1AXZA

Erythrina corallodendron lectin in complex with d-galactose
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
239
structure length
239
Chain Sequence
b'VETISFSFSEFEPGNDNLTLQGAALITQSGVLQLTKINQNGMPAWDSTGRTLYAKPVHIWDMTTGTVASFETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPAQGYGYLGIFNNSKQDNSYQTLGVEFDTFSNPWDPPQVPHIGIDVNSIRSIKTQPFQLDNGQVANVVIKYDASSKILHAVLVYPSSGAIYTIAEIVDVKQVLPEWVDVGLSGATGAQRDAAETHDVYSWSFQASLPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LECTIN
publication title Structures of the Erythrina corallodendron lectin and of its complexes with mono- and disaccharides.
pubmed doi rcsb
molecule tags Lectin
total genus 51
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 1997-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1axzA00
2JD4A 1A78A 3AFKA 3AJYA 1CONA 4YZ2A 3T1MA 3PJQA 2XG3A 4DRVA 1G8WA 1V6LA 1WD3A 1QKQA 2A6VA 5GJ6A 2ZGMA 4XJ9A 3TAYA 2DTWA 3WNXA 1GNHA 2TEPA 4BM8A 5GZDA 4DFSA 3VUOA 4YZ4A 1G9CA 2JJ6A 1O4ZA 1NXD1 4Y1UA 4DRRA 1SLBA 3APBA 1W6NB 1XQNA 5KXCA 1DQ1A 2VW2A 2DWRA 1AJOA 1JYCA 2AH2A 1LOAA 3ATGA 1Z78A 4YG0A 3NV2A 2ZMLA 4FVVA 2ZKNA 1PZ9A 2JE9A 1FV2A 2D3PA 2CY6A 1MS4A 4WVWA 1N1YA 3AXEA 2ZGNA 1LULA 2R16A 4BLIA 1N1VA 4UW3A 1BYHA 3VKLA 4AGRA 1JYIA 4LBJA 4YW5A 1IS3A 1QOTA 1H30A 2AREA 1LHWA 5DZEA 2A6WA 1YIFA 1MS9A 1LOEA 1Q8QA 3WDWA 4YW2A 3WDYA 3SH4A 3D4KA 1S0BA 4FPOB 2AUYA 3M3EA 2P3KA 3L2YA 2NMNA 1GBGA 2GN7A 4WV8A 2DVDA 3N3HA 2A3XA 1A8DA 1UZZA 1W6NA 4XBLA 3RSJA 1WLDA 2DUQA 2DVFA 4Y1YA 3FUOA 2WNEA 1AXYA 1WUVA 3NWKA 5DZFA 3JUUA 1F5FA 1N3OA 2WLQA 1SLLA 1J1TA 4FP3A 4FQ4A 4WZFA 1ZA4A 1GZ9A 3VV1A 4BPZA 2HYKA 4AVTA 2R1DA 4M3CF 2Q5TA 1WBFA 4YZ1A 1VAMA 2NZ9A 2ZACA 3IN9A 3RMXA 5T5PA 3BODA 1LTEA 1Q8OA 1HQLA 2P2KA 3WOGA 3RQ0A 4JC1A 1JHNA 4AWDA 1WLWA 3HN1A 4MYEA 5IUQA 3UJOA 5E88A 1RIRA 2V5YA 3USUA 2OUHA 4GA9A 4BLJA 1SCRA 1UN1A 3B01A 2ZGPA 5IK8A 3VKFC 1URXA 4XJWA 5EXOA 2ZGQA 4ZKTB 3NV1A 4PCRA 5JOZA 1I3HA 2ZGSA 2OVUA 3ZSLA 1DZQA 2P3JA 2WT2A 1B09A 4XBNA 5T5OA 3D5OA 5T54A 3O0WA 3WV6A 3AZZA 5KXDA 1G9DA 3ILNA 1SACA 4FPKA 1WD4A 3D6EA 4YFZA 1S1AA 3AP4A 1LHNA 3WUCA 3WLUA 4U36A 4C1XA 5EYYA 1YYNA 1FNYA 5HCAA 3KQRA 1YI7A 2P37A 1MS0A 1RITA 1KDKA 5DUVA 3V65A 1I1EA 3PVNA 4YM1A 4F83A 4ATEA 1X50A 5JOYA 3AZVA 4XHBA 4DS0A 2ZAAA 1FATA 5GZEA 1DQ5A 3W58A 3ZXJA 1ULCA 4P14A 3N7JA 1QNYA 1WBLA 3AP6A 3ZSKA 2LTNA 5T5JA 2D3SA 1ENQA 4XE9A 1N1SA 1SCSA 5EYXA 1FV3A 2KM2A 2D7FA 3HMYA 1QOSA 4OZXA 5IT6A 5HCFA 1V6NA 1LENA 4YZ5A 2CWMA 2EXKA 1W6QB 2PHXA 1WLCA 3AZWA 3O5SA 3ZXEA 1QDCA 3OJBA 1MR5A 2VY0A 1LGNA 2SBAA 2E7QA 3WHUA 4HANA 3WG4A 4GWMA 4M3CE 4P9WA 5KXBA 4YG6A 1S0CA 3WDVA 1UPSA 1Q56A 1W0PA 1YO8A 2GMEA 3ENRA 3N36A 2EALA 4FPLA 2D6KA 2D6MA 3SH3A 2E53A 1AF9A 2A3YA 2NYYA 2ZGKA 3OY8A 4ISQA 4LBKA 2D6NA 4GKYA 1Q8VA 1IKQA 3ZXLA 5CBLA 1DQ2A 4PBOA 3AYCA 4FOQA 4LBOA 1GSLA 3AYAA 1MS5A 3A0NA 2VXRA 5IK4A 3N7MA 1HLCA 2DV9A 1DGLA 1AVBA 3AJZA 3T2TA 3AK0A 3AYEA 4AVVA 5HCBA 4ISRA 2LALA 4Q8LA 1N47A 1W6QA 2ZMNA 5GM0A 1EPWA 1GNZA 1BJQA 4FOWA 2PHWA 4P9YA 1MVQA 2YZ4A 1LJ7A 1ENSA 5T52A 5T55A 1CN1A 2WQZC 3POWA 2D6PA 4ATFA 5FRAA 1S0EA 4R9DA 2V73A 2WKKA 1AZDA 3IPVB 5CA6A 3NV4A 3M3CA 4XOGA 1SBDA 1LOBA 1QOOA 4P9XA 4FPHA 4Z8BA 2A70A 1F9KA 1BZWA 3ZVXA 2YY1A 3H0OA 2CL2A 4TZDA 3ZXKA 1W6PA 3BOPA 1OKQA 3M3QA 3USUB 1GICA 5GLUA 2UWCA 4FQZA 1DIWA 1LCLA 3I4IA 4U2AA 5JOWA 3VKNA 1SBFA 2W39A 3FBYA 3KM5A 1LODA 3INAA 4Q26A 4UW4A 1LOFC 4FPFA 3BIWE 2ES3A 1KITA 1UZYA 4LBQB 1V6IA 4YZ3A 5F9TA 4FPJA 1CVNA 3B69A 3ZYPA 3POSA 3IPVA 1YRZA 4YW3A 1PZ7A 1Q8PA 4XIKA 3VKMA 1U0AA 2JDZA 1UMZA 2DTYA 1O4YA 1LHOA 3V0BB 3RMYA 1GZWB 1QU0A 1CQ9A 1LGBA 4YGDA 1DLLA 3B9CA 2JE7A 4Q2FA 3WDTA 3ZPYA 1DFQA 2CYFA 5FREA 1R1ZA 2R0FA 2GNDA 1G9BA 2H0BA 2ZHNA 2WSUA 4Y1ZA 1C57A 3ILRA 4PBPA 2P3IA 2GNTA 2ZHKA 3MPPG 4TYSA 1GLHA 4XMAA 5GZGA 1LEMA 2W52A 3WCSA 4PF5A 2EXHA 1HDKA 2DURA 4LBQA 1IOAA 2DVAA 1DYPA 2FMDA 1ULFA 1FAYA 2FHRA 3N7LA 2NN8A 3POYA 5F5QA 3WUDA 3WZ1A 4R9CA 1LGCA 2WT0A 1N3QA 2DU0A 1OQ1A 3U4XA 3LSEA 1SBEA 1LESA 3M2MA 4NO4A 1CESA 2PHTA 4BMBA 4XTPA 1W6MB 2CNAA 4HL0A 1GZWA 1CIWA 4JCKA 1KJRA 3V0BA 1SLIA 3WDXA 5IK7A 1KJLA 2EXIA 5GLVA 4DQAA 4LBQD 2ZGTA 1C1FA 4M3CB 1BKZA 2AYHA 2EF6A 3OY8B 4XIOA 2JECA 3WG3A 3R4UA 2R49A 1N1TA 5JVVA 5T50A 4Y26A 4FPYA 2D3RA 1DQ0A 4XJ8A 1KQRA 1V6KA 1QDOA 2VW0A 2XB6C 2D43A 1GZCA 4YGCA 5EWSA 3T1LA 2ZABA 3OYWA 1V00A 1G7YA 2WT1A 2DVGA 2P34A 4LBLA 3WDUA 2ZGOA 2WSVA 1OFSA 2GN3A 4AGGA 3AXDA 1Z0HA 2B7YA 3AP5A 1W6MA 1CJPA 1PZ8A 3SISA 1YXWA 1RINA 2YROA 5AVAA 1IKPA 3FFZA 1FYUA 2GMPA 4ITCA 3I8TA 4LBMA 1V6MA 1NLSA 4Q27A 3WVJA 4K21A 3N35A 5DZGA 1JBCA 1UAIA 3B3QE 3ILFA 4M3CA 4XBQA 3WG1A 4IQPA 4XMIA 3AX4A 4YM3A 2D44A 4C1WA 4FOYA 4R9AA 1A3KA 2DYCA 2ZGLA 4YGBA 2CWSA 1SFYA 4XDQA 2BQPA 2ZHMA 1LECA 2JKBA 1W6PB 3O0XA 4DPNA 2A6XA 2ZMKA 1VAVA 2EIGA 4XJUA 2A7AA 1QNWA 1DQ6A 1IS4A 1JN2P 4AYUA 4PQ9A 1W6OA 1SLCA 4GALA 3UJQA 3UK9A 5KXEA 1UX6A 1IS5A 4R9BA 1G86A 3AYDA 5DXDA 3V64A 3MW4A 4RA0A 4AVSA 5E8AA 4H55A 1TEIA 1ULEA 4Q8KA 1IS6A 3AP7A 4K1YA 1LOGA 3WCRA 1HQWA 1ZM1A 5GZFA 3VKOA 1FNZA 2W08A 2W68A 4BOWA 5DG2A 1N3PA 3C2UA 3NV3A 2GALA 4XILA 2GDFA 3DUIA 1UKGA 5LK5A 