3WV6A

Crystal structure of a protease-resistant mutant form of human galectin-9
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
292
structure length
284
Chain Sequence
GSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQHMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQSFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-9
publication title X-ray structure of a protease-resistant mutant form of human galectin-9 having two carbohydrate recognition domains with a metal-binding site
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 284
sequence length 292
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wv6A02
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3wv6A01
1KJLA 3AZXA 2A3YA 4I30A 1W0OA 1UL9A 4WVWA 3VV1A 4FPYA 2CTVA 5EWSA 3WV6A 1Q8SA 3IM0A 3N36A 3OY8B 2A75A 3HMYA 1SBFA 4Z8BA 2CL2A 4LBJA 5GZFA 3NWKA 5L73A 4HL0A 5GZEA 1LESA 1LJ7A 5JOYA 4FP2A 3N7MA 3ASIA 2D6OX 4XMAA 2AUYA 4XIKA 1O4ZA 5EYXA 1A78A 1UPSA 2JDZA 4K21A 2TEPA 4LBNA 3M3EA 1N3PA 3B9CA 1JBCA 5DUWA 1MS5A 3RRDA 2D7FA 4YW2A 1VALA 3I8TA 1Q8VA 2YXSA 2VW1A 4YG0A 1Y7BA 4YW1A 1BJQA 1GANA 2D6KA 2AR6A 2P2KA 2YROA 3USUA 3M3CA 5DXDA 2A71A 4AVSA 4FPGA 5EYYA 2GMEA 2XG3A 4LBQA 1LHVA 4XZPA 3RQ0A 1W6MB 1LODA 1SACA 2D6PA 1V6MA 2DU0A 5EXOA 5T5LA 1G9BA 1LGBA 4GKYA 3V0BA 1SLLA 2D6LX 2ZZJA 1JYIA 3GNEA 2EF6A 1HLCA 4BOWA 1S0JA 1CVNA 1UMZA 1VAMA 1NXD1 1AJOA 2XB6C 3FFZA 3MW4A 4XJ9A 4YZ3A 5T50A 1LHUA 3OBRA 1BZWA 2R0HA 1Q56A 3AZVA 1G9AA 1SBEA 1LECA 3H0OA 1DLLA 5KXDA 1W6PB 1G9DA 3ZXKA 2ZHLA 1QDOA 3AK0A 1LOCA 4XHBA 1U0AA 4XJUA 4YZ5A 5GZGA 3SH5A 1KQRA 2ZHNA 4RL7A 1G9FA 5CAZA 3W58A 5HCFA 1ULDA 5E88A 1S0GA 3BIWE 2ZGRA 3ZSKA 5KXBA 5CA6A 2UWAA 2VW0A 1C1FA 4KBBA 3UJOA 3V0AB 1GZWB 3A0NA 2EIGA 3OY8A 1AZDA 4P9XA 2GDFA 3BODA 4XJAA 4XJ8A 1CQ9A 4DS0A 2ZHKA 5T5OA 2NP0A 2EXJA 4YM0A 2DVAA 1V00A 2ZGSA 2DVFA 1SBDA 3RMXA 2D3PA 3VKNA 4BMEA 1GV9A 4WZFA 4FPLA 4K20A 3AXEA 1LOBA 5GLWA 3A4UA 1HQWA 2WQZC 1ULEA 3VKMA 4TZDA 2W08A 3ZSMA 4XDQA 1IKQA 1FV2A 2G4IA 3NV1A 2H0BA 4JCKA 1N1YA 2P37A 1F31A 2C9AA 2EXHA 2LALA 4FPKA 2DU1A 2GMPA 2VXRA 2GNMA 3N35A 3RS6A 4BLJA 4ISQA 4M00A 1S0FA 4Y1VA 4LBQD 2DVGA 4OZXA 1W6MA 1SCRA 5IT6A 2OUJA 3AX4A 1DQ0A 5T52A 2DTYA 4XTMA 4YM3A 3FLTA 4YM1A 2ENRA 4XXAA 1BXHA 1S0IA 2D43A 5CNAA 1UZYA 1AX0A 1V6NA 2DTWA 1N3QA 3WHTA 5IUQA 2ZMKA 3O0WA 1GSLA 2R0FA 1V6JA 2YV8A 3L2YA 2A7AA 1CESA 3LSDA 4PBOA 4FPFA 2CWSA 4Q1RA 1VAVA 1W6PA 1Z78A 4UW3A 4XTPA 1I1EA 4CRQA 1DBNA 1LOFA 3LCPA 1JN2P 2P34A 4YFZA 1GBGA 2R1DA 1QGLA 1JYCA 2FMDA 5T55A 3AXDA 3CNAA 1D0HA 1VLNA 3OBTA 1YI7A 1SLIA 2R1BA 1S0DA 3FUOA 1W6OB 1GNHA 2WT1A 1A3KA 3QCWA 4FPEA 2DURA 1LHOA 3V0AA 3T2TA 1GZWA 4FPJA 1HQLA 1WBLA 3AYEA 4BMBA 1MS1A 2ERFA 4LBLA 2EXKA 2D6MA 3FUQA 4C1XA 2CY6A 5FRAA 4LBKA 1QDCA 4FPCA 5HCBA 2ZAAA 1C1LA 4FOYA 1LHNA 4AVTA 3B3QE 3ZPYA 1LOFC 3APBA 3PVNA 4FQ4A 1PZ9A 1LGCA 3BTAA 3R4SA 1ULGA 2YY1A 3SH3A 4M01A 4AVVA 2A70A 1LHWA 1Q8OA 1V6OA 3ZYPA 5T5PA 1FAYA 1ENQA 1YRZA 4GALA 4XILA 4L8QA 1ONAA 1URXA 3QLQA 1YXWA 1AXZA 3PJQA 5FREA 2YMZA 1FATA 2E7TA 1ZM1A 2V73A 2EXIA 5LK5A 1R1ZA 1SLCA 1QMJA 1LEDA 1WW6A 1Z0HA 2PELA 1DGLA 3SH4A 2RHPA 1V6IA 2A6VA 1IOAA 2HYKA 4ATFA 4M3CB 1ENRA 3ZVXA 3MEPA 4Q26A 5GZDA 4XIOA 1KITA 1KJRA 1SLAA 4P9WA 1WCSA 4BQ1A 2YZ4A 1CONA 4ISRA 2AH2A 5H9QA 3VKOA 1IS6A 2EAKA 1UN1A 2CWMA 2I2SA 1LOGA 1W6QB 4LBOA 3ZXJA 3NV4A 2R16A 4MYEA 4DRVA 1FV3A 2NN8A 3N7KA 1AF9A 1WLCA 4UW5A 5JVVA 1WD3A 2WKKA 3PVEA 4M3CF 2D44A 2W68A 1MS3A 3N3HA 1DFQA 1GLHA 4CZSA 2ZGOA 4BM8A 5H9PA 1GNZA 3AFKA 2P3KA 1PZ8A 2E51A 1LENA 2BQPA 4CTEA 4AGVA 4PCRA 1DZQA 4ATEA 2DUPA 1SFYA 4Q8LA 4DPNA 1MS8A 2ZHMA 1W6OA 3WHUA 5GLUA 5IK5A 3NV3A 1LU1A 1Q8PA 2SBAA 4R9AA 1QU0A 3JUUA 4YGDA 2A6YA 1FYUA 5DZEA 2ZBJA 4AGRA 4XBQA 3AJYA 5BYNA 3ENRA 2WT2A 3AP6A 4BPZA 2WJSA 3AZZA 5GLTA 2GALA 1CJPA 1H9PA 1DQ5A 1A8DA 3M3OA 2ZGUA 5HCAA 1LOEA 3SITA 1RINA 4Y20B 1NLSA 5KXCA 1V6LA 3M3QA 1OKQA 4RA0A 2NMOA 3RMYA 1AXYA 5DZFA 2DVDA 2AYHA 4YZ1A 5JOZA 1YO8A 3B69A 1MS9A 3FLPA 1RIRA 2R49A 2JJ6A 1S0EA 3B01A 5DZGA 5JOWA 2WLQA 3SLIA 1F5FA 3AZYA 3LSEA 5GM0A 1RITA 1LOAA 1G7YA 1G8WA 3ZYRA 3IPVB 3MPPG 1WLWA 1HDKA 1DYKA 2A5ZA 4FPHA 3I4IA 1ULCA 2ZGNA 4M3CA 4UW4A 4Y1YA 2ZACA 5T5JA 1J1TA 4GA9A 3T1LA 5GLVA 1YYNA 3B00A 1MS4A 3ILRA 1AX2A 4D69A 1UZZA 1PZ7A 1WLDA 2JECA 4YW5A 2A6ZA 1APNA 1H30A 4Q2FA 1JHNA 1JXNA 1S0CA 1W6QA 3ZXLA 1BQPA 4LBMA 1LU2A 1JUIA 1KRIA 2W39A 2ARBA 2ZA9A 4R9BA 3OJBA 4K1ZA 2CNAA 3WDUA 2ZGLA 1QNYA 4YW4A 2ZMNA 1UAIA 1TEIA 2GNTA 5DG2A 4Y1XA 4XXPA 2CYFA 1UKGA 1QOSA 3WVJA 4XBLA 5F9TA 1CPNA 5JLVA 4FPOB 1WD4A 4AWDA 4YG3A 1GZ9A 1WW5A 3D4KA 4WVVA 1DYPA 1FX5A 2OW4A 1AVBA 4GKXA 1DQ4A 3ATGA 4Y1UA 5AVAA 3WUCA 1QOTA 2GN7A 1GZCA 2UWCA 2B7YA 3OPZA 3WUDA 2GNDA 3POWA 2ZMLA 3N7JA 3UJQA 2PHUA 4XYXA 5CBLA 4XE9A 2W52A 4Y20A 4F83A 2WT0A 2DV9A 3WCRA 2ZGPA 1WW7A 2DUQA 1BYHA 1MZ5A 5GALA 4DFSA 2FHRA 2ZGMA 1W6NB 3O0VA 3POSA 4H55A 3AYDA 4U2AA 1GYKA 2OVUA 4JC1A 4W65A 3AP5A 5T54A 1CN1A 2LTNA 3ZSLA 2C5DA 4Y22B 2E7QA 2JKBA 3W59A 1QKQA 2A6WA 3HN1A 3ILFA 4PF5A 1C4RA 1KDMA 3BOPA 1MZ6A 3AP9A 4TYSA 4U36A 1MS0A 2NMNA 3IPVA 5F5QA 1MR5A 1ENSA 