1OF3A

Structural and thermodynamic dissection of specific mannan recognition by a carbohydrate-binding module, tmcbm27
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
176
structure length
176
Chain Sequence
MASNEARYVLAEEVDFSSPEEVKNWWNSGTWQAEFGSPDIEWNGEVGNGALQLNVKLPGKSDWEEVRVARKFERLSECEILEYDIYIPNVEGLKGRLRPYAVLNPGWVKIGLDMNNANVESAEIITFGGKEYRRFHVRIEFDRTAGVKELHIGVVGDHLRYDGPIFIDNVRLYKRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/carbohydrate binding
molecule keywords BETA-MANNOSIDASE
publication title Structural and Thermodynamic Dissection of Specific Mannan Recognition by a Carbohydrate Binding Module, Tmcbm27
pubmed doi rcsb
source organism Thermotoga maritima
total genus 36
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09212 CBM27 Carbohydrate binding module 27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1of3A00
1DP0A 1JZ8A 1XPWA 1J84A 3D3AA 3K4AA 2J1RA 4KI5M 4LPLA 2J1UA 2VZVA 4MGQA 4W50A 1YQ2A 1T2XA 3MUY1 3I2FA 1J83A 2LS6A 4BK5A 4RN5A 2VMDA 3W5NA 3THCA 3T08A 4DEQA 3MO4A 1I5PA 2Y6GA 2YFUA 3NJXA 3T0DA 3EYPA 1UX7A 3CKHA 3I3DA 1PX3A 3PUIA 2YG0A 4P5YA 2VMCA 2W95A 2BGPA 3ACHA 3WF3A 3I3BA 1UMHA 1GUIA 2RJ2A 1UWWA 2VJXA 2VR4A 4QDRA 1WCQA 1CZVA 5HPOA 2VZOA 3I2GA 2WO3A 1JZ3A 3OGRA 2WO2A 2VCCA 2QQLA 2W1SA 2EIDA 3K75B 4RYDA 5DN2A 5IYYA 1D7PM 3FL7A 2B4KA 3J7HA 2Y8KA 1SHWB 5A1AA 4E8CA 1NKGA 4QDQA 2W91A 1LNSA 3EB7A 2ZEZA 5DMYA 3A21A 3T2PA 3BGAA 2E26A 5C71A 3SKVA 5LA2A 3HNBM 4UOJA 4ARXA 5JXHA 2W47A 3WSOA 4P08A 4CVUA 3MBWA 2QQJA 4QB6A 2V5DA 3WEZA 3HJRA 3A7QA 4ARYA 1W9WA 3IB3A 3FHQA 1JZ5A 4YPJA 1UY3A 4OMDA 5EJZB 2W5FA 2LW8A 5LCWL 4ZZ5A 5LA1A 2XHNA 3C7OA 3LPFA 2XOMA 4ZXEA 1JHJA 3OEBA 4CUAA 2W3JA 4CU8A 2ZXQA 4JKKA 2YFZA 4A3ZA 1GMMA 3I2KA 3ACFA 3K4DA 5I0DA 1GOGA 2W1UA 2DCJA 4DUXA 1IQDC 3CDZB 4JKMA 4M4RA 2VZPA 3CMGA 4KWUA 4W4ZA 3WNLA 1JYWA 2ZEXA 2VQUA 5DPNA 2WQ8A 2J1AA 5IJRA 1L7QA 1UY4A 2E31A 2DDUA 5JR2A 4HG6B 3WNKA 2VQTA 1KGYA 4DXRA 1NUKA 4MO3M 5IFPA 2R7EB 4QX1A 3MUZ1 2WAAA 2L9LA 5JXIA 4FI9A 2J1TA 4A45A 2WN3A 3GM8A 5IFTA 2W94A 3MV11 1UY2A 4QB2A 3WQBA 5IHRA 1JI6A 4MADA 3FN9A 4L0PA 3NRUA 3HNYM 3T0AA 4ZZ8A 5C70A 3WF2A 1JU3A 5CZKA 4GZ9A 1OF3A 2J1VA 2E32A 5JXGA 2W87A 1L7RA 3T0BA 3U37A 1SG3A 3SEEA 3HEIA 4BK4A 2VCAA 1GOFA 4XUPA 1K42A 1W0NA 2JD9A 3LEKA 3VDBA 3C7EA 3C8XA 1K12A 4AG4A 2JDAA 3WNMA 1MPXA 2VTFA 3ABZA 3LE0A 1UY0A 4JX0A 2J7MA 1UXZA 4XURA 3VD5A 2VOTA 2ORZA 2HYXA 2B9VA 2W46A 1W8OA 2J1SA 4A44A 1GNYA 1K3IA 3WNPA 1P8JA 2KD7A 4XZUG 3UNPA 1OT5A 4QX3A 3VD4A 1GQPA 4BXSV 1EUUA 2E33A 4JHZA 1W99A 2JKXA 1UXXX 1XNTA 1UYYA 2C26A 3ECQA 4P00B 3HOBA 1PMHX 4DUVA 1W9SA 3GXUA 1DYOA 1PMJX 4CUCA 3T2QA 2Y64A 4BDVB 3VDAA 4DXTA 1RYYA 4PQQA 4PF1A 2Y6HA 1OF4A 4XUTA 2EIEA 4QDSA 2VZQA 1JYXA 2X10A 2Z4FA 4XUNA 3OGVA 1CIYA 2BERA 4CU9A 2EICA 4W8JA 3VD9A 2W9XA 2VCBA 3PUHA 3P1IA 5JUVA 2ZEWA 2BGOA 2VC9A 3CIHA 2WDBA 2W1QA 3OGSA 1JZ6A 2YC2A 1JZ4A 5F7UA 3SKJE 2ID4A 5CYYA 1NAEA 2VZTA 1O8PA 3E1F1 2CDOA 1H6YA 3OB8A 4ZY9A 3K46A 2VZ3A 2W1WA 2X05A 1XC6A 2QQKA 4AAXA 4DXSA 5G05L 2XONA 4QAWA 1BHGA 4E8DA 1OH4A 2WABA 3K77A 1OD3A 2ORXA 3P6BA 5JMOA 3WNNA 2X09A 4JKLA 4GWJA 3WF0A 3VD3A 5J1XA 2RV9A 3WNOA 4IUGA 4A6OA 4QX0A 4OUEA 3CQOA 2HLEA 1JYNA 3I2IA 2Y6KA 3IIIA 2VZRA 3A23A 1ULOA 1UZ0A 5B4NA 2ZEYA 4MOAA 3IAPA 3UESA 4D0QA 5B4XA 3ACIA 2WBKA 1H6XA 1JU4A 2QBXA 3CZJA 4OZOA 3THDA 3UETA 2EIBA 2Y6LA 2VMEA 2C9KA 3WF1A 1JZ7A 5FUIA 4A42A 3HN3A 2VM9A 1GU3A 2YB7A 5EJ1B 4DEVA 2CDPA 1W8NA 5G04L 3VD7A 1UY1A 3OBAA 3FHAA 4OMCA 4LKSA 3SEPA 4XUOA 1O59A 5HXMA 3AC0A 2VZUA 3DYMA 4CU7A 3LPGA 4QB1A 4PT6A 4LQRA 2WZ8A 4CUBA 1PX4A 4QX2A 3VDCA 2VL4A 4UI9L 4A41A 1NX9A 1CZSA 2BBAA 1CZTA 3GGLA 4QPWA 4LHSA 1GOHA 1UMIA 2QQOA 3BN6A 4TXWA 2WN2A 3CZUA 2V4VA 2OKXA 2VZSA 3F2ZA 2WAOA 4MGSA 2VMFA 3HNMA 5LA0A 2YC4A 3MV01 4XUQA 4KMQA 1CX1A 4P02B 1HN1A 3IAQA 3K4ZA 3I2JA 3LEGA 2J22A 4D8MA 4TTGA 2J1EA 2VO5A 1EUTA 4BJ0A 3HPNA 2JE8A 2WZEA 2V72A 2QQNA 4DUWA 1F4HA 2DCKA 3GDBA 3ETPA 1UYXA 2BZDA 4CU6A 3W5MA 1US3A 1JYVA 1TG7A 3DYOA 2WYSA 3C7FA 4OYUA 3DECA 3T09A 1F4AA 2VZ1A 4UAPA 3NNGA 2Y6JA 1KEXA 1WKYA 2PQSA 1R64A 1K45A 2QQMA 3A22A 5JXJA 3I3EA 1DLCA 5DQ0A 3I97A 3I2HA 3LEIA 3ACGA 4M4PA 3LQCA 3IDAA 3C7GA 3T2OA 2RVAA 2W92A 1US2A 2WO1A 2C4XA 3OG2A 1W9TA 1JZ2A 2WUHA 3C7HA 2XQXA 3JXSA 4A4AA 3NJVA 3OEAA 3NQHA 2QQIA 4XVHA 1ULPA 5EIYB 1XNAA 4GWIA 3WF4A 3ZM8A 1UYZA 4Z2AA 5C7GA 3DYPA 1TVGA 1O8SA 4ET7A 1SDDB
chains in the Genus database with same CATH superfamily
1SBFA 3PU8A 3QH6A 1DP0A 1JZ8A 1ZA7A 3LKJA 2GDFA 1I3HA 3D3AA 2J1RA 2ETEA 3IN9A 4LPLA 4RS5A 3R6SA 3THTA 2J1UA 2VZVA 4KNCA 2F17A 4AVCA 4CP0A 1ENXA 2Y0OA 1JW6A 4GWNA 4PJYA 1BMV2 2WL1A 3I2FA 1J59A 2JDUA 3E5UA 1H4HA 2LROA 2UYBA 4BCUA 2NPIA 4CEYC 4EN6B 5K0UA 1QXRA 3VZOA 1WLTA 2AEYA 2XMLA 3O0XA 2ENRA 4OQ9A 2VTXJ 4IV3A 2EXHA 4CDUB 5JI9A 4Y1VA 5DDJ1 3EYPA 3HIFA 3HVDA 1KD7A 1W8WA 2D6MA 2YG0A 4P5YA 4HN0A 5CKNA 1HB4A 2BGPA 2Q0AA 4YGDA 1O5LA 2VXRA 3WF3A 4Y22A 5FYTA 2BDRA 2XPJA 5E16A 4GB32 3L9JT 4U36A 5LRSA 4N43B 3LB9A 1CZVA 4WM7C 1WMFA 2W0XA 4FPEA 4F83A 3FC0A 4MXWB 1JZ3A 3VZLA 1MS8A 3OGRA 5C5TA 2WO2A 2D5HA 1MQTA 4B1MA 1HRI2 3K75B 4RQPC 1ZRRA 4ZHNA 3AP9A 2VBPA 5DN2A 3JD73 5LEJA 2B4KA 3RFRA 5FZ0A 2ZX2A 3ASIA 3AP5A 4HPKA 4KU8A 3WQ0A 4C8DA 2ARXA 3T30A 1N1SA 4XEZA 2CGPA 3NMBA 4OI4A 4H7LA 5H9PA 3BCWA 3EB7A 1UQXA 4CDXB 1ZRCA 4IXLA 4XFHA 1UPSA 5FLJA 4FTBA 5EXOA 2ZEZA 1WW7A 1NE6A 1PZ8A 3E5QA 3A0NA 3HAGA 5FPVA 4YM3A 3VUOA 1POQA 1QJY3 4EWAA 5TSWA 3T2PA 5BV6A 4WZCA 4CEWB 2PLV1 4XHXA 1CAUA 4BXFA 5FKBA 3AP4A 3H8XA 3MPBA 1OH3A 2W47A 1HQWA 2DFCA 1W6OA 3AKRA 1ZYBA 1U12A 4Q4W1 3KS7A 4XJ8A 4P9JA 3WSOA 4JVAA 3ZFEB 1AR73 3VBOB 5LASA 4QB6A 2V5DA 1LEDA 3GZEA 2PAMA 5A3UA 1UIKA 4XQ4A 5FZBA 1NLRA 3FBMA 3MEPA 5FYYA 5BNNC 1JZ5A 5KHIA 4YPJA 3VLBB 3ZFGB 4AFMA 4Z82A 3RG0A 2IXJA 4LLOA 2LW8A 1VB2A 3DKQA 4ZZ5A 1QGLA 1DDLA 4HOOA 3LPFA 4NWWA 2XOMA 3RSJA 4EN9B 4E27A 2CWSA 2RMU1 1AX1A 4L8QA 3EO6A 5F5AA 2DVAA 4AI8A 2XUEA 2YFZA 1UF2C 4LBQB 4A3ZA 2HWB3 4ZS3A 2VNVA 2D43A 3I2KA 5F2WA 4K3UA 4OULA 3V65A 3B9IA 1WMXA 2B42B 4RR3B 3ZYGA 4Q0QA 3BUCA 3ES4A 1DYKA 2VXJA 1O5UA 3CDZB 3K48A 4JKMA 1IPKA 1RUD1 4M4RA 4N7UA 2VZPA 1HW5A 1U5ZA 4LK7A 1Z78A 3H7YA 3JQXA 4P5HA 3LIHA 3OY8A 1YUDA 4PQ9A 2A70A 4Q4V1 2DFBA 2E7QA 2ZEXA 1G9CA 1HXS1 1ULDA 3RZZA 1Q3EA 4EN7B 1UY4A 3ZFFB 4GIQA 4IV1A 3KT1A 1AR91 4FOYA 3I8TA 3HBZA 2YBPA 1B35C 1XQNA 5D21A 5FTTC 1AYM2 4DXRA 5BNQA 4QU1A 5EJ3A 5A7NA 1ODNA 1UYPA 4HKOA 4M3CB 2ZAAA 1EAH3 3N7MA 4LHNA 5FIXA 1WMDA 5HI0A 4LIVA 1R083 1EYBA 1UZWA 5KBFA 1ZZCA 2ZAHA 1F5FA 5CAZA 2WNUC 4BHPA 4K8FA 1V6IA 4AVSA 2WAAA 3NV1A 3BTAA 5DUUA 4B4RA 2Z79A 2I45A 2G1MA 4DXZA 2H0BA 4UFHA 2WN3A 2YC0A 5JVVA 5IFTA 3MV11 1ZBA1 1C1LA 1UY2A 4CDQB 5FZCA 1VAKA 1H30A 2WQ4A 4MADA 2XJQA 1X82A 1H1MA 2X29A 3ZLIA 2UWCA 5C70A 2HJIA 1OKOA 1CAVA 1OF3A 1QJX1 3WNXA 4ES9A 4JTOA 3ZXDA 3H3UA 1ULFA 1W8ZA 1ZNPA 2E32A 3KV6A 4RFRB 4XIOA 4YW1A 1BK1A 1N47A 5JXGA 3H8OA 1L7RA 1N1VA 2ZGMA 3AMQA 3LWCA 3T0BA 4BK4A 4QX5A 1GOFA 4G3YC 4I09A 1W0NA 3IT8A 5FZ1A 4Y26A 4IGOA 3HN1A 4JGYA 3M2MA 4AG4A 1ZZ8A 3ST7A 3VD9A 4L99A 5D8AB 4ZKTB 2ZX4A 2PHTA 3AKQA 1TME3 3TN91 1O6UA 3URFA 1UY0A 3K3NA 2V5YA 3N36A 4RHV1 5FPAA 2J7MA 3V0BB 1OOPB 1FPN3 1UXZA 4HT1T 3SCGA 4QGMA 5FPXA 2ZCWA 4LA3A 4XURA 4K1ZA 1J3RA 2XJRA 4J25A 4V2VA 1PIV1 2XKOA 2VOTA 3BALA 3GBFA 3GYDA 3RYKA 4FPYA 4A44A 2YU2A 1GNYA 4XF3A 5FYHA 5T50A 2CWMA 1X9TA 4TLFA 1NT0A 4DO0A 5C9AB 3LSDA 1OT5A 3J8F2 4QX3A 4B3NA 3S5AA 4P9IA 2GC3A 4FXKB 5D2AA 1C28A 4R8HA 3AZZA 5FAXA 4WVZA 5KHKA 2IXIA 4P9YA 4EWDA 2P3JA 4UW5A 3ECQA 2K46A 1PVC2 4P00B 4FFFA 2ARBA 3O0WA 3OCPA 4O61A 1PMHX 3RZGA 5F3EA 1XRUA 1C8NA 3FX3A 1W9SA 3I3QA 4XQDA 4WM8C 4QKNA 4C91A 1ZRFA 4PIZA 2JB4A 1MEC2 4TYSA 4MHUA 1SPPB 2Y64A 4A7YA 3ZDSA 4BDVB 1DQ5A 3THPA 4LOSA 3POSA 3VZKA 1BJQA 1JYCA 1EPWA 4PF1A 3IIAA 3JB4C 1OF4A 1R1A3 1ENQA 1WD3A 4Q0UA 4YG0A 5FZLA 1VLNA 4N9HA 4AVAA 3DXTA 4DZGA 3A4UA 1HKDA 1R093 3OGVA 1CIYA 4L2NA 4RA0A 2R061 2BJSA 1Y9GA 5BNPB 1AUYA 2ZPXA 1TZOA 1ZZ7A 3BOWA 1RL3A 1QOOA 1ULGA 3P1IA 3ZMOA 2BGOA 2BV4A 2VC9A 1V9U3 2WDBA 4IEZA 4IE0A 1LOEA 1J1LA 1OA2A 1YIPA 1HRV2 1JZ6A 4NWVA 2YC2A 1NLQA 5FZMA 3LOBA 5FZ9A 4LBQD 4XCAA 3VZMA 1RUOA 3IWZA 4L92A 2VECA 1GP5A 4Q0PA 2JDHA 1LAJA 2OW4A 4Q26A 4LITA 1BKZA 5JAXA 1O4TA 3R4DB 1XYPA 5I0SA 1H2LA 2VZTA 1PO11 4QQOA 2CGOA 2WZR1 2BOJA 1O8PA 1RHI1 4KWLA 4NUBA 2SBAA 5IVYA 4NHXA 1C8M1 2CDOA 1H6YA 2VE1A 3LAGA 1OLQA 3LSEA 4EWEA 1HV0A 4P9LA 4R9BA 1LU2A 2HEWF 1DCSA 3K46A 4XDPA 3UJOA 4QPYA 3ACLA 5APAA 3RYPA 3ZXLA 3O1SA 3VBRC 2YDEA 4LLFA 4O9GA 3LFMA 3X29B 1S0DA 2AGSA 2UWAA 2GH2A 3VKNA 3U14A 5CFCB 3FUOA 4TSVA 2C6SA 1Q43A 4W6WA 4B29A 2JDZA 2ORXA 2X09A 4UF0A 2YYOA 2JDNA 2B7YA 3MW4A 3VBFB 2R16A 1QJU2 1WBLA 1WCUA 3ZIWA 3KT7A 2PHDA 5FCCA 3VBHB 1PK6C 2XDVA 3P3PA 1JTZX 2BVBA 1SLCA 2VW0A 1O3QA 3B02A 5CFDC 1VE0A 2HKXA 2GAUA 2HWC1 4X6QB 4QX0A 4A6OA 1LB2A 1KRIA 5AFBA 4A6SA 5FP3A 2NLRA 4OUEA 3USUB 3ZYBA 2RJLA 4LTAA 1ENSA 4UW6A 5CKQA 5DAWA 5KWRA 2FDGA 4HN1A 1ZM1A 2JE7A 3WINE 2GP3A 5C4WC 1XOYA 5KC5A 5J36A 1T6BX 1MS4A 3SC7X 3HQXA 4L97A 2HWD1 1CQ9A 3LEMA 4UFLA 1AL23 2SLIA 3LZZA 2PTMA 3POJA 4S2HA 5A7WB 1RIRA 2Q8DA 4D0QA 5AC92 5IVFA 4CXWA 2DV9A 3SH5A 2ZMLA 1QNWA 3ZYIB 2FHRA 1D4M2 5I8YA 1H6XA 2QBXA 5EPAA 4MVTA 5C8CB 2Y6LA 4KBZA 2Q8OA 3PUAA 1ULCA 4PDWB 4MH0E 4LO8A 1YHFA 3NAPC 5EP9A 3WQ1A 1AL0G 2VG9A 4Z2WA 3FE5A 4JGZC 2JD4A 3WP3A 5A33A 2VGDA 1SDWA 1GU3A 2YB7A 5H9RA 4DEVA 1IS6A 2E51A 3AXEA 4BQWA 2VUAA 3HQUA 3IM0A 1UY1A 4FBFA 2ZGSA 3AZVA 4IEQA 3FHAA 4OMCA 3ZN6A 1NA1A 1S0GA 4XUOA 2NZ9A 1ND3C 1HIXA 4FP3A 1F15A 1O7FA 5BNOC 3WDUA 3H1WA 1UOJA 2JG8A 4IEUA 4OI2A 3PJYA 4PT6A 4LQRA 1LJ7A 1V6NA 2FQPA 3WDTA 4K9SA 1W6NA 4QX2A 4YVSC 3VDCA 4C1WA 2QDNA 4LEJA 4LXLA 4UI9L 4D69A 4E2SA 4EV0A 4AGRA 4AXOA 2P6CA 1COV2 1DZQA 4IGQA 2ZACA 3WR0A 4RD7A 3LOIA 3S7EA 5ISLA 4QPWA 4D6RA 4QHBA 3VHPA 3HQRA 2VQAA 5F3CA 3JD71 1UMIA 2OA2A 1RTVA 3QH7A 5IT6A 3WHTA 1A3KA 3OGGA 2KM2A 4TXWA 5FKCA 2WN2A 5HCBA 2PHUA 1PO23 1NCRB 4DRRA 1K5MC 2O1QA 3EMRA 4XJAA 3MYXA 2ZJCA 5IK7A 3HMYA 3AMPA 4AEDC 4NIIA 1DZTA 1RMU3 4Z1VA 2PLV2 4IEWA 4ITCA 2YC4A 1QJY1 2DCYA 4XZPA 2ZX3A 1T6GC 3CU7A 3BKZA 1VBC3 2ES3A 1YI9A 4UFIA 4CPBA 2GC2A 2XB6C 3WG3A 3IAQA 4R9CA 5EV7A 4XQWA 1VBE3 1HLCA 2PQQA 2B45X 4NMIA 4PLMA 4LR4A 2HBUA 2J22A 1QJEA 2DUPA 1AR71 4NPMA 5IVCA 1EUTA 1Q56A 2DU1A 2ZGOA 1Z7S3 4BJ0A 3PVNA 2WNVA 3B7MA 1QNYA 1UKRA 3QLQA 3ZO0B 2RS53 2DCKA 4EZHA 2FCVA 3PLQA 1JN2P 4Q8LA 4R52A 3W5MA 2R30A 3DXUA 4A3XA 2RMU2 5L73A 5HV4A 5LZ6A 3C7FA 4OYUA 4HVRA 1H8TB 1UU6A 3PHMA 3D82A 4LKEA 3ZSKA 2VPVA 1RGSA 1NZCA 2FDJA 2JWPA 