4LPLA

Structure of cbm32-1 from a family 31 glycoside hydrolase from clostridium perfringens
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
DPYRNVPKDMKTEWKWGQYSSDEPSKAVDGDDSSQFHSQDSAIDKPFIIDMQKAYTIEKLELLFRKNGNGSVKRAEIYSSLDGVTYEKVFSNAEGSDIAPWATDGEVKTINFNKPIKVRYFKIVTKESIGNFLAMREFRPYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
total genus 36
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4lplA00
1NAEA 1GNYA 3WF2A 3I2JA 1SHWB 2PQSA 5IFTA 5J1XA 5G04L 1D7PM 2QQLA 4XUQA 2X05A 3CIHA 1I5PA 4ZXEA 2YC2A 3CKHA 4W8JA 2YFUA 3LPFA 3T0AA 2VMDA 1XNTA 4A42A 1K3IA 5C70A 2CDPA 3HNBM 1W8NA 4OUEA 4DUXA 2WABA 4QB1A 4A44A 3FL7A 3GGLA 1JZ4A 3SKJE 1W9WA 2W1QA 1UMIA 1GOFA 1P8JA 4DEQA 4D0QA 4IUGA 4CU8A 1SDDB 4GZ9A 5IJRA 2XONA 3HOBA 3A21A 3FN9A 2WZ8A 4BDVB 1TG7A 4E8DA 2ORXA 2E26A 2J1RA 2W9XA 1NX9A 2J1AA 2QQIA 2B4KA 3LE0A 1EUUA 3CDZB 3VDBA 2J1UA 1JZ8A 2J1TA 3WF4A 4PT6A 5FUIA 1UY2A 5DPNA 2C9KA 4OMCA 4XVHA 4D8MA 4A4AA 2Y8KA 3HPNA 3HEIA 4W4ZA 2E32A 1O8SA 5CYYA 3W5MA 3T09A 4P5YA 4ARYA 1O59A 3K75B 4UOJA 1W8OA 1UY3A 5EIYB 1L7RA 2EIEA 2BBAA 2WZEA 3MO4A 2ZEYA 3C7GA 5C71A 2ZEXA 2DCKA 4XUNA 3E1F1 2VZOA 2Y6LA 4MO3M 2Z4FA 1WKYA 3C7FA 3LEIA 4QB6A 4QX1A 2YC4A 3OG2A 1UYXA 1O8PA 2W94A 1F4AA 2J7MA 3K46A 2HLEA 1PX4A 4UI9L 3WEZA 3NNGA 5DQ0A 5JXIA 1JYXA 4A3ZA 1DLCA 3BGAA 3CZJA 2XHNA 5IYYA 3CMGA 1R64A 2W46A 4CUCA 4QDSA 5JXJA 4BXSV 3ACIA 3SEPA 2W87A 4CU7A 2VC9A 4OZOA 1CX1A 3MV11 2VOTA 4LQRA 3OBAA 3I2HA 3A7QA 4JKKA 4PQQA 2HYXA 2QQOA 4MGSA 5LA1A 3CZUA 2WN2A 3HJRA 3C7EA 3HNMA 1PMJX 2VZRA 3I97A 2BZDA 2ZEWA 2RVAA 5IFPA 4DXSA 2C26A 4QB2A 2Y6HA 3GM8A 3IAPA 2BGPA 2DCJA 1F4HA 4M4PA 3VD3A 3VDCA 3T0DA 1JU3A 3T0BA 3W5NA 1UWWA 2YFZA 1JU4A 2VZSA 1CIYA 2J1VA 2LS6A 3K4AA 2E33A 1JZ6A 1JZ5A 1UYZA 2E31A 5JR2A 5B4NA 2YB7A 2VCBA 2JDAA 2VQTA 4P02B 3VD9A 3WNPA 4A41A 3DYMA 1DP0A 4JKLA 5JXGA 1NUKA 1GMMA 1PX3A 4XUOA 3UESA 4GWIA 3FHAA 2R7EB 3T2QA 4L0PA 4LHSA 2W47A 4OYUA 3T2PA 4CVUA 5LCWL 1KGYA 3MBWA 2YG0A 2WAAA 3THCA 3NRUA 3WNMA 2VMEA 1GQPA 4DEVA 3JXSA 4KMQA 1JZ7A 1JYNA 3UETA 3SEEA 1CZVA 2WUHA 4QPWA 5HXMA 2W1SA 2VM9A 4DUWA 2B9VA 2VR4A 3WNOA 5HPOA 5A1AA 2QQJA 4OMDA 2QQMA 2W1UA 4W50A 1OF4A 2VMFA 4JHZA 3NQHA 1T2XA 4MADA 4TTGA 2WDBA 4XZUG 3IB3A 2WN3A 4A45A 2VMCA 2JKXA 4DUVA 4CUBA 3P6BA 2QQKA 3VD4A 2VO5A 1JYVA 3WF3A 2JE8A 1JYWA 3I2IA 2VCCA 3K4ZA 4TXWA 5LA0A 3OB8A 1GOHA 1UX7A 3F2ZA 2ID4A 5IHRA 4LPLA 2W91A 3WF0A 1J84A 4AG4A 1UY1A 2X10A 1W0NA 4GWJA 3LEGA 3EYPA 2W92A 1K12A 1WCQA 3DYPA 3ACGA 4QX3A 3I3DA 4FI9A 1OF3A 1DYOA 1XNAA 2VZPA 3FHQA 1K42A 2WO3A 2WQ8A 4P08A 2CDOA 2V5DA 1PMHX 1BHGA 1OD3A 2VZ1A 1TVGA 4BK5A 1UY4A 5LA2A 3MUZ1 5JXHA 1J83A 3GDBA 4JX0A 2W1WA 2VZ3A 4ZZ8A 4ZY9A 3T08A 4KI5M 1W99A 1UXZA 2Y64A 3DECA 1US2A 3LPGA 5JMOA 4AAXA 2RV9A 3IDAA 4DXTA 2EIBA 2ZEZA 4XUPA 3ACHA 3ECQA 1EUTA 3OGVA 2J1SA 1UXXX 3VD7A 2C4XA 2DDUA 3OEBA 2J1EA 2W3JA 4KWUA 3I3BA 2W95A 3P1IA 5EJ1B 4ARXA 4RYDA 1SG3A 1W9TA 1OT5A 5DN2A 4BJ0A 1UZ0A 3WNLA 3I2KA 5C7GA 3ACFA 2WBKA 3WQBA 3OEAA 4QX2A 1KEXA 5G05L 2OKXA 3K77A 1UY0A 3HN3A 2L9LA 1ULOA 3C7OA 3VD5A 2EICA 4QDQA 2VZTA 2WO2A 2X09A 3VDAA 2KD7A 4MGQA 4CUAA 4A6OA 3SKVA 1IQDC 5DMYA 1LNSA 2BGOA 1CZTA 1GUIA 2VTFA 4P00B 4ZZ5A 4CU6A 5F7UA 2WO1A 1JHJA 2Y6GA 2V72A 2VL4A 3LEKA 3MV01 4DXRA 5CZKA 3I2FA 2QBXA 2VJXA 2Y6JA 3AC0A 1ULPA 3OGRA 2J22A 2XQXA 4M4RA 