4Y26A 3TB0A 4FVVA 2UURA 4YG6A 1QNWA 1W0PA 3NV2A 5IK8A 4FOQA 1IKPA 1MVQA 2AGSA 3V65A 1WBFA 3U4XA 5DG1A 2VW2A 1YIFA 2ARXA 2EALA 1X50A 2P3JA 3MW2A 4GWMA 4XMIA 2JE7A 2D6NA 4GXLA 4PQ9A 3V64A 1JW6A 1G86A 3ILNA 1EPWA 1C57A 2DUOA 4HANA 3R4UA 3AJZA 3WDVA 3UL2A 2WNEA 4Q8KA 5KXEA 2VU9A 3C2UA 2V5YA 5IK7A 3WDYA 3RG0A 2ZGTA 5GZCA 2DYCA 4P14A 1AX1A 1ULFA 1N1SA 1AJKA 4JRAA 3WG3A 4DQAA 1DQ2A 1O4YA 1GKBA 4YZ4A 5SV8A 4BLIA 1N47A 1VIWB 1SLBA 1S1AA 1IS3A 1ZA4A 2D3RA 4YFWA 4YGBA 1HKDA 2ZGQA 5E89A 2PHRA 3AYAA 3FBYA 4YGCA 3UK9A 3KQRA 3WG1A 3ZXEA 3IMNA 1WW4A 4Q1PA 4R9DA 3OYWB 3M1HA 1N1TA 2ZABA 4YGEA 3HR9A 1FNYA 3AYCA 3DGTA 3SISA 1SCSA 2PHWA 3SNMA 4YW3A 3AZWA 2OUHA 2KM2A 3FLRA 1BKZA 3O12A 2NM1A 4FP3A 1GICA 5IK4A 5GLZA 4FOWA 1CIWA 2Q5TA 1W6NA 3PMEA 1AXKA 3WG4A 4PBPA 3WNXA 1XQNA 4XJZA 3WOGA 3INAA 5JDBA 5DUXA 4C1WA 5JOXA 4ITCA 1OQ1A 5DUUA 2NYYA 3ZSJA 4FQZA 4IQPA 4R9CA 1LGNA 2Z42A 3N7LA 3O0XA 1DQ6A 4Y22A 1H9WA 1B09A 1MACA 3M2MA 1LTEA 3T1MA 3D6EA 3WG2A 5H9SA 4ASMB 3PVOA 1QF3A 1F9KA 1UX6A 4XBNA 1I3HA 2PHTA 2WSVA 1SLTA 2AENA 1LCLA 1Q8QA 3TAYA 4K1YA 3IKWA 4NOTA 3WDXA 1N1VA 2E6VA 2AREA 1S0BA 2JE9A 2VY0A 1LEMA 1FNZA 2A6XA 4YZ2A 2ZKNA 4XOGA 3R05A 5E8AA 3WDTA 5H9RA 3AP4A 1JOJA 3A0KA 3O5SA 4SLIA 4XJWA 4P9YA 4YM2A 3D5OA 3RSJA 1LULA 4WV8A 2UU8A 1WUVA 5JMCA 2A3XA 3DUIA 2PHXA 3OGGA 3USUB 1DIWA 2GMMA 3WDWA 3VUOA 4LBQB 1DQ1A 4YLZA 2GN3A 2WSUA 2GNBA 3V0BB 1DHKB 3WLUA 3WCSA 1KDKA 4XHXA 1OFSA 1CPMA 1N3OA 3JU9A 4ZKTB 3GALA 2VUAA 3IN9A 3OYWA 2SLIA 3VKLA 1QOOA 2A3WA 1MVEA 3AP7A 1IS5A 4Y1ZA 2ZGKA 4ZXKA 1G9CA 2UWBA 3POYA 3VKFC 4AGGA 4GWNA 4NO4A 2P3IA 2E53A 4Q27A 1D2SA 4Y24A 5DUVA 3MW3A 3WZ1A 2DVBA 3Q9OA 5CB7A 3KM5A 4FOVA 2VH9A 2D3SA 2NZ9A 2JD4A 4M3CE 1IS4A 2PHFA 2DWRA 1V6KA 1CR7A 3ZXFA 4AYUA 4DRRA 5GJ6A 2ES3A 4UW6A
chains in the Genus database with same CATH superfamily
3AZXA 3EJKA 3VL8A 2B9VA 3JBG1 1CAWA 2ADDA 3WV6A 3IM0A 3DL3A 5IFTA 4EWAA 5L9RA 1RUF1 1SBFA 1BVVA 5FDBA 5A3WA 1KS5A 1RUH1 1Q43A 5I93A 4BIOA 3NJXA 4HL0A 1OLMA 5JOYA 2WZEA 2QQOA 2R043 2QVSB 1LR5A 3AB0A 4AFAA 3PUSA 2PLV1 3CJXA 3ASIA 3ZYIB 1Z7S2 4IEYA 3VBFC 5F2SA 5BNNA 5A33A 2W1WA 3T2PA 3TEYA 3DN7A 1TME2 1JZ4A 2D7FA 4HT1T 3ACLA 1Q8VA 1ZBE3 1BJQA 2P2KA 2YDEA 4XC9A 3Q8AA 4AEJA 4CE8A 2A71A 4FPGA 5F39A 2XG3A 1F4HA 1LHVA 1YEWA 5JOZA 1W6MB 1LODA 1SACA 1VBE1 5T5LA 5FZGA 1SLLA 2D6LX 2HJIA 2ZZJA 3ES4A 4AI0A 4OHYA 1GMMA 3I49A 1VBB1 2HEYF 2Q8OA 4YZ3A 1VAMA 3WXPA 2XB6C 1PK6C 1VR3A 1VB2A 3KCCA 1AL22 4Q0SA 3E6CC 5EJ3A 3NNFA 5FZFA 4AEDB 2YG0A 4NUBA 1QJZA 2Y6KA 3AZVA 2VZVA 1SZBA 5FXVA 2BRTA 1ZZ8A 2EA7A 2G1MA 4S2HA 4XFAA 5KXDA 4PIYA 1X82A 2VXJA 1RL3A 2D5HA 1QDOA 4MOAA 5F3GA 5FO8B 5GZGA 5IVCA 1UU6A 1KQRA 3SH5A 2HWF1 2FZ2A 3MIDA 3LA3A 4LXLA 2KD7A 4B7EA 4LO5B 1OD5A 3N9LA 2Y6JA 3VDCA 2ATFA 3OGSA 4AEMA 2JDHA 2XJRA 3VBSA 1FOD2 2DBIA 5KXBA 4LJHA 1C1FA 2CAUA 3HNMA 5A3OA 2W87A 3WQ1A 2E7AA 1L7QA 2R063 4BIFA 2QQJA 1J3QA 4XDPA 1JI6A 4E9KA 4XJ8A 1R64A 3JD71 2C26A 2PYTA 4KBZA 2NP0A 2EXJA 2J1VA 4LKFA 5J37A 1SBDA 2PFWA 4JRLA 4K20A 3AXEA 2H6BA 5FWEA 1MEC1 2ZXQA 4AHZA 4HPKB 4Q4X1 1RMU1 2JKXA 2WQZC 5L7OA 1ULEA 2VNOA 4IGQA 4KL1A 2GH8A 3EHKA 4TZDA 1QH6A 2W08A 3MIHA 4O7XA 4AG4A 3NV1A 4JCKA 3RJ2X 2LALA 1ST8A 2XBO2 1EV11 1UU4A 4FPKA 1RUI2 3VBHA 3RS6A 1V9U1 1JZ6A 3SQOA 3CBNA 5KBFA 4FT8A 4CDUA 1I5PA 1UXXX 3H7YA 3ZFEC 1X9PA 3RZLA 3FFQA 3QD6A 1RC6A 3JXSA 2VMDA 5J1XA 2HBUA 1YUDA 5FMBA 4RR3B 2OUJA 3L9JT 1DQ0A 2IXCA 2XOMA 3NSTA 4OYUA 5BNOB 1YWKA 4CEWC 1AR71 5IYYA 1GP5A 2XL9A 2DF7A 1UZYA 2DTWA 4LULA 3MFAA 1QH7A 2VCCA 4PLNA 3CU7A 3I97A 3ZR6A 3ZPOA 2YV8A 2A7AA 3CO2A 1W8NA 4HKOA 1QEXA 1AHSA 2IFWA 4DXZA 1PGSA 1Z78A 4ZXEA 3FZ3A 4CRQA 2XJVA 4LE4A 4AR2A 1FXZA 1HRV3 2BGOA 4YFZA 3GJBA 2YYOA 1U5XA 5A80A 3OB8A 1S0DA 2YU2A 4UFMA 1GNHA 3QCWA 4XUOA 3HVDA 2JIGA 1HN1A 3H42B 4FPEA 4OHZA 5D21A 4FPJA 1HQLA 1EAH1 1WBLA 3AYEA 3GHMA 1GOGA 3H1YA 2D6MA 2NPIA 2ADEA 2V72A 1VMHA 1E57A 2EVXA 3ZSEA 2WABA 2W92A 3TN91 3JQXA 4Q4W2 3HT1A 3VHRA 1XBFA 3T30A 1VRH3 4DUXA 1LOFC 3APBA 4XZUG 1R1A1 3T0DA 3ST7A 1DGRN 1LGCA 2WBKA 4UAPA 1XJAA 5K0UB 3VDDA 2K0GA 1W2TA 5FZOA 3LOBA 2X5IA 4XURA 5FLJA 2UY9A 1ZZ9A 4GALA 3QOPA 4YYOA 3WP3A 3QLQA 1URXA 4HK8A 4C91A 5C8CB 4M0NA 1YXWA 4FI9A 3WNNA 5HPOA 4EROA 1FATA 1CX4A 1ND3B 2IVJA 2V73A 2EXIA 3IMMA 3O7OA 4LHSA 5LK5A 2I74A 1LEDA 3SH4A 1DGLA 1SMVA 4B4QA 2BU9A 4JTNA 2PAEA 4GMP3 4A4AA 2ZCWA 1OF3A 1GZTA 4M3CB 4IL7A 3WP5A 3ZXDA 3VD9A 1QJY3 2VVFA 3X29B 4N43B 4N90A 2BNMA 1DZTA 1SLAA 4P9WA 4XIOA 4AVBA 4MZUA 4BWOA 4CDQC 3NAPC 1COV1 4ISRA 2FDKA 5IAVA 1UN1A 2CWMA 4RQPA 1LOGA 4IEUA 1ACCA 3BU7A 4UF0B 5JMOA 2VOTA 4DRVA 1FV3A 4B29A 2RS11 1EUUA 1WLCA 2JG8A 4WVMA 3T09A 4BQYA 3NQHA 2HWB1 1WD3A 5FUPA 3PVEA 1WA4A 2W68A 1DFQA 2XH6A 4PHZA 3I2DA 3POEA 1H8TB 4AEKA 3PUIA 4D7TA 1GNZA 2ZX2A 5CG9A 2QQKA 1OD3A 3PUHA 2E51A 3NO8A 1FMD3 1LENA 3RZGA 1RXGA 5FWJA 4LIUA 3J26N 1W90A 4KH9A 4Q8LA 1MS8A 1ENXA 5K8SA 1NA1C 2RR11 3FJSA 1DF0A 3U11A 5A3TA 4V2VA 5GLUA 2SBAA 1O3QA 2CV6A 2P5BA 1UKRA 4GAZA 4MXVA 4Z2WA 4AGRA 4XBQA 3PUAA 4MHRA 3WQ0A 5BUVA 5A6ZA 2WT2A 1ALYA 3AZZA 4I3GA 4AF9A 2GALA 4EV0A 1HRI1 4EYUA 4H2AA 1DQ5A 3H9AA 5HCAA 3CJIA 2JDKA 