3WV6A

Crystal structure of a protease-resistant mutant form of human galectin-9
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
292
structure length
284
Chain Sequence
GSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQHMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQSFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a protease-resistant mutant form of human galectin-9 having two carbohydrate recognition domains with a metal-binding site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-9
total genus 72
structure length 284
sequence length 292
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wv6A02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wv6A01
4RL7A 5IK7A 1MACA 5F5QA 5GZFA 1W6MB 3AZWA 3IPVA 2WT0A 4AGVA 1BQPA 1YRZA 1W0OA 2B7YA 2GNMA 1LEMA 1BXHA 1LHOA 2AR6A 2ZGLA 1YYNA 4P9YA 3GALA 1J1TA 2I2SA 2JE9A 4YM0A 2JJ6A 2NM1A 5JMCA 2D6PA 3SLIA 1V6JA 3BTAA 3AFKA 4Z8BA 4K1YA 3B69A 5JOWA 1C1LA 1WLWA 2DUQA 1S0EA 2AENA 3B9CA 2A6YA 4FOYA 3WDVA 1Q8PA 3RS6A 1IS3A 2EF6A 4FOVA 5IT6A 1QNWA 1UPSA 4PCRA 3VKNA 1SLLA 5JOXA 2VU9A 1F9KA 1OQ1A 2EXHA 2W39A 3FLRA 5T5LA 4XYXA 5T54A 3ASIA 4YW4A 1F5FA 3OBRA 1APNA 5DUVA 1LECA 1LOBA 3INAA 1YIFA 4FQZA 1DYKA 4PBOA 4Y22A 2W68A 4Q8LA 2UWAA 4ZKTB 1R1ZA 1UKGA 3AZYA 1VAVA 1LOFC 2D3RA 3NWKA 4XHXA 5AVAA 1SFYA 4AGRA 1QKQA 1WW5A 3N7LA 1G9CA 1UL9A 4NO4A 2ZABA 3H0OA 1DQ4A 4R9AA 4GA9A 1NLSA 1UN1A 2PHUA 3O12A 1LGBA 2ZHNA 2NMNA 2C9AA 1W6NA 4Q1PA 1S0JA 2UWBA 1MS5A 5IK4A 1MZ6A 1DBNA 4BOWA 1G86A 4Y26A 5GLZA 4YZ1A 1FAYA 4AGGA 4YZ4A 5BYNA 1V6LA 1W6OA 4BM8A 3PVOA 4DS0A 4OZXA 5DZFA 4R9BA 3M3CA 5HCFA 4XBLA 4YZ2A 4YG6A 1ZM1A 3M2MA 4XMAA 3ZSJA 3MW4A 2D6MA 4Y20A 2OW4A 3VKLA 1DIWA 1H9WA 1WW7A 4YZ3A 5T55A 1ZA4A 3FFZA 2CTVA 5JVVA 4FOWA 4Y1XA 2A7AA 4XILA 2ARXA 1DQ2A 2A3YA 2R0HA 2AYHA 2XG3A 2EXKA 2NYYA 4M3CB 3ZXEA 2Q5TA 1V00A 1WLCA 2CNAA 4WVWA 1WD4A 3SNMA 1PZ9A 5H9SA 1FX5A 4FPCA 3UJOA 1ULDA 2CY6A 1IKPA 3R05A 3SH5A 4P9WA 4ATEA 1S0DA 2ENRA 4LBQA 4LBQB 1CPMA 2OVUA 4AVVA 3ILFA 1KDKA 2ZGOA 1MS8A 5T50A 4XOGA 1Q8OA 2D3PA 4YM3A 3MW3A 4LBNA 3FUQA 1QOSA 1Z78A 4FP2A 4M01A 4XXPA 4AYUA 3M3EA 4XXAA 3ZXKA 1LGNA 3ATGA 3ZYRA 1V6OA 2E7TA 3WG4A 1CIWA 2BQPA 4R9CA 4WZFA 1UX6A 3AZZA 1V6KA 1MS1A 2P3IA 4YM2A 5DZEA 1PZ8A 1AX1A 4FQ4A 1Q8SA 1FATA 4DFSA 2ZMNA 5KXCA 1QDCA 3AJYA 4FP3A 3NV4A 2WSUA 4XBNA 2UWCA 1ULEA 1G9FA 2E51A 4ZXKA 5DG2A 1URXA 4BLIA 2R0FA 1JYIA 3WOGA 1GZCA 3RMYA 4XMIA 1N47A 1ENQA 3O0XA 4C1XA 2DU0A 3IMNA 4XJWA 5JLVA 1UMZA 1V6NA 2YROA 1WD3A 2GNBA 1BJQA 1CR7A 1W6NB 2ZA9A 3DUIA 3O0WA 4L8QA 4CZSA 2CWMA 3V0BA 5GZDA 3TAYA 5IUQA 1O4ZA 2ZMLA 1LHUA 4GKYA 3BOPA 1N3QA 4YFWA 5GALA 3D5OA 3W59A 4YM1A 5CA6A 1MS9A 2YXSA 1SCSA 4PF5A 1LOEA 2ERFA 1EPWA 3OY8A 3ZSMA 4XE9A 1QDOA 1QOTA 5CNAA 1JXNA 4DRRA 5KXEA 4P9XA 4XJ8A 3OPZA 4LBQD 1ULCA 4XIOA 3WDTA 2SBAA 1OKQA 3HN1A 4Y1VA 3LSEA 3BIWE 2DV9A 1LHNA 1MS4A 2FMDA 4YFZA 5GZEA 3AJZA 1FYUA 4RA0A 4JRAA 5E89A 2WLQA 5GJ6A 2DU1A 5H9QA 3WCRA 4DPNA 1Z0HA 3SITA 1LOGA 2V73A 4BQ1A 1U0AA 2ZGUA 2PHFA 1RINA 2A6ZA 3UJQA 1AXZA 2WSVA 4XIKA 1SLBA 5T52A 3WNXA 2GN3A 1DFQA 1CJPA 1IOAA 3PVNA 2JECA 3TB0A 3SH3A 1KQRA 1SLAA 2YMZA 2ZKNA 3ZXLA 1KDMA 4MYEA 5H9RA 3AP4A 2ZGKA 3WZ1A 1JW6A 1ULGA 1PZ7A 4R9DA 3ILNA 4Q8KA 3D6EA 3ZXFA 2DYCA 1AVBA 1SCRA 2VH9A 4ITCA 4Y24A 2DUOA 4GALA 3POYA 3POWA 3AXDA 4FPOB 3CNAA 2CYFA 4D69A 3QCWA 3M3OA 1QGLA 1JN2P 5E88A 4YW3A 1GANA 2LALA 3V0AA 4FPGA 5GLTA 3T2TA 1W0PA 1MVEA 2SLIA 3AK0A 3N7KA 4ISQA 2EXJA 1QMJA 5DG1A 3V0AB 1N3OA 2D6LX 2WJSA 4PQ9A 4YW1A 1LULA 1GLHA 2P34A 3PMEA 3AP5A 1DQ6A 1H9PA 3WG1A 4K1ZA 2E6VA 4YZ5A 3LSDA 4JCKA 1IKQA 4LBMA 4Q2FA 4YG0A 2NP0A 1AZDA 1LU2A 5SV8A 3PJQA 4BPZA 4XTMA 2AH2A 1DGLA 1GICA 3RSJA 3IN9A 1I1EA 1GBGA 1GZ9A 2CL2A 5HCBA 2Z42A 4FVVA 3JU9A 1AF9A 1IS4A 4FPFA 4FPJA 1LHVA 5DUWA 2PHWA 1WW6A 1LU1A 1SBEA 3A0KA 2TEPA 3AYAA 2GNDA 3AZVA 4CTEA 4M3CA 2A6WA 3JUUA 1F31A 2D43A 2VW1A 4DQAA 5KXBA 4XTPA 1JOJA 2ZMKA 1HQWA 1SLCA 1KJLA 2H0BA 4Y1UA 2W52A 2RHPA 3WUDA 1C1FA 4UW4A 2DVFA 4YGEA 3ZXJA 4M3CF 2JD4A 4M00A 1Y7BA 5EYYA 4XJAA 4GXLA 2WKKA 4BMBA 1KRIA 2KM2A 1RITA 3WHUA 1W6QB 2WQZC 3WDYA 3M1HA 1UAIA 1FNZA 1LJ7A 3OBTA 3FLTA 2GMEA 4FPYA 1W6PA 4LBLA 1CPNA 3VKFC 2A5ZA 2D44A 1WUVA 1N1SA 4U2AA 5F9TA 5CBLA 2ZGTA 3O5SA 3B00A 4P14A 2ZHMA 3WV6A 3NV1A 2YV8A 3IM0A 4K21A 3LCPA 5DZGA 3VKOA 3AZXA 1ENSA 1GNZA 2GNTA 4U36A 3ILRA 1RIRA 5GZCA 2V5YA 2ES3A 2R49A 1JHNA 2P37A 1S0BA 3U4XA 1S0CA 4UW6A 1GSLA 2JE7A 4TYSA 5EYXA 3I8TA 1S0IA 4FPKA 3I4IA 1LCLA 1LOAA 1W6MA 2EXIA 5FREA 4YG3A 5CB7A 2NN8A 1WBFA 4LBKA 1CVNA 3WG3A 3ZVXA 5KXDA 1G9DA 1MVQA 1VLNA 4XHBA 2P3KA 2G4IA 3POSA 1A3KA 1LESA 5GZGA 3DGTA 1GKBA 3AP7A 1C4RA 2ZGMA 1QF3A 4GKXA 1IS6A 1VAMA 4DRVA 1LOFA 1W6PB 2ZZJA 2GDFA 3AP6A 4AVSA 2ZGPA 2ZBJA 3OYWA 1D0HA 1N3PA 5CAZA 1DQ0A 2EAKA 4ISRA 2WNEA 2P3JA 3QLQA 2GALA 2YY1A 4KBBA 3ZYPA 3AYCA 5EWSA 2DVAA 3FUOA 2ZHKA 2DVBA 4H55A 3VV1A 1QOOA 2GMMA 2UU8A 1Q8VA 2A3WA 2AGSA 3AX4A 5FRAA 3N35A 2DWRA 2ZGSA 4GWMA 3ZSLA 1OFSA 3L2YA 5E8AA 4AVTA 4XJZA 5DUXA 3WDWA 1MS3A 3RMXA 1HDKA 4AWDA 1A78A 2DTYA 4WVVA 1V6IA 1WCSA 2VW0A 2JKBA 1HLCA 3A4UA 1DLLA 3D4KA 3UL2A 