3RG0A 3ZYRA 1WW5A 4XJZA 1HKDA 1WW4A 4WVVA 1S0JA 3V0AB 3RRDA 3AZYA 4YW1A 5JOXA 4K20A 2DUOA 1MZ6A 2C9AA 2NM1A 2UURA 3ASIA 2D6OX 5GZCA 4JRAA 4SLIA 5SV8A 1AX1A 1C4RA 4Q1PA 3UL2A 3OBTA 4FPEA 2EAKA 2E51A 1S0FA 4Y1XA 5GLWA 2PHRA 5H9RA 1APNA 3AZXA 4FOVA 5H9SA 3HR9A 4L8QA 1MVEA 3SH5A 5GLZA 4M01A 1GYKA 2OW4A 4CTEA 2ZA9A 4Y22B 4XTMA 1D0HA 1VIWB 1W0OA 3OPZA 4ZXKA 1CPNA 3M1HA 4GWNA 2CTVA 4XJAA 4YLZA 4XXAA 4YGEA 3V0AA 3LSDA 5DUUA 5JLVA 2G4IA 2R1BA 2AENA 4CZSA 2D6LX 3GALA 1LOFA 2VH9A 3FLPA 2A6YA 1D2SA 4D69A 4XZPA 4Y24A 1MS1A 4YG3A 3GNEA 2PHFA 5CB7A 2GNMA 1VLNA 4I30A 4Q1RA 1ULDA 3W59A 4CRQA 1V6JA 2R0HA 3SITA 3ZSJA 2UWBA 1G9FA 3IKWA 3OYWB 4AGVA 4XXPA 5JMCA 4Y20B 2PELA 3CNAA 3B00A 3QCWA 2VW1A 4YM2A 1H9PA 1LU1A 1JUIA 1ONAA 2E6VA 4YM0A 2OUJA 1LOCA 3BTAA 5DG1A 2AR6A 1VALA 4YW4A 5H9PA 5CNAA 4Y1VA 2EXJA 2A6ZA 4Y22A 3OGGA 1GANA 3A0KA 5IK5A 4BMEA 2GMMA 2VU9A 5CAZA 1MS8A 1DBNA 3R05A 3MW3A 3IM0A 1Y7BA 4YFWA 2WJSA 3PMEA 1WCSA 1SLTA 1S0DA 2UWAA 4LBNA 1AX2A 1FX5A 1MACA 1QMJA 2YV8A 3MW2A 1LU2A 3WG2A 1DYKA 2UU8A 1KDMA 1V6OA 2A75A 2DUPA 1JW6A 2ZZJA 3O0VA 3QLQA 1MS3A 1LHUA 1QGLA 4M00A 5E89A 1GKBA 3TB0A 4Y20A 2A3WA 1F31A 1S0IA 2PHUA 3FUQA 5H9QA 2ERFA 1MZ5A 3Q9OA 4RL7A 1W6OB 3ZXFA 3SNMA 3R4SA 5GLTA 4KBBA 1UL9A 1ENRA 1Q8SA 3A4UA 1DQ4A 2SLIA 3JU9A 3M3OA 5DUWA 3OBRA 2DVBA 5DUXA 1BQPA 5JDBA 2RHPA 3FLRA 4W65A 2VUAA 5L73A 3O12A 1AXKA 2C5DA 3LCPA 2AGSA 4GKXA 1LHVA 3IMNA 1WW6A 1JOJA 1AJKA 2YXSA 2YMZA 3FLTA 1QF3A 2A71A 2ARXA 2GNBA 2Z42A 4UW6A 2DU1A 3ZSMA 1G9AA 1KRIA 3DGTA 1CPMA 3PVOA 4XYXA 4UW5A 1LEDA 2E7TA 2NMOA 4FP2A 1AXZA 1GV9A 2A5ZA 4FPCA 3SLIA 3N7KA 3WHTA 2ENRA 1WW7A 1AX0A 1S0GA 4XHXA 2ZHLA 5T5LA 4ASMB 2ZGRA 1CR7A 2ZBJA 4NOTA 1H9WA 1BXHA 1C1LA 2I2SA 4GXLA 4K1ZA 3AP9A 3MEPA 4BQ1A 1ULGA 1DHKB 2ARBA 3PVEA 4FPGA 3RS6A 2ZGUA 5GALA 5BYNA 1JXNA 1SLAA 2NP0A
chains in the Genus database with same CATH superfamily
4IE5A 1RUD3 3B9IA 1A78A 3M8LA 2W95A 1SDWA 1X9TA 3DXUA 4B4RA 4GJYA 3PJQA 4CCCA 2XG3A 4DRVA 1WCDJ 3Q8FA 1WD3A 1QKQA 4A6OA 3B94A 1YCIA 5EFUA 3ST7A 4XJ9A 1M4WA 2ORZA 4DFSA 2VD7A 1MEC3 3OPTA 4QX0A 4FAGA 5EIYB 1IPKA 1NXD1 1X82A 1TE1B 4K3UA 2DFBA 1WCUA 3SQOA 3DKWA 1W6NB 3O1MA 3KT4A 1XQNA 2JE8A 1YJKA 2VW2A 3ATGA 3OEBA 4AQSA 1Z78A 4QXCA 4DUVA 2D97A 2JE9A 5ABJA 1FV2A 1R082 2LUWA 1J1LA 2EA7A 3KMHA 4XW3A 3VDDC 2VOVA 1MS4A 4X8PA 2OPWA 1S2KA 4IXLA 3AXEA 4EN8B 1QXJA 4M4PA 2HBTA 1VBA1 5FZ0A 4BLIA 1OVPA 5LZ6A 3LEIA 5IAVA 5FDBA 1JZ5A 4YW5A 4CU7A 5FO9B 5CFDB 5C4WC 1BMV2 4TTGA 3FX3A 3VD3A 1LOEA 2VBPA 2TUNA 1OSGA 1IG3A 3D4KA 4K9SA 4DXTA 1ND2B 4Z82A 5A7NA 5A3UA 2QTWB 2NMNA 1GBGA 2IVIB 4L11A 4MGTA 3N3HA 5C8CC 1HN0A 1A8DA 1UZVA 2JXAA 5D8AC 4BQWA 5FY0A 4XBLA 1K5MA 5C9AC 3RSJA 3OG2A 4Y1YA 5CVRA 2WNEA 1AXYA 4LKDA 5DZFA 3VGIA 2AZ5A 4EYUA 3I97A 1N3OA 1XSRA 2JDHA 4FT8A 1ZA4A 4K8FA 2XHNA 2HWE3 2WN2A 2Q8EA 3T08A 4M3CF 3IDCB 2PLV2 3WQ7A 4YZ1A 1VAMA 2NZ9A 3H1WA 1CX1A 4RHV2 5FZ6A 4NWWA 2Y0OA 4LK7A 5F3IA 3ZFGA 1VMFA 4CDXB 2BNMA 3F95A 1UQXA 1VR3A 5FPBA 1W04A 2IXLA 2BWCA 1GMMA 1JYWA 1H8VA 1VBE2 1F4HA 2RVAA 2JG9B 1AL23 3BALA 2VUCA 2RS53 3NL1A 3EHKA 3HN1A 3T30A 2W1SA 2V5YA 5E88A 1VB2A 2OUHA 4A7YA 2W9XA 4BLJA 2QQKA 2D40A 3B01A 5LA1A 4INDA 3VBRB 2W0XA 5K0UA 4AEMA 1JS9A 3IT8A 1DZQA 2KA3A 2P3JA 4MGZE 1B09A 4LLFA 1JU3A 4XETA 5A7PA 2J7MA 5DAWA 1PO11 1W9TA 2WQ4A 4GIQA 5FY8A 3WV6A 4CPBD 5KXDA 2ATFA 4FPKA 2ZJCA 4JGYC 1TME1 2Y6FA 1VE0A 4META 4W4ZA 4IE7A 5EYYA 4QDRA 4GULA 1RUE1 2ETEA 1FNYA 2GSYA 5FZOB 1DP0A 2VOXA 3T4HB 1VBD1 1MS0A 2WDBA 1OVSA 1VAKA 3V65A 1I1EA 3PTYA 3PVNA 1UO9A 1OOPA 3J9SA 2WO3A 4YM1A 1QQP3 3AZVA 3U07A 3JBG3 5M0TA 1NLQA 1DQ5A 2CDPA 1NXMA 3ZXJA 4AHZA 5CFCB 3CO2A 3N7JA 3WF0A 1VMJA 4AI3A 1WBLA 4WVZA 4RFT0 1WMFA 3K4DA 1VBA3 2HWD2 1ENQA 3HT1A 5IHRA 4IDZA 5BNOB 4PF1A 3L2HA 2D7FA 3VZNA 1QOSA 1LENA 4O9GA 4J25A 4CXYA 4NIDA 4L9BA 2YGMA 3CJIC 2VECA 4CEWB 1W6QB 5EHDA 2IXKA 1QDCA 1RUD2 1UIKA 4QB2A 3VD9A 4XDPA 2E7QA 5KHHA 3WHUA 3ZKYA 1ZREA 4GWMA 1NZIA 3UETA 5JXGA 1Y4WA 4YG6A 4A42A 2VZSA 4CDQB 2VM9A 1NQDA 2BFUL 4CCNA 4FPLA 1QHDA 3OD0A 2A3YA 1MEC2 3NNGA 2YHJA 3OY8A 4LBKA 4NR1A 2D6NA 3PHMA 4CUAA 4ZZ8A 5JWPA 3JB8A 4MG2A 4JQRA 3KT7A 1DQ2A 1UPIA 5CBLA 1O91A 2VZPA 3AYCA 3MIBA 5FP7A 3FFQA 3CIHA 3I3QA 3U78A 2VXRA 5IK4A 2GH2A 5CU1A 4AVCA 3T2TA 2Y6HA 1DGRA 2KR2A 3O1TA 5HCBA 4CEYB 1WGPA 4LIVA 3NNLA 4Q8LA 3MFAA 1N47A 3KV5A 4QHZA 4A7ZA 1GNZA 2B42B 2XJSA 4IE4A 3ON7A 5T52A 5T55A 3I3MA 3HVDA 1TZOA 3GGLA 1S0EA 4Y4YA 2R30A 3RJ2X 3VDBA 1XOYA 3O7OA 5BUVA 4OQ8A 1GUIA 1T6GC 3NV4A 1PM7A 3M3CA 4XOGA 1SBDA 1LOBA 1BLZA 4IUGA 4CP9B 4BK4A 1F9KA 3TNQA 3SKJE 3ZVXA 1AR63 1YFUA 2QQUA 2YY1A 3H0OA 4ZPIA 2CL2A 3NJVA 2B46X 3S57A 5C3PA 4TZDA 4LNVA 5I0TA 1OKQA 3USUB 1GICA 4S2HA 1DIWA 4MOAA 3MF9A 3I3EA 1RUE3 3BN6A 4IV3B 3VKNA 2Q4SA 1ZRIA 3LWCA 2OYZA 3EYPA 2HWE2 2W39A 3FBYA 5FPAA 4B8EA 1VBD3 2ZAHA 4MXWB 4BQ3A 3VDDA 4BQYA 2WINB 4H14A 5FPVA 5A3NA 2H6CA 4G4FA 3W5MA 1PGL2 3VL8A 5C4WA 3LGRA 3IPVA 1AL22 4YW3A 3DV8A 1PZ7A 2MPFA 3I2GA 1U0AA 2X53S 1UMZA 4B1LA 1LHOA 3V0BB 3RMYA 1GZWB 4LTAA 1CQ9A 4QPIB 1IPSA 3B9CA 2BNNA 3ZXGA 5D8AA 5C8CA 5E6HA 1SQ4A 5C9AA 1BVP1 3SEPA 2R0FA 2GNDA 2WSUA 4PQQA 4NHYA 3F2ZA 