1RUC3 3LF7A 3FJSA 4YW2A 3N9NA 2HWB1 1LGNA 1H0BA 2UWBA 4IETA 4YGBA 4UBHA 3RYRA 5I0UA 5JXJA 1GP6A 1IGOA 1PGW2 1RUJ3 2WFPA 3I3EA 3AKPA 1VBA3 4SBVA 1VRH3 5KXCA 3TWIA 5DQ0A 3IKWA 4QQPA 4AEMA 3I2HA 3BPZA 3MLKA 3ZPOA 1IPJA 2RS32 4Y33A 3WZ1A 4DY3A 1HX6A 1RUI3 5I8TA 1UIJA 5FXZA 3RVHA 3ZX7A 2BU9A 3C7GA 1LRHA 2WO1A 4K40A 1XU1A 3J26N 3B69A 2R0FA 2ZMNA 3KV4A 2JICA 4EROA 4BMEA 3C7HA 2PN5A 1QKQA 2DURA 2IFWA 2RM23 3PVBB 3V0AB 1EAH1 3OEAA 3M3IA 5FYMA 1R081 4B1LA 2Q1ZB 4CPBD 4AFCA 3FUQA 4XVHA 4WM7A 5KXBA 1BYHA 4I0BA 3H42B 1ZBA2 1XNAA 2Q5TA 5JPNB 2BNMA 3WF4A 4IL7A 2BUKA 2IC1A 4NPLA 1OQEA 3ZM8A 4Z2AA 2C9AA 2O14A 4FOWA 4RQPA 4XTPA 1O8SA 3R0RA 4AAPA 1F2NA 5JCTA 1AR83 2P4EA 5AVAA 4AI3A 4YZ1A 2G9ZA 2O8OA 3W21A 4XF0A 2D97A 1QIQA 2JG9B 2XVGA 4KI5M 4WVMB 4YM0A 2PHWA 5FJHA 1QJX2 3BTXA 3LIGA 3IMNA 4MGQA 3CF6E 2D93A 5FZDA 3VBSB 1YLLA 4GH4C 4IEOA 1CONA 4XDQA 1S0FA 2QQWA 3U4XA 2WNEA 4XACA 4ZU4A 3KVBA 5FYIA 1WCSA 2Y38A 1GZCA 2B39A 3THCA 3T08A 1WD4A 1JUHA 4YLZA 3ON7A 1TQ5A 3NJXA 4P9XA 4XF9A 4QKBA 1W6QA 1QDCA 2FDFA 1EV12 3MFCA 4WVWA 1YJKA 3O0VA 3RNSA 3PUIA 2Z2SB 2VMCA 2W95A 1LTEA 4ATEA 1GUIA 1ND2B 5IATA 2RJ2A 5JIUA 3UGHA 1AZDA 1UWWA 1RXGA 2VJXA 5FPZA 1NE4A 4NN0A 4YVWB 3CJIC 4QDRA 5HCFA 3ZIXA 1WCQA 1TE1B 2P1BA 1PIV2 5HPOA 4CDWC 1W0OA 5BNNA 2ZGUA 2WO3A 1SLTA 4QXKA 4K8RB 1RUH3 4L11A 5EFUA 3CBNA 3N4MA 4A2UA 2W1SA 2D6NA 4EE2A 1YJLA 2CGNA 1AXYA 2VH9A 2JKBA 4D7TA 1DF0A 4LBMA 1MS5A 1BK0A 1PHMA 1TMF2 1W6PA 2HBTA 3O14A 4JV4A 3WDVA 3O1UA 1AXKA 4IW3A 4YWAA 2JDMA 5C3PA 2GMMA 4O9EA 4BE3A 2WRAA 3R4SA 3VBUA 3H3ZA 5HCHA 4XILA 2Q8CA 5SV8A 1S0CA 3BYWA 2ET1A 5ABJC 1JOBA 2JDPA 2XH6A 2JX9A 1A34A 3RMYA 3VZJA 1VBB2 3BB6A 3BI3A 3H1MA 1NCQA 1F8VA 4LKDA 3H8UA 2E26A 5C71A 2AH2A 2GC1A 3MFAA 4RS5B 4CA9A 2WZPP 1OHFA 5C3QA 1V6MA 5JXHA 2OVUA 1C3HA 2B5HA 3MIGA 4BA6A 4AQ6A 3SHRA 5BNPC 2WFF2 2XJUA 1R1A1 2R062 5K0UB 4P08A 1B35A 4FPKA 3TRSB 2QQJA 2RR13 2BOIA 2F6BA 1WW6A 1ZREA 1RVF1 1OVPA 4HSJA 5JIAA 1R091 4IV3B 4ARYA 1W9WA 4WVMA 3VL8A 2P37A 2VOKA 1NXD1 2F4LA 4KGGA 3PUSA 2VAUA 3R4UA 4OMDA 3ORJA 5EJZB 2WNUA 4ONUA 3F95A 1V9U1 4LHLA 5HV0A 2IXLA 4Y22B 2VVFA 3IDCB 5FZ6A 1ZBE3 4META 1OMIA 2XJVA 2EF6A 1JHJA 4CUAA 1PO12 3CNAA 2WZR2 2ZXQA 1W04A 1XE8A 4UW3A 1HB2A 1C8M2 5J48A 4PCRA 2JJ6A 1OC1A 4MXVA 5I0DA 1UX6A 2PHLA 1MQTB 4XJUA 2DCJA 4R4ZA 1SFYA 1RUE3 3ZPYA 2XR4A 3CMGA 3ZYRA 2GN7A 4MGZE 4W4ZA 4XTMA 3NJYA 3T4VA 3VD5A 1SCRA 3K2OA 3WNLA 1AXZA 4XCBA 1JYWA 4HPKB 4CP1A 2VQUA 1SBEA 4XC9A 4BQ3A 1LULA 3V64A 4LK6A 5FO9B 5IJRA 4M01A 2PYTA 1L7QA 3MICA 2E31A 2VOWA 4ZONA 5FZ4A 4NIGA 3WVJA 2DDUA 4NRQA 2FDIA 2LRPA 3U07A 4LNVA 1QDOA 1BBT3 4HG6B 4Q4X3 5F5IA 5IW0A 3WNKA 5L19A 2VQTA 3MLJA 1NUKA 2HWC2 4XF4A 3GJAA 5CNAA 2WS93 1QXPA 5IFPA 1CAUB 4XJWA 4I0WB 1KXGA 1W8UA 4FP2A 2ZX1A 4O7XA 4OCTA 4OI1A 1W6OB 3MUZ1 2ZGLA 5K8SA 2L9LA 3UGFA 2WNOA 2Y34A 4FPHA 1WBFA 4MHRA 4FI9A 4QWNA 3SISA 5FZEA 5ACA2 2MEV3 1E57A 1REFA 4M3CF 2W94A 1F31A 5FZOA 2H6CA 3W58A 5FZ7A 5A80A 3OSDA 3WQBA 2VBDA 1AL21 1WWYA 3ZXGA 1Y43B 1DLLA 3VDDA 3ILFA 3FFQA 1JOJA 2ADEA 1CJPA 3AM2A 1Y3TA 3S0MA 2CL2A 4Q8KA 1VP6A 2QE3A 3U4SA 3KT4A 1JU3A 3AYCA 1NYWA 3MI8A 5EYXA 4GZ9A 3APBA 2CAVA 3E97A 5KHHA 2Q30A 4OHWA 1V6OA 5J37A 1O91A 2DVGA 1FXZA 4JDMA 3SCFA 4YGCA 4YW5A 5LEKA 4XUPA 1X50A 4WM8A 5E1RA 5BY5A 2WKKA 4NAOA 3RWNA 5JOWA 1K42A 3LEKA 2CU5A 3VBUC 1LENA 1MS3A 3JQWA 3D0SA 1LU1A 3C8XA 3OY8B 3AMMA 3M4FA 3RS6A 4E4DX 1C5HA 1WW4A 4AI1A 4QQHA 3TAYA 1X8MA 2R043 4E4ZA 1TNRA 2ZX0A 3ABZA 1GYKA 3G6JB 3LE0A 4JX0A 3S7IA 5FYZA 4IV1B 2R071 2Y0IA 2E7AA 3N3HA 5F5CA 4JZRA 1DGRA 1VIWB 2A6VA 4ASKA 1ZZ9A 2YGLA 4GB33 3JD72 1MZ5A 1AVBA 2GNBA 2OT7A 1LHOA 1P8JA 1UZVA 1UAIA 1U5XA 1V0AA 2ZHLA 1DQ4A 1IG3A 1LOAA 4HKWA 3NNJA 2V4AA 1EUUA 4HK8A 5A3OA 1HRI3 4CCOA 1O3RA 2JKXA 1PO21 4FPJA 2XHKA 5A7PA 1LR5A 5JSPA 1ENRA 1UXXX 3FLTA 1J1TA 1UYYA 1QJY2 1AJOA 5FZKA 3AXDA 4UFMA 1RMU1 1D2SA 3HOBA 4DUVA 3GBWA 1DYOA 2JIGA 2RHPA 2P34A 2YGMA 2NM1A 3ELNA 1VBC1 1CAVB 3IBMA 1W2TA 2Y6HA 3FMGA 1SACA 4ISRA 2E63A 3POEA 3JUUA 4QDSA 1V00A 1LOBA 4DFSA 3ALQA 4COWA 1VBE1 1W28A 3OBZA 4QPIC 1UCXA 1N3OA 2X10A 3M8LA 5FYCA 4CU9A 1M06G 2EALA 1XYNA 1PK6A 4INDA 3PIGA 4W8JA 3PTYA 2YY1A 1Z7S1 2W9XA 4U2AA 5FZIA 2VCBA 5FZFA 2VUCA 3PUHA 1FI2A 4JGYB 2RS51 2RG4A 2UYAA 4DPNA 1BEV2 3GCWA 3B3QE 4GJZA 5A32A 1YFUA 4CRQA 5K4LA 4V1PA 2XWBB 3ME2A 5BPXA 5C4WA 1MR5A 4I3PA 4BISA 1NAEA 2KA3A 2HWB2 3I7DA 4LO6B 2GC0A 1ST8A 3ZKUA 2NN8A 2ZHKA 1AR61 1RUC1 3OOXA 3PJQA 4NJ4A 3E1F1 1OQ1A 4LA2A 2JB8A 4UBGA 2GU9A 4GXLA 3OB8A 3GNEA 1RUJ1 1TNFA 1WLCA 1DQ1A 1UU5A 1VBA1 1VRH1 3LA7A 1STMA 3WG4A 4YSFA 1YRZA 3K51A 4AAXA 5JZGC 3LDKA 3NAPA 4H3WA 5IK5A 1GFF2 4LBOA 3N9LA 4JGZA 1WA6X 4E8DA 1OH4A 1RUI1 3K77A 4OFGA 1ZZ6A 1H9WA 4YFWA 4YM2A 4EN0A 3NO8A 4OUMA 3OPWA 4B8EA 3OBRA 1XYOA 4AFAA 4GWJA 3WF0A 4I02A 4FOVA 2DU0A 3NV2A 4XJ9A 3VD3A 1AYN2 2VQ0A 3KGLA 3WG2A 4XETA 1R082 2HWE1 3J7NA 5FO7B 1W90A 5F6LB 1OLME 4IUGA 5EZWA 2RM21 2XBO2 4FQ4A 1ND3A 2GMEA 3U10A 5BNOA 2RDSA 2OQ7A 1UNBA 4XFCA 4Y5SA 3CQOA 3R05A 1AYM3 2HLEA 4XFAA 1JYNA 1NXMA 1UOGA 2PMWB 4FPGA 4I0AA 1QXJA 1KS5A 3I2IA 3MIHA 3VZNA 3ZKYA 5CBLA 1LOFC 2AR6A 1GNHA 4YVSA 1NLSA 2VZRA 3A23A 1LKNA 4QXBA 3GHMA 1UZ0A 5B4NA 2BFUS 2ZEYA 4MOAA 2BBVA 4K1YA 3IAPA 1C4RA 3UESA 1AR81 4AE2A 1IPSA 2BWAA 1OPMA 3ACIA 1WLDA 3QCWA 4HBNA 5A7SA 5A7OA 5FOJB 1W0PA 4JAAA 2GP5A 2HWF3 1K5MA 3UETA 1FYUA 2FZ2A 3VGIA 1WW5A 3DN7A 4KH9A 1VMFA 1W03A 1APNA 3EBRA 5B2GB 2IFRA 4QPGC 1J3PA 1QWRA 4R4XA 4OQ8A 3VKMA 4FPCA 2XL7A 2NMNA 3SH4A 5L9VA 3ZSMA 4CXXA 1FMD2 2VM9A 3CEWA 1N3PA 4IEYA 4J1XA 1S4CA 1KDKA 2NMOA 2ZGQA 1W8NA 3TB0A 3VD7A 4AVVA 3VKOA 3K3OA 3OBAA 2QVSB 1GQHA 1TME2 3E5XA 3HBKA 3SEPA 1EPZA 5HXMA 3E6CC 4CU7A 2CY6A 5A1FA 5J3UA 1XJAA 4CYDA 1VJ2A 1FPN2 3LPGA 4QB1A 2PA7A 1E5RA 1KITA 5CU1A 5FBZA 5FY5A 4UF0B 3WW1A 1XXNA 2RDRA 4DMIA 5GLVA 2WJSA 1PX4A 3FLRA 5F37A 2Z69A 1IHMA 4OHXA 1OSGA 1WZXA 4MLOA 1IOAA 4J1WA 4A41A 1RUH1 2X5IC 1LHUA 5KR7A 3ILRA 3GGLA 1V6KA 4LHSA 4YGEA 1POV0 4KWJA 4EN8B 2QQOA 1QF3A 4WV8A 1H4GA 4YFZA 2MHFA 2BVVA 2VW2A 3N7KA 5FUPA 5FYUA 5FK7A 4AW7A 3JCIA 1ULEA 1CIWA 2OKXA 1UU4A 2C24A 2MNGA 5SV5A 3OTFA 2R6QA 3QOPA 3ZYHA 2VMFA 3CHXA 2VW1A 4YZ4A 4ORFA 1EY2A 4RS5C 4BIFA 3J8F3 5FXWA 4LO4B 2VY0A 4AHZA 4ATFA 4WVVA 2ZZJA 5LY2A 3VV1A 5JDBA 1WLWA 5F8PA 1ASJ1 2Y60A 3RI8A 1RVF3 4P02B 1YFXA 1OA4A 1HN1A 4IV3C 3H1YA 2Q4SA 1DQ6A 4Q0VA 1DZRA 1W2OA 5JMCA 1VR3A 3KCXA 4F3JA 2LM3A 4TTGA 3AVRA 2RR11 4LBNA 1VBD3 1FNZA 5A33B 3AKSA 3UKVA 3PDQA 3VKLA 3O1PA 5C8WA 2QJVA 2CYFA 2QQNA 2DTYA 1F4HA 3ZR5A 1U0AA 1V9U2 2HH9A 3DPRC 2BZDA 4CU6A 2BGCA 4XOGA 1TG7A 4MGIE 1NA1B 5FYBA 3ZN6B 2WYSA 4O65A 2K2SA 4XXAA 1ZBE1 2JG8B 5JWPA 1E5SA 1U5IA 2Y6JA 4XIKA 2ATFA 2UU8A 1W6NB 1HRV3 3C3VA 2HEVF 1RJ8A 3MIFA 4FPLA 2DVBA 1WKYA 2PQSA 1R64A 5I0TA 1K45A 3A22A 1BVP1 3T3YA 3KHCA 5LY1A 1OBNA 4Q2FA 1RUE1 2XWJB 4N53C 2VCMA 3AVSA 5EYYA 3UT0A 3B01A 1OFSA 1HB1A 3LEIA 2PHXA 5F2SA 1PGL1 3ILNA 3B5LB 2IUWA 4BQ1A 5L7OB 3V56A 4GWMA 1D2QA 2TNFA 3MIBA 3FZ3A 1MS0A 2C4XA 3NVCA 1W9TA 1BCXA 2WC2A 5FZ8A 3JBG2 2ILMA 1BBT1 3UKTA 4Q4X1 2A3XA 2YUEA 3H9AA 2FZ1A 3JXSA 3LDBA 3O7OA 1S2BA 4XFFA 2A71A 5FQ0A 2DYCA 2WS91 4RFT0 2DF7A 1RUG2 1VALA 4N7IA 2OS2A 2X53S 5C5UA 3CJIA 4NRMA 1KJRA 1O3SA 4CDWA 3KHBA 1F5JA 4FOQA 1AL22 1UYZA 2MEV1 2VNOA 1JBCA 3DYPA 1W8HA 2WNVB 3L2HA 4HETA 1SDDB 5FY1A 5F3IA 1OA3A 1G6NA 2P5BA 3KCCA 3NNMA 5BYNA 3MW2A 3U1XA 2O0OA 3WDXA 4CDUC 2UURA 1XPWA 5DAXA 3EHKA 1J84A 1RUF3 1JYIA 4HXCA 1GZ9A 4W50A 3U78A 1S0JA 1YQ2A 2QCSB 5DDJ2 3MUY1 4Q1PA 5I8SA 3KM5A 5AC93 1SFPA 3P5BA 1LECA 1J83A 3WDWA 2GH8A 4BK5A 3FFZA 5ABJA 4CUGA 4BMBA 1D4M3 4RN5A 5JOYA 3BU7A 5T5PA 4IE4A 4N43C 1YI7A 4HL0A 4BYYA 3MO4A 1I5PA 2YFUA 4GKYA 1YXWA 3PUQA 5I91A 4NROA 3O1OA 3T0DA 2A3YA 1BMV1 1VMJA 2DUQA 4YRDA 5LBEA 3I3DA 3NKTA 1PX3A 2R073 2HEYF 4LORA 4NHYA 3HD8B 4IV1C 3W9AA 5GZEA 2DVFA 3ACHA 2ZKNA 4CEYB 3H3LA 1KS4A 3GBGA 1SLBA 1JODA 2R041 1OXCA 2K0GA 2TBVA 1PGSA 2VR4A 3DKWA 4Y20A 2CNAA 3J7MA 1XSRA 2R1DA 1SLAA 2OZJA 3I2GA 5FUNA 1UW8A 1AX2A 4AGVA 3MW3A 4ZXKA 4CDXC 4UFJA 4CCJA 2EIDA 3AFKA 5JOZA 4GB31 5FDBA 3KZ4C 1IS5A 1WCDJ 4FPOB 5L7OA 3FL7A 1D0HA 2QKDA 2R49A 2GZWA 2Y8KA 3ZOIA 4CEWC 3ZXJA 4F8AA 2BW8A 3QD6A 4WM7B 5E89A 1SHWB 2JEMA 4NR1A 1H1IA 1COV3 4XBLA 1HRI1 5T54A 2W08A 4YARA 5GJ6A 1N1TA 4N8MA 3AZYA 4PI2A 1Q8OA 4GMP0 3VB9A 2ZGTA 5FP4A 1RXFA 4RQPB 5GZDA 2WO7A 3SMHA 3ZFEC 1LGCA 3VBOC 4Q4W2 1I1EA 5DMYA 2EXKA 4GJYA 5E8AA 3M1HA 3BGAA 3ZDVA 5LBFA 1N3QA 4QXCA 5LA2A 2ZHNA 4UOJA 3IZOA 4IEVA 5LK5A 4GMP1 1Q8VA 3ZFGC 1OFNA 4R9DA 2C5DA 2LTNA 4TLGA 1VBE2 4ASMB 1CJDA 2OPKA 2J42A 2GMPA 1Q8PA 3WW2A 2C0ZA 3JU9A 1V70A 3KCYA 1KDMA 1Z7S2 4DY5A 3IMMA 3HJRA 1JUIA 3BIWE 3UL2A 4LT5A 3TEZA 3I2OA 4LKFA 3I59B 4KL1A 1R1ZA 3FHQA 3RI9A 1W6QB 1OPOA 4CCLA 4RR3C 5K9YA 3I3MA 4FAGA 3SH3A 1REDA 1VAVA 3KLSA 5H9SA 4HMZA 2XHNA 1AR63 4ZXEA 3RZKA 1OLMA 1XSQA 2JDYA 3WUCA 1RUD2 3Q8BA 4MZUA 3AP6A 5FPBA 1V6JA 4JKKA 4KU7A 4BB3A 3POGA 4Y1ZA 5BNNB 3POYA 1GMMA 1LCLA 4Q4V2 2GNDA 1W2AX 1HXS2 3K4DA 2I74A 3ZFFC 2WA3A 3NV4A 2QTWB 1QJZA 2W1UA 1VBA2 4CEYA 1VRH2 2NQYA 1AR92 2XGXA 2N7GA 1LODA 4XFIA 3IPVA 1W6PB 2UY8A 2YHJA 4PLOA 3AZXA 3PURA 3UGGA 2WWSA 4XXPA 3J9SA 5DPNA 3WG1A 2D5FA 4I30A 3VBUB 2J1AA 1O4YA 4PIXA 5A7QA 3POIA 2HWE3 4CE8A 1Y9MA 1BZWA 4XPVA 1DG6A 5IWFA 2QDRA 4AOCA 1XE7A 1G9DA 5ANQA 5JSOA 1N1YA 1SBDA 3IDEA 2E6VA 3J7LA 3LGRA 3GJBA 3ZSJA 1KFUL 3DV8A 4JRLA 1KGYA 3U0ZA 1NCQB 2DWRA 2RS33 4HSLA 4Y5TA 4COZA 4CP9B 2BNOA 3N9PA 3W20A 2LALA 4MO3M 4DS0A 1RC6A 1YIFA 2R7EB 2YV8A 3ES1A 4CDQC 4NPRA 3E6DA 5CG9A 3J4UH 3AP7A 4QX7A 4GAZA 2G4IA 4D3WA 4AQSA 3OYWA 3RZLA 1L7LA 1NY71 1AYM1 2WSVA 4M0NA 1ZRDA 5JXIA 5IK8A 1B35B 1AF9A 1IG0A 2AREA 2WT0A 2J1TA 3HT2A 1OVSA 4QGLA 3AJYA 1GP4A 4CZSA 1AR82 3DF0A 3FHIB 3VN4A 4PBOA 1XNBA 1HB3A 2EIGA 3FN9A 3Q8AA 4L0PA 5C3RA 3NRUA 2H0VA 4YZ5A 2WNUB 2VU9A 5ERLA 4ZZ8A 1G7YA 1OKQA 2BEOA 1JYTA 3M3QA 3WF2A 2ZABA 2HWF1 5CZKA 2J1VA 2OYZA 5D8AC 2ZBJA 3I59A 3RZJA 5IAVA 4KBBA 2W87A 2PXJA 3LA2A 4K21A 4AYUA 3WX5A 1SG3A 4CP2A 3HEIA 5T5JA 2EXIA 3TN92 2D6OX 1OOPC 2TEPA 1LOCA 4RHV2 3VDBA 3NV3A 3C7EA 4C0BA 2FDKA 3BPSA 1UZYA 1DGLA 3AK0A 2JDAA 1RB8G 2IXHA 4MUVA 3ENRA 1MPXA 2AYHA 2VTFA 4K6BA 4E2QA 2WWUA 4QPIA 4UXAA 2RS13 5C9AC 1YYNA 1EV13 3MF6A 1PZ7A 3SQOA 4I3GA 2DVDA 5GALA 4KQ7A 2B9VA 4PBPA 4QT6A 4ZU5A 2J1SA 1FV2A 3FLPA 4N9IA 3NL1A 1WCKA 4BLJA 2BPA2 1K3IA 3WNPA 1GQGA 2B8MA 4Z07A 2KD7A 1GSLA 1POV3 4NOTA 4L9BA 3VD4A 3OGJA 4IDZA 2E33A 1JOPA 4ES8A 5GZFA 5GLTA 4CP9A 2D6LX 1ZZBA 3WP4A 1J58A 4XF1A 4XMAA 1XNTA 2OUHA 1TMF3 2C26A 2XQRA 3CO2A 1ASJ3 4CXYA 1UOFA 5FZOB 2BNNA 4CCNA 4LJHA 1QQP3 3J8F1 3D6EA 2YBKA 