3KM5A 1N1TA 3V64A 2ARBA 4GWNA 1QU0A 2DTWA 1FV3A 4UW3A 4ASMB 3GNEA 5EXOA 1GYKA 2ZGRA 2NMOA 3WCSA 2VXRA 1KITA 2A3XA 2DUPA 2UURA 5JOYA 4Y1YA 1FNYA 1S0GA 1CN1A 2VW2A 3RRDA 1O4YA 5T5OA 3WG2A 2OUHA 4XJUA 1AJKA 4FPHA 4SLIA 3OYWB 1SBDA 3T1LA 3ENRA 1N1YA 1ONAA 1G8WA 2A6XA 1X50A 4UW5A 1DYPA 3N36A 5GLVA 4FOQA 2ZACA 1QNYA 2R1DA 3R4UA 4NOTA 2GMPA 4XDQA 1N1VA 1TEIA 1WBLA 2D6KA 1ULFA 3C2UA 4M3CE 1W6OB 4YLZA 1LENA 3OY8B 2E53A 3AXEA 3FLPA 4BMEA 3O0VA 5JOZA 2P2KA 1AJOA 3AYDA 1CESA 4Y22B 2VUAA 2OUJA 2GN7A 4XJ9A 4F83A 3USUA 1YI7A 2FHRA 2PHTA 1VIWB 1AX0A 3T1MA 2DVGA 1Q8QA 1YXWA 1G9BA 2LTNA 1SBFA 5LK5A 3NV3A 3KQRA 1GZWB 1GNHA 3AP9A 1AX2A 1SLIA 3Q9OA 4XZPA 4YGDA 3USUB 4BLJA 2NZ9A 1AXKA 5HCAA 2C5DA 2DURA 5GLUA 2D6NA 4XBQA 3BODA 4PBPA 3PVEA 3SISA 1LEDA 1Q56A 2A70A 2PHXA 1WW4A 1KJRA 3MW2A 4WV8A 1W6QA 4LBOA 1B09A 1D2SA 3MEPA 4I30A 3WDXA 4YW5A 1G9AA 4Q27A 5GLWA 2ZGQA 1G7YA 1C57A 3VUOA 2A6VA 1BZWA 4CRQA 1WLDA 1DQ1A 2R1BA 4IQPA 4JC1A 3HR9A 4Q26A 1YO8A 5DUUA 3A0NA 1HQLA 2DVDA 2EIGA 3FBYA 1AXYA 2E7QA 4W65A 4Y1ZA 1LODA 2WT1A 3RQ0A 2AREA 3OGGA 1GZWA 2AUYA 2CWSA 2D6OX 3B3QE 1H30A 1NXD1 1S0FA 2A75A 1VALA 2EALA 3R4SA 1MR5A 2R16A 5GM0A 3WDUA 1GV9A 1CQ9A 1I3HA 1LTEA 3N3HA 3V0BB 1JYCA 3OJBA 2XB6C 5T5PA 2VY0A 3MPPG 1LOCA 1MS0A 4Q1RA 3SH4A 5IK8A 3AYEA 3IPVB 3ZSKA 1A8DA 2ZAAA 1HKDA 2PHRA 1BKZA 3RG0A 1DQ5A 4HANA 1UZYA 1XQNA 3N7MA 1DZQA 4LBJA 4TZDA 3NV2A 1DHKB 1MZ5A 3N7JA 3W58A 3ZPYA 1V6MA 2A71A 4ATFA 5IK5A 1IS5A 1JBCA 2YZ4A 3V65A 3WHTA 3WUCA 1CONA 1S1AA 2WT2A 2W08A 2ZGNA 3IKWA 1UZZA 4FPEA 4Y20B 4C1WA 4K20A 3HMYA 2D7FA 5JDBA 2HYKA 3B01A 1FV2A 1LHWA 1JUIA 2ZHLA 2PELA 4YGBA 3UK9A 3WLUA 1LGCA 1SACA 5DXDA 1BYHA 1ENRA 3M3QA 4YGCA 2D3SA 5H9PA 3APBA 2JDZA 3VKMA 5T5JA 1SLTA 4YW2A 3WVJA 4HL0A 5L73A 4FPLA
chains in the Genus database with same CATH superfamily
5IK7A 3VDCA 5GZFA 1RUC1 2C24A 5FXVA 3VBFB 4RGAA 4IV3C 4AR2A 3VBHB 4CUBA 2FDIA 4Q4W1 3VD3A 1XXNA 1YRZA 1L7QA 1F4HA 1VBE2 3M4FA 3U1XA 4AI1A 5FJKA 1PGW1 5CU1A 3FFQA 5FYIA 2PLV2 4OLLA 4P9YA 2W91A 3GALA 1J1TA 3NNMA 2D6PA 2RM21 1HX6A 4Y3OA 5CIRA 5JOWA 2DUQA 1S0EA 4ZS2A 1K5MC 2AENA 4Q4X1 2W0XA 2O1QA 2Q0AA 4A3XA 1XBFA 1X82A 4XFBA 1HB4A 3SCFA 4GWJA 1UPSA 3OBAA 5JMOA 1HRV3 5L36A 1F9KA 2W39A 3K51A 5T5LA 3H8RA 4XYXA 1JZ3A 4YW4A 4UFMA 2HWB2 3OBRA 1APNA 1MZFA 1LECA 1YQ2A 5DUVA 3UV9A 3VBSA 4IV3A 3BTYA 1HRV1 3ME2A 3PIGA 3O1MA 2NLRA 3TWIA 1DYKA 1RUH2 1NE6A 2B46X 3ZR5A 4YARA 4JKKA 4GZ9A 3Q8AA 1W2AX 1RUJ3 2IXKA 3DF0A 1RMU3 1B35C 1WGPA 2BOJA 4LORA 4M0NA 5A7PA 1AYM3 3N7LA 3T08A 2OQ7A 2RE9A 2OS2A 3C8XA 3H0OA 1NLSA 5DMYA 1RUC2 4OHYA 2ZHNA 3ACHA 4QT6A 4Q1PA 5L19A 1S0JA 4P9JA 1JZ7A 1MS5A 2HWD1 1PNGA 3V56A 3WW2A 5KHKA 3C7GA 4X8PA 2FDKA 2V5DA 2J1TA 3JD72 5GLZA 4YZ1A 1PNFA 3MHZA 2E63A 5DDJ3 3PL0A 1TMF1 3T2QA 1PGW2 4BM8A 5CISA 5EZWA 1SFPA 4Q4W3 4AI3A 3DYMA 1RUE2 1ODMA 3SEPA 5FYVA 3BIEA 3MW4A 1WCDJ 2OW4A 1OC1A 1SPPA 2JIGA 2R6QA 5C9AC 4INDA 4UFLA 1W05A 1REFA 4FOWA 4Y1XA 2Y6KA 4AEDA 4E2GA 1UU5A 3D8CA 3OB8A 4V1PA 2A3YA 3ZXGA 1W06A 1IPJA 1RUI2 3KV9A 3Q8EA 3ACLA 1JMUB 2OZ6A 3ZXEA 2Q5TA 2W94A 4IW3A 3SNMA 5H9SA 1RXFA 1FX5A 3AKQA 2HYXA 1D7PM 3ACIA 3GHNA 4ATEA 4LBQB 3R6SA 4OFGA 2QJVA 5LB6A 1QEXA 1L7RA 1H8TA 4XOGA 3ZMNA 1Y43B 5JI7A 1VRH1 1YJLA 3MW3A 3B93A 5FMBA 4DUWA 4ES8A 1REDA 3FUQA 3WP4A 5C3QA 2RS12 2VOVA 4XXPA 1VB2A 1W9YA 1W8UA 1OH3A 3PJYA 3VL8A 4AYUA 3VDBA 2UY9A 3AKRA 2TUNA 1QQP3 1V6OA 4HVOA 2BQPA 4FO9A 4C90A 5CFCB 2P3IA 1O3SA 1PZ8A 2P3YA 5IVVA 3THDA 4PIXA 4XFIA 4IETA 4LLOA 2WO7A 2QQUA 4BZ4A 1G9FA 3ZYBA 4YPJA 2OQ6A 2DBNA 4QHOA 3WOGA 3RMYA 3O0XA 2HWF1 4XURA 3R0RA 1V6NA 3C7HA 3JBG3 5FY1A 1CR7A 1W6NB 2ZA9A 2WWUA 3V0BA 2VUJA 5FZAA 3M7AA 1PO23 4NIIA 1O4ZA 2GC3A 2WWJA 3I7DA 3QACA 2HKXA 1KGYA 3AMMA 2ZX3A 4YVWB 5C3RA 4RSUA 4YM1A 1O4TA 2BU9A 4GJYA 2XUMA 5BV6A 5CA6A 2OIIA 2VTXJ 3W5NA 1SCSA 1UZ0A 2EAAA 3PVBB 3KLSA 1TQ5A 1VBA3 2CU5A 3ZSMA 4LEJA 2QKDA 1QDOA 4IE5A 1XE8A 1QY4A 2GH2A 5F8PA 2XJSA 5JSRA 3UKVA 1AUYA 3MF6A 4EWDA 2RMU3 3KV5A 1OKQA 2WLPA 1JOBA 4MX3A 5LASA 4YYOA 3BIWE 1COV1 4XDPA 5DAWA 4CP0A 1W9TA 4MGZE 4BXFA 3BI3A 1QJX1 4RA0A 4M4PA 5H9QA 3WCRA 3ACGA 1Z0HA 3SITA 4B4RA 2JX9A 5FLJA 3WQ0A 2V73A 4COWA 2ZGUA 2A6ZA 2W1WA 5T52A 1RVF2 2X8KA 1C3HA 2GN3A 2XKPA 1DFQA 3LE0A 1UY1A 3VBFC 1Z7S2 4RQPC 4IEQA 3WNNA 2XJTA 3KT1A 3AP4A 1OLME 2XVLA 3IDAA 1JW6A 4Q0PA 1OPOA 1C8M3 3K75B 4Q8KA 2Q1FA 3D6EA 5BNOB 4OHZA 1GNYA 4IE0A 2FDGA 1GOHA 4Y24A 4EZ4A 2W46A 4MH0E 4N90A 4HOOA 3AXDA 4QDQA 1TE1B 3CNAA 2VOWA 1BVP1 2J1EA 4JDMA 4N53C 3FE5A 3V0AA 3LB9A 2LALA 3N7KA 3AK0A 4ISQA 1QMJA 4FXGB 5FKBA 5AC91 3S7IA 1LULA 3PMEA 3WG1A 1DQ6A 4QQOA 3U78A 4YZ5A 2WS91 1ZZCA 4RHV3 2Y33A 1I5ZA 3PIJA 4IE4A 4JCKA 4PIYA 4ZY9A 1OSGA 4AVBA 1GWKA 3DECA 4XUNA 1D0GA 4XTMA 3KWVA 3RSJA 4FAHA 1PGL2 2GH8A 1GZ9A 2CL2A 4WBBA 1NA1C 5A7SA 5K0UC 2HWB1 1O91A 2G9ZA 1PX4A 1IS4A 4FPJA 4FPFA 3ZFEA 2PHWA 2QUOA 4XZUG 1WW6A 2JXAA 1DGWX 1DCSA 4XQ4A 3PTYA 5FZOA 2JICA 2TEPA 2R063 3AL5A 1RHI2 4UAPA 1QJX2 4NVPA 1YUDA 4CXXA 4XW3A 2QQWA 2X53S 4MGIE 4QB2A 1JOJA 1SLCA 1NYWA 3MDPA 4FXKB 1Y4WA 2H0BA 4PT6A 2TBVA 4Y1UA 1AR82 4PLMA 2W52A 5ACA2 1Z7S1 3WUDA 4O9EA 1QJU1 4YGEA 