3WV6A

Crystal structure of a protease-resistant mutant form of human galectin-9
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
292
structure length
284
Chain Sequence
b'GSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQHMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQSFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-9
publication title X-ray structure of a protease-resistant mutant form of human galectin-9 having two carbohydrate recognition domains with a metal-binding site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 72
structure length 284
sequence length 292
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wv6A02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wv6A01
3SH4A 4UW3A 3AFKA 4XBNA 2ARBA 1LHOA 1UPSA 1W6OA 2ZABA 2ZGQA 4C1XA 5HCFA 2WJSA 1SLBA 3H0OA 4K1ZA 4NOTA 4YM2A 3WV6A 1CVNA 1EPWA 4WV8A 1DZQA 1GLHA 1KDMA 2LALA 2RHPA 4M00A 4U2AA 2UWAA 2WLQA 2PHFA 4WVVA 1KDKA 2YXSA 2A6ZA 2VH9A 2W08A 3L2YA 4GA9A 1WD3A 1ULGA 2A3WA 1DQ1A 1V6KA 4XHXA 5KXBA 2ZHMA 1AXZA 4FOQA 1FNZA 5KXDA 3RQ0A 4Q2FA 4YG3A 3OPZA 4FPGA 1GICA 3UJQA 1S0BA 1SBDA 1S1AA 2C5DA 2JE9A 4YW5A 1W0OA 4XTPA 1CR7A 2NMOA 3OY8A 3A0KA 1UX6A 1CPMA 3ZXLA 1SACA 3RMXA 1G9CA 2ZACA 2EXIA 2ZGKA 2FHRA 1UKGA 4Y26A 2ZGUA 3NWKA 5JOWA 2D44A 3MW2A 4HL0A 1LENA 3FLPA 4TYSA 1N1SA 4BOWA 1SCSA 1V6NA 1WLWA 1FATA 3O0WA 3OBTA 1S0GA 4XBQA 1BQPA 1Z0HA 3V0AA 3FUQA 4M01A 1IKQA 1QOSA 2YV8A 3ZXEA 3ZSJA 5T5OA 3UL2A 4Z8BA 5GZDA 1DQ5A 3SNMA 2D3PA 3WHUA 2A71A 2R0HA 2A3XA 4XJ8A 2NYYA 3N7JA 4ATFA 4XMIA 5CA6A 3AXDA 1VALA 2WSVA 3USUA 2DV9A 4UW5A 3B9CA 4Q8KA 1N47A 3PVEA 1LU2A 1G7YA 5DUWA 1O4ZA 1WW4A 3SLIA 3VKNA 3WCRA 1G9DA 3M3QA 3NV4A 2D7FA 2XB6C 3N7MA 3WDUA 5EYYA 3SH5A 1H9WA 1QKQA 1VAVA 4M3CE 2ZA9A 3AYCA 3AYDA 3WDXA 2A6WA 1WUVA 4LBQB 1AVBA 3N36A 4YW2A 2GNTA 4XZPA 2W68A 4CTEA 1LECA 2DUQA 4XILA 3GALA 3HR9A 5IK4A 1QU0A 4FOYA 3T1LA 5T5PA 1QNWA 1S0JA 4GWMA 1YI7A 2DUPA 2DUOA 4LBLA 2GMPA 4YM1A 1IS3A 2VW0A 3IPVB 3M1HA 1WW7A 5JVVA 3V64A 3U4XA 1BKZA 3FLTA 3UJOA 2P2KA 2D43A 5DZGA 3V65A 4PCRA 3WG4A 1DQ6A 4P9YA 2DVFA 5T50A 3AP9A 3O0XA 1GNHA 1MS0A 2GALA 2H0BA 3M3EA 3AZXA 3D6EA 1YRZA 1MVQA 1AZDA 1WW6A 1JUIA 1FX5A 1HQLA 1LODA 1OQ1A 3AP5A 3BIWE 1DYPA 5SV8A 5T5LA 1B09A 3I8TA 3AZWA 1N1TA 2D6KA 3AZZA 4BQ1A 1HDKA 1VAMA 4YG6A 1MS4A 4YZ1A 1QDOA 4FP2A 4IQPA 4YFWA 2P34A 5DG1A 4YW1A 4LBJA 2ARXA 3VUOA 3OYWA 1IS6A 2JE7A 3ENRA 1ULEA 1ULDA 3MEPA 2OVUA 4Y22A 3RRDA 1BYHA 2GN3A 1FYUA 4YZ5A 1RINA 3WG3A 1G8WA 3D5OA 2DYCA 2JJ6A 2ZGTA 2E7TA 5H9SA 2EALA 3AK0A 5F9TA 1MS8A 1LTEA 3MW3A 2DVDA 3SISA 3O0VA 3JU9A 1GV9A 4K21A 4YW3A 1ENQA 1N3PA 1URXA 1JYCA 1ENRA 1G9FA 1UZYA 4XOGA 2ZMLA 4Q1PA 1W0PA 2DU1A 4ATEA 3POWA 4YGBA 1FV2A 1UZZA 5JOYA 1ONAA 2W52A 4FOVA 4DQAA 4XIOA 3A4UA 1GZ9A 3AYAA 4AVTA 5CBLA 4FPFA 3BOPA 1HLCA 4UW6A 2GMMA 1C57A 2YZ4A 3WUDA 1LOFC 4GKYA 4BMEA 2D6LX 4YW4A 4H55A 3ZSLA 2P3IA 4M3CF 1DFQA 1OKQA 4DS0A 3WDVA 1S0CA 2NP0A 2VXRA 2HYKA 2EXJA 2DTYA 2WT1A 4Y20B 2C9AA 1PZ7A 1CONA 2R0FA 4P9WA 4XIKA 2JD4A 2JKBA 2CNAA 4OZXA 5KXEA 2EIGA 4LBOA 4PBOA 1I3HA 1Q56A 2XG3A 3NV3A 4CZSA 3V0BB 2D6NA 2DVBA 1UAIA 2D6MA 3APBA 2WSUA 4XXAA 3ILRA 1LOGA 4FPCA 1LU1A 1LCLA 2ZHNA 5T52A 4D69A 5JOXA 1LGBA 3A0NA 3Q9OA 2ZHLA 5GLWA 1JHNA 1V6OA 4L8QA 4XJZA 4XJWA 1GYKA 1MR5A 1R1ZA 3ASIA 3WDWA 3AP4A 4UW4A 4RL7A 1QMJA 1ZA4A 5T5JA 1RITA 1DQ0A 1C1LA 1LESA 2AR6A 3W59A 5BYNA 3SH3A 2A6VA 2ZMKA 2Q5TA 2W39A 2CWMA 5LK5A 2AENA 3MPPG 5DZFA 5DUXA 2PHUA 3NV2A 4YGDA 1V6IA 4ASMB 4YM3A 1DLLA 5GLZA 5E8AA 1W6NB 3IPVA 3AJZA 3AZYA 1Y7BA 2AREA 2VW2A 1GANA 3B69A 2ZGNA 3RSJA 2AUYA 4FP3A 4Y1VA 4FVVA 1MZ5A 2R1DA 1MS1A 3ZSKA 2E6VA 2VY0A 3IKWA 1JN2P 4YG0A 3ZVXA 4DPNA 1AX2A 2AGSA 2OUHA 1DQ2A 4R9CA 4BLIA 4AVSA 2ZGSA 1VLNA 3B00A 5CB7A 1DBNA 4GALA 4LBMA 1JYIA 3B3QE 4C1WA 1S0FA 3ZPYA 3FLRA 2GN7A 3QCWA 1FNYA 1LHVA 4XYXA 2FMDA 1ZM1A 4ITCA 1W6PB 1SLAA 2JDZA 4RA0A 4FQZA 2CYFA 1LOCA 1WW5A 2UWBA 3ILNA 2UU8A 4XE9A 1UN1A 4AGGA 3SITA 5JMCA 5IT6A 4AGRA 1WBFA 1W6QB 3WLUA 1G9AA 3IMNA 1NLSA 2D6PA 4XDQA 2G4IA 3HN1A 3ZXFA 1LOFA 3N35A 2EXHA 2OW4A 1MS5A 5HCBA 2WKKA 1BJQA 2UWCA 1AX1A 3AXEA 4FPYA 3PJQA 1PZ9A 5EWSA 4GXLA 4P9XA 4YZ4A 3JUUA 5E88A 3CNAA 5DXDA 4NO4A 2ZBJA 1A78A 4HANA 1QNYA 1BXHA 3HMYA 1AJKA 5GZEA 3OJBA 1GBGA 4BLJA 3ATGA 2EF6A 2OUJA 1LJ7A 1V6JA 1LEMA 5GZCA 3AZVA 2ES3A 3TAYA 2E51A 5GM0A 3M3CA 5HCAA 4XTMA 2V73A 1WCSA 3GNEA 1AXYA 5IK8A 1W6MB 1CN1A 2P37A 2EXKA 4Y20A 4GWNA 2CY6A 2CTVA 1LULA 2E7QA 2ZZJA 3AX4A 2PELA 3ILFA 1RIRA 4FPJA 4FPLA 1LGCA 4JC1A 4CRQA 2DVAA 4GKXA 4XJAA 3FBYA 4FPEA 5FRAA 3VKOA 1A8DA 3WVJA 1F9KA 1LOBA 1SLCA 4WVWA 5GLVA 2UURA 1I1EA 3N3HA 1KRIA 1ULCA 4K20A 5H9QA 3B01A 3VKMA 2WNEA 4M3CB 1MACA 4DRRA 4TZDA 2NN8A 1N3QA 2A6YA 1JXNA 2A5ZA 4AGVA 3R4SA 2EAKA 1MZ6A 3POSA 5DUUA 2DVGA 1JOJA 2WT0A 1APNA 3LSEA 3R05A 2AYHA 1YO8A 4Q1RA 5IK7A 4AVVA 4Y1XA 1LEDA 4FPHA 3IN9A 5E89A 5CAZA 2SBAA 1U0AA 4PBPA 3INAA 1LOAA 1UMZA 3AP6A 2ZGOA 1N1YA 1W6NA 5DUVA 2A7AA 2R49A 3WCSA 1N3OA 1DYKA 3AP7A 1SFYA 3I4IA 4YZ2A 5DG2A 2A70A 3ZYRA 1KJLA 3OYWB 2D6OX 1ULFA 2SLIA 1LHUA 1TEIA 1GSLA 1WLDA 4Y22B 5GZFA 1Q8SA 2R16A 4Y1ZA 1Q8VA 