3VDDB 2ARCA 1PM4A 3GXUA 1LHVA 3RZMA 2AUYA 3D4KA 5JZGA 1FOD3 3WT3A 1JS9A 2JENA 3UYJA 3VDAA 5JPMB 1RYYA 4PQQA 1VBB3 5FYVA 2AACA 1LGBA 4OHZA 3D5OA 4QMAA 4XUTA 2O8QA 3UJQA 2XL9A 3QACA 3AMHA 1JYXA 3WY6A 1RINA 1F35A 1X33A 2Z4FA 4XUNA 2B46X 2XUMA 4EJRA 1MEC1 2JDKA 3INAA 1UD1A 4UFKA 4BM8A 1KJLA 4WM8B 1ZX5A 1VBD1 4TZDA 3WCRA 3HWJA 4IQPA 2YPDA 5JUVA 2OQ6A 2JG8C 5JR7B 1OQDA 4D6QA 4HLTA 1RHI2 2W1QA 3DUIA 5CIRA 3GF6A 1H2MA 2VBBA 1W05A 4B7KA 2QQUA 1JZ4A 1EP0A 1LOFA 3SCHA 2AENA 1Y9QA 1YO8A 3B9CA 4Q27A 4YM1A 4LBJA 3OPZA 5CFCC 4M3CE 1HRV1 2FCUA 1G9AA 4B7EA 4XFBA 1RJ7A 3VBFC 4ZY9A 1NQJA 1W2UA 1PGL2 2VZ3A 4KGQA 1D0GA 3VBHC 3WD5A 5CA6A 4IEXA 3BOPA 3G7DA 4DQAA 2XLFA 4QPGA 4UT5A 4BU2A 4BPZA 3ETQA 3ZN5A 3NW4A 2IVJA 3AMNA 5FO8B 3AKTA 1OUXA 1OD3A 4IE5A 5D1IA 3WNNA 1BXHA 3H50A 5DZGA 2XG3A 2G9FA 3D8CA 4MYEA 4XAAA 1YQ8A 3S6PA 2RV9A 3WNOA 3VBRB 1GZWA 3KMHA 2HWD2 3JZVA 4CCDA 5FYSA 2VTXA 5T52A 2IVIB 5K7PA 3FWEA 5J96B 3TEYA 1NZIA 5C8CC 4QD2A 2Y6KA 2YZ4A 3T1LA 2NYYA 4BQYA 4PDWC 2XVKA 2ZGKA 1ULOA 2X5IA 3ZXEA 1PK6B 1DBNA 1UO9A 1C5IA 2OIIA 4Q4Y3 3OBTA 4GA9A 5CFDB 4M00A 1UOBA 1VRBA 4CCMA 5B4XA 5ACA3 2ZGRA 4G4FA 2WBKA 4AI9A 3AFGA 5CB7A 1RUF1 2FDHA 5A32B 1S2EA 2A1XA 3THDA 2EIBA 4V2WA 5I0RA 3BTZA 5DABA 5C4WB 4NRPA 3AL6A 2A3WA 3RPQA 2AEZA 1W9YA 5AC91 1XB9A 3SNMA 4JCKA 2I2SA 3KGZA 1D4M1 4JRAA 4XJZA 1YQCA 4A42A 4UWDA 4CCCA 5J7MA 5LK7B 1QOSA 2YPJA 3B93A 1S2KA 4MSVA 1RUNA 2QQVA 1CAXB 5EJ1B 1MS1A 1WUVA 5G04L 2VMHA 5GM0A 3ZN4A 2R042 5FOBB 2GNMA 2WT2A 1WGPA 2D44A 4LKSA 3NAPB 1HQLA 1O59A 3AC0A 2VZUA 3NKGA 2A7AA 4JGZB 4MGTA 3TEXA 5IVJA 4A7ZA 4C0HA 5EHDA 2DCTA 4XBQA 2CSGA 3O1TA 1CN1A 1NCRC 1Y7BA 5F3GA 4B4QA 5FLIA 4JDNA 4BQXA 4JQRA 2DBNA 2EVXA 2VL4A 4CCKA 3DPRA 5FZAA 1NX9A 3GHNA 5FY8A 1A8DA 3RRDA 3WHUA 1CZSA 2BBAA 4CTEA 1CZTA 2W39A 3H0OA 2Q1MA 4J6GA 5CISA 1GOHA 1ND3B 2R1BA 3HT1A 5BNOB 5C6CA 2ZS6B 1QJFA 2YMZA 4ZS2A 1QH7A 1WMEA 4ZU7A 2FMDA 4P9WA 3PIJA 4AVTA 3F2ZA 1IS3A 4YVSB 1COV1 1GR3A 4MGSA 1Q5OA 2DCZA 3HNMA 1YQ5A 3VBRA 5FZ3A 4GMP3 3RWKX 1SEFA 1C1FA 2VMGA 4N53A 4XUQA 3MV01 2RE9A 4QX8A 5FP8A 1GZTA 1AR72 2G9GA 2DUOA 3B94A 4I01A 1DIWA 1K5MB 1CX1A 5FMDA 1MS9A 3K4ZA 2A5ZA 3ITQA 4AEDB 1ACCA 4FFIA 3SITA 5CFDA 1H8TC 2JXAA 3ZYPA 2XKPA 3LEGA 4JQTA 1IQAA 3VHRA 4AK3A 5A3LA 3EXUA 2J1EA 2OZ6A 2VO5A 3RDIA 3WCSA 2QFEA 3HPNA 2HYKA 4MX3A 1LESA 2WZEA 4AEJA 4DUWA 1OLRA 4Y1UA 3PU3A 4OUSA 3GDBA 3PTRB 1G8WA 1TEIA 4GKXA 1MVQA 1GBGA 3ETPA 4UW4A 4XABA 5FLHA 4PHZA 4RGAA 3V0BA 1KQRA 1US3A 5BUVA 3RZHA 1JYVA 2YU1A 2BFUL 2XJSA 1CPNA 4D94A 1W2NA 3NWKA 5DUWA 3ZSLA 4Z8BA 5KHJA 5A3TA 4IE6A 4IGPA 4XBNA 5IUQA 4AZZA 3BTYA 5KC6A 4COUA 2VOXA 3NNGA 1BEV3 1CAXA 1QY4A 5BXXA 3GZTB 3DEMA 3GCXA 3DCQA 5FV3A 4CDUA 3BU0A 2QQMA 2WLQA 4FO9A 4MGYE 1I5ZA 1DLCA 3A0KA 4JDOA 1C57A 1LHNA 1ALYA 1UPIA 3ACGA 4K20A 2P3YA 3LQCA 3IDAA 1NCQC 1EAH2 4D6SA 3T2OA 4N43A 2BYVE 1PGW1 1US2A 4NAMA 5DAPA 3UKNA 5A3PA 3OG2A 1F9KA 2ET7A 5JLVA 4LHKA 1JZ2A 4MXWA 5F5QA 5LRRA 2TUNA 3KV9A 2AZ5A 4LOTA 3WOGA 2D40A 2XQXA 2RS31 5FMOL 4A4AA 3NJVA 1UMZA 5FPUA 1NY72 5J09A 3AX4A 5AVPA 4GALA 1QHDA 5FJKA 2JG9C 1AYN3 1QH6A 3DGTA 4FXGB 4OHVA 5C3SA 1JXNA 3I4IA 3VBSC 1A8MA 5EIYB 3ZXKA 2XBO3 1ONAA 4JTNA 2D7FA 3U75A 4CDXA 5C7GA 2A73B 1W9FA 3KQRA 4ET7A 2ARAA 5DZEA 2P2KA 2FBEA 4XW3A 5FZHA 1UL9A 2A75A 4CEWA 2HWF2 3K4AA 3M7AA 4IEPA 4AEDA 3MGUA 1W06A 5IVBA 5FREA 1OI6A 5F6KA 5A6ZA 1MZFA 4DIQA 3AYEA 1T2XA 2WR9A 3WP5A 1RITA 5FFOC 5GLUA 2LS6A 4YW4A 2QQPA 1ND2C 2YBSA 3ZFEA 2DTWA 3VBOA 4XFGA 4YVWC 2VMDA 3W5NA 4DEQA 3SLIA 4CSWA 1K5JA 1YFYA 2Y6GA 1VB4A 2GNTA 2A6ZA 3NSTA 4HZFA 3VHNA 1E5IA 1UX7A 3CKHA 2PAEA 3ZFGA 4GH4B 4LIUA 3C2UA 1UN1A 5FMOS 5A3MA 2P17A 2Y6FA 3I3BA 4E4HA 1UMHA 1W6MB 3WXPA 1FMD3 1O3TA 4Y4YA 1S0EA 3TYJA 4BIOA 1X8EA 3M3CA 2RS11 2W68A 2P3IA 2VMIA 3CL1A 1SMVA 5T3NA 1EV11 5IK4A 2JE9A 2OPWA 2VZOA 4LBQA 3N35A 4B4PA 2EXJA 2PHRA 4ISQA 5CVRA 3AYAA 2VCCA 2QQLA 4RR3A 1LEMA 5H9QA 4RYDA 3GZUC 4QKDA 2FD8A 4YW6A 4AQ2A 3BIEA 2LUWA 5FQ0B 5IYYA 1D7PM 1XNCA 3RGBA 3J7HA 1L3JA 1AJKA 2ZZQA 1S55A 3CJIB 2I07B 2D6KA 1DFQA 1GICA 3AL5A 4JHTA 1POV1 2RDNA 5A1AA 1GV9A 4E8CA 4CDWB 1NKGA 3ZR6A 2VNGA 4QDQA 2W91A 1LNSA 3VDDC 3ZFFA 4DB5A 3KB5A 2E7TA 5K0UC 2ZOEB 1TMF1 1PVC3 4EYUA 3A21A 1R1A2 2VUJA 5JI7A 1QQP1 4W65A 1YQ6A 4M3CA 1RVF2 3SKVA 4AI0A 1R092 3HNBM 2CHHA 4ARXA 1GLHA 1OUSA 1MEC3 4D7YA 1FOD1 4C90A 2OX0A 5DUXA 1UKGA 1VBB1 2WWJA 4W6YA 3TNQA 5ABJB 4LUMA 3PL0A 4HVQA 4CVUA 1VBD2 3MBWA 1DHKB 4GULA 3ZMNA 4BWOA 4C1XA 1OURA 3WEZA 4LE4A 5LBBA 2QZ2A 1X7NA 3A7QA 5F39A 2A6XA 1NQDA 3IB3A 4FFGA 2ZHMA 4CDQA 2B9UA 1H2KA 1UY3A 2WFF1 4AVBA 1MQTC 2W5FA 3WUDA 5IAXA 5GKAC 4NHKA 5LCWL 2W52A 5LA1A 3N9QA 3C7OA 1GANA 1S1AA 3N9MA 4Y20B 3OEBA 4CU8A 2W3JA 5FXXA 2MPFA 1ZVFA 1X9PA 3KSCA 4NHLA 4AFBA 5CEHA 4QHZA 1YEWA 5FP7A 1Z0HA 2BRTA 4AHWA 4LMFA 4QGNA 3ACFA 4GH4A 4WZFA 1GOGA 1XNDA 4YG3A 4HVOA 4R9AA 5HXVA 4DUXA 1IQDC 1W6MA 3PMEA 2P3KA 3BODA 4Y3OA 4AI2A 4KWUA 4SLIA 3NNFA 2PHFA 5EQUA 4AEKA 4LBKA 2ZTNA 1GNZA 5D8AA 2WQ8A 1H8VA 3PVEA 5T55A 4W6XA 2ZGPA 4E9KA 3KVAA 1CVNA 4OI0A 1OOPA 5JR2A 3OUIA 3O1MA 1DGRN 1MVEA 2Y33A 4LUKA 5FMCA 3KV5A 1QJU3 4FT8A 2KR2A 2E53A 4A7KA 3RJRA 1CWPA 3BVCA 5A1LA 4EZ4A 4QX1A 1Y4WA 4NO4A 3LDRA 2RDQA 5T5OA 4BZ4A 3JBG3 5C9AA 4BOWA 5LBCA 2XXZA 1HJFA 4YW3A 1GWKA 2W2IA 4IERA 3ROUA 3O5SA 4A45A 2VVDA 1URXA 1ZA4A 1G9FA 2RJKA 1RUG3 3GM8A 1M4WA 2VOVA 5FXVA 1HV1A 4Q4Y1 4QB2A 3MPPG 4LE3A 1JI6A 3Q8CA 1RUF2 4QKFA 4QM9A 5DG2A 4LBLA 5T5LA 1A78A 1LOGA 1DU3D 3HNYM 3T0AA 1MACA 3M3OA 3TOJA 1S0IA 4PLNA 3UV9A 5ACA1 1SPPA 2Z5WA 4EQVA 4YG6A 3S30A 4AHYA 1H9PA 4RGGA 4BQ5A 5FR3A 1H2NA 2A6YA 2VVEA 3AB0A 1HN0A 3CLPA 3U37A 3PVOA 3SEEA 2VCAA 4X6RB 5DDJ3 1XBFA 3T1MA 5BNPA 3AZWA 5F1RA 2JD9A 5I93A 1FNYA 2PFWA 2R072 2WIIB 1CPMA 2YROA 3IPVB 5DXDA 4AR2A 1I9RA 1K12A 3VKFC 1A6CA 3WQ7A 3WNMA 4URAA 1ODMA 4PF5A 5CG8A 5JSRA 2F4PA 2FCTA 3Q9OA 3O1VA 1SZBA 4FAHA 4BQ2A 3N7LA 5KHGA 4OLLA 2CV6A 1PO22 2HYXA 2ORZA 2W46A 1W8OA 5FY7A 5LWBA 4GD4A 4PIYA 4Y24A 4TN7A 1S0BA 3ATGA 2C1FA 1AHSA 3POBA 4XZUG 3UNPA 3NJZA 4LO7A 1RMU2 4IE7A 1GQPA 3OYWB 4FCAA 4BXSV 2QZ3A 1OD5A 4JHZA 1JH5A 2ZMKA 3TNPB 1W99A 1FX5A 4QHOA 5CFCA 1PM7A 3OD4A 5F9TA 4DINB 1YCIA 1VBC2 2AC1A 3IDBB 3OD0A 5FWEA 3NNLA 3HR9A 5CADA 1QEXA 3VBFA 5L36A 3S5QA 5FY4A 3P3NA 1SQ4A 2V73A 5DG1A 2PLV3 3RJ2X 3VBHA 3LD8A 1PMJX 4CUCA 3T2QA 4JGYC 4P9GA 5C33A 4DXTA 3WV6A 3USUA 4Q4W3 1BQPA 1FT9A 4XAEA 2EIEA 2RS52 1W39A 3KF5A 5M0TA 5FBJA 3WP6A 4DNYA 2VZQA 2WA4A 1G9BA 1CAWB 3B00A 1HJGA 2BERA 4AFDA 5DUVA 1G86A 5KXEA 1REEA 2EICA 3MIEA 1QMJA 4URTA 4ZPIA 3O12A 5GZCA 2EAKA 2IZWA 3KQ4B 5A7WA 3ZYJB 2XJPA 2ZEWA 3CIHA 4HANA 1HDKA 1AR62 1RUC2 4X8PA 3OGSA 5LATA 3POWA 4AWDA 5C8CA 5F7UA 3GALA 2RMU3 4QPIB 1WA4A 3SKJE 3ZXAC 4PDWA 2ID4A 5CYYA 1RUJ2 1XNKA 3RQ0A 1PZ9A 1SLIA 1CD3G 1FV3A 1BEV1 5JOXA 3EJKA 4H55A 4M0HA 1RUD3 1RUI2 1W3XA 2BP6A 1W8TA 4S2DA 2GALA 5FY9A 5AFEA 4YYOA 2W1WA 1D4VB 2OUJA 4QM8A 1DGWX 4Q4V3 2KXLA 4BLIA 4OHYA 1HXS3 2A6WA 1XC6A 2EA7A 2QQKA 2X05A 4DXSA 1BLZA 5G05L 3SXWA 2HWE2 2QUOA 2FMYA 3LCPA 4FVVA 4BQ4A 1B09A 2XONA 4QAWA 1BHGA 1MZ6A 1AR93 1FAYA 2RM22 2WABA 4LO5B 3M3EA 3P6BA 5JMOA 3U11A 5FWJA 5A3WA 1Q8SA 4JKLA 1CX4A 3MLLA 4Y4RA 2VD7A 5J1XA 2WYFA 5JZGB 3Q8FA 4HKLA 4Y5Z0 2WT1A 1XU2A 2R32A 5IHRA 1IS4A 2WLPA 5ANNA 1NCRA 2DBIA 1AYN1 2V09A 3IIIA 4AL9A 2PELA 1W3VA 3L2YA 3MF9A 4AF9A 1ZBA3 2P6HA 1NOVA 2XBO1 4Q29A 1YNAA 5HCAA 3OUJA 3QBQA 5FK8A 5A6YA 1NG0A 4TWTA 3VHOA 4WBBA 2ERFA 5HBAA 2ZGNA 1FATA 2D3SA 1JU4A 3D0JA 4NVPA 3CZJA 2Q1FA 4OZOA 3POFA 3GZAA 5FP9A 5FPLA 1QJX3 4DOUA 4DRVA 4QU2A 1CAWA 2VMEA 2C9KA 4HONA 2VUDA 3WF1A 4D7SA 1IZ3A 1JZ7A 4HFSA 4E4SA 4NIHA 3EQEA 3I2DA 4G9SB 1IKPA 4QQ2A 5FUIA 5L9BA 4H7MA 1YC61 3HN3A 2XJTA 3W59A 2NP0A 4H14A 2D6PA 1H1AA 1XE0A 2CDPA 3ZXFA 4AGGA 4ASLA 1PMIA 3FBYA 3TEWA 1DYPA 3MDPA 4NE9A 2RS12 1RUH2 4QPGB 1SCSA 3TN93 1H8TA 3DYMA 5J98B 4RHV3 1FMD1 3ZYFA 5GZGA 1VMHA 4Z92B 2WZ8A 1SLLA 2GSYA 3PMSA 4CUBA 1PIV3 3OJBA 3AJZA 2R0HA 4FPFA 5IVEA 2EAAA 1TME1 4Q0SA 1QOTA 3E6BA 5LB6A 3KD4A 1E5HA 2XVLA 4OVEA 1GZWB 1GWLA 1FPN1 1DQ2A 3BN6A 4AHXA 4AQTA 1YWKA 1VAMA 3CZUA 2V4VA 2VZSA 3ZSEA 1I6XA 3H7JA 2WAOA 5A70A 1KFXL 4FSJA 1ASJ2 1ZRIA 1SFNA 4KWKA 4E2GA 5E6HA 3MHZA 2X5IB 3KWVA 1QQP2 4RL7A 2OXBA 4Y1XA 4GQ7A 5GLZA 3T2TA 5A6XA 5LA0A 1CESA 4NIDA 1JHNA 4F7ZA 5C3OA 1W8FA 5A6QA 1PVC1 3WLUA 3I54A 2JIJA 3O1RA 1FOD2 4H2AA 3V0AA 2RR12 4KMQA 2VNRA 4IESA 1UZZA 2Z42A 4Q5OA 5E88A 5DAQA 4N90A 2G19A 4P14A 4MG2A 1NA1C 4LULA 1CR7A 2BTVC 3DL3A 3I2JA 4S2GA 2YXSA 4YZ3A 2WFF3 2R063 4D8MA 5IVVA 2BWCA 2VULA 5GLWA 4FQZA 1CGPA 1PNFA 4CCEA 1DGWA 1ZBE2 4COYA 2JE8A 2V72A 2GN3A 3OUHA 3PNAA 3I49A 3CJXA 1UYXA 4XHBA 2JG9A 5FRAA 4I2OA 3H8RA 4RGKA 4FTSA 2UY9A 2IXCA 3DYOA 4RSUA 1U5YA 3N9OA 3Q8EA 3VBSA 3DECA 5CKMA 4Q1RA 3KF3A 2ADDA 1QU0A 1O4ZA 4NHMA 4S2FA 5DZFA 5FY0A 3T4HB 3T09A 2D3RA 1F4AA 1RUE2 2VZ1A 4OZXA 4UAPA 2WQZC 3JB8A 1PO13 5LA9A 5L7OC 2WZR3 3LA3A 2PAKA 1RHI3 5LW9A 2WINB 1GWMA 1KEXA 1IKQA 1C8M3 3DPRB 4QXHA 3WW4A 4COVA 2Y26A 2K9ZA 1BVVA 5EWSA 2IWGB 3MIDA 5FMBA 1YFWA 4KG8A 3I97A 4K7JA 1BBT2 3TBDA 4Q4X2 2X8KA 1ND2A 2ZA9A 4M4PA 2H6BA 3WDYA 2ZKLA 1MZEA 2XLAA 4XDOA 1GKBA 3UK9A 1VPHA 2WS92 4YVWA 4BH9A 2RVAA 4YZ2A 2W92A 3OF1A 4XMIA 2QNKA 4JC1A 5DAVA 4UYBA 5KXDA 1HQNA 4MV2A 3VL9A 4PI0A 2WUHA 2Q8EA 3AYDA 4N53B 1LHWA 2BQPA 3WW3A 5FZGA 3OPTA 2E9QA 5A3NA 1X36A 4NIAA 1J3QA 2HWC3 1QJU1 2CAUA 2CTVA 2D3PA 2MEV2 2WNVC 4XE9A 1Q8QA 3N7JA 3NQHA 3S57A 5F32A 2QQIA 1AX0A 1JMUB 3RMXA 3USSA 1PVXA 2IXKA 4YNIA 3JBG1 1ULPA 3M70A 4XYXA 4MGKE 4GWIA 5L9RA 1DQ0A 2WSUA 4Q4Y2 2HWD3 2D98A 4KG0A 4HK9A 4QQLA 4X8NA 2XLGA 1TVGA 4Y1YA 1RUG1 3MZHA 3LFIA 4FTEA 1PNGA 1V6LA 4YW7A 3ZVXA 4FFHA 2JECA
chains in the Genus database with same CATH topology
