1AXZA

Erythrina corallodendron lectin in complex with d-galactose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
239
structure length
239
Chain Sequence
VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords LECTIN
publication title Structures of the Erythrina corallodendron lectin and of its complexes with mono- and disaccharides.
pubmed doi rcsb
total genus 51
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1997-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1axzA00
5DZEA 1LOEA 2XB6C 2ZGKA 5AVAA 1IS4A 4YW2A 1BZWA 4LBNA 1WCSA 2A75A 3OY8B 3POYA 4BMBA 5JOXA 2PHWA 5T5JA 2VW1A 3T2TA 4LBQD 1NLSA 3W58A 1BYHA 1D2SA 1RINA 2A3WA 2GDFA 3GNEA 1UX6A 4H55A 1UN1A 1UAIA 2A3YA 5JOYA 2C5DA 2D7FA 5EWSA 1HDKA 2W52A 5GLTA 2EAKA 1EPWA 1MS9A 5F9TA 3TB0A 4AVTA 2WKKA 3WG1A 5KXDA 3AZYA 2I2SA 3ZPYA 4FPYA 3POSA 1C4RA 1QDCA 2ZBJA 3FUQA 4LBKA 3CNAA 2D44A 3AZXA 1U0AA 2JD4A 1DQ2A 4P9XA 2P3IA 4ATFA 2LTNA 3NV4A 1IS5A 3A0NA 3MW2A 3PVNA 5SV8A 2ZGSA 4HL0A 2ZMLA 1AXZA 3N7LA 4DRVA 1DQ6A 2VXRA 4CZSA 2W68A 3VUOA 5LK5A 4YM2A 1MS1A 1SFYA 5KXCA 3QLQA 1LOAA 1G9AA 1ZM1A 3N36A 4XJAA 4YLZA 1WUVA 1S0FA 2Q5TA 3AFKA 4XOGA 4Y1VA 3ZSLA 4FPHA 3KM5A 5HCBA 1LU1A 1S0CA 4XXAA 5DG1A 2A6VA 1ULFA 4UW6A 5EYXA 2NMOA 1FAYA 1GKBA 1URXA 3AYEA 3R4SA 4FVVA 2E51A 3BTAA 4TYSA 1IOAA 3IM0A 1LOFA 1G9BA 1SCRA 5T5OA 4BQ1A 4XYXA 3ZVXA 1DYPA 5DZFA 3ZSMA 1LU2A 3V0AA 1LEDA 3GALA 1G9DA 2NN8A 1LECA 2D3SA 5CAZA 2CTVA 1UZZA 2GMMA 3FLPA 4Y20A 1QMJA 5DXDA 4FPJA 3N3HA 4Q2FA 1S0IA 2D6KA 3JUUA 2JJ6A 5DUUA 2WSVA 1MVQA 5CB7A 2SLIA 3RMYA 5JOZA 4FPGA 5GZCA 2NYYA 4GWNA 3WCSA 2AREA 4YGCA 4XJWA 5CBLA 3O0VA 4CTEA 2DUPA 1QOOA 1LGNA 2NM1A 2AR6A 4ZXKA 2A6ZA 2GMEA 2EALA 4YGDA 3FBYA 4IQPA 4YFZA 2ZGRA 4PF5A 3O0XA 1LHOA 2YZ4A 3ENRA 4FPCA 4FOYA 3IKWA 1V6JA 4BMEA 1WLCA 1JYCA 4GXLA 2NP0A 3USUA 5T55A 3PMEA 3MW4A 1YI7A 1CPMA 3Q9OA 2ZGMA 4YW4A 3AYCA 1GZWA 3B01A 5T54A 3V0AB 4Q1PA 4GKYA 1I3HA 4DQAA 1ULEA 3FUOA 2PHXA 3AP5A 3I8TA 4WV8A 4CRQA 1IKPA 3A4UA 4RA0A 2ES3A 1QNYA 3PVEA 3WDUA 5GM0A 3M3EA 1Q8OA 1W0OA 1KDMA 3WG3A 4XMIA 1S0DA 4DFSA 1BQPA 1YYNA 1Z0HA 2WJSA 2WT1A 2WT0A 1ULCA 2Z42A 1ULGA 3AZZA 4Y1YA 4Y24A 3AP6A 4UW5A 3O5SA 2TEPA 1N1SA 1V6IA 4XJUA 2D3PA 2V5YA 3WCRA 3QCWA 4YZ3A 4XIKA 3VKOA 3USUB 4BPZA 2ZMNA 1XQNA 5H9RA 4M3CE 4XXPA 3VV1A 3PJQA 1N1YA 2RHPA 1V6MA 2W39A 3L2YA 3TAYA 5GZGA 1AXYA 1C1FA 1RIRA 2HYKA 2WT2A 4PBOA 1PZ9A 1Q8VA 2DWRA 1LOCA 3HR9A 3ZXJA 2A6YA 2OUJA 2GN7A 3AK0A 1AXKA 2D6NA 4ITCA 1GNHA 5T50A 1SACA 1DQ1A 4DRRA 1DQ0A 1O4YA 3D6EA 3HN1A 4AGVA 2DVAA 1AF9A 1JHNA 2ZGLA 3ILFA 1SBDA 5GJ6A 1GNZA 3R4UA 1N3PA 1YRZA 3W59A 1CN1A 5EXOA 4FPLA 2ZABA 2ZMKA 3AZWA 4LBQA 3WHUA 1AJOA 5L73A 4FOQA 3N7MA 4AGRA 3V64A 4R9AA 2A70A 3WDXA 5FRAA 1LULA 1MR5A 1UL9A 2AUYA 2ZKNA 2ZHNA 1GZ9A 4LBMA 1SBEA 4XJ9A 2AH2A 5E88A 3UL2A 1LOGA 2PHFA 2R49A 1LCLA 3AJZA 1LGCA 5T52A 3V65A 1LHUA 3N7JA 5GZEA 1Q8PA 3UJQA 4M01A 3OGGA 3RQ0A 1W6PA 4ISRA 1V6KA 1KRIA 2UURA 1G86A 3WV6A 1CJPA 1LODA 2JKBA 3NV1A 2FMDA 1W6OA 3WDVA 1S1AA 1DIWA 1W6QA 2E7TA 4XTMA 1GLHA 1AVBA 3SH5A 4F83A 5GLVA 5T5PA 1WW4A 3SISA 3VKNA 2P37A 1Q56A 3NV3A 2A6XA 5GLZA 5IK5A 4GA9A 1N1VA 3FLRA 4FPEA 1MS3A 3LCPA 4XMAA 4M3CF 3MPPG 1GSLA 2EF6A 3MEPA 1F31A 2CNAA 2YXSA 3WDYA 1QNWA 3PVOA 2D6OX 2E6VA 1W0PA 4JC1A 1IS3A 1DBNA 2VW0A 3FLTA 4LBJA 1JN2P 1MVEA 4Y1UA 3A0KA 1YXWA 4FOWA 4P14A 4YGBA 1W6PB 1B09A 2A71A 2CL2A 2JDZA 2YV8A 4Q8LA 2DUOA 4WVWA 2W08A 5DUWA 1KDKA 3OYWA 4DS0A 4XIOA 1R1ZA 1W6NA 2H0BA 4GALA 1W6OB 4LBLA 2WNEA 5H9PA 1W6QB 3WG4A 3ILNA 3SH4A 3SLIA 3DUIA 1MS0A 2C9AA 3ZXKA 1UPSA 2D3RA 1VALA 3VKFC 3WG2A 2GNBA 2DVFA 3WDTA 1ZA4A 1MZ6A 4YZ2A 1PZ8A 2R0FA 4Q27A 1TEIA 3SNMA 2ZA9A 2ZGNA 4FPKA 2YY1A 1AX0A 4R9CA 1AJKA 1SCSA 4KBBA 5JLVA 1SLAA 1OFSA 4UW4A 4Y20B 3AYAA 1SLLA 3OBRA 5FREA 1WD3A 4JCKA 2DYCA 5GZFA 5JVVA 4K1YA 3ATGA 4Y26A 2CWSA 1JOJA 2OVUA 2ZHLA 2P2KA 4Y1ZA 5GLUA 3OYWB 3OBTA 1FV3A 1BXHA 4Y1XA 4OZXA 2A3XA 2GNDA 2VUAA 1W6NB 4XHBA 4XDQA 3ZXFA 1A8DA 2FHRA 3VKMA 3I4IA 5CNAA 1ULDA 3AX4A 4L8QA 3OJBA 1SLCA 4ASMB 2JE7A 2VH9A 2ZGOA 3INAA 1QKQA 4YG3A 4ISQA 2D43A 5DUXA 3WDWA 1HQWA 1N3OA 3DGTA 2OUHA 5GLWA 2EIGA 1J1TA 1UZYA 4XJ8A 2ZZJA 3AXDA 1FNZA 4C1WA 3RS6A 1SLTA 1VAVA 2SBAA 4R9BA 2EXKA 1GZWB 4YZ1A 2UWCA 1LEMA 4FQ4A 5GZDA 1D0HA 1YIFA 1C57A 2P34A 2ZGPA 2CWMA 1F5FA 1WBFA 4XBLA 2ENRA 3AP7A 5KXBA 1GANA 1UMZA 1G9FA 1DYKA 3D5OA 4P9YA 3UK9A 3O12A 4PBPA 5E8AA 1FNYA 4PCRA 4WVVA 2NZ9A 1KJLA 3M3QA 1MS5A 2DURA 3ZYRA 5IK8A 4GWMA 2R1BA 1LGBA 2D6PA 4R9DA 3AYDA 1DLLA 2XG3A 1W6MA 2P3KA 1CQ9A 1SLBA 2B7YA 2R0HA 1QF3A 1SLIA 2UWBA 1ENRA 1MS8A 3NWKA 3WHTA 4YZ4A 3ZXLA 4BLIA 4YM3A 1QDOA 2DV9A 1LJ7A 3FFZA 2GNTA 1VLNA 3ILRA 4XHXA 2A6WA 1QU0A 3BODA 4XILA 3M2MA 4XTPA 4DPNA 4FPFA 1C1LA 2E53A 1UKGA 3N35A 4K1ZA 1LOFC 2ARXA 2ERFA 1CESA 1AZDA 2WQZC 4WZFA 5T5LA 1VAMA 1IS6A 3U4XA 4UW3A 2DTYA 2D6MA 2AENA 1YO8A 1FV2A 4BLJA 3B69A 1DFQA 1WW6A 2CY6A 2OW4A 2PHTA 4YW5A 2ARBA 1A78A 1CVNA 2V73A 2ZGUA 2ZAAA 4Y22A 4AVSA 5IK7A 3LSDA 3RMXA 2D6LX 3OPZA 1QGLA 4FPOB 1W6MB 1I1EA 1S0GA 3ZSJA 5DUVA 3VKLA 2DVDA 1LHVA 4LBQB 2R1DA 1QOTA 1PZ7A 2JE9A 4FP2A 4W65A 5JDBA 2GMPA 