3M2MA 4Y1YA 2DURA 3ZSMA 5T55A 1AXKA 1MVEA 1Q8QA 2JECA 1A3KA 4P14A 2DU0A 2GNDA 3N7LA 4LBQA 2YROA 1JW6A 2ZGPA 3TB0A 1W6PA 1XQNA 3WOGA 1MS9A 4WZFA 2R1BA 4FPKA 1KQRA 2B7YA 3ZXKA 1SCRA 4R9AA 3RMYA 2YY1A 1LOEA 4K1YA 1JBCA 3UK9A 1GNZA 1FAYA 4SLIA 1SLIA 1W6QA 2A6XA 1CESA 4R9BA 3KQRA 3T1MA 1GZWB 4BMBA 1BZWA 4XBLA 4YGCA 1G86A 2BQPA 1W6OB 3BODA 3O5SA 1YXWA 4PF5A 2ENRA 3ZXJA 1IS5A 3WG2A 2GMEA 1LHWA 4LBQD 4Y1UA 5AVAA 1N1VA 1GZCA 3WUCA 1HKDA 1YYNA 4JRAA 2DWRA 1SLTA 5CNAA 3ZYPA 1QGLA 3O12A 5KXCA 2PHRA 5GALA 1WBLA 5JOZA 1IOAA 1CIWA 3FFZA 1IS4A 1V6LA 1J1TA 2Z42A 4AYUA 1OFSA 2NM1A 2ZGLA 4KBBA 4YFZA 1PZ8A 3R4UA 1O4YA 1QDCA 1S0IA 1AX0A 5GLTA 2YMZA 1W6MA 2GDFA 3OY8B 5JDBA 1SBEA 1H30A 2A3YA 1CQ9A 3MW4A 5GLUA 2ZMNA 1HQWA 3RG0A 1UL9A 1WLCA 2ZGMA 3C2UA 4R9DA 3WG1A 4ISQA 1D0HA 5GZGA 3POYA 1S0DA 4XJ9A 1C1FA 5GJ6A 4LBNA 4XXPA 2CWSA 1Q8PA 3M3OA 3WNXA 1LGNA 2ZAAA 2ZGRA 4F83A 1GKBA 4DFSA 3PVNA 1G9BA 3V0AB 2E53A 3KM5A 3WZ1A 1H9PA 4Q8LA 1ENSA 4W65A 4FOWA 4M3CA 2D3RA 4YZ3A 3QLQA 4AWDA 4Y24A 1QF3A 1C4RA 4ZKTB 5DZEA 1QOOA 2VW1A 4YLZA 2ERFA 4PQ9A 4ZXKA 4ISRA 3NV1A 4MYEA 5FREA 3USUB 1WD4A 3FUOA 2TEPA 4Q26A 1AJOA 1X50A 1KJRA 5EYXA 2WQZC 5JLVA 5T54A 2VU9A 2A75A 1LHNA 2ZKNA 4XMAA 3PVOA 2AH2A 4Q27A 5H9RA 3VKLA 4JCKA 2CL2A 3RS6A 1VIWB 2P3KA 3N7KA 2WT2A 4YM0A 2LTNA 5EXOA 1QOTA 3WDTA 2KM2A 1DHKB 1IKPA 3AJYA 3OBRA 4I30A 1D2SA 3V0BA 2ZHKA 2DTWA 3OGGA 3W58A 3VV1A 2GNBA 3LSDA 4XJUA 1DIWA 1V00A 3WDYA 1DGLA 2V5YA 4FPOB 1CPNA 3VKFC 4BM8A 1SLLA 3BTAA 4DRVA 4LBKA 1AF9A 3D4KA 3IM0A 1NXD1 1DQ4A 2GNMA 1MS3A 5F5QA 3T2TA 5IUQA 1Q8OA 4U36A 3WHTA 2NZ9A 4YGEA 1V6MA 4FQ4A 5L73A 3AYEA 5IK5A 2PHXA 1S0EA 1F31A 5H9PA 2PHTA 2P3JA 4BPZA 3DUIA 1F5FA 3DGTA 2D3SA 3PMEA 1FV3A 1YIFA 1SBFA 2NMNA 1KITA 4XHBA 2VUAA 2PHWA 1Z78A 2I2SA 3LCPA 1GZWA 1CJPA
chains in the Genus database with same CATH superfamily
3SH4A 1XNCA 1W9WA 1QWRA 1RHI3 2XUMA 5FZ1A 3ZIXA 4D7TA 2VNGA 1LHOA 2BP6A 2ZCWA 5A7QA 3UGGA 4GB33 5DPNA 5C3RA 2HWC3 4NIIA 2WJSA 3H0OA 2VTXA 2JDYA 4L92A 4OFGA 4YM2A 1CVNA 1EPWA 2ADEA 4COYA 2LALA 2UWAA 4YARA 4WVVA 5B2GB 3MF6A 2VQ0A 3ZFEB 2KA3A 4FTSA 3L2YA 5A3TA 5C5TA 3ORJA 4TLFA 2A3WA 1DQ1A 5KXBA 3PDQA 2ZHMA 4R52A 4QX1A 4CDQB 2F4PA 4LXLA 4FOQA 1JOBA 5I0UA 1YQ6A 3SMHA 3BVCA 4E4DX 2GH8A 4NHKA 5KXDA 1FOD2 2BNNA 1UF2C 3UJQA 1JZ6A 1JYWA 1SBDA 2C5DA 2HWF1 1YCIA 3MIBA 5I0RA 4XC9A 4BISA 4L9BA 2PAMA 3VD5A 3RMXA 5C8CA 1G9CA 2VAUA 1HXS2 2EXIA 1W8OA 4ZU7A 1TME3 2FHRA 2YC2A 1C8NA 3BTZA 2QQJA 5IATA 2D44A 5D2AA 3MW2A 5BNOA 1ZRCA 3FLPA 4FXKB 5CYYA 1Y4WA 3U1XA 1WLWA 5I0SA 3SKJE 4ET7A 4YRDA 2HEVF 1Z0HA 3I59B 3V0AA 3VBSB 2IXIA 1W39A 4MGQA 2WR9A 5FY8A 3AKQA 5J1XA 2BGCA 2FCTA 1R091 2A3XA 3ROUA 2W2IA 1MQTA 4V1PA 3VBOA 4IEWA 3GCWA 2BJSA 4B7EA 3O1SA 3USUA 1NCRB 1JH5A 2DV9A 2VBDA 3PVEA 2Z2SB 3I7DA 5EFUA 1G7YA 3OPWA 1WW4A 4W8JA 5DUWA 4AQTA 5CEHA 1PO23 3BYWA 4QHZA 3NV4A 4BU2A 1ND2C 5EIYB 3GBWA 3M8LA 4C91A 1H9WA 1W99A 1QKQA 5FP7A 2CGNA 3AKTA 3AYCA 1AYM1 1GWLA 1F15A 1HN0A 4YW2A 2JG8B 2AC1A 2DUQA 4LULA 2PXJA 4GWJA 3HR9A 4QX8A 4AXOA 1UMIA 3KT4A 5B4NA 3O1PA 5CISA 4PDWB 1QU0A 5AC93 1DGRN 3ZYIB 1COV2 3VZOA 1TG7A 4GWMA 2WO3A 3D0SA 2QQLA 1IS3A 4NWWA 3M1HA 1WW7A 1VBA1 2RR13 1XB9A 1O4TA 4E2QA 2X5IC 2GC0A 3NJYA 4HKOA 2P2KA 2DCZA 1U5YA 2D43A 2JG8C 5FZKA 5L19A 5LRSA 2QDRA 4CEWB 4P9YA 4FBFA 3AP9A 5L9RA 5F7UA 2GALA 2DFBA 3E6CC 2H0BA 1C5IA 3D6EA 3NNFA 3G7DA 1MVQA 1NT0A 1FX5A 1OQ1A 3AP5A 3MZHA 1W90A 4LHSA 2QKDA 3FL7A 5FY4A 3SCFA 1E5HA 3OD0A 4LO6B 4P9IA 3NJXA 1HDKA 1MS4A 2ZX2A 1QDOA 1B35B 3KCYA 4FP2A 4I09A 5ABJA 1GQHA 3PU8A 2YDEA 5L9VA 4YW1A 2JDUA 1L7RA 1XNKA 5L9BA 1RUC1 4QD2A 4K9SA 3OYWA 1IS6A 4CEWC 1WKYA 4LTAA 5KHHA 4MGYE 1AYN2 5DDJ1 1IZ3A 2OVUA 1NCQB 3NQHA 3RRDA 4AVAA 3NL1A 3WX5A 1FYUA 4QB6A 4BZ4A 4YZ5A 4KNCA 3M7AA 5D8AB 3HQXA 3WG3A 2DYCA 4UFMA 5JXHA 4NN0A 1PVC2 3MV01 4MLOA 1OOPB 5IFPA 2B4KA 2VNRA 3MW3A 3MV11 4ASLA 5JI9A 3O0VA 1ENQA 4DIQA 3RZJA 1UZYA 4A41A 5BNPB 4XOGA 2ZMLA 4Q1PA 4UFJA 2WZR3 1SEFA 3WQBA 2ZOEB 5JOYA 2YPDA 1ONAA 4J1XA 3OB8A 3H9AA 5FV3A 4EZHA 1GZ9A 3H8XA 3ZYGA 5BNNC 3AYAA 4RGKA 3RJRA 4AVTA 3PNAA 4IEPA 5FFOC 3UGFA 3E5UA 2GMMA 4CDWB 4Q4V2 3S5AA 3KMHA 2D6LX 1TMF2 4AEJA 5JR2A 3N9MA 1H2NA 2W1WA 4A3XA 2NP0A 4DUVA 3FHIB 3IAPA 4JGZA 3H8RA 2OXBA 5C4WA 1QHDA 4AFAA 1K3IA 1XYPA 2R0FA 3CDZB 4I02A 1ZZ9A 4P9WA 1VRH1 4OZXA 1U5IA 2EIGA 3OUHA 4URTA 5KXEA 3FN9A 2HWE2 4MXWA 2OPKA 1PX4A 4PBOA 3NV3A 2D6NA 2DVBA 3LDRA 1RHI1 4QPWA 3SCHA 4NR1A 1UMHA 2CSGA 4GB31 1REFA 1WMDA 2HWC1 3G6JB 1LOGA 5T52A 2G9FA 4D69A 2VNVA 1LGBA 2VJXA 4HETA 2ZHLA 5JOXA 4XDPA 1JHNA 2XQRA 4EJRA 1X9PA 3AP4A 4UW4A 1QMJA 3MI8A 1ZA4A 5T5JA 2A1XA 2R32A 1HJFA 1MEC2 2AR6A 4JHZA 2EICA 2XLGA 4N53A 4OHWA 4XW3A 2OS2A 3SH3A 5ANNA 5BYNA 2IXLA 5FP9A 2W39A 5LBFA 2CWMA 5A3MA 5K7PA 2WNVA 4NRMA 1AR63 2JG9B 2PHUA 3NV2A 5FPVA 4MG2A 1OA2A 4WM8B 4ASMB 3ZKYA 3RWNA 2ZX4A 3IPVA 4QM9A 1Z7S3 3VL8A 4X8NA 1DYOA 4AI1A 5F8PA 1QJY1 4XUNA 4FVVA 1TME1 4XF9A 4HK8A 5FZ4A 1J3PA 4QMAA 4LA3A 1BEV3 2FDGA 1WMEA 5FPXA 1SQ4A 1RVF2 1OF3A 4HSLA 1CIYA 4WM8C 1IHMA 3B00A 4GULA 3WNNA 1DBNA 2FMYA 4DEQA 1JYIA 2VZSA 1QJEA 2ORXA 3CIHA 1S0FA 3ACHA 3CJXA 3OUIA 4N8MA 