1DP0A 1JZ8A 1XPWA 1J84A 3D3AA 3K4AA 2J1RA 4KI5M 4LPLA 2J1UA 2VZVA 4MGQA 4W50A 1YQ2A 1T2XA 3MUY1 3I2FA 1J83A 2LS6A 4BK5A 4RN5A 2VMDA 3W5NA 3THCA 3T08A 4DEQA 3MO4A 1I5PA 2Y6GA 2YFUA 3NJXA 3T0DA 3EYPA 1UX7A 3CKHA 3I3DA 1PX3A 3PUIA 2YG0A 4P5YA 2VMCA 2W95A 2BGPA 3ACHA 3WF3A 3I3BA 1UMHA 1GUIA 2RJ2A 1UWWA 2VJXA 2VR4A 4QDRA 1WCQA 1CZVA 5HPOA 2VZOA 3I2GA 2WO3A 1JZ3A 3OGRA 2WO2A 2VCCA 2QQLA 2W1SA 2EIDA 3K75B 4RYDA 5DN2A 5IYYA 1D7PM 3FL7A 2B4KA 3J7HA 2Y8KA 1SHWB 5A1AA 4E8CA 1NKGA 4QDQA 2W91A 1LNSA 3EB7A 2ZEZA 5DMYA 3A21A 3T2PA 3BGAA 2E26A 5C71A 3SKVA 5LA2A 3HNBM 4UOJA 4ARXA 5JXHA 2W47A 3WSOA 4P08A 4CVUA 3MBWA 2QQJA 4QB6A 2V5DA 3WEZA 3HJRA 3A7QA 4ARYA 1W9WA 3IB3A 3FHQA 1JZ5A 4YPJA 1UY3A 4OMDA 5EJZB 2W5FA 2LW8A 5LCWL 4ZZ5A 5LA1A 2XHNA 3C7OA 3LPFA 2XOMA 4ZXEA 1JHJA 3OEBA 4CUAA 2W3JA 4CU8A 2ZXQA 4JKKA 2YFZA 4A3ZA 1GMMA 3I2KA 3ACFA 3K4DA 5I0DA 1GOGA 2W1UA 2DCJA 4DUXA 1IQDC 3CDZB 4JKMA 4M4RA 2VZPA 3CMGA 4KWUA 4W4ZA 3WNLA 1JYWA 2ZEXA 2VQUA 5DPNA 2WQ8A 2J1AA 5IJRA 1L7QA 1UY4A 2E31A 2DDUA 5JR2A 4HG6B 3WNKA 2VQTA 1KGYA 4DXRA 1NUKA 4MO3M 5IFPA 2R7EB 4QX1A 3MUZ1 2WAAA 2L9LA 5JXIA 4FI9A 2J1TA 4A45A 2WN3A 3GM8A 5IFTA 2W94A 3MV11 1UY2A 4QB2A 3WQBA 5IHRA 1JI6A 4MADA 3FN9A 4L0PA 3NRUA 3HNYM 3T0AA 4ZZ8A 5C70A 3WF2A 1JU3A 5CZKA 4GZ9A 1OF3A 2J1VA 2E32A 5JXGA 2W87A 1L7RA 3T0BA 3U37A 1SG3A 3SEEA 3HEIA 4BK4A 2VCAA 1GOFA 4XUPA 1K42A 1W0NA 2JD9A 3LEKA 3VDBA 3C7EA 3C8XA 1K12A 4AG4A 2JDAA 3WNMA 1MPXA 2VTFA 3ABZA 3LE0A 1UY0A 4JX0A 2J7MA 1UXZA 4XURA 3VD5A 2VOTA 2ORZA 2HYXA 2B9VA 2W46A 1W8OA 2J1SA 4A44A 1GNYA 1K3IA 3WNPA 1P8JA 2KD7A 4XZUG 3UNPA 1OT5A 4QX3A 3VD4A 1GQPA 4BXSV 1EUUA 2E33A 4JHZA 1W99A 2JKXA 1UXXX 1XNTA 1UYYA 2C26A 3ECQA 4P00B 3HOBA 1PMHX 4DUVA 1W9SA 3GXUA 1DYOA 1PMJX 4CUCA 3T2QA 2Y64A 4BDVB 3VDAA 4DXTA 1RYYA 4PQQA 4PF1A 2Y6HA 1OF4A 4XUTA 2EIEA 4QDSA 2VZQA 1JYXA 2X10A 2Z4FA 4XUNA 3OGVA 1CIYA 2BERA 4CU9A 2EICA 4W8JA 3VD9A 2W9XA 2VCBA 3PUHA 3P1IA 5JUVA 2ZEWA 2BGOA 2VC9A 3CIHA 2WDBA 2W1QA 3OGSA 1JZ6A 2YC2A 1JZ4A 5F7UA 3SKJE 2ID4A 5CYYA 1NAEA 2VZTA 1O8PA 3E1F1 2CDOA 1H6YA 3OB8A 4ZY9A 3K46A 2VZ3A 2W1WA 2X05A 1XC6A 2QQKA 4AAXA 4DXSA 5G05L 2XONA 4QAWA 1BHGA 4E8DA 1OH4A 2WABA 3K77A 1OD3A 2ORXA 3P6BA 5JMOA 3WNNA 2X09A 4JKLA 4GWJA 3WF0A 3VD3A 5J1XA 2RV9A 3WNOA 4IUGA 4A6OA 4QX0A 4OUEA 3CQOA 2HLEA 1JYNA 3I2IA 2Y6KA 3IIIA 2VZRA 3A23A 1ULOA 1UZ0A 5B4NA 2ZEYA 4MOAA 3IAPA 3UESA 4D0QA 5B4XA 3ACIA 2WBKA 1H6XA 1JU4A 2QBXA 3CZJA 4OZOA 3THDA 3UETA 2EIBA 2Y6LA 2VMEA 2C9KA 3WF1A 1JZ7A 5FUIA 4A42A 3HN3A 2VM9A 1GU3A 2YB7A 5EJ1B 4DEVA 2CDPA 1W8NA 5G04L 3VD7A 1UY1A 3OBAA 3FHAA 4OMCA 4LKSA 3SEPA 4XUOA 1O59A 5HXMA 3AC0A 2VZUA 3DYMA 4CU7A 3LPGA 4QB1A 4PT6A 4LQRA 2WZ8A 4CUBA 1PX4A 4QX2A 3VDCA 2VL4A 4UI9L 4A41A 1NX9A 1CZSA 2BBAA 1CZTA 3GGLA 4QPWA 4LHSA 1GOHA 1UMIA 2QQOA 3BN6A 4TXWA 2WN2A 3CZUA 2V4VA 2OKXA 2VZSA 3F2ZA 2WAOA 4MGSA 2VMFA 3HNMA 5LA0A 2YC4A 3MV01 4XUQA 4KMQA 1CX1A 4P02B 1HN1A 3IAQA 3K4ZA 3I2JA 3LEGA 2J22A 4D8MA 4TTGA 2J1EA 2VO5A 1EUTA 4BJ0A 3HPNA 2JE8A 2WZEA 2V72A 2QQNA 4DUWA 1F4HA 2DCKA 3GDBA 3ETPA 1UYXA 2BZDA 4CU6A 3W5MA 1US3A 1JYVA 1TG7A 3DYOA 2WYSA 3C7FA 4OYUA 3DECA 3T09A 1F4AA 2VZ1A 4UAPA 3NNGA 2Y6JA 1KEXA 1WKYA 2PQSA 1R64A 1K45A 2QQMA 3A22A 5JXJA 3I3EA 1DLCA 5DQ0A 3I97A 3I2HA 3LEIA 3ACGA 4M4PA 3LQCA 3IDAA 3C7GA 3T2OA 2RVAA 2W92A 1US2A 2WO1A 2C4XA 3OG2A 1W9TA 1JZ2A 2WUHA 3C7HA 2XQXA 3JXSA 4A4AA 3NJVA 3OEAA 3NQHA 2QQIA 4XVHA 1ULPA 5EIYB 1XNAA 4GWIA 3WF4A 3ZM8A 1UYZA 4Z2AA 5C7GA 3DYPA 1TVGA 1O8SA 4ET7A 1SDDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP0 A;  1JZ8 A;  1XPW A;  1J84 A;  3D3A A;  3K4A A;  2J1R A;  4KI5 M;  4LPL A;  2J1U A;  2VZV A;  4MGQ A;  4W50 A;  1YQ2 A;  1T2X A;  3MUY 1;  3I2F A;  1J83 A;  2LS6 A;  4BK5 A;  4RN5 A;  2VMD A;  3W5N A;  3THC A;  3T08 A;  4DEQ A;  3MO4 A;  1I5P A;  2Y6G A;  2YFU A;  3NJX A;  3T0D A;  3EYP A;  1UX7 A;  3CKH A;  3I3D A;  1PX3 A;  3PUI A;  2YG0 A;  4P5Y A;  2VMC A;  2W95 A;  2BGP A;  3ACH A;  3WF3 A;  3I3B A;  1UMH A;  1GUI A;  2RJ2 A;  1UWW A;  2VJX A;  2VR4 A;  4QDR A;  1WCQ A;  1CZV A;  5HPO A;  2VZO A;  3I2G A;  2WO3 A;  1JZ3 A;  3OGR A;  2WO2 A;  2VCC A;  2QQL A;  2W1S A;  2EID A;  3K75 B;  4RYD A;  5DN2 A;  5IYY A;  1D7P M;  3FL7 A;  2B4K A;  3J7H A;  2Y8K A;  1SHW B;  5A1A A;  4E8C A;  1NKG A;  4QDQ A;  2W91 A;  1LNS A;  3EB7 A;  2ZEZ A;  5DMY A;  3A21 A;  3T2P A;  3BGA A;  2E26 A;  5C71 A;  3SKV A;  5LA2 A;  3HNB M;  4UOJ A;  4ARX A;  5JXH A;  2W47 A;  3WSO A;  4P08 A;  4CVU A;  3MBW A;  2QQJ A;  4QB6 A;  2V5D A;  3WEZ A;  3HJR A;  3A7Q A;  4ARY A;  1W9W A;  3IB3 A;  3FHQ A;  1JZ5 A;  4YPJ A;  1UY3 A;  4OMD A;  5EJZ B;  2W5F A;  2LW8 A;  5LCW L;  4ZZ5 A;  5LA1 A;  2XHN A;  3C7O A;  3LPF A;  2XOM A;  4ZXE A;  1JHJ A;  3OEB A;  4CUA A;  2W3J A;  4CU8 A;  2ZXQ A;  4JKK A;  2YFZ A;  4A3Z A;  1GMM A;  3I2K A;  3ACF A;  3K4D A;  5I0D A;  1GOG A;  2W1U A;  2DCJ A;  4DUX A;  1IQD C;  3CDZ B;  4JKM A;  4M4R A;  2VZP A;  3CMG A;  4KWU A;  4W4Z A;  3WNL A;  1JYW A;  2ZEX A;  2VQU A;  5DPN A;  2WQ8 A;  2J1A A;  5IJR A;  1L7Q A;  1UY4 A;  2E31 A;  2DDU A;  5JR2 A;  4HG6 B;  3WNK A;  2VQT A;  1KGY A;  4DXR A;  1NUK A;  4MO3 M;  5IFP A;  2R7E B;  4QX1 A;  3MUZ 1;  2WAA A;  2L9L A;  5JXI A;  4FI9 A;  2J1T A;  4A45 A;  2WN3 A;  3GM8 A;  5IFT A;  2W94 A;  3MV1 1;  1UY2 A;  4QB2 A;  3WQB A;  5IHR A;  1JI6 A;  4MAD A;  3FN9 A;  4L0P A;  3NRU A;  3HNY M;  3T0A A;  4ZZ8 A;  5C70 A;  3WF2 A;  1JU3 A;  5CZK A;  4GZ9 A;  1OF3 A;  2J1V A;  2E32 A;  5JXG A;  2W87 A;  1L7R A;  3T0B A;  3U37 A;  1SG3 A;  3SEE A;  3HEI A;  4BK4 A;  2VCA A;  1GOF A;  4XUP A;  1K42 A;  1W0N A;  2JD9 A;  3LEK A;  3VDB A;  3C7E A;  3C8X A;  1K12 A;  4AG4 A;  2JDA A;  3WNM A;  1MPX A;  2VTF A;  3ABZ A;  3LE0 A;  1UY0 A;  4JX0 A;  2J7M A;  1UXZ A;  4XUR A;  3VD5 A;  2VOT A;  2ORZ A;  2HYX A;  2B9V A;  2W46 A;  1W8O A;  2J1S A;  4A44 A;  1GNY A;  1K3I A;  3WNP A;  1P8J A;  2KD7 A;  4XZU G;  3UNP A;  1OT5 A;  4QX3 A;  3VD4 A;  1GQP A;  4BXS V;  1EUU A;  2E33 A;  4JHZ A;  1W99 A;  2JKX A;  1UXX X;  1XNT A;  1UYY A;  2C26 A;  3ECQ A;  4P00 B;  3HOB A;  1PMH X;  4DUV A;  1W9S A;  3GXU A;  1DYO A;  1PMJ X;  4CUC A;  3T2Q A;  2Y64 A;  4BDV B;  3VDA A;  4DXT A;  1RYY A;  4PQQ A;  4PF1 A;  2Y6H A;  1OF4 A;  4XUT A;  2EIE A;  4QDS A;  2VZQ A;  1JYX A;  2X10 A;  2Z4F A;  4XUN A;  3OGV A;  1CIY A;  2BER A;  4CU9 A;  2EIC A;  4W8J A;  3VD9 A;  2W9X A;  2VCB A;  3PUH A;  3P1I A;  5JUV A;  2ZEW A;  2BGO A;  2VC9 A;  3CIH A;  2WDB A;  2W1Q A;  3OGS A;  1JZ6 A;  2YC2 A;  1JZ4 A;  5F7U A;  3SKJ E;  2ID4 A;  5CYY A;  1NAE A;  2VZT A;  1O8P A;  3E1F 1;  2CDO A;  1H6Y A;  3OB8 A;  4ZY9 A;  3K46 A;  2VZ3 A;  2W1W A;  2X05 A;  1XC6 A;  2QQK A;  4AAX A;  4DXS A;  5G05 L;  2XON A;  4QAW A;  1BHG A;  4E8D A;  1OH4 A;  2WAB A;  3K77 A;  1OD3 A;  2ORX A;  3P6B A;  5JMO A;  3WNN A;  2X09 A;  4JKL A;  4GWJ A;  3WF0 A;  3VD3 A;  5J1X A;  2RV9 A;  3WNO A;  4IUG A;  4A6O A;  4QX0 A;  4OUE A;  3CQO A;  2HLE A;  1JYN A;  3I2I A;  2Y6K A;  3III A;  2VZR A;  3A23 A;  1ULO A;  1UZ0 A;  5B4N A;  2ZEY A;  4MOA A;  3IAP A;  3UES A;  4D0Q A;  5B4X A;  3ACI A;  2WBK A;  1H6X A;  1JU4 A;  2QBX A;  3CZJ A;  4OZO A;  3THD A;  3UET A;  2EIB A;  2Y6L A;  2VME A;  2C9K A;  3WF1 A;  1JZ7 A;  5FUI A;  4A42 A;  3HN3 A;  2VM9 A;  1GU3 A;  2YB7 A;  5EJ1 B;  4DEV A;  2CDP A;  1W8N A;  5G04 L;  3VD7 A;  1UY1 A;  3OBA A;  3FHA A;  4OMC A;  4LKS A;  3SEP A;  4XUO A;  1O59 A;  5HXM A;  3AC0 A;  2VZU A;  3DYM A;  4CU7 A;  3LPG A;  4QB1 A;  4PT6 A;  4LQR A;  2WZ8 A;  4CUB A;  1PX4 A;  4QX2 A;  3VDC A;  2VL4 A;  4UI9 L;  4A41 A;  1NX9 A;  1CZS A;  2BBA A;  1CZT A;  3GGL A;  4QPW A;  4LHS A;  1GOH A;  1UMI A;  2QQO A;  3BN6 A;  4TXW A;  2WN2 A;  3CZU A;  2V4V A;  2OKX A;  2VZS A;  3F2Z A;  2WAO A;  4MGS A;  2VMF A;  3HNM A;  5LA0 A;  2YC4 A;  3MV0 1;  4XUQ A;  4KMQ A;  1CX1 A;  4P02 B;  1HN1 A;  3IAQ A;  3K4Z A;  3I2J A;  3LEG A;  2J22 A;  4D8M A;  4TTG A;  2J1E A;  2VO5 A;  1EUT A;  4BJ0 A;  3HPN A;  2JE8 A;  2WZE A;  2V72 A;  2QQN A;  4DUW A;  1F4H A;  2DCK A;  3GDB A;  3ETP A;  1UYX A;  2BZD A;  4CU6 A;  3W5M A;  1US3 A;  1JYV A;  1TG7 A;  3DYO A;  2WYS A;  3C7F A;  4OYU A;  3DEC A;  3T09 A;  1F4A A;  2VZ1 A;  4UAP A;  3NNG A;  2Y6J A;  1KEX A;  1WKY A;  2PQS A;  1R64 A;  1K45 A;  2QQM A;  3A22 A;  5JXJ A;  3I3E A;  1DLC A;  5DQ0 A;  3I97 A;  3I2H A;  3LEI A;  3ACG A;  4M4P A;  3LQC A;  3IDA A;  3C7G A;  3T2O A;  2RVA A;  2W92 A;  1US2 A;  2WO1 A;  2C4X A;  3OG2 A;  1W9T A;  1JZ2 A;  2WUH A;  3C7H A;  2XQX A;  3JXS A;  4A4A A;  3NJV A;  3OEA A;  3NQH A;  2QQI A;  4XVH A;  1ULP A;  5EIY B;  1XNA A;  4GWI A;  3WF4 A;  3ZM8 A;  1UYZ A;  4Z2A A;  5C7G A;  3DYP A;  1TVG A;  1O8S A;  4ET7 A;  1SDD B; 
#chains in the Genus database with same CATH topology
 1SBF A;  3PU8 A;  3QH6 A;  1DP0 A;  1JZ8 A;  1ZA7 A;  3LKJ A;  2GDF A;  1I3H A;  3D3A A;  2J1R A;  2ETE A;  3IN9 A;  4LPL A;  4RS5 A;  3R6S A;  3THT A;  2J1U A;  2VZV A;  4KNC A;  2F17 A;  4AVC A;  4CP0 A;  1ENX A;  2Y0O A;  1JW6 A;  4GWN A;  4PJY A;  1BMV 2;  2WL1 A;  3I2F A;  1J59 A;  2JDU A;  3E5U A;  1H4H A;  2LRO A;  2UYB A;  4BCU A;  2NPI A;  4CEY C;  4EN6 B;  5K0U A;  1QXR A;  3VZO A;  1WLT A;  2AEY A;  2XML A;  3O0X A;  2ENR A;  4OQ9 A;  2VTX J;  4IV3 A;  2EXH A;  4CDU B;  5JI9 A;  4Y1V A;  5DDJ 1;  3EYP A;  3HIF A;  3HVD A;  1KD7 A;  1W8W A;  2D6M A;  2YG0 A;  4P5Y A;  4HN0 A;  5CKN A;  1HB4 A;  2BGP A;  2Q0A A;  4YGD A;  1O5L A;  2VXR A;  3WF3 A;  4Y22 A;  5FYT A;  2BDR A;  2XPJ A;  5E16 A;  4GB3 2;  3L9J T;  4U36 A;  5LRS A;  4N43 B;  3LB9 A;  1CZV A;  4WM7 C;  1WMF A;  2W0X A;  4FPE A;  4F83 A;  3FC0 A;  4MXW B;  1JZ3 A;  3VZL A;  1MS8 A;  3OGR A;  5C5T A;  2WO2 A;  2D5H A;  1MQT A;  4B1M A;  1HRI 2;  3K75 B;  4RQP C;  1ZRR A;  4ZHN A;  3AP9 A;  2VBP A;  5DN2 A;  3JD7 3;  5LEJ A;  2B4K A;  3RFR A;  5FZ0 A;  2ZX2 A;  3ASI A;  3AP5 A;  4HPK A;  4KU8 A;  3WQ0 A;  4C8D A;  2ARX A;  3T30 A;  1N1S A;  4XEZ A;  2CGP A;  3NMB A;  4OI4 A;  4H7L A;  5H9P A;  3BCW A;  3EB7 A;  1UQX A;  4CDX B;  1ZRC A;  4IXL A;  4XFH A;  1UPS A;  5FLJ A;  4FTB A;  5EXO A;  2ZEZ A;  1WW7 A;  1NE6 A;  1PZ8 A;  3E5Q A;  3A0N A;  3HAG A;  5FPV A;  4YM3 A;  3VUO A;  1POQ A;  1QJY 3;  4EWA A;  5TSW A;  3T2P A;  5BV6 A;  4WZC A;  4CEW B;  2PLV 1;  4XHX A;  1CAU A;  4BXF A;  5FKB A;  3AP4 A;  3H8X A;  3MPB A;  1OH3 A;  2W47 A;  1HQW A;  2DFC A;  1W6O A;  3AKR A;  1ZYB A;  1U12 A;  4Q4W 1;  3KS7 A;  4XJ8 A;  4P9J A;  3WSO A;  4JVA A;  3ZFE B;  1AR7 3;  3VBO B;  5LAS A;  4QB6 A;  2V5D A;  1LED A;  3GZE A;  2PAM A;  5A3U A;  1UIK A;  4XQ4 A;  5FZB A;  1NLR A;  3FBM A;  3MEP A;  5FYY A;  5BNN C;  1JZ5 A;  5KHI A;  4YPJ A;  3VLB B;  3ZFG B;  4AFM A;  4Z82 A;  3RG0 A;  2IXJ A;  4LLO A;  2LW8 A;  1VB2 A;  3DKQ A;  4ZZ5 A;  1QGL A;  1DDL A;  4HOO A;  3LPF A;  4NWW A;  2XOM A;  3RSJ A;  4EN9 B;  4E27 A;  2CWS A;  2RMU 1;  1AX1 A;  4L8Q A;  3EO6 A;  5F5A A;  2DVA A;  4AI8 A;  2XUE A;  2YFZ A;  1UF2 C;  4LBQ B;  4A3Z A;  2HWB 3;  4ZS3 A;  2VNV A;  2D43 A;  3I2K A;  5F2W A;  4K3U A;  4OUL A;  3V65 A;  3B9I A;  1WMX A;  2B42 B;  4RR3 B;  3ZYG A;  4Q0Q A;  3BUC A;  3ES4 A;  1DYK A;  2VXJ A;  1O5U A;  3CDZ B;  3K48 A;  4JKM A;  1IPK A;  1RUD 1;  4M4R A;  4N7U A;  2VZP A;  1HW5 A;  1U5Z A;  4LK7 