4QDRA 4RGAA 1YJKA 3K4ZA 4MVTA 1KS4A 1NLSA 4Y20B 3F2ZA 3K4DA 4CP9B 2BVVA 5DAQA 4CEYC 4RA0A 3I3EA 1H4GA 1AYM1 3CMGA 3ABZA 5JIAA 2YC4A 2RDNA 5FPAA 1GWMA 1YO8A 1K5MB 3B69A 1QJU1 2JDAA 3PVBB 4IE5A 3B01A 5ERLA 1T6GC 2WLQA 1PIV2 1R092 4V1PA 3BTZA 1J3RA 1LOAA 1G7YA 3AMMA 3ZYRA 1PVC1 3DPRA 1WLWA 1HDKA 1ASJ2 3DEMA 3VB9A 4JGZA 4KU7A 1POV1 1RHI2 5GLVA 1YYNA 3ILRA 4UT5A 2QFEA 1PZ7A 4YW5A 2VC9A 1UW8A 1BBT3 1H30A 4MX3A 2VZQA 1JHNA 1RUG2 1UMHA 2QQUA 2XGXA 4E8DA 1EP0A 1SDWA 1W6QA 4LO7A 4L97A 2XJTA 1BK0A 2IXIA 4IV3B 5KHKA 4A7KA 2J7MA 2WNVC 1W3VA 2IXJA 1RUJ1 5HBAA 3BALA 4FAHA 1VMFA 5J3UA 2RJLA 2CNAA 3MUY1 4PDWC 3WDUA 4WM7B 4GWIA 2Y0IA 4RHV2 2Y6FA 3U07A 5DDJ3 5DG2A 2R073 2XMLA 5FBJA 4BQXA 1MZEA 2WZ8A 1EY2A 5F3CA 4MV2A 3WVJA 5CFDC 1W8ZA 5JLVA 1QXJA 2XVKA 4F3JA 4KWJA 1WW5A 2R041 3FMGA 1DYPA 1FX5A 1PO22 2EAAA 2LRPA 1DQ4A 2OW4A 3CKHA 3LGRA 3EB7A 4NWVA 1CIYA 4A7ZA 3ZN5A 4DEVA 3ACFA 1O5LA 2B7YA 3MO4A 1YNAA 3N7JA 4P02B 1JZ7A 2W94A 2WT0A 4LMFA 1WMEA 4MGKE 3WCRA 2ZGPA 1UYZA 2DUQA 3GGLA 4IEVA 4AQ2A 5GALA 4CCKA 2FHRA 3HEIA 1ZBE1 3O0VA 1WWYA 4XF4A 3UV9A 4DXSA 2IXLA 5JCTA 2J22A 4JGYB 4NPLA 2ZEZA 4E4HA 1CN1A 2LTNA 4Y4RA 4RS5C 1TMF2 4Y22B 2JKBA 2VCMA 2XDVA 4Z1VA 2VBPA 3SCHA 1QKQA 2A6WA 3HN1A 1AR92 3ILFA 3DYMA 1X7NA 1XU1A 4LORA 1MZ6A 4TYSA 1UQXA 2NMNA 3IPVA 5JPNB 2XL7A 1OI6A 5LWBA 4E4DX 3KQ4B 2UURA 1RB8G 1QNWA 1W0PA 4AFBA 4ES9A 4QGMA 1UOJA 3V65A 2QQMA 3AL5A 1WBFA 4GH4B 4P9IA 3AL6A 5C5UA 1YIFA 2VQ0A 3WW4A 1X50A 2P3JA 4A45A 3ZYJB 2XUEA 1B35A 4GXLA 4PQ9A 2QQIA 3NJYA 4OMDA 1CWPA 1EPWA 4HANA 5FZAA 2WNEA 5BXXA 4D8MA 1IG0A 3ZDSA 2Y26A 5J98B 1AR63 5F2WA 3KD4A 3RG0A 5LRSA 2CDPA 3I2OA 4OUMA 1DGWA 1AR83 5FZLA 2VMHA 3HPNA 1TE1B 1ZZCA 4BJ0A 1PHMA 4YSFA 2R061 5J09A 2B5HA 1S2EA 4YZ4A 5SV8A 4SBVA 5I0DA 4MGQA 2DFBA 3POFA 4MGZE 2HEVF 4YGBA 3FBYA 5BNOC 4L9BA 3KQRA 4OHWA 1J83A 2ZEYA 5FY5A 2XJQA 3PIJA 2C1FA 2UYAA 4QD2A 4Y33A 3D3AA 2VUJA 3K51A 5C4WA 4R9DA 3ZDVA 5A6XA 3OYWB 1QHDA 2ZABA 3M1HA 1ZBA2 3SISA 3DGTA 4N53B 5C3RA 1ZNPA 1VBE3 5L36A 1NCRC 4CDXA 3DECA 4FTEA 1J3PA 3ZFGC 3GJAA 3RWKX 2QTWB 1H1AA 2X8KA 5FZ8A 4FP3A 4QB6A 1D4M2 5EV7A 1R082 4HK9A 3WNXA 2F6BA 3PMEA 5IJRA 4PBPA 2JB8A 2GC0A 3L2HA 2ZJCA 2F17A 4NVPA 3MIFA 3VBFB 5JDBA 1OQ1A 1EUTA 2ZS6B 5FPZA 4IQPA 3ZSJA 3LE0A 2VR4A 1DQ6A 3LDRA 4B8EA 4I0BA 2ZPXA 2OZ6A 3Q8CA 4ZZ5A 4OI0A 3NJVA 1GQPA 4NWWA 3J8F2 3WNMA 2I07B 3WG2A 4MGIE 2KR2A 1QF3A 1JOPA 1UX6A 4LHKA 2RDRA 1SLTA 1LCLA 2XKPA 4K6BA 4FAGA 5C9AA 3KB5A 1JZ2A 1Y9QA 2AREA 2Q4SA 2JE9A 2VY0A 5FLHA 1HRV1 1LEMA 2VMEA 1ULPA 2E26A 1PO13 2A6XA 1U12A 2QDNA 2B46X 1RUNA 3P3PA 5IVFA 2WZR3 2BW8A 4XOGA 2DDUA 1E5HA 1FT9A 2VUDA 1LKNA 5C8CC 3SCFA 4CXYA 4LO4B 4YM2A 5APAA 4XF1A 4JAAA 5IVEA 5CZKA 3MICA 2OKXA 2VZSA 3USUB 1GNYA 2Z79A 2YC0A 4KWUA 3WDWA 3VUOA 5TSWA 1EV13 4MGYE 3W5NA 1W2AX 3WLUA 1QXPA 5FFOC 4N43C 3VN4A 2JX9A 4AAPA 4X8NA 3LDBA 1VRH1 2IUWA 3IN9A 3C7GA 2A3WA 1IS5A 1CAXB 3K77A 4DO0A 1LRHA 3TRSB 5LA1A 2GP3A 3D82A 1OOPB 4ZXKA 5DPNA 2UWBA 3AMNA 4GWNA 4NO4A 3U37A 1D2SA 5D8AC 4BQ5A 4CCEA 4IEZA 2DVBA 1W8WA 4TN7A 3KM5A 4S2GA 5FLIA 5FZCA 5CB7A 3WX5A 3WQBA 1TG7A 4K3UA 4QKBA 1IS4A 4XFIA 4GMP1 1CR7A 4LKSA 2PHDA 5A32B 4DRRA 5FY8A 2JICA 1JZ8A 1C8M2 4PJYA 3I59A 4XACA 3NNMA 5HV4A 4WVWA 3S30A 1GP6A 3VV1A 2CTVA 1ZZ6A 2W91A 1WGPA 4GD4A 2R30A 2WO1A 3HMYA 3ZFEB 4HETA 1TQ5A 4QX8A 3ZOIA 3ACHA 5JAXA 2PAMA 3IIIA 2CGPA 4IEWA 1LESA 1LJ7A 4GQ7A 2MEV3 4CEWB 1SEFA 5LY2A 1I6XA 4GJYA 2ZTNA 3C7EA 4XMAA 5IVYA 2AUYA 2VQTA 1O4ZA 5L9VA 5EYXA 1A78A 4NIIA 2JDZA 2XHNA 4LBNA 1FMD1 1W8OA 4LNVA 1JBCA 2B39A 3MPBA 3I2HA 2W1QA 4A3ZA 4D94A 2WNOA 1VALA 2VNGA 3CF6E 2VW1A 4CP1A 1Y7BA 1R1A3 5A3LA 1NY71 2MPFA 2D6KA 3LD8A 4AVSA 3RQ0A 5EYYA 3T2OA 1OLQA 3WT3A 3A21A 3OGJA 3OGVA 2XJPA 2YBSA 5JIUA 1IZ3A 1LGBA 1JYIA 4L11A 3PTRB 4D0QA 3POBA 4QM9A 3VGIA 1HLCA 3Q8BA 3ALQA 1CVNA 2Y34A 1H1IA 1NXD1 1QXRA 3NW4A 4MUVA 2NLRA 3DXTA 5FO9B 1C5HA 4YVWB 5T50A 1VBD3 1LHUA 2RS32 5J96B 5FPXA 4QPYA 5BNNC 1Q56A 3DYPA 1OMIA 3MIGA 1BLZA 4HMZA 5FY9A 1SBEA 1RVF2 3H0OA 1DLLA 1JODA 1MQTA 1VBC2 1W6PB 4HOOA 3ZXKA 1OH3A 3A23A 3PTYA 2DBNA 3AK0A 4A7YA 1U0AA 5AC93 3AFGA 4CVUA 3ORJA 4QX7A 3TEWA 1Y4WA 3W58A 1CJDA 3ETQA 1ULDA 1FPN3 4EN0A 2ZGRA 3ZSKA 1PM7A 2UWAA 2VW0A 2QCSB 5I8SA 3NNLA 4MHUA 2D97A 4JGYC 5BNQA 1BBT1 5BNPA 2EIGA 3OY8A 1U5ZA 4P9XA 1FI2A 2Z2SB 1Q5OA 3BODA 5FTTC 4MO3M 5FYHA 2IZWA 2HEWF 4N7UA 5ACA3 4UYBA 4DS0A 5LY1A 4I0WB 2DVAA 3VZLA 4BK5A 4Q29A 3VKNA 3RMXA 2D3PA 2JB4A 2RM23 1OUSA 4FPLA 3BU0A 5HV0A 1WMFA 3A4UA 4E2GA 4QPGA 2OS2A 2RJKA 3NAPB 4CUGA 3VKMA 1JZ5A 1A8MA 3K75B 1GOFA 3ZSMA 5DDJ1 3PUQA 1YQ2A 1FV2A 2R071 2H0BA 1N1YA 1HRI3 4AFMA 1ZVFA 3LIGA 5F5AA 1OSGA 3VBSC 2GMPA 2IXKA 2VXRA 5F1RA 2EIBA 1POQA 2R32A 1IHMA 1S0FA 2KXLA 4LBQD 4Y1VA 3IWZA 4OFGA 1XSRA 3NKGA 1D4VB 2K46A 1VBA3 2RS53 3OOXA 3U0ZA 1SCRA 2V5DA 3KT4A 1O8SA 5IWFA 5IT6A 4IEQA 2XONA 4C0BA 2YHJA 5D2AA 1F8VA 3D0SA 4QPWA 2B45X 5LBBA 5FMOS 5FPUA 4XXAA 4EJRA 2ZZQA 5FYIA 1BXHA 1S0IA 2D43A 1HB3A 2Y6HA 1SFPA 3MLLA 3PLQA 3E5XA 1N3QA 4HVQA 5L7OC 5IUQA 4UFLA 1V6JA 3IB3A 3O1SA 3L2YA 2W5FA 3PJYA 4XETA 2D40A 4LE3A 4FPFA 1UNBA 3TEZA 2CWSA 2ZX3A 3HWJA 3VBHC 3HAGA 