4C1WA 1C8M2 1IQAA 3VN4A 4TTGA 3VHPA 3LA7A 4ITCA 3WW2A 2WO2A 1GP4A 5FZIA 1ZRDA 1W6PB 2JDZA 4FFGA 4AQSA 4QQPA 4RA0A 2CYFA 5HV0A 5F6KA 1AL0G 2UWBA 3ILNA 1BHGA 2UU8A 2OQ6A 1ZVFA 3K2OA 2B5HA 3NJZA 4TSVA 1H4HA 1D4M3 1WBFA 4PT6A 3VD7A 4WM7C 3LWCA 4A2UA 3O1TA 4JGYA 5HCHA 1T2XA 3BU7A 4META 1PO21 4WZCA 2Q8EA 4UAPA 2ZEXA 2IXJA 4XUOA 5A3WA 4BK5A 3ZMNA 1XNAA 3A23A 1OLRA 4BIOA 4KH9A 1YEWA 1OT5A 3W20A 1HRV1 1VJ2A 4AHZA 2UWCA 3RJ2X 4ZZ8A 1OC1A 4FPYA 3O7OA 2KXLA 1PZ9A 2CHHA 3PLQA 4I0WB 5F3GA 3JUUA 2ZX3A 4NO4A 4QHOA 3GHMA 4UWDA 4HANA 2WN2A 1O3SA 1R083 1L7QA 3OJBA 2RJLA 1XSQA 4BLJA 3VBOB 3ATGA 1Q3EA 1UPIA 2OUJA 1CAXA 2RR11 2Y6FA 5KHJA 2ES3A 3TAYA 3NW4A 4XTMA 4HN0A 4Q0PA 1AXYA 3M4FA 2P37A 3K75B 5FAXA 5A3UA 4GD4A 4Y20A 4AOCA 1W2OA 5C6CA 3PTRB 2CTVA 2RM22 2WNOA 2ZZJA 1H1MA 2PELA 3AX4A 4QU2A 2WRAA 5FZMA 4AQ2A 4Q4W2 1O5LA 3OUJA 4GKXA 4IL7A 4XJAA 5FZDA 4FPEA 2J1TA 1A8DA 1F9KA 4B8EA 4OHVA 1XU1A 3S30A 4D0QA 4Y4RA 1GP5A 1OHFA 5K0UC 1R1A2 4N9HA 1I1EA 1VR3A 1REEA 3VBFA 1ULCA 2ZZQA 3VB9A 3B01A 5DAVA 2RS32 2Y60A 4W6YA 5JAXA 1RUH3 4KL1A 1UXZA 3ZFGC 3R4SA 4HPKB 3IDCB 3IMMA 4R4XA 4Q1RA 3ZYBA 5CKNA 5KHKA 2SBAA 1U0AA 2C4XA 2W87A 1PO12 1QJX1 1UMZA 3AP6A 5BPXA 1C3HA 2GC2A 3NJVA 4QXCA 1VBC2 4PI2A 1N3OA 1DYKA 1CZTA 4YZ2A 1SFYA 3I4IA 5ABJB 1W28A 4MH0E 4RHV2 2XJUA 3OYWB 4PQQA 2SLIA 1LHUA 1TEIA 3KZ4C 3EXUA 4RS5A 3S7IA 4QGLA 3M2MA 2Q30A 4Y1YA 3ZSMA 1PGW1 4AHXA 2XWJB 4GMP3 1A3KA 4A6SA 3RZLA 3N7LA 4LBQA 5FYIA 4CEYC 1RUJ3 4BE3A 3E5XA 1PK6C 2GH2A 4H7LA 4K8RB 4HONA 1MS9A 4B4PA 1XNDA 4QPGC 1OLQA 5A7NA 4FAGA 2RVAA 3WQ0A 3H8UA 4R9AA 5I91A 1PIV3 4K1YA 1JBCA 3UK9A 1OLME 2CAUA 4I01A 2Z5WA 4SLIA 1SLIA 1EY2A 3OGSA 4IW3A 2NLRA 3T1MA 1GFF2 2OT7A 4KU8A 4C0BA 4AL9A 3IBMA 5EQUA 3SEPA 3MIGA 2ENRA 2WABA 3WP6A 1IS5A 3THTA 3ZXJA 5IVVA 1WGPA 3WG2A 2Q8DA 3A22A 4Y1UA 1JODA 3LAGA 4BQWA 1OLMA 2JDMA 3C7HA 4RN5A 5LWBA 1HKDA 1YYNA 2DWRA 4N43A 3PURA 3VBUB 4JGZB 1F4AA 1QGLA 3O12A 4IE4A 1O8SA 5GALA 3VBHC 5JOZA 1QJZA 4K6BA 5DABA 3FMGA 3JBG3 1RGSA 3RYKA 2O8QA 4YFZA 2K0GA 1Z7S1 1PZ8A 1W03A 1O4YA 3TEXA 1QDCA 5CFDC 2YMZA 3IDBB 4QDQA 2JB8A 1UYPA 3MYXA 4GH4A 5JDBA 4QAWA 3ZOIA 1SBEA 4NHXA 4AI3A 2ZMNA 1HQWA 4IV1B 2VMFA 3RG0A 1UL9A 1H8TB 1WLCA 3C2UA 4R9DA 3ZXAC 1D0HA 1VBE3 5FZLA 4UOJA 2CGOA 4Q0VA 4HVOA 4ES8A 1SZBA 4XXPA 1IPJA 1JI6A 2CWSA 4N53B 4YVWC 3T0AA 3WNXA 2XLAA 3LGRA 4F83A 5HXVA 1NXMA 3PJYA 1UOGA 1UOJA 4FFFA 1O5UA 1YJLA 2RMU2 2YPJA 1DZRA 4IE7A 4COVA 3K4AA 2BWAA 2XH6A 4RR3A 3L9JT 5JSRA 1I5ZA 1YNAA 1H8TC 1QF3A 1AUYA 1D4M1 5DZEA 5LA0A 1UY3A 2VW1A 3VBRB 2HWD3 1ZBA3 3ZR5A 4ZXKA 4MYEA 1US3A 4YYOA 3RZZA 4ARYA 3POFA 1X50A 1RUD3 2BUKA 2N7GA 1OPOA 3TN93 4AR2A 5FQ0A 1ULOA 1V9U2 2VXJA 2ZKNA 2IXCA 3WY6A 4DXRA 2AH2A 1RUG2 2Y34A 1Y43B 1VIWB 2P3KA 5D1IA 3WDTA 3C7OA 2W95A 1DHKB 3BUCA 4KMQA 1UX7A 3VBRC 1NA1C 4QXHA 1J83A 3H42B 5FXXA 4OUEA 4F7ZA 3FBMA 1NE4A 1R081 1DGLA 3AVRA 1CPNA 4DRVA 4OHYA 1OA4A 1AF9A 3D4KA 1HV0A 3IM0A 3MIFA 5FXZA 5LBCA 4AI9A 4RGGA 4R4ZA 5IUQA 2OPWA 3EYPA 4IEZA 2NZ9A 3OTFA 3SKVA 3MICA 3AYEA 5J98B 4CDUA 1CZSA 2ZEZA 4QGMA 4Q4X1 4B4QA 4IV3C 3RZGA 2PHTA 3CEWA 2D3SA 4QX0A 2HWF2 2J42A 3DYMA 1SBFA 2F6BA 4XFAA 4D3WA 4XHBA 5JPMB 2VZOA 4COWA 5JLVA 1W9TA 4UW3A 3AFKA 2BDRA 5FY9A 1UPSA 2AEZA 3AB0A 3ALQA 3TNPB 2Q0AA 4C1XA 1RUH1 4NOTA 4O61A 5HCFA 3WV6A 4WV8A 3POGA 1DZQA 2PHFA 1NY71 5IAXA 2ZX0A 2VCAA 4W6WA 3RFRA 2A6ZA 2UYBA 5FDBA 1IGOA 4CA9A 1ND2A 1JMUB 3ACGA 4GA9A 2YG0A 4J6GA 4XHXA 1V6KA 5CFCC 1AXZA 1R092 4QKFA 5FMCA 4UYBA 4S2GA 5FYVA 5IHRA 3PIGA 4Q2FA 1EYBA 1JTZX 1S0BA 2WNUB 5M0TA 1X33A 2D40A 1W0OA 4HN1A 4XTPA 3OY8A 1UX6A 4LUMA 5F5CA 4IEUA 5A7WB 5A1AA 4LORA 5ACA3 2EVXA 3PUIA 3W5MA 4QQ2A 5FMDA 3UKVA 4QQOA 3T2OA 4P00B 3WXPA 1AYM2 1LENA 4IERA 2X5IA 1N1SA 5FYHA 4BOWA 3I3MA 1EAH3 5FZAA 2ARCA 1ST8A 1RUJ1 1D7PM 2OX0A 3NNMA 1SDDB 4LKSA 1EUTA 2XKPA 3O0WA 4AAXA 2MEV3 1YFYA 4HVRA 1HQNA 2QQIA 5A7PA 2YV8A 3ZXEA 1UD1A 3URFA 5T5OA 3UL2A 1EV13 3ZSJA 2XVKA 5IVJA 1DGRA 1PIV1 2ET7A 2Q8CA 2A71A 1VBA2 2R0HA 4HOOA 2NYYA 3AXDA 4H14A 5FZ3A 2VZRA 3MF9A 4C0HA 1YJKA 5HI0A 3HN3A 4IGQA 2YGLA 1RUE3 1FMD2 4MOAA 4Q8KA 1N47A 2HYXA 3I2FA 4AE2A 2D93A 1US2A 3N9PA 1FI2A 5FZ7A 4CCDA 2XB6C 5EP9A 3FX3A 4AF9A 4DZGA 3SH5A 5FK8A 2FCUA 2ORZA 4M3CE 4OZOA 2X29A 2Y38A 3AYDA 4YVSC 3WT3A 1JU4A 4DUWA 4LBQB 1CAUA 4DXZA 4P5HA 3BKZA 2W68A 4Y4YA 4CTEA 1H2LA 1LECA 2FZ1A 3GALA 1RUC2 4TLGA 5IK4A 1IG3A 3FWEA 3JBG1 4KWKA 3T1LA 5T5PA 2VMDA 3KF3A 4WBBA 1QNWA 1S0JA 3AM2A 2HJIA 2DUPA 4LBLA 5FXVA 2GMPA 2VECA 4YM1A 2VW0A 5JVVA 4CPBA 1PHMA 5BNNA 3I49A 4URAA 5DDJ3 3U4XA 1YQ5A 3I54A 5JZGC 1VMFA 3OCPA 4RD7A 5A32B 3TRSB 3V65A 2JDAA 3WG4A 2I07B 3UESA 5A6YA 1VBE1 3O0XA 1ACCA 1GNHA 3KCCA 4EWAA 3AZXA 1WW6A 2XHNA 3BIWE 1KGYA 1LODA 2Z79A 2WIIB 3LOIA 5SV8A 4NIAA 4OHZA 1DYPA 3OEAA 3U07A 1B09A 4AI0A 3I8TA 1RUOA 1JUHA 3AZWA 2AEYA 2NPIA 3HEIA 2WAOA 2D6KA 3NMBA 4BQ1A 1KS5A 4X6RB 3MLLA 4JDOA 3BALA 3H7JA 1L3JA 4YFWA 5DG1A 2VUCA 1QJU3 2ARXA 2W47A 4L0PA 1GNYA 1ULEA 4JRLA 1BBT2 2PQQA 1GWMA 5E6HA 3HBZA 4Y22A 1ZBA1 3LA2A 5F1RA 2O8OA 2GN3A 2A73B 1G8WA 1OQEA 4CXWA 3TBDA 1RUD1 3TN91 5FYZA 4XAAA 2BW8A 4L97A 5FP3A 5H9SA 2EALA 3K46A 2ZEWA 