1C57A 4XFFA 1UY2A 4V1PA 2BBVA 2FZ2A 1DCSA 2GNTA 4JTNA 4P9JA 2ARCA 3ES1A 3T3YA 3ZR6A 4URAA 1OFNA 1UOGA 2DURA 2GAUA 4LBQA 1H8TB 4UFIA 3POYA 1FAYA 1ODNA 3IB3A 2NN8A 4I09A 4QDSA 3WX5A 5TSWA 3U4XA 3UT0A 5FO7B 2VMEA 1AR73 3DL3A 1NOVA 3POJA 2CNAA 4LUMA 5F5CA 5FFOC 2A1XA 3AMNA 3JBG2 3T4VA 3WDXA 1KJLA 2WNVC 3BB6A 5A33B 3HN3A 3TEYA 4HKWA 3IBMA 3ZFEB 4OI0A 2XBO3 3OTFA 5F2SA 3SXWA 4M3CB 4FTSA 1VBA2 1W9YA 1X7NA 4CCOA 2EF6A 2VL4A 4LA2A 1VB4A 4QPGB 3WG3A 4TN7A 1N1TA 1WA6X 2XLAA 3OBAA 1CAXB 3AMQA 4JGYA 1V6KA 5E16A 2VW0A 4HKOA 3GHMA 2ZABA 1G6NA 4QPYA 1BBT1 1UOJA 2WFF1 3NVCA 4LPLA 5C7GA 2ADEA 3ZR5A 3ITQA 4LBLA 3W21A 1OD3A 5A70A 2CDOA 2GN3A 3AP5A 4XUTA 1CJPA 2XWJB 3POGA 4CDWC 3T0DA 1RHI3 5AVAA 1IKPA 3FFZA 4ITCA 4LBMA 5FP3A 2JB4A 3C7HA 4LORA 1D4VB 3RYRA 2VMCA 1UAIA 4CDUC 4CU9A 1UY1A 3C7FA 2VZRA 2VVDA 3IDEA 2VCCA 1RUC1 3AX4A 5JSRA 4QGNA 2ZGLA 1UW8A 4UFLA 2CWSA 4W6XA 1GOHA 1C28A 4XDQA 1NE4A 4TXWA 3EXUA 1LECA 5BNPB 1IPJA 3RZKA 4Y3OA 3O0XA 4P02B 5LA2A 2LW8A 2ZMKA 5IVVA 1VAVA 3LOIA 2BPA2 2LRPA 1JODA 1H2MA 1OF3A 1IS4A 1QWRA 3VBSC 5DN2A 4AYUA 4LHLA 4GALA 4P00B 2G9GA 4S2GA 3UESA 1OI6A 1G86A 1CWPA 3AYDA 4AQ2A 1ZZ6A 3MW4A 5SV5A 2VZOA 3MFCA 4Q8KA 1CD3G 1DF0A 2Q1MA 4BIOA 3AP7A 1XPWA 4B29A 2P3YA 1UKRA 1HQWA 1W8OA 4QDQA 2VCAA 3WP4A 4JDOA 5CZKA 2HYXA 1EAH3 1HB2A 4PI2A 3UGHA 5FQ0B 2GALA 4XILA 1RUE2 4G9SB 4HONA 4RQPC 5LY1A 3PIJA 4E27A 1VBD2 1UMHA 3ZYRA 4BQ4A 4DZGA 1UY0A 1WW4A 5FPZA 3J7HA 2Y64A 5CG9A 3G6JB 2QQWA 1VBB1 3AZYA 4Y33A 2PAKA 4MADA 1HRV1 2OZ6A 2YYOA 1UYXA 5F3EA 1MZ6A 5FAXA 1YI9A 2C9AA 2NM1A 1ASJ1 5BNQA 2FD8A 4XC9A 4LO8A 5FLIA 3I3BA 1COV1 2VBDA 1EUUA 1QJU3 2VTXJ 1REEA 2VTFA 3N9OA 5H9RA 2WNUB 3KV6A 4LOTA 3USSA 1APNA 1RUNA 4RN5A 2RS31 3AZXA 4RFRB 3HWJA 4BQXA 2Q0AA 2XJVA 3HR9A 2HH9A 1GYKA 5DAPA 5F5IA 4A7KA 4XTMA 5FLJA 3ZX7A 4EN0A 1VIWB 2UYBA 1BBT3 2WFF3 3EBRA 4YLZA 2CTVA 4J1WA 3LSDA 1REDA 4XF0A 5DUUA 5JLVA 1HXS1 2G4IA 2D6LX 3GALA 3MI8A 3FLPA 1D2SA 4D69A 5FZHA 2QQVA 4XZPA 4YG3A 3BKZA 2FDKA 4OHXA 5CISA 3GNEA 4NHXA 2VAUA 1ULDA 3I59B 3RI8A 3OSDA 5KHGA 2BVBA 2RMU3 4IGOA 1C5IA 1IGOA 1RUC3 2O0OA 3SITA 3ZSJA 4PIZA 2VQTA 3CNAA 3QCWA 1H9PA 1ONAA 5DG1A 3RZLA 1PX4A 2F17A 3MYXA 4Y22A 5FYCA 1D0GA 3OGGA 5IK5A 4BMEA 3LDKA 3WW4A 3OBZA 2BV4A 5AFEA 5CAZA 5DMYA 3ETQA 2IC1A 1WMEA 1S55A 2VG9A 5JI9A 4YWAA 2HEVF 1EP0A 1Y7BA 2WFPA 2YB7A 1KGYA 3LFIA 4Q4X3 5A7WA 2EICA 4CP0A 4LBNA 4JKKA 2WAAA 3WG2A 2UU8A 2AACA 1KDMA 3MHZA 2BUKA 3O0VA 2VMDA 4ES8A 1J3PA 1AL0G 1QGLA 2XVGA 2Z4FA 3LA3A 4M00A 4S2FA 5E89A 3TB0A 1KD7A 2A3WA 1F31A 3VDAA 2R041 1UZ0A 2ERFA 3P3NA 2VNGA 1W6OB 3PUAA 4HOOA 4WZCA 3B7MA 4Y4RA 3SNMA 2WNVA 3NJXA 1Q8SA 1JYVA 3GJBA 4DUXA 2DVBA 2YC0A 5C71A 5FZLA 5JDBA 1XU1A 1VBB3 4WM8C 1FPN3 1NA1C 1I5PA 3LCPA 4GKXA 2AGSA 1HRV3 1K3IA 1GU3A 3BOWA 2YXSA 4HXCA 1U12A 5FK7A 1G9AA 1KRIA 3ZSMA 2E26A 3ZYHA 5CKNA 1COV3 4UW5A 2NMOA 4O9EA 3U10A 2RS11 1XE7A 1YQCA 2CGNA 1AX0A 1S0GA 2G9ZA 3CF6E 4KGGA 4DOUA 2ZGRA 1UD1A 4BQ5A 1OLMA 2VNVA 2RS33 1A34A 2ZZQA 1BXHA 5ABJB 3H8OA 2HLEA 3AP9A 3KF3A 3OCPA 3MUY1 4IE0A 2ZGUA 4CDWA 1W8FA 4KL1A 3LEGA 1XJAA 2XLFA 3QH7A 4NWVA 4CP2A 1CONA 4YZ2A 1Z7S1 1ENXA 4CDUA 2JDPA 3B93A 1PNFA 1HXS3 4QHOA 1V6LA 5GJ6A 1OA3A 4CU6A 3RPQA 1EAH2 1PVC1 1W90A 2BGCA 2DTWA 4OMDA 3RJRA 5KBFA 1G9CA 4YSFA 1MQTC 5L19A 1RUOA 1O4ZA 5A32A 5C6CA 2XHKA 2X8KA 4DRRA 1SLBA 3APBA 3HQRA 4GJZA 1K5MB 5FZ9A 1YJLA 1AJOA 4YG0A 3VBSA 1LOAA 5IYYA 4NHKA 4FVVA 4CA9A 3IAQA 5DQ0A 2P4EA 2FDJA 1QXRA 3DPRC 5ISLA 1AYN1 2Y33A 3LF7A 4WVWA 4FI9A 2R063 3JB4C 4QXKA 3QACA 1QJU2 1N1VA 3ZFGB 1BYHA 1R083 3VKLA 4AGRA 1GWKA 1QOTA 1UYYA 1LHWA 4NN0A 5DZEA 1YIFA 4FO9A 1POV0 3VDCA 5FZGA 4IEQA 4ZXEA 1R64A 2C6SA 2F6BA 3ZFFB 3KVAA 5DDJ1 4KU8A 2XOMA 1BBT2 2WFF2 4DEQA 5A6XA 1L7LA 2A3XA 1KFUL 2E32A 2XWBB 5FIXA 1D2QA 2Z79A 1RUI1 1O8PA 3RWKX 5K0UB 5IFPA 3BTXA 2DUQA 2UYAA 3ACFA 5A3WA 3QH6A 2ZXQA 3NWKA 4YVSC 2R043 3ZYGA 3JUUA 2FQPA 1SLLA 5KWRA 3VV1A 1GZ9A 3O1UA 1XNKA 3THDA 4KU7A 3WNPA 4FTEA 1UU5A 2ZACA 1HQNA 3IN9A 3T09A 1RUC2 4D6RA 4I2OA 2GC3A 1M06G 2VE1A 2DCYA 1F15A 2J1EA 3PU3A 5D1IA 2P2KA 1HQLA 1Y3TA 1UX7A 3WOGA 4XAEA 4JC1A 2OX0A 2VXJA 3ZN6A 2QQIA 5IUQA 2RS13 1RIRA 4UBHA 5HI0A 5CKQA 2XL9A 1PGSA 3FWEA 1OOPB 3Q8AA 1OHFA 1SCRA 1UN1A 5IK8A 2VZUA 2W1WA 3JD73 3I2IA 2Q8OA 4XJWA 5EXOA 1NE6A 4ZKTB 3I2FA 3NV1A 5EJ3A 1F2NA 5GKAC 3WNKA 1I3HA 1I9RA 2OS2A 2ZGSA 4Q4X2 4EN6B 3UV9A 3ZSLA 3WD5A 2PA7A 2B45X 2JKXA 5EP9A 4B1MA 1PGW1 5C3QA 3I54A 4AFAA 4LE4A 4W8JA 1YC61 3NNMA 2HWF1 2YFUA 1F5JA 4FSJA 1WD4A 3D6EA 4YFZA 1RVF1 3C7GA 4LKFA 2EIDA 1PVC3 2V4VA 3A21A 4P5YA 2P37A 2ZEYA 3N9LA 1KDKA 3W20A 3AKRA 4C90A 5T3NA 2NQYA 4F83A 1VBB2 5JOYA 1FPN2 4AFDA 3CHXA 4AFMA 4CXWA 1HRV2 3AMPA 4RS5C 2Y26A 3SEEA 4RYDA 1YHFA 5LBCA 4D0QA 4KWKA 3WF4A 4OUEA 1COV2 1H1MA 3AP6A 4LHSA 2D3SA 1H4HA 1YQ5A 5A3TA 3LA7A 3NNJA 2WS91 3BGAA 2JD9A 4L92A 2DCJA 1OQEA 3RNSA 1L3JA 1SPPB 1I5ZA 4DO0A 1BCXA 2RS32 3HMYA 2BERA 4OZXA 5HCFA 1V6NA 4BIFA 4AHYA 4D7YA 1ULPA 2RJ2A 5LB6A 1RUH1 3AZWA 2XONA 2D93A 1LGNA 1S4CA 3IIIA 4M3CE 1HV1A 5EQUA 1HXS2 5A7OA 1UPSA 1YO8A 4AK3A 3ENRA 2GC1A 3M3IA 4WM8A 1NA1A 3CJXA 5B2GB 1O4TA 3GDBA 2D6KA 2D6MA 2BFUS 2ZGKA 2FCVA 1OBNA 