2JD4A 2ZS6B 1VBE3 3VB9A 4I0AA 4IDZA 4AE2A 3KCXA 4MGTA 3JD71 1WLTA 1UAIA 5A33B 1LJ7A 3MLJA 3NMBA 5CG8A 4B7KA 4OVEA 4J1XA 4LBLA 4LQRA 1UWWA 1T6GC 4LR4A 5LBEA 1YFWA 4U2AA 5CBLA 4CDUB 1ZBE3 4Y4RA 2IWGB 2W1QA 4NPLA 2DCYA 4UOJA 3F2ZA 3GXUA 3WV6A 2AACA 2YV8A 4ARXA 4QQ2A 4DMIA 1GNZA 3P3NA 4U36A 2J1VA 1GMMA 1OUXA 1HRV2 5GZCA 2ES3A 4QX3A 1CAVB 2VNOA 1JHNA 4K8FA 3WP6A 1S0CA 4META 1GSLA 4RN5A 4TYSA 4Q4Y1 3ZO0B 1S0IA 2FCUA 4FPKA 4PHZA 1UY4A 1W6MA 2QQJA 4C8DA 1UX7A 3WG3A 3U37A 4A41A 1VLNA 1FT9A 2P3KA 2QQNA 5FKCA 3N9NA 1KS5A 1AYN3 3R4DB 1LESA 3OGSA 5GZGA 1US3A 1GKBA 1RHI1 1C4RA 3AP7A 4QQLA 2ZGMA 5IW0A 4GKXA 1PK6A 2VCBA 2YFUA 1WCUA 2H6BA 2ZZJA 3C7EA 2XJVA 3MV01 1PMIA 2ZBJA 4RQPB 5A33A 1OXCA 1RUF2 4IL7A 3RWKX 5IAXA 2HBTA 2JDPA 1YQCA 4CDXB 2V09A 3QLQA 4I0WB 3RWNA 5GKAC 2N7GA 4RR3A 5IJRA 3ZDVA 2DVAA 4QX1A 4ZONA 5K0UB 4J25A 3AFGA 1QOOA 1Q8VA 2AGSA 2D93A 3NNJA 3MO4A 1OQDA 2BZDA 1VBA1 3THPA 1SDDB 4AVTA 1OLRA 1H8VA 4EN0A 4W4ZA 5FPZA 1TZOA 3PHMA 3WDWA 1MS3A 3RMXA 1HDKA 3ZYJB 3VD7A 5JSPA 1WMXA 2BPA2 1Y9MA 4MXVA 3VN4A 2GC0A 3J7HA 4AEMA 2BFUL 1WA4A 1FPN3 3Q8CA 4E2QA 1ZREA 1DLLA 4HKWA 3VBUB 4JHZA 3POIA 1QU0A 2Z79A 1FV3A 4L2NA 4NAOA 2OX0A 3ZXDA 4L92A 1K5MA 1WMDA 4QGMA 1SEFA 1TG7A 2LUWA 2HWF3 2A3XA 5JOYA 3IB3A 1W8OA 1XU2A 4HN1A 5J48A 4QHBA 4XF9A 4NHKA 2CHHA 1AJKA 3K4ZA 4AEDB 1AR71 1ENXA 4AI0A 3T1LA 3B94A 1G8WA 4UW5A 4TXWA 4WM7A 2MNGA 5F3EA 3GZEA 5J98B 3K2OA 3MV11 1UYZA 2WNVB 2VNRA 2ZACA 2R1DA 4NMIA 4PDWA 5FPAA 3TNPB 5FZ1A 1VMJA 2RS13 2XQXA 4MGYE 1RUOA 4NJ4A 1BEV3 2OPWA 1B35A 3QOPA 5FPBA 2ZX4A 1AHSA 4P9IA 2VNVA 3KV4A 3KS7A 2JDMA 1KEXA 3AYDA 3JB4C 4JGYC 4SBVA 2VUAA 1LR5A 2RMU1 4UF0A 3BTXA 4NPRA 3WNMA 1UNBA 5DABA 4AFDA 2O8OA 3FMGA 5A3WA 1X9PA 1RUJ1 1NZIA 1GZWB 1AX2A 4JKLA 4YGDA 3JXSA 1SQ4A 5FYSA 3O1PA 4BLJA 1YQ6A 1AXKA 3DPRB 4N9HA 5A6ZA 5FDBA 5GLUA 3VBOC 5FTTC 1GP5A 3PUQA 4X8NA 4PBPA 3PVEA 3SISA 1LEDA 3I59B 5E6HA 1JOPA 2ZX1A 3MW2A 1BK0A 1W6QA 4C0HA 1D2SA 3IBMA 3LD8A 4Q27A 3BOWA 2HWC2 4S2HA 4WM8A 4HVRA 5F37A 1G9AA 1AR91 2A6VA 1ZBA3 1NKGA 4DEVA 1WLDA 1QJY1 4JC1A 5FYCA 5F5AA 3T0BA 1YO8A 3LEGA 5DUUA 4AL9A 3UGGA 2VMCA 1PIV1 1AXYA 2E7QA 4LUKA 3VHNA 1C8NA 5FO9B 2ILMA 4D7TA 4PF1A 2WZ8A 2F6BA 1BBT2 3LIHA 3RQ0A 3T4HB 2BDRA 3OGGA 2CDOA 3KMHA 4DXRA 1YQ5A 2CWSA 4JGZB 4LO7A 2CV6A 1VALA 3DKWA 5BXXA 3HN3A 5GM0A 5JXJA 1NLRA 1GV9A 2P17A 3V0BB 1JYCA 3OJBA 3LA3A 2ETEA 5BPXA 2PFWA 5JAXA 2HWD2 1LOCA 3MPPG 4BB3A 1QJFA 2J1UA 2BWAA 1C5HA 1GQPA 3ZSKA 3SKVA 4CDQA 5A3UA 4OZOA 4GD4A 4MOAA 3VBFA 1HKDA 1W8NA 5FZKA 3ETPA 1DZQA 3NV2A 4IERA 3ZPYA 4CU8A 1QJU2 1V6MA 4ATFA 1IS5A 1UKRA 1PVC2 5HXMA 1C8M2 1CONA 2WT2A 2XL9A 4Y20B 4E27A 4RS5A 4K20A 5IVFA 2WYFA 2D7FA 2IUWA 4IGPA 4QPGA 3S0MA 1ZZ7A 1LHWA 1W9FA 2QBXA 1BCXA 3RZGA 3NNFA 5IFTA 2WZR2 4UWDA 5DXDA 1BYHA 2QQVA 3H1MA 4CCCA 5CKQA 4Y4YA 4QXCA 2BERA 4I01A 1W04A 3FHIB 2JDZA 2DFCA 5D8AC 5FYBA 3VKMA 2BJSA 1F2NA 4GB33 4IEVA 4JTOA 1NX9A 5L73A 5F3CA 1CAWB 2O0OA 5FCCA 2RJKA 1IG0A 4D6SA 1S4CA 4IEYA 1EAH3 4RGKA 1PIV2 4LK6A 4MVTA 4EQVA 1W6MB 1VRH2 4NPMA 1OOPC 2RS33 3MLLA 3VBHC 1VBC1 2VOKA 4QM9A 1W0OA 1RUG1 3UGFA 4NRPA 1LEMA 1GU3A 1KD7A 1NOVA 1LHOA 1UY0A 2AR6A 2K9ZA 5FBJA 4X6RB 1VRBA 3H3UA 1S55A 3NL1A 4WVMB 2ZEZA 2VCMA 5KWRA 3CF6E 2C4XA 1YYNA 3TYJA 2WC2A 5JMCA 2JJ6A 2RDQA 3AM2A 1M06G 3SLIA 1RMU1 1VBB3 3QH7A 2ARCA 3AFKA 5KHHA 4AXOA 4CDUA 2JG8A 1OT5A 3GJBA 3PURA 4L11A 1C1LA 1WLWA 4BIOA 3TEZA 1AR83 1UU6A 2EICA 5LCWL 4P5HA 3J26N 5A6YA 2QZ2A 4TTGA 4QX7A 1IS3A 4X6QB 1QH7A 2ZKLA 1ZVFA 2XBO1 4CDQC 4AOCA 2VU9A 3OCPA 1OQ1A 3VBRC 4NROA 5FYHA 4L97A 3RZJA 2Y8KA 3UYJA 2F4LA 2XXZA 3QH6A 5IATA 3I2HA 3C7FA 4EE2A 3BGAA 3INAA 4UF0B 2DF7A 1BLZA 2WFPA 2Q8EA 4PBOA 1ZBE2 2HJIA 3KT7A 5M0TA 2UWAA 3WP3A 4CDXC 2FQPA 2A73B 2D3RA 2BEOA 2RDSA 2VOTA 3ACFA 1GP6A 1SFYA 2QVSB 5AVAA 1QKQA 4URAA 1PMHX 1CAUA 1G9CA 3THTA 2VQ0A 1DQ4A 1VBB1 4GA9A 1VP6A 2GU9A 2NMNA 1R092 5KC5A 1CD3G 4QXBA 1OH4A 1FXZA 1W8HA 4QQHA 5HV0A 1G86A 2PAMA 4KG0A 4A45A 2C1FA 4CXYA 1FAYA 1RUC3 4ZU7A 1IPKA 1AYN2 2XLGA 3I97A 3SXWA 4DS0A 4XFAA 5DZFA 4UI9L 5CZKA 5I0DA 4QKDA 1UW8A 3H8XA 3ZLIA 4YG6A 1SZBA 4YWAA 2WNUC 2Y38A 2GZWA 5FYMA 1WW7A 1OLQA 2IVIB 5T55A 4CA9A 4COZA 3E97A 2CTVA 4XILA 2XJQA 1O5LA 3WF0A 4XETA 1RUI1 5FP7A 4DY3A 1NXMA 2RG4A 2WINB 1W8FA 2XG3A 5ERLA 5A32A 2BYVE 2NYYA 4M3CB 4QKFA 5FIXA 4C91A 4R8HA 4A2UA 2CNAA 1WD4A 4BDVB 2V72A 5LY2A 2XDVA 1JZ4A 4HKLA 1JTZX 1PGL1 2YBKA 1E5HA 1ULDA 5IWFA 1RUI3 2R30A 4FSJA 2ADDA 1XNAA 2XJPA 3KSCA 5FZLA 4EN8B 1CPMA 4YW6A 4QPIA 1UYPA 2WA3A 3VBRA 4BJ0A 2X5IC 1Q8OA 4YM3A 5JPNB 2QQMA 4LBNA 2PHLA 5KHIA 2Y26A 2PA7A 1Z78A 3GZTB 4FP2A 4M01A 3M3EA 4QAWA 1KS4A 1R1A2 2JD9A 1HW5A 3C3VA 1CX4A 3GF6A 3IT8A 1JU4A 1NE4A 3E1F1 4QPGB 3BU0A 5BNQA 4H7LA 4QB6A 1AR81 1PO13 3WF2A 4AEJA 4RGGA 5KC6A 3RNSA 3VD4A 4FQ4A 5T3NA 4LK7A 5KXCA 5C7GA 1QJY2 4EROA 4FP3A 3NV4A 4QX2A 3K3OA 2R042 1P8JA 2YUEA 4XBNA 3URFA 2WL1A 4RD7A 2K0GA 2E51A 3AMNA 5DG2A 4ZXKA 3WW1A 1URXA 1FMD3 5TSWA 2R0FA 4PDWC 2VBPA 4XMIA 3VBOA 1BVVA 1ENQA 3NAPB 1J1LA 2P6CA 3WX5A 3CMGA 2VO5A 4RHV1 4BCUA 1DZRA 5GZDA 4XABA 4KGGA 3MPBA 3TAYA 3ES1A 2VBDA 1HRI3 2ZMLA 1LHUA 3CL1A 2JDAA 5IVEA 