1X9TA 2XXZA 3NAPA 1LTEA 2WYFA 4FI9A 4FTEA 2VQUA 1VRH2 2WO1A 1GV9A 1QXJA 2YUEA 4UXAA 3RVHA 1ENRA 1RTVA 5LBBA 3H8OA 4ATEA 5JWPA 2WDBA 5FXWA 3O1MA 1FV2A 1UZZA 1RHI2 3RWKX 3I3DA 2W52A 4FOVA 5ANQA 4GB32 2BPA2 2HWC2 1KFXL 3KCXA 5EPAA 2F17A 4Z07A 1AHSA 3ZPOA 1SG3A 1HLCA 2VMEA 4UW6A 5IVEA 4Z2AA 4YW4A 2VCBA 4Q29A 4FSJA 2P3IA 4M3CF 4HVQA 2LS6A 4DS0A 1ODNA 2P17A 4OULA 2G9ZA 1S0CA 2VZQA 3U10A 3RZHA 2HYKA 3K48A 2W9XA 4AEDC 1JZ7A 1CAVB 4ZY9A 3ZDSA 4CDXA 2WT1A 2C9AA 1IQDC 1ZREA 1ZZ8A 1QH7A 2JKBA 2CNAA 2JENA 4MV2A 5KC5A 2XG3A 2YU2A 4AQ6A 4CCNA 5CIRA 4AHYA 1UAIA 2D6MA 1TME2 3UKNA 5I8YA 4IGPA 4XXAA 3ILRA 3J8F3 3ZXGA 1LU1A 1LCLA 2ZHNA 5FLIA 3ZFEC 2VG9A 5HPOA 3A0NA 1JS9A 2QQMA 1QJY3 1V6OA 4NUBA 5E1RA 5A33B 4Q0SA 4GAZA 2KD7A 1R1ZA 3I97A 4IEXA 5DMYA 3JD71 5F3CA 4RL7A 4CDQC 1PMIA 2LUWA 4IEOA 2IWGB 4LPLA 5F5IA 2D5FA 3MUY1 1E5RA 3LFIA 3EO6A 1LESA 2QUOA 5FYCA 2XOMA 4CCEA 3I2OA 3H3LA 4MGTA 4O9GA 4KWLA 3CBNA 4JKLA 5LK5A 2ID4A 3IT8A 1VBB3 5DUXA 3LOBA 1GZTA 1DLLA 3MDPA 4AG4A 4CUAA 4UF0A 2ZS6B 2QBXA 1CGPA 4BCUA 1Y7BA 4DINB 1NAEA 3D3AA 1D2QA 2VVDA 1DU3D 1GANA 1PO22 3B69A 5ACA1 2RV9A 3LKJA 4IETA 3WSOA 3ZSKA 2E6VA 2HWB3 3IKWA 2IC1A 1PGL1 4LT5A 3VBSC 4K3UA 1EAH1 4LNVA 4XUQA 1DQ2A 1HB2A 2QQKA 4NWVA 4R9CA 3UV9A 4BLIA 5CB7A 2DCKA 1OH4A 5AC92 2MEV1 3ZYHA 2Q8OA 3ZPYA 2VOWA 5JR7B 3CU7A 1HRV3 2GN7A 3QCWA 3VL9A 1LHVA 1EV11 4XYXA 3OF1A 3WP3A 4BQ4A 1SLAA 1NCRC 4NJ4A 1LR5A 4XQWA 1A8MA 2Q4SA 2RR12 5CADA 1E5SA 3LEGA 3V56A 2XHKA 4XE9A 1UN1A 1W2AX 5K0UA 4QB2A 5JMCA 4S2FA 1RUE1 4GZ9A 4LHLA 4XQ4A 5JSOA 2BFUS 3IMNA 1GOFA 1NLSA 2D6PA 2Y6JA 2G4IA 1U5ZA 4BQ2A 1UY2A 1LOFA 3N35A 3POBA 2AACA 2EAAA 3SQOA 4PDWC 4COUA 2XJRA 1UIKA 3I2IA 5HCBA 1BJQA 3PUHA 1AX1A 4K7JA 4DXTA 1I5PA 5ERLA 3VD9A 3MFAA 3AXEA 3PJQA 2W3JA 4GXLA 4QKNA 1U5XA 2QQWA 1K5MB 3ELNA 5C8WA 2VZUA 3J4UH 3DV8A 3KS7A 5GZEA 4C8DA 4A4AA 2HH9A 1XE7A 1GBGA 4IEVA 4CPBD 2W94A 4D8MA 4CU6A 2EF6A 3CZJA 1LEMA 2RDNA 1W8TA 4JKMA 5GM0A 1HRI3 1S2EA 5IK8A 4AZZA 1W6MB 3ZN5A 5C70A 1CN1A 1VB4A 2DBNA 1YIPA 5FBZA 4GWNA 2DBIA 2WZR2 3DPRA 2Y0IA 5D21A 1LULA 1B35C 1OD5A 1S55A 2E7QA 4FPLA 2Y33A 4OI0A 3S57A 1LGCA 1MPXA 1GR3A 2QQUA 4JC1A 5FPZA 2WBKA 4NPLA 3WNPA 4DO0A 2J1RA 1PK6A 4EN0A 1QJX3 1UY1A 1NCQC 1SLCA 2VOKA 1C5HA 2W1UA 1OKOA 4LUKA 4DNYA 5LEKA 1QJU1 4QPGA 2Y6HA 5D8AC 4B3NA 5BUVA 1XU2A 2QZ2A 2XL7A 4XZUG 1O3QA 1J3QA 2NQYA 3K3NA 1OOPC 4M3CB 2PYTA 4DRRA 4S2DA 2A5ZA 3CL1A 5DAXA 4JHTA 2R043 5BNPC 5IYYA 2DVGA 1OMIA 4CP1A 5K8SA 1DLCA 1FT9A 2C9KA 2DCYA 1LEDA 1W06A 3U75A 5E89A 2R7EB 4A7KA 5HXMA 3KLSA 4FFHA 4JX0A 4PBPA 4BYYA 1ZBE3 1H1AA 1LOAA 1XE8A 2C24A 2WS93 2ZGOA 3MHZA 3W9AA 1W6NA 5DUVA 4HSJA 4CDWC 3VBHA 5FKCA 5FUIA 5SV5A 5FPLA 1WCUA 1PM7A 4EV0A 4KWUA 5CKMA 3ZYRA 2P1BA 4Z2WA 5A1LA 3VDDB 2C1FA 5FPUA 3IB3A 2R073 3I3QA 4Y22B 3S6PA 3DF0A 4QKBA 2XQXA 3DXTA 4QPIB 1Q8VA 1UYXA 2OZJA 1CAWA 1OVPA 4OLLA 4FAHA 3AMQA 2WZPP 4A44A 2DU0A 3GYDA 4B1MA 4BQYA 1AR62 1GQPA 3VDCA 2YROA 4QU1A 1JW6A 4ARXA 5C9AA 3POJA 3X29B 1RB8G 3D82A 3ZFFB 1XQNA 3OGVA 5APAA 2YC4A 3J7NA 4WZFA 1LAJA 1VE0A 4FPKA 4P08A 5BV6A 4IEQA 1Z7S2 2Q1ZB 4YVWA 5FCCA 2GU9A 5A3OA 3B5LB 3KT7A 4XFCA 4JTNA 1OQDA 1M4WA 2ZKLA 2DDUA 3CJIB 4QPIC 3LEMA 3AL5A 1NYWA 4N7IA 1VAKA 5F2WA 3WNOA 1W6QA 2A6XA 2BWCA 1CESA 4RQPA 5FOBB 3O1OA 1BEV2 3Q8AA 1JYVA 1SDWA 3J8F1 5JUVA 1GZWB 2L9LA 4BMBA 3HT2A 1VBD3 2BQPA 3BODA 3ZFFC 3MGUA 2DCTA 4CUCA 3B94A 3KD4A 5FIXA 1X36A 1BVVA 2JG9C 1BVP1 2PLV3 2YC0A 5FZFA 4NIDA 1SLTA 4LOTA 3TWIA 1NX9A 4CDXB 3HOBA 4AAPA 1VBB1 1NLRA 3QBQA 1IOAA 1C28A 2VMGA 2WZEA 2Z42A 3N9QA 1J1TA 4XFGA 1ZNPA 4ZXEA 4AYUA 5FWJA 1D4M2 4LMFA 2XLFA 3ZO0B 4KG0A 2ZGLA 4KBBA 3C7EA 1NA1A 3KQ4B 4XACA 3R4UA 2QQPA 3O1UA 1UZVA 2I45A 3H1WA 3WW4A 3BIEA 2B42B 2JKXA 2HWB1 1UU5A 3UGHA 2A3YA 1CQ9A 4LE4A 4GIQA 5C8CB 4EROA 5FZOA 3HNMA 1NE6A 1YHFA 1QEXA 1XBFA 3UT0A 4MADA 3POYA 2AZ5A 2PHLA 4XJ9A 3VGIA 5BNOB 1C1FA 3H1MA 5GJ6A 4LBNA 5T3NA 3I3BA 1Q8PA 4A7ZA 1GMMA 1LGNA 1XXNA 4FT8A 1R082 3FE5A 1G9BA 3GCXA 3V0AB 4HKLA 2CAVA 1NQDA 1H9PA 2WA3A 3E5QA 1I6XA 3KWVA 4CUGA 1ENSA 5JMOA 3CZUA 3ZDVA 1S2BA 4YZ3A 3VDAA 2B8MA 3EHKA 1UY4A 3BPZA 3QLQA 4UF0B 4AWDA 1XPWA 1C4RA 3U37A 1EUUA 1QOOA 5BNOC 1MQTB 2BTVC 3K4DA 4ISRA 3NV1A 5FREA 2BEOA 3USUB 1WD4A 3FUOA 3K3OA 4EYUA 2X10A 3HIFA 5T54A 2VU9A 5HBAA 2A75A 1OUXA 2CL2A 2JWPA 4KGQA 4Q4X3 5A70A 4I30A 2PN5A 1T6BX 4XFHA 4BQ3A 1MQTC 2DTWA 2FCVA 3OGGA 3VBOC 3W58A 1NUKA 5CFCA 1DIWA 4NROA 2W5FA 4OMDA 4W50A 1RUH2 1SHWB 5LATA 3VKFC 3WF0A 4D7SA 4EN8B 1ASJ3 2VOVA 3E6DA 1OURA 3KV6A 2WWJA 4QX2A 2GNMA 1NY72 5EJ3A 4RFRB 1HRI1 1LNSA 4U36A 1VRBA 4E2GA 3FFQA 1Q43A 4YGEA 3R0RA 5FZCA 1NZCA 2FDJA 5LASA 3LEKA 5IK5A 4EWDA 3J9SA 3OEBA 1W8HA 2GC3A 1F31A 1NOVA 4MZUA 5H9PA 1UZWA 4BPZA 3DUIA 2E9QA 3DGTA 3LD8A 4QM8A 2LRPA 4RGAA 4CXXA 2NMNA 2P4EA 3FC0A 4IXLA 4PI0A 2VUAA 3LFMA 4B7KA 3LCPA 1XJAA 2VE1A 3UKTA 2ARBA 1W6OA 2PQSA 3KVAA 2ZABA 2WLPA 2ZGQA 4OI2A 1ALYA 1RUI3 2IFRA 1SLBA 3RZKA 4OQ9A 2JICA 2H6BA 1RUJ2 4CCOA 1GLHA 1KDMA 2R041 2RHPA 4U2AA 2WLQA 2P5BA 2J22A 2WFPA 1KDKA 2UY8A 4Q0QA 5J36A 4XUPA 5FWEA 1Q5OA 5FZ9A 1QY4A 1UOFA 2VH9A 2W08A 1PVC1 3LPGA 4LLOA 4YNIA 4PLNA 5FP8A 5KBFA 