2ZGTA 2R16A 4JRAA 1FX5A 4MYEA 2ZGQA 1HQLA 4AVVA 3APBA 1KITA 2YMZA 4XZPA 1JYIA 1IKQA 4P9WA 3ZXEA 1JW6A 5HCAA 4LBOA 5DZGA 1SBFA 2WLQA 3M3CA 4Q26A 4XBNA 1OKQA 1LTEA 3AZVA 3SH3A 3B00A 4AYUA 1BKZA 3BIWE 4FOVA 1S0BA 2JECA 4D69A 1G8WA 4Y22B 1A3KA 3KQRA 4YG0A 3HMYA 2PHUA 4Q8KA 3IN9A 3IMNA 3WLUA 1LHWA 4NOTA 1S0JA 1N47A 1V6OA 1V00A 4C1XA 1F9KA 2KM2A 2EXJA 2DU1A 2YROA 3AJYA 3IPVA 4Q1RA 4ZKTB 1GYKA 1H30A 1O4ZA 3B9CA 4I30A 4YG6A 3T1LA 2ZHKA 2P3JA 2VU9A 1GV9A 4ATEA 3LSEA 1CIWA 1KQRA 1AX2A 1FATA 2GNMA 4M00A 4YM1A 1Y7BA 1JUIA 1LESA 1MACA 1N1TA 2AGSA 3M3OA 5HCFA 1S0EA 5IUQA 1G7YA 4SLIA 2DTWA 4BM8A 1N3QA 1H9PA 4M3CA 2NMNA 1DHKB 1V6LA 1KJRA 1MS4A 4K21A 5DG2A 2DUQA 3MW3A 3RRDA 1WBLA 3WOGA 3ZSKA 1DZQA 4GKXA 3JU9A 4XE9A 4FQZA 3WUCA 1WLWA 4YW1A 3R05A 5F5QA 1AX1A 3V0BA 2EXIA 4HANA 1QOSA 2ZHMA 1GICA 3AXEA 4AWDA 1Q8SA 3RSJA 3IPVB 3WNXA 1RITA 2PHRA 1G9CA 3BOPA 3WVJA 4YZ5A 4YW3A 5H9QA 3M1HA 4FP3A 1GBGA 4YFWA 5IK4A 5GALA 3WUDA 1CR7A 4AGGA 1BJQA 1H9WA 4PQ9A 4U2AA 1CPNA 1ONAA 2GN3A 1VIWB 1CONA 4XJZA 3UJOA 2ZACA 5EYYA 1FYUA 3N7KA 1DQ5A 1NXD1 1APNA 2DVGA 2PELA 4K20A 5CA6A 4NO4A 3O0WA 3D4KA 1ENSA 1JBCA 2A7AA 3WZ1A 1Z78A 1WW7A 1LOBA 2EXHA 2G4IA 2UWAA 4M3CB 2UU8A 2GALA 5H9SA 3SITA 4BOWA 1GZCA 2CYFA 2DVBA 3B3QE 3H0OA 3POWA 1JXNA 5JMCA 4RL7A 1OQ1A 3OY8A 1HLCA 1LHNA 2E7QA 4Z8BA 4U36A 5JOWA 4YGEA 1WW5A 1LENA 1DGLA 2WSUA 1DQ4A 4XBQA 3V0BB 2AYHA 5E89A 1WD4A 1ENQA 3C2UA 1WLDA 5KXEA 1X50A 3AP4A 2LALA 2VW2A 3T1MA 3NV2A 3AP9A 4YM0A 2A5ZA 2DU0A 5IT6A 1V6NA 3ZYPA 2BQPA 2VY0A 3RG0A 3ASIA 5BYNA 1Q8QA 1HKDA 1MZ5A 4TZDA
chains in the Genus database with same CATH superfamily
4K7JA 5DZEA 2ZEXA 4A41A 2XXZA 4AEDB 1E57A 1WCSA 3POYA 4QGMA 1ZZ6A 2YG0A 1KFXL 1H4GA 4XFAA 3T2TA 5D2AA 4IEPA 3VBRA 3K3OA 2A3WA 3W58A 3JD72 4XF0A 4QX2A 2BERA 1L7RA 2IXKA 4CDUC 2ET7A 4OLLA 4W6YA 1OA4A 1UAIA 3X29B 2CGNA 3S57A 2A3YA 1VBA2 4UFMA 1W8NA 2B5HA 2JWPA 5K7PA 3DYOA 3SEEA 1H8TB 3J4UH 4HFSA 2XBO3 2WFPA 1PGL1 1EPWA 1MS9A 2J1UA 4JKMA 5FP9A 3TB0A 4AVTA 5F9TA 5FTTC 1D4M1 3LD8A 3HOBA 5M0TA 5KXDA 3AZYA 1HRV2 5F8PA 3OPTA 5FLJA 1JHJA 4QHOA 4ARYA 2QQUA 4FPYA 1YCIA 5K0UA 4TLGA 1C4RA 5LA2A 2WN2A 4SBVA 2DCZA 5CG8A 1U0AA 3OB8A 3BYWA 4PHZA 1JZ5A 1E5IA 4Z2WA 2GC1A 1IS5A 3MW2A 3I49A 3WD5A 5GKAC 1AXZA 2BNOA 2Y6JA 4CZSA 2W68A 1STMA 3HWJA 5LK5A 3ZXGA 3ZYJB 1GMMA 2R32A 2RS53 5JR7B 1HB1A 3KB5A 2HYXA 2UY9A 1G9AA 3N36A 1POV3 3ZMOA 1WUVA 1JZ4A 1CAVB 3I2HA 3VBOA 4COYA 5SV5A 3AFKA 1RMU3 3HN3A 3NAPC 4FPHA 3ZSLA 1SZBA 2BYVE 1OHFA 2XJQA 3H8UA 1S0CA 3ZXDA 4XXAA 4I0WB 4QPWA 1ULFA 4YYOA 3HT2A 2ZZQA 1NE4A 4NROA 5EYXA 3B93A 1J1LA 3JBG3 3BTAA 2BPA2 1LOFA 1QJZA 1RXGA 1H6YA 4GZ9A 4BQ1A 5CKNA 3ZVXA 1DYPA 4LE3A 3CHXA 2ZJCA 4MADA 4LOTA 3O14A 3WINE 1HRI3 1LEDA 1RHI1 4FTEA 1BMV2 5CAZA 2IVIB 2XWBB 4CCKA 1UZZA 3BKZA 3FLPA 4LO8A 3OG2A 4IL7A 4FPJA 4YVWC 1OH4A 2D6KA 4RFT0 1BEV3 2G1MA 1JU3A 4P00B 2VGDA 2VCMA 3RYPA 5CB7A 2VMHA 2JIJA 2SLIA 4BYYA 5JOZA 3AVSA 1H4HA 1K5MB 3WCSA 4AFCA 1HN0A 4Z07A 2XMLA 5FZCA 4XJWA 5B2GB 3NSTA 4UT5A 5FPXA 1PO23 1PO12 4AK3A 4BQYA 3HQUA 2QQJA 3GF6A 4ZXKA 2XVGA 4CDQB 5IVCA 3FBYA 4IQPA 4HG6B 4R52A 1W03A 2XJSA 4PF5A 3O0XA 3ENRA 4IDZA 4LE4A 3ZO0B 4NHMA 5LY2A 1V6JA 4GXLA 3CJIA 1YIPA 5T55A 2NP0A 5J96B 3D82A 3Q9OA 4XACA 2LW8A 4YW4A 3HEIA 1QIQA 3B01A 5LRRA 5T54A 1Q43A 1X8MA 5HCAA 1ULEA 3KCCA 5A6YA 1L3JA 1VRH3 2PHXA 2WABA 3FE5A 4WV8A 2E7AA 2HKXA 3LFIA 1QNYA 2HBUA 3PVEA 5GM0A 5I0DA 2JG9A 1W0OA 2XJTA 4QAWA 5F32A 4V1PA 4B7KA 2X53S 3ZOIA 3O1UA 1S0DA 3ZDSA 4W4ZA 1CX1A 1AYM3 2VOTA 4QB6A 3RZJA 1R082 4DZGA 2WJSA 4YSFA 3VD5A 2Z42A 4Y1YA 3AP6A 3U37A 4B4QA 4AI3A 3RJRA 2HWC3 3ES4A 3NNLA 4COWA 2RV9A 3KVBA 2VBPA 3ORJA 4FFIA 2WS93 4LKSA 3VBSA 3VKOA 3EXUA 2QJVA 5FY7A 2BVVA 2BWCA 2JICA 2RM22 3J7HA 2E63A 1WLTA 3FZ3A 4JGZC 2HYKA 5LW9A 3ZFGB 3SKJE 1WA6X 3H1YA 3LDRA 3HBZA 1LOCA 3HR9A 3ZXJA 2OUJA 5IHRA 2ZEZA 2GN7A 2AC1A 3WNPA 2Q8OA 1YFYA 2VQAA 3ZLIA 2O8OA 2P3YA 1V9U3 3MF9A 2NLRA 3D6EA 2DVAA 1JHNA 3PL0A 4HN1A 1AR82 1OF3A 3LA3A 1W2OA 1LB2A 3H8XA 1OPOA 4BQ4A 1RUJ2 2RS12 1X36A 5F37A 4LBQA 4MH0E 3WHUA 3TWIA 2X10A 1Y9QA 4E9KA 3ALQA 4FOQA 3N7MA 2Y33A 1UU5A 4ZZ8A 5JXIA 4D8MA 1WGPA 4CP9A 1XU2A 1E5RA 4WVZA 3PMSA 3OCPA 3H9AA 4KG8A 1UL9A 3P5BA 4XJ9A 4URTA 2OKXA 2RS51 3LQCA 2Z2SB 3JB8A 3KT7A 3OTFA 2VZ1A 1LCLA 2O0OA 5D8AB 3AJZA 4BU2A 5T52A 1O3TA 1XB9A 1LHUA 1YJKA 5FUIA 5FQ0A 1XU1A 4HPKA 1Q8PA 1R083 1ALYA 1RL3A 2R30A 2P5BA 2LROA 2JG8C 4I0BA 4ZXEA 1W05A 3RQ0A 2PLV2 4BWOA 5CU1A 4ISRA 1V6KA 3EMRA 3ZYGA 4QQHA 2QKDA 1ZBA3 4RFRB 3WDVA 5KHHA 3P3NA 2VZQA 5HCHA 3R0RA 1HRI1 1AVBA 1WCDJ 5T5PA 5HBAA 4GULA 5ISLA 2JDHA 4WVMB 3J8F2 3KHBA 1Q56A 4D6SA 4CDWA 2WUHA 4FPEA 4GH4B 3KGLA 4XMAA 4M3CF 1TZOA 3VGIA 4QWNA 2CHHA 2YXSA 4OQ9A 3WDYA 2OT7A 1UIJA 1VBD3 4GMP1 4ASKA 5FYMA 4CDXA 3K3NA 3VN4A 4HT1T 1PO21 3MLLA 2Y26A 1JYXA 2WFF3 1JN2P 4GJZA 1MVEA 4H7MA 1UXXX 2QNKA 3RWNA 3EJKA 2JDYA 1OURA 1OUSA 3HQXA 2JDZA 2YV8A 1NY71 5DUWA 5FZIA 2W08A 4XFFA 4AF9A 4BQ5A 2V09A 1UYYA 2QZ3A 4FO9A 1PMIA 2OS2A 2QQMA 5LCWL 1W6OB 4J1WA 1QJU2 1W6QB 2JB4A 1GQGA 5L7OC 3POIA 1MS0A 2C9AA 3I59A 1UPSA 1ZZBA 4AHWA 1H8TC 3WG2A 1FPN1 1SFPA 