2WO1A 2FDGA 1IKQA 1SHWB 2O8OA 4IEVA 3NAPC 2WIIB 2I74A 5KR7A 1MS5A 1QH7A 1XNBA 3N7MA 1B35A 4JDMA 4XZUG 3U14A 2Y8KA 4IEPA 2WZPP 4UFJA 3I2HA 4GB31 2BBAA 1E5RA 2R062 2OPKA 3VDDB 5J7MA 1EPWA 5JR2A 2ADDA 4QKDA 1MVQA 2YZ4A 1GR3A 4I01A 1NCQC 1CZVA 5F32A 5JR7B 4ATFA 3FHQA 3Q8BA 5C4WB 4R9DA 2V73A 2WKKA 4AI8A 3IPVB 5CA6A 1GWLA 5I93A 1XE0A 1QOOA 2CAVA 2FMYA 4FPHA 4MGQA 4Z8BA 2A70A 1BZWA 1MQTA 2HWF3 3PUIA 1I6XA 5JI7A 2C24A 1C8M3 1W6PA 3BOPA 1ZZ7A 3CZUA 5D8AB 2ZPXA 3M3QA 5BNNC 5C8WA 5C8CB 3ZFFC 2UWCA 5C9AB 5FMOL 3I4IA 3ZMOA 2R042 4AQ6A 1JZ6A 3ZYFA 1O7FA 2Q1FA 2RJLA 4I0WB 2MEV1 3ETPA 5LRSA 4YPJA 3T2QA 1XYNA 3DPRA 3HBKA 4R52A 4NRPA 2V4AA 3SHRA 5FWJA 3AVSA 5ANNA 1KITA 5IATA 3KGZA 3JQXA 1V6IA 4LBQB 4OUMA 5FBZA 3VBFA 1W06A 5F9TA 5LK7B 3B69A 3ZYPA 4AVBA 2WAOA 1PNGA 2BU9A 1ZZCA 2WZ8A 1W03A 2ET1A 1YRZA 3GHNA 2RS12 4MSVA 1D7PM 2L9LA 3KCYA 4ET7A 2WS93 1O4YA 2FCTA 3CKHA 2I45A 3JD72 3LPGA 2XJRA 4GWIA 2QUOA 5IVCA 2RDQA 2AEZA 2K9ZA 2XXZA 3KQ4B 1OLQA 2E33A 2JE7A 4XEZA 1DFQA 5FZAA 3ZPYA 4JAAA 4CCDA 4R8HA 2RR11 5JXHA 1NZCA 2GP5A 4QD2A 4YVSA 5DPNA 2HWC1 4I02A 3WQ1A 5LATA 4PBPA 2P3IA 4TYSA 5GZGA 2VNRA 1GLHA 2JDYA 4NVPA 4PF5A 4EV0A 2EXHA 1HDKA 5KHKA 1AR83 4CUGA 1ULFA 3N7LA 5F5QA 1PVC2 4JGYB 4R9CA 4UFKA 1PX3A 1XRUA 4J6GA 3CU7A 4N7UA 1GFF2 4OZOA 3LSEA 3E5XA 1SBEA 1H0BA 4NO4A 4OFGA 4Z07A 5FZ7A 4PIXA 3U1XA 4DY3A 1AUYA 5J3UA 4NIAA 2AC1A 1CIWA 3DXTA 4BWOA 2CHHA 1YNAA 5IK7A 3E97A 3N4MA 3H1YA 1W2UA 2QKDA 4XF9A 3P3PA 1K45A 1J59A 4DQAA 4LBQD 3HJRA 5LASA 1DZRA 2VTXA 3J26N 3L9JT 5IFTA 5LA0A 1JZ2A 3P6BA 1CZTA 3TNPB 1W8HA 2E9QA 4RGGA 4XFHA 5CADA 2JECA 4N43C 4A45A 5JVVA 4MUVA 3R6SA 4Y26A 4FPYA 5A3PA 3H8UA 1KQRA 4WM7C 4YGCA 4GMP1 1GZCA 5EWSA 3OYWA 4GH4C 2YU2A 1V00A 1G7YA 1UU4A 2BVVA 2WT1A 2P34A 2XJUA 3CJIB 2ZX0A 2IVJA 3OB8A 4XACA 1W6MA 4PDWC 1PZ8A 3SISA 1D4M1 1RINA 2PYTA 2YROA 4AG4A 2W46A 3V56A 4UBGA 4IESA 1V6MA 3D0SA 2MEV3 4RS5A 1JOPA 3E5UA 2G1MA 1FOD1 4XBQA 4URTA 2VOKA 4IQPA 4K7JA 1RXGA 2WO2A 3VZOA 4YM3A 2D44A 4AW7A 1O59A 4FOYA 4R9AA 4AEKA 2DYCA 3BPZA 4LE3A 4C1WA 1SFYA 3A23A 4AXOA 5JSPA 1NG0A 2JKBA 2B9UA 1T2XA 2A6XA 1YEWA 1TMF1 2EIGA 4XJUA 1W39A 3K46A 1WMDA 2JWPA 1DQ6A 1JN2P 3WW1A 4PQ9A 3O1SA 5JIAA 1F8VA 3NMBA 5IVJA 3UK9A 1UX6A 3BPSA 4R9BA 1W8ZA 2JDKA 2QZ3A 4YVWC 3FHAA 4MGYE 4RA0A 5DXDA 4AVSA 1PGW2 2F4LA 3PLQA 1YQ2A 3E5QA 1TEIA 4H55A 3H42B 5FR3A 2HWC3 4XUNA 3WY6A 2YPJA 2HWF2 2OT7A 1LOGA 2VBBA 4HSJA 4E8CA 5ACA1 1C8M2 1FNZA 2W08A 3GBFA 3NAPA 3S7IA 3TBDA 1DG6A 3WSOA 1PO13 4HFSA 5DG2A 2G9FA 1N3PA 3ZSEA 5EJZB 1UY4A 5JPMB 2IZWA 4QXHA 1TME3 4PHZA 1FMD1 1S0JA 3LEKA 3RRDA 4AAXA 4RR3C 2DCTA 4YW1A 4EE2A 5JZGC 5ANQA 1US2A 4K20A 4K40A 1WCKA 3ASIA 1NCQA 2YBKA 4Q0PA 3MGUA 5FZDA 1DDLA 1K42A 3UL2A 4GMP0 4IEXA 4ES9A 4FPEA 2E51A 1S0FA 2Y0IA 4CCKA 3RZZA 1W99A 1VRH1 2WS92 3K77A 5C3RA 1SZBA 5JXJA 3VZJA 2B39A 3BUCA 1BHGA 4PLNA 4G3YC 1MVEA 3ACHA 2WRAA 3AKQA 3SH5A 4M01A 5A3LA 4CTEA 5BNNA 4O65A 4Y22B 3ZFFA 4ZU7A 5G04L 1OH3A 1XNTA 3ZPOA 1W0OA 1Y43B 5LW9A 1CPNA 3M1HA 2VR4A 4BXFA 4DINB 4YGEA 5FZ1A 3V0AA 4CZSA 2EIBA 1OMIA 1AR82 2AENA 1CJDA 2ILMA 3LKJA 1D4M3 4LK6A 2XGXA 5A7WB 4E4DX 3DEMA 5JPNB 4MGIE 1PVXA 5FJHA 2GNMA 5J98B 1O6UA 1VLNA 3VHPA 4BA6A 3TYJA 2YG0A 4KG8A 3W59A 5HV4A 1FOD3 3KD4A 4CRQA 2VMGA 4NE9A 4JQTA 1FT9A 3UKNA 1UZWA 2R0HA 4KBZA 2W1QA 5K9YA 2UWBA 1G9FA 4BHPA 3H3UA 4KWJA 5KXEA 2VW1A 4IGQA 4OMCA 4Q4Y1 1OXCA 4YW4A 2AR6A 1VALA 2XDVA 4H3WA 4LLOA 5FP9A 4Y1VA 2WNVB 5H9PA 2VQAA 1KS4A 3AMHA 4ZHNA 1W2AX 2XR4A 5F37A 2XLGA 2ZEWA 3A0KA 1TMF3 4Y5TA 2RM21 5FZ3A 3MIFA 2GMMA 2ZX1A 3C7EA 5DAVA 5BPXA 2D98A 3H9AA 4LQRA 4NPMA 4L97A 1NYWA 1SLTA 4ORFA 3O1OA 2UWAA 3PURA 1AX2A 1FX5A 4E2SA 3DYOA 4QB1A 4AHXA 2P6CA 4CDXA 4CU8A 4NIIA 3B5LB 3RZMA 1UYPA 2ZEXA 4QU1A 2XJPA 5ACA3 4M4RA 4DNYA 5AC91 1JYNA 4L0PA 1GKBA 5FO8B 1RL3A 4Y20A 2PN5A 1S0IA 1UU6A 4JTOA 4OI4A 2V5DA 4CDWB 4RL7A 3NNFA 2MEV2 3R4SA 5FMBA 4PLMA 2WYFA 1UL9A 3CQOA 2UY9A 1DQ4A 5DUWA 2Q8CA 4DXSA 2B4KA 1W3XA 5DUXA 5LY2A 4CDUB 2RHPA 3FLRA 4W65A 5F3GA 2VUAA 5L73A 3RYPA 5K8SA 1AXKA 2C5DA 2GC0A 4QHBA 5FJKA 5LA9A 3WR0A 1LHVA 4X6QB 2XH6A 2OQ7A 3FLTA 2YMZA 5FZKA 1QF3A 4QQHA 4N43A 4D8MA 2W47A 1V70A 1W9SA 1NAEA 1OF4A 2ID4A 1EPZA 4FPCA 1RB8G 1US3A 1RJ7A 2ENRA 1X8EA 4WM7A 1S2BA 2Z69A 2ZHLA 1VRH3 4GH4A 3URFA 3VBSB 2ARAA 4BQ1A 3MEPA 4YGDA 4PDWA 4P9LA 3OGRA 2RR12 4AQTA 1SLAA 4XFCA 4AE2A 2NP0A 2WWSA 2V72A 5A6QA 2HWC2 3AFKA 3AJYA 5FCCA 3W9AA 2XMLA 3T1MA 2JEMA 2QNKA 2XUMA 2A6VA 3UYJA 3N9NA 1PO12 3M7AA 3WNXA 1JZ8A 3IWZA 1GNHA 1YFWA 2TEPA 4CE8A 3VUOA 2JJ6A 5CKMA 1TME2 1J3QA 1HJGA 4Y1UA 4RQPB 3HQUA 1AHSA 3DYPA 3GM8A 4H2AA 1X8MA 3BVCA 4LMFA 3H7YA 1DGRN 3K4ZA 2DWRA 1JYCA 4CCEA 3NV2A 2ZMLA 2ZKNA 4Q4W1 1W0NA 1N1YA 4F3JA 2FDIA 1LULA 4YVWA 2P1BA 2R16A 1E5IA 2RM23 2WR9A 3E6BA 4PJYA 4QMAA 3PVBB 4CP1A 5C5UA 1EYBA 4LBJA 2QE3A 5LEJA 5KC6A 3PNAA 4OQ9A 2AREA 5L9BA 2A6WA 3VBHC 2R6QA 2WYSA 2VUDA 3PTRB 3WDYA 4YW2A 5LRRA 3SKVA 1S0BA 3ZN6B 4FPOB 4AEDC 3MIGA 2AUYA 4IV1C 3U75A 4D6QA 2P3KA 2P5BA 2GN7A 4WV8A 4A3XA 2BDRA 1NCRC 4OUSA 4B7EA 1TNFA 1UNBA 2DVFA 2IFRA 5AC93 4TLFA 2BGOA 1D4M2 4RR3A 4HPKA 1YIPA 4YRDA 4CXXA 4RD7A 4GWJA 5FYVA 3UNPA 5JZGA 1J1TA 