1JZ2A 1PIV2 5ABJC 1RUF3 1ZBE1 2WS91 4YVSA 3TYJA 3LIHA 2C0ZA 2O14A 1UW8A 1XNBA 2ZTNA 3RQ0A 5J48A 4YG3A 3OPZA 3LIGA 2JXAA 4FPGA 1W2NA 4WVMA 2JE9A 1K5JA 1OD3A 4QX7A 1CR7A 4KU7A 3A0KA 3T4VA 1Y9GA 5F5AA 1CPMA 5LRRA 1SACA 3SXWA 4I0AA 2R071 2VTXJ 2ZACA 2CU5A 4NE9A 2X8KA 1UKGA 2ZGUA 2DCJA 3POIA 4HL0A 5JZGA 2WYSA 3UETA 1OH3A 5FYYA 3OBTA 4MGIE 1ZRFA 3JBG2 1BQPA 2C26A 4XBQA 3FUQA 3Q8CA 4M01A 5IAVA 4YW6A 1QOSA 5C4WB 4J25A 4MO3M 4BQ5A 4XQDA 5GZDA 1DQ5A 2D3PA 4AFMA 1TNRA 1UIJA 4MXWB 5CA6A 3ZN6A 4Q4Y3 1H2MA 2RG4A 5AFBA 1VBD1 2XBO3 1VBE2 1LU2A 3VBUC 2Y6KA 3N4MA 1J58A 1O4ZA 4JGZC 4DUXA 5C4WC 2XVLA 1HB3A 1D4VB 1POV0 2J1VA 2X09A 5EYYA 3WDUA 3AKPA 3LZZA 2PLV1 1VAVA 3GJBA 5IW0A 3NVCA 4MSVA 1RJ7A 2O1QA 3WDXA 1W9FA 1WUVA 4BA6A 3N36A 5C9AB 3ST7A 4XZPA 1NKGA 2LROA 3RYPA 1K12A 2R30A 1BK1A 2BGPA 3LPFA 2QDNA 3TNQA 3KVBA 2QVSB 2WNVB 2VMIA 4BXFA 1OVSA 2FQPA 2HWD2 1ZBA2 3IZOA 5I8SA 3WQ7A 5BXXA 2WAAA 1J59A 3GDBA 4IV1C 5L7OA 3ZR6A 1RUD2 3IPVB 4QWNA 1ND3A 4RQPB 5FKBA 3TN92 2H0VA 4LKEA 2BV4A 1BKZA 2VQTA 3FLTA 3UJOA 5FYTA 2HLEA 4N53C 5DZGA 3RGBA 1RMU3 4QX3A 4NPRA 1MS0A 3J26N 2BNOA 3B9IA 2BERA 5FLJA 1YRZA 4LITA 1AZDA 1HQLA 5T5LA 1TQ5A 4NHMA 1WZXA 4FTBA 3I2GA 1D0GA 4O65A 3WINE 4AEDA 3THDA 1N1TA 3KF5A 2IFWA 5LA1A 1GOGA 4YZ1A 4YG6A 1VAMA 1XNTA 2I74A 1C8M1 2QTWB 4HXCA 1O8PA 4ZS2A 2Y0OA 5LY2A 3BU0A 3VUOA 3ENRA 2MHFA 4F8AA 1ULDA 4BB3A 3MEPA 4UT5A 3OD4A 3NNLA 5LEJA 2JIJA 4D7YA 1IG0A 4XFBA 4OUMA 2TBVA 3LQCA 4C90A 3ZFEA 2E7TA 2D98A 1FPN3 2HEWF 3AK0A 4I0BA 3W5NA 4E27A 4JGYB 1MS8A 3ACIA 1ZA7A 4LIUA 5FZOB 3SISA 4IGOA 3O14A 2WFF3 3JU9A 4UBHA 2XJPA 4K21A 4CDQA 1N3PA 4LEJA 5FMOS 1JYCA 1G9FA 3KSCA 1CD3G 2DU1A 3JCIA 5FYUA 4BIFA 3ZIWA 4DQAA 4XIOA 1VPHA 2V4VA 1GWKA 2VMCA 4Y5Z0 5CU1A 4Z82A 2J1UA 3U11A 5CBLA 4FPFA 3TEZA 4JGYC 4GJZA 1ASJ1 3BOPA 1C57A 1O7FA 3WUDA 3AL6A 3S0MA 1F4HA 1DZTA 1QQP3 2R063 4KI5M 4BMEA 4O7XA 3ZSLA 5FYMA 1CAXB 1DFQA 5A6ZA 3WDVA 3WP5A 2VXRA 3JD73 2EXJA 3I59A 3J7LA 3KHBA 3D8CA 4CCLA 4PF1A 3VBSA 3PU3A 2DTYA 2BU9A 1FXZA 2XVGA 4Y20B 4MUVA 4XIKA 3DEMA 5F2SA 3CHXA 1DG6A 1BLZA 3R4DB 1Q56A 2PA7A 4CZSA 5FJKA 5ACA2 4A6OA 1O59A 4JVAA 4NAOA 5JXJA 2E31A 2BVVA 3SCGA 1XSRA 5CG9A 1RUI1 3GZUC 4UFIA 1JOPA 3VBFB 1PGL2 2E63A 1BMV1 3R6SA 3I2DA 4PIZA 4XJZA 5FZBA 4Y3OA 1MR5A 5LA2A 3WDWA 2MEV2 4ZZ5A 3VDBA 4PHZA 1ODMA 1RITA 1C1LA 1EV12 2JG8A 3W59A 4P9JA 2WNUC 1UU6A 5I0DA 1RUF1 2Q5TA 3K4ZA 2AENA 5FPAA 3VBFC 4LO7A 5F39A 1NLQA 4YM3A 2YFZA 2P3YA 1RUE2 2JDHA 5E8AA 3AJZA 3UYJA 1POV3 4HK9A 2AREA 3DN7A 4NAMA 1QJFA 5DAQA 3RSJA 1WLTA 4XF3A 2DF7A 4A42A 2ZJCA 1AR93 4FP3A 4Y1VA 1SPPA 3MIEA 4CEWA 1MS1A 5EHDA 3T30A 4H3WA 5IJRA 4RS5B 1AX2A 1YQCA 2AGSA 2OUHA 4LKFA 3O1RA 1E5IA 1V70A 4AVSA 3NO8A 2ZGSA 3GZEA 1UZ0A 4EWEA 3TEYA 5FZGA 4LBMA 3B02A 1OI6A 1OPMA 3ZMOA 2UY9A 3CO2A 3FLRA 2Q1FA 3LE0A 4COZA 1B35A 2ILMA 3ACLA 1FNYA 2FBEA 1YWKA 4A45A 1JHJA 1ZZ6A 5C71A 3BI3A 2XJSA 3W21A 1AR73 2YFUA 4LE3A 5DDJ2 1WW5A 1GOHA 4RS5C 2BFUL 4Q4Y1 5LBEA 4WVMB 4JZRA 3T2PA 4AGGA 5D8AA 5IT6A 2XBO1 4JDMA 3WLUA 2ATFA 1LRHA 4FO9A 1OOPA 3T2QA 4DOUA 3HN1A 5C5UA 4W4ZA 3T0BA 5J09A 2EXHA 5A1FA 4I2OA 1UOBA 5BNPA 3CMGA 2VM9A 1IPKA 5EV7A 2RS53 2XKOA 2GAUA 3L2HA 4MGSA 3KGZA 4EN9B 4CP2A 1OF4A 2VR4A 4N43B 3OBZA 4QPYA 4BH9A 1RXFA 4P9XA 4EE2A 2IXKA 4ES9A 3BB6A 2TNFA 1A78A 2VCMA 2QQNA 2WUHA 4PIXA 2JD9A 2ARAA 3UNPA 1HX6A 5FZ8A 3WF3A 3WW3A 1LJ7A 1V6JA 2VTFA 5GZCA 2E51A 2V73A 1WCSA 3GNEA 1UYZA 3BN6A 2QFEA 4GH4B 1RMU1 2RS13 4UFKA 2C6SA 2VUDA 2R6QA 2FZ2A 2CY6A 1S4CA 1YFUA 2J1SA 3OOXA 4DB5A 3DXUA 2Y64A 3ILFA 4X6QB 1JZ8A 1AL23 3AKRA 5LZ6A 2DVAA 1DGWX 4K40A 2VOXA 3FBYA 5FRAA 1WA6X 1GU3A 4K8FA 5FBJA 5FY5A 3VKOA 3VD4A 4MXVA 5C7GA 3KHCA 3I2KA 2VULA 2VMHA 1KRIA 3A21A 4GH4C 4K20A 2RJ2A 4RR3B 1PVXA 1MACA 3THPA 2NN8A 1N3QA 3VHRA 1ND3B 2A6YA 3MLJA 1JXNA 1KEXA 4E4ZA 4AGVA 4XVHA 4NHYA 4P02B 1FPN1 2EAKA 2HBUA 3POSA 4M4PA 5DUUA 3MPBA 1JOJA 2WT0A 3LSEA 4G9SB 4M0NA 2AYHA 5IK7A 4QKDA 4D6SA 2WFF1 5FQ0B 2BGOA 4FPHA 4Y1XA 1AR83 4LIVA 4YSFA 4L99A 4P9GA 2JG9A 1H8VA 5KHIA 1GP6A 5KHGA 4WM8A 1W8FA 3INAA 3MIHA 4CU9A 3K77A 5CZKA 1R64A 4QT6A 2QZ3A 4HKWA 2A7AA 3AMPA 3P3NA 3J8F2 3WCSA 2FDHA 2ADDA 3AP7A 5FO8B 1QJY2 4M4RA 3WD5A 2OA2A 1NQJA 2D6OX 1ULFA 1GSLA 4PJYA 2PTMA 4FCAA 1QQP1 2R061 2VVFA 3RPQA 5GZFA 1Q8SA 4Y1ZA 3THCA 3WF1A 4V2WA 2DURA 3IWZA 4W6XA 3T0DA 1SFNA 1MVEA 3EJKA 1W2TA 1V0AA 2H6CA 1YQ2A 3IDEA 3MFCA 3N9LA 4WM7A 1VBB2 2GNDA 2PMWB 5KR7A 4XEZA 3GBGA 5J3UA 1SFPA 2ZGPA 5G04L 4CU7A 5CVRA 1W6PA 3WOGA 3ZYJB 4CDUB 4ZS3A 2FDIA 2R1BA 1K45A 5FOJB 1JU3A 4RSUA 3RMYA 1LOEA 1OA3A 1FAYA 3GZAA 2E26A 2HWB2 1FOD3 2B45X 1RYYA 3ETQA 4B1LA 3J7HA 4XBLA 4YGCA 1G86A 4HLTA 4NMIA 5LB6A 3GBFA 1YXWA 2VZ3A 2MNGA 2XMLA 4CDUC 3LDBA 5JCTA 4A7YA 4LO8A 2GMEA 3RDIA 1HRV2 1GZCA 1HXS3 3A7QA 3WUCA 5FYBA 1W8NA 4JRAA 2VPVA 3KGLA 2IUWA 1MZEA 4NVPA 2JB4A 5KXCA 4E2SA 2PHRA 2Y26A 1ND2B 2B39A 2Y6GA 5FY0A 3FFZA 2V09A 4O9EA 2LW8A 3GM8A 2HKXA 1OFSA 3JQXA 3MLKA 2NM1A 3EMRA 3ZX7A 4Q5OA 1JZ4A 5CKQA 1POV1 5L36A 5KWRA 3QOPA 3NKTA 1OBNA 3B93A 5C3QA 1AX0A 1AR91 1GQGA 2XGXA 5KC6A 2GDFA 3JB4C 3OY8B 5I93A 2V72A 1H30A 2BVBA 4B29A 5FR3A 2GZWA 1F35A 2ZGMA 1XRUA 