3G6JB 3BOPA 1N3QA 3NNLA 3OBZA 4OCTA 2G9GA 5GALA 3U14A 4D6QA 3W59A 1HB3A 5EPAA 4G3YC 5BNPB 3RDIA 4EN6B 4CCMA 4RR3C 1MS9A 3MIDA 5LA2A 3W9AA 3J7LA 4CDUC 2YXSA 2YPJA 4CCOA 5FXWA 3X29B 1C5IA 3NVCA 4N53A 4QU1A 1UOBA 3BALA 4I2OA 2WQ8A 2Y34A 5CNAA 5LA0A 1C8M1 5IYYA 5KXEA 4XIOA 5IVBA 1XB9A 2LS6A 3WDTA 2SBAA 1ZRDA 3EQEA 5ANQA 3S6PA 2L9LA 2YGMA 4F7ZA 4Y5SA 1MS4A 2FMDA 2FDHA 5EHDA 4YFZA 5GZEA 3AJZA 1ZX5A 4S2FA 3M3IA 2QNKA 3HJRA 4K3UA 4KI5M 4D7SA 1CGPA 4BQ1A 5LEKA 2GSYA 2WSVA 1SLBA 1QJZA 1ZRFA 3LPGA 2JKXA 3PDQA 3ZFEB 4COVA 3DEMA 1TMF3 2JECA 3SH3A 2ZKNA 4CU9A 4LLFA 4I0BA 1PZ7A 4QXHA 1IGOA 4OMCA 3HQRA 1AVBA 3D0JA 2DUOA 1W39A 4GALA 3T0AA 1NG0A 4IGOA 3RFRA 3ZFGB 5JIUA 3POEA 2QQIA 4DO0A 4JRLA 2VR4A 4D69A 3AVRA 3WF4A 1JYTA 3M3OA 1JN2P 5DQ0A 5E88A 2CSGA 4HLTA 5FO8B 2ZEYA 3THCA 3E5XA 2SLIA 1MVEA 4HETA 3OPTA 3V0AB 4NAMA 4FCAA 4COUA 4R4ZA 4PQ9A 4CSWA 1POQA 5C9AA 1ND2A 1OUSA 4LBMA 3RZLA 1F5JA 1LU2A 3PJQA 4BPZA 5I93A 2JG9C 3MICA 4FI9A 1GICA 2VUCA 4DEQA 4QKBA 4QHZA 4Y5Z0 3JU9A 3D82A 1XSRA 4H14A 2BW8A 3J8F1 1XNCA 1MQTB 1LU1A 1SBEA 4P08A 4MUVA 4AFBA 3H9AA 4G9SB 2VZQA 4CTEA 2A6WA 2VW1A 3DV8A 4QD2A 1VR3A 4N43B 5D8AA 3EJKA 4DQAA 1EY2A 3BVCA 3BKZA 5KXBA 1UY3A 2B8MA 5D1IA 1I6XA 3WD5A 2VVDA 3I3EA 4QU2A 1O3RA 2VZRA 2HWE1 3AKTA 1KJLA 1EAH2 1PIV3 1TNFA 4LHLA 3H8OA 1R081 1C1FA 2BTVC 1QQP2 4TWTA 2DVFA 1RUNA 2WNOA 4M3CF 4XJAA 3PLQA 5FMCA 4CVUA 3I3MA 1LB2A 4MADA 4OMDA 3WHUA 5FOBB 3WDYA 3H42B 4Z2AA 3HAGA 3NW4A 2GMEA 4FPYA 3FBMA 3S5QA 3WNOA 3VKFC 3RZKA 3SC7X 1WUVA 5BNNB 3P5BA 5AFBA 4XF1A 1JZ8A 3M8LA 4K6BA 2GP5A 3O1OA 3KGZA 3B00A 3KCYA 4P14A 1MEC1 4JKMA 1QXPA 4EZHA 4J1WA 1ZRRA 4LJHA 1W8TA 2PTMA 2VMDA 3EHKA 3VKOA 5F7UA 4KU8A 2ET1A 3ILRA 1RIRA 3E6DA 3ZDSA 5I0TA 4CCNA 1CAVA 4JZRA 3LFIA 5FYUA 4FAGA 2JE7A 5EYXA 3I8TA 3GBFA 3HD8B 3VDDA 2EXIA 5FREA 3U4SA 2DCTA 2NN8A 3KF5A 2MEV1 1CVNA 3PUIA 4OUMA 5KXDA 3I3DA 1G9DA 4BISA 5CFDB 4NIDA 3POSA 4ZPIA 2WQ4A 1A3KA 2HWC1 1V9U3 4IEPA 2WNUB 5SV5A 3RZHA 4AW7A 4IXLA 1E5RA 3DGTA 4P00B 5FZ8A 5CFCA 1IS6A 4DRVA 2RS11 1W6PB 4BA6A 3VZOA 3U75A 3AP6A 2ZGPA 2R32A 1ND2B 2FBEA 1D0HA 1NY71 1HN0A 3HNBM 4WVZA 3KCCA 1NLQA 1DQ0A 4ISRA 3BTZA 2FD8A 2VG9A 4UFHA 3H7YA 5EQUA 2WFF1 2X09A 5DN2A 3AVSA 4KBBA 2XJUA 5EWSA 4I09A 3FUOA 3VV1A 1RHI3 5C70A 2PAKA 3MFAA 2XHNA 1ASJ1 3CDZB 3E6BA 4XJZA 4YW7A 4RYDA 3PUSA 1F4AA 1ZZ8A 4JGYA 4MG2A 4OI1A 1A78A 3MBWA 1YWKA 5FAXA 3GBWA 2VZSA 4KBZA 2ID4A 3D4KA 1N1TA 1OVPA 1HRI1 1POV3 2WUHA 5FP8A 5ABJC 1OA3A 2I74A 3T09A 4ASMB 4O7XA 1K5MB 4OI4A 3DN7A 1EV13 1OD5A 3B5LB 2PAEA 4NE9A 4DY5A 1PX3A 4CUGA 5KHGA 1KITA 3HQUA 2UURA 3FC0A 2IXHA 4MGKE 3H7JA 1CN1A 3RRDA 1O4YA 5T5OA 1TNRA 2OUHA 4BYYA 3LQCA 2YGLA 2WR9A 3OYWB 1SBDA 2YPDA 2WABA 4Z2WA 4XDOA 2FDJA 4GH4C 3KHBA 3VBSC 1QHDA 3TN91 4NIHA 2ORXA 1QNYA 3R4UA 4Q29A 1NA1A 1NCQA 1PO11 1N1VA 2GMPA 5F5IA 5A7WB 1TEIA 3CIHA 1OHFA 4A7ZA 4LKSA 4A4AA 4LE4A 5CFDA 4AAXA 3NKGA 2J1RA 2VQTA 3IDEA 2J7MA 1LENA 3LEMA 3OY8B 3I54A 3U0ZA 4BMEA 2QQOA 3DCQA 3BPSA 4D0QA 5HBAA 3L2HA 2R062 1CESA 3OF1A 1QJX3 1UO9A 2I45A 2OUJA 4LNVA 5BNPA 2GN7A 5F6LB 2R043 3DL3A 1COV3 4BQ4A 3WEZA 2RR11 4KWJA 5EP9A 1VIWB 2G9FA 1O6UA 2ZOEB 4PI0A 3WXPA 4COYA 2DVGA 1YXWA 3I2KA 2OYZA 2F4PA 5C8CA 3WNKA 5LK5A 1POV0 5FPXA 1GNHA 3AP9A 3CZUA 2IXCA 4S2GA 2ZEWA 3N9MA 5HCAA 3PUHA 2DURA 2D6NA 1ZBE1 1YQ8A 4QGNA 3NAPA 1UQXA 1UOGA 2ZPXA 2VM9A 1HRI2 2A70A 2W9XA 4OUSA 1WMFA 4UFKA 1Q3EA 3BU7A 2W2IA 4WV8A 4CPBD 4FFFA 4HBNA 3MEPA 2VTFA 4YW5A 4HZFA 5G04L 4RS5C 5GLWA 4A6SA 5C5UA 1O8PA 1G7YA 5FZ6A 3ZYGA 2F17A 4GMP3 5FY5A 2UYAA 3LF7A 4N7IA 4CRQA 4OUEA 4BQXA 1W28A 1VBD3 2D5FA 2DVDA 1D4M1 3EB7A 3U11A 4CYDA 3OUIA 4LKDA 1OF4A 3RYKA 3TEWA 1SDWA 1YHFA 1REEA 2P5BA 1LODA 2WT1A 2PXJA 3RPQA 2EIDA 5I0RA 4LO8A 3K4DA 2MPFA 1BHGA 2A75A 1H1MA 4IV1A 2R16A 3CQOA 1DYOA 1H4GA 3ALQA 3QBQA 3WDUA 4IESA 1CQ9A 1I3HA 4URTA 3TRSB 1O59A 2XB6C 1U5XA 2VC9A 1NCQC 4PI2A 2I07B 3LGRA 3LDKA 4G4FA 4E4HA 1U5YA 3VBHA 2XR4A 5LBBA 4J6GA 1V9U1 1TMF2 3RG0A 1DQ5A 2RDNA 1UZYA 1XQNA 3IWZA 3N7MA 4TZDA 1TVGA 1JBCA 1STMA 1L7LA 2YZ4A 3GM8A 1NA1B 4RS5B 5FZDA 2RM22 5A7WA 3V65A 3WHTA 1UZZA 5JPMB 5FZ3A 2QE3A 4C1WA 5LK7B 2H6CA 3WINE 4KMQA 4YVWC 2YC2A 5C4WB 2VZ3A 2PELA 5FP3A 4CDWC 2VOXA 4D94A 1OQEA 4YGCA 1IG3A 1H8TB 2D3SA 1AR61 2PN5A 5EV7A 5H9PA 3UKNA 3GCXA 4AK3A 4YVSB 3ZFGC 2H0VA 1FPN2 5KBFA 3RJRA 4D6RA 1PVXA 3O1RA 1SLTA 4KGQA 3NRUA 3A7QA 3MIHA 1UF2C 3ZR6A 1H0BA 1XYNA 4JV4A 5FZGA 3WNLA 3MIGA 4AI2A 5FY7A 4F3JA 2QDRA 2RVAA 5A70A 1TME2 1D4M2 1VBC3 5DAXA 1J59A 1ND2C 3TN93 3IPVA 3HBZA 4GB32 1T6BX 1ZYBA 2HWF2 4MGQA 4XCAA 4XF4A 2GNMA 1T2XA 3QD6A 4XF0A 3F95A 3CKHA 1CWPA 1CIYA 4MGSA 1R083 2QZ3A 1HJFA 2LW8A 5BY5A 3WF3A 2I2SA 4YM0A 2NM1A 1WKYA 3MGUA 5FPUA 5J1XA 3BTAA 1W0NA 4Z8BA 3BYWA 1W90A 2XJRA 3FZ3A 3B69A 4CU7A 1NZCA 5I8YA 1HJGA 3GYDA 1HXS3 3WW3A 2BGCA 2HLEA 4FOYA 2ZTNA 3MUY1 3RS6A 3NSTA 4E4DX 1LRHA 4RFRB 2XBO2 1CAXB 4CEYB 5IT6A 1QNWA 3DPRA 4XCBA 3VKNA 4PCRA 2BBVA 1YIPA 2EXHA 5FZHA 3RI9A 3FLRA 5HV4A 4TSVA 3NJVA 2ZAHA 2UYBA 3HVDA 1NCRA 1OKOA 2PMWB 3HT2A 5T54A 1JYVA 5FFOC 2KA3A 3AL6A 1ZNPA 1LOBA 1F35A 3K48A 1EUUA 4N7UA 3KZ4C 1H1AA 4FTBA 1YIFA 4JQRA 