A;  1Z78 A;  3H7Y A;  3JQX A;  4P5H A;  3LIH A;  3OY8 A;  1YUD A;  4PQ9 A;  2A70 A;  4Q4V 1;  2DFB A;  2E7Q A;  2ZEX A;  1G9C A;  1HXS 1;  1ULD A;  3RZZ A;  1Q3E A;  4EN7 B;  1UY4 A;  3ZFF B;  4GIQ A;  4IV1 A;  3KT1 A;  1AR9 1;  4FOY A;  3I8T A;  3HBZ A;  2YBP A;  1B35 C;  1XQN A;  5D21 A;  5FTT C;  1AYM 2;  4DXR A;  5BNQ A;  4QU1 A;  5EJ3 A;  5A7N A;  1ODN A;  1UYP A;  4HKO A;  4M3C B;  2ZAA A;  1EAH 3;  3N7M A;  4LHN A;  5FIX A;  1WMD A;  5HI0 A;  4LIV A;  1R08 3;  1EYB A;  1UZW A;  5KBF A;  1ZZC A;  2ZAH A;  1F5F A;  5CAZ A;  2WNU C;  4BHP A;  4K8F A;  1V6I A;  4AVS A;  2WAA A;  3NV1 A;  3BTA A;  5DUU A;  4B4R A;  2Z79 A;  2I45 A;  2G1M A;  4DXZ A;  2H0B A;  4UFH A;  2WN3 A;  2YC0 A;  5JVV A;  5IFT A;  3MV1 1;  1ZBA 1;  1C1L A;  1UY2 A;  4CDQ B;  5FZC A;  1VAK A;  1H30 A;  2WQ4 A;  4MAD A;  2XJQ A;  1X82 A;  1H1M A;  2X29 A;  3ZLI A;  2UWC A;  5C70 A;  2HJI A;  1OKO A;  1CAV A;  1OF3 A;  1QJX 1;  3WNX A;  4ES9 A;  4JTO A;  3ZXD A;  3H3U A;  1ULF A;  1W8Z A;  1ZNP A;  2E32 A;  3KV6 A;  4RFR B;  4XIO A;  4YW1 A;  1BK1 A;  1N47 A;  5JXG A;  3H8O A;  1L7R A;  1N1V A;  2ZGM A;  3AMQ A;  3LWC A;  3T0B A;  4BK4 A;  4QX5 A;  1GOF A;  4G3Y C;  4I09 A;  1W0N A;  3IT8 A;  5FZ1 A;  4Y26 A;  4IGO A;  3HN1 A;  4JGY A;  3M2M A;  4AG4 A;  1ZZ8 A;  3ST7 A;  3VD9 A;  4L99 A;  5D8A B;  4ZKT B;  2ZX4 A;  2PHT A;  3AKQ A;  1TME 3;  3TN9 1;  1O6U A;  3URF A;  1UY0 A;  3K3N A;  2V5Y A;  3N36 A;  4RHV 1;  5FPA A;  2J7M A;  3V0B B;  1OOP B;  1FPN 3;  1UXZ A;  4HT1 T;  3SCG A;  4QGM A;  5FPX A;  2ZCW A;  4LA3 A;  4XUR A;  4K1Z A;  1J3R A;  2XJR A;  4J25 A;  4V2V A;  1PIV 1;  2XKO A;  2VOT A;  3BAL A;  3GBF A;  3GYD A;  3RYK A;  4FPY A;  4A44 A;  2YU2 A;  1GNY A;  4XF3 A;  5FYH A;  5T50 A;  2CWM A;  1X9T A;  4TLF A;  1NT0 A;  4DO0 A;  5C9A B;  3LSD A;  1OT5 A;  3J8F 2;  4QX3 A;  4B3N A;  3S5A A;  4P9I A;  2GC3 A;  4FXK B;  5D2A A;  1C28 A;  4R8H A;  3AZZ A;  5FAX A;  4WVZ A;  5KHK A;  2IXI A;  4P9Y A;  4EWD A;  2P3J A;  4UW5 A;  3ECQ A;  2K46 A;  1PVC 2;  4P00 B;  4FFF A;  2ARB A;  3O0W A;  3OCP A;  4O61 A;  1PMH X;  3RZG A;  5F3E A;  1XRU A;  1C8N A;  3FX3 A;  1W9S A;  3I3Q A;  4XQD A;  4WM8 C;  4QKN A;  4C91 A;  1ZRF A;  4PIZ A;  2JB4 A;  1MEC 2;  4TYS A;  4MHU A;  1SPP B;  2Y64 A;  4A7Y A;  3ZDS A;  4BDV B;  1DQ5 A;  3THP A;  4LOS A;  3POS A;  3VZK A;  1BJQ A;  1JYC A;  1EPW A;  4PF1 A;  3IIA A;  3JB4 C;  1OF4 A;  1R1A 3;  1ENQ A;  1WD3 A;  4Q0U A;  4YG0 A;  5FZL A;  1VLN A;  4N9H A;  4AVA A;  3DXT A;  4DZG A;  3A4U A;  1HKD A;  1R09 3;  3OGV A;  1CIY A;  4L2N A;  4RA0 A;  2R06 1;  2BJS A;  1Y9G A;  5BNP B;  1AUY A;  2ZPX A;  1TZO A;  1ZZ7 A;  3BOW A;  1RL3 A;  1QOO A;  1ULG A;  3P1I A;  3ZMO A;  2BGO A;  2BV4 A;  2VC9 A;  1V9U 3;  2WDB A;  4IEZ A;  4IE0 A;  1LOE A;  1J1L A;  1OA2 A;  1YIP A;  1HRV 2;  1JZ6 A;  4NWV A;  2YC2 A;  1NLQ A;  5FZM A;  3LOB A;  5FZ9 A;  4LBQ D;  4XCA A;  3VZM A;  1RUO A;  3IWZ A;  4L92 A;  2VEC A;  1GP5 A;  4Q0P A;  2JDH A;  1LAJ A;  2OW4 A;  4Q26 A;  4LIT A;  1BKZ A;  5JAX A;  1O4T A;  3R4D B;  1XYP A;  5I0S A;  1H2L A;  2VZT A;  1PO1 1;  4QQO A;  2CGO A;  2WZR 1;  2BOJ A;  1O8P A;  1RHI 1;  4KWL A;  4NUB A;  2SBA A;  5IVY A;  4NHX A;  1C8M 1;  2CDO A;  1H6Y A;  2VE1 A;  3LAG A;  1OLQ A;  3LSE A;  4EWE A;  1HV0 A;  4P9L A;  4R9B A;  1LU2 A;  2HEW F;  1DCS A;  3K46 A;  4XDP A;  3UJO A;  4QPY A;  3ACL A;  5APA A;  3RYP A;  3ZXL A;  3O1S A;  3VBR C;  2YDE A;  4LLF A;  4O9G A;  3LFM A;  3X29 B;  1S0D A;  2AGS A;  2UWA A;  2GH2 A;  3VKN A;  3U14 A;  5CFC B;  3FUO A;  4TSV A;  2C6S A;  1Q43 A;  4W6W A;  4B29 A;  2JDZ A;  2ORX A;  2X09 A;  4UF0 A;  2YYO A;  2JDN A;  2B7Y A;  3MW4 A;  3VBF B;  2R16 A;  1QJU 2;  1WBL A;  1WCU A;  3ZIW A;  3KT7 A;  2PHD A;  5FCC A;  3VBH B;  1PK6 C;  2XDV A;  3P3P A;  1JTZ X;  2BVB A;  1SLC A;  2VW0 A;  1O3Q A;  3B02 A;  5CFD C;  1VE0 A;  2HKX A;  2GAU A;  2HWC 1;  4X6Q B;  4QX0 A;  4A6O A;  1LB2 A;  1KRI A;  5AFB A;  4A6S A;  5FP3 A;  2NLR A;  4OUE A;  3USU B;  3ZYB A;  2RJL A;  4LTA A;  1ENS A;  4UW6 A;  5CKQ A;  5DAW A;  5KWR A;  2FDG A;  4HN1 A;  1ZM1 A;  2JE7 A;  3WIN E;  2GP3 A;  5C4W C;  1XOY A;  5KC5 A;  5J36 A;  1T6B X;  1MS4 A;  3SC7 X;  3HQX A;  4L97 A;  2HWD 1;  1CQ9 A;  3LEM A;  4UFL A;  1AL2 3;  2SLI A;  3LZZ A;  2PTM A;  3POJ A;  4S2H A;  5A7W B;  1RIR A;  2Q8D A;  4D0Q A;  5AC9 2;  5IVF A;  4CXW A;  2DV9 A;  3SH5 A;  2ZML A;  1QNW A;  3ZYI B;  2FHR A;  1D4M 2;  5I8Y A;  1H6X A;  2QBX A;  5EPA A;  4MVT A;  5C8C B;  2Y6L A;  4KBZ A;  2Q8O A;  3PUA A;  1ULC A;  4PDW B;  4MH0 E;  4LO8 A;  1YHF A;  3NAP C;  5EP9 A;  3WQ1 A;  1AL0 G;  2VG9 A;  4Z2W A;  3FE5 A;  4JGZ C;  2JD4 A;  3WP3 A;  5A33 A;  2VGD A;  1SDW A;  1GU3 A;  2YB7 A;  5H9R A;  4DEV A;  1IS6 A;  2E51 A;  3AXE A;  4BQW A;  2VUA A;  3HQU A;  3IM0 A;  1UY1 A;  4FBF A;  2ZGS A;  3AZV A;  4IEQ A;  3FHA A;  4OMC A;  3ZN6 A;  1NA1 A;  1S0G A;  4XUO A;  2NZ9 A;  1ND3 C;  1HIX A;  4FP3 A;  1F15 A;  1O7F A;  5BNO C;  3WDU A;  3H1W A;  1UOJ A;  2JG8 A;  4IEU A;  4OI2 A;  3PJY A;  4PT6 A;  4LQR A;  1LJ7 A;  1V6N A;  2FQP A;  3WDT A;  4K9S A;  1W6N A;  4QX2 A;  4YVS C;  3VDC A;  4C1W A;  2QDN A;  4LEJ A;  4LXL A;  4UI9 L;  4D69 A;  4E2S A;  4EV0 A;  4AGR A;  4AXO A;  2P6C A;  1COV 2;  1DZQ A;  4IGQ A;  2ZAC A;  3WR0 A;  4RD7 A;  3LOI A;  3S7E A;  5ISL A;  4QPW A;  4D6R A;  4QHB A;  3VHP A;  3HQR A;  2VQA A;  5F3C A;  3JD7 1;  1UMI A;  2OA2 A;  1RTV A;  3QH7 A;  5IT6 A;  3WHT A;  1A3K A;  3OGG A;  2KM2 A;  4TXW A;  5FKC A;  2WN2 A;  5HCB A;  2PHU A;  1PO2 3;  1NCR B;  4DRR A;  1K5M C;  2O1Q A;  3EMR A;  4XJA A;  3MYX A;  2ZJC A;  5IK7 A;  3HMY A;  3AMP A;  4AED C;  4NII A;  1DZT A;  1RMU 3;  4Z1V A;  2PLV 2;  4IEW A;  4ITC A;  2YC4 A;  1QJY 1;  2DCY A;  4XZP A;  2ZX3 A;  1T6G C;  3CU7 A;  3BKZ A;  1VBC 3;  2ES3 A;  1YI9 A;  4UFI A;  4CPB A;  2GC2 A;  2XB6 C;  3WG3 A;  3IAQ A;  4R9C A;  5EV7 A;  4XQW A;  1VBE 3;  1HLC A;  2PQQ A;  2B45 X;  4NMI A;  4PLM A;  4LR4 A;  2HBU A;  2J22 A;  1QJE A;  2DUP A;  1AR7 1;  4NPM A;  5IVC A;  1EUT A;  1Q56 A;  2DU1 A;  2ZGO A;  1Z7S 3;  4BJ0 A;  3PVN A;  2WNV A;  3B7M A;  1QNY A;  1UKR A;  3QLQ A;  3ZO0 B;  2RS5 3;  2DCK A;  4EZH A;  2FCV A;  3PLQ A;  1JN2 P;  4Q8L A;  4R52 A;  3W5M A;  2R30 A;  3DXU A;  4A3X A;  2RMU 2;  5L73 A;  5HV4 A;  5LZ6 A;  3C7F A;  4OYU A;  4HVR A;  1H8T B;  1UU6 A;  3PHM A;  3D82 A;  4LKE A;  3ZSK A;  2VPV A;  1RGS A;  1NZC A;  2FDJ A;  2JWP A;  1RUC 3;  3LF7 A;  3FJS A;  4YW2 A;  3N9N A;  2HWB 1;  1LGN A;  1H0B A;  2UWB A;  4IET A;  4YGB A;  4UBH A;  3RYR A;  5I0U A;  5JXJ A;  1GP6 A;  1IGO A;  1PGW 2;  1RUJ 3;  2WFP A;  3I3E A;  3AKP A;  1VBA 3;  4SBV A;  1VRH 3;  5KXC A;  3TWI A;  5DQ0 A;  3IKW A;  4QQP A;  4AEM A;  3I2H A;  3BPZ A;  3MLK A;  3ZPO A;  1IPJ A;  2RS3 2;  4Y33 A;  3WZ1 A;  4DY3 A;  1HX6 A;  1RUI 3;  5I8T A;  1UIJ A;  5FXZ A;  3RVH A;  3ZX7 A;  2BU9 A;  3C7G A;  1LRH A;  2WO1 A;  4K40 A;  1XU1 A;  3J26 N;  3B69 A;  2R0F A;  2ZMN A;  3KV4 A;  2JIC A;  4ERO A;  4BME A;  3C7H A;  2PN5 A;  1QKQ A;  2DUR A;  2IFW A;  2RM2 3;  3PVB B;  3V0A B;  1EAH 1;  3OEA A;  3M3I A;  5FYM A;  1R08 1;  4B1L A;  2Q1Z B;  4CPB D;  4AFC A;  3FUQ A;  4XVH A;  4WM7 A;  5KXB A;  1BYH A;  4I0B A;  3H42 B;  1ZBA 2;  1XNA A;  2Q5T A;  5JPN B;  2BNM A;  3WF4 A;  4IL7 A;  2BUK A;  2IC1 A;  4NPL A;  1OQE A;  3ZM8 A;  4Z2A A;  2C9A A;  2O14 A;  4FOW A;  4RQP A;  4XTP A;  1O8S A;  3R0R A;  4AAP A;  1F2N A;  5JCT A;  1AR8 3;  2P4E A;  5AVA A;  4AI3 A;  4YZ1 A;  2G9Z A;  2O8O A;  3W21 A;  4XF0 A;  2D97 A;  1QIQ A;  2JG9 B;  2XVG A;  4KI5 M;  4WVM B;  4YM0 A;  2PHW A;  5FJH A;  1QJX 2;  3BTX A;  3LIG A;  3IMN A;  4MGQ A;  3CF6 E;  2D93 A;  5FZD A;  3VBS B;  1YLL A;  4GH4 C;  4IEO A;  1CON A;  4XDQ A;  1S0F A;  2QQW A;  3U4X A;  2WNE A;  4XAC A;  4ZU4 A;  3KVB A;  5FYI A;  1WCS A;  2Y38 A;  1GZC A;  2B39 A;  3THC A;  3T08 A;  1WD4 A;  1JUH A;  4YLZ A;  3ON7 A;  1TQ5 A;  3NJX A;  4P9X A;  4XF9 A;  4QKB A;  1W6Q A;  1QDC A;  2FDF A;  1EV1 2;  3MFC A;  4WVW A;  1YJK A;  3O0V A;  3RNS A;  3PUI A;  2Z2S B;  2VMC A;  2W95 A;  1LTE A;  4ATE A;  1GUI A;  1ND2 B;  5IAT A;  2RJ2 A;  5JIU A;  3UGH A;  1AZD A;  1UWW A;  1RXG A;  2VJX A;  5FPZ A;  1NE4 A;  4NN0 A;  4YVW B;  3CJI C;  4QDR A;  5HCF A;  3ZIX A;  1WCQ A;  1TE1 B;  2P1B A;  1PIV 2;  5HPO A;  4CDW C;  1W0O A;  5BNN A;  2ZGU A;  2WO3 A;  1SLT A;  4QXK A;  4K8R B;  1RUH 3;  4L11 A;  5EFU A;  3CBN A;  3N4M A;  4A2U A;  2W1S A;  2D6N A;  4EE2 A;  1YJL A;  2CGN A;  1AXY A;  2VH9 A;  2JKB A;  4D7T A;  1DF0 A;  4LBM A;  1MS5 A;  1BK0 A;  1PHM A;  1TMF 2;  1W6P A;  2HBT A;  3O14 A;  4JV4 A;  3WDV A;  3O1U A;  1AXK A;  4IW3 A;  4YWA A;  2JDM A;  5C3P A;  2GMM A;  4O9E A;  4BE3 A;  2WRA A;  3R4S A;  3VBU A;  3H3Z A;  5HCH A;  4XIL A;  2Q8C A;  5SV8 A;  1S0C A;  3BYW A;  2ET1 A;  5ABJ C;  1JOB A;  2JDP A;  2XH6 A;  2JX9 A;  1A34 A;  3RMY A;  3VZJ A;  1VBB 2;  3BB6 A;  3BI3 A;  3H1M A;  1NCQ A;  1F8V A;  4LKD A;  3H8U A;  2E26 A;  5C71 A;  2AH2 A;  2GC1 A;  3MFA A;  4RS5 B;  4CA9 A;  2WZP P;  1OHF A;  5C3Q A;  1V6M A;  5JXH A;  2OVU A;  1C3H A;  2B5H A;  3MIG A;  4BA6 A;  4AQ6 A;  3SHR A;  5BNP C;  2WFF 2;  2XJU A;  1R1A 1;  2R06 2;  5K0U B;  4P08 A;  1B35 A;  4FPK A;  3TRS B;  2QQJ A;  2RR1 3;  2BOI A;  2F6B A;  1WW6 A;  1ZRE A;  1RVF 1;  1OVP A;  4HSJ A;  5JIA A;  1R09 1;  4IV3 B;  4ARY A;  1W9W A;  4WVM A;  3VL8 A;  2P37 A;  2VOK A;  1NXD 1;  2F4L A;  4KGG A;  3PUS A;  2VAU A;  3R4U A;  4OMD A;  3ORJ A;  5EJZ B;  2WNU A;  4ONU A;  3F95 A;  1V9U 1;  4LHL A;  5HV0 A;  2IXL A;  4Y22 B;  2VVF A;  3IDC B;  5FZ6 A;  1ZBE 3;  4MET A;  1OMI A;  2XJV A;  2EF6 A;  1JHJ A;  4CUA A;  1PO1 2;  3CNA A;  2WZR 2;  2ZXQ A;  1W04 A;  1XE8 A;  4UW3 A;  1HB2 A;  1C8M 2;  5J48 A;  4PCR A;  2JJ6 A;  1OC1 A;  4MXV A;  5I0D A;  1UX6 A;  2PHL A;  1MQT B;  4XJU A;  2DCJ A;  4R4Z A;  1SFY A;  1RUE 3;  3ZPY A;  2XR4 A;  3CMG A;  3ZYR A;  2GN7 A;  4MGZ E;  4W4Z A;  4XTM A;  3NJY A;  3T4V A;  3VD5 A;  1SCR A;  3K2O A;  3WNL A;  1AXZ A;  4XCB A;  1JYW A;  4HPK B;  4CP1 A;  2VQU A;  1SBE A;  4XC9 A;  4BQ3 A;  1LUL A;  3V64 A;  4LK6 A;  5FO9 B;  5IJR A;  4M01 A;  2PYT A;  1L7Q A;  3MIC A;  2E31 A;  2VOW A;  4ZON A;  5FZ4 A;  4NIG A;  3WVJ A;  2DDU A;  4NRQ A;  2FDI A;  2LRP A;  3U07 A;  4LNV A;  1QDO A;  1BBT 3;  4HG6 B;  4Q4X 3;  5F5I A;  5IW0 A;  