3WG1A 5GZGA 4LR4A 1OSGA 3ZFGA 1S0DA 2E33A 4DY5A 2EIBA 2X5IB 3RYRA 2CDPA 2BRTA 2DFCA 4JV4A 2TUNA 2UYAA 1GKBA 1HB4A 1UU4A 2WL1A 4DFSA 1AR71 4TN7A 3WZ1A 2Y8KA 4P9LA 1S2KA 1VP6A 2XONA 4GJYA 3H7YA 1J1LA 3KV5A 4QQHA 4XAEA 4AI8A 3ZXKA 4SBVA 1E57A 1HRI2 3AFGA 4Y24A 3S7EA 1QH6A 1CX4A 3WNKA 4LO5B 4L11A 1COV3 4PQ9A 5FO7B 4CSWA 2YHJA 4HPKA 1SPPB 1W2UA 3PHMA 2V5DA 1MZFA 2VO5A 3FHAA 5EYXA 3DKWA 1FMD1 2WQZC 5A80A 3WQ1A 4AVBA 1JZ5A 3LA3A 1H0BA 1LHNA 1HIXA 1PMJX 3PVOA 3AKSA 1QJX2 4Q27A 5H9RA 5C33A 2RS51 3RS6A 3N7KA 2LTNA 2OIIA 2VD7A 1K5MC 3EBRA 3PL0A 4ZHNA 1HJGA 1WMFA 3MUZ1 5DN2A 1CAUB 2JE8A 3HJRA 2PAKA 4KQ7A 3VZNA 4CEYA 3V0BA 1XE0A 3ZYFA 4XDOA 4CUBA 3VV1A 3U0ZA 1W3XA 4LK7A 1NZIA 1V00A 1H6XA 2V5YA 2WWUA 2XDVA 2BOJA 3OG2A 4FPOB 1SLLA 3SC7X 4BM8A 3ABZA 4CP0A 2R042 3H1YA 4QDSA 4LBKA 1NXD1 1PGW2 2VL4A 1MS3A 3T2TA 5BNNB 1Q8OA 1AYN3 2RS11 1TZOA 1W3VA 3HQRA 1V6MA 1UY0A 1HW5A 1ZBE2 2XJVA 2WS92 3AC0A 3HNYM 4D6QA 2WC2A 4R8HA 2JDNA 1AL21 4OHXA 1PVC3 5BNQA 1F5FA 2JDKA 2WQ8A 2YBSA 3PMEA 3ITQA 4BHPA 4AHWA 4WVZA 2W92A 2MPFA 2PHWA 5DQ0A 5IVYA 2I2SA 1RXGA 4ASKA 3NWKA 2R072 3Q8EA 1CJPA 1SMVA 4XBNA 1JYNA 3HPNA 3QH6A 1QXPA 2VBBA 2W46A 4K1ZA 1BBT1 5A3NA 3GZTB 3MIDA 4NIGA 4FFIA 5CFDA 1T6GC 4M00A 4XFIA 5FPBA 4E8DA 1UWWA 4Q4V3 3H50A 1L7LA 3VBUA 3O1VA 2YXSA 3GJAA 1TMF3 5A7OA 1AR81 3NAPB 1W0NA 1WD3A 1ULGA 1PM4A 5DAWA 2QJVA 2YU1A 2Z4FA 1U12A 1UKRA 4XURA 5J96B 1HV1A 4YWAA 1FNZA 2EA7A 3VDDC 3ES1A 2GP5A 1W05A 1GICA 1VBD2 1S1AA 4YW5A 2B9UA 2RJKA 2NMOA 4D94A 2HWE3 5IWFA 2ZEYA 4ZU5A 5JIAA 3ZXLA 3HNBM 2QQOA 2ZGKA 1X8MA 3NAPC 2B9VA 1H8TA 3F95A 4IV1A 2PLV2 4Y26A 4CCKA 5BY5A 1O3RA 2K2SA 5JOWA 2J1AA 2PAEA 4TYSA 4OYUA 1SCSA 2JEMA 3FZ3A 1H6YA 4D6RA 1V6NA 3Q8FA 1FATA 4XCAA 3RI8A 1PNFA 1S0GA 3KB5A 3CJIC 3S5QA 2E32A 1IKQA 3HAGA 4GMP0 4BK4A 3VZKA 1MEC3 4Z8BA 3ME2A 1RUNA 3SNMA 3OSDA 2BYVE 3WHUA 4UFLA 1M06G 4XJ8A 4ATFA 3N7JA 3VBRA 4XMIA 5FY1A 4BQXA 2BBVA 5HV4A 1FOD1 1VALA 3ZSEA 3T09A 4ZU4A 2WA4A 2WSVA 5FY7A 2OYZA 4UW5A 2J1EA 3B9CA 3DCQA 3JXSA 3VKNA 1G9DA 3SLIA 2D5HA 2F4LA 3WCRA 4CDXC 3M3QA 1W8ZA 2D7FA 3N7MA 1HXS1 1PNGA 4JAAA 4WM7B 3CQOA 2ET1A 2ZA9A 4AW7A 3FJSA 4JDNA 2A6WA 4ZONA 1AVBA 3PTYA 2GNTA 1RVF3 3CF6E 4CP9A 4IE0A 3BTYA 4XILA 1W8UA 2VOTA 2VCCA 2O0OA 1VMJA 4IV3A 4LKDA 3TEWA 4FOYA 4S2HA 4QX5A 3ZM8A 1C8M3 2V4AA 1YI7A 2B46X 4JQTA 2X53S 3N9OA 2DUOA 5C8CC 1Y9MA 2EIEA 4GWIA 4G3YC 3B7MA 1CJDA 1XYOA 5EJ1B 3V64A 3LEIA 4INDA 4Y33A 3AMMA 2YGMA 4PCRA 2QQVA 1DQ6A 2DVFA 4Q4X2 3KV9A 5T50A 3U4SA 4H7MA 2OZ6A 1ZZ7A 3M3EA 2W1SA 3VZMA 1JUIA 5J37A 3RI9A 1ZX5A 2VBPA 4IESA 1F5JA 5FO9B 1Y9QA 5GKAC 5AC91 3WF2A 3AZZA 1BCXA 1H2KA 2VZTA 3PUAA 1ASJ2 4IQPA 4LK6A 4CCJA 5A3LA 2P34A 5JXIA 4LOSA 4AEMA 4LBJA 2JE7A 4OVEA 4IE6A 3C3VA 1COV1 4BDVB 1BYHA 3IDAA 5C3OA 5K0UB 1RINA 1UCXA 5JPNB 4UI9L 2CGPA 3D5OA 2JJ6A 2ZGTA 3DYPA 1RC6A 3NNJA 4MX3A 4TWTA 3VHNA 2YBKA 5FMOL 5F9TA 1YLLA 5E16A 4E4HA 1POQA 2DVDA 2G9GA 1KS4A 4HBNA 3DL3A 4YW3A 1URXA 2G1MA 3AMHA 3ZFGB 4H2AA 2IVIB 5LW9A 1DDLA 1WMXA 3BOWA 4LHNA 1W0PA 3RZMA 1X8EA 1ZZBA 3POWA 1XOYA 3ETPA 2RM23 2WNUA 4YGBA 3USSA 5F37A 5IVCA 4P5YA 4OCTA 1GUIA 3A4UA 3H3UA 4Q4W3 1RUI2 5FJHA 2JIGA 3HD8B 2RDSA 3I3EA 4EQVA 1BMV2 1OFNA 1KD7A 5A7WA 1R1A3 2YZ4A 3AVSA 1LOFC 4GKYA 2QNKA 3VD3A 4H55A 4E4SA 1AYN1 3OGJA 1OKQA 3OGRA 4KG8A 2XWBB 1ZRIA 2JX9A 4PIYA 2RS33 1RUF2 4XPVA 3HBKA 3E6BA 3DYOA 4JTOA 2WZR1 4OI1A 1PZ7A 1CONA 3DPRB 2XR4A 2JD4A 1REDA 4IDZA 1STMA 4LBOA 4CEYB 4A3ZA 1I3HA 1PO13 4BWOA 3V0BB 1PK6B 5LY1A 2QE3A 4DMIA 3APBA 4G4FA 1TVGA 2WSUA 4QPGB 4XABA 4AFBA 1VBC3 4FPCA 3QH7A 5GLWA 3Q9OA 2EIDA 4JKKA 1EP0A 4I3GA 4L8QA 1UYYA 1WCDJ 3DPRC 1GYKA 3ES4A 4RHV3 4XJWA 3ASIA 2IVJA 4Q4V1 3WW1A 5AVPA 1TMF1 4IE5A 1DQ0A 2HEYF 5C3SA 2VZVA 3SHRA 2A6VA 2VUJA 2ZMKA 4MGKE 4OI4A 5FP4A 2ZAHA 2CV6A 3MPPG 5DZFA 4Q4Y2 4YGDA 1F2NA 1V6IA 5FMBA 3VLBB 5GLZA 2XBO2 1W6NB 3AZYA 3LB9A 4NRPA 1A6CA 3VBHB 2HWE1 2QCSB 2VW2A 1QXRA 2ZGNA 5FZ6A 5C3PA 2AUYA 5A32A 4MGZE 1MZ5A 2R1DA 1BK0A 4L2NA 2VY0A 2WWSA 1JN2P 4YG0A 3ZKUA 3ZVXA 5CG8A 4DPNA 1H4GA 1DCSA 5CFDB 5DAPA 1WCQA 3IIIA 1CX1A 1VLNA 4JQRA 4LA2A 1CAWB 4GALA 4AFCA 4NIHA 5LA9A 3B3QE 3CKHA 5FK7A 1AR61 1TNFA 1IPSA 4PLMA 2FMDA 1ZM1A 1MEC1 4QQLA 4QXBA 5A3PA 4FQZA 3RNSA 1LOCA 3GXUA 4YVWB 2ETEA 3H3ZA 4XCBA 4DEVA 4EN6B 1O3TA 4ZPIA 4AEKA 3DKQA 3T3YA 3SITA 1J84A 4AGRA 1RMU2 1W6QB 2XUEA 1HN1A 1BEV1 1G9AA 3NRUA 4XDQA 1W8WA 3D0JA 3OPTA 1O91A 4NPMA 3ZXFA 5C9AC 2ZPXA 4DY3A 4TXWA 5FUPA 2KR2A 3NNGA 3Q8BA 4QGNA 2OW4A 3PIJA 2WO7A 5F3EA 4BXSV 2WNVC 1YI9A 1MS5A 2WKKA 1ZYBA 1ZZCA 4E9KA 1RVF1 3M3IA 2YBPA 3WNLA 5A6QA 3IAQA 5EWSA 4AVCA 4YZ4A 2IZWA 5F32A 4HT1T 4RQPC 5G05L 5E88A 3CNAA 4HG6B 5DXDA 4CVUA 1K42A 2ZBJA 1ULPA 2YYOA 1X7NA 1QNYA 1BXHA 3BGAA 1AJKA 3HMYA 2CDOA 2RMU3 3JZVA 3VHOA 2WZ8A 1NA1B 1FPN2 1Y3TA 2XJTA 3AZVA 3HT1A 3I2HA 2FDFA 3M3CA 5HCAA 2WFF2 2RE9A 3OBAA 4CYDA 1UQXA 1KXGA 5F6LB 1CAVA 4XF0A 2VZ1A 2EXKA 1J3RA 3E1F1 4LO4B 4FPJA 1LB2A 1RIRA 3ZLIA 3AMNA 3C7FA 1UNBA 1V9U3 4CCCA 4CRQA 2ZX1A 2XJQA 2VGDA 3WVJA 1RUG3 4HMZA 1XC6A 1LOBA 1PGSA 4WVWA 5GLVA 4CP9B 4YW7A 2UURA 4IV3B 4V2VA 3N3HA 4BJ0A 4QDRA 2BBAA 3ECQA 1QQP2 2R062 5FUNA 3FHQA 