1ZA4A 2PXJA 3DYPA 3OBZA 3TRSB 2VZSA 4N9IA 5A7WB 4FTBA 4DEVA 5K8SA 1BVP1 3MIGA 4FPKA 5LBCA 3J26N 3ZN4A 2Q8DA 4R8HA 2WZ8A 1AYM1 2IWGB 1SLAA 5FZDA 4UW4A 4Y20B 1CD3G 1SLLA 3ZYHA 2V72A 4XEZA 5JVVA 2QQLA 4K1YA 1X7NA 2CWSA 2Y6KA 1UWWA 5F3EA 4XZUG 4DUXA 3DEMA 1B35C 1UOFA 4OZXA 4MO3M 1W6NB 3N9QA 4XDQA 4IERA 4BA6A 3S5QA 3BGAA 4HOOA 3VKMA 3IMMA 5CNAA 5FY8A 4L8QA 4E4HA 5FMDA 2ZGOA 4GQ7A 1UO9A 3WDWA 3FHAA 1EPZA 1HQWA 2RS31 2FBEA 4QQPA 2CSGA 4QPYA 1XNAA 1PVXA 3THPA 2VVEA 2ZZJA 3CZUA 3KV4A 4C1WA 4IXLA 1SLTA 2SBAA 4R9BA 4IEUA 4NRMA 1UOJA 3JQWA 1QJX2 1UMHA 4LA3A 4XW3A 2P34A 2ZGPA 1C57A 3NJZA 2CWMA 3WW2A 5KXBA 1IPSA 1CGPA 1XSQA 4OUEA 2XLFA 3J9SA 3O12A 1WCKA 4N53C 5E8AA 2XUMA 5A3UA 4AW7A 3HVDA 1LAJA 1JH5A 1ZYBA 2PTMA 2Y0IA 5ABJB 4ZZ5A 2CU5A 4K9SA 5IK8A 4GWMA 1VBB2 5L36A 3GZAA 4JGYC 3N9OA 1W6MA 3E5XA 1FMD1 1EYBA 2RR11 2BOIA 2UWBA 5J98B 3WHTA 5AC93 4QX1A 1GZTA 2DV9A 2YDEA 3FFZA 5FIXA 4XHXA 2C26A 2RMU1 4RSUA 4XTPA 3VZKA 4Q4W3 1IHMA 3RFRA 4FPFA 1C1LA 1UKGA 3N35A 2ERFA 2WQZC 1AZDA 1RVF2 1UD1A 5AFBA 5A6ZA 3U4XA 4UW3A 3OGVA 2DTYA 4UOJA 3CJXA 3O1PA 2FQPA 1PMHX 4CEYA 4BLJA 1FV2A 4NPLA 3N9PA 2CV6A 1DFQA 1WW6A 1K3IA 4OULA 3HNBM 3SHRA 1OBNA 2GSYA 1HB4A 1A78A 1CVNA 2XJUA 5FJKA 2JB8A 2ZAAA 1D4VB 5BPXA 1GWMA 3I2IA 5DQ0A 4NIIA 1R091 3C7HA 4FPOB 4QQLA 3GGLA 2BVBA 3LPGA 5L9RA 3WSOA 5FXWA 5BNQA 2RDQA 1W99A 4LOSA 3F95A 4XC9A 4I3PA 2F4PA 4JRAA 5HXMA 4MYEA 3WNKA 4AVVA 1K12A 1U5YA 4NIAA 4BH9A 1DGRA 2VL4A 4M4PA 4IEVA 4YVSB 3GM8A 1ULPA 2PQSA 2WZR1 3MLKA 4IEOA 4Q4X2 4AQ6A 1FOD3 5FO8B 1AHSA 5IVVA 1H2NA 1V0AA 2AZ5A 2WLQA 1W9YA 3ZFGC 1OLME 1LTEA 4AQTA 1COV1 3SH3A 4WM8B 1K5MA 2Q8EA 3O1OA 2JECA 3POGA 2ZEYA 2HLEA 1XE0A 2J7MA 5FP8A 2GU9A 4YG0A 3W9AA 2JXAA 4AOCA 5IVEA 2PHUA 4Q4V2 1BBT2 1ZRIA 3DXUA 4Q8KA 1RUD3 1I9RA 2LM3A 3IDEA 1S0JA 3H8OA 4MXWA 1F9KA 1YHFA 3Q8EA 2YROA 3D0SA 2B8MA 3LB9A 1XRUA 4NUBA 5KBFA 5FYIA 2ZXQA 2H6BA 1H30A 3RNSA 3B9CA 2JD9A 2P3JA 2R063 3JCIA 4QKBA 3WQ1A 1RVF3 1VBE3 4C8DA 1NG0A 1YNAA 1F15A 1L7LA 1BHGA 5JZGC 2GNMA 4M00A 4GJYA 4ES9A 3I3QA 4JV4A 1MACA 2AGSA 5IUQA 4BM8A 4COZA 3FC0A 3EO6A 3UNPA 4EN8B 5L9VA 1ZBE2 2VE1A 4M3CA 2NMNA 3TEZA 1KJRA 4K21A 5DG2A 3ZSKA 4CDUB 3C7OA 3T0AA 1PVC2 3JU9A 1VBC2 1CAWA 3RWKX 1RUE1 4FQZA 2XR4A 4XVHA 5EPAA 3T2OA 3WUCA 1BVVA 2EXIA 4XPVA 4AWDA 4URAA 1BK0A 5DMYA 1NUKA 3IPVB 3WNXA 1RITA 3C7EA 3T2QA 1RUF1 5HXVA 3KD4A 4YW3A 5T3NA 3WVJA 3M1HA 3KMHA 4FP3A 1UX7A 5IVJA 2X05A 3U0ZA 5IK4A 2QDNA 4P5HA 1Z7S2 2ZX1A 4N8MA 1JI6A 1OA3A 4ZONA 2ZACA 2WNOA 1FYUA 3N7KA 4M0HA 4RGKA 1NXD1 1W2UA 2D5FA 1H1IA 1VB2A 3VBUA 5B4XA 1DGWA 4Q0SA 1WW7A 5FZMA 4Q4Y3 5H9SA 5J37A 4I02A 4MLOA 5JMCA 4G3YC 4RL7A 4GH4C 4Y4YA 4XDOA 2VUDA 2ORZA 1HLCA 3OD4A 4FCAA 2E7QA 5I0RA 3I3EA 4KWLA 4YGEA 1ND3B 1O5LA 2W47A 2Y38A 4XBQA 3RI8A 3ZXAC 5AC91 4MSVA 2ET1A 3TEXA 5FPAA 3KVAA 4IV3B 1NKGA 3VB9A 1WD4A 3BCWA 2HWB3 4LITA 4RYDA 3NAPB 1YFWA 1WLDA 4CCJA 5KXEA 1BK1A 2XJVA 2J42A 4XF4A 3U4SA 4HK8A 5FZ6A 5CFDA 5FY4A 1V6NA 3ZYPA 3RG0A 3OUHA 4CCCA 1PGL2 2BZDA 3VBFB 1TME1 1QH6A 2FZ2A 1VR3A 4I3GA 1I5ZA 2FDJA 2WA4A 2GP3A 2XB6C 4NE9A 5AVAA 1QJEA 4YVWB 4RS5B 3E6BA 2A75A 5A33A 2K0GA 4AAPA 4BMBA 2H6CA 5D8AA 5F1RA 2PHWA 2VW1A 1RYYA 1Y9MA 1BYHA 2GDFA 3FFQA 4DIQA 4A2UA 1W9SA 1UN1A 4JHTA 5F5CA 4QD2A 3LA7A 4KG0A 4Q29A 4QHZA 4B1MA 3NRUA 4QKDA 2VJXA 3ELNA 5EWSA 5FZHA 1HDKA 2W52A 4OHVA 5F5IA 3HBKA 4FXKB 3MYXA 2EAKA 2X29A 1A6CA 2WZEA 2GC3A 3M3IA 2WRAA 4EWEA 1PGSA 3THDA 1FOD1 2QE3A 3U07A 1DGRN 2KR2A 3H1WA 1F4HA 3OF1A 3FUQA 4PLNA 4LBKA 5CISA 2WAOA 1ZZ8A 3ACIA 3A23A 4N43B 4Y33A 4CXYA 3H3ZA 5CG9A 2HWD2 5A3MA 4P9XA 5DDJ3 2BNMA 3BPZA 2LTNA 2NQYA 3A0NA 4DXRA 2ARCA 3PVNA 3PDQA 4DXZA 4HL0A 4LKFA 4MV2A 4IETA 3ETPA 4CEWA 3WXPA 3VUOA 1RHI2 3VD4A 1UF2C 2K2SA 4YM2A 1MS1A 4UBHA 2YUEA 5KXCA 2IXCA 4KMQA 5BXXA 1LOAA 1F4AA 3C7FA 4RHV3 1W8HA 2ETEA 1ZM1A 4YLZA 2BDRA 4BB3A 4GB33 1DLCA 1EAH3 2E31A 1UY2A 4E2SA 4XOGA 5A32A 5ABJC 5HCBA 3KM5A 3DV8A 3BVCA 2R071 3OPWA 1H0BA 3GYDA 1W3VA 3GZEA 4UW6A 5FZ0A 1POV0 2DCKA 1GFF2 1URXA 3AYEA 2E51A 4NRQA 1IOAA 2MEV3 4JGZB 1G9BA 1SCRA 5T5OA 4UF0B 3KCXA 4HKOA 4O65A 3D8CA 3BB6A 3ZSMA 1PK6A 1US3A 5ACA1 1LECA 2D3SA 3BPSA 2CTVA 4L97A 3TN93 4FBFA 4Y20A 1QMJA 5DXDA 3N3HA 2XKPA 1ODMA 3DF0A 2JJ6A 3OSDA 4XUOA 2PHDA 5HI0A 4Y3OA 4MGZE 3LE0A 4UI9L 2HWE3 4HXCA 3RMYA 5BNPA 2NYYA 5GZCA 1NT0A 3URFA 3MFCA 1DGWX 2PAEA 4CVUA 4CTEA 2VNRA 4XFBA 2W5FA 1O8SA 2A6ZA 2QQNA 4YFZA 5FZ7A 4A4AA 4LO6B 4K6BA 1YFUA 1LHOA 2BJSA 3RYKA 4OCTA 1NCQB 4CYDA 4FOYA 5DAXA 4A7ZA 5CIRA 1DG6A 4Q4Y1 3T09A 4BMEA 1WLCA 1JYCA 1OPMA 1W2AX 2F4LA 2G19A 1OLQA 2WA3A 4KGGA 1NCRA 3MW4A 3USUA 1CPMA 3TNQA 3ZIWA 3V0AB 3H7JA 4Q1PA 2HWF3 4WM7C 2WO2A 5I93A 4HKLA 5FZ1A 2OXBA 3EHKA 4DQAA 3T30A 3I8TA 4N90A 4CRQA 2OZJA 1SPPA 3A4UA 1X33A 4AL9A 1UOGA 1XNKA 2JG8B 5FZEA 2DFCA 5JXGA 4KU7A 1BQPA 1OI6A 1PHMA 1YYNA 4L0PA 3FL7A 4NHKA 1EV13 4WM8C 1ULCA 5IAVA 1ULGA 2P6HA 1ZZ7A 5F3IA 3VDDC 5C7GA 1AYN3 4WZCA 4UW5A 5F7UA 2TEPA 2UYAA 4XF1A 1O7FA 2D3PA 2X5IB 3RGBA 4RQPB 4DO0A 5KHIA 4NJ4A 2WLPA 5LY1A 3Q8AA 4XIKA 5IAXA 1CAUB 1K45A 4LXLA 3ZFFA 4KU8A 3WW1A 1N1YA 2VZ3A 2VZTA 4W50A 1V6MA 3L2YA 5GZGA 