3UNPA 2RJ2A 3BN6A 4E8CA 3J7HA 1JZ3A 2BERA 1UYYA 1HN1A 4CU9A 1MPXA 4HG6B 1JZ2A 1W9SA 1CZSA 3OGSA 4XURA 3NJVA 3WF1A 4YPJA 1GOGA 2VZUA 4MOAA 4PF1A 2EIDA 2XOMA 3WNNA 1K45A 3A22A 3GXUA 1L7QA 3PUHA 3HNYM 3D3AA 4LKSA 4QAWA 1H6XA 4RN5A 3ABZA 1H6YA 2ZXQA 2VZVA 3K4DA 3C7HA 4QDRA 3DYOA 1XC6A 3ETPA 3MUY1 1GU3A 1UMHA 2ORZA 4UAPA 3WSOA 4JKMA 3U37A 2W5FA 3EB7A 5JUVA 2JD9A 2V4VA 3THDA 2QQNA 2VQUA 1XPWA 3A23A 2WYSA 1OH4A 3ZM8A 1JI6A 3IIIA 3C8XA 3T2OA 1NKGA 1RYYA 3IAQA 4XUTA 1YQ2A 3NJXA 5I0DA 3LQCA 3I2GA 4ET7A 3I3EA 4QX0A 4Z2AA 3CQOA 2VCAA 3WNKA 5EJZB 2VZQA 5B4XA 1US3A 2WAOA 3PUIA 2Y6KA 2LW8A 4BK4A
chains in the Genus database with same CATH superfamily
1TMF1 2ZHMA 3I2JA 3WW1A 1W8UA 4XF0A 1SHWB 3TAYA 4BISA 2UYBA 1UOBA 1GKBA 4RQPB 5A7PA 3N4MA 3AMNA 1RUD2 4ZU7A 1SBEA 1PK6C 2XJVA 4XUQA 4YZ2A 2X05A 3Q8EA 4AXOA 3WDYA 1RUI1 2ZGRA 5GZCA 2ES3A 3GZUC 2GP5A 5D8AA 4OI0A 1MS9A 1SQ4A 1NLQA 1E5SA 5I0SA 2YFUA 1CAWB 2FCTA 1E5HA 5F39A 2VMDA 2BNNA 5FYBA 4A42A 1K3IA 4DXZA 1BLZA 4U2AA 2JECA 3OUJA 3WLUA 3Q8CA 3ZFEA 4A44A 3U4SA 4OCTA 3GGLA 2VOXA 2JDHA 4A2UA 1D4M2 5ACA1 4L92A 4UF0A 3MF6A 2RS12 1MZEA 1LENA 2X8KA 2W08A 1R091 2DUQA 2VNGA 2KM2A 2YBPA 3B9CA 3SQOA 3ZMNA 4I3GA 3H8XA 4IUGA 5FYHA 2VAUA 2WIIB 3AZYA 4FBFA 4QGLA 4GZ9A 1BXHA 4OHVA 3ZXJA 5GALA 4WM8C 3HOBA 3FN9A 4AI3A 3V0BB 4QQPA 2VBDA 5K9YA 2RMU3 3KMHA 1S0FA 4PIZA 3EHKA 5C33A 4RR3A 3LKJA 2W9XA 1NX9A 5FXXA 4XBNA 1AJKA 2QQIA 5HCBA 2QQVA 1WUVA 4LJHA 5EPAA 5FPVA 3NNJA 4CCMA 3WF4A 3E5XA 3WCSA 4BMEA 3PLQA 3THTA 1T6GC 4Y26A 5F5QA 4HKOA 1GFF2 4NHLA 3VKNA 1SDWA 3HT2A 4P9IA 4XJUA 1AL22 1PIV1 2WNVC 3HPNA 3N7KA 3OUIA 4N53C 3FUQA 1QMJA 1ULEA 1RJ8A 2E32A 2FCVA 2BW8A 2IUWA 3WDWA 2NMNA 1RMU2 1ULCA 3LFIA 1N1VA 4N90A 2R32A 3GNEA 4V1PA 2JENA 1KDMA 1W8OA 1NE6A 3KV6A 4UOJA 1LB2A 1WA6X 5F5IA 2HWE1 1QJX3 2WZEA 4NOTA 4YVSB 1AR83 3S30A 4CCOA 4MGYE 3WHTA 2VG9A 3QH7A 4RR3C 3WW3A 3HQUA 3NL1A 4UW3A 3VL8A 4MG2A 1PO22 3E1F1 3TBDA 2GU9A 2Y6LA 2GMEA 2VQAA 2XVKA 3WP3A 4AR2A 5HBAA 1AVBA 5SV8A 3C7FA 1HQWA 4QX1A 3ST7A 1A3KA 2E7TA 2TNFA 2YC4A 3OG2A 2ZX4A 1FMD2 3K46A 2HLEA 5LEJA 2X5IA 3DL3A 3VBSA 2P2KA 3MEPA 3UK9A 3NNGA 1ZX5A 1W6OB 5L73A 5K4LA 4A3ZA 4FQ4A 1ZRIA 3B3QE 3BGAA 3DXUA 1Q43A 1TE1B 4R4XA 4CUCA 3USUA 4BZ4A 3POEA 3ACLA 4QT6A 4AK3A 4CU7A 4IV1B 1IG3A 1FOD3 3USSA 2NYYA 3CNAA 1A34A 2VULA 5ANNA 4DB5A 3POWA 2VOTA 1UN1A 1FX5A 2JG9A 3LIHA 3OBAA 2RS33 4FPGA 5L9VA 1REEA 3JBG1 1W2OA 4N43A 3JCIA 3VKMA 2A73B 1VBB3 2WN2A 1QDOA 4UYBA 1U12A 4PQ9A 4XJ8A 5DZGA 5BPXA 4YARA 2JDZA 4YVSC 5FY8A 3C7EA 1ONAA 2O8OA 4N7IA 3LD8A 4FSJA 2VZRA 3I97A 2PELA 5A3TA 1U5XA 5IVCA 2BZDA 4IE4A 1GZTA 2RVAA 5IFPA 4LT5A 4YZ5A 1W3VA 3JB4C 4RQPA 4XBLA 1VBD1 1G8WA 5EXOA 2YROA 5DG1A 5IT6A 3HR9A 4YZ3A 4HONA 4WV8A 4AI1A 4M4PA 1REFA 2BRTA 1JU3A 3FUOA 5A3WA 1L3JA 5C6CA 2D6KA 1W6NB 1JU4A 2VZSA 5LRRA 3NMBA 2PA7A 2JEMA 3AP7A 2VVFA 3BU7A 3DUIA 4K1YA 1C5HA 1IS4A 1IKPA 3AM2A 1JZ5A 5ABJC 3CL1A 3VBUC 4COZA 1W9YA 2VNRA 2WNEA 4FO9A 2RS11 2FDGA 3OBZA 5C3QA 2BNMA 3NAPA 3CJXA 3QLQA 3IZOA 2OUHA 2P6HA 2P34A 4RHV2 2ZKLA 4ES8A 2AREA 2QE3A 2VQTA 5JWPA 1VBA2 4J25A 5FIXA 3SITA 3VBRA 3WNPA 1W3XA 3AB0A 1KJRA 4XQ4A 1WW7A 5AVAA 3WQ1A 5BNOB 1ODMA 4CDQC 2NN8A 1DLLA 3FFQA 2AGSA 5FUPA 5A32A 4EZ4A 4GD4A 3VZKA 3ES4A 4AVBA 2YXSA 1PVC1 2VMGA 4OYUA 4QPGB 4QPYA 5JIAA 4CVUA 5LCWL 1KGYA 4XBQA 4WVWA 2GDFA 