4FQZA 4YNIA 2YDEA 1M4WA 3HBKA 2W68A 5JZGB 4HSLA 4YVWA 5F32A 1OMIA 1R1ZA 1UKGA 1O7FA 3NWKA 1VAVA 1LOFC 4XHXA 1RUD2 4ASLA 2PHDA 4AGRA 2K46A 3ZFFC 4XAEA 3UT0A 1UL9A 1AL22 1IQDC 4XUTA 4Z92B 2ZABA 1UN1A 2WO2A 1TME1 3O12A 3T3YA 3KF3A 2WNVA 1W6NA 4PDWB 3VZNA 3VDDC 2HWC3 2AC1A 3IAPA 2RJ2A 4I02A 4BOWA 3RJ2X 2VMEA 1RTVA 2NQYA 2D40A 4YZ4A 3WF1A 2W92A 1R093 1YNAA 1US2A 3PVOA 4NN0A 1X9TA 3L9JT 5FK8A 5L7OC 2VAUA 3M2MA 4P02B 2FMYA 4MLOA 4GAZA 1BBT3 5A1LA 1VRH3 3AKSA 1AR73 1H9WA 1XNKA 4YZ3A 1RXGA 3I2GA 3M70A 3T2PA 5IHRA 3O1TA 2G19A 5JVVA 1JH5A 1ASJ2 2A7AA 2X10A 3Q8FA 1AYM1 1AL0G 5I8SA 2W87A 1DGWA 5D8AB 2EXKA 3S30A 3WQ7A 3N9QA 1V00A 4WVWA 5FZIA 2Q4SA 4CEWA 5A7OA 1W2OA 3FL7A 3E6CC 3R05A 3SH5A 2ENRA 1XNDA 2WO3A 2OVUA 4DNYA 1KDKA 1MS8A 4CCKA 5T50A 3DKQA 1JS9A 2B9UA 3GDBA 2B42B 5FK7A 1QOSA 2P4EA 3J7MA 1DU3D 4QDSA 4XFGA 1HV1A 4XXAA 3ZXKA 1S2EA 2LRPA 3MUZ1 2QQKA 3ATGA 3ZYRA 2E7TA 3WG4A 5DDJ1 1CIWA 1PMJX 1UX6A 5A7NA 4EN7B 5DZEA 4UXAA 1XU1A 1XRUA 2BVVA 1HB1A 2V4AA 4DFSA 4MHUA 4CP9A 1QDCA 3AJYA 5G05L 3ZFFA 2IC1A 5LY1A 5IFPA 3CHXA 3IIAA 2XWBB 3MI8A 4W6YA 5DAPA 3MLKA 4BLIA 2VZUA 4AVAA 4W8JA 5A3NA 1GZCA 1OOPA 1UIJA 1QJY3 4GH4A 4HSJA 4LKEA 2DU0A 3IMNA 2RDRA 5JLVA 2IXIA 1UMZA 4JQTA 4LBJA 2GNBA 2RS32 4CZSA 3DUIA 4N9IA 2CWMA 1FMD2 5HXVA 4DXSA 5FZ4A 5IUQA 1I9RA 3WQBA 4GKYA 4WZCA 5K8SA 1C28A 1JHJA 5JCTA 4MZUA 2YU2A 4LTAA 4YVSC 3D5OA 2D98A 3POJA 4IEWA 2VNGA 4QX8A 1H2NA 4IEZA 5FUNA 4FTSA 4AHWA 4DIQA 4F8AA 2ARAA 1LOEA 2ERFA 1EPWA 5LBCA 3PU8A 4AQ6A 3OY8A 3WSOA 4EJRA 4XE9A 2JG8B 5A7QA 1QOTA 4DRRA 1JXNA 1HXS1 4HPKA 3O1VA 1WZXA 4XJ8A 2WBKA 3OPZA 4LBQD 1ULCA 3OUJA 4FBFA 1PHMA 3HN1A 2VMHA 4Y1VA 5JUVA 5F5CA 2BOIA 3MFCA 3RYRA 4HKOA 2VZPA 2DV9A 2R041 1LHNA 2J42A 3AC0A 2WDBA 3LA7A 1FYUA 5E89A 2LROA 4JRAA 2WLQA 1BEV1 2DU1A 3ORJA 5FLHA 5I8TA 2XKOA 1LOGA 1UPIA 3D0SA 5FZ7A 2PHFA 2Y6JA 1FI2A 1KXGA 1A8MA 1RINA 1AXZA 1ND3B 2Q30A 3ZFEC 3ZOIA 3ZX7A 4AVCA 3WNXA 4Z1VA 4OYUA 3PVNA 3TB0A 1BMV2 1KQRA 5AC92 3VL9A 1SLAA 1VMHA 2DCJA 1BK1A 1R1A3 1KDMA 2VPVA 2VZVA 5F3GA 1W3VA 1QWRA 2JEMA 4Q0VA 4GH4B 1ULGA 3VBUA 3WZ1A 4CEWB 4NRQA 3J7NA 4NHYA 3JCIA 2WNVC 5A1FA 3K77A 3ZXFA 4EWAA 1SCRA 2VH9A 4Q4X2 3LDRA 2WN2A 5C4WA 3POYA 5FP9A 4YSFA 4FPOB 3VHOA 5J37A 2BRTA 2CYFA 2PQQA 2Z4FA 3QCWA 1QGLA 2RJLA 1YFYA 4FPGA 2VMGA 5GLTA 1WA6X 2BV4A 1W0PA 4LA2A 5DG1A 4OQ8A 2EXJA 2D6LX 2EVXA 1GWLA 1K12A 2WJSA 2WS93 2Z69A 4YW1A 5FMOS 1GLHA 4CE8A 1POV1 4K1ZA 4LE3A 2PQSA 4K40A 3RGBA 4HFSA 5LA9A 1IKQA 2HH9A 4Q2FA 5LW9A 2VZTA 2NP0A 5SV8A 4O9GA 5APAA 2VXJA 4ZU4A 2JDNA 2X29A 3ZN4A 3SEEA 3IN9A 1J58A 1GBGA 1OA4A 1I1EA 5HCBA 4HK9A 5DAVA 2QDNA 1V70A 2CDPA 3T4VA 1FOD2 4QPIC 4ET7A 1HIXA 4XFFA 1UXXX 3A0KA 3BN6A 3ZYHA 4O65A 3ZYFA 4PLOA 2D43A 2B45X 5JXGA 2VECA 4NHMA 4AEKA 2R061 3ZN6B 1XE0A 4QXKA 2VQAA 3CU7A 1GUIA 1HQWA 4ASKA 5ACA1 1AYN1 2E9QA 4BIFA 1D4M3 2RHPA 4R4XA 4QKNA 1VBD1 1Y3TA 1F8VA 1NCRB 3TN92 4M00A 4E9KA 1Y7BA 5EYYA 1PO12 1KRIA 4WM8B 2KM2A 2BVBA 4H7MA 2YC4A 4Q4Y3 4V2VA 1RITA 1UD1A 1RC6A 2WQZC 2HEVF 3CJIB 4CP1A 2MEV3 1U12A 3OG2A 4KQ7A 1XC6A 1FNZA 5AFEA 2VD7A 4GMP0 4BQ3A 3JQWA 2XMLA 3GZUC 5AC93 2X5IB 1CPNA 1J3PA 1H6XA 1OVSA 2A5ZA 5C8WA 2E26A 1W8WA 3POGA 2ADEA 4CDWB 5F9TA 5JR2A 1WCQA 2FCTA 4BHPA 2ZJCA 4UFJA 1K45A 1CAUB 4B1MA 2Y0IA 5FZFA 4KG8A 3AZXA 3I59A 2VGDA 3I2DA 3JQXA 3ZPOA 1RGSA 2V5YA 5FR3A 2R49A 2P37A 1S0BA 4JVAA 3U4XA 4UW6A 1RYYA 4N43A 3CO2A 3I4IA 1H6YA 1VBE1 1LCLA 1LOAA 3NO8A 4CEYC 1X33A 1PO21 3PNAA 1MZEA 4YG3A 4CP2A 1O3QA 1WBFA 4LT5A 1A6CA 3JBG1 4TN7A 4DOUA 2RS52 4Q4V2 4CXWA 2ZXQA 4XUOA 1QF3A 4LULA 1VAMA 4P5YA 2DDUA 1LOFA 2D5HA 2BUKA 2WFF3 4AVSA 2VVFA 3OYWA 3TOJA 4GULA 1V9U2 1AL23 4V2WA 5F39A 2JDYA 2P3JA 2P6HA 2PLV1 2VTXA 1J3QA 1KFXL 4H55A 2VZ1A 3AX4A 5CADA 4QM8A 5IK4A 5FRAA 4GWMA 4WM7B 3OGJA 1OFSA 3BPZA 3VZMA 3HWJA 5CFDC 2FZ2A 5DUXA 2R073 4GJZA 5J3UA 5E1RA 5FUIA 5D2AA 4PJYA 1UMIA 2BGPA 2YC0A 5JZGA 3HIFA 3IZOA 4WVVA 1JZ2A 2VW0A 1AR93 2HEWF 1WWYA 2GAUA 5L9BA 4LHKA 3UL2A 4HXCA 3OD4A 1W2UA 2ARBA 4GWNA 1R64A 2EA7A 4UW3A 2Q8CA 3GNEA 5EXOA 4AHYA 1SPPB 2D97A 5C4WC 2NMOA 4KWKA 4AQ2A 2VXRA 4ORFA 3HEIA 2XLFA 1ODNA 5FZ9A 1RUH1 4KWLA 3DPRC 3IDCB 4Y1YA 5FWJA 2W95A 3WG2A 4M0HA 1RUG2 3S7EA 5C71A 1EV12 3NAPC 4NHXA 4FPHA 4RQPA 1XYOA 1XPWA 3VGIA 5KHJA 5F1RA 3ENRA 1N1YA 4A3ZA 2A6XA 3NJXA 1ZZBA 1X50A 4WM8C 3N36A 3P3PA 4FOQA 4KWUA 2RS51 4NOTA 2X05A 4LHSA 3I2OA 1R091 5FP4A 1UOFA 2A1XA 1ULFA 3C2UA 2ZX0A 3JZVA 1W6OB 5FWEA 3VDDB 2HWE3 3FLPA 4A7KA 3ES4A 5JOZA 1AJOA 4Y22B 1PK6B 4H2AA 2FDFA 1X36A 2PYTA 4IV3B 2RR12 2VCAA 1LAJA 3USUA 1YI7A 2FHRA 5B2GB 1AX0A 2AZ5A 1G9BA 2LTNA 1KFUL 4JGZA 1UCXA 3NV3A 5FZ0A 3LKJA 3Q9OA 3USUB 2P1BA 3VDAA 3P6BA 1E5SA 1RJ7A 1U5IA 3FHQA 3GBGA 3POBA 3VZKA 3W21A 5J96B 4XBQA 4YRDA 3VBOB 4JAAA 2WN3A 2ET7A 1WW4A 4C0BA 3S57A 3U07A 1B09A 5FZEA 1Y9QA 4I30A 2E7AA 3WDXA 3IDBB 1H1IA 2DCZA 2VUDA 3NNGA 1C57A 3VUOA 2XONA 1FPN1 2O14A 5FY9A 5ABJA 2J1SA 1HV0A 1BZWA 1OI6A 2TNFA 1CAXA 2R1BA 1DQ1A 1IQAA 3U10A 3PMSA 3HR9A 4XAAA 4Q26A 3EO6A 1OLMA 2E31A 4BQYA 2R071 1HQLA 2EIGA 2ZZQA 4W65A 2VE1A 3DYPA 4DINB 4IEXA 4Y1ZA 5CKMA 2WAAA 3O1SA 2AUYA 3SMHA 2D6OX 4QPIB 1NXD1 5C8CB 