3NJYA 1AXYA 1C1FA 4PBOA 1OC1A 1NA1C 1UZ0A 1REFA 3FHQA 2DWRA 3P3PA 4XABA 4AE2A 5A6XA 3MBWA 1S2BA 2O14A 3NJXA 4XUNA 2YYOA 2VAUA 4OI4A 1D7PM 1RXFA 1SACA 2XDVA 5FWJA 2RJLA 4DRRA 4A3XA 5DN2A 5A1LA 1FI2A 2VUJA 1C8M1 3ILFA 5A3WA 3AFGA 3R4UA 2BBVA 5DPNA 4IE0A 1AL23 1N3PA 1OFNA 1VB4A 4TN7A 5EXOA 4LLOA 3N9MA 4HSLA 3NJVA 5L7OB 3D0JA 5C4WB 2ZKLA 4H2AA 2VCCA 1L7QA 1OT5A 4QM9A 2IFWA 3V64A 4FSJA 2C1FA 1OD5A 5F6KA 2A70A 3OEBA 4YVSA 4LKDA 4IV1A 5JXJA 4CCDA 4B1LA 1LULA 3LOBA 1RUG3 4JVAA 2ZKNA 3HNMA 2AH2A 2VNGA 1XBFA 3AM2A 3LEMA 3NNMA 1PIV3 4DY5A 2EIBA 1EAH1 2VUCA 5FXXA 3AL6A 2UY8A 3N7JA 1B35B 4PDWA 2VVDA 4E8CA 1MEC2 2BGCA 5FXZA 3U75A 5FP4A 4K8FA 4M01A 2ADEA 1AR73 3OGGA 4D3WA 4AXOA 1W6PA 1TMF1 1QQP1 1HXS3 5FMCA 2VTXJ 3RZMA 1ND3C 2E32A 2MEV1 4CA9A 5BNNA 4PI2A 5KHKA 1HB3A 4LULA 2JKBA 3CO2A 3LPFA 4KWJA 5C5TA 4IV3C 4XUQA 2KD7A 1RUH2 2FMDA 2O8QA 3GZUC 5FYCA 1NY72 3N9NA 4EWDA 5J48A 3B94A 3IBMA 4F83A 5DAVA 2LRPA 2QUOA 4LNVA 3DPRA 1H6XA 3NV3A 5G05L 3O1RA 4GA9A 1GOFA 3FLRA 4XQ4A 1RUC2 1Y43B 1FPN2 1J59A 3MEPA 3LIGA 3VBFC 1F31A 4B29A 5A3TA 1SDDB 1JZ2A 2BBAA 2E6VA 2GZWA 5E16A 3WR0A 4N53B 4JC1A 1IS3A 4BIOA 4CDUA 2H0VA 2VW0A 3JD73 4RS5C 2GC0A 4XFCA 4Y1UA 5F5AA 3TBDA 2G9GA 4Y4RA 5J36A 3A0KA 4S2DA 5LATA 1VBA3 3BU0A 1B09A 1DU3D 2CL2A 5T5JA 3FN9A 5LBEA 1ZNPA 2YU1A 4JGYB 1ZRCA 1R1ZA 1SDWA 2H0BA 2YC2A 4TTGA 5H9PA 3K46A 2XH6A 2OA2A 3ILNA 3SH4A 4QMAA 2PYTA 2W1QA 1HRV3 2D3RA 5KC6A 3VKFC 3GDBA 2DVFA 3WDTA 2CDPA 5C9AB 3FHIB 4AG4A 2R0FA 4YZ2A 3SNMA 1CZTA 4COUA 3K2OA 4V2VA 1TG7A 2RS32 1AJKA 2BNNA 2VPVA 4KBBA 4AI9A 5I8TA 4DUWA 1RUI2 5C3PA 1UU4A 2KXLA 3QBQA 2FMYA 1UPIA 5ANQA 3OBRA 1W8TA 4N43C 4QB2A 5FREA 3WNNA 1ND2B 2OQ6A 5BNOB 1TNRA 3GJBA 4JCKA 4UXAA 1W0NA 4Y26A 4PIXA 3OUJA 5B4NA 2OVUA 2QQOA 4AFMA 2P2KA 5FAXA 3OYWB 3OBTA 1BXHA 2VUAA 1RUH3 3MF6A 3NAPA 2FHRA 4O9GA 3WQBA 1ULDA 3OJBA 4D7YA 5D21A 2VH9A 2BW8A 3C3VA 4YG3A 2D43A 1VP6A 4L9BA 1N3OA 2BFUS 4LA2A 2OUHA 5CFCB 1OVSA 1J3QA 2MNGA 4HBNA 4ASLA 5BV6A 4CDQC 4EE2A 4YZ1A 1VAVA 2RR12 1GZWB 1YQ5A 4FQ4A 1ASJ2 3R6SA 4YVWA 4AI8A 5GZDA 4CUCA 1YIFA 2RMU2 4XBLA 1WBFA 1IGOA 1CZSA 1AL21 3AP7A 2CAVA 1GANA 5FDBA 1G9FA 3KZ4C 2W87A 2XKOA 3AKPA 1ZA7A 2DF7A 3E97A 4MHUA 5FO7B 5I0SA 1UIKA 2XBO1 1K42A 1AR62 3ZYRA 1PO13 3NMBA 2VMEA 3ZYBA 4FAHA 4AR2A 2D6PA 2VCAA 4R9DA 5LBFA 3AYDA 1QXRA 2P3KA 2IZWA 4XUTA 1PGW1 1SLIA 1ENRA 3NWKA 4OHZA 1OLRA 1R092 1LJ7A 1H1AA 2GNTA 3AMPA 5LASA 3BODA 4G9SB 5JZGB 1PIV1 4DPNA 2VM9A 4UAPA 1NCQC 1Q5OA 2E53A 4TWTA 4WZFA 4OI1A 4JKKA 3HQRA 5T5LA 3VBHB 4LK7A 1VAMA 1XNDA 3O7OA 3T4VA 1W04A 1WMFA 3DXTA 2ZOEB 2AENA 3NQHA 4C0HA 1XE8A 1FT9A 4Q0QA 5I0TA 2VZUA 2VCBA 1POV1 1OSGA 1VPHA 2CY6A 2WZR2 1XYPA 2IXLA 4I01A 4E4DX 2V73A 3IDBB 1QY4A 1RMU1 2ADDA 3LSDA 1PX4A 1COV2 2D6LX 2R042 3OPZA 4EV0A 4IW3A 4XCAA 1I1EA 2WWUA 4MXVA 3VKLA 3ZN6B 1IZ3A 1I5PA 3JBG1 2DVDA 5A3OA 1LHVA 4NHYA 4B3NA 2OYZA 3MIHA 1J83A 1PZ7A 1QOTA 3CBNA 4FP2A 1OF4A 2VOVA 4EN0A 5FY9A 4KWUA 2ZGTA 3NO8A 2J1RA 4N7IA 4JGZA 2RM23 1ASJ3 2X5IC 2ZGQA 1AR92 4Q0VA 1KITA 4QPGC 4RQPC 1CZVA 4RR3B 4UF0A 4MHRA 4XZPA 1ZZCA 3JD71 1IKQA 1BEV1 2PHLA 3ABZA 3ZXEA 3POFA 5JAXA 5DABA 4BQXA 5JCTA 4LBOA 5JWPA 1SG3A 5DZGA 3LF7A 1OKOA 4Q26A 3S7IA 5I91A 3PIGA 3B00A 1JOPA 3BIWE 4FOVA 1S0BA 4D69A 1AR83 3GCXA 4Y22B 1A3KA 1QH7A 1NE6A 2W91A 1YLLA 3MFAA 2K9ZA 4QX5A 3O1TA 1RUJ3 3IN9A 2RS13 3IMNA 4J25A 5FMBA 4HVQA 2CGOA 4NOTA 4IESA 3NW4A 1SFNA 4FFFA 2W9XA 1JU4A 1C3HA 1V00A 4LIUA 3ON7A 4Q1RA 1RUE2 1ST8A 1O4ZA 5F6LB 2JDMA 3T1LA 2G9ZA 4I30A 2ZHKA 4XURA 4IEXA 1R1A2 2ORXA 2VU9A 2WL1A 3I2GA 1GV9A 1VRH1 2ZPXA 3LZZA 1RUF2 3CLPA 4L11A 4QXKA 4ATEA 5C4WC 5C8CB 1CIWA 1KQRA 1MQTB 3ZFEB 5CYYA 1DCSA 4MGYE 1IG0A 1LESA 1N1TA 4CPBA 5HCFA 4SLIA 3RZZA 3NVCA 3UGHA 4B4PA 1NZCA 1H9PA 3KS7A 3ZYFA 1DHKB 1MS4A 2XJPA 4OMCA 1NYWA 4Z92B 4OHYA 3BTXA 1WBLA 2EIDA 2JG8A 4GKXA 3ACLA 4B8EA 4UFLA 2W1SA 3UV9A 4KGQA 3UKVA 2PLV3 3R4DB 3PU3A 1YQCA 5IVBA 1VAKA 5F5QA 3V0BA 4C91A 2HWC1 5FWEA 4HANA 1QOSA 2ZHMA 4LUKA 2WS91 1U5IA 1BMV1 3HNYM 1GBGA 3L2HA 4YFWA 1CAXB 3TNPB 3J8F3 3LDKA 1BJQA 4AZZA 2GN3A 4P08A 4H3WA 3LA2A 1RJ8A 5EYYA 2I74A 1APNA 4QM8A 2PELA 5CA6A 4NO4A 3Q8BA 4J1XA 1GOGA 2FDIA 3D4KA 2A7AA 1JBCA 3WZ1A 2UWAA 1V9U1 3GHMA 2VVFA 5DAWA 4NPMA 2GALA 5FYVA 2CYFA 2DVBA 1TME2 1PO11 3H0OA 3POWA 1JXNA 3GJAA 4LHNA 4AEDA 2HEYF 3POJA 3WQ0A 2FDGA 3AKQA 2Y34A 4Z8BA 5A80A 4ONUA 1VJ2A 2AYHA 5E89A 1KFUL 2ZS6B 2WIIB 1SMVA 3KSCA 4E8DA 5KWRA 3VL8A 1QJU3 5L7OA 2TBVA 2LALA 2VNVA 1H8TA 1JZ6A 3ZKUA 4MGIE 5LA0A 3Q8CA 4NPRA 2VMFA 2OIIA 3KLSA 4AI2A 2VY0A 4XCBA 1UKRA 1UOBA 2B9VA 2W46A 4M4RA 2QDRA 1Q8QA 1HKDA 5IJRA 1LOBA 4TSVA 2XQXA 3UGGA 4BK4A 5FKCA 2ZGKA 3LIHA 5C9AC 3H3LA 1BZWA 2LUWA 3FWEA 4D6QA 4LBNA 5FLHA 1R081 3OY8B 2A1XA 4NWWA 2PAKA 4QXCA 3SC7X 1SEFA 1B35A 1D2SA 4X8PA 3GNEA 1WKYA 2OPKA 3DN7A 5IW0A 2HH9A 4H55A 1WCUA 2V4AA 3KGZA 3OD0A 4P02B 3CF6E 5BNOC 1ND2C 3OBAA 1C5IA 4GWIA 1HX6A 1ZBA1 4A42A 2C5DA 1JTZX 2D7FA 4OUMA 3VHRA 2WNVB 1EP0A 3E5UA 5GLTA 2RM21 3PUIA 3IAQA 3LAGA 1CAVA 3KV6A 2WKKA 3RZGA 3WG1A 2JEMA 2I2SA 5C3QA 3CQOA 1VMJA 4BQWA 4JTOA 5CFDB 4WM7B 2ZBJA 3UYJA 3K75B 1VBD1 3CNAA 