3WNK A;  5L19 A;  2VQT A;  3MLJ A;  1NUK A;  2HWC 2;  4XF4 A;  3GJA A;  5CNA A;  2WS9 3;  1QXP A;  5IFP A;  1CAU B;  4XJW A;  4I0W B;  1KXG A;  1W8U A;  4FP2 A;  2ZX1 A;  4O7X A;  4OCT A;  4OI1 A;  1W6O B;  3MUZ 1;  2ZGL A;  5K8S A;  2L9L A;  3UGF A;  2WNO A;  2Y34 A;  4FPH A;  1WBF A;  4MHR A;  4FI9 A;  4QWN A;  3SIS A;  5FZE A;  5ACA 2;  2MEV 3;  1E57 A;  1REF A;  4M3C F;  2W94 A;  1F31 A;  5FZO A;  2H6C A;  3W58 A;  5FZ7 A;  5A80 A;  3OSD A;  3WQB A;  2VBD A;  1AL2 1;  1WWY A;  3ZXG A;  1Y43 B;  1DLL A;  3VDD A;  3ILF A;  3FFQ A;  1JOJ A;  2ADE A;  1CJP A;  3AM2 A;  1Y3T A;  3S0M A;  2CL2 A;  4Q8K A;  1VP6 A;  2QE3 A;  3U4S A;  3KT4 A;  1JU3 A;  3AYC A;  1NYW A;  3MI8 A;  5EYX A;  4GZ9 A;  3APB A;  2CAV A;  3E97 A;  5KHH A;  2Q30 A;  4OHW A;  1V6O A;  5J37 A;  1O91 A;  2DVG A;  1FXZ A;  4JDM A;  3SCF A;  4YGC A;  4YW5 A;  5LEK A;  4XUP A;  1X50 A;  4WM8 A;  5E1R A;  5BY5 A;  2WKK A;  4NAO A;  3RWN A;  5JOW A;  1K42 A;  3LEK A;  2CU5 A;  3VBU C;  1LEN A;  1MS3 A;  3JQW A;  3D0S A;  1LU1 A;  3C8X A;  3OY8 B;  3AMM A;  3M4F A;  3RS6 A;  4E4D X;  1C5H A;  1WW4 A;  4AI1 A;  4QQH A;  3TAY A;  1X8M A;  2R04 3;  4E4Z A;  1TNR A;  2ZX0 A;  3ABZ A;  1GYK A;  3G6J B;  3LE0 A;  4JX0 A;  3S7I A;  5FYZ A;  4IV1 B;  2R07 1;  2Y0I A;  2E7A A;  3N3H A;  5F5C A;  4JZR A;  1DGR A;  1VIW B;  2A6V A;  4ASK A;  1ZZ9 A;  2YGL A;  4GB3 3;  3JD7 2;  1MZ5 A;  1AVB A;  2GNB A;  2OT7 A;  1LHO A;  1P8J A;  1UZV A;  1UAI A;  1U5X A;  1V0A A;  2ZHL A;  1DQ4 A;  1IG3 A;  1LOA A;  4HKW A;  3NNJ A;  2V4A A;  1EUU A;  4HK8 A;  5A3O A;  1HRI 3;  4CCO A;  1O3R A;  2JKX A;  1PO2 1;  4FPJ A;  2XHK A;  5A7P A;  1LR5 A;  5JSP A;  1ENR A;  1UXX X;  3FLT A;  1J1T A;  1UYY A;  1QJY 2;  1AJO A;  5FZK A;  3AXD A;  4UFM A;  1RMU 1;  1D2S A;  3HOB A;  4DUV A;  3GBW A;  1DYO A;  2JIG A;  2RHP A;  2P34 A;  2YGM A;  2NM1 A;  3ELN A;  1VBC 1;  1CAV B;  3IBM A;  1W2T A;  2Y6H A;  3FMG A;  1SAC A;  4ISR A;  2E63 A;  3POE A;  3JUU A;  4QDS A;  1V00 A;  1LOB A;  4DFS A;  3ALQ A;  4COW A;  1VBE 1;  1W28 A;  3OBZ A;  4QPI C;  1UCX A;  1N3O A;  2X10 A;  3M8L A;  5FYC A;  4CU9 A;  1M06 G;  2EAL A;  1XYN A;  1PK6 A;  4IND A;  3PIG A;  4W8J A;  3PTY A;  2YY1 A;  1Z7S 1;  2W9X A;  4U2A A;  5FZI A;  2VCB A;  5FZF A;  2VUC A;  3PUH A;  1FI2 A;  4JGY B;  2RS5 1;  2RG4 A;  2UYA A;  4DPN A;  1BEV 2;  3GCW A;  3B3Q E;  4GJZ A;  5A32 A;  1YFU A;  4CRQ A;  5K4L A;  4V1P A;  2XWB B;  3ME2 A;  5BPX A;  5C4W A;  1MR5 A;  4I3P A;  4BIS A;  1NAE A;  2KA3 A;  2HWB 2;  3I7D A;  4LO6 B;  2GC0 A;  1ST8 A;  3ZKU A;  2NN8 A;  2ZHK A;  1AR6 1;  1RUC 1;  3OOX A;  3PJQ A;  4NJ4 A;  3E1F 1;  1OQ1 A;  4LA2 A;  2JB8 A;  4UBG A;  2GU9 A;  4GXL A;  3OB8 A;  3GNE A;  1RUJ 1;  1TNF A;  1WLC A;  1DQ1 A;  1UU5 A;  1VBA 1;  1VRH 1;  3LA7 A;  1STM A;  3WG4 A;  4YSF A;  1YRZ A;  3K51 A;  4AAX A;  5JZG C;  3LDK A;  3NAP A;  4H3W A;  5IK5 A;  1GFF 2;  4LBO A;  3N9L A;  4JGZ A;  1WA6 X;  4E8D A;  1OH4 A;  1RUI 1;  3K77 A;  4OFG A;  1ZZ6 A;  1H9W A;  4YFW A;  4YM2 A;  4EN0 A;  3NO8 A;  4OUM A;  3OPW A;  4B8E A;  3OBR A;  1XYO A;  4AFA A;  4GWJ A;  3WF0 A;  4I02 A;  4FOV A;  2DU0 A;  3NV2 A;  4XJ9 A;  3VD3 A;  1AYN 2;  2VQ0 A;  3KGL A;  3WG2 A;  4XET A;  1R08 2;  2HWE 1;  3J7N A;  5FO7 B;  1W90 A;  5F6L B;  1OLM E;  4IUG A;  5EZW A;  2RM2 1;  2XBO 2;  4FQ4 A;  1ND3 A;  2GME A;  3U10 A;  5BNO A;  2RDS A;  2OQ7 A;  1UNB A;  4XFC A;  4Y5S A;  3CQO A;  3R05 A;  1AYM 3;  2HLE A;  4XFA A;  1JYN A;  1NXM A;  1UOG A;  2PMW B;  4FPG A;  4I0A A;  1QXJ A;  1KS5 A;  3I2I A;  3MIH A;  3VZN A;  3ZKY A;  5CBL A;  1LOF C;  2AR6 A;  1GNH A;  4YVS A;  1NLS A;  2VZR A;  3A23 A;  1LKN A;  4QXB A;  3GHM A;  1UZ0 A;  5B4N A;  2BFU S;  2ZEY A;  4MOA A;  2BBV A;  4K1Y A;  3IAP A;  1C4R A;  3UES A;  1AR8 1;  4AE2 A;  1IPS A;  2BWA A;  1OPM A;  3ACI A;  1WLD A;  3QCW A;  4HBN A;  5A7S A;  5A7O A;  5FOJ B;  1W0P A;  4JAA A;  2GP5 A;  2HWF 3;  1K5M A;  3UET A;  1FYU A;  2FZ2 A;  3VGI A;  1WW5 A;  3DN7 A;  4KH9 A;  1VMF A;  1W03 A;  1APN A;  3EBR A;  5B2G B;  2IFR A;  4QPG C;  1J3P A;  1QWR A;  4R4X A;  4OQ8 A;  3VKM A;  4FPC A;  2XL7 A;  2NMN A;  3SH4 A;  5L9V A;  3ZSM A;  4CXX A;  1FMD 2;  2VM9 A;  3CEW A;  1N3P A;  4IEY A;  4J1X A;  1S4C A;  1KDK A;  2NMO A;  2ZGQ A;  1W8N A;  3TB0 A;  3VD7 A;  4AVV A;  3VKO A;  3K3O A;  3OBA A;  2QVS B;  1GQH A;  1TME 2;  3E5X A;  3HBK A;  3SEP A;  1EPZ A;  5HXM A;  3E6C C;  4CU7 A;  2CY6 A;  5A1F A;  5J3U A;  1XJA A;  4CYD A;  1VJ2 A;  1FPN 2;  3LPG A;  4QB1 A;  2PA7 A;  1E5R A;  1KIT A;  5CU1 A;  5FBZ A;  5FY5 A;  4UF0 B;  3WW1 A;  1XXN A;  2RDR A;  4DMI A;  5GLV A;  2WJS A;  1PX4 A;  3FLR A;  5F37 A;  2Z69 A;  1IHM A;  4OHX A;  1OSG A;  1WZX A;  4MLO A;  1IOA A;  4J1W A;  4A41 A;  1RUH 1;  2X5I C;  1LHU A;  5KR7 A;  3ILR A;  3GGL A;  1V6K A;  4LHS A;  4YGE A;  1POV 0;  4KWJ A;  4EN8 B;  2QQO A;  1QF3 A;  4WV8 A;  1H4G A;  4YFZ A;  2MHF A;  2BVV A;  2VW2 A;  3N7K A;  5FUP A;  5FYU A;  5FK7 A;  4AW7 A;  3JCI A;  1ULE A;  1CIW A;  2OKX A;  1UU4 A;  2C24 A;  2MNG A;  5SV5 A;  3OTF A;  2R6Q A;  3QOP A;  3ZYH A;  2VMF A;  3CHX A;  2VW1 A;  4YZ4 A;  4ORF A;  1EY2 A;  4RS5 C;  4BIF A;  3J8F 3;  5FXW A;  4LO4 B;  2VY0 A;  4AHZ A;  4ATF A;  4WVV A;  2ZZJ A;  5LY2 A;  3VV1 A;  5JDB A;  1WLW A;  5F8P A;  1ASJ 1;  2Y60 A;  3RI8 A;  1RVF 3;  4P02 B;  1YFX A;  1OA4 A;  1HN1 A;  4IV3 C;  3H1Y A;  2Q4S A;  1DQ6 A;  4Q0V A;  1DZR A;  1W2O A;  5JMC A;  1VR3 A;  3KCX A;  4F3J A;  2LM3 A;  4TTG A;  3AVR A;  2RR1 1;  4LBN A;  1VBD 3;  1FNZ A;  5A33 B;  3AKS A;  3UKV A;  3PDQ A;  3VKL A;  3O1P A;  5C8W A;  2QJV A;  2CYF A;  2QQN A;  2DTY A;  1F4H A;  3ZR5 A;  1U0A A;  1V9U 2;  2HH9 A;  3DPR C;  2BZD A;  4CU6 A;  2BGC A;  4XOG A;  1TG7 A;  4MGI E;  1NA1 B;  5FYB A;  3ZN6 B;  2WYS A;  4O65 A;  2K2S A;  4XXA A;  1ZBE 1;  2JG8 B;  5JWP A;  1E5S A;  1U5I A;  2Y6J A;  4XIK A;  2ATF A;  2UU8 A;  1W6N B;  1HRV 3;  3C3V A;  2HEV F;  1RJ8 A;  3MIF A;  4FPL A;  2DVB A;  1WKY A;  2PQS A;  1R64 A;  5I0T A;  1K45 A;  3A22 A;  1BVP 1;  3T3Y A;  3KHC A;  5LY1 A;  1OBN A;  4Q2F A;  1RUE 1;  2XWJ B;  4N53 C;  2VCM A;  3AVS A;  5EYY A;  3UT0 A;  3B01 A;  1OFS A;  1HB1 A;  3LEI A;  2PHX A;  5F2S A;  1PGL 1;  3ILN A;  3B5L B;  2IUW A;  4BQ1 A;  5L7O B;  3V56 A;  4GWM A;  1D2Q A;  2TNF A;  3MIB A;  3FZ3 A;  1MS0 A;  2C4X A;  3NVC A;  1W9T A;  1BCX A;  2WC2 A;  5FZ8 A;  3JBG 2;  2ILM A;  1BBT 1;  3UKT A;  4Q4X 1;  2A3X A;  2YUE A;  3H9A A;  2FZ1 A;  3JXS A;  3LDB A;  3O7O A;  1S2B A;  4XFF A;  2A71 A;  5FQ0 A;  2DYC A;  2WS9 1;  4RFT 0;  2DF7 A;  1RUG 2;  1VAL A;  4N7I A;  2OS2 A;  2X53 S;  5C5U A;  3CJI A;  4NRM A;  1KJR A;  1O3S A;  4CDW A;  3KHB A;  1F5J A;  4FOQ A;  1AL2 2;  1UYZ A;  2MEV 1;  2VNO A;  1JBC A;  3DYP A;  1W8H A;  2WNV B;  3L2H A;  4HET A;  1SDD B;  5FY1 A;  5F3I A;  1OA3 A;  1G6N A;  2P5B A;  3KCC A;  3NNM A;  5BYN A;  3MW2 A;  3U1X A;  2O0O A;  3WDX A;  4CDU C;  2UUR A;  1XPW A;  5DAX A;  3EHK A;  1J84 A;  1RUF 3;  1JYI A;  4HXC A;  1GZ9 A;  4W50 A;  3U78 A;  1S0J A;  1YQ2 A;  2QCS B;  5DDJ 2;  3MUY 1;  4Q1P A;  5I8S A;  3KM5 A;  5AC9 3;  1SFP A;  3P5B A;  1LEC A;  1J83 A;  3WDW A;  2GH8 A;  4BK5 A;  3FFZ A;  5ABJ A;  4CUG A;  4BMB A;  1D4M 3;  4RN5 A;  5JOY A;  3BU7 A;  5T5P A;  4IE4 A;  4N43 C;  1YI7 A;  4HL0 A;  4BYY A;  3MO4 A;  1I5P A;  2YFU A;  4GKY A;  1YXW A;  3PUQ A;  5I91 A;  4NRO A;  3O1O A;  3T0D A;  2A3Y A;  1BMV 1;  1VMJ A;  2DUQ A;  4YRD A;  5LBE A;  3I3D A;  3NKT A;  1PX3 A;  2R07 3;  2HEY F;  4LOR A;  4NHY A;  3HD8 B;  4IV1 C;  3W9A A;  5GZE A;  2DVF A;  3ACH A;  2ZKN A;  4CEY B;  3H3L A;  1KS4 A;  3GBG A;  1SLB A;  1JOD A;  2R04 1;  1OXC A;  2K0G A;  2TBV A;  1PGS A;  2VR4 A;  3DKW A;  4Y20 A;  2CNA A;  3J7M A;  1XSR A;  2R1D A;  1SLA A;  2OZJ A;  3I2G A;  5FUN A;  1UW8 A;  1AX2 A;  4AGV A;  3MW3 A;  4ZXK A;  4CDX C;  4UFJ A;  4CCJ A;  2EID A;  3AFK A;  5JOZ A;  4GB3 1;  5FDB A;  3KZ4 C;  1IS5 A;  1WCD J;  4FPO B;  5L7O A;  3FL7 A;  1D0H A;  2QKD A;  2R49 A;  2GZW A;  2Y8K A;  3ZOI A;  4CEW C;  3ZXJ A;  4F8A A;  2BW8 A;  3QD6 A;  4WM7 B;  5E89 A;  1SHW B;  2JEM A;  4NR1 A;  1H1I A;  1COV 3;  4XBL A;  1HRI 1;  5T54 A;  2W08 A;  4YAR A;  5GJ6 A;  1N1T A;  4N8M A;  3AZY A;  4PI2 A;  1Q8O A;  4GMP 0;  3VB9 A;  2ZGT A;  5FP4 A;  1RXF A;  4RQP B;  5GZD A;  2WO7 A;  3SMH A;  3ZFE C;  1LGC A;  3VBO C;  4Q4W 2;  1I1E A;  5DMY A;  2EXK A;  4GJY A;  5E8A A;  3M1H A;  3BGA A;  3ZDV A;  5LBF A;  1N3Q A;  4QXC A;  5LA2 A;  2ZHN A;  4UOJ A;  3IZO A;  4IEV A;  5LK5 A;  4GMP 1;  1Q8V A;  3ZFG C;  1OFN A;  4R9D A;  2C5D A;  2LTN A;  4TLG A;  1VBE 2;  4ASM B;  1CJD A;  2OPK A;  2J42 A;  2GMP A;  1Q8P A;  3WW2 A;  2C0Z A;  3JU9 A;  1V70 A;  3KCY A;  1KDM A;  1Z7S 2;  4DY5 A;  3IMM A;  3HJR A;  1JUI A;  3BIW E;  3UL2 A;  4LT5 A;  3TEZ A;  3I2O A;  4LKF A;  3I59 B;  4KL1 A;  1R1Z A;  3FHQ A;  3RI9 A;  1W6Q B;  1OPO A;  4CCL A;  4RR3 C;  5K9Y A;  3I3M A;  4FAG A;  3SH3 A;  1RED A;  1VAV A;  3KLS A;  5H9S A;  4HMZ A;  2XHN A;  1AR6 3;  4ZXE A;  3RZK A;  1OLM A;  1XSQ A;  2JDY A;  3WUC A;  1RUD 2;  3Q8B A;  4MZU A;  3AP6 A;  5FPB A;  1V6J A;  4JKK A;  4KU7 A;  4BB3 A;  3POG A;  4Y1Z A;  5BNN B;  3POY A;  1GMM A;  1LCL A;  4Q4V 2;  2GND A;  1W2A X;  1HXS 2;  3K4D A;  2I74 A;  3ZFF C;  2WA3 A;  3NV4 A;  2QTW B;  1QJZ A;  2W1U A;  1VBA 2;  4CEY A;  1VRH 2;  2NQY A;  1AR9 2;  2XGX A;  2N7G A;  1LOD A;  4XFI A;  3IPV A;  1W6P B;  2UY8 A;  2YHJ A;  4PLO A;  3AZX A;  3PUR A;  3UGG A;  2WWS A;  4XXP A;  3J9S A;  5DPN A;  3WG1 A;  2D5F A;  4I30 A;  3VBU B;  2J1A A;  1O4Y A;  4PIX A;  5A7Q A;  3POI A;  2HWE 3;  4CE8 A;  1Y9M A;  1BZW A;  4XPV A;  1DG6 A;  5IWF A;  2QDR A;  4AOC A;  1XE7 A;  1G9D A;  5ANQ A;  5JSO A;  1N1Y A;  1SBD A;  3IDE A;  2E6V A;  3J7L A;  3LGR A;  3GJB A;  3ZSJ A;  1KFU L;  3DV8 A;  4JRL A;  1KGY A;  3U0Z A;  1NCQ B;  2DWR A;  2RS3 3;  4HSL A;  4Y5T A;  4COZ A;  4CP9 B;  2BNO A;  3N9P A;  3W20 A;  2LAL A;  4MO3 M;  4DS0 A;  1RC6 A;  1YIF A;  2R7E B;  2YV8 A;  3ES1 A;  4CDQ C;  4NPR A;  3E6D A;  5CG9 A;  3J4U H;  3AP7 A;  4QX7 A;  4GAZ A;  2G4I A;  4D3W A;  4AQS A;  3OYW A;  3RZL A;  1L7L A;  1NY7 1;  1AYM 1;  2WSV A;  4M0N A;  1ZRD A;  5JXI A;  5IK8 A;  1B35 B;  1AF9 A;  1IG0 A;  2ARE A;  2WT0 A;  2J1T A;  3HT2 A;  1OVS A;  4QGL A;  3AJY A;  1GP4 A;  4CZS A;  1AR8 2;  3DF0 A;  3FHI B;  3VN4 