2WWUA 2JG8C 2ADEA 3USUB 3WNMA 2KR2A 2HWE2 2CAVA 1GQPA 1T6BX 2VMEA 4WVZA 1H0BA 1WMDA 3TNPB 4JZRA 1UOFA 1Q8QA 4ATFA 4N9IA 1QF3A 4R9AA 2LRPA 5C4WA 1JYNA 3UETA 2ZOEB 4AVSA 3SEEA 1UOGA 4N53A 2RM23 4GULA 5KHHA 3N9LA 1LHOA 2B9VA 2VR4A 2X29A 1PMIA 3WNOA 5HPOA 1D0HA 5IUQA 5A7SA 1C5IA 1OQEA 2A7AA 1EPWA 4X6QB 1K5JA 1J3PA 2RS32 1C3HA 1ZZ8A 2A71A 2WO7A 3IMNA 4YLZA 4L99A 5CVRA 5KXEA 2QZ3A 5KHGA 2OUJA 4GALA 2H6CA 4JHZA 3LCPA 2PHUA 2A6YA 5BXXA 1OBNA 3ASIA 1OOPB 5HCAA 2ZPXA 5I91A 2PN5A 4C1WA 4DZGA 1OQ1A 1CJDA 1LU1A 1RUI2 1TEIA 3CJIB 1DQ5A 3M4FA 3T4HB 5KXBA 1O91A 2JKXA 4DUVA 5C4WB 3B5LB 5HCFA 3P6BA 2QQKA 1GWMA 5T5JA 4CXXA 3MDPA 2VO5A 4J6GA 4Y3OA 5GLWA 2ARCA 4AVTA 1JYVA 2ILMA 3RI8A 1NLSA 4JGZA 1DDLA 1BVVA 2VCCA 4KBBA 2HKXA 3GALA 2VCMA 3VB9A 3OB8A 2PXJA 3N36A 3DN7A 5A1LA 4O61A 2QDNA 3THPA 4DY3A 1PO23 3U1XA 3VN4A 5IHRA 4RS5B 1F15A 5FZAA 3IIAA 3LF7A 1V0AA 2VBPA 3RZKA 4H7MA 1R083 3HMYA 3I2OA 3H3UA 2ZGQA 1V6OA 4LBOA 3POJA 4C1XA 2CGOA 2G19A 4GWJA 1D2SA 4TLGA 3DYPA 3VBFA 3RZGA 1OLQA 4WBBA 4K7JA 1V00A 4JTNA 4Q4Y3 4AEDB 3KV4A 1SACA 4NROA 1KJLA 3LIGA 4B8EA 5BNNA 1MS1A 1PIV2 5GLUA 1XNAA 3W59A 2BGCA 5DDJ3 2ETEA 2ZAAA 4CEWB 2W68A 2CL2A 5EV7A 2V5DA 2XJSA 3D0JA 3POFA 1GP4A 1O7FA 1COV1 3IWZA 1J1LA 4W6WA 4MLOA 3FLTA 2QFEA 4AQ2A 2LALA 1J83A 2OZ6A 3GDBA 4C8DA 1OA3A 1YIPA 2W1WA 2XVGA 2ZHLA 3BCWA 3DKWA 2CHHA 4WM8A 4AEDC 4ZZ8A 5AC91 2ZGSA 4M0HA 2DU0A 3A4UA 4XJWA 5L9RA 1ZM1A 4Q5OA 1LGCA 1CPNA 2Y64A 1O3RA 5DUXA 1S1AA 3ZYBA 1KQRA 3LOBA 1HKDA 3M3EA 3WXPA 4Q1RA 2XXZA 1ZBA2 1OD5A 1S0IA 1ND2A 4NIIA 2FDIA 1QU0A 3GZEA 4M0NA 3CHXA 5FXVA 4G4FA 2VUDA 4JRLA 5FPLA 1HRI3 2WINB 4Y1UA 5FP8A 1VBE2 1SCRA 4HVRA 4RS5C 4AAPA 3OGVA 3MIGA 4QMAA 5A6QA 1U5YA 3GCWA 1R1A3 4XETA 2VXRA 4GB32 4ONUA 1OPOA 5CIRA 2NM1A 5DUUA 4AQTA 1B35B 1F5FA 1WZXA 2O14A 2NPIA 1HW5A 4KWUA 1ASJ1 5EJ1B 3P1IA 3R4DB 4QPIA 5FY0A 1YQCA 4ARXA 1SG3A 3DV8A 5BYNA 4H2AA 5EZWA 3WINE 5B2GB 4BJ0A 1RXFA 1UZ0A 1GSLA 5FXZA 2MEV1 3WNLA 4OULA 5FO7B 1QQP2 1VAKA 4IERA 4JQRA 5C7GA 2AH2A 4M3CA 2WBKA 3I59B 2EIGA 1H4GA 3SC7X 2N7GA 4E2GA 3WQBA 4UBHA 3ZFFC 2AZ5A 1KEXA 5M0TA 4IXLA 2Z2SB 5L36A 3ILFA 4XF9A 1RUH3 1VRH3 2DVGA 2UURA 2L9LA 1LEDA 3VV1A 4K40A 1XE7A 4MXWB 4JC1A 1CAVB 2AR6A 4Q27A 2B9UA 4XMAA 3N7MA 2VZTA 1CIWA 3PVBB 4ZS2A 5C9AA 2D6LX 3VDDA 1IQDC 2XBO1 3URFA 5C4WC 4P9LA 2DF7A 3CJIC 5FPXA 2PTMA 3V56A 1DHKB 1U0AA 1Q8SA 2W39A 1KXGA 3HQRA 2XMLA 2BYVE 3LWCA 4CU6A 3QH6A 4LO8A 1KFUL 3U10A 2GSYA 1JHJA 1PK6B 4YW4A 3J7NA 3KHBA 1EY2A 2IFRA 2V09A 1HQNA 1W2UA 1V9U1 3BYWA 5IWFA 3MV01 3VBHC 1QXPA 1J59A 4Z07A 1DGRA 2VJXA 1FAYA 5KC5A 1AR72 1F9KA 3OPWA 2J22A 4GJZA 3A0NA 1QNWA 4M4RA 4K8FA 2P3JA 1D0GA 1JZ3A 3D5OA 5I0RA 2BERA 4GB31 3E97A 1OPMA 2RS51 1URXA 2ZGUA 2JD4A 3VDDB 5JZGC 1UW8A 3PMSA 4IEZA 1SZBA 1X36A 1GYKA 3WW2A 4XF3A 3ZXKA 4CEYC 5CEHA 3JD71 4YNIA 1H2LA 3OCPA 1JN2P 4PJYA 1CAVA 1C8M1 3HIFA 2Y0OA 4MXWA 2BP6A 1JYIA 3SCGA 1RJ7A 4QXHA 4DOUA 4YPJA 5FMBA 2MEV2 2BU9A 5F6LB 1VBD2 2XOMA 4OI2A 4JGYB 1PO13 1WLCA 1RL3A 1K45A 2VUCA 3A22A 5KHJA 2GH2A 1C57A 3M1HA 4AGRA 1Y43B 3DEMA 2DUOA 3UYJA 5JDBA 2IVIB 5JPNB 4RN5A 1LU2A 1W9FA 2YV8A 3ABZA 4EV0A 1DIWA 2VZVA 4K20A 4XQWA 5I0TA 5EHDA 3AZXA 3LA2A 3VBUA 4AI9A 3AK0A 4WVMB 5CKNA 1J58A 3M8LA 4FPCA 2ORZA 4IE7A 3WSOA 1STMA 1IQAA 4GH4B 4JKMA 3VBSC 1XE8A 3RYRA 3M3OA 5GZFA 2Y26A 4KGGA 2VECA 2CWSA 