3ACHA 2R072 5FYZA 3VL9A 1QJX3 1U5XA 2JD4A 1AR81 1DQ2A 4YARA 4JTNA 5CFCC 2WFF1 3NV4A 4UYBA 1UY0A 1PM7A 2RS11 3I97A 4N53A 2WO3A 3N7LA 4KNCA 4AFBA 4XAEA 2EVXA 1YWKA 3TYJA 3IWZA 4P9LA 4CP2A 4XETA 2VZPA 4XJAA 1VBB3 3D3AA 3VDDB 4JGYA 4JX0A 4QPIC 4UFHA 4DXSA 3H8RA 1LU1A 4LMFA 3ZR5A 2B4KA 4L92A 5DG1A 3USSA 4DEQA 2A6VA 2BUKA 2TNFA 5CKQA 4BE3A 1NQJA 2EAAA 5A7NA 5HPOA 1FAYA 1GKBA 4TYSA 5IVFA 5FBJA 4JDMA 3IM0A 5J3UA 2QQIA 3KF3A 4E2GA 4CXWA 2K46A 1NA1B 5DZFA 2Z4FA 1LU2A 4NAOA 3EYPA 3GALA 1G9DA 1YEWA 5IFTA 2PLV1 3NKTA 4XFIA 2D5HA 5DUUA 3PUAA 3VBHC 2WSVA 1MVQA 4OMDA 4OYUA 2C6SA 4GWNA 3OUIA 4NVPA 5IFPA 4JDOA 3VD3A 4YGCA 3BU7A 2JX9A 1A8MA 2RVAA 3I7DA 1QHDA 5CBLA 2DUPA 5JSPA 1OOPC 2XJRA 3H1MA 4BQ3A 2NM1A 3PUSA 5JUVA 1O91A 4YGDA 2ZGRA 4MGTA 1W9WA 5JXHA 5J09A 1PNGA 3GHNA 3KHCA 2QQVA 2ZX2A 3UESA 1ZVFA 3IKWA 3OEAA 4HLTA 4UFKA 2YGLA 3MV01 1YI7A 2ZGMA 5I8SA 1GZWA 4I2OA 4Q4X3 3DYMA 4GKYA 4IUGA 1JYVA 3ACGA 4RR3C 5ERLA 3AP5A 4W8JA 1NZIA 2W1WA 3ZFGA 4RA0A 2P17A 4FI9A 4CE8A 1JUHA 5EZWA 5LA9A 5BUVA 1KDMA 1QJU1 4ZU7A 3MV11 1QJY2 2RE9A 2WQ8A 3WG3A 3G7DA 1QEXA 4XMIA 4A44A 2XVKA 4Q4V3 1BBT3 4DFSA 5CZKA 1Z0HA 2B45X 1E5SA 3MGUA 4QDQA 4ZS2A 2WT0A 3GBWA 3AZZA 3KF5A 4W6XA 5KHJA 4CCMA 3W5NA 4E4ZA 3O5SA 1C8M2 1YUDA 4XJUA 1JOBA 1ULOA 1V6IA 2V5YA 3GBFA 3P1IA 3QCWA 4Q4W1 1TQ5A 4W6WA 5FZ8A 5A1FA 2E33A 5JR2A 4D7SA 4DINB 1IQDC 3CJIB 2CGPA 2Y0OA 3BTYA 2ZMNA 1IPJA 1XQNA 2HJIA 1O5UA 4XXPA 3VV1A 5JZGA 3POBA 2RDRA 1JZ3A 5I8YA 2RHPA 3HPNA 2QQWA 2HEWF 3PHMA 3TAYA 1RIRA 3I2FA 3LWCA 1IPKA 2ID4A 1PMJX 1W2TA 4Y5Z0 1D4M2 2BP6A 2JDAA 1ZBE3 5C8CC 2BEOA 1MQTC 2JG9B 3AK0A 1AXKA 4M0NA 3ZFEC 4MX3A 4DY3A 4ITCA 2ZEWA 4ES8A 2VTXA 5T50A 5A3LA 1O4YA 1PVC3 1S4CA 1VBC3 2WQ4A 4AGVA 4BZ4A 3VD9A 1YFXA 5GJ6A 1SBDA 2IUWA 3S7EA 1UYZA 1SHWB 1YRZA 3W59A 2W95A 1PX3A 1OLMA 4FPLA 2VMGA 1HJFA 4C0BA 3HD8B 2ZMKA 3CL1A 3M4FA 3ST7A 2WN3A 3DKWA 4BHPA 1W8OA 5FPBA 3VBSB 4E2QA 4MOAA 1QQP2 1TNFA 1Z7S3 2YBSA 4AGRA 4BQ2A 1ZZ9A 3N4MA 5IWFA 1PM4A 3KCYA 4TZDA 3WDXA 4H14A 4EJRA 3DECA 1W2NA 3IIAA 4WVMA 1O59A 4GWJA 2C4XA 1MR5A 2AUYA 3S6PA 2Q8CA 1UXZA 1SBEA 4CUAA 1J58A 4XQDA 1LOGA 3G6JB 4GH4A 2FD8A 2PHFA 2ZX0A 4BDVB 1UNBA 2R49A 1VBB1 1WCQA 4CXXA 1CJDA 1LGCA 4COVA 3KV5A 1ZRFA 4UWDA 3PUQA 2P4EA 1RUD1 3UJQA 2XWJB 4DNYA 5FLIA 5FZAA 4TLFA 1P8JA 2RG4A 1KRIA 2UURA 2VXJA 1CJPA 1LODA 5IYYA 2R061 3NV1A 1RVF1 1VBE1 1W6OA 3K4DA 4RGAA 3SH5A 1W6QA 2E7TA 4LHKA 5GLVA 3K77A 1UZVA 3VHOA 2VQTA 3MLJA 1V70A 5JI9A 2P37A 4E27A 2B39A 3KV9A 2IC1A 5GLZA 3MPBA 5A7WA 1MS3A 2WNUC 1WWYA 3MPPG 3WNLA 2VOWA 2CNAA 3QD6A 4LO5B 4CU8A 2D6OX 3LOIA 4HPKB 1DBNA 5K9YA 3FLTA 3PVBB 1Y3TA 5FJHA 5EJZB 5FPUA 4AQSA 5KHGA 4LIVA 4EZ4A 4P5YA 1UW8A 1LR5A 1YXWA 4FOWA 5FV3A 3RYRA 2A71A 4Q8LA 5CVRA 3WP5A 2DUOA 5FK7A 2Z5WA 4JQTA 4H7LA 4XIOA 1W6NA 4EYUA 4DB5A 2YBPA 4Q4X1 3MIDA 1W8WA 2KA3A 2WNVC 1WMDA 3SLIA 3V56A 4DOUA 1CAXA 1KD7A 3W5MA 2VQ0A 2GNBA 2YGMA 2P1BA 1H2KA 5C3SA 1CWPA 5BY5A 3LEIA 1PZ8A 4LR4A 4Q27A 4CDWB 2ZA9A 1W8ZA 2BWAA 2BGOA 4R4ZA 2HWD3 3A22A 3BN6A 1AX0A 3T0DA 3WF3A 4CDXB 1YC61 5JLVA 5CFDC 4Q4V1 1H2LA 4AEMA 1OFSA 1W9FA 2ZX4A 3AYAA 3MDPA 4KH9A 1J3RA 1RHI3 3AMQA 4IEZA 5GZFA 3PNAA 3ATGA 1XYOA 5CADA 3FBMA 2HWB1 5LRSA 1JOJA 3S0MA 2Y8KA 1RTVA 3LGRA 3VBRC 4S2HA 5E1RA 4KQ7A 1FV3A 3WF2A 3J7LA 2A3XA 2GNDA 3I3DA 4XHBA 3ZXFA 5ABJA 1A8DA 3BALA 2D97A 4AHXA 4FTSA 5DAQA 4JHZA 3AX4A 4ASMB 2VQUA 2XHKA 2XBO2 1YQ6A 3INAA 2Q0AA 2RJ2A 2CDOA 4ISQA 3L9JT 1UZWA 2YB7A 3WCRA 3DGTA 4QPGB 2X09A 2EIGA 1J1TA 1UZYA 4CCOA 4S2GA 3AXDA 4IE6A 2DCJA 1GWKA 1PGW2 2B9UA 5K0UC 1OVPA 3ZM8A 1NLQA 3MICA 4BCUA 2YU2A 1D0HA 2BFUL 2OPWA 2VC9A 1RJ7A 4A7KA 2Q1ZB 4B4RA 3E6DA 1YQ8A 2ENRA 3TEWA 3ACFA 1ODNA 2NPIA 1VRBA 4OUSA 1HV1A 2XHNA 1UMZA 3D5OA 4P9YA 4D7TA 4PBPA 4EN7B 2L9LA 1FNYA 3JQXA 4WVVA 3EB7A 2W0XA 5FK8A 3AMMA 1JYNA 2RS52 1Z7S1 5K4LA 3NL1A 1LGBA 2JDNA 4JKLA 3RJ2X 1XOYA 4AVAA 1AUYA 1PNFA 4X6RB 2B7YA 1KGYA 1SLBA 1RMU2 2R0HA 3MIBA 3MUY1 3VBOC 1GQHA 3ZXLA 4YM3A 4YZ4A 5FFOC 1ZRRA 3THTA 1QDOA 4Y5TA 4Q5OA 3PUHA 3ILRA 4ET7A 3SQOA 3CEWA 1ENXA 3JBG2 3M2MA 4WM7A 4XILA 1HIXA 4KI5M 5DDJ1 3SEPA 3LFMA 4Y24A 2DDUA 4K1ZA 1LOFC 4GIQA 4CUGA 1WMEA 1IS6A 1HRI2 2DBNA 3UKNA 2D6MA 2PMWB 4ZU4A 4AQ2A 2WWSA 4RHV1 1YO8A 2QVSB 1BEV2 3B69A 2GAUA 4LHLA 2OW4A 4GB31 4YW5A 2V4VA 4WM8A 1ZRDA 1LRHA 3S30A 2ZGUA 1O3SA 3NKGA 1HN1A 4AVSA 5TSWA 3VDDA 5J7MA 5JSOA 3THCA 2F17A 3DL3A 1GP5A 4HN0A 1W6MB 4NR1A 3VHNA 4A3ZA 1S0GA 1PO22 1UYXA 4FT8A 1REEA 3AC0A 5LK7B 4G4FA 2JE9A 5FZOB 5JDBA 4MG2A 2GMPA 2XQRA 2R16A 1KS4A 5LA1A 4O61A 4AI0A 3KQ4B 4OI2A 3RZHA 3APBA 3TN91 4L2NA 4AEJA 1NA1A 3H42B 4A6SA 3CJIC 1XPWA 1CX4A 3PTRB 3VZJA 3JXSA 2Q4SA 4AFDA 2PQQA 4QX3A 4DUVA 3OGJA 2HWE1 1VRH2 4CEYB 2VO5A 2F6BA 1MPXA 2QZ2A 2D40A 1OKQA 3WEZA 4AVBA 4BIFA 3TEYA 4AYUA 2VMIA 1BKZA 3J7NA 4LQRA 2JG9C 4J6GA 5JPMB 1XJAA 1AYM2 3K4AA 4AHZA 1LKNA 1GNYA 1W90A 4X8NA 1N47A 3IT8A 4D6RA 4V2WA 4LK6A 1W9TA 1G6NA 4ZS3A 2WC2A 2DU1A 3IPVA 2HWD1 1W28A 3WF0A 4EWAA 1GYKA 2Q1MA 4PIYA 2HWC2 2VZOA 1SQ4A 2HWF1 2B46X 2WS92 4O9EA 4NRPA 3VBSC 5F2SA 2C24A 1O6UA 3LSEA 4NN0A 1AX2A 4QB1A 1XSRA 1JUIA 1EUUA 1XC6A 3IDAA 1G7YA 