3DXUA 3IDAA 2QUOA 4CDUC 4LKEA 2WFF3 1WCKA 1BK1A 4CEYB 1UMIA 2PA7A 4GIQA 1JYCA 5JXIA 5T55A 1JZ3A 2OIIA 1H2LA 4OULA 3CNAA 1D0HA 1JYVA 4QHOA 3J4UH 2DCJA 3LZZA 2VVEA 4TSVA 4QGLA 4GB33 1W8UA 3FUOA 4IW3A 1JYNA 4AVCA 1W6OB 2WT1A 1A3KA 2RMU3 2DURA 5ISLA 3V0AA 1GZWA 1H0BA 4Q4V2 3S6PA 5FPLA 2DCTA 4CSWA 5JSPA 2WWJA 4LBLA 4N53C 4BB3A 2EXKA 3PU8A 4C1XA 2CY6A 5FRAA 4LBKA 4LK6A 4XFBA 2E32A 2ZAAA 2W3JA 4FOYA 1AR61 2QDRA 3B3QE 5IHRA 2IWGB 2P4EA 3J9SA 4WM8A 3CZUA 4DEQA 1AR81 1QQP2 3BTAA 5DABA 4DNYA 3R4SA 5ABJA 1ULGA 4AVVA 1LHWA 1Q8OA 2WZPP 5KHGA 2WNVB 4Q4W1 1XE0A 1ENQA 2HWD3 4XILA 4PF1A 3E1F1 3FHAA 1OURA 2BWAA 2YFUA 4PDWB 3BTXA 5KHIA 1SLCA 4JDNA 3RYRA 4M0HA 5LW9A 1WW6A 1Z0HA 2PELA 3H8UA 3PU3A 1CZVA 1AYN2 2RHPA 5J48A 4ATFA 3CEWA 4EWEA 3ZVXA 5CFDB 4Q26A 2HWE2 2WINB 1KITA 1KJRA 1WCSA 1CONA 2D93A 2AH2A 5FP3A 3VKOA 5C70A 5LA9A 3E97A 3NV4A 3TNQA 4CUBA 4YVSB 4ASLA 4MYEA 4I3PA 1WKYA 3V56A 2BFUL 4LO8A 4L2NA 2VZRA 5C3PA 3THDA 3KMHA 5F3EA 1PNGA 2YBKA 1MS3A 1RUE3 3DV8A 1GLHA 4RFRB 3ZYFA 1GWLA 5GKAC 3VHOA 4CZSA 2C4XA 2ZGOA 2WS92 3AFKA 1JTZX 1PZ8A 3S7IA 4MADA 2HH9A 4R4XA 4CTEA 4AGVA 4PCRA 1DZQA 4AQ6A 2Q1MA 5F37A 1RUC3 3LB9A 1X8MA 1OLME 4PT6A 4RS5B 4LQRA 4NE9A 3VD5A 5JXJA 4MXWB 5F32A 1LU1A 3W21A 1QU0A 3N9MA 2WWUA 4RQPC 3THCA 2GC1A 3AJYA 4A42A 2IFRA 3ZYBA 1PO11 3DYOA 1OOPC 1HB4A 5C7GA 2WZR1 2JG8C 3H3LA 3M3OA 4C90A 3SITA 3JZVA 3MYXA 4YW7A 1GWKA 1A6CA 1UCXA 4N7IA 4CU8A 5KXCA 3M3QA 1OKQA 4Q4Y3 2NMOA 3RMYA 4JKKA 2PHLA 5ANNA 1W9FA 1X36A 4G3YC 5A7WB 5FZKA 1UIJA 2ZEXA 5FZ9A 4TWTA 1ZZ7A 1RIRA 4XPVA 2JJ6A 1WCDJ 1S0EA 5DZGA 5JWPA 4EN9B 1HXS2 3SLIA 1WMDA 1F5FA 4W50A 3AZYA 3ELNA 1ND2B 3LSEA 5FP9A 1VPHA 2P3YA 2VMGA 1G8WA 4KGGA 2XPJA 1SHWB 1O7FA 2LM3A 4XFFA 1WMXA 1XSQA 3I4IA 4UW4A 2PQSA 2WRAA 1SPPB 2ID4A 4BU2A 1HN0A 4OI4A 4E27A 1MS4A 5CISA 1UZZA 1RUD3 2JECA 2LUWA 2Q8DA 1PX4A 2A6ZA 4UI9L 1UY0A 1APNA 3OCPA 5FZ7A 5DMYA 1S0CA 3OPTA 1BQPA 1CAVA 4LBMA 3R0RA 4L92A 1OLRA 3E6DA 1NCRB 1KRIA 2W39A 3AKQA 3ZFGB 5JXHA 4UXAA 1UU5A 4R9BA 1ZX5A 5FXZA 3S7EA 3UGHA 4K1ZA 3S5QA 3ZN6A 4UFIA 2ZGLA 4YW4A 1OF4A 4QKDA 1TEIA 1UO9A 3MF9A 2GNTA 4P9JA 1CX1A 3DPRC 4AI2A 3SCGA 2WUHA 4FO9A 2OT7A 4XXPA 1BMV2 1H6XA 4QPIA 1UWWA 2VNRA 2Z5WA 2FMYA 1JS9A 1QJX3 2OQ7A 3MIBA 2Y6LA 1WD4A 4AWDA 2WO2A 4JHZA 3KCXA 2BPA2 4XVHA 2MEV1 2HWC2 4Y1UA 4GKXA 5EPAA 1AVBA 5FZIA 3ATGA 3LIHA 4YVWC 2JDMA 2PN5A 2ZOEB 5LBEA 4IV1A 3IT8A 1CGPA 4RGKA 1QOTA 3VBOB 1GU3A 2UWCA 3FHIB 3OPZA 4IETA 4AE2A 5LATA 3POWA 2BBVA 2A1XA 1PGL2 2ZMLA 2VULA 2G9FA 3C8XA 2YPJA 5CBLA 2W52A 4NAMA 5C6CA 5DAVA 4YW6A 1BEV3 1WW7A 4AK3A 2UYBA 4AI9A 3JBG2 4H55A 3HD8B 3ZN4A 5FZDA 4CXWA 1GYKA 1RUF2 2XKOA 4W8JA 3WNLA 1RUH2 4RD7A 2C5DA 4JZRA 4ZU7A 1W9TA 4D6SA 4META 4PF5A 1XNAA 1KDMA 4KWLA 3BOPA 2J1TA 2PLV2 3OSDA 1K12A 3I2KA 3UKTA 4B7KA 1W03A 1PM4A 2WQ4A 1MR5A 2V09A 4AAXA 4X6RB 1VBD1 2BJSA 3LAGA 3TB0A 5LZ6A 3RZMA 4GJZA 3NKTA 4LPLA 4YARA 2WNUA 4FOQA 5JZGA 1PGW1 3U4XA 4RGGA 3POJA 2ARXA 2Z69A 3MW2A 4GWMA 4TLGA 4CUCA 3I2IA 4XMIA 1PK6A 3PHMA 3V64A 2V4AA 2B8MA 3A22A 4LO6B 1XPWA 4OUSA 5AC91 2DUOA 5C33A 3UL2A 4MG2A 3M7AA 2PQQA 4QXCA 2WIIB 5T3NA 1FPN1 3I2JA 4Y5SA 4QKNA 5D8AB 2O1QA 1VBB2 5GZCA 4P14A 1ULFA 1O3SA 1RUOA 1N1SA 1AJKA 3J7MA 4IEOA 5FBZA 1O4YA 1N47A 5ACA1 1S1AA 5A70A 5E89A 3KV6A 3ZYGA 4HXCA 2ZGQA 2L9LA 1Z7S3 3VBUB 5I0TA 3ZXEA 3IMNA 2RM21 3MZHA 3DCQA 4Q1PA 4JTOA 3PL0A 5FK7A 2VQUA 3KLSA 4P08A 3TOJA 4YGEA 3GBFA 3GZUC 2BZDA 2HWF2 3AYCA 1TME3 3SEPA 3AZWA 2OUHA 2ORZA 1BKZA 2NM1A 3WW1A 2VZ3A 3EXUA 1GP4A 2Q5TA 2WC2A 1W6NA 3WG4A 4CPBD 1NX9A 1E5RA 5ANQA 5F5CA 3WOGA 4NHLA 5FQ0B 4LA2A 5DUXA 5JOXA 1OXCA 4ITCA 1P8JA 1VBA1 2RS51 2NYYA 4R9CA 3JD72 3KT1A 4C8DA 3O0XA 4CCJA 1UZWA 1C3HA 1O8PA 4ZZ8A 5A1AA 4O9GA 5CFCB 1AL23 1OKOA 2XWBB 4ZHNA 3T1MA 3ES1A 5EHDA 1E5SA 2VG9A 1MEC2 3EQEA 4HFSA 4Q4X2 1CAWB 1RMU2 4E8CA 4ASMB 3KGZA 2D98A 3CHXA 4XFGA 5A7NA 4XBNA 1I3HA 4CDXC 3AC0A 2WSVA 4JX0A 5JSOA 4BK4A 4P9GA 3WR0A 1RTVA 5FP4A 1GOHA 1VAKA 3F95A 3HQRA 1V9U2 3VD3A 5K9YA 2Q30A 1BCXA 2WFF1 2OA2A 4Z2AA 2JWPA 5B2GB 3H8XA 2MHFA 1FOD3 4ORFA 2XJUA 5E8AA 5A33B 5BNNB 1L3JA 3WDTA 1WCQA 3BCWA 4A3XA 3AP4A 4N8MA 3A0KA 3GXUA 1OVSA 3CL1A 4GB31 3FHQA 4P9YA 4CDWA 1AR72 4WV8A 1UOBA 3RSJA 3I7DA 2RMU1 3OG2A 1WUVA 2I45A 4Q0PA 2FDGA 2A3XA 3DUIA 2VBDA 1TVGA 3OGGA 2QKDA 4PQQA 1DIWA 1DP0A 4HKLA 4BQWA 3ZKYA 3IDBB 2ZKLA 2GN3A 2W9XA 2GNBA 4NRQA 2VAUA 4WZCA 5A3PA 1KDKA 4CCNA 3DF0A 4CCOA 3NVCA 3HN3A 3USSA 1YQ8A 1OA3A 1N3OA 3JU9A 1SDDB 3VBRA 3LEGA 3GBGA 3VKLA 3GZTB 3K3NA 1MVEA 4BCUA 4E4ZA 2XBO3 4O61A 2J1SA 2GP5A 3MLKA 1RUI3 4YVSC 1W2OA 3VKFC 2BTVC 1NG0A 3KZ4C 2HWD1 2JG9A 3FX3A 3RZZA 4URAA 4Y24A 3WD5A 4QGNA 1EAH2 1MZFA 3VZJA 3C7FA 1IQDC 4NR1A 3AM2A 3KV9A 3O1TA 1OQDA 2PHFA 3HT2A 2BV4A 2XHKA 2DWRA 3BOWA 3ZXFA 1ULOA 1TNFA 2Y38A 3CDZB 2CSGA 4JDMA 3VBSB 3TN92 3LEKA 3WSOA 2A3YA 4I30A 3FL7A 3RZJA 4AI3A 1KGYA 2Y6GA 1YC61 5EWSA 4PI2A 4F7ZA 3N36A 2XWJB 4ES8A 4Z8BA 2CL2A 2XVGA 4KWKA 4KI5M 3O1RA 3JCIA 4N9IA 3NWKA 4M4PA 2B42B 2BERA 4CDQA 4FP2A 4QDSA 3K2OA 2PMWB 1RUE1 3WY6A 5L7OB 1J58A 4I2OA 1UPSA 4K21A 4NAOA 3UNPA 5DUWA 4AFCA 4QB2A 5LASA 1D0GA 1RUC1 4IXLA 4DOUA 3VD4A 