQ0A 5B2GB 2GDFA 1GICA 3K51A 3ZXGA 4GMP0 4KNCA 5JDBA 3CJIB 4E2GA 4AQ2A 4MVTA 3LA7A 4ZU4A 1UN1A 1W6NA 1KJLA 1NZCA 1RUJ3 1S55A 2KXLA 4XDQA 4YW3A 5KXBA 4UW5A 4EWAA 2WQ4A 3EQEA 1DZQA 1PGW2 5GZDA 4XE9A 1S2BA 1ULDA 2BYVE 1IPKA 1NA1C 1XU2A 4AE2A 3MPPG 4Q4W2 3WDVA 1RUI3 4KWKA 5FLIA 1OOPA 4Y1UA 4YZ2A 5CAZA 2A3YA 2IFWA 1OA4A 5C4WB 2RS52 4AHYA 1V00A 4GH4A 4XF1A 4K9SA 4IEQA 5GJ6A 3AMPA 1AR82 3IPVB 4GKYA 4LBQD 4XFGA 5FPXA 4U36A 1AXKA 1CONA 2WZR3 3N7JA 1HW5A 4IV1A 4P9GA 4E4SA 1W6PA 1OQEA 3FUQA 3PHMA 3B69A 4I0WB 4JRLA 1AYM1 2CWSA 4PJYA 4XQDA 1SLIA 1TME3 2BWAA 2XLAA