3IPVB 3Q8BA 5ABJB 2BPA2 2V4VA 3JBG3 3SH3A 2XB6C 3ON7A 2BFUS 3MGUA 2VQUA 1ENSA 2ET1A 4PI0A 3A23A 1OHFA 4ATEA 1G9BA 4BQ2A 1JOPA 1OH4A 2VW2A 4LKFA 3VL9A 5FZCA 1FYUA 1XB9A 1PGL2 2DBNA 1UZWA 1GR3A 4B4QA 2EAKA 1LGBA 3LQCA 4X6RB 2J42A 5DG2A 2Q8EA 3VHOA 2FHRA 5AC92 2QQUA 3AXEA 2DUPA 2F4PA 2HEYF 4ORFA 2OA2A 1HB1A 4Z2AA 2VUAA 4AVCA 2CYFA 2UWCA 4LHNA 5L9BA 2BFUL 1POV3 3WNKA 5EJZB 1CJPA 3MIEA 5B4XA 4BLJA 1US3A 1CN1A 4BHPA 1UF2C 2WAOA 4K1ZA 4YG0A 3WQ0A 4COVA 2C0ZA 2JG9C 2Y6KA 1X82A 3DPRB 3PUIA 4PDWA 2BDRA 1RUC3 3EBRA 2WNUA 1AX2A 2PQSA 5J1XA 1H1IA 1CPMA 5FQ0B 5BNPC 3BOWA 1D7PM 3HBKA 4ISRA 2V4AA 5T5PA 2W2IA 2R061 1QJFA 3CIHA 1AX0A 1VAVA 3LDRA 3OY8A 3FFZA 4ZS3A 5FMDA 1Y9MA 3IN9A 2XLGA 4FVVA 4K6BA 1GQHA 4HOOA 1IZ3A 3ZFFB 2ZBJA 1X8EA 3RNSA 4IV1C 2XHKA 5CU1A 5E1RA 3T0AA 2HEWF 4Q4W3 3NJZA 1VBB2 1YUDA 4FP3A 3PU3A 1RTVA 1UMZA 4OUEA 2HWD3 3POBA 4DUXA 3WQ7A 5A70A 1S0BA 2A5ZA 1VBC1 4K8RB 4QHZA 3FL7A 2D3SA 5ABJA 4S2DA 2ZX2A 2I45A 3HBZA 4CEYA 4R52A 4X8PA 1I1EA 4JGZB 5GZEA 4EE2A 2B7YA 5H9PA 1NCRC 5C9AC 4DFSA 1V6IA 3S0MA 5FP4A 4XACA 3KV5A 3MPBA 4DEQA 4DMIA 2DTWA 2PHRA 3H1MA 1OSGA 2PHDA 4GKYA 1SDDB 4P9WA 4Q0SA 3EQEA 1JOBA 1RUH2 1VRH2 2P37A 2HBTA 2DVDA 2KXLA 2WNUC 3FBYA 1R081 3J7MA 2FDJA 3VHRA 1ZRCA 1OI6A 3SMHA 1F35A 1TG7A 3TWIA 4SLIA 1ZA4A 2ZHKA 2QCSB 1W2TA 2ZX3A 3H3ZA 1W6PB 2ATFA 4Q0VA 4BQ5A 2YPJA 2JG8B 4LOTA 3AYCA 3ZFGC 1Q5OA 1V70A 1YNAA 3JBG2 1H9WA 1EYBA 4MHUA 5CA6A 4KH9A 1EUUA 2GC0A 3MIBA 4LOSA 4URTA 4DQAA 3CF6E 4XDOA 1ZZBA 3VGIA 3WDVA 4PT6A 5FUIA 1ND2C 3A0KA 2HH9A 2WJSA 2RS52 3KT1A 3L2YA 5E89A 2RHPA 2WT1A 4NR1A 1SBDA 4AFMA 4MUVA 4CP9B 1MS5A 4YW1A 3GF6A 3JQXA 3ZIWA 1O8SA 4CZSA 4WZCA 5CYYA 4YFZA 5I8SA 1REDA 4CTEA 5FYYA 1W05A 4QX5A 3WT3A 5LWBA 4ARYA 3WOGA 3OD0A 3D0SA 5LBCA 2BTVC 2FQPA 2X53S 3IMMA 2WWSA 5EIYB 4NHYA 1Z78A 3OYWA 3ZKUA 3RZHA 3H7JA 5FKBA 4QXCA 1YFYA 3MO4A 1OUXA 2ZEYA 4RHV3 1VBD3 2WZR3 3C7GA 3P3NA 1UYPA 4IW3A 1KITA 4Z82A 2RDNA 4IEWA 5CBLA 2DCKA 3ZN6B 4CDUA 1AR92 4BE3A 4RHV1 3RQ0A 1VRBA 3B93A 3LEIA 4QB6A 1LHWA 2A1XA 2OW4A 1TME1 4UXAA 1TQ5A 4AVAA 2W94A 3NNLA 4C90A 3NW4A 1A8MA 2QTWB 2ZABA 3R05A 1PX4A 3E6BA 4UI9L 3FHIB 2ZHNA 2HJIA 5JXIA 2JX9A 1JYXA 2Y38A 2XKOA 3CZJA 4XFBA 4XAAA 2XHNA 1RUI3 1WA4A 1AXYA 1V6JA 1LODA 2EF6A 1VIWB 2DFBA 2JDPA 3CMGA 4Q0PA 5C8WA 1ASJ3 1YQ8A 4D94A 1W90A 3MYXA 4QHOA 5FXWA 3RJ2X 4XZPA 1WWYA 1YFWA 4GH4A 1JOJA 1PGW1 5IK5A 4LQRA 4GMP0 3VZOA 1WD3A 1QXJA 5JOYA 1GZ9A 3JD72 1UIKA 3A7QA 2WR9A 3I2HA 2QQOA 4JKKA 4UFLA 4WVMA 5LA1A 2GH8A 4Y22B 5J37A 3CJIA 3T4VA 5ISLA 3TEZA 1O3SA 2GP3A 5J98B 4QQHA 4MV2A 1BBT2 2ZEWA 1B09A 2WFF2 2C26A 1XYOA 1V9U2 1MQTB 4BH9A 2XJRA 1LKNA 2EA7A 2RG4A 1J1TA 1XNKA 4AI2A 3ZR5A 4N8MA 4QKFA 3T0DA 3VD3A 5SV5A 3MW4A 2RS53 5F3IA 3FZ3A 5EWSA 3W5NA 1R092 3AMPA 3FMGA 1UWWA 2QJVA 3W20A 3RYKA 2AC1A 3MIHA 1OLMA 1ZYBA 2LS6A 3K4AA 4Q26A 2D5FA 5JMCA 2E33A 1GANA 1A78A 3OSDA 3WY6A 1LR5A 3AMQA 4XOGA 4BQ1A 1AYN1 1UYZA 3ILNA 1VMFA 1I5ZA 4D6SA 4EYUA 2E31A 1AR81 4W65A 3RDIA 1RUJ2 5JOXA 1Y9GA 5GZDA 4YRDA 4NWWA 3R0RA 3INAA 2VCBA 2JDYA 2JDAA 1HB4A 4EZHA 3VD9A 4IEUA 5JOWA 4N7UA 4X8NA 4JKLA 2E9QA 3N7JA 5JXGA 2A70A 1L7LA 1GMMA 4GA9A 3KGLA 1SBFA 2YY1A 4GWIA 2XG3A 5GM0A 4KGQA 2R7EB 1GBGA 3PJYA 1JH5A 4XF4A 5FZ1A 1XYPA 2GALA 4RGAA 2IXJA 3LZZA 5FYCA 5FZDA 2FDKA 2Q5TA 3AX4A 3LDBA 4CPBA 5FY4A 1RUF3 5K7PA 2Y60A 2ZGOA 