A;  4PBO A;  1XNB A;  1HB3 A;  2EIG A;  3FN9 A;  3Q8A A;  4L0P A;  5C3R A;  3NRU A;  2H0V A;  4YZ5 A;  2WNU B;  2VU9 A;  5ERL A;  4ZZ8 A;  1G7Y A;  1OKQ A;  2BEO A;  1JYT A;  3M3Q A;  3WF2 A;  2ZAB A;  2HWF 1;  5CZK A;  2J1V A;  2OYZ A;  5D8A C;  2ZBJ A;  3I59 A;  3RZJ A;  5IAV A;  4KBB A;  2W87 A;  2PXJ A;  3LA2 A;  4K21 A;  4AYU A;  3WX5 A;  1SG3 A;  4CP2 A;  3HEI A;  5T5J A;  2EXI A;  3TN9 2;  2D6O X;  1OOP C;  2TEP A;  1LOC A;  4RHV 2;  3VDB A;  3NV3 A;  3C7E A;  4C0B A;  2FDK A;  3BPS A;  1UZY A;  1DGL A;  3AK0 A;  2JDA A;  1RB8 G;  2IXH A;  4MUV A;  3ENR A;  1MPX A;  2AYH A;  2VTF A;  4K6B A;  4E2Q A;  2WWU A;  4QPI A;  4UXA A;  2RS1 3;  5C9A C;  1YYN A;  1EV1 3;  3MF6 A;  1PZ7 A;  3SQO A;  4I3G A;  2DVD A;  5GAL A;  4KQ7 A;  2B9V A;  4PBP A;  4QT6 A;  4ZU5 A;  2J1S A;  1FV2 A;  3FLP A;  4N9I A;  3NL1 A;  1WCK A;  4BLJ A;  2BPA 2;  1K3I A;  3WNP A;  1GQG A;  2B8M A;  4Z07 A;  2KD7 A;  1GSL A;  1POV 3;  4NOT A;  4L9B A;  3VD4 A;  3OGJ A;  4IDZ A;  2E33 A;  1JOP A;  4ES8 A;  5GZF A;  5GLT A;  4CP9 A;  2D6L X;  1ZZB A;  3WP4 A;  1J58 A;  4XF1 A;  4XMA A;  1XNT A;  2OUH A;  1TMF 3;  2C26 A;  2XQR A;  3CO2 A;  1ASJ 3;  4CXY A;  1UOF A;  5FZO B;  2BNN A;  4CCN A;  4LJH A;  1QQP 3;  3J8F 1;  3D6E A;  2YBK A;  3VDD B;  2ARC A;  1PM4 A;  3GXU A;  1LHV A;  3RZM A;  2AUY A;  3D4K A;  5JZG A;  1FOD 3;  3WT3 A;  1JS9 A;  2JEN A;  3UYJ A;  3VDA A;  5JPM B;  1RYY A;  4PQQ A;  1VBB 3;  5FYV A;  2AAC A;  1LGB A;  4OHZ A;  3D5O A;  4QMA A;  4XUT A;  2O8Q A;  3UJQ A;  2XL9 A;  3QAC A;  3AMH A;  1JYX A;  3WY6 A;  1RIN A;  1F35 A;  1X33 A;  2Z4F A;  4XUN A;  2B46 X;  2XUM A;  4EJR A;  1MEC 1;  2JDK A;  3INA A;  1UD1 A;  4UFK A;  4BM8 A;  1KJL A;  4WM8 B;  1ZX5 A;  1VBD 1;  4TZD A;  3WCR A;  3HWJ A;  4IQP A;  2YPD A;  5JUV A;  2OQ6 A;  2JG8 C;  5JR7 B;  1OQD A;  4D6Q A;  4HLT A;  1RHI 2;  2W1Q A;  3DUI A;  5CIR A;  3GF6 A;  1H2M A;  2VBB A;  1W05 A;  4B7K A;  2QQU A;  1JZ4 A;  1EP0 A;  1LOF A;  3SCH A;  2AEN A;  1Y9Q A;  1YO8 A;  3B9C A;  4Q27 A;  4YM1 A;  4LBJ A;  3OPZ A;  5CFC C;  4M3C E;  1HRV 1;  2FCU A;  1G9A A;  4B7E A;  4XFB A;  1RJ7 A;  3VBF C;  4ZY9 A;  1NQJ A;  1W2U A;  1PGL 2;  2VZ3 A;  4KGQ A;  1D0G A;  3VBH C;  3WD5 A;  5CA6 A;  4IEX A;  3BOP A;  3G7D A;  4DQA A;  2XLF A;  4QPG A;  4UT5 A;  4BU2 A;  4BPZ A;  3ETQ A;  3ZN5 A;  3NW4 A;  2IVJ A;  3AMN A;  5FO8 B;  3AKT A;  1OUX A;  1OD3 A;  4IE5 A;  5D1I A;  3WNN A;  1BXH A;  3H50 A;  5DZG A;  2XG3 A;  2G9F A;  3D8C A;  4MYE A;  4XAA A;  1YQ8 A;  3S6P A;  2RV9 A;  3WNO A;  3VBR B;  1GZW A;  3KMH A;  2HWD 2;  3JZV A;  4CCD A;  5FYS A;  2VTX A;  5T52 A;  2IVI B;  5K7P A;  3FWE A;  5J96 B;  3TEY A;  1NZI A;  5C8C C;  4QD2 A;  2Y6K A;  2YZ4 A;  3T1L A;  2NYY A;  4BQY A;  4PDW C;  2XVK A;  2ZGK A;  1ULO A;  2X5I A;  3ZXE A;  1PK6 B;  1DBN A;  1UO9 A;  1C5I A;  2OII A;  4Q4Y 3;  3OBT A;  4GA9 A;  5CFD B;  4M00 A;  1UOB A;  1VRB A;  4CCM A;  5B4X A;  5ACA 3;  2ZGR A;  4G4F A;  2WBK A;  4AI9 A;  3AFG A;  5CB7 A;  1RUF 1;  2FDH A;  5A32 B;  1S2E A;  2A1X A;  3THD A;  2EIB A;  4V2W A;  5I0R A;  3BTZ A;  5DAB A;  5C4W B;  4NRP A;  3AL6 A;  2A3W A;  3RPQ A;  2AEZ A;  1W9Y A;  5AC9 1;  1XB9 A;  3SNM A;  4JCK A;  2I2S A;  3KGZ A;  1D4M 1;  4JRA A;  4XJZ A;  1YQC A;  4A42 A;  4UWD A;  4CCC A;  5J7M A;  5LK7 B;  1QOS A;  2YPJ A;  3B93 A;  1S2K A;  4MSV A;  1RUN A;  2QQV A;  1CAX B;  5EJ1 B;  1MS1 A;  1WUV A;  5G04 L;  2VMH A;  5GM0 A;  3ZN4 A;  2R04 2;  5FOB B;  2GNM A;  2WT2 A;  1WGP A;  2D44 A;  4LKS A;  3NAP B;  1HQL A;  1O59 A;  3AC0 A;  2VZU A;  3NKG A;  2A7A A;  4JGZ B;  4MGT A;  3TEX A;  5IVJ A;  4A7Z A;  4C0H A;  5EHD A;  2DCT A;  4XBQ A;  2CSG A;  3O1T A;  1CN1 A;  1NCR C;  1Y7B A;  5F3G A;  4B4Q A;  5FLI A;  4JDN A;  4BQX A;  4JQR A;  2DBN A;  2EVX A;  2VL4 A;  4CCK A;  3DPR A;  5FZA A;  1NX9 A;  3GHN A;  5FY8 A;  1A8D A;  3RRD A;  3WHU A;  1CZS A;  2BBA A;  4CTE A;  1CZT A;  2W39 A;  3H0O A;  2Q1M A;  4J6G A;  5CIS A;  1GOH A;  1ND3 B;  2R1B A;  3HT1 A;  5BNO B;  5C6C A;  2ZS6 B;  1QJF A;  2YMZ A;  4ZS2 A;  1QH7 A;  1WME A;  4ZU7 A;  2FMD A;  4P9W A;  3PIJ A;  4AVT A;  3F2Z A;  1IS3 A;  4YVS B;  1COV 1;  1GR3 A;  4MGS A;  1Q5O A;  2DCZ A;  3HNM A;  1YQ5 A;  3VBR A;  5FZ3 A;  4GMP 3;  3RWK X;  1SEF A;  1C1F A;  2VMG A;  4N53 A;  4XUQ A;  3MV0 1;  2RE9 A;  4QX8 A;  5FP8 A;  1GZT A;  1AR7 2;  2G9G A;  2DUO A;  3B94 A;  4I01 A;  1DIW A;  1K5M B;  1CX1 A;  5FMD A;  1MS9 A;  3K4Z A;  2A5Z A;  3ITQ A;  4AED B;  1ACC A;  4FFI A;  3SIT A;  5CFD A;  1H8T C;  2JXA A;  3ZYP A;  2XKP A;  3LEG A;  4JQT A;  1IQA A;  3VHR A;  4AK3 A;  5A3L A;  3EXU A;  2J1E A;  2OZ6 A;  2VO5 A;  3RDI A;  3WCS A;  2QFE A;  3HPN A;  2HYK A;  4MX3 A;  1LES A;  2WZE A;  4AEJ A;  4DUW A;  1OLR A;  4Y1U A;  3PU3 A;  4OUS A;  3GDB A;  3PTR B;  1G8W A;  1TEI A;  4GKX A;  1MVQ A;  1GBG A;  3ETP A;  4UW4 A;  4XAB A;  5FLH A;  4PHZ A;  4RGA A;  3V0B A;  1KQR A;  1US3 A;  5BUV A;  3RZH A;  1JYV A;  2YU1 A;  2BFU L;  2XJS A;  1CPN A;  4D94 A;  1W2N A;  3NWK A;  5DUW A;  3ZSL A;  4Z8B A;  5KHJ A;  5A3T A;  4IE6 A;  4IGP A;  4XBN A;  5IUQ A;  4AZZ A;  3BTY A;  5KC6 A;  4COU A;  2VOX A;  3NNG A;  1BEV 3;  1CAX A;  1QY4 A;  5BXX A;  3GZT B;  3DEM A;  3GCX A;  3DCQ A;  5FV3 A;  4CDU A;  3BU0 A;  2QQM A;  2WLQ A;  4FO9 A;  4MGY E;  1I5Z A;  1DLC A;  3A0K A;  4JDO A;  1C57 A;  1LHN A;  1ALY A;  1UPI A;  3ACG A;  4K20 A;  2P3Y A;  3LQC A;  3IDA A;  1NCQ C;  1EAH 2;  4D6S A;  3T2O A;  4N43 A;  2BYV E;  1PGW 1;  1US2 A;  4NAM A;  5DAP A;  3UKN A;  5A3P A;  3OG2 A;  1F9K A;  2ET7 A;  5JLV A;  4LHK A;  1JZ2 A;  4MXW A;  5F5Q A;  5LRR A;  2TUN A;  3KV9 A;  2AZ5 A;  4LOT A;  3WOG A;  2D40 A;  2XQX A;  2RS3 1;  5FMO L;  4A4A A;  3NJV A;  1UMZ A;  5FPU A;  1NY7 2;  5J09 A;  3AX4 A;  5AVP A;  4GAL A;  1QHD A;  5FJK A;  2JG9 C;  1AYN 3;  1QH6 A;  3DGT A;  4FXG B;  4OHV A;  5C3S A;  1JXN A;  3I4I A;  3VBS C;  1A8M A;  5EIY B;  3ZXK A;  2XBO 3;  1ONA A;  4JTN A;  2D7F A;  3U75 A;  4CDX A;  5C7G A;  2A73 B;  1W9F A;  3KQR A;  4ET7 A;  2ARA A;  5DZE A;  2P2K A;  2FBE A;  4XW3 A;  5FZH A;  1UL9 A;  2A75 A;  4CEW A;  2HWF 2;  3K4A A;  3M7A A;  4IEP A;  4AED A;  3MGU A;  1W06 A;  5IVB A;  5FRE A;  1OI6 A;  5F6K A;  5A6Z A;  1MZF A;  4DIQ A;  3AYE A;  1T2X A;  2WR9 A;  3WP5 A;  1RIT A;  5FFO C;  5GLU A;  2LS6 A;  4YW4 A;  2QQP A;  1ND2 C;  2YBS A;  3ZFE A;  2DTW A;  3VBO A;  4XFG A;  4YVW C;  2VMD A;  3W5N A;  4DEQ A;  3SLI A;  4CSW A;  1K5J A;  1YFY A;  2Y6G A;  1VB4 A;  2GNT A;  2A6Z A;  3NST A;  4HZF A;  3VHN A;  1E5I A;  1UX7 A;  3CKH A;  2PAE A;  3ZFG A;  4GH4 B;  4LIU A;  3C2U A;  1UN1 A;  5FMO S;  5A3M A;  2P17 A;  2Y6F A;  3I3B A;  4E4H A;  1UMH A;  1W6M B;  3WXP A;  1FMD 3;  1O3T A;  4Y4Y A;  1S0E A;  3TYJ A;  4BIO A;  1X8E A;  3M3C A;  2RS1 1;  2W68 A;  2P3I A;  2VMI A;  3CL1 A;  1SMV A;  5T3N A;  1EV1 1;  5IK4 A;  2JE9 A;  2OPW A;  2VZO A;  4LBQ A;  3N35 A;  4B4P A;  2EXJ A;  2PHR A;  4ISQ A;  5CVR A;  3AYA A;  2VCC A;  2QQL A;  4RR3 A;  1LEM A;  5H9Q A;  4RYD A;  3GZU C;  4QKD A;  2FD8 A;  4YW6 A;  4AQ2 A;  3BIE A;  2LUW A;  5FQ0 B;  5IYY A;  1D7P M;  1XNC A;  3RGB A;  3J7H A;  1L3J A;  1AJK A;  2ZZQ A;  1S55 A;  3CJI B;  2I07 B;  2D6K A;  1DFQ A;  1GIC A;  3AL5 A;  4JHT A;  1POV 1;  2RDN A;  5A1A A;  1GV9 A;  4E8C A;  4CDW B;  1NKG A;  3ZR6 A;  2VNG A;  4QDQ A;  2W91 A;  1LNS A;  3VDD C;  3ZFF A;  4DB5 A;  3KB5 A;  2E7T A;  5K0U C;  2ZOE B;  1TMF 1;  1PVC 3;  4EYU A;  3A21 A;  1R1A 2;  2VUJ A;  5JI7 A;  1QQP 1;  4W65 A;  1YQ6 A;  4M3C A;  1RVF 2;  3SKV A;  4AI0 A;  1R09 2;  3HNB M;  2CHH A;  4ARX A;  1GLH A;  1OUS A;  1MEC 3;  4D7Y A;  1FOD 1;  4C90 A;  2OX0 A;  5DUX A;  1UKG A;  1VBB 1;  2WWJ A;  4W6Y A;  3TNQ A;  5ABJ B;  4LUM A;  3PL0 A;  4HVQ A;  4CVU A;  1VBD 2;  3MBW A;  1DHK B;  4GUL A;  3ZMN A;  4BWO A;  4C1X A;  1OUR A;  3WEZ A;  4LE4 A;  5LBB A;  2QZ2 A;  1X7N A;  3A7Q A;  5F39 A;  2A6X A;  1NQD A;  3IB3 A;  4FFG A;  2ZHM A;  4CDQ A;  2B9U A;  1H2K A;  1UY3 A;  2WFF 1;  4AVB A;  1MQT C;  2W5F A;  3WUD A;  5IAX A;  5GKA C;  4NHK A;  5LCW L;  2W52 A;  5LA1 A;  3N9Q A;  3C7O A;  1GAN A;  1S1A A;  3N9M A;  4Y20 B;  3OEB A;  4CU8 A;  2W3J A;  5FXX A;  2MPF A;  1ZVF A;  1X9P A;  3KSC A;  4NHL A;  4AFB A;  5CEH A;  4QHZ A;  1YEW A;  5FP7 A;  1Z0H A;  2BRT A;  4AHW A;  4LMF A;  4QGN A;  3ACF A;  4GH4 A;  4WZF A;  1GOG A;  1XND A;  4YG3 A;  4HVO A;  4R9A A;  5HXV A;  4DUX A;  1IQD C;  1W6M A;  3PME A;  2P3K A;  3BOD A;  4Y3O A;  4AI2 A;  4KWU A;  4SLI A;  3NNF A;  2PHF A;  5EQU A;  4AEK A;  4LBK A;  2ZTN A;  1GNZ A;  5D8A A;  2WQ8 A;  1H8V A;  3PVE A;  5T55 A;  4W6X A;  2ZGP A;  4E9K A;  3KVA A;  1CVN A;  4OI0 A;  1OOP A;  5JR2 A;  3OUI A;  3O1M A;  1DGR N;  1MVE A;  2Y33 A;  4LUK A;  5FMC A;  3KV5 A;  1QJU 3;  4FT8 A;  2KR2 A;  2E53 A;  4A7K A;  3RJR A;  1CWP A;  3BVC A;  5A1L A;  4EZ4 A;  4QX1 A;  1Y4W A;  4NO4 A;  3LDR A;  2RDQ A;  5T5O A;  4BZ4 A;  3JBG 3;  5C9A A;  4BOW A;  5LBC A;  2XXZ A;  1HJF A;  4YW3 A;  1GWK A;  2W2I A;  4IER A;  3ROU A;  3O5S A;  4A45 A;  2VVD A;  1URX A;  1ZA4 A;  1G9F A;  2RJK A;  1RUG 3;  3GM8 A;  1M4W A;  2VOV A;  5FXV A;  1HV1 A;  4Q4Y 1;  4QB2 A;  3MPP G;  4LE3 A;  1JI6 A;  3Q8C A;  1RUF 2;  4QKF A;  4QM9 A;  5DG2 A;  4LBL A;  5T5L A;  1A78 A;  1LOG A;  1DU3 D;  3HNY M;  3T0A A;  1MAC A;  3M3O A;  3TOJ A;  1S0I A;  4PLN A;  3UV9 A;  5ACA 1;  1SPP A;  2Z5W A;  4EQV A;  4YG6 A;  3S30 A;  4AHY A;  1H9P A;  4RGG A;  4BQ5 A;  5FR3 A;  1H2N A;  2A6Y A;  2VVE A;  3AB0 A;  1HN0 A;  3CLP A;  3U37 A;  3PVO A;  3SEE A;  2VCA A;  4X6R B;  5DDJ 3;  1XBF A;  3T1M A;  5BNP A;  3AZW A;  5F1R A;  2JD9 A;  5I93 A;  1FNY A;  2PFW A;  2R07 2;  2WII B;  1CPM A;  2YRO A;  3IPV B;  5DXD A;  4AR2 A;  1I9R A;  1K12 A;  3VKF C;  1A6C A;  3WQ7 A;  3WNM A;  4URA A;  1ODM A;  4PF5 A;  5CG8 A;  5JSR A;  2F4P A;  2FCT A;  3Q9O A;  3O1V A;  1SZB A;  4FAH A;  4BQ2 A;  3N7L A;  5KHG A;  4OLL A;  2CV6 A;  1PO2 2;  2HYX A;  2ORZ A;  2W46 A;  1W8O A;  5FY7 A;  5LWB A;  4GD4 A;  4PIY A;  4Y24 A;  4TN7 A;  1S0B A;  3ATG A;  2C1F A;  1AHS A;  3POB A;  4XZU G;  3UNP A;  3NJZ A;  4LO7 A;  1RMU 2;  4IE7 A;  1GQP A;  3OYW B;  4FCA A;  4BXS V;  2QZ3 A;  1OD5 A;  4JHZ A;  1JH5 A;  2ZMK A;  3TNP B;  1W99 A;  1FX5 A;  4QHO A;  5CFC A;  1PM7 A;  3OD4 A;  5F9T A;  4DIN B;  1YCI A;  1VBC 2;  2AC1 A;  3IDB B;  3OD0 A;  