2DTWA 2YPJA 1GU3A 4CUBA 4KL1A 4IE4A 2JENA 1V6LA 5ANNA 3MW3A 4CSWA 1MEC3 1EV11 1V9U2 3WX5A 4B7EA 4GMP3 5I0UA 2Y60A 1AYN1 1LNSA 1OQDA 4XE9A 4CU6A 5A3NA 1ND3A 3R05A 1AX1A 1KS5A 4MXWB 2WYFA 4IV3A 3RSJA 3I3MA 3BOPA 3IAPA 5A6QA 3ZPOA 1U5ZA 2VMCA 4XF9A 3WUDA 1CR7A 4QQ2A 4AGGA 1HV0A 2BTVC 4U2AA 2YFZA 1CPNA 1ONAA 1VIWB 2ATFA 5L19A 5IATA 1DQ5A 2DVGA 3SCHA 2BU9A 3VBFA 5JSRA 1RUC3 1X8EA 1FPN3 1FMD2 3ITQA 1ENSA 3O0WA 5FUPA 3T08A 2W92A 4EN9B 2AACA 4M3CB 3SITA 2UU8A 1GZCA 3RVHA 4RS5A 1ZX5A 1VE0A 1OQ1A 4E4SA 3AVRA 1HB2A 1LHNA 1CAWB 4OFGA 2FCTA 2W94A 3WT3A 2R6QA 5JOWA 4PLOA 2GP5A 1WW5A 1LENA 1DGLA 1GR3A 1W3XA 4QPIB 5IVYA 5C3OA 1GWLA 1ENQA 4LO7A 1QJFA 1YI9A 4JZRA 3UKTA 1JYTA 5KC5A 3ZN5A 1C5HA 1A34A 2VG9A 3C2UA 4F7ZA 1X50A 3AP4A 2VW2A 4XAAA 5DAPA 1ZBA2 3A21A 1Y4WA 3AP9A 4LEJA 3JB4C 3N9LA 1M06G 1RUG1 1UY4A 2BQPA 5LWBA 4LJHA 1DF0A 4OHWA 3ASIA 5BYNA 4F3JA 3RPQA 5HV0A 3VBUB 5FYHA 2XPJA 2RS33 4HETA 5FZLA 3VZOA 5C6CA 1ACCA 1LOEA 1RUI3 4HMZA 5LBBA 4AFAA 1IS4A 4YW2A 1J84A 4N43A 4CDWC 3ZDVA 1HJGA 4NIDA 4ZU5A 5JOXA 3BIEA 1VBD2 1VMFA 5FZKA 2VTFA 4CDXC 4IEQA 1AR71 1NLSA 4LBQD 1RINA 2W1UA 1HXS1 2WFF2 1UX6A 4IGQA 1TVGA 4INDA 3MHZA 1OOPB 1OMIA 5JOYA 1YQ2A 1WMXA 2WO7A 3ZYIB 2OX0A 3VD7A 2VULA 5F2WA 3SMHA 1EY2A 3O1MA 3EQEA 2BV4A 2WO1A 4NHXA 2OZ6A 4CDQA 3ZPYA 1FMD3 4IE5A 3POSA 2RR13 5FPVA 1QDCA 3AKSA 5JIAA 3ZIXA 3BTZA 1NX9A 4K3UA 4RGGA 3AKTA 1NLRA 2D44A 3AZXA 3SKVA 2RDNA 2RMU3 2P3IA 5A33B 4ATFA 2O1QA 5SV8A 2ZGSA 1GQPA 5FYBA 1S2KA 2VOKA 2ZMLA 1VBA1 4DRVA 1DQ6A 2VXRA 1JYWA 3DCQA 2FDFA 2QBXA 1JMUB 1SFYA 1U12A 1AR63 1XE7A 3VZMA 3QLQA 3S5AA 3NNJA 4CU7A 5EV7A 1FXZA 1XNCA 1HRV1 2Y6GA 4LLFA 1T6BX 5A7SA 3BOWA 4LTAA 1S0FA 2Q5TA 3J7MA 4MVTA 3LDBA 4Y1VA 5FOBB 3ZKYA 1I6XA 1GOHA 4HSJA 1R093 1O8PA 3M70A 2E26A 3AL5A 2NMOA 2EIEA 1NCQA 3R4SA 4FVVA 3FMGA 3HT1A 4LORA 4QU1A 5A7QA 1KEXA 4R4XA 4AAXA 4K8RB 4XYXA 2VMDA 5FBZA 3VHPA 1MEC1 2XVLA 3V0AA 2NN8A 2GMMA 4P9GA 3NNFA 4Q2FA 1S0IA 1S55A 3JUUA 3QH6A 4XFGA 2WZR3 4ZY9A 3WQ7A 4AEDC 4CEWB 3T4HB 2YPDA 2EICA 2WZPP 1OUXA 3H7YA 3GZTB 4FPGA 4YRDA 1UYPA 1RUH1 3SXWA 4A6OA 2AREA 4JRLA 4XQWA 3U78A 5AFEA 1COV3 2R043 3O0VA 4AI1A 3HIFA 1QOOA 1NQDA 1WZXA 2ZTNA 5A32B 1LGNA 2AR6A 2J1EA 4CPBD 2GMEA 2QFEA 2EALA 2YZ4A 3VLBB 1RUC1 4YW7A 4FPCA 4IGOA 3VZLA 2X5IA 3T2PA 2QCSB 3H3UA 4QPGA 4RQPA 5AC92 2V5DA 1AR93 4QXHA 4ARXA 2QQKA 2XONA 3PMEA 1D0GA 1CAUA 4FFHA 1PK6B 3AYCA 4N7UA 1UU6A 4Q4W2 5F3GA 2X8KA 2XLGA 1I3HA 3K51A 3RDIA 1HW5A 3FUOA 3KWVA 3CKHA 1IKPA 5JI7A 3ZMNA 5FZ9A 2ES3A 3MZHA 3WDUA 3QACA 4HZFA 3M3EA 1Q8OA 5E6HA 5BNPB 4CEYC 2W3JA 2JDPA 4NMIA 5JMOA 5FY0A 4AVCA 1NXMA 1UY3A 2VBDA 4UFIA 4XDPA 3UT0A 3ME2A 2WT1A 4UFJA 3VDCA 3POEA 3VDAA 1RUE3 1N1SA 3E1F1 4QDRA 5FP7A 2ZAHA 1OD3A 1RUI1 2IXIA 3PURA 4YZ3A 3LEKA 4RD7A 5C4WA 1W39A 3USUB 1R1A3 2BRTA 4FFGA 1NCRB 2YBKA 4UBGA 4BPZA 5H9RA 4M3CE 1E5HA 1RUF3 4PIZA 1OA2A 1OXCA 3PJQA 3IB3A 2BOJA 2W39A 2WNUB 1TE1B 2WYSA 3P6BA 1T6GC 2PN5A 2WT2A 3PU8A 1PZ9A 1Q8VA 4META 1SPPB 2D93A 1FOD2 2N7GA 2A6YA 1D2QA 5LB6A 3EBRA 2D6NA 3RZKA 2IFRA 2J1SA 1F5JA 2E9QA 1GNHA 2Y6FA 2YFUA 4LHSA 5EHDA 1DQ1A 3I2OA 1DQ0A 1UMIA 3KT4A 3HN1A 4HVOA 4TXWA 4D0QA 1AF9A 2ZGLA 4QKNA 1K5MC 1GNZA 2JDUA 2PAMA 1CN1A 1UCXA 2ARAA 1RUD2 3ETQA 2A73B 4JQRA 5A7OA 3F2ZA 2ZABA 4QT6A 3AZWA 3U11A 3WY6A 1ASJ1 1S2EA 5FZFA 1AJOA 5FZOA 4RN5A 5L73A 4IEYA 2IXJA 3ZFFB 2IVJA 4R9AA 4QGNA 2DCYA 2R062 3BI3A 1VBE2 2Z69A 4OZOA 5APAA 5FRAA 5D1IA 5FP3A 4BK5A 5E88A 5LEKA 2ZHNA 1GZ9A 4LBMA 2GH2A 3UL2A 1AR61 4Z82A 4ZHNA 1TME3 4YPJA 3LEGA 4QX8A 3V65A 2ILMA 3B02A 1RUJ1 2VECA 3VBRB 5GZEA 3O1VA 3MIFA 2Y6LA 2XOMA 5ACA2 1XXNA 2BGPA 1K5JA 4NIHA 4O7XA 1MZEA 4PI0A 3U14A 1G86A 3WV6A 4Y5SA 1H1MA 3MIEA 5FYTA 3CZJA 1S1AA 1DIWA 4EQVA 5C71A 4XTMA 1GLHA 3QH7A 1WW4A 2XL7A 2XUEA 3SISA 4OVEA 3VKNA 4CCLA 4IV1B 2QQPA 5K0UB 2QTWB 3Q8FA 2A6XA 4LKEA 1GP4A 5C9AA 5JPNB 5IK5A 1N1VA 3O1SA 2C0ZA 3KT1A 3LCPA 3A7QA 1GSLA 1AL0G 2EF6A 4YW6A 4DXTA 1UY1A 3LKJA 2WAAA 3VBUC 2AEYA 1QNWA 2R041 3PVOA 1VMHA 3IDCB 1X9PA 4Q4Y2 1W0PA 4BXSV 4KWKA 4PDWB 4LBJA 3MO4A 2FCVA 4CP1A 5BNOA 1ND2A 1BLZA 5L9BA 3OGSA 5JIUA 1JS9A 3AB0A 4P14A 4YGBA 1POQA 1W6PB 1RB8G 4WVWA 5BNNB 1KDKA 3OYWA 1AR91 5FY1A 4DS0A 1MZFA 2HWB2 4NHLA 3VBOB 3J8F1 4GALA 4LBLA 2WNEA 5F39A 1H8VA 1YJLA 3WG4A 1F2NA 5FO9B 4CCNA 3DUIA 5FZ4A 2WDBA 3MUZ1 3RI9A 4LO4B 3ZXKA 3AMHA 4AHYA 3VDBA 4QHBA 4XF3A 1VALA 4QX7A 3W20A 4HVRA 3DPRB 3GBGA 5A7PA 5C3RA 3PTYA 4JAAA 1MZ6A 2J1VA 2Y6HA 4OQ8A 1TEIA 2R073 2ZGNA 4WBBA 5CFCA 4Q0UA 2I07B 2YY1A 5FCCA 1O3QA 1GUIA 4R9CA 1QWRA 1SCSA 5FKBA 4JDNA 2PFWA 2XGXA 5EFUA 2VZRA 2Q30A 4GD4A 2FZ1A 1WD3A 3H50A 3JZVA 3U1XA 2DYCA 5ACA3 5D8AC 5CEHA 2ZHLA 1XNBA 2XLAA 4Y1ZA 4QPIA 5GLUA 3WW4A 1GP6A 2HEVF 4P9JA 4Y1XA 1R1A1 5AVPA 4Z2AA 2FDHA 4NWVA 4HK9A 3I4IA 4DMIA 1SLCA 3B7MA 5CKMA 5FZBA 2JE7A 3B9IA 3WW3A 1QKQA 4S2FA 3U10A 2AEZA 5DUXA 5FR3A 5FY5A 2JKXA 2W2IA 5GLWA 5FPLA 5LZ6A 3WF1A 4XJ8A 1JODA 1X82A 1FNZA 3RS6A 3AMNA 3I3BA 1C8NA 4NAMA 2EXKA 2DBIA 3TOJA 1WA4A 2UWCA 1LEMA 2DCTA 3IIIA 4BJ0A 4OI0A 3I2JA 3FJSA 5FZ3A 5LEJA 3AKRA 3VBHA 1F5FA 5DDJ2 4EN6B 5HV4A 4FAGA 3T3YA 2ZX3A 1DYKA 3UK9A 