4YW2A 3VBHB 2YXSA 4CP0A 1ND2C 4TTGA 4CDUB 2YROA 2BYVE 1COV2 5DXDA 4O65A 1H1MA 4LOTA 2GMEA 4LBQA 4XZPA 4ATEA 3K48A 4AW7A 5AFBA 1ZRIA 2D6PA 1V6MA 2DU0A 4LOSA 5EXOA 2VZ1A 1NA1A 4Q4W3 3V0BA 2VM9A 3GNEA 2EF6A 5JPMB 2RS12 5LK7B 2YFZA 4BOWA 1DZRA 2HWB2 1YIPA 1S0JA 4NMIA 1NCQA 1AJOA 3MW4A 4Y5Z0 1CAUA 3K46A 4QQOA 4QX3A 2BOIA 3OBRA 1X9TA 1BZWA 2ET7A 4Q4Y1 3ZFFA 2R0HA 3LF7A 3I3QA 4ONUA 4B1LA 2W95A 1W8FA 1MPXA 2CDOA 2W1UA 5F7UA 1G9AA 3B02A 4COYA 4IGPA 2RR12 2C24A 5CIRA 5FZ6A 2ZHLA 4LIVA 4XHBA 1LOCA 1SFNA 2WO3A 4YZ5A 3WF3A 3KSCA 5CAZA 2K2SA 2P6CA 4AFDA 4RSUA 5FMDA 5HCFA 1YQ6A 1LNSA 3KS7A 4QX1A 5E88A 1S0GA 3BIWE 3MBWA 1HRI2 2JD9A 5CA6A 4UOJA 1RGSA 1HV1A 1TNRA 4KBBA 1RUD1 5BPXA 3UJOA 5FZ1A 3A0NA 3BYWA 1YFYA 5A7OA 2BDRA 1AYM2 2BGPA 2GDFA 1VMJA 4HKWA 1H2MA 3VBOC 3OD4A 1CQ9A 5L19A 2GSYA 2ZHKA 2E33A 1QJU2 1OPOA 1V00A 2ZGSA 4AQTA 4R4ZA 1YFUA 1GV9A 4JKLA 1MQTC 2EIEA 4ET7A 2QQPA 3GDBA 1M4WA 1HQWA 3OEAA 2YPDA 3BI3A 3MUZ1 4UWDA 4B4RA 5FK8A 3ME2A 3T2QA 4XW3A 1PVC2 2O14A 3VDDB 2P37A 2EXHA 5FZOB 2X5IB 1OHFA 2DU1A 4L99A 2GNMA 3N35A 1QJX1 3ZMNA 4BLJA 4ISQA 1OFNA 4PIXA 2GAUA 5FCCA 3MFCA 1POV0 3KV5A 4OZXA 1F35A 4S2DA 1DGRA 1JUHA 1W6MA 3LOIA 1NQDA 1H8VA 3MLJA 4XUNA 3LA2A 4WBBA 5I8YA 1IPSA 1J84A 3AX4A 4FFFA 4QKFA 4XTMA 4BYYA 4COWA 1RUJ2 1PMHX 4YM1A 3C7HA 4LLOA 5CNAA 4QPGC 1V6NA 3U78A 4BDVB 1VP6A 1BEV1 4EZ4A 4DXRA 2ZMKA 3O0WA 2WDBA 1I5ZA 2R0FA 2CHHA 2XLFA 4RQPB 4TXWA 3U10A 4AEDA 1CESA 1ZA7A 4R8HA 4PBOA 1PIV3 1R093 1ZYBA 5LCWL 1Q3EA 4WVMB 2JG8B 3U4SA 3VD7A 4MGTA 2BNNA 4UW3A 4XTPA 3JB8A 2J1RA 1I1EA 3O1OA 2FCVA 4KQ7A 2VOXA 4OUEA 3LCPA 1ASJ3 1JN2P 2BOJA 2P34A 2R042 3OBAA 4IE4A 5FYMA 2JE8A 3C7OA 1RHI3 1VLNA 3K3OA 3JB4C 1WCUA 3OBTA 1YI7A 1W39A 5JSRA 1RUG3 1CZSA 3VBUC 1LHOA 3MV01 4IE0A 3T2TA 1XNCA 3B9IA 1ZBE2 2BUKA 4XAAA 3KV4A 2ERFA 4FXGB 3W9AA 2JDUA 2WQ8A 4PIZA 3AKSA 2YB7A 1UYYA 4BA6A 3FUQA 4BH9A 1QDCA 4COVA 3CJIB 2RJ2A 1LHNA 4AVTA 4RHV3 4DUVA 4FQ4A 4HPKA 1HW5A 4MGSA 4UBGA 5A1FA 1S2KA 2YY1A 4QX0A 3SH3A 3GCWA 4M01A 5CFCA 3UGGA 2AEYA 2EIDA 3OGRA 4K9SA 1RJ8A 4L8QA 1PO23 5CFCC 2YMZA 3WEZA 2E7TA 1ZM1A 1Z7S1 4UBHA 1R1ZA 1QMJA 1UY4A 3H8RA 4ASKA 3DPRB 3D8CA 1PMIA 3VZMA 4JGZB 1V6IA 2A6VA 1IOAA 4P9LA 4H7LA 1TME1 4QXKA 4RR3A 4HG6B 1ENRA 5BNOA 2Q1ZB 1JOBA 4ARXA 3RYPA 2VTXJ 2GC3A 1DDLA 5FZEA 2YZ4A 5H9QA 1ZZBA 1W6QB 4CU6A 4JVAA 2Q1FA 1YHFA 1TMF3 3LEIA 5K4LA 2R062 1DYOA 5FOBB 3QBQA 3ZMOA 3N7KA 4IEXA 1AF9A 1AR93 4MSVA 3ETPA 4KGQA 2WKKA 4PLOA 4M3CF 3N3HA 4NHMA 3K4AA 4NN0A 3RNSA 4A6OA 5BY5A 2BGCA 1AL21 4BM8A 1DLCA 3I2GA 5H9PA 3T3YA 3TBDA 2P3KA 1EPZA 4NHYA 4DINB 1LB2A 2BQPA 3ACGA 2WN3A 4D3WA 1GR3A 1O4TA 4DPNA 1W99A 4ZU4A 2W0XA 3WP4A 1NE6A 5IK5A 3NV3A 4NRPA 4YGDA 5DZEA 1DG6A 5B4NA 2ZBJA 4HZFA 2VZTA 4EE2A 2VD7A 3ACIA 4BPZA 2WJSA 3QH6A 2FBEA 3N9NA 4LITA 1FOD1 2FDHA 1A8DA 5JUVA 1LOEA 1K45A 1RINA 3SKJE 3HNBM 1XXNA 3GHNA 1ZRCA 4L0PA 4PI0A 1AXYA 5DZFA 4OZOA 4Y4YA 3S0MA 5K0UA 2AYHA 2AZ5A 3FLPA 1MS9A 2BFUS 2HKXA 2R49A 5JOWA 4IE6A 1NQJA 1W3XA 5C8CA 4XF9A 5HXMA 2W47A 4NHXA 2LW8A 5JXGA 3ROUA 1ND3A 1UOFA 1ZBA3 1XOYA 5GM0A 2JXAA 1O5UA 5CU1A 5D1IA 3IPVB 3MPPG 1HRV2 1DYKA 1VJ2A 2A5ZA 2XBO1 5LBFA 2B4KA 1ULCA 1ZRFA 1CD3G 3MGUA 4M3CA 2ZACA 4Y1YA 1RUI1 1SQ4A 4GA9A 5FYUA 1D4M3 5T5JA 4D69A 1AX2A 1R083 1WLDA 2N7GA 3DKQA 4N43A 4D6RA 3O1UA 3B93A 4CXXA 1B35B 3I2FA 5FR3A 2RVAA 3U1XA 4ZPIA 3QACA 4UF0A 4J6GA 3VL9A 2QZ2A 2ILMA 2ARBA 2ZA9A 3J8F3 1JMUB 1YJLA 1H8TA 4IESA 4LKDA 4H3WA 3H1MA 2VGDA 1UAIA 1UY3A 4AVAA 1VRH2 1UPIA 1PVXA 4IEPA 3R6SA 2YGMA 3WINE 1UKGA 4AHYA 1X33A 5F9TA 2O8QA 1CPNA 2FQPA 3UETA 4XFCA 5CYYA 4YG3A 1OQEA 3D4KA 4WVVA 5C4WB 3J7LA 3ZM8A 3ZX7A 5IW0A 4CYDA 5LA2A 1YLLA 1YQ5A 2GN7A 1GZCA 4LHNA 5FZ3A 5IATA 4CDXB 4BXFA 2IC1A 4F8AA 1YCIA 4XE9A 4Y20A 4CP9A 4F83A 4FBFA 2DV9A 1AL0G 1QY4A 3P1IA 1QJY2 4QT6A 1BYHA 1MZ5A 3P3NA 2VCAA 4DFSA 2ZGMA 1XC6A 3POSA 4CA9A 4GMP0 3AYDA 3I54A 3N9QA 4U2AA 4KG0A 1K5MA 2MNGA 3UESA 4BE3A 2JENA 4JC1A 4QPIC 4W65A 5T54A 4CPBA 4BQ2A 4FFIA 4PLMA 5SV5A 3W59A 4GULA 2WL1A 5E1RA 5HI0A 2FDJA 5F5QA 3AP9A 1MS0A 3SEEA 1KD7A 4IV1C 4Y26A 1ENSA 3WF4A 3Q8EA 4YG6A 2OPWA 3NV2A 5IK8A 3AMHA 4QDQA 2VPVA 1FMD2 1F4AA 1IKPA 1OUXA 3RDIA 4OHXA 5A6YA 3NNJA 5DG1A 1W2UA 2VW2A 2X53S 2ZEWA 2EALA 3O1MA 5C9AB 3VZNA 4JKMA 2JE7A 1NY72 4E2SA 1G86A 1O59A 3ILNA 5L9BA 3H3UA 4YM3A 3MDPA 3R4UA 2QZ3A 4IV3A 3RPQA 3CLPA 1C8M3 3VDDC 1YI9A 1WZXA 2X5IC 3RZHA 3C2UA 5IAXA 3WNPA 5IK7A 3WDYA 4WM7A 5JR7B 4HVRA 2ZGTA 3RZKA 2DYCA 4NIHA 1XYOA 3WG3A 3C3VA 4AL9A 5A6QA 3CQOA 4DQAA 1DQ2A 3LEMA 4BLIA 4CCMA 3T4HB 5JZGC 2WNUC 1SLBA 2D3RA 1IS3A 2PHRA 3AYAA 3T0BA 5FYSA 5CKQA 3OUJA 3FE5A 3S57A 4JGYA 3O1VA 5FYZA 5FAXA 3HJRA 3HR9A 1FNYA 1ZREA 2AACA 2C9KA 3I3MA 3S5AA 3JQWA 3O12A 3ZIXA 4LUMA 1GICA 3OEBA 3UGFA 1W8HA 3WW2A 5IK4A 2D5FA 2BWCA 3ECQA 1CIWA 1O3RA 4GZ9A 2QQVA 2DFCA 3EMRA 1BBT2 1XQNA 2RV9A 3INAA 3RI8A 3H7JA 3KHCA 4JQRA 4C1WA 5FY7A 5KR7A 2WO7A 2ZAHA 1LGNA 3N7LA 4Y22A 3AMPA 5FYBA 5FYVA 3M2MA 1LTEA 4B3NA 3I59B 5FMOL 1OA2A 4QMAA 2F4LA 2RS33 2WN2A 3D6EA 1REDA 1Y43B 3W5MA 1F5JA 2VL4A 5H9SA 5CEHA 3PVOA 4HBNA 1F9KA 1ZRRA 3KF3A 4AXOA 3D0JA 1RVF3 4FFGA 2R072 5DDJ2 1VBC3 4GH4A 