5LK7B 5F3IA 1CWPA 5FZHA 5H9QA 3C7GA 3VKMA 2WNEA 5A33A 1YUDA 4TZDA 3U14A 1ENXA 2FD8A 2VNOA 3JD72 5IVFA 1LKNA 4MVTA 4OMCA 4YPJA 4KGGA 5IVBA 3P6BA 5FZ0A 3KT1A 1JYXA 4CXYA 1MZ6A 2W91A 4UFHA 4OQ8A 1APNA 2VZPA 3M70A 3R05A 1YO8A 4E8CA 5I8TA 3QACA 1RL3A 4AVVA 5CAZA 3IN9A 2G19A 3QD6A 1A34A 4FXGB 3WP4A 5JSPA 3TOJA 3WF4A 3T4HB 1EPZA 4Z1VA 2K46A 2RM21 3ZXDA 3NKGA 4IUGA 1N1YA 5FLHA 2R49A 4Q4W1 3KV4A 3MO4A 1VMHA 2VC9A 4UBGA 4DXSA 4EN7B 5CFCB 3I2JA 1PX3A 2HWF3 5I0TA 5DG2A 1DF0A 1DP0A 1NCRA 1KJLA 2A70A 2PHDA 5A7SA 1G6NA 1R1A1 3P3PA 4I3PA 2D97A 2PFWA 1WLDA 4XFFA 1EAH2 2X05A 2R16A 1KFUL 2BNMA 4LHKA 5ISLA 1PMHX 5T55A 1AXKA 2RS31 4MHRA 4LJHA 1Q8QA 2JECA 3C8XA 3JB8A 4KBZA 3PVBB 4P14A 4CU8A 4PLOA 4HFSA 2IXHA 5EJZB 2RDQA 4RFT0 3POEA 3TB0A 4AK3A 3CLPA 4PDWA 1W9YA 1HB1A 3EQEA 3LF7A 3WR0A 5FZEA 1KQRA 2B7YA 2BOIA 3ZN4A 1PO11 1SCRA 1YFXA 4QB1A 1AR92 2YY1A 2W1QA 1GNZA 1X82A 2ZXQA 1R093 4XUTA 5LCWL 2Q1MA 1P8JA 4R9BA 3KQRA 1VBC1 1CZVA 1BZWA 2GP3A 3BPSA 1W6OB 3O5SA 4Y5TA 4RHV1 1W04A 4PF5A 4Z92B 4GMP1 2Z69A 4AFDA 4F3JA 2GC1A 1LHWA 4LBQD 5AVAA 1N1VA 1I9RA 2VVEA 1UO9A 4ONUA 1AR72 3EB7A 4Q0UA 5FYSA 5CNAA 1AYM3 3ZYPA 4EZ4A 2WQ4A 2XL9A 1OXCA 3VZJA 5JXGA 1WBLA 2VQAA 1CIWA 4ORFA 1IS4A 1V6LA 1K5MA 3HWJA 1JZ3A 4YVSB 3HVDA 4RYDA 1H1IA 5FTTC 1WA4A 4N9IA 1NCQA 4NHLA 2GSYA 2WN3A 1YQ8A 4M0HA 1S0IA 4X8PA 4B4RA 3U78A 5GLTA 1VBA3 1W6MA 4CE8A 1O6UA 2XPJA 4GQ7A 4XF1A 1YC61 3MW4A 4NRQA 5GLUA 2RS52 3N9NA 3VZLA 1QIQA 1WWYA 4QHBA 3DECA 5AFEA 1XYNA 4ISQA 1FMD3 1OUSA 3NSTA 3P1IA 3T08A 2P6HA 5JZGB 3M3OA 1VB2A 2ZAAA 2ZGRA 3K51A 2LM3A 4CCMA 3PVNA 4AI2A 1QJU2 4LLFA 2BZDA 2E53A 3KM5A 1ZRRA 2W0XA 2WINB 2YB7A 4Q8LA 5IFTA 2P6CA 4W65A 4FOWA 5JI7A 3MBWA 2D3RA 1RUC3 4IEYA 4M3CA 5EZWA 3WNMA 4CDWA 4ZKTB 5TSWA 2RS12 4YLZA 1UXXX 2ERFA 1DGWA 3ZN6B 1F8VA 2J7MA 2RDRA 4LQRA 1YFWA 5J7MA 2TEPA 4Q26A 3LDKA 1AJOA 1KJRA 3GGLA 1AL22 4N43C 3PUSA 3GF6A 3GHNA 4XMAA 3WEZA 4XETA 4XF4A 3JQWA 4JCKA 3SEEA 4MHUA 4YM0A 3VKLA 2WT2A 4N7UA 5EXOA 1QOTA 2KM2A 1IKPA 3AJYA 3OBRA 3P5BA 1D2SA 1RJ8A 2ZHKA 2FDKA 2GNBA 3LSDA 4XJUA 1JYTA 5B4XA 3VDDA 3F2ZA 2RMU1 3E97A 3WDYA 5JIUA 2HWD1 3BTAA 4KWJA 4OUSA 5K4LA 4QPIA 3HQUA 1DQ4A 5L7OB 3IIAA 5F5QA 1AR82 4N90A 1BBT3 2OQ7A 3PUQA 3WHTA 4HZFA 1WCKA 5A6XA 2OKXA 2E7AA 3J7MA 3ON7A 4FQ4A 5L73A 4Y5SA 1TE1B 5K9YA 3PMSA 3ACFA 3ZFFA 2PHXA 1S0EA 3BTXA 2HBTA 2P3JA 1V9U1 2JDPA 2Y6LA 4J1WA 1NG0A 1RUG1 1FV3A 1VRH3 1YIFA 2K9ZA 3CJIA 4QXKA 1KITA 4RR3C 4AEDB 5L7OC 1Z78A 3BCWA 1ND3C 1W9SA 1GZWA
chains in the Genus database with same CATH topology
3SH4A 1XNCA 3ZIXA 1QWRA 1RHI3 2XUMA 4D7TA 2VNGA 1LHOA 2ZCWA 4GB33 2HWC3 2WJSA 3H0OA 4L92A 4OFGA 4YM2A 1CVNA 1EPWA 4COYA 2LALA 2UWAA 4YARA 4WVVA 5B2GB 3MF6A 2VQ0A 3ZFEB 2KA3A 4FTSA 3L2YA 4TLFA 2A3WA 1DQ1A 5KXBA 2ZHMA 4R52A 4CDQB 2F4PA 5I0UA 4FOQA 3SMHA 4E4DX 2GH8A 4NHKA 5KXDA 1FOD2 2BNNA 1UF2C 3UJQA 1SBDA 2C5DA 2HWF1 1YCIA 3MIBA 5I0RA 4L9BA 2PAMA 3RMXA 5C8CA 1G9CA 1HXS2 2EXIA 4ZU7A 1TME3 2FHRA 1C8NA 2D44A 3MW2A 5BNOA 1ZRCA 3FLPA 4FXKB 1WLWA 5I0SA 4YRDA 2HEVF 1Z0HA 3I59B 3V0AA 3VBSB 2IXIA 1W39A 3AKQA 2BGCA 1R091 2A3XA 3ROUA 1MQTA 4V1PA 3VBOA 4IEWA 4B7EA 3USUA 1NCRB 1JH5A 2DV9A 3PVEA 2Z2SB 3I7DA 5EFUA 1G7YA 5DUWA 1WW4A 4AQTA 1PO23 3NV4A 1ND2C 3GBWA 3M8LA 4C91A 1H9WA 1QKQA 2CGNA 3AKTA 3AYCA 1AYM1 4YW2A 2JG8B 2DUQA 4LULA 4AXOA 3HR9A 3KT4A 4PDWB 1QU0A 5AC93 1DGRN 3ZYIB 1COV2 3VZOA 4GWMA 3D0SA 1IS3A 4NWWA 3M1HA 1WW7A 1VBA1 2RR13 1O4TA 4E2QA 2X5IC 2GC0A 4HKOA 2P2KA 2DCZA 1U5YA 2D43A 2JG8C 5L19A 5LRSA 2QDRA 4CEWB 4P9YA 4FBFA 3AP9A 2GALA 2DFBA 3E6CC 2H0BA 1C5IA 3D6EA 3G7DA 1MVQA 1FX5A 1OQ1A 3AP5A 3MZHA 2QKDA 3SCFA 3OD0A 4LO6B 4P9IA 1HDKA 1MS4A 2ZX2A 1QDOA 1B35B 3KCYA 4FP2A 4I09A 5ABJA 1GQHA 2YDEA 4YW1A 1XNKA 1RUC1 4QD2A 4K9SA 3OYWA 1IS6A 4CEWC 4LTAA 5KHHA 4MGYE 1AYN2 5DDJ1 1IZ3A 2OVUA 1NCQB 3RRDA 4AVAA 3NL1A 3WX5A 1FYUA 4BZ4A 4YZ5A 4KNCA 3M7AA 5D8AB 3HQXA 3WG3A 2DYCA 4NN0A 1PVC2 4MLOA 1OOPB 2VNRA 3MW3A 4ASLA 5JI9A 3O0VA 1ENQA 1UZYA 5BNPB 4XOGA 2ZMLA 4Q1PA 2WZR3 1SEFA 2ZOEB 5JOYA 1ONAA 4J1XA 3H9AA 1GZ9A 3ZYGA 5BNNC 3AYAA 3RJRA 4AVTA 3PNAA 4IEPA 5FFOC 3E5UA 2GMMA 4CDWB 4Q4V2 3KMHA 2D6LX 1TMF2 4AEJA 1H2NA 4A3XA 2NP0A 3FHIB 4JGZA 5C4WA 4AFAA 1QHDA 1XYPA 2R0FA 4I02A 4P9WA 1ZZ9A 1VRH1 4OZXA 1U5IA 2EIGA 4URTA 5KXEA 4MXWA 2HWE2 2OPKA 4PBOA 3NV3A 2D6NA 2DVBA 1RHI1 3SCHA 4NR1A 4GB31 1REFA 1WMDA 2HWC1 3G6JB 1LOGA 5T52A 2G9FA 4D69A 5JOXA 1LGBA 4HETA 2ZHLA 1JHNA 4EJRA 3AP4A 4UW4A 1QMJA 3MI8A 1ZA4A 5T5JA 2R32A 4N53A 2AR6A 1MEC2 4OHWA 4XW3A 5BYNA 2XLGA 3SH3A 2IXLA 2W39A 2CWMA 5A3MA 5K7PA 2WNVA 1AR63 2JG9B 2PHUA 3NV2A 1OA2A 4WM8B 4ASMB 3RWNA 2ZX4A 3IPVA 4QM9A 1Z7S3 3VL8A 4X8NA 4AI1A 1QJY1 4FVVA 1TME1 4XF9A 4HK8A 1J3PA 4QMAA 4LA3A 1BEV3 1WMEA 5FPXA 1SQ4A 1RVF2 4HSLA 4WM8C 1IHMA 3B00A 4GULA 1DBNA 2FMYA 1JYIA 4C1WA 1S0FA 3CJXA 1C8M2 1IQAA 3VN4A 3VHPA 3LA7A 4ITCA 3WW2A 1ZRDA 1W6PB 2JDZA 4AQSA 4QQPA 4RA0A 2CYFA 5F6KA 1AL0G 2UWBA 3ILNA 2UU8A 1ZVFA 2B5HA 3NJZA 4TSVA 1H4HA 1D4M3 1WBFA 4WM7C 3LWCA 4A2UA 4JGYA 4META 3BU7A 1PO21 4WZCA 2IXJA 3ZMNA 1OLRA 4BIOA 4KH9A 1HRV1 1VJ2A 4AHZA 2UWCA 3RJ2X 4FPYA 3O7OA 2KXLA 1PZ9A 3PLQA 4I0WB 