3LA3A 2E53A 2ZGKA 1N1YA 3MBWA 4G9SB 2YG0A 4IGPA 4RL7A 4XDQA 5A33B 1IHMA 2WAAA 3THCA 4AFDA 2IZWA 5C9AB 4AFAA 5C8CB 4L9BA 4CDWC 1ULFA 3IT8A 4PDWC 4CPBD 3NAPB 1CAXA 1JZ7A 1O3QA 1UU5A 5HV0A 5C3RA 5FYZA 2RJKA 4XFCA 4IEPA 3WVJA 1Y3TA 4WM8B 3OPZA 2JICA 2WUHA 1H9PA 1X8MA 5HXMA 2VM9A 1LEMA 5FTTC 1WW5A 3H9AA 1WCUA 2W1UA 3ZXFA 2OX0A 2GNDA 4W50A 1DZRA 1DYPA 1PM4A 2VU9A 4FXGB 1H1AA 1ZBA1 1V6NA 2CWMA 2VH9A 4TTGA 5FREA 3B7MA 2BOIA 4Q1PA 1H8TC 3VLBB 1ULDA 4F3JA 1BYHA 5FPUA 1S2KA 1JYTA 1BCXA 4CUBA 3VBOA 2D97A 3WF3A 5FAXA 1COV2 3GZAA 3ITQA 1R1ZA 5C5UA 1JYWA 1UOJA 2CY6A 3I2IA 2WQZC 4D6RA 3E5UA 3KHCA 4TXWA 1QXRA 3KM5A 4LEJA 1Q3EA 1TME2 4IV1A 1W0PA 4QPGA 5FCCA 3ZO0B 4GQ7A 2ZGLA 2IFWA 3QOPA 3H8RA 5T5OA 3OJBA 2WFPA 5JR7B 2BQPA 4IEOA 3N9NA 2MNGA 4EN8B 1MS8A 1KFXL 2R072 1O6UA 3WF0A 1M4WA 5A7OA 4IESA 5TSWA 2X10A 2DBIA 2YGLA 1H2KA 1HRV3 4GH4C 5FJKA 4DINB 4MGTA 5BNNB 2P3KA 1K12A 1UQXA 1WCQA 1XNBA 3ACGA 3ZFEC 3ZYJB 5BY5A 1PVC3 3PL0A 4LUMA 3TNQA 3ZX7A 1RVF3 4MVTA 3SXWA 1W06A 2V73A 3PU8A 1OF3A 1AR63 1YXWA 5IVBA 4OLLA 1RHI3 2PLV1 3I7DA 4JGYA 3AJZA 1EV13 2QDRA 3BTAA 4IEVA 4RFT0 1HXS1 3GHNA 5FYVA 1K42A 2WO3A 3S5QA 4EJRA 3S5AA 1Y7BA 2JDUA 3L2HA 1W03A 1XU1A 1O5UA 1BHGA 4FOWA 3N3HA 4LBKA 1OD3A 4AHXA 1TVGA 2P3YA 3ZYRA 4AOCA 4E4SA 4H7LA 5LA2A 1HDKA 3O0VA 5JXHA 4FPJA 2D98A 4NAMA 1E5RA 2DWRA 1CGPA 5BV6A 1OFNA 2CGNA 2XL7A 1FATA 4KG0A 5CFCC 3UGFA 1W99A 4MGZE 5AVPA 1XYNA 3LPGA 5JMOA 2RV9A 3C2UA 1DGLA 5FZGA 1I6XA 4XFHA 3AKRA 4M01A 5FUNA 4DXTA 3WZ1A 4LO5B 2ADDA 4XUPA 1YIFA 1HJGA 3ACHA 2HWD1 4AL9A 1JW6A 4N43B 2ET7A 3NSTA 3VZNA 5IK7A 3K3OA 1Z7S1 4YYOA 2GC1A 2CTVA 3PVOA 4YW3A 1AR82 5D8AC 2C4XA 1CVNA 1MS3A 2DDUA 3RFRA 2W3JA 2ZX1A 3I3BA 3KWVA 3J8F3 5FDBA 1OLRA 4LO7A 1W9TA 5JVVA 1VPHA 4OHWA 2BUKA 4BIOA 1UKGA 5FK7A 3ZMOA 3R4UA 2WZR1 3OF1A 3RMXA 5LBEA 3TN93 3AZWA 3DF0A 3BPZA 2WS92 3HVDA 3OEAA 5LA9A 3M3IA 4QX8A 5G05L 1UO9A 1UY0A 3HN3A 2HEVF 4PIXA 1ZZ6A 2Z42A 1VBA3 4FAHA 3V64A 5FO8B 3CEWA 1HXS3 2R063 2X09A 3VDAA 4BQXA 4MGQA 4CUAA 3H42B 1DG6A 2XKPA 4Q4W2 1LAJA 1GNZA 3RYPA 5AC93 3KQ4B 3EMRA 4YVSA 2Q1FA 3H3LA 1QJEA 4GMP3 2BGOA 4P00B 1GUIA 4ZZ5A 2IXIA 4YGCA 2BVBA 4DRRA 5FZ8A 5F7UA 3ILRA 2UWBA 5FPBA 5BNOA 3BTXA 5EYXA 2FD8A 1CAWA 2GNTA 4Y4YA 1RVF2 4HBNA 2WL1A 4ITCA 5IAXA 3LEKA 3M70A 5FZ9A 3KT4A 5CZKA 2XR4A 3MHZA 3I2FA 2QBXA 4BQYA 3ZDVA 1MEC1 2A3WA 2JG9B 2Y6JA 3DPRC 2XUMA 5FP9A 5C8CC 1WLWA 4F83A 3I3MA 2XQXA 3GZTB 1AXKA 1YFUA 3O1PA 2OQ7A 1SFPA 4NAOA 4UFIA 4XXAA 3UNPA 2IVJA 3J7HA 5FQ0A 3ZSKA 1HN1A 2GAUA 2WKKA 4HKWA 3T1LA 2IC1A 2ZMKA 3NKTA 5IVEA 1C1FA 2Q0AA 1OUSA 1Y4WA 1IS3A 1IG0A 1JZ2A 5IK4A 4CDUC 3QD6A 2ZGPA 1AF9A 3POSA 5DUWA 3NJVA 2YDEA 1W6OA 3PTYA 3FX3A 4MOAA 5F3EA 2EIDA 5DAPA 3DXTA 1AR91 1GZWB 2D40A 2VW1A 4IE6A 4XILA 1MVEA 4IE5A 4Y1VA 3WG4A 4CDWB 3PUHA 4JHTA 3H50A 4QAWA 1RGSA 4Y5SA 2YZ4A 1RIRA 2EXHA 4HMZA 3AMHA 5DABA 1ZRDA 2WSUA 3Q9OA 4LA3A 4W6XA 2F17A 3KVAA 1RUD3 2DFCA 2ZCWA 3HT1A 4UFJA 5FZOA 4Y1YA 1W8FA 5J96B 5KXCA 3ETPA 2VPVA 3JZVA 1C28A 2O0OA 4HSLA 4V2WA 4UFHA 1VB2A 2BNOA 1OC1A 3SLIA 4S2HA 4ES9A 4XTPA 4PHZA 5ACA3 1HB3A 1YC61 1D4M1 1X50A 1LHNA 4IL7A 4ZKTB 2G1MA 4CXWA 3U4XA 2HWE3 4AEKA 5CNAA 4LUKA 4LTAA 4BMBA 2HWB3 1JI6A 1W8TA 4FPKA 2HWF1 4UW5A 5A7NA 3T2OA 3VKFC 1AR62 2AUYA 2PHFA 3JQWA 3NJXA 4XHBA 2EALA 5I0DA 4R9BA 3E6DA 4Q0QA 2OXBA 4CP2A 4XJAA 5DDJ2 3J7LA 