4XQDA 3TAYA 1Q8QA 4P5HA 3G7DA 3OBZA 1PIV1 1R091 3CJIC 4UFHA 4NOTA 3WDXA 2E6VA 1H2KA 2Q0AA 3NL1A 3BVCA 2Y60A 2OX0A 1NKGA 5A3NA 1ASJ1 2GZWA 1TZOA 2ZKNA 1US2A 3O14A 1JHJA 1RHI1 4QQLA 1HB1A 1XE7A 1JH5A 5H9RA 1JOJA 3O5SA 3I3DA 4XJWA 5KC5A 4OQ8A 3D5OA 1RUG1 3THTA 2UU8A 1ODNA 2VVDA 4ZU5A 2GMMA 4DB5A 5DAWA 4JGZC 4XAEA 5CKNA 4BXSV 1DHKB 3LKJA 2JEMA 4QXBA 4XF0A 4XUQA 4XHXA 5FYYA 3UKVA 1OFSA 1HX6A 1CPMA 4K40A 5KWRA 3N4MA 3HQXA 4CCLA 4ZKTB 4RHV1 3GALA 3OYWA 2SLIA 5KC6A 3AP7A 4Y1ZA 4N53A 4I0AA 2ZX0A 3POYA 2E9QA 3T0AA 3GF6A 3NJZA 3B94A 5FZBA 4HVOA 3SXWA 4AGGA 2P3IA 2E53A 2R7EB 4IERA 4Q27A 4X8PA 3WP6A 4BQ3A 1MQTB 4ZS2A 4CDWC 3MW3A 1PO21 1S2BA 1JYXA 3P5BA 5DAPA 4FOVA 1XU2A 1XNKA 5FZHA 3VBFA 5I0SA 3BIEA 4Q0UA 2VE1A 2JD4A 4G9SB 3AVRA 3IDEA 1LAJA 1V6KA 2DCKA 5GJ6A 1IG3A 2ES3A 5CG8A 2WYSA 4UW6A 3WW3A 1KJLA 3VLBB 1W0OA 1UL9A 1AR62 4EN8B 4FPYA 3VBRC 5BNPB 1Q8SA 3OY8B 4KU8A 2A75A 3GZAA 1AR82 3PDQA 1NLRA 4LBJA 5GZFA 4XFHA 3J7HA 1DGWX 1RJ7A 1TMF1 5L73A 3PIGA 2J42A 2JDPA 1SG3A 2RG4A 4HLTA 1H2NA 5GZEA 2JG9C 1AR91 1YQCA 4A6SA 1W9YA 4XUTA 2CU5A 3N7MA 3SHRA 2D6OX 1UZ0A 4NJ4A 4QPGB 1ODMA 4IE7A 2VUCA 3M3IA 3G6JB 4XIKA 3TWIA 3U14A 3GYDA 5F8PA 4DXTA 2TEPA 3M4FA 3M3EA 1N3PA 2XQXA 3B9CA 4OHVA 4YPJA 4E4SA 1JYWA 1MS5A 3RRDA 1VBE2 3ZXAC 4Q4V3 3OUIA 3I8TA 3TNPB 2IXHA 2VTXA 4YG0A 4YW1A 1JU3A 4EN6B 1GANA 1NOVA 5EZWA 2AR6A 5FXXA 3USUA 2X09A 3M3CA 3WNKA 5IVBA 1Y9MA 5G04L 5LBCA 4CU9A 4COUA 4OCTA 4P5YA 4TLFA 4AQSA 1O6UA 1BVP1 1G9BA 4GKYA 4LUKA 2XVLA 3WF0A 1OC1A 4KMQA 1PMJX 3VZOA 2ETEA 4BHPA 2K9ZA 3NRUA 5HXVA 3ZR5A 5C8WA 1UMZA 3IAPA 4XJ9A 2WAAA 3FFZA 1QQP3 4NIAA 2FDFA 5A3UA 1B35C 1CAXA 2WAOA 2O8OA 4OLLA 4J25A 3R4DB 2VO5A 2E31A 1PX3A 3LPFA 1OOPA 4NHKA 3UYJA 1NZCA 1VE0A 5LB6A 1LECA 1GFF2 2OQ6A 2JDNA 3B5LB 1UOGA 4K7JA 1G9DA 3CZJA 2PXJA 1GQHA 4XJUA 1AYN3 2WA4A 2XXZA 3KF5A 4FTSA 1ZBA1 2ZHNA 4RL7A 3WF1A 2VJXA 1G9FA 4MLOA 2XR4A 2LS6A 2XQRA 3E6BA 4D6QA 2ET1A 3IZOA 2HWE3 1PO12 2YU1A 4K8RB 5A32A 1DU3D 3LPGA 1E5IA 1NXMA 2A73B 2G19A 2WZR2 2YGLA 3IIAA 5M0TA 1D4M1 1J1LA 2P1BA 4XQWA 1R081 4ZS3A 4DIQA 3ITQA 1NCQC 3V0AB 4JDOA 5C4WC 1GZWB 1AZDA 3N9PA 3ZFEA 4XJAA 5JI7A 3ZFFC 3GBWA 3ZKUA 2CGOA 2R6QA 5T5OA 2YUEA 4YM0A 4BMEA 2DVFA 3LWCA 2WS93 1EV12 2GH2A 4WZFA 4CEWA 2VOKA 3J8F1 1LOBA 3Q8FA 3HBKA 1US3A 5FZMA 5GLWA 5LEJA 5FP8A 1W06A 4WM8B 5FY4A 4QQHA 2VCBA 5ABJB 4XDQA 1IKQA 2G4IA 3HIFA 2DCYA 5FKCA 1F31A 2C9AA 3THPA 2J1UA 5E16A 4EZHA 3A7QA 1W2NA 1HIXA 5FJHA 4M00A 5A7PA 5F5IA 2DVGA 1VRBA 2X10A 5EJZB 1H6YA 1HB2A 1V0AA 3FN9A 4A44A 5FO7B 3DKWA 2VOWA 5T52A 2DTYA 3HBZA 2ARCA 3FLTA 2ENRA 2Z4FA 5C9AC 5DQ0A 1GQGA 4JV4A 1AX0A 1C5IA 2E63A 4I09A 4YVWA 4DY5A 3WHTA 4E2QA 4RN5A 2HLEA 3T4VA 3VDAA 1GSLA 3KGLA 4NPRA 4Z92B 3AKPA 1HXS3 3LSDA 3H1WA 1OA4A 4XABA 1XE8A 2OPKA 4Q1RA 2WYFA 3UKNA 1VAVA 1W6PA 1WLTA 1DBNA 1LOFA 2MEV2 4QAWA 1GBGA 2R1DA 1QGLA 1W05A 2FMDA 3BB6A 3AXDA 2NQYA 2W1SA 4LEJA 1PNFA 1OBNA 1STMA 2R1BA 1SLIA 4N9HA 4FSJA 2VTFA 1M06G 5A3MA 4I01A 5FV3A 1T6BX 4P00B 3B7MA 3MIEA 1KXGA 4QQPA 4BMBA 1R1A2 1MS1A 4DZGA 1K3IA 4AEDC 4EQVA 1XNTA 4Y5TA 1XYNA 2RDSA 2G9ZA 1C8M1 2VQAA 1W0NA 3MHZA 4FPCA 4W6WA 5HCBA 1C1LA 4R52A 2LROA 4A41A 3KVAA 2VBBA 3BKZA 3ZPYA 3PVNA 3NAPA 3PURA 1GUIA 2AC1A 2XUMA 3M70A 4QX2A 4CU7A 1PZ9A 2VMFA 2GU9A 3TYJA 1F15A 1VBD2 1QWRA 2A70A 2Y33A 1V6OA 3ZYPA 5T5PA 1FAYA 1YRZA 3KWVA 1PGW2 1ONAA 2HWC3 4YWAA 3BTYA 1AXZA 3KCYA 3PJQA 5FREA 4HSJA 1EYBA 5FXWA 3WF2A 3N9OA 3ZXGA 2BNOA 3SKVA 2RDQA 1OPMA 2AEZA 5DN2A 1UY2A 5AC92 1HJGA 3POGA 5JR2A 2HYKA 2QQLA 1ZRDA 5IFPA 2J1AA 4OMCA 4QHBA 3MEPA 2QNKA 5GZDA 1FPN2 1UYXA 4BQ1A 3JBG3 4BQ4A 1OT5A 1V70A 1IS6A 1RUF3 2EAKA 2I2SA 2UY8A 5EP9A 5IVJA 1HJFA 1RUH3 4LBOA 3ZXJA 1HQNA 3OPWA 1CAVB 3W20A 3MV11 4CCCA 2R16A 4LLFA 4AHXA 4BZ4A 2NN8A 4QM8A 5ACA2 1OH4A 4UW5A 5JVVA 2CGNA 2PLV3 1REFA 2D44A 4IUGA 3ZN6B 1XNBA 4H7MA 3UT0A 1C28A 4LK7A 2RM22 2Y0OA 3EYPA 4URTA 4CEYA 2RS31 4XQ4A 1W9SA 5C71A 4FCAA 4OVEA 2P6HA 3VDBA 1NAEA 5HCHA 4RR3C 2DUPA 1SFYA 4QPIB 4LR4A 2ZHMA 2QQWA 1RVF1 1W6OA 1VBC1 2H6CA 1WA6X 3WHUA 4R9AA 1Q8PA 5I0UA 1UF2C 4FXKB 3JUUA 2VZUA 2A6YA 1FYUA 2QBXA 4GWJA 5K7PA 4AZZA 5BV6A 4IV1B 5BYNA 3ENRA 1KFXL 3AP6A 3RI9A 5GLTA 4UFJA 5A7QA 1H9PA 1CJPA 1VBA2 2RS52 4D7SA 1S55A 3RGBA 4AI8A 2ZGUA 1VBB3 1NUKA 3WNOA 3OF1A 4XUPA 4W6YA 5DAXA 5C3QA 1VB4A 1V6LA 2HBTA 1U5IA 4JHTA 4O9EA 5EJ1B 2WR9A 3BPZA 4D7YA 1IGOA 2DVDA 4YZ1A 2ARAA 4BISA 4DY3A 2BP6A 1QJEA 2WNVA 4I02A 3FBMA 4NPMA 5F6KA 2C6SA 3HOBA 2XJSA 5EIYB 1K42A 4Z82A 4PDWA 3AMQA 3H50A 5I8TA 2HWF3 3SC7X 1RITA 5BNPC 2H0VA 3RYKA 2P17A 2YC2A 2WFF2 1I9RA 4FPHA 3URFA 4NRMA 4NROA 2ZGNA 3T1LA 5JZGB 1J1TA 2WNUB 5CFDA 5LRRA 3B00A 3TEXA 2QJVA 2Q8CA 5FUIA 5KHJA 1KEXA 1KFUL 2FCUA 4GB32 4LTAA 1PK6B 4Q2FA 3ZO0B 1JXNA 2RMU2 3ZXLA 2QE3A 4W6XA 5G05L 3JD73 4B1MA 5K0UC 1LU2A 5FKBA 4YVSA 1L7LA 3EO6A 1JUIA 1X8EA 1T2XA 5FUNA 1MEC3 3OJBA 4UFKA 3PNAA 4Q4X3 2FZ1A 1ND3C 1RMU3 2PTMA 2XLGA 3AKRA 5FPVA 1QNYA 2WWSA 2ZMNA 1REEA 2F4PA 2VMCA 3MF6A 3EBRA 3PMSA 2TBVA 4CUAA 2OXBA 4Y1XA 2Y64A 2CYFA 2RE9A 1QOSA 1UYPA 4CP2A 4RS5A 2VZPA 4XBLA 3NNGA 1V9U3 4FPOB 4MXWA 2HWD2 4QWNA 3VZKA 4COZA 4EWDA 1GZ9A 2WA3A 