3LFMA 4N8MA 1XNTA 2XL7A 1ALYA 3J8F2 3OEBA 1UYYA 3P1IA 4JGZC 4TLFA 5FPVA 4BU2A 1DGRA 1W2TA 1QQP1 1YC61 1LTEA 3N3HA 3OOXA 3ROUA 2QTWB 5T5PA 4GQ7A 4CUAA 2MHFA 4FFIA 5EFUA 5FO7B 2GC2A 2Y6HA 3FHAA 3W20A 5IK8A 1OOPB 1CZTA 1S2BA 3AYEA 4LUMA 3IPVB 5FZMA 2OKXA 1A8DA 5I0UA 3ZKYA 3AMQA 5CFCC 5JWPA 5FJHA 2ZAAA 1YFXA 2JG9B 1GFF2 3TEXA 1B35B 4BE3A 5C3SA 4HANA 3ZFFB 1DHKB 1O8SA 3RYPA 3EXUA 5K7PA 2A71A 1RMU2 3WUCA 1S1AA 1ZRIA 2ZGNA 1GOFA 2CGNA 2JG8C 3IKWA 4JTNA 3ZSEA 5LA1A 4UYBA 5EJ1B 1O5UA 4OHXA 1MEC2 4EV0A 4A7YA 5JDBA 2ZCWA 1GQGA 2WZPP 1JUIA 2ZHLA 5K4LA 2YHJA 1COV2 1XYPA 3CBNA 4KNCA 1LGCA 4YGBA 3UK9A 1ENRA 5LRRA 3M3QA 1UZVA 4OQ9A 2W47A 5FUPA 5JZGC 1UU4A 1ZZ6A 1BBT1 1GP4A 3H3LA 3JB8A 2OA2A 5EJ3A 2W3JA 4K8RB 5FYZA 1J3RA 4UT5A 4YW2A 5JXHA 4AI9A 2JE8A 1OBNA 4I3PA 4FPLA 5IVCA 4RL7A 1MACA 2BNMA 5F5QA 1D2QA 1LNSA 2JG9A 3RZZA 3AZWA 4GIQA 2WT0A 4AQSA 3KHCA 2WZEA 4AGVA 1BQPA 3SCHA 3WT3A 4BQ2A 2B7YA 5C5TA 1W8ZA 4L99A 1BXHA 1PO22 3I49A 4DB5A 1TME3 2Y6FA 1FMD1 2IVJA 3EYPA 1OPMA 2ZGLA 3H8UA 4XACA 5FMDA 3ZIXA 2C26A 2JE9A 1VBD2 3NQHA 3FJSA 4QB1A 2ZX2A 3MZHA 4W6WA 2J22A 1V6JA 5JI9A 1DP0A 4K1YA 1JYXA 3VD5A 2CGOA 1VBA2 5FY0A 3B9CA 3AB0A 2Q1MA 1JYNA 1JU3A 2A6YA 3WDVA 3KT4A 4LOSA 4GMP1 1W3XA 1Q8PA 4K7JA 4W6XA 3UETA 4B29A 5JXIA 2HWB3 2EF6A 4FOVA 3HPNA 5A3PA 1H4HA 5ABJB 2RMU2 1SLLA 5JOXA 2WNUA 4NUBA 2IFRA 2W1SA 4AFAA 2ZEXA 3OEAA 3SHRA 5BNPC 3ASIA 3WW4A 5LATA 1Y9GA 1F5FA 2R7EB 1RUJ2 2JDHA 1OA2A 4WVMA 4UBHA 1PGSA 4CCDA 4MXWA 3W5MA 2OXBA 4DXZA 1NT0A 3LWCA 4LXLA 4Y22A 1DDLA 5FBZA 4Q8LA 4UFIA 4ZKTB 4A6OA 4AAPA 4B4QA 1CZVA 1EP0A 2RM23 5A3MA 3AZYA 3O7OA 2YG0A 3B9IA 4CUCA 1WW5A 1CAWA 3LEIA 4LIVA 4Q4V1 3D3AA 4NO4A 4R9AA 3JBG2 3B7MA 2PHUA 3MIBA 1LGBA 2C9AA 3AMPA 2IFWA 1OFNA 2UWBA 4NWVA 1VE0A 3CEWA 4L0PA 3OGRA 4Q4W2 1MZ6A 4CEYA 1DBNA 1RUE3 2CAVA 4FT8A 2XHKA 5FQ0A 1R1A1 4Y26A 3OUHA 4W50A 2VVEA 4AGGA 4DUVA 4HK8A 5BYNA 1V6LA 1W6OA 4OZXA 4R9BA 3M3CA 5HCFA 4XBLA 5F2WA 4YZ2A 1RUE1 3OPWA 2JIJA 1X8MA 1ZM1A 4XMAA 3WR0A 2LM3A 4HN0A 4Y20A 2D6MA 3VKLA 3ZSJA 1DIWA 2JDUA 5ANNA 1AR63 4IV1C 5F2SA 5HPOA 1X7NA 3UNPA 5B4XA 4P9LA 2HBUA 1IPSA 1ACCA 1ZA4A 3FFZA 4BWOA 1H2KA 3GCWA 4D3WA 2Y64A 4B7EA 1EYBA 5EIYB 4IUGA 3LZZA 2ARXA 1DQ2A 1ULOA 2R0HA 2AYHA 5FYYA 2IXLA 4JHTA 3G7DA 3I3BA 5A32B 1JYWA 3LA2A 1WLCA 4EWEA 1YJKA 5FOJB 3MIFA 5FZOB 1PZ9A 3ST7A 1XNBA 2JB8A 4FPCA 2B39A 2BBAA 5AVPA 3UJOA 5BNNC 1JI6A 3RZMA 2CY6A 1IKPA 1J84A 4P9WA 3VHPA 1S0DA 4LBQA 4AI8A 3S5AA 3FX3A 1HB2A 4D7YA 3J4UH 4YVSA 4AVVA 3ILFA 2ZGOA 1ND3A 3VZLA 1H2MA 4EN9B 5FXZA 4WM7C 2D3PA 2Y6GA 1JUHA 5F6KA 5KR7A 2YYOA 1QXJA 2XBO3 1Z7S3 3H1WA 1VAKA 5C9AB 4NHLA 2XVKA 1W9WA 3IIIA 4JGYB 5A80A 5ACA3 3I2JA 4XEZA 1ZRCA 1LGNA 1U5ZA 4R9CA 2NPIA 4WZFA 3EMRA 2WIIB 3AZZA 2BP6A 1V6KA 1O3TA 1MS1A 3AKPA 4YM2A 1AX1A 4Z82A 1Q8SA 1FATA 3OGVA 2ZMNA 3N9PA 2Q8DA 3UGHA 2WSUA 1QH6A 3ZFGA 2J1AA 1ULEA 2UWCA 5LBFA 4ZXEA 1NY72 1JYIA 4AEDC 1N47A 5FQ0B 1VBC2 4C1XA 2XLAA 4BH9A 4XJWA 2YROA 1WD3A 4L8QA 1BJQA 3O0WA 1UMHA 1UYXA 1SFNA 1VB4A 4RHV2 4XVHA 3VBSB 4NR1A 1E5IA 1UOJA 4JDOA 4Q0QA 1EAH1 5A3LA 3ZMOA 4LO5B 1R082 1XJAA 2O8QA 1UXZA 2VL4A 1H8TC 1J83A 4YFWA 5DPNA 4QDRA 3BUCA 4KL1A 1CX1A 3ZXAC 2X5IA 3PUAA 3OD0A 5C3PA 3BB6A 4ES9A 4PF5A 4BQ5A 3K3NA 4Q0SA 3HNMA 3ON7A 4PQQA 4LA3A 2XH6A 1AR72 1E57A 1HXS2 3H3ZA 4AHZA 1DGRN 4MV2A 3MIEA 5EJZB 4P9XA 3HT1A 4CP9B 3WNPA 4QPYA 5BNNA 3KB5A 3VLBB 1DLCA 1ZA7A 2E33A 3LSEA 1RUF3 4MSVA 1FOD1 1ULPA 2YB7A 5FXXA 4IE7A 3SKJE 4ZZ5A 1MPXA 4XC9A 5GJ6A 1W99A 4DPNA 1SG3A 4NRMA 3ZIWA 2VBBA 1JZ6A 2JENA 1U0AA 3DYOA 5FPLA 4HMZA 3UJQA 2RS31 3H50A 4XIKA 2C9KA 5IVYA 4CU6A 5J36A 4XFHA 1CJPA 3A23A 4IEOA 1IOAA 1RUD3 4HVQA 5FMOL 2E32A 2DBIA 2YMZA 3ZXLA 2WYSA 4MYEA 1JODA 4JX0A 1W2NA 2ZGKA 4GB31 4QMAA 3CZJA 4ZS3A 1W9SA 3KVAA 3ZN6A 3I2IA 4H3WA 4AG4A 4R9DA 3ILNA 5I0SA 4QPWA 2DYCA 3J8F3 3Q8BA 4ITCA 4D8MA 3KV6A 2JDKA 4OI2A 3RI8A 4NIGA 4KU7A 4QPGC 1MQTA 3POWA 2QCSB 2XPJA 5LZ6A 2DFBA 3ETQA 4YW3A 1GANA 1ZBA1 4QGLA 4FFHA 3T2TA 1D4VB 3J9SA 5A1AA 4AHXA 3E5QA 4Z07A 1N3OA 2P34A 3AP5A 1H9PA 2Y0OA 2E6VA 3K46A 1LKNA 3ELNA 3LSDA 3T0DA 4CDQB 1ASJ3 4YG0A 4AFCA 1AZDA 5CG9A 4XUQA 3ZM8A 2XQRA 4LMFA 4ONUA 2AH2A 1DGLA 2BNOA 5CVRA 5C6CA 1K5JA 2C6SA 1PK6C 2Z42A 4FVVA 4TLGA 2JB4A 4UBGA 1AF9A 2K2SA 3A21A 3AMHA 4B4PA 1LHVA 2OPKA 3ABZA 4QWNA 4R52A 5DUWA 2EIBA 2GC1A 5LWBA 2QQLA 5L7OB 3AYAA 2GNDA 1DF0A 3AZVA 5CYYA 4M3CA 2PLV3 4N43C 1YLLA 1F31A 3JUUA 4PIZA 4CCEA 1Q5OA 4ZHNA 1PM7A 4A44A 4XTPA 1RUD1 4AQTA 2ZMKA 4OHWA 2BNNA 4XF3A 3N9LA 4AZZA 3I3QA 1QJEA 3HNYM 1F15A 2WWSA 3FWEA 3VD9A 2CGPA 4UW4A 5C8CC 1X8EA 2RV9A 3ZXJA 4B1LA 4BMBA 4GXLA 2WKKA 2Q1ZB 1EUTA 1W6QB 4DUXA 3M1HA 2JWPA 4CCLA 1RUF1 4ZU5A 3LOIA 1ZZ9A 4LITA 4CCJA 3OBTA 2XOMA 3FLTA 3LEKA 1W6PA 4B3NA 1NUKA 2D44A 1RJ8A 1N1SA 5I91A 1YFUA 2YFZA 1ZBA2 3NKTA 1RUH3 2ZGTA 3I2FA 2WRAA 3O5SA 1HN1A 4E8CA 4ZZ8A 5CKNA 2ZHMA 4LO4B 4OI0A 3NJZA 2XUEA 4HPKB 4A42A 3NV1A 2W5FA 4E2SA 3IM0A 4K21A 4BXSV 3LCPA 1WCKA 1AYM2 4N53B 5DZGA 1ENSA 2GNTA 4EYUA 4LPLA 2KD7A 3K4AA 4QX0A 3N4MA 4K9SA 3KGLA 2BFUS 2BWCA 2YBPA 5CB7A 1PM4A 5JR7B 4LBKA 3ITQA 3JD73 3T2OA 3ZVXA 2VZOA 1MVQA 4XHBA 5DDJ2 3ZKUA 