2PQQA 4NUBA 1YWKA 2D3PA 1SMVA 5FMOS 2BBVA 5JCTA 1BEV2 2VCAA 5FZFA 3KQRA 5L7OC 2GZWA 2NZ9A 3U11A 4GMP1 4B4RA 2DURA 4V2VA 2FDFA 2RMU2 2VOWA 4QD2A 4FQZA 4AZZA 5FOBB 4CCJA 1AXZA 4JDOA 2VMIA 4QQLA 4Y20B 5A3LA 5DUVA 5FBJA 5BNQA 5G04L 3CU7A 3ZN5A 4JQTA 2QQLA 4FT8A 2P5BA 4HKLA 4NN0A 3ZKYA 2D6NA 3OYWB 1I5PA 4ZXEA 2Q1ZB 5CADA 5E8AA 4ISQA 2IWGB 2YC2A 4PBOA 1LOFA 5C3PA 3NO8A 2TBVA 4AGGA 1QJX1 2CGPA 4IV3B 5FZKA 1A6CA 1YCIA 1LOAA 1NQDA 1VBE3 4OFGA 1XNTA 4YFWA 5FFOC 3UKTA 4CP1A 1M06G 1QHDA 1YEWA 5C70A 1H1MA 1W8NA 4EQVA 4AVVA 1NYWA 2CAUA 2TUNA 3AKSA 4Q4X3 2WABA 1N1TA 1GNHA 5IVVA 3GJBA 1JZ4A 3SKJE 3MI8A 1LOCA 1EV11 3ES1A 3ZLIA 3LFMA 4LR4A 1UMIA 3ZR6A 2F6BA 1P8JA 1MEC3 4HVOA 4Y1ZA 4XJ9A 3QACA 2VUJA 1XNDA 5JSRA 3H0OA 2UU8A 1R082 3J26N 4L2NA 5FO9B 4QM8A 1WD4A 2R041 1DYKA 2WA3A 1XJAA 1QJX2 3S6PA 2PHTA 2K0GA 1S4CA 4P9GA 3C3VA 4YGEA 1RUE2 4H3WA 2XONA 3BALA 4Q4W1 5JPMB 1EP0A 3A21A 3N7LA 2B42B 2K46A 4M3CB 5H9QA 1FNYA 2QKDA 2SLIA 2R062 1YQ5A 4E8DA 1Q8PA 3LSDA 2E26A 4PDWB 2OPKA 5FZMA 5ACA2 1FV3A 1UPSA 4JRAA 5FMCA 2GMPA 1RVF1 4O9GA 2RMU1 2XJQA 4XPVA 4YVWB 4QQOA 4CDXC 1PGL1 2E51A 1VJ2A 3RPQA 5JI9A 3LE0A 2XL9A 4R4ZA 2OZJA 2P3IA 1JZ8A 2J1TA 4Y4RA 3KLSA 2PFWA 5F9TA 4AEJA 1UY2A 2BJSA 2C9KA 5A3MA 4OMCA 1LOGA 3RSJA 1UX6A 4COWA 2Y8KA 3N35A 3PJQA 5T52A 4W4ZA 1MZ6A 2OQ6A 2XJUA 5I8YA 4AHWA 5H9RA 3B94A 5FYUA 4JTOA 4KWLA 4XDPA 1VE0A 3W5MA 2Z69A 4FCAA 2GNMA 3SCHA 3T09A 3VZLA 1OVPA 5LBBA 2LM3A 1RUH1 1VRH1 4QKDA 4CEWC 1LTEA 3K75B 3RS6A 1YFXA 4E27A 1UY3A 2FMYA 4NE9A 3ZYFA 3OY8B 2BBAA 4S2GA 2RE9A 5JLVA 1VR3A 3KCCA 5L19A 3WUCA 2A3XA 3ZPYA 2MEV3 1GZCA 2CV6A 3OGJA 5E88A 2WNUB 1RC6A 2ZEXA 3PMEA 1H4HA 1Z0HA 4N9HA 5F3GA 5GZGA 3IDCB 4KWKA 1VBC2 4CRQA 5F5AA 2Q8OA 3OD4A 4YG3A 4LHLA 1W2NA 4I02A 3VBFB 1NCRB 1G9DA 2D3RA 1JUHA 4KU7A 2O8QA 1ZVFA 1PZ9A 5E16A 3RG0A 3WEZA 3CO2A 4BLIA 1I3HA 1ZBE3 1DLCA 1OXCA 1SCSA 5A1FA 2JDKA 1FOD1 3UKNA 3ZYHA 4R9CA 1ZREA 4GAZA 3S7IA 3WCRA 5C8CA 1PHMA 1R64A 5JXJA 1MEC2 4NRMA 1DF0A 3ACIA 4OI1A 1OH3A 3SEPA 2AYHA 5A33A 3VBFC 4UWDA 2VC9A 4Q4Y1 4OZOA 3S7EA 4AHZA 1CX1A 1DQ1A 2I2SA 1RINA 2EXJA 3PUAA 1RUJ1 1TME3 4LHKA 4YW7A 5FP3A 3KF3A 3M3CA 3R6SA 1W0OA 2HYXA 2ZA9A 4IV3A 4MGSA 3CZUA 5APAA 1O5LA 4LBNA 5FZEA 2C9AA 4XIOA 4NIGA 4DIQA 1PK6A 1VMHA 5FP7A 3HNMA 4CDQA 2VBBA 4KQ7A 2ARAA 4NO4A 1SLBA 5LATA 4GWNA 1OQDA 3PUSA 5C3SA 1ZZ7A 4YZ1A 3ZSLA 4QB2A 1C8M3 4CCNA 4WVVA 4XABA 1YYNA 2DCJA 1RUJ3 1YJLA 5FZ3A 5ERLA 3T30A 1RUC2 5LBFA 2WQ4A 2WFF1 2A6XA 3WD5A 2JIJA 3SHRA 3GCXA 4BQ3A 5CFCB 3RZMA 2RM22 2VVEA 4YM3A 5CFCA 3HQXA 1DQ0A 4IETA 4CCLA 2A6VA 3UGGA 5F8PA 3AZVA 2WLPA 2JG8A 2RR11 5T50A 1ZRFA 5JAXA 5EP9A 3V65A 1MVQA 4F7ZA 3D4KA 2VTXA 2DVAA 3KZ4C 1JZ6A 4JVAA 4QKBA 5KR7A 2WS91 5JR2A 1CWPA 4IEQA 3FLPA 4ZONA 4CDXB 2OVUA 5FLIA 1F2NA 5B4NA 2YB7A 1SEFA 5KBFA 4ZHNA 2ZMLA 4YM2A 1Z7S2 4A3XA 1N1SA 4CDQB 3AKQA 4P9JA 4Q4X2 4JGYC 4L11A 4AHYA 2MPFA 3PNAA 3DYMA 1DP0A 2QQPA 3KGZA 3FJSA 3H1WA 3IPVA 3NWKA 4LKDA 3UESA 3FHAA 5A32B 3T2QA 4XFAA 4L0PA 4LHSA 2W47A 5LY2A 4CEYB 3FWEA 3PDQA 1BMV2 1KD7A 2B45X 3VBUB 5FKCA 5J3UA 2RS31 5FZOB 1RUE3 2KA3A 4NPMA 3Q8AA 1QJY2 1QH7A 4L8QA 4OVEA 3ZXGA 4LLOA 5F3CA 3W9AA 4DEVA 3JXSA 4KMQA 5F32A 4CSWA 4LBQA 4YW2A 1WCKA 5IW0A 2EAAA 4OI4A 2HWC2 5EJ3A 1H8VA 2XJPA 3MF9A 4LMFA 1CZVA 2VOVA 4QPWA 4PLNA 3LEMA 4UFMA 1UPIA 1IPSA 2W1SA 3VDDC 5K0UB 4DUWA 