3JUUA 2ZX3A 4NO4A 3GHMA 4HANA 1O3SA 1R083 3OJBA 2RJLA 4BLJA 3VBOB 3ATGA 2RR11 1Q3EA 1UPIA 1CAXA 2OUJA 5KHJA 2ES3A 3TAYA 3NW4A 4XTMA 4HN0A 4Q0PA 1AXYA 3M4FA 2P37A 5FAXA 4Y20A 5C6CA 2CTVA 2RM22 2ZZJA 3AX4A 1H1MA 2PELA 4QU2A 4AQ2A 4Q4W2 1O5LA 4IL7A 4GKXA 4XJAA 4FPEA 1A8DA 1F9KA 4B8EA 4OHVA 1XU1A 3S30A 1OHFA 5K0UC 1R1A2 4N9HA 1I1EA 1VR3A 1REEA 3VBFA 1ULCA 2ZZQA 3B01A 2RS32 4W6YA 5JAXA 1RUH3 4KL1A 3ZFGC 3R4SA 4HPKB 3IDCB 4R4XA 4Q1RA 5KHKA 2SBAA 1U0AA 1PO12 1QJX1 1UMZA 3AP6A 5BPXA 1C3HA 2GC2A 1VBC2 1N3OA 1DYKA 4YZ2A 1SFYA 3I4IA 5ABJB 4MH0E 4RHV2 2XJUA 3OYWB 2SLIA 1LHUA 1TEIA 3KZ4C 3EXUA 4RS5A 3S7IA 4QGLA 3M2MA 2Q30A 4Y1YA 3ZSMA 1PGW1 4AHXA 2XWJB 4GMP3 1A3KA 3N7LA 4LBQA 4CEYC 1RUJ3 4BE3A 3E5XA 1PK6C 2GH2A 4H7LA 1MS9A 4B4PA 1XNDA 4QPGC 1OLQA 4FAGA 3WQ0A 3H8UA 4R9AA 5I91A 1PIV3 4K1YA 1JBCA 3UK9A 2CAUA 4I01A 2Z5WA 4SLIA 1SLIA 1EY2A 2NLRA 3T1MA 1GFF2 4KU8A 4C0BA 3IBMA 3MIGA 2ENRA 3WP6A 3ZXJA 1IS5A 3THTA 1WGPA 3WG2A 4Y1UA 3LAGA 1HKDA 1YYNA 2DWRA 4N43A 3VBUB 4JGZB 1QGLA 3O12A 5GALA 3VBHC 5JOZA 1QJZA 4K6BA 3FMGA 3JBG3 1RGSA 3RYKA 2O8QA 4YFZA 2K0GA 1Z7S1 1PZ8A 1O4YA 1QDCA 5CFDC 2YMZA 3IDBB 3MYXA 4GH4A 5JDBA 1SBEA 4AI3A 2ZMNA 1HQWA 4IV1B 3RG0A 1UL9A 1H8TB 1WLCA 3C2UA 4R9DA 3ZXAC 1D0HA 1VBE3 2CGOA 4Q0VA 4HVOA 4ES8A 4XXPA 1IPJA 2CWSA 4N53B 3WNXA 4YVWC 4F83A 2XLAA 3LGRA 5HXVA 1NXMA 3PJYA 1O5UA 1YJLA 2RMU2 2YPJA 1DZRA 4COVA 2BWAA 2XH6A 4RR3A 3L9JT 5JSRA 1I5ZA 1YNAA 1H8TC 1QF3A 1AUYA 1D4M1 5DZEA 2VW1A 3VBRB 2HWD3 1ZBA3 4ZXKA 4MYEA 4YYOA 3RZZA 1X50A 1RUD3 2BUKA 2N7GA 1OPOA 3TN93 5FQ0A 1V9U2 2ZKNA 2IXCA 3WY6A 2AH2A 1RUG2 1Y43B 1VIWB 2P3KA 5D1IA 3WDTA 1DHKB 3VBRC 1NA1C 4F7ZA 3FBMA 1NE4A 1R081 1DGLA 1CPNA 4DRVA 4OHYA 1OA4A 1AF9A 3D4KA 1HV0A 3IM0A 3MIFA 4RGGA 4R4ZA 5IUQA 4IEZA 2NZ9A 3OTFA 3MICA 3AYEA 5J98B 4CDUA 4QGMA 4Q4X1 4B4QA 4IV3C 2PHTA 3CEWA 2D3SA 2HWF2 1SBFA 2F6BA 4XFAA 4D3WA 4XHBA 5JPMB 4COWA 5JLVA 4UW3A 3AFKA 1UPSA 3AB0A 3ALQA 3TNPB 2Q0AA 4C1XA 1RUH1 4NOTA 5HCFA 3WV6A 4WV8A 1DZQA 2PHFA 1NY71 2ZX0A 4W6WA 5FDBA 2A6ZA 2UYBA 1IGOA 1ND2A 4GA9A 4J6GA 4XHXA 1V6KA 5CFCC 1AXZA 1R092 4S2GA 4Q2FA 1EYBA 1JTZX 1S0BA 2WNUB 1X33A 2D40A 1W0OA 4HN1A 4XTPA 3OY8A 1UX6A 4LUMA 4IEUA 5ACA3 2EVXA 4QQ2A 3UKVA 4QQOA 3WXPA 1AYM2 1LENA 4IERA 2X5IA 1N1SA 4BOWA 1EAH3 1RUJ1 2XKPA 3O0WA 2MEV3 1YFYA 4HVRA 1HQNA 2YV8A 3ZXEA 1UD1A 3URFA 5T5OA 3UL2A 1EV13 3ZSJA 2XVKA 1DGRA 1PIV1 2ET7A 2A71A 1VBA2 2R0HA 2NYYA 3AXDA 4H14A 3MF9A 4C0HA 1YJKA 5HI0A 2YGLA 1RUE3 1FMD2 4Q8KA 1N47A 4AE2A 2D93A 1FI2A 2XB6C 3FX3A 4AF9A 4DZGA 3SH5A 4YVSC 4M3CE 2X29A 2Y38A 3AYDA 4LBQB 1CAUA 4P5HA 2W68A 4Y4YA 4CTEA 1H2LA 1LECA 2FZ1A 3GALA 1RUC2 5IK4A 3FWEA 3JBG1 4KWKA 3T1LA 5T5PA 4WBBA 1QNWA 1S0JA 3AM2A 2HJIA 2DUPA 4LBLA 2GMPA 2VECA 4YM1A 2VW0A 5JVVA 5BNNA 1PHMA 5DDJ3 3U4XA 3I54A 5JZGC 3OCPA 4RD7A 5A32B 3TRSB 3V65A 3WG4A 2I07B 1VBE1 3O0XA 1GNHA 3KCCA 4EWAA 3AZXA 1WW6A 3BIWE 4OHZA 5SV8A 1LODA 2Z79A 2WIIB 3LOIA 3U07A 3WT3A 1RUOA 1DYPA 4AI0A 1B09A 3I8TA 1JUHA 3AZWA 2NPIA 2D6KA 4BQ1A 1KS5A 4X6RB 3MLLA 4JDOA 3BALA 3H7JA 1L3JA 4YFWA 5DG1A 1QJU3 2ARXA 1ULEA 4JRLA 1BBT2 2PQQA 3HBZA 4Y22A 1ZBA1 3LA2A 5F1RA 2O8OA 2GN3A 2A73B 1G8WA 1OQEA 3TBDA 1RUD1 3TN91 2BW8A 4L97A 5H9SA 2EALA 3NAPA 1LTEA 4FTEA 1VRH2 1GV9A 1QXJA 2YUEA 4UXAA 1ENRA 1RTVA 4ATEA 5JWPA 1FV2A 1UZZA 1RHI2 2W52A 4FOVA 4GB32 2BPA2 2HWC2 1KFXL 3KCXA 4Z07A 1AHSA 1HLCA 4UW6A 4YW4A 4FSJA 4Q29A 2P3IA 4M3CF 4HVQA 4DS0A 2P17A 4OULA 1S0CA 3U10A 2HYKA 3K48A 4AEDC 1CAVB 3ZDSA 4CDXA 2WT1A 2C9AA 1ZREA 1ZZ8A 1QH7A 2JKBA 2CNAA 2JENA 4MV2A 5KC5A 2XG3A 4AQ6A 5CIRA 4AHYA 1UAIA 2D6MA 1TME2 3UKNA 5I8YA 4XXAA 3ILRA 3J8F3 3ZXGA 1LU1A 1LCLA 2ZHNA 5FLIA 3ZFEC 2VG9A 3A0NA 1QJY3 1V6OA 5E1RA 5A33B 4Q0SA 1R1ZA 4IEXA 3JD71 4RL7A 4CDQC 1PMIA 2LUWA 4IEOA 2IWGB 2D5FA 3EO6A 1LESA 2QUOA 4O9GA 4KWLA 5LK5A 3IT8A 1VBB3 5DUXA 3LOBA 1DLLA 3MDPA 4AG4A 2ZS6B 1CGPA 4BCUA 1Y7BA 4DINB 1D2QA 2VVDA 1DU3D 1GANA 1PO22 3B69A 5ACA1 3LKJA 4IETA 3ZSKA 2E6VA 2HWB3 3IKWA 2IC1A 1PGL1 4LT5A 3VBSC 4K3UA 1EAH1 4LNVA 3UV9A 1DQ2A 4NWVA 4R9CA 4BLIA 5CB7A 2DCKA 5AC92 2MEV1 2Q8OA 3ZPYA 2VOWA 5JR7B 3CU7A 1HRV3 2GN7A 3QCWA 3VL9A 1LHVA 1EV11 4XYXA 3OF1A 3WP3A 1SLAA 1NCRC 1LR5A 4XQWA 1A8MA 2Q4SA 2RR12 5CADA 3V56A 2XHKA 4XE9A 1UN1A 5K0UA 5JMCA 4S2FA 1RUE1 4LHLA 4XQ4A 5JSOA 2BFUS 3IMNA 1NLSA 2D6PA 2G4IA 1U5ZA 1LOFA 3N35A 2EAAA 4PDWC 4COUA 2XJRA 1UIKA 5HCBA 1BJQA 1AX1A 4K7JA 3MFAA 3AXEA 3PJQA 4GXLA 1U5XA 1K5MB 3ELNA 5C8WA 3J4UH 3DV8A 3KS7A 5GZEA 1XE7A 1GBGA 4IEVA 2EF6A 1LEMA 5GM0A 1HRI3 5IK8A 1W6MB 3ZN5A 1CN1A 1VB4A 1YIPA 5FBZA 4GWNA 2WZR2 3DPRA 2Y0IA 4OI0A 1LULA 1B35C 1OD5A 1S55A 2E7QA 4FPLA 1LGCA 4JC1A 1GR3A 5FPZA 1PK6A 4EN0A 1QJX3 1NCQC 1SLCA 2VOKA 1C5HA 4LUKA 4DNYA 5LEKA 1QJU1 4QPGA 5D8AC 4B3NA 5BUVA 1XU2A 2QZ2A 2XL7A 1O3QA 1J3QA 2NQYA 1OOPC 4M3CB 2PYTA 4DRRA 4S2DA 2A5ZA 3CL1A 2R043 5BNPC 2DVGA 1OMIA 4CP1A 5K8SA 1FT9A 2DCYA 1LEDA 5E89A 4A7KA 3KLSA 4PBPA 4BYYA 1ZBE3 1H1AA 1LOAA 1XE8A 2WS93 2ZGOA 3W9AA 1W6NA 5DUVA 4HSJA 4CDWC 3VBHA 5SV5A 1PM7A 4EV0A 3ZYRA 4Z2WA 3VDDB 2C1FA 2R073 3S6PA 4Y22B 3DF0A 4QPIB 1Q8VA 2OZJA 1CAWA 4FAHA 4OLLA 3AMQA 2WZPP 2DU0A