1VJ2A 4E4SA 2G4IA 2HWD3 4CDWA 3DXTA 2GDFA 5H9RA 2RS53 2IXJA 3OSDA 1OF3A 1N3PA 5DAQA 5CAZA 2EAKA 2WNEA 5ISLA 5JIAA 2GALA 2Y6LA 2YY1A 3ZYPA 1NQJA 5HCHA 2WFF2 3AYCA 3CLPA 1A34A 1CJDA 4LKFA 2ZHKA 2DVBA 3N9OA 1RB8G 4BK5A 2CAUA 2GMMA 2UU8A 4E8DA 2A3WA 3LIGA 2DWRA 2ZGSA 3N35A 5D21A 3L2YA 5E8AA 3ZSLA 5BUVA 1JZ5A 2WZR3 4IE6A 3SQOA 1XSQA 2QQPA 1IHMA 4P9GA 4RFT0 3C7OA 2FZ1A 4AWDA 3LOBA 2DTYA 1V6IA 1WCSA 1UY2A 2JKBA 1HLCA 2WAOA 3A4UA 3VBUC 1AR62 3V64A 3KM5A 2Z5WA 2DCKA 3WP5A 1DG6A 2DTWA 4Q0UA 3CJXA 2YBSA 5JSOA 4Q4X3 1GYKA 2B5HA 4XPVA 4ARYA 3HQXA 2MEV2 5IVJA 1GOGA 2ZGRA 4IV1B 2VMFA 5A3TA 3B02A 4PLNA 3WCSA 4CPBA 4RR3B 3POFA 2DUPA 4LOTA 3MF9A 1FNYA 1S0GA 3CJIC 2BGOA 2VW2A 4Y5TA 3LDBA 1GWMA 4IGQA 1XOYA 2ATFA 3IMMA 4XJUA 2WS92 1QXRA 4SLIA 2VMIA 2AEYA 5FY8A 3IAQA 3UKTA 4LIUA 3E5UA 1ONAA 1ND3C 3LPFA 1W03A 1BEV2 1DYPA 1AL21 1RL3A 3GHMA 5GLVA 4JDNA 1VBB2 2VCCA 4B8EA 4OULA 5K9YA 1HQNA 4XDQA 4XQWA 5FYTA 3MYXA 1Q43A 1WBLA 2D6KA 2EIEA 1QJU3 3PU3A 2VQUA 3GJAA 4HONA 4M3CE 1BMV1 3SCGA 3ZN5A 4YLZA 3NJYA 2E53A 2Z2SB 3AXEA 2KXLA 2OT7A 1FOD3 3O0VA 4KH9A 5LEJA 1QIQA 2P2KA 4IEUA 2YU1A 4Q4V3 4XJ9A 3O1UA 1GR3A 4MXWB 5F3IA 4F83A 2Y60A 3VHRA 2HWE2 2PHTA 3GGLA 1ST8A 1YCIA 3T1MA 5A6QA 1Q8QA 5CEHA 3GZAA 3TBDA 1SBFA 4QX5A 4DXTA 3A22A 5L9VA 3KQRA 1WMEA 1SLIA 3LAGA 4XZPA 2GP3A 1G6NA 1SMVA 2NZ9A 3ZYIB 2C5DA 1OD3A 1I5PA 2WA4A 1NQDA 2WO1A 3BODA 1SHWB 4Q4Y2 4FTEA 4NWWA 1Q56A 2PHXA 1EV11 5IAVA 1KJRA 3KD4A 1PVC1 4LBOA 1L3JA 3KVBA 3PTRB 4XFCA 3UESA 4OHVA 4BQWA 3BCWA 3DXUA 1GZTA 2ZGQA 4MO3M 1OURA 1NCQB 3FN9A 5J09A 4O61A 4HG6B 4IQPA 1K3IA 3VZJA 4CEWC 1RVF3 2QFEA 4Y33A 5B4NA 3A0NA 2WZR1 2W1UA 1UZWA 3FBYA 4L9BA 2KR2A 4M4RA 2AEZA 3TEYA 5BNOC 3KQ4B 1DZTA 3CJIA 3O14A 4LHNA 5A3OA 4NIAA 2AREA 3WQ1A 3EBRA 1CZSA 5L7OA 1GZWA 2VJXA 3B3QE 5E16A 1MQTC 1H30A 1S0FA 4AF9A 4DZGA 2EALA 1RVF1 3R4SA 4BK4A 1MR5A 5C33A 5J7MA 2VULA 1YEWA 1RUG3 5A6XA 4S2DA 4E4ZA 5FV3A 3T30A 2VY0A 3HOBA 2V4VA 5FZCA 3TNQA 1GQHA 2B9VA 1MS0A 1XE7A 4Q1RA 3SH4A 4HT1T 2B4KA 1K42A 4GWIA 1PVC3 1UIKA 2XGXA 2XWJB 5FY4A 1S2KA 2PHRA 1BKZA 4Q5OA 1VMFA 2Q8OA 4I3GA 1IZ3A 1MZ5A 3N7JA 3W58A 5HI0A 5IK5A 5FLIA 2FCVA 2C0ZA 2W08A 5K0UA 3ECQA 4FPEA 3RVHA 3HMYA 4QQPA 3OTFA 2HYKA 3B01A 4MHRA 1FV2A 3WY6A 1V0AA 4CDXA 2RR13 5FZBA 1H2LA 4LO6B 3USSA 3WLUA 5C3OA 5L9RA 5BNOA 1SACA 2HEYF 2R072 1YI9A 2UY8A 1EPZA 1NAEA 1MEC3 5LRSA 4AFMA 2ORZA 4XQDA 3VBRB 3APBA 2G1MA 2OZJA 1NCRC 1AR92 1VPHA 5T5JA 4XUPA 3H1YA 4FFGA 3WVJA 4HL0A 2IZWA 2XVGA
chains in the Genus database with same CATH topology
5IK7A 5GZFA 1RUC1 3VBFB 4RGAA 4IV3C 3VBHB 4Q4W1 1XXNA 1YRZA 1VBE2 3M4FA 4AI1A 1PGW1 5CU1A 3FFQA 2PLV2 4OLLA 4P9YA 3GALA 1J1TA 2D6PA 2RM21 1HX6A 5CIRA 5JOWA 2DUQA 1S0EA 1K5MC 2AENA 4Q4X1 2W0XA 2O1QA 2Q0AA 4A3XA 1X82A 4XFBA 3SCFA 1UPSA 1HRV3 5L36A 1F9KA 2W39A 3K51A 5T5LA 4XYXA 4YW4A 2HWB2 3OBRA 1APNA 1MZFA 1LECA 5DUVA 3UV9A 3VBSA 4IV3A 1HRV1 3ME2A 2NLRA 3TWIA 1DYKA 1RUH2 1NE6A 2B46X 4YARA 1RUJ3 2IXKA 3DF0A 1RMU3 1B35C 1WGPA 4M0NA 1AYM3 3N7LA 2RE9A 3H0OA 1NLSA 4OHYA 1RUC2 2ZHNA 4QT6A 4Q1PA 5L19A 1S0JA 4P9JA 1MS5A 2HWD1 1PNGA 3V56A 3WW2A 5KHKA 4X8PA 3JD72 5GLZA 4YZ1A 1PNFA 2E63A 5DDJ3 1TMF1 1PGW2 4BM8A 5EZWA 4Q4W3 4AI3A 1RUE2 3MW4A 1WCDJ 2OW4A 2R6QA 5C9AC 4INDA 1REFA 4FOWA 4Y1XA 4AEDA 4E2GA 1UU5A 3D8CA 4V1PA 2A3YA 3ZXGA 1IPJA 1RUI2 3ACLA 2OZ6A 3ZXEA 2Q5TA 3SNMA 5H9SA 1FX5A 3AKQA 3GHNA 4ATEA 4LBQB 3R6SA 4OFGA 2QJVA 4XOGA 1H8TA 3ZMNA 1Y43B 5JI7A 1VRH1 1YJLA 3MW3A 3B93A 4ES8A 1REDA 3FUQA 3WP4A 2RS12 2VOVA 4XXPA 1VB2A 4AYUA 3VL8A 3PJYA 2UY9A 3AKRA 2TUNA 1QQP3 1V6OA 4HVOA 2BQPA 4FO9A 4C90A 5CFCB 2P3IA 1O3SA 1PZ8A 4PIXA 4XFIA 4IETA 4LLOA 4BZ4A 1G9FA 3WOGA 3RMYA 3O0XA 2HWF1 3R0RA 1V6NA 3JBG3 1CR7A 1W6NB 2ZA9A 3V0BA 2VUJA 3M7AA 1PO23 1O4ZA 2GC3A 3I7DA 3QACA 2HKXA 3AMMA 2ZX3A 4YVWB 4RSUA 4YM1A 1O4TA 5BV6A 2XUMA 5CA6A 2OIIA 1SCSA 2EAAA 3PVBB 3KLSA 1TQ5A 1VBA3 3ZSMA 4LEJA 2QKDA 1QDOA 1XE8A 1QY4A 2GH2A 2XJSA 5JSRA 3UKVA 1AUYA 3MF6A 4EWDA 2RMU3 1OKQA 2WLPA 4MX3A 4YYOA 3BIWE 1COV1 4CP0A 4MGZE 1QJX1 4RA0A 5H9QA 3WCRA 1Z0HA 3SITA 4B4RA 2JX9A 5FLJA 3WQ0A 2V73A 4COWA 2ZGUA 2A6ZA 5T52A 1RVF2 2X8KA 1C3HA 2GN3A 2XKPA 1DFQA 3VBFC 1Z7S2 4RQPC 4IEQA 2XJTA 3KT1A 3AP4A 2XVLA 4Q0PA 1JW6A 1OPOA 1C8M3 4Q8KA 3D6EA 5BNOB 4OHZA 4Y24A 4MH0E 4N90A 3AXDA 1TE1B 3CNAA 2VOWA 1BVP1 4JDMA 4N53C 3FE5A 3V0AA 3LB9A 2LALA 3N7KA 3AK0A 4ISQA 1QMJA 4FXGB 5AC91 3S7IA 1LULA 3PMEA 3WG1A 1DQ6A 4QQOA 4YZ5A 2WS91 1ZZCA 4RHV3 4PIYA 1I5ZA 4JCKA 1OSGA 4AVBA 1D0GA 4XTMA 3RSJA 4FAHA 1PGL2 2GH8A 1GZ9A 2CL2A 4WBBA 1NA1C 5K0UC 2HWB1 1O91A 1IS4A 4FPJA 4FPFA 3ZFEA 2QUOA 2PHWA 1WW6A 1DGWX 2JXAA 4XQ4A 3PTYA 2JICA 2TEPA 2R063 1RHI2 1QJX2 4NVPA 1YUDA 4XW3A 2X53S 4MGIE 1JOJA 1SLCA 1NYWA 3MDPA 4FXKB 2H0BA 4Y1UA 2TBVA 5ACA2 1AR82 4PLMA 2W52A 1Z7S1 3WUDA 4O9EA 1QJU1 4YGEA 2JD4A 2ZS6B 1VBE3 4I0AA 4AE2A 3KCXA 3JD71 1WLTA 1UAIA 5A33B 1LJ7A 3MLJA 5CG8A 4B7KA 4OVEA 4J1XA 4LBLA 1T6GC 4LR4A 1YFWA 4U2AA 5CBLA 4CDUB 1ZBE3 2IWGB 2DCYA 3WV6A 2YV8A 4QQ2A 4DMIA 1GNZA 3P3NA 4U36A 1HRV2 5GZCA 2ES3A 1CAVB 2VNOA 1JHNA 4K8FA 3WP6A 1S0CA 4META 1GSLA 4TYSA 3ZO0B 4Q4Y1 1S0IA 4FPKA 1W6MA 