5FWE A;  3NNL A;  3HR9 A;  5CAD A;  1QEX A;  3VBF A;  5L36 A;  3S5Q A;  5FY4 A;  3P3N A;  1SQ4 A;  2V73 A;  5DG1 A;  2PLV 3;  3RJ2 X;  3VBH A;  3LD8 A;  1PMJ X;  4CUC A;  3T2Q A;  4JGY C;  4P9G A;  5C33 A;  4DXT A;  3WV6 A;  3USU A;  4Q4W 3;  1BQP A;  1FT9 A;  4XAE A;  2EIE A;  2RS5 2;  1W39 A;  3KF5 A;  5M0T A;  5FBJ A;  3WP6 A;  4DNY A;  2VZQ A;  2WA4 A;  1G9B A;  1CAW B;  3B00 A;  1HJG A;  2BER A;  4AFD A;  5DUV A;  1G86 A;  5KXE A;  1REE A;  2EIC A;  3MIE A;  1QMJ A;  4URT A;  4ZPI A;  3O12 A;  5GZC A;  2EAK A;  2IZW A;  3KQ4 B;  5A7W A;  3ZYJ B;  2XJP A;  2ZEW A;  3CIH A;  4HAN A;  1HDK A;  1AR6 2;  1RUC 2;  4X8P A;  3OGS A;  5LAT A;  3POW A;  4AWD A;  5C8C A;  5F7U A;  3GAL A;  2RMU 3;  4QPI B;  1WA4 A;  3SKJ E;  3ZXA C;  4PDW A;  2ID4 A;  5CYY A;  1RUJ 2;  1XNK A;  3RQ0 A;  1PZ9 A;  1SLI A;  1CD3 G;  1FV3 A;  1BEV 1;  5JOX A;  3EJK A;  4H55 A;  4M0H A;  1RUD 3;  1RUI 2;  1W3X A;  2BP6 A;  1W8T A;  4S2D A;  2GAL A;  5FY9 A;  5AFE A;  4YYO A;  2W1W A;  1D4V B;  2OUJ A;  4QM8 A;  1DGW X;  4Q4V 3;  2KXL A;  4BLI A;  4OHY A;  1HXS 3;  2A6W A;  1XC6 A;  2EA7 A;  2QQK A;  2X05 A;  4DXS A;  1BLZ A;  5G05 L;  3SXW A;  2HWE 2;  2QUO A;  2FMY A;  3LCP A;  4FVV A;  4BQ4 A;  1B09 A;  2XON A;  4QAW A;  1BHG A;  1MZ6 A;  1AR9 3;  1FAY A;  2RM2 2;  2WAB A;  4LO5 B;  3M3E A;  3P6B A;  5JMO A;  3U11 A;  5FWJ A;  5A3W A;  1Q8S A;  4JKL A;  1CX4 A;  3MLL A;  4Y4R A;  2VD7 A;  5J1X A;  2WYF A;  5JZG B;  3Q8F A;  4HKL A;  4Y5Z 0;  2WT1 A;  1XU2 A;  2R32 A;  5IHR A;  1IS4 A;  2WLP A;  5ANN A;  1NCR A;  2DBI A;  1AYN 1;  2V09 A;  3III A;  4AL9 A;  2PEL A;  1W3V A;  3L2Y A;  3MF9 A;  4AF9 A;  1ZBA 3;  2P6H A;  1NOV A;  2XBO 1;  4Q29 A;  1YNA A;  5HCA A;  3OUJ A;  3QBQ A;  5FK8 A;  5A6Y A;  1NG0 A;  4TWT A;  3VHO A;  4WBB A;  2ERF A;  5HBA A;  2ZGN A;  1FAT A;  2D3S A;  1JU4 A;  3D0J A;  4NVP A;  3CZJ A;  2Q1F A;  4OZO A;  3POF A;  3GZA A;  5FP9 A;  5FPL A;  1QJX 3;  4DOU A;  4DRV A;  4QU2 A;  1CAW A;  2VME A;  2C9K A;  4HON A;  2VUD A;  3WF1 A;  4D7S A;  1IZ3 A;  1JZ7 A;  4HFS A;  4E4S A;  4NIH A;  3EQE A;  3I2D A;  4G9S B;  1IKP A;  4QQ2 A;  5FUI A;  5L9B A;  4H7M A;  1YC6 1;  3HN3 A;  2XJT A;  3W59 A;  2NP0 A;  4H14 A;  2D6P A;  1H1A A;  1XE0 A;  2CDP A;  3ZXF A;  4AGG A;  4ASL A;  1PMI A;  3FBY A;  3TEW A;  1DYP A;  3MDP A;  4NE9 A;  2RS1 2;  1RUH 2;  4QPG B;  1SCS A;  3TN9 3;  1H8T A;  3DYM A;  5J98 B;  4RHV 3;  1FMD 1;  3ZYF A;  5GZG A;  1VMH A;  4Z92 B;  2WZ8 A;  1SLL A;  2GSY A;  3PMS A;  4CUB A;  1PIV 3;  3OJB A;  3AJZ A;  2R0H A;  4FPF A;  5IVE A;  2EAA A;  1TME 1;  4Q0S A;  1QOT A;  3E6B A;  5LB6 A;  3KD4 A;  1E5H A;  2XVL A;  4OVE A;  1GZW B;  1GWL A;  1FPN 1;  1DQ2 A;  3BN6 A;  4AHX A;  4AQT A;  1YWK A;  1VAM A;  3CZU A;  2V4V A;  2VZS A;  3ZSE A;  1I6X A;  3H7J A;  2WAO A;  5A70 A;  1KFX L;  4FSJ A;  1ASJ 2;  1ZRI A;  1SFN A;  4KWK A;  4E2G A;  5E6H A;  3MHZ A;  2X5I B;  3KWV A;  1QQP 2;  4RL7 A;  2OXB A;  4Y1X A;  4GQ7 A;  5GLZ A;  3T2T A;  5A6X A;  5LA0 A;  1CES A;  4NID A;  1JHN A;  4F7Z A;  5C3O A;  1W8F A;  5A6Q A;  1PVC 1;  3WLU A;  3I54 A;  2JIJ A;  3O1R A;  1FOD 2;  4H2A A;  3V0A A;  2RR1 2;  4KMQ A;  2VNR A;  4IES A;  1UZZ A;  2Z42 A;  4Q5O A;  5E88 A;  5DAQ A;  4N90 A;  2G19 A;  4P14 A;  4MG2 A;  1NA1 C;  4LUL A;  1CR7 A;  2BTV C;  3DL3 A;  3I2J A;  4S2G A;  2YXS A;  4YZ3 A;  2WFF 3;  2R06 3;  4D8M A;  5IVV A;  2BWC A;  2VUL A;  5GLW A;  4FQZ A;  1CGP A;  1PNF A;  4CCE A;  1DGW A;  1ZBE 2;  4COY A;  2JE8 A;  2V72 A;  2GN3 A;  3OUH A;  3PNA A;  3I49 A;  3CJX A;  1UYX A;  4XHB A;  2JG9 A;  5FRA A;  4I2O A;  3H8R A;  4RGK A;  4FTS A;  2UY9 A;  2IXC A;  3DYO A;  4RSU A;  1U5Y A;  3N9O A;  3Q8E A;  3VBS A;  3DEC A;  5CKM A;  4Q1R A;  3KF3 A;  2ADD A;  1QU0 A;  1O4Z A;  4NHM A;  4S2F A;  5DZF A;  5FY0 A;  3T4H B;  3T09 A;  2D3R A;  1F4A A;  1RUE 2;  2VZ1 A;  4OZX A;  4UAP A;  2WQZ C;  3JB8 A;  1PO1 3;  5LA9 A;  5L7O C;  2WZR 3;  3LA3 A;  2PAK A;  1RHI 3;  5LW9 A;  2WIN B;  1GWM A;  1KEX A;  1IKQ A;  1C8M 3;  3DPR B;  4QXH A;  3WW4 A;  4COV A;  2Y26 A;  2K9Z A;  1BVV A;  5EWS A;  2IWG B;  3MID A;  5FMB A;  1YFW A;  4KG8 A;  3I97 A;  4K7J A;  1BBT 2;  3TBD A;  4Q4X 2;  2X8K A;  1ND2 A;  2ZA9 A;  4M4P A;  2H6B A;  3WDY A;  2ZKL A;  1MZE A;  2XLA A;  4XDO A;  1GKB A;  3UK9 A;  1VPH A;  2WS9 2;  4YVW A;  4BH9 A;  2RVA A;  4YZ2 A;  2W92 A;  3OF1 A;  4XMI A;  2QNK A;  4JC1 A;  5DAV A;  4UYB A;  5KXD A;  1HQN A;  4MV2 A;  3VL9 A;  4PI0 A;  2WUH A;  2Q8E A;  3AYD A;  4N53 B;  1LHW A;  2BQP A;  3WW3 A;  5FZG A;  3OPT A;  2E9Q A;  5A3N A;  1X36 A;  4NIA A;  1J3Q A;  2HWC 3;  1QJU 1;  2CAU A;  2CTV A;  2D3P A;  2MEV 2;  2WNV C;  4XE9 A;  1Q8Q A;  3N7J A;  3NQH A;  3S57 A;  5F32 A;  2QQI A;  1AX0 A;  1JMU B;  3RMX A;  3USS A;  1PVX A;  2IXK A;  4YNI A;  3JBG 1;  1ULP A;  3M70 A;  4XYX A;  4MGK E;  4GWI A;  5L9R A;  1DQ0 A;  2WSU A;  4Q4Y 2;  2HWD 3;  2D98 A;  4KG0 A;  4HK9 A;  4QQL A;  4X8N A;  2XLG A;  1TVG A;  4Y1Y A;  1RUG 1;  3MZH A;  3LFI A;  4FTE A;  1PNG A;  1V6L A;  4YW7 A;  3ZVX A;  4FFH A;  2JEC A; 
#chains in the Genus database with same CATH homology
 1DP0 A;  1JZ8 A;  1XPW A;  1J84 A;  3D3A A;  3K4A A;  2J1R A;  4KI5 M;  4LPL A;  2J1U A;  2VZV A;  4MGQ A;  4W50 A;  1YQ2 A;  1T2X A;  3MUY 1;  3I2F A;  1J83 A;  2LS6 A;  4BK5 A;  4RN5 A;  2VMD A;  3W5N A;  3THC A;  3T08 A;  4DEQ A;  3MO4 A;  1I5P A;  2Y6G A;  2YFU A;  3NJX A;  3T0D A;  3EYP A;  1UX7 A;  3CKH A;  3I3D A;  1PX3 A;  3PUI A;  2YG0 A;  4P5Y A;  2VMC A;  2W95 A;  2BGP A;  3ACH A;  3WF3 A;  3I3B A;  1UMH A;  1GUI A;  2RJ2 A;  1UWW A;  2VJX A;  2VR4 A;  4QDR A;  1WCQ A;  1CZV A;  5HPO A;  2VZO A;  3I2G A;  2WO3 A;  1JZ3 A;  3OGR A;  2WO2 A;  2VCC A;  2QQL A;  2W1S A;  2EID A;  3K75 B;  4RYD A;  5DN2 A;  5IYY A;  1D7P M;  3FL7 A;  2B4K A;  3J7H A;  2Y8K A;  1SHW B;  5A1A A;  4E8C A;  1NKG A;  4QDQ A;  2W91 A;  1LNS A;  3EB7 A;  2ZEZ A;  5DMY A;  3A21 A;  3T2P A;  3BGA A;  2E26 A;  5C71 A;  3SKV A;  5LA2 A;  3HNB M;  4UOJ A;  4ARX A;  5JXH A;  2W47 A;  3WSO A;  4P08 A;  4CVU A;  3MBW A;  2QQJ A;  4QB6 A;  2V5D A;  3WEZ A;  3HJR A;  3A7Q A;  4ARY A;  1W9W A;  3IB3 A;  3FHQ A;  1JZ5 A;  4YPJ A;  1UY3 A;  4OMD A;  5EJZ B;  2W5F A;  2LW8 A;  5LCW L;  4ZZ5 A;  5LA1 A;  2XHN A;  3C7O A;  3LPF A;  2XOM A;  4ZXE A;  1JHJ A;  3OEB A;  4CUA A;  2W3J A;  4CU8 A;  2ZXQ A;  4JKK A;  2YFZ A;  4A3Z A;  1GMM A;  3I2K A;  3ACF A;  3K4D A;  5I0D A;  1GOG A;  2W1U A;  2DCJ A;  4DUX A;  1IQD C;  3CDZ B;  4JKM A;  4M4R A;  2VZP A;  3CMG A;  4KWU A;  4W4Z A;  3WNL A;  1JYW A;  2ZEX A;  2VQU A;  5DPN A;  2WQ8 A;  2J1A A;  5IJR A;  1L7Q A;  1UY4 A;  2E31 A;  2DDU A;  5JR2 A;  4HG6 B;  3WNK A;  2VQT A;  1KGY A;  4DXR A;  1NUK A;  4MO3 M;  5IFP A;  2R7E B;  4QX1 A;  3MUZ 1;  2WAA A;  2L9L A;  5JXI A;  4FI9 A;  2J1T A;  4A45 A;  2WN3 A;  3GM8 A;  5IFT A;  2W94 A;  3MV1 1;  1UY2 A;  4QB2 A;  3WQB A;  5IHR A;  1JI6 A;  4MAD A;  3FN9 A;  4L0P A;  3NRU A;  3HNY M;  3T0A A;  4ZZ8 A;  5C70 A;  3WF2 A;  1JU3 A;  5CZK A;  4GZ9 A;  1OF3 A;  2J1V A;  2E32 A;  5JXG A;  2W87 A;  1L7R A;  3T0B A;  3U37 A;  1SG3 A;  3SEE A;  3HEI A;  4BK4 A;  2VCA A;  1GOF A;  4XUP A;  1K42 A;  1W0N A;  2JD9 A;  3LEK A;  3VDB A;  3C7E A;  3C8X A;  1K12 A;  4AG4 A;  2JDA A;  3WNM A;  1MPX A;  2VTF A;  3ABZ A;  3LE0 A;  1UY0 A;  4JX0 A;  2J7M A;  1UXZ A;  4XUR A;  3VD5 A;  2VOT A;  2ORZ A;  2HYX A;  2B9V A;  2W46 A;  1W8O A;  2J1S A;  4A44 A;  1GNY A;  1K3I A;  3WNP A;  1P8J A;  2KD7 A;  4XZU G;  3UNP A;  1OT5 A;  4QX3 A;  3VD4 A;  1GQP A;  4BXS V;  1EUU A;  2E33 A;  4JHZ A;  1W99 A;  2JKX A;  1UXX X;  1XNT A;  1UYY A;  2C26 A;  3ECQ A;  4P00 B;  3HOB A;  1PMH X;  4DUV A;  1W9S A;  3GXU A;  1DYO A;  1PMJ X;  4CUC A;  3T2Q A;  2Y64 A;  4BDV B;  3VDA A;  4DXT A;  1RYY A;  4PQQ A;  4PF1 A;  2Y6H A;  1OF4 A;  4XUT A;  2EIE A;  4QDS A;  2VZQ A;  1JYX A;  2X10 A;  2Z4F A;  4XUN A;  3OGV A;  1CIY A;  2BER A;  4CU9 A;  2EIC A;  4W8J A;  3VD9 A;  2W9X A;  2VCB A;  3PUH A;  3P1I A;  5JUV A;  2ZEW A;  2BGO A;  2VC9 A;  3CIH A;  2WDB A;  2W1Q A;  3OGS A;  1JZ6 A;  2YC2 A;  1JZ4 A;  5F7U A;  3SKJ E;  2ID4 A;  5CYY A;  1NAE A;  2VZT A;  1O8P A;  3E1F 1;  2CDO A;  1H6Y A;  3OB8 A;  4ZY9 A;  3K46 A;  2VZ3 A;  2W1W A;  2X05 A;  1XC6 A;  2QQK A;  4AAX A;  4DXS A;  5G05 L;  2XON A;  4QAW A;  1BHG A;  4E8D A;  1OH4 A;  2WAB A;  3K77 A;  1OD3 A;  2ORX A;  3P6B A;  5JMO A;  3WNN A;  2X09 A;  4JKL A;  4GWJ A;  3WF0 A;  3VD3 A;  5J1X A;  2RV9 A;  3WNO A;  4IUG A;  4A6O A;  4QX0 A;  4OUE A;  3CQO A;  2HLE A;  1JYN A;  3I2I A;  2Y6K A;  3III A;  2VZR A;  3A23 A;  1ULO A;  1UZ0 A;  5B4N A;  2ZEY A;  4MOA A;  3IAP A;  3UES A;  4D0Q A;  5B4X A;  3ACI A;  2WBK A;  1H6X A;  1JU4 A;  2QBX A;  3CZJ A;  4OZO A;  3THD A;  3UET A;  2EIB A;  2Y6L A;  2VME A;  2C9K A;  3WF1 A;  1JZ7 A;  5FUI A;  4A42 A;  3HN3 A;  2VM9 A;  1GU3 A;  2YB7 A;  5EJ1 B;  4DEV A;  2CDP A;  1W8N A;  5G04 L;  3VD7 A;  1UY1 A;  3OBA A;  3FHA A;  4OMC A;  4LKS A;  3SEP A;  4XUO A;  1O59 A;  5HXM A;  3AC0 A;  2VZU A;  3DYM A;  4CU7 A;  3LPG A;  4QB1 A;  4PT6 A;  4LQR A;  2WZ8 A;  4CUB A;  1PX4 A;  4QX2 A;  3VDC A;  2VL4 A;  4UI9 L;  4A41 A;  1NX9 A;  1CZS A;  2BBA A;  1CZT A;  3GGL A;  4QPW A;  4LHS A;  1GOH A;  1UMI A;  2QQO A;  3BN6 A;  4TXW A;  2WN2 A;  3CZU A;  2V4V A;  2OKX A;  2VZS A;  3F2Z A;  2WAO A;  4MGS A;  2VMF A;  3HNM A;  5LA0 A;  2YC4 A;  3MV0 1;  4XUQ A;  4KMQ A;  1CX1 A;  4P02 B;  1HN1 A;  3IAQ A;  3K4Z A;  3I2J A;  3LEG A;  2J22 A;  4D8M A;  4TTG A;  2J1E A;  2VO5 A;  1EUT A;  4BJ0 A;  3HPN A;  2JE8 A;  2WZE A;  2V72 A;  2QQN A;  4DUW A;  1F4H A;  2DCK A;  3GDB A;  3ETP A;  1UYX A;  2BZD A;  4CU6 A;  3W5M A;  1US3 A;  1JYV A;  1TG7 A;  3DYO A;  2WYS A;  3C7F A;  4OYU A;  3DEC A;  3T09 A;  1F4A A;  2VZ1 A;  4UAP A;  3NNG A;  2Y6J A;  1KEX A;  1WKY A;  2PQS A;  1R64 A;  1K45 A;  2QQM A;  3A22 A;  5JXJ A;  3I3E A;  1DLC A;  5DQ0 A;  3I97 A;  3I2H A;  3LEI A;  3ACG A;  4M4P A;  3LQC A;  3IDA A;  3C7G A;  3T2O A;  2RVA A;  2W92 A;  1US2 A;  2WO1 A;  2C4X A;  3OG2 A;  1W9T A;  1JZ2 A;  2WUH A;  3C7H A;  2XQX A;  3JXS A;  4A4A A;  3NJV A;  3OEA A;  3NQH A;  2QQI A;  4XVH A;  1ULP A;  5EIY B;  1XNA A;  4GWI A;  3WF4 A;  3ZM8 A;  1UYZ A;  4Z2A A;  5C7G A;  3DYP A;  1TVG A;  1O8S A;  4ET7 A;  1SDD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...