4LITA 2E63A 3TRSB 4BPZA 2F4PA 1CAWA 3VL9A 4AVTA 2R1DA 1FOD2 1PGL1 1WBFA 3WW3A 3VB9A 5A6YA 2VO5A 3KB5A 5A6ZA 3I2JA 3B02A 1J3RA 5T5PA 3BODA 4IEOA 1A6CA 3ZYIB 2RDNA 4FBFA 2ZTNA 4J1XA 1JHNA 4AWDA 2C9KA 5FY9A 4QU2A 2QQNA 2YC2A 3H8RA 4MYEA 5DAXA 3UJOA 1QJY1 4XUOA 1JYXA 3J4UH 1TMF2 3USUA 2J1UA 1DGWX 4XUQA 4BZ4A 2ZGPA 2MNGA 5LBFA 1URXA 1HN1A 4N53C 1BEV1 1OPOA 3FMGA 5JOZA 4FXKB 1EUTA 2XUEA 4R4XA 2HWB1 2OVUA 5FXZA 4AZZA 5CG8A 4XBNA 5FXVA 5FP4A 3CZJA 5T54A 2W94A 3C8XA 3O0WA 3VBUC 3AZZA 4GD4A 3RZGA 4CUBA 1G9DA 5ACA2 3ILNA 1SACA 5FYIA 5L7OC 4UAPA 2BWAA 3AP4A 3NRUA 3BCWA 1MPXA 2YGLA 4LO4B 1ZZBA 5IVBA 4U36A 1PMHX 1AYM1 3SCHA 2VZQA 1YI7A 4HN0A 3WNOA 5FWEA 4NMIA 1YFYA 1POV1 3LPFA 3H50A 4NHMA 4QB6A 4ATEA 5JXIA 4DS0A 4DXRA 5L9VA 4WM8B 3UGFA 1NA1B 4KH9A 2ZKLA 5GZEA 5A1FA 3RZHA 4C91A 4P14A 4BCUA 4Q4W3 3CLPA 1JU4A 1QNYA 3ZSKA 2B8MA 4N9HA 3IZOA 5FZBA 4SBVA 4YW6A 1ASJ3 1RUF1 2QZ2A 3T0AA 3AKTA 3RGBA 1VRH2 4XE9A 2QQLA 5EYXA 3OF1A 1RUJ1 2KM2A 2BGPA 3M4FA 3LFMA 4AF9A 3UGGA 3WCSA 3N9QA 1B35C 2DBIA 2C26A 3LIGA 5F8PA 3VZLA 3LOBA 2PHXA 3O1PA 3ZXEA 2CV6A 3O5SA 5G05L 1ZYBA 3OJBA 2RV9A 1MR5A 2VY0A 4HN1A 2SBAA 3FN9A 5APAA 2CGPA 1W05A 3GCXA 5C70A 3ECQA 1Q56A 2GMEA 3N36A 2XL7A 3NSTA 2WLPA 5F39A 4ARXA 5FOJB 2EALA 4NPRA 4JVAA 1AF9A 2JB8A 2NYYA 3D3AA 1VP6A 3M70A 4FCAA 4ISQA 2BW8A 1QEXA 2C4XA 2R071 1ZZ8A 2VC9A 4GKYA 3ZXLA 2YU1A 3OOXA 1MQTB 4JHZA 4EZHA 3K3OA 3H8XA 2VGDA 1GSLA 4DUWA 3RFRA 3A0NA 5FYTA 1X36A 3PU8A 3TEZA 1HLCA 4Q4Y2 1AVBA 2Q30A 3AK0A 1E5SA 3AYEA 2PQQA 1X33A 4I3PA 4OCTA 1PM4A 4CUCA 4ISRA 2LALA 3DPRB 4LO7A 3MIEA 1Y9QA 2RM22 4FOWA 1BJQA 1W3VA 3MBWA 3S7EA 1LJ7A 3OPWA 3BU0A 2WQZC 4OHYA 1WLTA 4LUKA 3JXSA 1XU2A 3PDQA 1UY3A 4XDOA 5HXVA 3VBFC 3C7OA 3ZN4A 4NAOA 5FP8A 4W6WA 5I91A 4QWNA 2QFEA 4GQ7A 4EROA 5C5TA 4UOJA 1LR5A 2J1AA 3LA2A 3H3LA 3ZXKA 2XJQA 1UCXA 5AC92 3RYKA 4O7XA 1UWWA 2DFCA 5GLUA 4HLTA 4QX8A 1CAVA 1AYM3 4U2AA 5FMOS 3VZMA 5JOWA 2FDHA 2O1QA 2Y6LA 2W2IA 4YVSB 1XNCA 4NUBA 1SBFA 5A7QA 3KM5A 3WP5A 1LODA 3INAA 1POV3 1LOFC 1CAUA 3TOJA 2K0GA 2Z5WA 3BIWE 1UZYA 5I0DA 2RJKA 1RTVA 5F6LB 4BU2A 4D3WA 2ZCWA 1GP5A 2JG8C 3KV4A 1L7QA 4HK9A 3VBHA 1SEFA 2J1TA 2JDZA 4XFBA 4GZ9A 4IEZA 4AEDA 1RUF3 4IV1A 4QQ2A 5FZ8A 2HEYF 1QU0A 5LBBA 2WABA 3IDAA 2BEOA 4MGSA 1DLLA 4N7IA 1NCRA 4QT6A 1RUJ3 4Q2FA 1RUD1 2PFWA 3ZO0B 1W9WA 5DAQA 2CYFA 2Y34A 3OGSA 2PHLA 2PHDA 2H0BA 1OKOA 3NKGA 1G9BA 3SCGA 3DCQA 3KHCA 4JGZC 1HB4A 3POEA 4NHLA 3QOPA 4QAWA 3TWIA 3VHOA 2ZHKA 4QGMA 2WQ8A 3O1RA 1BK1A 1GQGA 2XVKA 4BE3A 5IVYA 5FZIA 2DVAA 2FMDA 4IL7A 2FHRA 4AR2A 2ZOEB 3THCA 4MGKE 3WZ1A 5JSOA 1UXXX 1Z7S3 2WT0A 3FL7A 4KQ7A 4YNIA 2BRTA 4WVMA 1OQ1A 4A44A 4AVAA 1LESA 1IZ3A 2EIEA 2R073 2WNUA 1CESA 3LDBA 4O61A 4XFIA 5A1AA 1GP4A 3HD8B 4UXAA 1W6MB 5FYHA 5BY5A 4JCKA 1KJRA 1SLIA 3AKPA 2EXIA 3CBNA 4N53A 1TVGA 4MX3A 1Q43A 4Q4W2 2WZEA 3NJZA 4RS5B 4WBBA 1XC6A 3H7JA 1C1FA 1Q3EA 4UFHA 2X09A 1BKZA 1NUKA 5IVEA 4BH9A 1ASJ2 4UF0A 2AYHA 3TN91 2VVEA 3OY8B 1AYN3 5CEHA 4XCAA 3VBUA 4AAPA 2VMIA 3A7QA 4N8MA 5B4NA 3DN7A 2QQOA 5L7OA 2JENA 1EY2A 3N9MA 1DQ0A 3WNMA 3MZHA 4W50A 2C1FA 5C3OA 5C3SA 5C33A 2D43A 2XJTA 1ZX5A 1PK6C 3T1LA 2CGOA 1WWYA 4CVUA 4AI2A 4DY5A 3KHBA 4I0AA 3O1VA 1GWMA 2ZGOA 2WSVA 3AXDA 2NLRA 1Z0HA 3ZIXA 1QIQA 3VBOC 4DIQA 5LWBA 2HWE1 5DDJ3 2PAMA 5LEKA 1FYUA 3I8TA 3MF6A 4QKNA 5IJRA 1RUI3 4Q27A 3WQ0A 5DZGA 1JBCA 2WWJA 3Q8CA 3ILFA 3ZIWA 4QXBA 3NAPB 1HB1A 4YGBA 2IFWA 2RS51 1LAJA 2JIJA 4JDNA 1ND3C 4JX0A 2ZHMA 4FFFA 3AKSA 1OH4A 1OLME 4DPNA 2XQRA 4JRLA 3DECA 2XKOA 4YW7A 1WCQA 4V2WA 2Y6KA 2WO7A 4LA3A 5FY7A 3T2OA 1E57A 1KXGA 1QH6A 1U5ZA 2R32A 2X5IC 4MVTA 3WNNA 2DCKA 1W6OA 4V2VA 1SLCA 1BEV2 1SG3A 2EAAA 1NCQB 3VHRA 3U37A 3FJSA 2JDMA 2HWB2 3V64A 1GQPA 5E8AA 4DEVA 3EJKA 1ULEA 1ZBE1 2YFZA 1IS6A 5FYYA 5I0UA 1V9U1 3MLJA 1LB2A 2W68A 3S30A 1VMHA 3K75B 4HT1T 5FUIA 1OA2A 1DU3D 4CCJA 4I0BA 1ZA7A 4PT6A 3C2UA 3J8F1 4CSWA 1AYM2 5BNNB 4OYUA 3WINE 3DUIA 1QQP1 4P5HA 2ZX3A 1NX9A 1RVF3 2ORXA 3JBG1 3MPBA 1OPMA 3WF2A 4NRQA 2QCSB 3SCFA 1HKDA 1UOFA 4WVVA 3V0AB 4LEJA 5FOBB 1STMA 4GAZA 4Q4V1 3AMMA 4UI9L 5JOXA 1ZBA1 3OUIA 4HVRA 2DUOA 2BNOA 3ZKUA 5GZCA 5A7SA 2UURA 2D6OX 1HB3A 3UKTA 4SLIA 5SV8A 4NRMA 4Q0UA 4Q1PA 5I8YA 5KHIA 4XF4A 5FZ4A 2EAKA 4OI1A 2K46A 1VJ2A 4OVEA 4XUPA 1K12A 2K2SA 1YQ8A 3K3NA 5CFDC 4CCLA 3TN93 1RUF2 3MV01 2QDRA 4FFGA 4N90A 2XQXA 1PO21 2PHRA 4XF3A 1BK0A 1KFXL 3T0BA 5AFBA 2YBPA 1RUJ2 4FOVA 1JZ4A 1ND2C 1R1A1 5FZCA 5GLZA 5FV3A 3A22A 4LHKA 3ZMNA 3FE5A 3OPZA 4ZXKA 5J09A 4XJAA 4LKEA 4A41A 4A3ZA 1RYYA 4KG0A 4KWUA 5FYUA 3U4SA 1RMU1 1RUH3 1LOFA 4UT5A 3AL6A 4Y24A 4FFIA 4D94A 1Z7S2 2PHFA 4HKLA 4LKSA 1ZZ9A 4I30A 2OKXA 2R072 1XYOA 3CEWA 2JG8A 1HX6A 4CDXC 1V6JA 3HQXA 4AI0A 3LB9A 4FXGB 3TEWA 4AGVA 2WA3A 3ACIA 5JMCA 4LJHA 4Y20B 3J7MA 3B00A 4YM2A 4EWAA 2JG9C 1LU1A 1JUIA 4YM0A 2IXJA 5B4XA 1LOCA 1UIJA 1WMXA 5AVPA 1SMVA 2EXJA 2A6ZA 3D8CA 3ME2A 4W6YA 5EZWA 1GANA 4COZA 4FAHA 2P6HA 3PIGA 2Q8DA 3VBRC 2VU9A 5FY1A 1MS8A 1DBNA 3R05A 1AYN2 3MW3A 1R091 4GB33 4JGZA 5FYBA 2WJSA 1GP6A 3X29B 4K8RB 1S0DA 4N43B 1AR61 4DXZA 2FDFA 1QMJA 3MW2A 2BP6A 5A3OA 1LU2A 2VZTA 2QQPA 4WM7B 1JI6A 1ZBE3 1L7RA 2DUPA 3ZDSA 1JW6A 2ZZJA 3ACGA 1RC6A 4GH4B 