3IDCB 3LFMA 5AVAA 5CADA 3BN6A 4RFT0 3WUCA 3HNYM 2Q8EA 4ARYA 3WUDA 2GNDA 3FWEA 5FZ4A 4LA3A 2KA3A 2GC2A 3LFIA 3UJQA 4FFHA 1AR73 2PHUA 4JQTA 4XYXA 2FD8A 4ZONA 5A1LA 4Q4V1 1H8TC 3RWNA 5KHHA 1QIQA 1W6NB 1NE4A 5A7WA 4HN1A 5F3IA 4XEZA 2OVUA 3MI8A 2W46A 3AP5A 4X6QB 2OYZA 3OTFA 5FP7A 3ZSLA 2E7QA 1YFWA 1QJY1 2TNFA 1O91A 1ND2A 5FOJB 1C4RA 3GCXA 2BEOA 2V4VA 4U36A 1RUE2 1Y9GA 1QQP1 4G4FA 4HN0A 4EN7B 4QB1A 3LDKA 4FVVA 3SMHA 4NIDA 1SPPA 2ORXA 1D2QA 1MVQA 2AGSA 4XDOA 2G9GA 2C0ZA 3POIA 1J59A 1RUC2 3E5QA 2VECA 3BGAA 1XYPA 2VMIA 5A7SA 1EAH3 1QJFA 2D6NA 2W2IA 3AKTA 1JW6A 4WM8C 1AYN1 2X05A 1C57A 3WDVA 1K5MC 1UXZA 3AJZA 3HQUA 5ABJC 5AFEA 4W4ZA 1NCRA 4Q8KA 5KXEA 3ZFGA 1AUYA 3TN93 5IVVA 3OUHA 1A34A 4QXHA 2HWE1 4A2UA 1H4HA 2VU9A 3U75A 5I0RA 2DCZA 4H14A 2V5YA 5J36A 4CDWB 1W04A 2PAKA 1AX1A 4AI1A 1RXFA 4JRAA 5EFUA 4DMIA 2VNVA 4Q4Y2 1GKBA 2J1EA 4MH0E 4RYDA 1NT0A 1UD1A 1VIWB 1W8TA 1ZA4A 4YFWA 4B4PA 1IQAA 1HKDA 1S4CA 5CKMA 4YGCA 3UK9A 2FCTA 1IPJA 1YFXA 3WG1A 2QQNA 2XLAA 1WW4A 1HV0A 2WS91 4FTBA 3CIHA 4AOCA 1JYTA 2B9UA 3VBRB 4CCDA 2JIJA 4J1XA 1N1TA 2OZJA 3KT7A 3VHPA 3BUCA 4Q5OA 3GM8A 3VBOA 1UY1A 4IV3C 1SCSA 5FJKA 2PHWA 5C3OA 3KVBA 2WLPA 3SNMA 4YW3A 5LA0A 5FMCA 2KM2A 3FLRA 4OI1A 3AVSA 4Z07A 2JG9B 1COV3 3NMBA 4WM7C 5GLZA 4FOWA 1W28A 1RUD2 3KHBA 1AXKA 4QQ2A 5F6LB 3H3ZA 4IGOA 4XJZA 4Q0VA 3M8LA 3H8OA 4LT5A 3QH7A 1JU4A 4WVZA 5DUUA 5J7MA 1NLQA 2BBAA 2RS13 4FQZA 4LHLA 2Z42A 3RFRA 2HWB3 1UIKA 1H9WA 2Y8KA 1B09A 1W9WA 1MACA 4HSLA 4YNIA 4OQ9A 3FC0A 4QU1A 4KNCA 3ON7A 3WQ7A 4DUWA 4XF3A 4INDA 5E6HA 3T08A 1U5YA 4KG8A 5B4XA 1Y3TA 2RR13 2PHTA 5FYCA 1RYYA 2AENA 1HXS1 1NYWA 4M4RA 1XNDA 4K1YA 3IKWA 3ZYHA 5FPBA 5AVPA 1N1VA 4CDQB 1D7PM 1QJX2 2JDYA 1S0BA 3P6BA 4QU2A 4IDZA 5JI9A 3I3BA 4S2FA 1FNZA 3RJRA 1K5JA 4YRDA 2IVIB 4HONA 4J1WA 4YZ2A 1IPKA 2TUNA 3R05A 5I91A 5C5TA 1UX7A 3O1PA 5CVRA 1UZVA 4XCAA 4SLIA 5D8AA 2FDIA 1O3TA 3GZEA 3ZLIA 1AYM3 1C8NA 1LULA 3OD0A 3IBMA 2WFPA 1CZTA 5JMCA 1BEV2 2PHXA 3ZIWA 1QJU3 2ZX1A 4LBQB 1DQ1A 5EQUA 4YLZA 2EICA 3IAQA 5FYTA 1DCSA 2WSUA 1F2NA 1NA1B 4GH4C 3V0BB 3WCSA 5FZ0A 3RVHA 3VBUA 4QHZA 3E5UA 4C0HA 4NIGA 2VOVA 5FIXA 1NCQB 1PVC3 2VUAA 4XCBA 1CAUB 4Y3OA 1QOOA 2ZX4A 1BMV1 2O0OA 1POV3 2BVBA 2ZGKA 3ZFFB 5LEKA 1NZIA 3LA7A 4Q0QA 1G6NA 4K8FA 5FY0A 1G9CA 4AHWA 3LQCA 1XRUA 3VHNA 5DUVA 1XB9A 2HWC1 3WZ1A 4OI2A 5C3SA 3Q9OA 5FY1A 4ZY9A 5FQ0A 2VH9A 2D3SA 2NZ9A 4M3CE 3BPSA 1OVPA 1RUJ3 1PGL1 1L7RA 2X29A 1BHGA 2CAVA 2HYXA 4V2WA 4AYUA 2YBPA 3J7NA 2VZOA 4QX5A
chains in the Genus database with same CATH topology
3AZXA 3EJKA 3VL8A 3JBG1 1CAWA 3WV6A 3IM0A 3DL3A 4EWAA 5FDBA 1RUF1 1SBFA 1BVVA 1KS5A 1RUH1 1Q43A 5I93A 4BIOA 4HL0A 5JOYA 2R043 4AFAA 2QVSB 1LR5A 3AB0A 2PLV1 3CJXA 3ASIA 3ZYIB 1Z7S2 4IEYA 3VBFC 5BNNA 5A33A 3DN7A 1TME2 2D7FA 4HT1T 3ACLA 1Q8VA 1ZBE3 1BJQA 2P2KA 2YDEA 4AEJA 2A71A 4FPGA 2XG3A 5JOZA 1LHVA 1W6MB 1LODA 1SACA 1VBE1 5T5LA 1SLLA 2D6LX 2HJIA 2ZZJA 3ES4A 4AI0A 4OHYA 1VBB1 2HEYF 2Q8OA 4YZ3A 1VAMA 3WXPA 2XB6C 1PK6C 1VR3A 1VB2A 3KCCA 1AL22 4Q0SA 3E6CC 5EJ3A 4AEDB 1QJZA 3AZVA 1ZZ8A 2EA7A 4S2HA 5KXDA 4XFAA 4PIYA 1X82A 1RL3A 2D5HA 1QDOA 5FO8B 5GZGA 1UU6A 1KQRA 3SH5A 2HWF1 2FZ2A 3MIDA 3LA3A 4B7EA 4LO5B 1OD5A 2ATFA 4AEMA 2XJRA 5KXBA 3VBSA 1FOD2 1C1FA 2CAUA 3WQ1A 2E7AA 2R063 4BIFA 1J3QA 4E9KA 4XJ8A 3JD71 2PYTA 2NP0A 2EXJA 5J37A 1SBDA 2PFWA 4JRLA 4K20A 3AXEA 2H6BA 1MEC1 4AHZA 4HPKB 4Q4X1 1RMU1 2WQZC 5L7OA 1ULEA 2VNOA 4KL1A 2GH8A 3EHKA 4TZDA 1QH6A 2W08A 3MIHA 4AG4A 3NV1A 4JCKA 3RJ2X 2LALA 2XBO2 1EV11 1UU4A 4FPKA 1RUI2 3VBHA 3RS6A 1V9U1 5KBFA 4FT8A 4CDUA 3H7YA 3ZFEC 3FFQA 3QD6A 1RC6A 1YUDA 4RR3B 2OUJA 3L9JT 1DQ0A 2IXCA 3NSTA 5BNOB 1YWKA 4CEWC 1AR71 2XL9A 2DF7A 1UZYA 2DTWA 4LULA 3MFAA 1QH7A 4PLNA 3CU7A 2YV8A 2A7AA 3CO2A 4HKOA 1AHSA 2IFWA 4DXZA 1PGSA 1Z78A 3FZ3A 4CRQA 2XJVA 4LE4A 1FXZA 1HRV3 4YFZA 2YYOA 1U5XA 1S0DA 1GNHA 3QCWA 4FPEA 4OHZA 4FPJA 1HQLA 1EAH1 1WBLA 3AYEA 3GHMA 3H1YA 2D6MA 2NPIA 1E57A 2EVXA 3ZSEA 3TN91 3JQXA 4Q4W2 3HT1A 3VHRA 1VRH3 1LOFC 3APBA 1R1A1 3ST7A 1DGRN 1LGCA 5K0UB 3VDDA 2K0GA 3LOBA 2X5IA 5FLJA 2UY9A 1ZZ9A 4GALA 3QOPA 4YYOA 3WP3A 3QLQA 1URXA 4HK8A 4C91A 5C8CB 4M0NA 1YXWA 4EROA 1FATA 1CX4A 1ND3B 3O7OA 2V73A 2EXIA 5LK5A 2I74A 1LEDA 3SH4A 1DGLA 1SMVA 4B4QA 4JTNA 2PAEA 4GMP3 2ZCWA 3WP5A 4M3CB 4IL7A 3ZXDA 1QJY3 2VVFA 3X29B 4N43B 4N90A 2BNMA 1DZTA 1SLAA 4P9WA 4XIOA 4AVBA 4MZUA 4BWOA 4CDQC 3NAPC 1COV1 4ISRA 1UN1A 2CWMA 4RQPA 1LOGA 4IEUA 3BU7A 4DRVA 1FV3A 4B29A 2RS11 4WVMA 1WLCA 2JG8A 2HWB1 1WD3A 3PVEA 1WA4A 2W68A 1DFQA 2XH6A 3I2DA 4AEKA 1H8TB 4D7TA 1GNZA 2ZX2A 5CG9A 2E51A 3NO8A 1FMD3 1LENA 3J26N 4KH9A 4Q8LA 1MS8A 1ENXA 5K8SA 1NA1C 2RR11 3FJSA 1DF0A 3U11A 5GLUA 2SBAA 1O3QA 2CV6A 4MXVA 1UKRA 4Z2WA 4AGRA 4XBQA 3WQ0A 5BUVA 2WT2A 1ALYA 3AZZA 4I3GA 4AF9A 2GALA 4EV0A 1HRI1 1DQ5A 3H9AA 5HCAA 3CJIA 4RGAA 1YJKA 4MVTA 1KS4A 1NLSA 4Y20B 2BVVA 4CEYC 4RA0A 1H4GA 1AYM1 5JIAA 1YO8A 1K5MB 3B69A 1QJU1 3PVBB 3B01A 1T6GC 2WLQA 1PIV2 1R092 4V1PA 1J3RA 1LOAA 1G7YA 3AMMA 3ZYRA 1PVC1 3DPRA 1WLWA 1HDKA 1ASJ2 4JGZA 4KU7A 1POV1 1RHI2 5GLVA 1YYNA 3ILRA 2QFEA 1PZ7A 4YW5A 1UW8A 1BBT3 1H30A 4MX3A 1JHNA 1RUG2 2XGXA 1EP0A 