5FXVA 5FYUA 3W21A 4CCEA 4PCRA 5FMOL 4CEWC 1OOPA 2NZ9A 3VZNA 4D94A 2IXHA 1KJLA 3M3QA 1DZRA 1MS5A 4HKWA 4PJYA 2DURA 3E5QA 4RHV2 5EJ1B 3UGFA 4F8AA 2R1BA 4L99A 4Q0PA 4IGPA 4GB32 2XL9A 1EAH2 3ZR6A 1DLLA 2XG3A 4N9HA 5FYSA 1CQ9A 1QXPA 1QF3A 3ZN6A 1MS8A 4BLIA 1T2XA 3ZX7A 3WP6A 1QJX1 1VLNA 2FCUA 4P9IA 2A6WA 1QU0A 1TMF2 2WBKA 3UETA 2B42B 2D98A 4IEWA 1O4TA 2EA7A 2MEV2 4RR3A 3I2DA 2ARXA 2YC0A 1CESA 4LUMA 5A70A 4PLMA 3QOPA 1PK6C 3K4ZA 4MZUA 3TN92 5A1AA 3BUCA 3CDZB 1NAEA 3OOXA 1QJY3 4MGQA 2PHTA 1JZ8A 1DZTA 2ARBA 2HWE2 1UQXA 2OQ7A 1O3RA 2WR9A 4Y22A 2RJKA 3FX3A 5BNPC 3RMXA 5IK7A 1QGLA 3C7GA 4I09A 3M7AA 3PIJA 3ZSJA 1C8M3 5DUVA 2TUNA 3SCGA 3T0BA 4LBQB 2R1DA 4MUVA 4W65A 2VD7A 3M8LA 4A45A 1RUOA 4K40A 1FX5A 3WP3A 1HQLA 2YMZA 1CIYA 2MHFA 4ORFA 4QXBA 2J1AA 4CP9B 1JYIA 1ZREA 4P9WA 5C70A 1NCRC 2PA7A 5C8CA 4QX0A 1J3PA 1JW6A 2HWF2 1MQTA 5C33A 1D4M3 3DKQA 3I54A 1HQNA 3ZFEA 1RGSA 2Q1FA 4OHXA 4EROA 2YC4A 1R64A 1SBFA 4BXFA 4CP0A 3M3CA 1OH3A 4XBNA 4XUPA 5J1XA 3WNOA 3AZVA 3CIHA 2R7EB 5C8WA 1X9TA 4FXGB 5FQ0B 1G8WA 3KQRA 3HMYA 2GC2A 3GCWA 5EIYB 1US2A 3CMGA 3HJRA 3WLUA 1LHWA 4QKFA 1XNTA 4PQQA 1EV12 1V6OA 4NIGA 4C1XA 2KM2A 2EXJA 1AYN2 1Q3EA 3AJYA 1DDLA 1TMF3 1QQP3 2Y64A 4ZKTB 1M4WA 4YG6A 2VNOA 4C90A 2HBTA 2J1TA 1W8FA 2ZCWA 1NOVA 2VZVA 1JZ7A 2I45A 1W8UA 3ZFFC 1FATA 4YM1A 3WP4A 4BISA 1XYNA 1Y7BA 1IG3A 3M3OA 2Z79A 1S0EA 3ZSEA 1N3QA 3SCFA 5EQUA 1BBT1 1EUTA 1H2MA 3PLQA 2VR4A 2DUQA 4YWAA 3RRDA 3WOGA 3C8XA 3ES1A 1DZQA 4PF1A 5EJ3A 3ECQA 3E6CC 3CU7A 3HAGA 2WINB 4CU9A 1WLWA 1W06A 4YW1A 3B5LB 3WF4A 1RUNA 1AL22 1RC6A 3AXEA 1GICA 1Q8SA 2UYBA 5FUNA 1G9CA 2PHRA 4GMP0 4YNIA 1IQAA 3OGRA 5H9QA 4YZ5A 2CAUA 2MPFA 1QXJA 2G9FA 3I59B 3IZOA 3K48A 4LPLA 5GALA 1H9WA 4PQ9A 5FZGA 3RZLA 5FOJB 1CONA 3I2KA 4XJZA 3UJOA 2WNUA 1ZBE1 4K20A 1F35A 4MGKE 4YVSC 2FDKA 3WNMA 1RUG2 2JDKA 2WWJA 4IV1C 1Z78A 2EXHA 2G4IA 4PT6A 1PVC1 4QU2A 5G04L 1VBC1 4EZHA 4BOWA 3B3QE 5FMOS 5FPZA 3OY8A 1PIV2 3NNGA 4I0AA 3PJYA 1DP0A 4MGSA 4U36A 4ZPIA 4HONA 2JE8A 4X6QB 2JIGA 2WSUA 1DQ4A 2VOXA 4PDWC 3V0BB 1KXGA 5A3PA 3MI8A 4QDSA 5C5UA 1C28A 2GH8A 4AEKA 1AR72 4Z1VA 1HXS2 2WNVA 4A7YA 4XFHA 1DYOA 3T1MA 2P6CA 2LS6A 5KR7A 1REDA 2J22A 5FYYA 2RDSA 5BNNC 1F8VA 1BCXA 1OQEA 1Y9GA 4KBZA 3NV2A 2VBBA 2A5ZA 2DU0A 4YM0A 5IT6A 5F3CA 3GXUA 4LT5A 4QGLA 2YHJA 4QQOA 4GAZA 4IE7A 3ROUA 2C9KA 1QJY1 5EP9A 1MZ5A 2DFBA 3DPRC
chains in the Genus database with same CATH topology
4K7JA 5DZEA 4AEDB 1E57A 1WCSA 3POYA 4QGMA 1ZZ6A 4XFAA 1KFXL 1H4GA 3T2TA 3W58A 3WW3A 4IEPA 3VBRA 2A3WA 3JD72 4XF0A 4CDUC 2IXKA 2ET7A 4OLLA 4W6YA 1OA4A 1UAIA 3X29B 2CGNA 2A3YA 1VBA2 2B5HA 5K7PA 1H8TB 3J4UH 4HFSA 2XBO3 2WFPA 1PGL1 1EPWA 1MS9A 5F9TA 3TB0A 4AVTA 5FTTC 1D4M1 5KXDA 3AZYA 1HRV2 5FLJA 4FPYA 1YCIA 5K0UA 1C4RA 4SBVA 2DCZA 5CG8A 1U0AA 4Z2WA 2GC1A 1IS5A 3MW2A 3WD5A 5GKAC 1AXZA 2BNOA 4CZSA 2W68A 3HWJA 5LK5A 3ZXGA 3ZYJB 2R32A 2RS53 5JR7B 3KB5A 2UY9A 1G9AA 3N36A 1POV3 3ZMOA 1WUVA 1CAVB 3VBOA 4COYA 5SV5A 3AFKA 1RMU3 3ZSLA 3NAPC 4FPHA 2BYVE 3ZXDA 1OHFA 2XJQA 3H8UA 1S0CA 4XXAA 4I0WB 1ULFA 4YYOA 3HT2A 2ZZQA 1NE4A 5EYXA 3B93A 1J1LA 3JBG3 3BTAA 2BPA2 1LOFA 1QJZA 4BQ1A 3ZVXA 1DYPA 4LE3A 2ZJCA 3O14A 3WINE 1HRI3 1LEDA 1RHI1 4FTEA 1BMV2 5CAZA 2XWBB 1UZZA 3FLPA 4LO8A 4IL7A 4FPJA 4YVWC 2D6KA 4RFT0 1BEV3 2VGDA 3RYPA 5CB7A 2VMHA 4BYYA 2SLIA 5JOZA 1H4HA 1K5MB 3WCSA 4AFCA 4Z07A 4XJWA 5B2GB 3NSTA 5FPXA 1PO23 1PO12 4AK3A 4ZXKA 3GF6A 2XVGA 3FBYA 4IQPA 4R52A 2XJSA 4PF5A 3O0XA 3ENRA 4LE4A 3ZO0B 4NHMA 1V6JA 4GXLA 3CJIA 1YIPA 5T55A 2NP0A 5J96B 3D82A 3Q9OA 4YW4A 3B01A 5LRRA 5T54A 1Q43A 1X8MA 1ULEA 3KCCA 1L3JA 1VRH3 2PHXA 3FE5A 4WV8A 2E7AA 2HKXA 1QNYA 3PVEA 5GM0A 2JG9A 1W0OA 2XJTA 4V1PA 4B7KA 2X53S 1S0DA 3ZDSA 1AYM3 1R082 4DZGA 2WJSA 4YSFA 2Z42A 4Y1YA 3AP6A 4B4QA 4AI3A 3RJRA 2HWC3 3ES4A 4COWA 3VKOA 2WS93 3VBSA 3EXUA 2QJVA 2BVVA 2BWCA 2JICA 2RM22 2E63A 1WLTA 3FZ3A 4JGZC 2HYKA 3ZFGB 3H1YA 3HBZA 1LOCA 3HR9A 3ZXJA 2OUJA 2GN7A 2Q8OA 1YFYA 2VQAA 2O8OA 1V9U3 3MF9A 2NLRA 3D6EA 2DVAA 1JHNA 4HN1A 1AR82 3LA3A 1LB2A 1OPOA 1RUJ2 2RS12 1X36A 4LBQA 4MH0E 3WHUA 3TWIA 1Y9QA 4E9KA 3ALQA 4FOQA 3N7MA 1UU5A 1WGPA 1XU2A 4WVZA 3PMSA 3OCPA 3H9AA 4KG8A 1UL9A 4XJ9A 4URTA 2RS51 2Z2SB 3JB8A 3KT7A 3OTFA 1LCLA 2O0OA 5D8AB 3AJZA 1O3TA 5T52A 1YJKA 1LHUA 5FQ0A 1XU1A 4HPKA 1Q8PA 1R083 1ALYA 1RL3A 2R30A 2JG8C 4I0BA 3RQ0A 2PLV2 4BWOA 5CU1A 4ISRA 1V6KA 3ZYGA 4QQHA 2QKDA 1ZBA3 3WDVA 5KHHA 3P3NA 3R0RA 1HRI1 1AVBA 1WCDJ 5T5PA 5HBAA 4GULA 4WVMB 3J8F2 1Q56A 4CDWA 4FPEA 4GH4B 3KGLA 4XMAA 4M3CF 3VGIA 2YXSA 4CDXA 3WDYA 1UIJA 1VBD3 4GMP1 3VN4A 4HT1T 1PO21 3MLLA 2Y26A 2WFF3 1JN2P 1MVEA 4H7MA 2QNKA 3RWNA 3EJKA 3HQXA 5J36A 2JDZA 2YV8A 1NY71 5DUWA 4AF9A 2W08A 4XFFA 2V09A 2QZ3A 4FO9A 1PMIA 1W6OB 4J1WA 1QJU2 1W6QB 1GQGA 5L7OC 1MS0A 2C9AA 3I59A 1UPSA 1ZZBA 4AHWA 1H8TC 3WG2A 1FPN1 1ZA4A 3TRSB 4N9IA 4FTBA 5K8SA 1BVP1 3MIGA 4FPKA 3J26N 3ZN4A 4R8HA 1AYM1 2IWGB 1SLAA 4UW4A 4Y20B 1CD3G 1SLLA 4XEZA 5JVVA 4K1YA 1X7NA 2CWSA 1B35C 4OZXA 1W6NB 4XDQA 4IERA 4BA6A 3VKMA 5CNAA 4L8QA 2ZGOA 4GQ7A 3WDWA 1EPZA 1HQWA 2RS31 2FBEA 4QQPA 4QPYA 1PVXA 3THPA 2VVEA 2ZZJA 4C1WA 4IXLA 1SLTA 2SBAA 