1SFPA 1V9U3 4XFGA 4LULA 4MHUA 5DDJ2 4OHZA 2PHUA 3FUQA 3P1IA 4PDWB 3GBGA 5H9QA 1MZ5A 3J7LA 3J8F3 4H7MA 4UWDA 3MIHA 1RUI2 3GZEA 3ZN5A 3ZXFA 2PAEA 4AFBA 5F3CA 1PMJX 4KBBA 3A4UA 1ENRA 3OGJA 4QKBA 3OUJA 3M3OA 4IETA 1KEXA 2G19A 1BQPA 3FC0A 3WT3A 2VZ1A 3O12A 4Q4V3 3RWNA 5CFCC 2LM3A 4LIUA 1ZBA3 1PIV1 3ES4A 1WW6A 2ARXA 1NT0A 3AB0A 2JICA 3DGTA 4XYXA 1LEDA 3EMRA 3LE0A 3SLIA 2A5ZA 1WA4A 2CSGA 3IIAA 3N7KA 2FBEA 4LO6B 4XQDA 1MZEA 1WW7A 3GBWA 2C0ZA 2D5HA 3JCIA 1PK6A 2VQ0A 5BNOC 5T5LA 1PO23 4IEYA 4Z92B 1CR7A 1J83A 1YLLA 2TNFA 5J37A 4BJ0A 4NOTA 1H9WA 2BYVE 2YC4A 1O3SA 1CX4A 4K1ZA 3KVBA 1R1A3 4CEWC 2VULA 3VBOA 1DHKB 2ARBA 3PVEA 4OI2A 4FPGA 3NO8A 4BB3A 1JTZX 1JXNA 4COYA 4P9IA 4YVWB 3PL0A 3I2OA 1X9PA 2JD4A 4XQWA 2VJXA 4CDQC 2RR13 1JYTA 4I3GA 4JKLA 2QBXA 1RMU3 4QKFA 3KGLA 1G8WA 4S2DA 1W8UA 1ALYA 1AR71 2ZGMA 3KF5A 4PI0A 3TAYA 4YARA 4P9GA 4BM8A 4AHWA 5GZDA 3WF3A 4YZ4A 4QQLA 1ND3A 2J42A 1RVF2 1ZRDA 1SPPA 4Q5OA 4LOSA 5KC5A 1H6XA 1OD5A 2XBO1 5KXCA 1DQ1A 3E6CC 1SDDB 2YBSA 4RR3B 5FXWA 2WUHA 2AH2A 2GP3A 4HPKB 3FBMA 2X5IA 3W5NA 4CEYC 1PZ9A 5JZGB 5FUPA 3SC7X 1V0AA 2D3PA 5F1RA 2CY6A 4ZY9A 3JQWA 1CAWB 4EZ4A 1QJX1 2VMHA 2ZGNA 3AM2A 3GJAA 1OQDA 1JOBA 4UW3A 3Q8EA 1RJ8A 3TN92 1JYIA 3HOBA 1J58A 1VBC1 1IS3A 1R093 1H30A 1U5IA 4K6BA 5JCTA 4EN7B 1MS9A 1Q8QA 1XNDA 4LXLA 3WDWA 1DYOA 1REFA 3SH4A 4QQPA 4ASLA 2WN3A 3K4AA 1IG0A 4XCBA 3THTA 3M3EA 3L2YA 4N9IA 1Q5OA 5FZMA 5LBEA 4C0BA 2FZ1A 1GZTA 1QXPA 1RHI1 2DVDA 5FTTC 3S5QA 3HNYM 3THPA 1F4AA 1UZZA 1W6NA 4GMP3 4BISA 2VOWA 2W5FA 3I49A 1WLDA 1T6BX 3AFGA 1RUH2 5FK8A 3FUOA 4MHRA 1H2NA 2J1RA 1WUVA 4IV3C 4B4QA 5FPUA 4AOCA 4TSVA 1F5FA 2WLQA 4FP3A 3HEIA 4FQ4A 4WZFA 3HPNA 2HYKA 1OURA 2Q5TA 3I2KA 2UY8A 4JV4A 3RMXA 2VCBA 2WA4A 2AEYA 4F8AA 3POFA 2WC2A 2X10A 2RS52 4L99A 5FZEA 5CFDA 1TNRA 1LTEA 1Q8OA 4EQVA 1PIV3 3RQ0A 2QQMA 4BQ2A 4CPBA 2XKPA 2QJVA 4QX3A 1WLWA 2HJIA 4RGAA 1ND2A 4BK5A 3BU7A 2O8QA 4QM9A 3WP6A 4GA9A 4QPIC 4FTBA 1FXZA 1OA4A 1U5XA 3PJYA 3I7DA 4GB32 3VKFC 1ZRFA 4D7TA 2ZGQA 3EO6A 2HKXA 4XABA 4PCRA 2QVSB 3MLLA 1TQ5A 2MHFA 5FY4A 1A8MA 4OHVA 1IHMA 2WT2A 5A3MA 5T5OA 1QY4A 3D5OA 1ZBE2 5D2AA 1EAH1 1OUXA 3VZKA 1U5YA 1H8TC 3KZ4C 1V9U2 2RG4A 1S1AA 1LHNA 3WUCA 2YUEA 5I0SA 5K7PA 3WLUA 3ACLA 3BTZA 1JUHA 4C1XA 3J8F2 1YYNA 5HCAA 1RGSA 4COUA 1QQP2 3KQRA 2JG9A 1OLRA 2BZDA 1DZTA 3MDPA 2W3JA 1RITA 5DUVA 3S6PA 4NJ4A 4Q0QA 3PUHA 5LCWL 4QX7A 1X50A 2B5HA 4Q4V2 1GOGA 3P5BA 4XHBA 4XQ4A 1ZBA2 3VBRA 2DCZA 2ZAAA 3ZFEC 1FATA 1QJU1 5FPLA 1FMD3 3W58A 1SFNA 1ULCA 4MZUA 1LNSA 3D0JA 2JX9A 2LTNA 5T5JA 3KV9A 1QJX3 1W2OA 2HEWF 2P17A 4QPGC 4XAAA 2IXHA 1P8JA 4DB5A 5HBAA 2NPIA 3H3ZA 3ZXDA 1PO22 1N1SA 1VBC3 1SCSA 2DDUA 1FV3A 5A32B 1UXZA 4HSLA 5J36A 5IT6A 1DLCA 1IQAA 1R1A2 1HRI1 3J7NA 1W2NA 4JHTA 4YZ5A 3ZOIA 1RUG1 4CYDA 2CWMA 2OIIA 5FYMA 2EXKA 5FZOA 3FZ3A 1WLCA 5F2WA 3HNBM 4KWLA 4F7ZA 1CGPA 5FZFA 2QDNA 4HANA 3WG4A 3S5AA 1JZ3A 4MLOA 4P9WA 2GZWA 5JIUA 1RMU2 4D6SA 1S0CA 3WDVA 1W0PA 1XSQA 1ZVFA 5KXBA 2PTMA 5L9RA 5J1XA 2RMU1 4HVOA 1HV0A 3GXUA 3SH3A 5CFCA 3DKQA 1XYPA 2WL1A 2E53A 3ZYBA 4E2GA 3QBQA 3GYDA 1W8TA 1Q8VA 4HBNA 2E31A 2VZ3A 4NAMA 4RSUA 5FY5A 2WWUA 3MLKA 1H1IA 4PBOA 5F5AA 4FOQA 5I8TA 4LBOA 5A80A 4B3NA 1EV11 1QJEA 2GU9A 3AYAA 3GZUC 4HZFA 5E1RA 5HCHA 1CZSA 5BNPC 5BNOA 1C3HA 4B7KA 2DV9A 1DGLA 1CAVB 3CJIA 3AJZA 3LAGA 3MV11 4AVVA 3KCCA 3CMGA 4CEWA 4KNCA 2GH8A 1W6QA 4Z2WA 2ZMNA 5BXXA 4Q4Y3 5GM0A 3IAPA 4Q4X1 4EN9B 1CAUB 2CU5A 4EWEA 5A1LA 2PHWA 2OA2A 4P9YA 5ERLA 1XB9A 4HK8A 5FUNA 1ENSA 1LKNA 2RE9A 2XVLA 1R092 1CN1A 2WBKA 4LO5B 3BIEA 3POWA 2D6PA 3ALQA 4E4SA 4CDQA 2Y6GA 5FRAA 3LIHA 2YPDA 1AR62 2CAUA 1AZDA 1ZNPA 5CIRA 4JKMA 3VBHB 5FLHA 4IE6A 4ZS2A 4P08A 1MZFA 2OZJA 4P9XA 4D7SA 2J1VA 4AEDB 3OUHA 4IV1B 3POBA 4NPLA 4ZU4A 2W92A 4BYYA 4MXVA 1NCRB 1O8SA 4B4PA 1VPHA 1ACCA 4FQZA 3LQCA 1LCLA 4XPVA 1O5UA 2QQJA 3TEXA 1VRBA 1FPN1 4CEYA 4RGKA 4Q26A 2IWGB 2VPVA 4UW4A 1XXNA 4FPFA 2ES3A 4YZ3A 1PMIA 3GZAA 3SMHA 1AR91 4FPJA 1CVNA 1PIV2 2H0VA 4EJRA 2BTVC 2JDNA 3POSA 2VMFA 4WVMB 1JZ7A 2WZR1 4IEUA 1Q8PA 4KMQA 4XIKA 5IW0A 3VKMA 1NY71 4CP9A 2WNUC 2DTYA 5EJ1B 2RDSA 1LGBA 3KSCA 4A2UA 1JHJA 4AL9A 3WDTA 1YQ6A 3MIDA 4N53B 3LD8A 1HRI3 4AI1A 5FREA 5FBJA 1R1ZA 3K51A 3NJYA 1RUG3 3U0ZA 2ZHNA 4IV3A 4Y1ZA 4AEJA 3OGVA 4ARYA 2JIGA 3E6DA 4LHNA 1ODMA 3ILRA 4MXWA 2VQUA 4QGLA 2IUWA 3MPPG 4UF0B 1UMIA 4XF1A 4XMAA 5F7UA 1LEMA 1LRHA 2W52A 1PHMA 3JZVA 4NROA 4QM8A 3VBUB 3AL5A 3PUQA 5FMCA 1IOAA 1DYPA 5L7OB 5FYZA 3WUDA 1AR72 2VCMA 1ZRCA 1LGCA 2WNOA 1F35A 1N3QA 1TG7A 2DU0A 1JMUB 2FCUA 3M2MA 1ULOA 5IVFA 4LT5A 4PLOA 2PHTA 4BMBA 3MUZ1 4L2NA 4XTPA 3HAGA 2XBO2 3V0BA 1EV13 1GZWA 4HL0A 3MO4A 4JZRA 3PMSA 3VLBB 4QPIA 2KXLA 2R061 4H7LA 2XPJA 1FMD2 3RVHA 1R081 1KS5A 1POQA 2J1SA 2PXJA 5GLVA 3AC0A 2ZGTA 1GQHA 1QJX2 3KT1A 5CYYA 2YDEA 2ZS6B 2JDAA 4MV2A 4OULA 4XIOA 1BMV1 1VBC2 3R4UA 2R49A 4Y5Z0 3R4DB 3OD4A 5T50A 1H8TA 1C5HA 3VD7A 4E8DA 2D3RA 4IGPA 2OQ6A 3FHIB 4ZZ5A 1C8NA 2XB6C 2LROA 1QDOA 4XJ8A 1OT5A 1RXFA 1Y9GA 1B35B 1HIXA 3HT2A 2IXIA 3GCWA 5EV7A 3ZXAC 1RHI2 2DVGA 4BDVB 4TWTA 3WDUA 1XBFA 1OFSA 4AGGA 3T2PA 2R7EB 2B7YA 1FI2A 5DABA 4HVQA 5L36A 4QPWA 1GOFA 3DYMA 1YXWA 3LEMA 4KGQA 4Z2AA 2GMPA 