5F1RA 4KWJA 1S2BA 1D2QA 1UU4A 2GC2A 1GICA 4C0HA 4KNCA 1J3QA 3O1OA 1R1A1 2AACA 4UFKA 5C5TA 1GP6A 4FFIA 3RI9A 3ZN6A 1OF4A 2ZGMA 3I3QA 2VMFA 1COV3 3UV9A 4COUA 1G9AA 1AL0G 3OBRA 1K5MB 4UT5A 3NQHA 1YQ6A 1AYN3 3AL5A 4FPEA 1VAMA 4MADA 1IOAA 1LOBA 5JZGA 3GBWA 2P6CA 4FOVA 4NPRA 2CNAA 1RB8G 1NCQB 2XBO3 2BWAA 5HCHA 1BZWA 2LTNA 4FPOB 1IGOA 4HETA 4OHZA 1N3PA 4UW4A 4Q29A 1X33A 3PIJA 2VMCA 1HJFA 1N47A 2JJ6A 4ZXKA 3NV4A 2JE7A 3VD4A 2K2SA 4HPKB 1E5IA 4RS5A 1XE0A 1AX1A 5GJ6A 5HXVA 2JE8A 3KCXA 4B29A 4YM1A 3I2DA 2WS93 3TN91 4ZPIA 1EAH2 2DVFA 5LA0A 1ZZ9A 3IDEA 3EO6A 3K51A 4S2FA 1S0JA 5FK8A 1D4VB 3WR0A 1PVC2 3AJYA 1UX7A 4AGVA 1HIXA 4IGOA 4FFHA 5FZBA 2PHXA 3F2ZA 5KHKA 2UY9A 1MZ5A 4Q2FA 4LPLA 1EV12 2AEYA 5FZ4A 2PAMA 1FT9A 2D5HA 1J84A 2Q4SA 1O4YA 1U5ZA 1UY1A 3PTRB 1QGLA 1VLNA 1W0NA 4AG4A 1ZNPA 2YHJA 5HI0A 2Q30A 1JBCA 2W92A 3EYPA 4HL0A 3RWKX 2JWPA 2D44A 1RUE1 3I3DA 2G9GA 5CFDA 4FI9A 4XIKA 4AI0A 3NAPC 1A8DA 2VQ0A 3U07A 2C1FA 3AP9A 4RA0A 3NNMA 4Q4V3 1QQP3 2VZPA 2BOJA 5IATA 3FHQA 3WDUA 1BK1A 3MIFA 1XOYA 4UW6A 1CONA 2VGDA 4P08A 4QPIB 2CDOA 1TNFA 5EQUA 4P9YA 2D6MA 1WGPA 2YU1A 2VZ1A 4QPIC 3SNMA 3GYDA 1JODA 4BK5A 3AKTA 3G7DA 5A6ZA 4LA2A 4N53B 1LULA 4B3NA 4XFIA 4H14A 4J1XA 4HSJA 4XXPA 1KS5A 3ZOIA 1DGRN 3RRDA 3T08A 4E4DX 1UXZA 4QWNA 4Q4V1 4EWAA 1US2A 3NVCA 4YW5A 2NQYA 4XJZA 5DDJ1 3ZSMA 4AAXA 2RM21 3IDAA 4IQPA 4E2SA 2EIBA 2BV4A 3DCQA 2C6SA 1NA1C 5CB7A 2Q8DA 3U0ZA 3ECQA 2GMMA 2HWB2 3HAGA 4NMIA 3TN92 2C24A 4KU8A 1WLDA 1EUTA 4O9EA 4P14A 3WDXA 4BA6A 2X5IC 1CAUB 3MFCA 1MR5A 3AYAA 4XC9A 3VD7A 3SCFA 3BOPA 5A6YA 1BEV1 1KDKA 1UU6A 3FLRA 1QY4A 3OEBA 5A3UA 2P1BA 1R093 2IXKA 2W95A 3ZSJA 1E57A 5KWRA 2IXHA 4RYDA 1W6MB 3JUUA 1OT5A 4EN7B 4AYUA 2LUWA 5DN2A 1JUIA 2D6PA 3GJAA 3O14A 1PIV3 2ENRA 4Y5TA 3ACFA 2Y33A 2DU1A 2XDVA 1NOVA 2WLQA 3KF5A 1UZYA 3BKZA 4FFFA 4QX2A 2OKXA 1Q56A 4EN6B 3K77A 2DV9A 3R4SA 1GZWA 2B46X 1UCXA 1FMD1 4LBJA 2R0FA 1W39A 1MS4A 5FZ0A 1NY71 1ULOA 1X9PA 2LROA 5DAQA 5FLHA 5A80A 2WT2A 3VD5A 4D7TA 3V0AA 1WLTA 2EICA 3AFKA 2AENA 2O1QA 3WHUA 1IPKA 3J8F1 4SBVA 2WWJA 4XF1A 3WNXA 4A6OA 3NJYA 4M00A 1HX6A 1LNSA 2R1DA 1F31A 5BNPA 3O1VA 3LGRA 3BB6A 1QOTA 3BU0A 3G6JB 1QNYA 4HFSA 2VTFA 4PLOA 5I8TA 3J9SA 4BCUA 3JD73 2SBAA 3O1SA 4RSUA 5A3PA 2HWC3 3IM0A 4Q0UA 2Y6GA 5F2WA 2YBSA 3TOJA 3VBOB 1R1A2 1K5MC 4WM7A 2V72A 3H7YA 1JXNA 5D8AB 4RGKA 4I01A 1FPN1 4D3WA 5FZLA 3B00A 1AJOA 1OKQA 2XWBB 4CCEA 4P5HA 3AC0A 1PO11 1ULPA 3OGRA 1XSQA 3UT0A 2JE9A 4WZFA 4N43C 3IBMA 4LNVA 5CFDC 1MPXA 4FXKB 2WNVA 1UIJA 3MLLA 3T3YA 5K0UC 4AW7A 3PVNA 3BIEA 3NV1A 2WA4A 4TLFA 1W6NA 3OTFA 5LZ6A 3ELNA 1CZSA 3OGSA 4FAGA 4XURA 4IE0A 1GOGA 4MXVA 2VZUA 4PF1A 3IDBB 5EYYA 1C8NA 2PLV3 3DGTA 3HN1A 3WNNA 5FJHA 2X5IB 5J36A 4NIAA 1W8HA 1AYM2 3RMYA 4AI8A 1RUOA 5JSOA 1GWLA 3D3AA 4LKSA 3H8UA 3N9MA 2PHLA 3NV3A 3JU9A 3BODA 1H6XA 2R49A 2B8MA 4I0AA 1FMD3 1ZRRA 3KCYA 4FTBA 2JDMA 1WCSA 2XLFA 2ZXQA 1EAH3 3BVCA 1W6MA 5BNOC 2ZACA 3JB8A 3FBMA 1LECA 3C7HA 4QDRA 2P4EA 4E2QA 3DYOA 1XC6A 3MUY1 1XQNA 2FCUA 1GU3A 5I0UA 3B01A 1LHVA 1UMHA 4W6YA 4UAPA 1WMFA 3AP6A 3L9JT 1UAIA 4LIVA 1LRHA 2DYCA 4P9XA 3TEYA 4I30A 3O1TA 1YO8A 4NRQA 5IK8A 2R073 5JUVA 5FWJA 1VBA1 2I74A 2JD9A 1YJKA 3ZFGB 1WMEA 3THDA 1TMF3 3OGGA 3BIWE 1HRV2 1XPWA 3POGA 5FMOL 1JYCA 2WYSA 3VKOA 1ODNA 4A6SA 2PAKA 3IIIA 3GHMA 1SLIA 2ZMNA 3C8XA 5E6HA 1NKGA 2CU5A 2E6VA 