1SDWA 1W6QA 4LO7A 4L97A 2XJTA 2IXIA 4IV3B 5KHKA 4A7KA 2WNVC 2IXJA 1RUJ1 5HBAA 3BALA 4FAHA 5J3UA 2RJLA 2CNAA 4PDWC 3WDUA 4WM7B 2Y0IA 4RHV2 3U07A 5DDJ3 5DG2A 2R073 1MZEA 1EY2A 4MV2A 3WVJA 5CFDC 5JLVA 1QXJA 2XVKA 4F3JA 4KWJA 2R041 1WW5A 3FMGA 1DYPA 1FX5A 1PO22 2EAAA 2OW4A 1DQ4A 3LGRA 4JGYB 4LEJA 4NWVA 4A7ZA 3ZN5A 1O5LA 2B7YA 1YNAA 3N7JA 2WT0A 4MGKE 1WMEA 3WCRA 2ZGPA 2DUQA 4AQ2A 4IEVA 5GALA 2FHRA 1ZBE1 3O0VA 4XF4A 3UV9A 2IXLA 5JCTA 1CN1A 2LTNA 4RS5C 1TMF2 4Y22B 2JKBA 4Z1VA 3SCHA 1QKQA 2A6WA 3HN1A 1AR92 3ILFA 1X7NA 1XU1A 1MZ6A 4TYSA 5JPNB 2NMNA 3IPVA 2XL7A 1OI6A 4E4DX 1RB8G 2UURA 1QNWA 1W0PA 4AFBA 4ES9A 4QGMA 3V65A 4P9IA 1WBFA 4GH4B 1YIFA 2VQ0A 3WW4A 1X50A 2P3JA 3ZYJB 1B35A 4GXLA 4PQ9A 1EPWA 4HANA 2WNEA 5BXXA 3ZDSA 2Y26A 5J98B 1AR63 3KD4A 3RG0A 5LRSA 4OUMA 1DGWA 1AR83 2VMHA 1TE1B 1ZZCA 4YSFA 1PHMA 2R061 5J09A 2B5HA 4YZ4A 5SV8A 4SBVA 2DFBA 4MGZE 2HEVF 4YGBA 3FBYA 5BNOC 4L9BA 3KQRA 4OHWA 2XJQA 2C1FA 2UYAA 4QD2A 5C4WA 2VUJA 3K51A 4R9DA 3OYWB 1QHDA 2ZABA 3M1HA 1ZBA2 3SISA 3DGTA 4N53B 1ZNPA 1VBE3 5L36A 1NCRC 4CDXA 4FTEA 1J3PA 3ZFGC 1H1AA 2X8KA 4FP3A 1D4M2 5EV7A 1R082 4HK9A 3WNXA 2F6BA 3PMEA 4PBPA 3L2HA 2GC0A 2ZJCA 4NVPA 3MIFA 3VBFB 5JDBA 1OQ1A 2ZS6B 5FPZA 4IQPA 3ZSJA 1DQ6A 4B8EA 4I0BA 2ZPXA 2OZ6A 4OI0A 4NWWA 3J8F2 2I07B 3WG2A 4MGIE 1QF3A 1UX6A 4LHKA 1SLTA 1LCLA 2XKPA 4K6BA 4FAGA 5C9AA 3KB5A 1Y9QA 2AREA 2Q4SA 2JE9A 2VY0A 5FLHA 1HRV1 1LEMA 1PO13 2A6XA 1U12A 2QDNA 2B46X 1RUNA 3P3PA 2WZR3 2BW8A 4XOGA 1FT9A 1LKNA 5C8CC 3SCFA 4LO4B 4YM2A 4XF1A 4JAAA 3MICA 3USUB 2Z79A 2YC0A 3WDWA 3VUOA 5TSWA 1EV13 4MGYE 3WLUA 1QXPA 5FFOC 4N43C 3VN4A 2JX9A 4X8NA 1VRH1 3IN9A 2A3WA 1IS5A 1CAXB 1LRHA 3TRSB 3D82A 1OOPB 4ZXKA 2UWBA 3AMNA 4GWNA 4NO4A 1D2SA 5D8AC 4IEZA 2DVBA 5CB7A 3KM5A 4S2GA 5FLIA 3WX5A 4K3UA 1IS4A 4XFIA 4GMP1 1CR7A 4DRRA 2PHDA 5A32B 2JICA 1C8M2 4PJYA 3I59A 4WVWA 3S30A 3VV1A 2CTVA 1ZZ6A 1WGPA 2R30A 3ZFEB 3HMYA 5JAXA 4HETA 1TQ5A 2PAMA 2CGPA 4IEWA 1LESA 1LJ7A 4GQ7A 2MEV3 4CEWB 1SEFA 1I6XA 2ZTNA 4XMAA 2AUYA 1O4ZA 5EYXA 1A78A 2JDZA 4LBNA 1FMD1 4LNVA 1JBCA 2B39A 3MPBA 4D94A 1VALA 2VNGA 3CF6E 2VW1A 4CP1A 1Y7BA 1R1A3 5A3LA 1NY71 2MPFA 2D6KA 4AVSA 3RQ0A 5EYYA 1OLQA 3WT3A 3OGJA 2XJPA 5JIUA 1IZ3A 1LGBA 1JYIA 4L11A 4QM9A 3VGIA 1HLCA 3ALQA 1CVNA 1H1IA 1NXD1 1QXRA 3NW4A 4MUVA 2NLRA 5FO9B 1C5HA 4YVWB 5T50A 1VBD3 1LHUA 2RS32 5J96B 5FPXA 4QPYA 5BNNC 1Q56A 1OMIA 3MIGA 4HMZA 1SBEA 1RVF2 3H0OA 1DLLA 1MQTA 1VBC2 1W6PB 3ZXKA 3PTYA 4A7YA 3AK0A 1U0AA 5AC93 3AFGA 3W58A 1CJDA 3ETQA 1ULDA 1FPN3 4EN0A 2ZGRA 3ZSKA 1PM7A 2UWAA 2VW0A 2QCSB 5I8SA 2D97A 4JGYC 5BNQA 1BBT1 5BNPA 2EIGA 3OY8A 1U5ZA 4P9XA 1FI2A 2Z2SB 1Q5OA 3BODA 5FTTC 2IZWA 2HEWF 4N7UA 5ACA3 4DS0A 4I0WB 2DVAA 3VZLA 4Q29A 3VKNA 3RMXA 2D3PA 2RM23 4FPLA 1WMFA 3A4UA 4E2GA 4QPGA 2RJKA 3NAPB 3VKMA 1A8MA 3ZSMA 5DDJ1 1FV2A 2R071 2H0BA 1N1YA 1HRI3 4AFMA 1ZVFA 1OSGA 3VBSC 2GMPA 2IXKA 2VXRA 5F1RA 2R32A 1IHMA 1S0FA 2KXLA 4LBQD 4Y1VA 3IWZA 4OFGA 3NKGA 1D4VB 1VBA3 2RS53 3U0ZA 1SCRA 3KT4A 5IT6A 1F8VA 4IEQA 4C0BA 2YHJA 3D0SA 2B45X 5FMOS 4XXAA 4EJRA 2ZZQA 1BXHA 1S0IA 2D43A 3MLLA 3PLQA 3E5XA 1N3QA 4HVQA 5L7OC 5IUQA 1V6JA 3L2YA 3PJYA 4XETA 2D40A 4LE3A 4FPFA 2CWSA 2ZX3A 3HWJA 3VBHC 3HAGA 2QUOA 4CDUC 2WFF3 1WCKA 1BK1A 4CEYB 2PA7A 4GIQA 1JYCA 5T55A 2OIIA 1H2LA 4OULA 3CNAA 1D0HA 3J4UH 2DCJA 3LZZA 2VVEA 4TSVA 4QGLA 4GB33 3FUOA 4AVCA 1W6OB 2WT1A 1A3KA 2RMU3 2DURA 3V0AA 1GZWA 1H0BA 4Q4V2 3S6PA 2DCTA 5JSPA 4LBLA 4N53C 2EXKA 4C1XA 2CY6A 5FRAA 4LBKA 4XFBA 2ZAAA 4FOYA 1AR61 2QDRA 3B3QE 2IWGB 3J9SA 4WM8A 1AR81 1QQP2 3BTAA 4DNYA 5ABJA 3R4SA 1ULGA 4AVVA 1LHWA 1Q8OA 2WZPP 5KHGA 2WNVB 4Q4W1 1ENQA 2HWD3 4XILA 2BWAA 4PDWB 5KHIA 1SLCA 4JDNA 3RYRA 4M0HA 1WW6A 1Z0HA 2PELA 3H8UA 1AYN2 2RHPA 5J48A 4ATFA 3CEWA 4EWEA 3ZVXA 5CFDB 4Q26A 2HWE2 2WINB 1KITA 1KJRA 1WCSA 1CONA 2D93A 2AH2A 3VKOA 3E97A 3NV4A 3TNQA 4YVSB 4ASLA 4MYEA 4I3PA 3V56A 2BFUL 4LO8A 4L2NA 3KMHA 1PNGA 1MS3A 1RUE3 3DV8A 1GLHA 4CZSA 5GKAC 3VHOA 2ZGOA 2WS92 3AFKA 1JTZX 1PZ8A 4R4XA 4CTEA 4AGVA 4PCRA 1DZQA 4AQ6A 2Q1MA 1RUC3 3LB9A 1X8MA 4RS5B 4MXWB 1LU1A 1QU0A 4RQPC 2GC1A 3AJYA 2IFRA 1PO11 1OOPC 2WZR1 2JG8C 3M3OA 4C90A 3SITA 3JZVA 3MYXA 1A6CA 1UCXA 4N7IA 5KXCA 3M3QA 1OKQA 4Q4Y3 2NMOA 3RMYA 2PHLA 4G3YC 1X36A 1UIJA 4TWTA 1ZZ7A 1RIRA 4XPVA 2JJ6A 1WCDJ 1S0EA 5DZGA 5JWPA 4EN9B 1HXS2 3SLIA 1WMDA 1F5FA 3AZYA 3ELNA 1ND2B 3LSEA 2VMGA 1G8WA 4KGGA 2XPJA 1O7FA 2LM3A 4XFFA 3I4IA 4UW4A 4OI4A 4E27A 1MS4A 1UZZA 1RUD3 2JECA 2LUWA 2A6ZA 1APNA 3OCPA 1S0CA 1BQPA 1CAVA 4LBMA 3R0RA 4L92A 1OLRA 3E6DA 1NCRB 1KRIA 2W39A 3AKQA 3ZFGB 4UXAA 1UU5A 4R9BA 1ZX5A 3ZN6A 3S7EA 4K1ZA 2ZGLA 4YW4A 1TEIA 4P9JA 3MF9A 2GNTA 3DPRC 4AI2A 3SCGA 4FO9A 4XXPA 1BMV2 4QPIA 2VNRA 2Z5WA 2FMYA 1QJX3 3MIBA 1WD4A 4AWDA 2BPA2 3KCXA 2MEV1 2HWC2 4Y1UA 4GKXA 1AVBA 3ATGA 4YVWC 2PN5A 2ZOEB 4IV1A 3IT8A 1CGPA 1QOTA 3VBOB 3FHIB 2UWCA 3OPZA 4IETA 4AE2A 3POWA 2BBVA 1PGL2 2ZMLA 2VULA 2G9FA 2YPJA 5CBLA 2W52A 5C6CA 1BEV3 1WW7A 4AK3A 2UYBA 3JBG2 4H55A 3HD8B 3ZN4A 1GYKA 1RUF2 2XKOA 1RUH2 4RD7A 2C5DA 4ZU7A 4META 4PF5A 1KDMA 4KWLA 3BOPA 2PLV2 3UKTA 4B7KA 2WQ4A 1MR5A 2V09A 4X6RB 1VBD1 3LAGA 3TB0A 3NKTA