5HXMA 2VOTA 5A33A 1NLSA 2Z2SB 4XFAA 3WVJA 3ZFEA 4K21A 3N35A 3B3QE 4ZS3A 1UF2C 5FMDA 2PLV1 4M3CA 2IXCA 4RHV1 3RDIA 3WG1A 4XVHA 4XMIA 3RI9A 1A3KA 4QPGA 3O14A 2W87A 1AR93 2TBVA 4X8NA 2BQPA 1W8WA 1XE8A 1VBE1 1W6PB 1CAXA 1W2TA 3JD71 2WZR3 5EPAA 2H6BA 4OLLA 4ASKA 2RDRA 4HMZA 2A73B 4EWDA 2A7AA 1QNWA 4IEWA 3CDZB 2BOIA 2I07B 3KLSA 2Y60A 1W28A 3AVRA 5ABJC 4E2QA 1DGWA 3NW4A 1QJY3 3KCXA 3UJQA 1H6YA 1IS5A 3KS7A 5JMOA 4NIGA 3VD5A 3VBFB 4DMIA 4NIHA 1BEV3 1IQDC 4FFHA 4K1YA 5BV6A 4COWA 3BTYA 1W8NA 2HWB3 1UOBA 3WCRA 2W91A 1ZM1A 5GZFA 3VKOA 1W9FA 2VNOA 3ELNA 3NQHA 4BOWA 5HV0A 1WKYA 1O3RA 3HNMA 4Z1VA 5IAXA 4M0HA 3NV3A 5BNPA 4QX1A 3VD4A 2GDFA 1UKGA 5LK5A 3RG0A 2EVXA 3ORJA 1K5MC 1WW5A 4XJZA 4KI5M 4A4AA 2E7AA 3RZJA 3EQEA 4Y5SA 4E4HA 1ST8A 4IERA 1YWKA 4QX2A 2BJSA 4AI9A 5I0RA 4AFCA 3DF0A 3I3DA 1NKGA 3POIA 4JRAA 1AX1A 1C4RA 3OBTA 1BVVA 2JG8B 3ZFGC 1K5JA 2HWD1 2ZX4A 2X29A 3NKTA 5F6KA 1WZXA 4Y1XA 5GLWA 1OUSA 4ZU5A 1NLRA 2Y6JA 1H4GA 3D82A 5H9SA 4L8QA 4RQPA 1HRI2 3WNLA 2Q1ZB 2OW4A 4UYBA 2ZA9A 4ONUA 1RUG2 5FQ0A 5J48A 2DBNA 4A6SA 1YUDA 3H1MA 1D0HA 2W1UA 4XURA 4GWNA 1UYZA 3ABZA 3HIFA 4COVA 5K0UC 4XXAA 3EB7A 3U11A 1QJZA 1S2EA 1QJFA 3G7DA 4JGZB 1O5LA 3ZM8A 3N9PA 2R1BA 5FXXA 2VH9A 3BYWA 2A6YA 1E5HA 1MS1A 2RMU2 3MICA 4Q0SA 5IWFA 1O3QA 1MEC1 2GC2A 3HBZA 4MH0E 5CB7A 3WXPA 4Q1RA 2VVFA 4R4ZA 2ET7A 3C3VA 5K4LA 2PLV3 3KWVA 4RHV3 4CCMA 4TLGA 5FKCA 1EV12 2PQSA 3IKWA 3OYWB 4XXPA 2N7GA 2PELA 3IMMA 3OEAA 2PMWB 2E6VA 2OUJA 2ZX2A 3BTAA 1VBE3 3LDRA 4BXSV 5HPOA 4UFMA 3ZLIA 5CNAA 2BOJA 3IDBB 5D21A 1H2LA 1OOPC 4Q0VA 3GZTB 1Y9MA 4QQOA 3VHNA 2KD7A 3UKVA 4HETA 5JAXA 3LZZA 3IM0A 4YFWA 4MO3M 3PMEA 1WCSA 4Q29A 3I2DA 1MACA 2V09A 2YV8A 1GNYA 2JDUA 4HG6B 4OHWA 4YYOA 1C8M1 1JH5A 1DYKA 3CL1A 4PIYA 4ZONA 3I59A 4X6RB 5J96B 1V6OA 2A75A 5I8SA 1PK6B 1NQJA 2DF7A 3WP3A 3QLQA 2ZEZA 3ZDVA 1MS3A 1LHUA 1YFXA 1OC1A 3VBOB 3BI3A 1CIYA 3ZYJB 3Q9OA 4IW3A 2B9VA 2J22A 4C0HA 5GLTA 3WQBA 2SLIA 1HJFA 3JU9A 3OBRA 1ZRRA 3PUSA 2D5FA 3WF1A 4QX5A 4E4ZA 4M0NA 1H1AA 3IMNA 1AR92 3GF6A 3ROUA 1JOJA 1AJKA 4C8DA 3VN4A 4UW6A 4E9KA 2A71A 2Z42A 2GNBA 5KHJA 2DU1A 2LS6A 1ND3B 1AL21 5FPXA 1CPMA 2VZVA 2WZR2 3K48A 2E7TA 1XNAA 3PVOA 1J84A 1AXZA 1GV9A 3QD6A 3R0RA 4FP2A 1NY72 3WHTA 2X05A 2HWD3 5JUVA 4XHXA 2Y38A 3WEZA 3WW2A 4ASMB 2OXBA 5FKBA 2HBUA 3S0MA 1QJY2 2X5IB 2ZBJA 2O14A 5FYSA 1C1LA 1H2KA 2I2SA 4GXLA 4LR4A 1ULGA 3K2OA 3E1F1 2VUJA 3RS6A 5GALA 5BYNA 1O3TA 1HW5A 1AR81
chains in the Genus database with same CATH topology
1RUD3 3B9IA 1A78A 3M8LA 1SDWA 4B4RA 3PJQA 2XG3A 4DRVA 1WCDJ 1WD3A 1QKQA 3B94A 1YCIA 5EFUA 3ST7A 4XJ9A 1M4WA 4DFSA 1MEC3 4FAGA 1IPKA 1NXD1 1X82A 1TE1B 4K3UA 2DFBA 3DKWA 1W6NB 3KT4A 1XQNA 1YJKA 2VW2A 3ATGA 4AQSA 1Z78A 2D97A 2JE9A 5ABJA 1FV2A 1R082 2LUWA 1J1LA 2EA7A 3KMHA 4XW3A 3VDDC 2VOVA 1MS4A 4X8PA 4EN8B 1S2KA 4IXLA 3AXEA 1QXJA 1VBA1 4BLIA 5FDBA 4YW5A 5FO9B 5CFDB 5C4WC 1BMV2 3FX3A 1LOEA 2TUNA 1OSGA 3D4KA 4K9SA 1ND2B 4Z82A 2NMNA 1GBGA 4L11A 3N3HA 5C8CC 1A8DA 2JXAA 5D8AC 4XBLA 1K5MA 5C9AC 3RSJA 4Y1YA 5CVRA 2WNEA 1AXYA 5DZFA 3VGIA 2AZ5A 1N3OA 4FT8A 1ZA4A 4K8FA 2HWE3 4M3CF 3IDCB 2PLV2 3WQ7A 4YZ1A 1VAMA 2NZ9A 3H1WA 4RHV2 4NWWA 2Y0OA 3ZFGA 4CDXB 2BNMA 1VR3A 2IXLA 2BWCA 1H8VA 1VBE2 2JG9B 1AL23 3BALA 2RS53 3NL1A 3EHKA 3HN1A 5E88A 2V5YA 1VB2A 2OUHA 4A7YA 4BLJA 2D40A 3B01A 4INDA 3VBRB 2W0XA 5K0UA 4AEMA 3IT8A 1DZQA 2KA3A 2P3JA 4MGZE 1B09A 4LLFA 4XETA 3WV6A 1PO11 2WQ4A 4GIQA 5KXDA 2ATFA 4FPKA 2ZJCA 4JGYC 1TME1 4META 5EYYA 4GULA 1RUE1 2ETEA 1FNYA 2GSYA 2VOXA 1VBD1 1MS0A 1VAKA 3V65A 1I1EA 3PTYA 3PVNA 3J9SA 1OOPA 4YM1A 3U07A 1QQP3 3AZVA 3JBG3 1DQ5A 3ZXJA 1NXMA 4AHZA 5CFCB 3CO2A 3N7JA 4AI3A 1WBLA 4WVZA 4RFT0 1WMFA 1VBA3 2HWD2 1ENQA 3HT1A 5BNOB 3L2HA 2D7FA 3VZNA 1QOSA 1LENA 4O9GA 4L9BA 2YGMA 3CJIC 2VECA 4CEWB 1W6QB 2IXKA 1QDCA 1RUD2 1UIKA 2E7QA 5KHHA 3WHUA 1ZREA 4GWMA 4YG6A 4CDQB 1NQDA 2BFUL 4FPLA 1QHDA 3OD0A 2A3YA 1MEC2 4LBKA 2YHJA 3OY8A 4NR1A 2D6NA 3PHMA 5JWPA 3JB8A 4JQRA 3KT7A 1DQ2A 1UPIA 5CBLA 1O91A 3AYCA 3MIBA 3FFQA 2VXRA 5IK4A 2GH2A 5CU1A 4AVCA 3T2TA 1DGRA 5HCBA 4CEYB 1WGPA 4Q8LA 3MFAA 1N47A 4A7ZA 1GNZA 2B42B 2XJSA 5T52A 5T55A 3RJ2X 1S0EA 4Y4YA 2R30A 3O7OA 5BUVA 1T6GC 3NV4A 1PM7A 3M3CA 4XOGA 1SBDA 1LOBA 1F9KA 3TNQA 3ZVXA 1AR63 1YFUA 2YY1A 3H0OA 2CL2A 2B46X 4TZDA 4LNVA 5I0TA 1OKQA 3USUB 1GICA 4S2HA 1DIWA 3MF9A 1RUE3 3VKNA 4IV3B 2Q4SA 3LWCA 2OYZA 4B8EA 2HWE2 2W39A 3FBYA 1VBD3 2ZAHA 4MXWB 3VDDA 2WINB 4H14A 2H6CA 4G4FA 1PGL2 3VL8A 5C4WA 3LGRA 3IPVA 1AL22 4YW3A 3DV8A 1PZ7A 2MPFA 1U0AA 2X53S 1UMZA 1LHOA 3V0BB 3RMYA 1GZWB 4LTAA 1CQ9A 4QPIB 3B9CA 2BNNA 3ZXGA 5D8AA 5C8CA 1SQ4A 5C9AA 1BVP1 2R0FA 2GNDA 2WSUA 1C57A 4XFFA 4V1PA 2BBVA 2FZ2A 2GNTA 4JTNA 4P9JA 3ES1A 1OFNA 2DURA 2GAUA 4LBQA 1H8TB 3POYA 1FAYA 2NN8A 4I09A 3WX5A 5TSWA 3U4XA 5FO7B 1AR73 3DL3A 1NOVA 2CNAA 4LUMA 5FFOC 3AMNA 3JBG2 3WDXA 1KJLA 2WNVC 3BB6A 5A33B 4OI0A 4HKWA 3IBMA 3ZFEB 2XBO3 3OTFA 3SXWA 4M3CB 4FTSA 1VBA2 1X7NA 2EF6A 4LA2A 1VB4A 4QPGB 3WG3A 1N1TA 2XLAA 1CAXB 3AMQA 4JGYA 1V6KA 5E16A 2VW0A 4HKOA 3GHMA 2ZABA 1G6NA 4QPYA 1BBT1 2WFF1 3NVCA 4LBLA 2GN3A 3AP5A 1CJPA 2XWJB 4CDWC 1RHI3 5AVAA 1IKPA 3FFZA 4ITCA 4LBMA 1D4VB 