3WG3A 1VLNA 1FT9A 2P3KA 1KS5A 1AYN3 3R4DB 1LESA 5GZGA 1GKBA 1RHI1 1C4RA 3AP7A 4QQLA 2ZGMA 4GKXA 1PK6A 2H6BA 2ZZJA 2XJVA 2ZBJA 1PMIA 4RQPB 5A33A 1RUF2 4IL7A 4CDXB 2V09A 3QLQA 4I0WB 3RWNA 5GKAC 2N7GA 4RR3A 2DVAA 5K0UB 3AFGA 1QOOA 1Q8VA 2AGSA 2D93A 1OQDA 3THPA 1VBA1 4AVTA 1OLRA 1H8VA 4EN0A 5FPZA 3PHMA 3WDWA 1MS3A 3RMXA 1HDKA 3ZYJB 5JSPA 2BPA2 4MXVA 3VN4A 2GC0A 4AEMA 2BFUL 1WA4A 1FPN3 4E2QA 1ZREA 1DLLA 4HKWA 3VBUB 1QU0A 2Z79A 1FV3A 4L2NA 3ZXDA 4L92A 1K5MA 1WMDA 4QGMA 1SEFA 2LUWA 2HWF3 2A3XA 5JOYA 1XU2A 4HN1A 5J48A 4QHBA 4XF9A 4NHKA 1AJKA 4AEDB 1AR71 1ENXA 4AI0A 3T1LA 3B94A 1G8WA 4UW5A 4WM7A 2MNGA 5J98B 2WNVB 2VNRA 2ZACA 2R1DA 4PDWA 3TNPB 2RS13 4MGYE 1RUOA 1BEV3 1B35A 3QOPA 2ZX4A 1AHSA 4P9IA 3KS7A 3AYDA 3JB4C 4JGYC 4SBVA 2VUAA 1LR5A 2RMU1 4NPRA 4AFDA 2O8OA 3FMGA 1RUJ1 1GZWB 1AX2A 4YGDA 1SQ4A 4BLJA 1AXKA 3DPRB 4N9HA 5FDBA 5GLUA 3VBOC 5FTTC 4X8NA 4PBPA 3PVEA 3SISA 1LEDA 3I59B 2ZX1A 3MW2A 1W6QA 4C0HA 1D2SA 3IBMA 1G9AA 4Q27A 3BOWA 2HWC2 4S2HA 4WM8A 4HVRA 1AR91 2A6VA 1ZBA3 1WLDA 1QJY1 4JC1A 1YO8A 5DUUA 1PIV1 1AXYA 2E7QA 4LUKA 3VHNA 1C8NA 5FO9B 2ILMA 4D7TA 2F6BA 1BBT2 3RQ0A 3OGGA 3KMHA 2CWSA 4JGZB 4LO7A 3DKWA 1VALA 2CV6A 5BXXA 5GM0A 1NLRA 1GV9A 2P17A 3V0BB 1JYCA 3OJBA 3LA3A 2ETEA 5BPXA 2PFWA 5JAXA 2HWD2 1LOCA 3MPPG 2BWAA 1C5HA 3ZSKA 4CDQA 3VBFA 1HKDA 1DZQA 3NV2A 4IERA 3ZPYA 1QJU2 1V6MA 4ATFA 1IS5A 1UKRA 1PVC2 1C8M2 1CONA 2WT2A 2XL9A 4Y20B 4E27A 4RS5A 4K20A 2D7FA 4QPGA 3S0MA 1ZZ7A 1LHWA 1BCXA 2WZR2 5DXDA 1BYHA 3H1MA 4Y4YA 4I01A 3FHIB 2JDZA 2DFCA 5D8AC 3VKMA 1F2NA 4GB33 4IEVA 4JTOA 5L73A 1CAWB 2O0OA 5FCCA 2RJKA 4IEYA 1EAH3 1PIV2 4MVTA 1W6MB 1VRH2 1OOPC 2RS33 3MLLA 3VBHC 1VBC1 2VOKA 4QM9A 1W0OA 1RUG1 1LEMA 1KD7A 1NOVA 2AR6A 1LHOA 2K9ZA 4X6RB 3H3UA 1S55A 3NL1A 4WVMB 5KWRA 3CF6E 1YYNA 3TYJA 2WC2A 5JMCA 2JJ6A 3AM2A 1M06G 3SLIA 1RMU1 1VBB3 3QH7A 4AXOA 3AFKA 5KHHA 4CDUA 2JG8A 4L11A 4BIOA 1C1LA 1WLWA 1AR83 1UU6A 4P5HA 3J26N 2QZ2A 1IS3A 4X6QB 1QH7A 2ZKLA 1ZVFA 2XBO1 4CDQC 2VU9A 3OCPA 1OQ1A 3VBRC 4L97A 3QH6A 3INAA 2DF7A 2WFPA 4PBOA 1ZBE2 2HJIA 3KT7A 2UWAA 3WP3A 4CDXC 2FQPA 2A73B 2D3RA 2BEOA 5AVAA 1SFYA 2QVSB 1QKQA 1CAUA 1G9CA 3THTA 2VQ0A 1DQ4A 1VBB1 4GA9A 1VP6A 2GU9A 2NMNA 1R092 5KC5A 1CD3G 1FXZA 4QQHA 1G86A 2PAMA 4KG0A 2C1FA 1FAYA 1RUC3 4ZU7A 1IPKA 1AYN2 2XLGA 3SXWA 4DS0A 4XFAA 5DZFA 1UW8A 4YG6A 2WNUC 2Y38A 2GZWA 1WW7A 1OLQA 5T55A 4COZA 3E97A 2CTVA 4XILA 2XJQA 1O5LA 4XETA 1RUI1 4DY3A 1NXMA 2WINB 2XG3A 5A32A 2BYVE 2NYYA 4M3CB 4C91A 4R8HA 4A2UA 2CNAA 1WD4A 4HKLA 1JTZX 1PGL1 1ULDA 1RUI3 2R30A 4FSJA 2XJPA 3KSCA 4EN8B 1CPMA 4QPIA 2WA3A 3VBRA 2X5IC 1Q8OA 4YM3A 5JPNB 4LBNA 2PHLA 5KHIA 2Y26A 2PA7A 1Z78A 3GZTB 4FP2A 4M01A 3M3EA 1KS4A 1R1A2 3C3VA 1HW5A 3GF6A 1CX4A 3IT8A 1NE4A 4QPGB 5BNQA 4H7LA 1AR81 1PO13 4AEJA 4RGGA 5KC6A 3RNSA 4FQ4A 5T3NA 5KXCA 1QJY2 4EROA 4FP3A 3NV4A 4XBNA 2R042 2YUEA 2WL1A 4RD7A 2K0GA 2E51A 3AMNA 5DG2A 4ZXKA 3WW1A 1URXA 1FMD3 5TSWA 2R0FA 4PDWC 4XMIA 3VBOA 1BVVA 1ENQA 3NAPB 1J1LA 3WX5A 4RHV1 4BCUA 1DZRA 5GZDA 3TAYA 4KGGA 3MPBA 3ES1A 1HRI3 2ZMLA 1LHUA 3CL1A 3G6JB 3BOPA 1N3QA 5GALA 2G9GA 3W59A 5BNPB 4G3YC 3RDIA 4EN6B 4RR3C 1MS9A 3MIDA 3W9AA 4CDUC 2YXSA 2YPJA 3X29B 1C5IA 3NVCA 4N53A 3BALA 4I2OA 5CNAA 1C8M1 5KXEA 4XIOA 3WDTA 2SBAA 1ZRDA 3EQEA 3S6PA 2YGMA 4F7ZA 1MS4A 2FMDA 4YFZA 5GZEA 3AJZA 1ZX5A 4S2FA 3M3IA 2QNKA 4K3UA 4D7SA 1CGPA 4BQ1A 5LEKA 2GSYA 2WSVA 1SLBA 1QJZA 1ZRFA 3ZFEB 4COVA 1TMF3 2JECA 3SH3A 2ZKNA 4LLFA 4I0BA 1PZ7A 1IGOA 1AVBA 3D0JA 2DUOA 1W39A 4GALA 1NG0A 3ZFGB 5JIUA 4JRLA 4D69A 3M3OA 1JN2P 5E88A 4HLTA 5FO8B 3E5XA 2SLIA 1MVEA 4HETA 3V0AB 4FCAA 4COUA 4R4ZA 4PQ9A 5C9AA 1ND2A 4LBMA 1F5JA 1LU2A 3PJQA 4BPZA 5I93A 2JG9C 3MICA 1GICA 4Y5Z0 3JU9A 3D82A 4H14A 2BW8A 3J8F1 1XNCA 1MQTB 1LU1A 1SBEA 4MUVA 4AFBA 3H9AA 4G9SB 4CTEA 2A6WA 2VW1A 3DV8A 4QD2A 1VR3A 4N43B 5D8AA 3EJKA 4DQAA 1EY2A 5KXBA 5D1IA 2B8MA 1I6XA 3WD5A 2VVDA 1O3RA 4QU2A 2HWE1 3AKTA 1KJLA 1EAH2 1PIV3 1TNFA 4LHLA 1R081 1C1FA 2BTVC 1QQP2 4TWTA 2DVFA 1RUNA 4M3CF 4XJAA 3PLQA 1LB2A 3WHUA 5FOBB 3WDYA 3HAGA 3NW4A 2GMEA 4FPYA 3FBMA 3VKFC 1WUVA 5BNNB 5AFBA 4XF1A 3M8LA 4K6BA 3KGZA 3B00A 3KCYA 4P14A 1MEC1 1QXPA 4J1WA 1ZRRA 2PTMA 3EHKA 3VKOA 4KU8A 2ET1A 3ILRA 1RIRA 3E6DA 3ZDSA 5I0TA 1CAVA 4FAGA 2JE7A 5EYXA 3I8TA 3GBFA 3HD8B 3VDDA 2EXIA 5FREA 2DCTA 2NN8A 2MEV1 1CVNA 4OUMA 1G9DA 5KXDA 5CFDB 3POSA 2WQ4A 1A3KA 2HWC1 1V9U3 4IEPA 2WNUB 5SV5A 4AW7A 4IXLA 3DGTA 5CFCA 1IS6A 4DRVA 2RS11 1W6PB 4BA6A 3VZOA 3AP6A 2ZGPA 2R32A 1ND2B 1NY71 1D0HA 2FBEA 4WVZA 3KCCA 1DQ0A 4ISRA 2VG9A 3H7YA 2WFF1 4KBBA 2XJUA 5EWSA 4I09A 3FUOA 3VV1A 1RHI3 2PAKA 3MFAA 1ASJ1 3E6BA 4XJZA 1ZZ8A 4JGYA 4OI1A 1A78A 1YWKA 5FAXA 3GBWA 3D4KA 1N1TA 1POV3 1HRI1 5ABJC 1OA3A 2I74A 4ASMB 1K5MB 4OI4A 3DN7A 1EV13 1OD5A 3B5LB 2PAEA 4DY5A 5KHGA 1KITA 2UURA 3FC0A 2IXHA 4MGKE 3H7JA 1CN1A 3RRDA 1O4YA 5T5OA 1TNRA 2OUHA 4BYYA 2YGLA 3OYWB 1SBDA 4Z2WA 4GH4C 3VBSC 1QHDA 3TN91 1QNYA 3R4UA 4Q29A 1NA1A 1NCQA 1PO11 1N1VA 2GMPA 4A7ZA 1TEIA 1OHFA 4LE4A 5CFDA 3NKGA 3IDEA 1LENA 3U0ZA 3OY8B 3I54A 4BMEA 5HBAA 3L2HA 2R062 1CESA 3OF1A 1QJX3 2I45A 4LNVA 2OUJA 5BNPA 2GN7A 5F6LB 2R043 3DL3A 1COV3