4R9BA 4IEUA 3JQWA 1QJX2 4LA3A 4XW3A 2P34A 2ZGPA 1C57A 3NJZA 2CWMA 3WW2A 5KXBA 1CGPA 2XLFA 3J9SA 3O12A 1WCKA 4N53C 5E8AA 2XUMA 4AW7A 2Y0IA 1JH5A 1ZYBA 2PTMA 5ABJB 4K9SA 5IK8A 4GWMA 1VBB2 5L36A 3GZAA 4JGYC 1W6MA 3E5XA 1FMD1 1EYBA 2RR11 2UWBA 5J98B 3WHTA 5AC93 2DV9A 2YDEA 3FFZA 4XHXA 2RMU1 4RSUA 4XTPA 3VZKA 4Q4W3 1IHMA 4FPFA 1C1LA 1UKGA 3N35A 2ERFA 2WQZC 1AZDA 1RVF2 1UD1A 5AFBA 3U4XA 4UW3A 2DTYA 3CJXA 2FQPA 4CEYA 4BLJA 1FV2A 2CV6A 1DFQA 1WW6A 4OULA 3SHRA 2GSYA 1A78A 1CVNA 2XJUA 2ZAAA 1D4VB 5BPXA 1R091 4FPOB 4QQLA 2BVBA 5BNQA 4I3PA 2F4PA 4JRAA 4MYEA 4AVVA 1U5YA 4BH9A 1DGRA 4IEVA 4YVSB 3MLKA 2WZR1 4Q4X2 4IEOA 4AQ6A 1FOD3 5FO8B 1AHSA 1H2NA 2WLQA 2AZ5A 3ZFGC 1LTEA 4AQTA 1COV1 3SH3A 4WM8B 1K5MA 2JECA 2GU9A 4YG0A 3W9AA 2JXAA 2PHUA 4Q4V2 1BBT2 4Q8KA 1RUD3 1I9RA 2LM3A 3IDEA 1S0JA 4MXWA 1F9KA 1YHFA 2YROA 3D0SA 2B8MA 3LB9A 1XRUA 5KBFA 2H6BA 1H30A 3RNSA 3B9CA 2R063 2P3JA 3JCIA 3WQ1A 1RVF3 1VBE3 1NG0A 1YNAA 5JZGC 2GNMA 4M00A 4ES9A 4JV4A 1MACA 2AGSA 5IUQA 4BM8A 4COZA 3FC0A 3EO6A 4EN8B 1ZBE2 4M3CA 2NMNA 1KJRA 4K21A 5DG2A 3ZSKA 4CDUB 1PVC2 3JU9A 1VBC2 1CAWA 1RUE1 4FQZA 3WUCA 1BVVA 2EXIA 4XPVA 4AWDA 3IPVB 3WNXA 1RITA 3WVJA 1RUF1 5HXVA 3KD4A 4YW3A 5T3NA 3M1HA 3KMHA 4FP3A 3U0ZA 5IK4A 2QDNA 4P5HA 1Z7S2 2ZX1A 1OA3A 2ZACA 1FYUA 3N7KA 4M0HA 1NXD1 1W2UA 2D5FA 1H1IA 1VB2A 3VBUA 1DGWA 4Q0SA 1WW7A 4Q4Y3 5H9SA 5J37A 4I02A 4MLOA 5JMCA 4G3YC 4RL7A 4GH4C 4Y4YA 3OD4A 1HLCA 4FCAA 2E7QA 5I0RA 4KWLA 4YGEA 1ND3B 1O5LA 2Y38A 3RI8A 4XBQA 3ZXAC 5AC91 4MSVA 2ET1A 4IV3B 1WD4A 3BCWA 2HWB3 3NAPB 1YFWA 1WLDA 5KXEA 1BK1A 2XJVA 4XF4A 4HK8A 1V6NA 3ZYPA 3RG0A 1PGL2 3VBFB 1TME1 1QH6A 2FZ2A 1VR3A 4I3GA 1I5ZA 2WA4A 2XB6C 5AVAA 4YVWB 4RS5B 3E6BA 2A75A 5A33A 2K0GA 4BMBA 2H6CA 5D8AA 5F1RA 2PHWA 2VW1A 1BYHA 2GDFA 3FFQA 4A2UA 1UN1A 4QD2A 3LA7A 4KG0A 4Q29A 5EWSA 3ELNA 1HDKA 2W52A 4OHVA 4FXKB 3MYXA 2EAKA 2X29A 1A6CA 2GC3A 3M3IA 1PGSA 1FOD1 2QE3A 3U07A 1DGRN 3H1WA 3OF1A 3FUQA 4PLNA 4LBKA 1ZZ8A 4N43B 3H3ZA 5CG9A 2HWD2 5A3MA 4P9XA 5DDJ3 2BNMA 3BPZA 2LTNA 2NQYA 3A0NA 3PVNA 4DXZA 4HL0A 4MV2A 4IETA 4CEWA 3WXPA 3VUOA 1RHI2 1UF2C 2K2SA 4YM2A 1MS1A 4UBHA 2YUEA 5KXCA 2IXCA 5BXXA 1LOAA 4RHV3 2ETEA 1ZM1A 4YLZA 4GB33 1EAH3 4E2SA 4XOGA 5A32A 5ABJC 5HCBA 3KM5A 3DV8A 2R071 4CDQB 1H0BA 3GYDA 4UW6A 1POV0 2DCKA 1GFF2 1URXA 3AYEA 2E51A 1IOAA 2MEV3 4JGZB 1G9BA 1SCRA 5T5OA 3KCXA 4HKOA 3D8CA 3BB6A 3ZSMA 1PK6A 5ACA1 1LECA 2D3SA 4L97A 2CTVA 3TN93 4FBFA 4Y20A 1QMJA 5DXDA 3N3HA 2XKPA 3DF0A 2JJ6A 2PHDA 5HI0A 4MGZE 3RMYA 5GZCA 2HWE3 5BNPA 2NYYA 3URFA 3MFCA 1DGWX 2PAEA 4CTEA 2VNRA 4XFBA 2A6ZA 4YFZA 4LO6B 4K6BA 1YFUA 1LHOA 3RYKA 1NCQB 4CYDA 4FOYA 4A7ZA 5CIRA 1DG6A 4Q4Y1 4BMEA 1WLCA 1JYCA 1OPMA 2WA3A 4KGGA 3USUA 1OLQA 3ZIWA 1NCRA 3MW4A 1CPMA 3TNQA 3V0AB 3H7JA 4Q1PA 2HWF3 4WM7C 5I93A 4HKLA 3EHKA 4DQAA 3I8TA 4N90A 4CRQA 2OZJA 3A4UA 1X33A 1XNKA 2JG8B 2DFCA 4KU7A 1BQPA 1OI6A 1PHMA 1YYNA 4NHKA 4WM8C 1EV13 1ULCA 1ULGA 1ZZ7A 3VDDC 1AYN3 4WZCA 4UW5A 2TEPA 2UYAA 4XF1A 1O7FA 2D3PA 2X5IB 4RQPB 5KHIA 2WLPA 4XIKA 1CAUB 3ZFFA 4KU8A 3WW1A 1N1YA 1V6MA 3L2YA 5GZGA 1AXYA 1C1FA 4PBOA 3P3PA 1NA1C 4AE2A 1REFA 2DWRA 1S2BA 2YYOA 4OI4A 1SACA 2RJLA 4DRRA 4A3XA 1FI2A 2VUJA 1C8M1 3ILFA 3AFGA 3R4UA 2BBVA 1AL23 1N3PA 1OFNA 1VB4A 5EXOA 4LLOA 4HSLA 5L7OB 3D0JA 5C4WB 2ZKLA 4QM9A 2IFWA 3V64A 4FSJA 2C1FA 1OD5A 5F6KA 2A70A 4YVSA 4IV1A 3LOBA 1LULA 1RUG3 4JVAA 2ZKNA 2AH2A 2VNGA 3AM2A 1PIV3 4DY5A 1EAH1 2UY8A 3N7JA 1B35B 4PDWA 2VVDA 1MEC2 2BGCA 4K8FA 4M01A 1AR73 3OGGA 4D3WA 4AXOA 1W6PA 1TMF1 1QQP1 1HXS3 1ND3C 2MEV1 5BNNA 5KHKA 4LULA 2JKBA 3CO2A 4KWJA 4IV3C 4EWDA 2O8QA 1RUH2 2FMDA 3GZUC 5J48A 1NY72 3B94A 3IBMA 4F83A 2QUOA 4LNVA 3DPRA 3NV3A 4GA9A 3FLRA 4XQ4A 1RUC2 1Y43B 1FPN2 1J59A 3MEPA 3VBFC 1F31A 2GZWA 2E6VA 5E16A 3WR0A 4N53B 4JC1A 1IS3A 4BIOA 4CDUA 2H0VA 2VW0A 3JD73 4RS5C 2GC0A 4XFCA 4Y1UA 3TBDA 2G9GA 3A0KA 4S2DA 1VBA3 1B09A 1DU3D 2CL2A 5T5JA 1ZNPA 4JGYB 1ZRCA 1R1ZA 1SDWA 2H0BA 5H9PA 2XH6A 2OA2A 3ILNA 3SH4A 4QMAA 2PYTA 1HRV3 2D3RA 5KC6A 3VKFC 2DVFA 3WDTA 5C9AB 3FHIB 4AG4A 2R0FA 4YZ2A 3SNMA 4COUA 5I8TA 2RS32 1AJKA 2BNNA 2VPVA 4KBBA 1RUI2 1UU4A 2KXLA 3QBQA 2FMYA 1UPIA 3OBRA 4N43C 5FREA 5BNOB 1ND2B 1TNRA 4JCKA 4UXAA 4Y26A 4PIXA 2OVUA 4AFMA 2P2KA 5FAXA 3OYWB 3OBTA 1BXHA 2VUAA 1RUH3 3MF6A 3NAPA 2FHRA 4O9GA 1ULDA 3OJBA 4D7YA 2VH9A 2BW8A 3C3VA 4YG3A 2D43A 1VP6A 4L9BA 1N3OA 2BFUS 4LA2A 2OUHA 5CFCB 2MNGA 1J3QA 4HBNA 4ASLA 5BV6A 4CDQC 4YZ1A 1VAVA 2RR12 1GZWB 3R6SA 4FQ4A 1ASJ2 4AI8A 4YVWA 5GZDA 1YIFA 2RMU2 4XBLA 1WBFA 1IGOA 1AL21 3AP7A 2CAVA 1GANA 5FDBA 1G9FA 3KZ4C 2XKOA 3AKPA 2DF7A 3E97A 5I0SA 5FO7B 1UIKA 2XBO1 1AR62 3ZYRA 1PO13 4FAHA 2D6PA 4R9DA 3AYDA 1QXRA 2P3KA 2IZWA 1PGW1 1SLIA 1ENRA 3NWKA 4OHZA 1OLRA 1R092 1LJ7A 1H1AA 2GNTA 3AMPA 3BODA 4G9SB 5JZGB 1PIV1 4DPNA 1NCQC 1Q5OA 2E53A 4TWTA 4WZFA 4OI1A 5T5LA 3VBHB 1VAMA 1XNDA 3O7OA 1WMFA 2ZOEB 2AENA 4C0HA 1FT9A 1XE8A 4Q0QA 5I0TA 2WZR2 1POV1 1OSGA 2CY6A 4I01A 4E4DX 1XYPA 2IXLA 2V73A 3IDBB 1QY4A 1RMU1 3LSDA 1COV2 2D6LX 2R042 3OPZA 4EV0A 1I1EA 4MXVA 3VKLA 3ZN6B 1IZ3A 3JBG1 2DVDA 4B3NA 1LHVA 2OYZA 3MIHA 1PZ7A 1QOTA 4FP2A 4EN0A