3RYRA 1UAIA 4CDUC 2VVDA 3IDEA 3AX4A 1RUC1 5JSRA 4QGNA 2ZGLA 1UW8A 2CWSA 4W6XA 1C28A 4XDQA 1NE4A 3EXUA 1LECA 5BNPB 1IPJA 3O0XA 2ZMKA 2BPA2 1VAVA 3LOIA 1H2MA 1QWRA 1IS4A 3VBSC 4AYUA 4LHLA 4GALA 2G9GA 4S2GA 1OI6A 1G86A 3AYDA 4AQ2A 1ZZ6A 3MW4A 5SV5A 3MFCA 4Q8KA 1CD3G 1DF0A 2Q1MA 4BIOA 3AP7A 4B29A 1UKRA 1HQWA 3WP4A 4JDOA 1EAH3 5FQ0B 2GALA 4XILA 1RUE2 4G9SB 4RQPC 4E27A 1VBD2 3ZYRA 4DZGA 1WW4A 5FPZA 5CG9A 3G6JB 1VBB1 3AZYA 2PAKA 1HRV1 2OZ6A 2YYOA 5FAXA 1MZ6A 1YI9A 2C9AA 2NM1A 1ASJ1 5BNQA 4LO8A 5FLIA 1COV1 1QJU3 1REEA 1RUNA 5H9RA 2WNUB 3USSA 1APNA 2RS31 3AZXA 3HWJA 2Q0AA 2XJVA 3HR9A 1GYKA 4A7KA 4XTMA 5FLJA 3ZX7A 4EN0A 1VIWB 2UYBA 1BBT3 2WFF3 3EBRA 4YLZA 2CTVA 4J1WA 3LSDA 1REDA 4XF0A 5DUUA 5JLVA 1HXS1 2G4IA 2D6LX 3GALA 3MI8A 3FLPA 1D2SA 4D69A 4XZPA 4YG3A 4OHXA 3GNEA 1ULDA 3I59B 3RI8A 5KHGA 2BVBA 2RMU3 1C5IA 1IGOA 1RUC3 2O0OA 3SITA 3ZSJA 4PIZA 3CNAA 3QCWA 1H9PA 1ONAA 5DG1A 3MYXA 4Y22A 1D0GA 3OGGA 5IK5A 4BMEA 3WW4A 5AFEA 5CAZA 3ETQA 2IC1A 1WMEA 1S55A 2VG9A 5JI9A 2HEVF 1EP0A 1Y7BA 2WFPA 4Q4X3 4CP0A 4LBNA 3WG2A 2UU8A 1KDMA 2BUKA 3O0VA 4ES8A 1J3PA 1AL0G 1QGLA 2XVGA 4M00A 3LA3A 4S2FA 5E89A 3TB0A 1KD7A 2A3WA 1F31A 2R041 3P3NA 2ERFA 2VNGA 1W6OB 4WZCA 3B7MA 3SNMA 2WNVA 1Q8SA 2DVBA 2YC0A 5JDBA 1XU1A 1VBB3 4WM8C 1FPN3 1NA1C 3LCPA 4GKXA 2AGSA 1HRV3 3BOWA 2YXSA 1U12A 1G9AA 1KRIA 3ZSMA 1COV3 4UW5A 2NMOA 4O9EA 3U10A 2RS11 1XE7A 2CGNA 1AX0A 1S0GA 3CF6E 4KGGA 4DOUA 2ZGRA 1UD1A 2RS33 2ZZQA 1BXHA 5ABJB 3AP9A 3OCPA 2ZGUA 4CDWA 4KL1A 2XLFA 3QH7A 4NWVA 4CP2A 1CONA 4YZ2A 1Z7S1 1ENXA 4CDUA 3B93A 1PNFA 1HXS3 1V6LA 5GJ6A 1OA3A 3RPQA 1EAH2 1PVC1 2BGCA 2DTWA 3RJRA 5KBFA 1G9CA 4YSFA 1MQTC 5L19A 1RUOA 1O4ZA 5A32A 5C6CA 2XHKA 2X8KA 4DRRA 1SLBA 3APBA 1K5MB 1YJLA 1AJOA 4YG0A 3VBSA 1LOAA 4NHKA 4FVVA 1QXRA 3DPRC 1AYN1 4WVWA 2R063 3JB4C 4QXKA 3QACA 1QJU2 1N1VA 3ZFGB 1BYHA 1R083 3VKLA 4AGRA 1QOTA 5DZEA 1LHWA 4NN0A 1YIFA 4FO9A 1POV0 4IEQA 2F6BA 5DDJ1 4KU8A 1BBT2 2WFF2 2A3XA 1KFUL 2XWBB 1D2QA 2Z79A 1RUI1 5K0UB 2DUQA 2UYAA 3QH6A 3NWKA 4YVSC 2R043 3ZYGA 3JUUA 2FQPA 1SLLA 5KWRA 3VV1A 1GZ9A 1XNKA 4FTEA 4KU7A 1UU5A 2ZACA 1HQNA 3IN9A 1RUC2 4I2OA 2GC3A 1M06G 2DCYA 5D1IA 2P2KA 1HQLA 1Y3TA 3WOGA 4JC1A 3ZN6A 5IUQA 2RS13 1RIRA 4UBHA 5HI0A 2XL9A 1PGSA 3FWEA 1OOPB 1OHFA 1SCRA 1UN1A 5IK8A 3JD73 2Q8OA 4XJWA 5EXOA 1NE6A 4ZKTB 3NV1A 5EJ3A 1F2NA 5GKAC 1I3HA 1I9RA 2ZGSA 4Q4X2 4EN6B 3UV9A 3ZSLA 3WD5A 2PA7A 2B45X 1PGW1 3I54A 4AFAA 4LE4A 2HWF1 1F5JA 4FSJA 1WD4A 3D6EA 4YFZA 1RVF1 1PVC3 2P37A 1KDKA 3AKRA 4C90A 5T3NA 2NQYA 4F83A 1VBB2 5JOYA 1FPN2 4AFDA 4AFMA 1HRV2 3AMPA 4RS5C 2Y26A 1YHFA 4KWKA 1COV2 1H1MA 3AP6A 2D3SA 1H4HA 3LA7A 2WS91 4L92A 2DCJA 1OQEA 3RNSA 1L3JA 1I5ZA 1BCXA 2RS32 3HMYA 4OZXA 5HCFA 1V6NA 4BIFA 4AHYA 4D7YA 1RUH1 3AZWA 2D93A 1LGNA 4M3CE 1HV1A 1HXS2 1UPSA 1YO8A 4AK3A 3ENRA 2GC1A 3M3IA 4WM8A 1NA1A 3CJXA 5B2GB 1O4TA 2D6KA 2D6MA 2BFUS 2ZGKA 1IKQA 2O8OA 4IEVA 3NAPC 2WIIB 2I74A 1MS5A 1QH7A 1XNBA 3N7MA 1B35A 4JDMA 4IEPA 2WZPP 4GB31 3VDDB 2R062 2OPKA 5J7MA 1EPWA 1MVQA 2YZ4A 1GR3A 4I01A 1NCQC 5JR7B 4ATFA 5C4WB 4R9DA 2V73A 2WKKA 4AI8A 3IPVB 5CA6A 5I93A 1QOOA 2CAVA 2FMYA 4FPHA 4Z8BA 2A70A 1BZWA 1MQTA 2HWF3 1I6XA 5JI7A 1C8M3 1W6PA 3BOPA 1ZZ7A 5C8CB 5D8AB 2ZPXA 3M3QA 5BNNC 5C8WA 3ZFFC 2UWCA 5C9AB 5FMOL 3I4IA 3ZMOA 2R042 4AQ6A 1O7FA 2RJLA 4I0WB 2MEV1 5LRSA 1XYNA 3DPRA 4R52A 3SHRA 1KITA 3KGZA 3JQXA 1V6IA 4LBQB 4OUMA 5FBZA 3VBFA 5F9TA 5LK7B 3B69A 3ZYPA 4AVBA 1PNGA 1ZZCA 2ET1A 1YRZA 3GHNA 2RS12 4MSVA 3KCYA 2WS93 1O4YA 2I45A 3JD72 2XJRA 2QUOA 2K9ZA 1OLQA 2JE7A 3ZPYA 4XEZA 1DFQA 4JAAA 4R8HA 2RR11 1NZCA 4QD2A 4YVSA 2HWC1 4I02A 3WQ1A 4PBPA 2P3IA 4TYSA 5GZGA 2VNRA 1GLHA 4NVPA 4PF5A 4EV0A 2EXHA 1HDKA 5KHKA 1AR83 1ULFA 3N7LA 5F5QA 1PVC2 4JGYB 4R9CA 1XRUA 4J6GA 3CU7A 4N7UA 1GFF2 3LSEA 3E5XA 1SBEA 1H0BA 4NO4A 4OFGA 4Z07A 4PIXA 4DY3A 1AUYA 5J3UA 1CIWA 4BWOA 5IK7A 1YNAA 3E97A 3N4MA 3H1YA 1W2UA 2QKDA 4XF9A 3P3PA 1J59A 4DQAA 4LBQD 1DZRA 3J26N 3L9JT 3TNPB 2E9QA 4RGGA 4XFHA 5CADA 2JECA 4N43C 5JVVA 4MUVA 3R6SA 4Y26A 4FPYA 3H8UA 1KQRA 4WM7C 4YGCA 4GMP1 1GZCA 5EWSA 3OYWA 4GH4C 1V00A 1G7YA 1UU4A 2BVVA 2WT1A 2P34A 2XJUA 3CJIB 2ZX0A 1W6MA 4PDWC 1PZ8A 3SISA 1D4M1 1RINA 2PYTA 2YROA 4AG4A 3V56A 4UBGA 4IESA 1V6MA 3D0SA 2MEV3 4RS5A 3E5UA 1FOD1 4XBQA 4URTA 2VOKA 4IQPA 4K7JA 3VZOA 4YM3A 2D44A 4AW7A 4FOYA 4R9AA 4AEKA 4C1WA 2DYCA 3BPZA 4LE3A 1SFYA 4AXOA 5JSPA 1NG0A 2JKBA 2B9UA 2A6XA 1TMF1 2EIGA 4XJUA 1W39A 1WMDA 1DQ6A 1JN2P 3WW1A 4PQ9A 5JIAA 1F8VA 3UK9A 1UX6A 4R9BA 2QZ3A 4YVWC 5DXDA 4MGYE 4RA0A 4AVSA 1PGW2 3PLQA 3E5QA 1TEIA 4H55A 2HWC3 3WY6A 2YPJA 2HWF2 4HSJA 1LOGA 5ACA1 1C8M2 1FNZA 2W08A 3GBFA 3NAPA 3S7IA 1DG6A 1PO13 4HFSA 5DG2A 2G9FA 1N3PA 3ZSEA 5JPMB 2IZWA 1TME3 1FMD1 1S0JA 3RRDA 4RR3C 2DCTA 4YW1A 5JZGC 4K20A 4K40A 1WCKA 3ASIA 1NCQA 4Q0PA 3MGUA 1DDLA 3UL2A 4GMP0 4IEXA 4ES9A 4FPEA 2E51A 1S0FA 2Y0IA 3RZZA 2WS92 1VRH1 3VZJA 2B39A 4PLNA 4G3YC 1MVEA 3SH5A 3AKQA 5A3LA 4M01A 4CTEA 5BNNA 4Y22B 3ZFFA 4ZU7A 1W0OA 1Y43B 1CPNA 3M1HA 4DINB 4YGEA 3V0AA 4CZSA 2ILMA 1OMIA 1AR82 2AENA 1CJDA 3LKJA 5JPNB 1D4M3 2XGXA 4E4DX 4MGIE 1PVXA 2GNMA 5J98B 1VLNA 3VHPA 4BA6A 3TYJA 4KG8A 3W59A 1FOD3