3Q8FA 2FDHA 1C4RA 3IAQA 5A6XA 1YQ2A 4R8HA 5K8SA 1PM7A 3I4IA 1POQA 3B9IA 1NZCA 3D6EA 3KSCA 4ET7A 2WSVA 1QQP1 4G3YC 4QX0A 4AQSA 1ZA7A 2VY0A 4FPFA 4Y5Z0 1FPN3 2MHFA 1UL9A 2VZQA 1NT0A 4JV4A 2YU2A 4XEZA 1YI9A 3ZM8A 2H6BA 2LW8A 4JGZC 4XMIA 1XNCA 1NAEA 1GNYA 3WF2A 3ZXAC 1GV9A 1W6QB 1YI7A 5JI7A 3T1MA 4AFCA 5IFTA 1QEXA 1PGSA 4QQ2A 4MGKE 1NXD1 1V6LA 1LESA 1CQ9A 3AZZA 1B35A 1SLTA 3AKPA 4H55A 3RGBA 1W8ZA 2IXCA 3ATGA 4BPZA 1VMJA 5LK7B 1ACCA 2C5DA 3P5BA 4I0BA 4CE8A 2OS2A 3WG2A 3MW2A 3CKHA 1JHNA 4HT1T 4NRPA 1ND3C 4L97A 5LEKA 3NV2A 4W8JA 3ZYIB 3IKWA 3LPFA 1VBC3 1DBNA 3WDTA 4QU2A 3M7AA 2WRAA 1S0EA 3VHNA 4CUGA 2CDPA 1RUC1 3HNBM 4UF0B 2ERFA 1F5JA 2YC0A 4KL1A 3M3QA 4CCCA 5FY5A 4XTMA 2ZKNA 1SFYA 4QB1A 5BNPB 5FOJB 1NE4A 4Z8BA 4HK8A 1W9WA 2W1QA 3WV6A 1AYM3 5AFBA 3WW4A 4UBGA 1GOFA 4AEMA 1S2EA 1OMIA 1LOEA 2DTYA 2YGMA 4HPKA 2ZGTA 4LE3A 3VBRB 3VZJA 4GWMA 4DO0A 2RR12 4AQ6A 1QJU3 2VXJA 4D0QA 4CU8A 1UKRA 1UZVA 4AFBA 3VBSB 5IJRA 2D93A 5ANQA 1H30A 1NCQA 2YMZA 1X7NA 4RR3B 1NQJA 3TEXA 2WZ8A 2YBKA 1D4M3 1JTZX 4BDVB 5FYTA 1W6QA 2XJTA 4Q4Y2 1PVXA 1HXS2 4IDZA 4TYSA 2ORXA 4E9KA 1AYM1 2J1RA 1KRIA 4TZDA 5GLZA 1NG0A 3AYDA 3H8OA 4XFGA 3AXDA 4BM8A 2OPWA 2J1AA 3D8CA 4PI2A 5J7MA 3O1MA 2B4KA 5GLTA 3U78A 4YSFA 1OURA 3CDZB 1CX4A 1ZZCA 5K0UA 3VDBA 2J1UA 3LAGA 3ZXDA 1SLLA 4XYXA 4NWVA 4Z92B 4LULA 2R043 2WNVB 4GIQA 3K2OA 5DPNA 4XVHA 5JOZA 4D8MA 1PGW2 4YZ4A 1YRZA 5KC6A 1I9RA 2Q1MA 2VE1A 3HEIA 3POYA 4NHXA 4A4AA 1ASJ2 1H2NA 2XLAA 1BVP1 4XFFA 5H9SA 3ZIXA 4B7KA 2GN3A 2FZ2A 3UGHA 5GLVA 3ZDSA 3E6CC 3ZN4A 1ENRA 5D1IA 1ZBA3 3X29B 2ZAHA 3PURA 4P5YA 1HLCA 1O59A 1WBLA 1XRUA 4J1WA 1OA4A 1OOPA 1L7RA 2EIEA 2VD7A 2Z79A 3TB0A 4BB3A 1HRI1 1GP5A 2TEPA 5T5LA 3VBHB 3POIA 1LJ7A 1DGWX 2DCYA 3UJQA 3I49A 4D7SA 3VBOC 2YPDA 1CD3G 4KBZA 1O4ZA 4FP2A 5FZHA 3I54A 4QKNA 3TYJA 3U75A 3VZMA 3ZYGA 2VW0A 4AF9A 4EWDA 5C71A 5CG8A 4XUNA 3KS7A 2VZOA 2P17A 4MO3M 5FYIA 1H2MA 4C0BA 2Z4FA 1AUYA 1WKYA 4IEXA 1XU2A 4CCDA 4YG6A 4MH0E 5CFDB 3K3NA 3MICA 1Y9QA 3W21A 1G9CA 2UWAA 1UYXA 3O0WA 1O8PA 5FY7A 1F4AA 2J7MA 3N9PA 5JIUA 4GJYA 4EWEA 1AYN2 2A75A 1NCQC 4DRVA 4QM9A 4FOQA 5DQ0A 2R1BA 3W58A 1Q8VA 1VB4A 2IXLA 2PHWA 2R071 2RS13 2V5YA 4LK7A 5DXDA 4OQ9A 4D7YA 5IYYA 1CAXB 1XBFA 2W46A 1FV2A 4QDSA 2JB4A 4BQ4A 4BXSV 1MQTA 4LKEA 3ZFGA 1SLAA 2W87A 4BIFA 1RUNA 3VBHA 2R16A 1Q8OA 1TMF2 2UY8A 1G86A 1NY72 3GBFA 2Y0IA 4HZFA 2BWCA 3MV11 2ZZQA 5DAVA 3ZXEA 3KB5A 4PQQA 3T2TA 3AVRA 4HN0A 4YM0A 4Y24A 3H1YA 1POV0 1BJQA 2VVDA 1FI2A 3HJRA 3OBTA 4EN0A 4BOWA 1B35C 4URAA 2G9ZA 4AWDA 1PMJX 5A7QA 2XVLA 1PO21 5F5CA 1DZTA 4Y1XA 2RJLA 3HD8B 5J09A 4MX3A 3GBGA 1WCDJ 5LB6A 1BEV3 4DXSA 2FBEA 4Y33A 2Y6HA 2ZGNA 3GM8A 3IAPA 4I09A 2BGPA 2EXIA 1F4HA 4QXKA 2XWJB 4LLFA 3VDCA 2XPJA 5FBZA 3T0BA 3RWNA 2PMWB 2WNOA 2YFZA 5CISA 3S57A 2B39A 4XCAA 1CIYA 2J1VA 2ZTNA 4Z1VA 4NJ4A 2VOKA 1O3TA 1NA1B 1YLLA 4M3CF 3UJOA 3V0BA 3EXUA 4HK9A 1GQGA 3KT7A 4NPLA 3BUCA 4I3PA 2E7QA 1OKOA 3ALQA 1RXGA 4P02B 4JDNA 1S55A 4Y22A 4NIDA 3ZYPA 4A41A 4O7XA 4LBLA 5CAZA 3BI3A 1NUKA 2VNOA 1RUF1 4YW6A 1PX3A 4XUOA 2G9FA 3N9QA 4IGQA 3WP5A 1CAUA 1MACA 1H8TA 4I0WB 1O4TA 4META 3ENRA 2RR13 4ZU4A 4INDA 5F37A 3T2PA 2AEZA 1ZBE1 4XW3A 1BBT3 3FE5A 2HWF3 3WP6A 1HB2A 1BKZA 1FNZA 4OHXA 3NRUA 1LHUA 2YUEA 3O12A 4LO6B 4K9SA 5FZIA 1G7YA 3AL6A 1HRV1 2G4IA 1BK0A 1QDCA 2QZ2A 2Y34A 4B1LA 1BBT1 4OZXA 3O1UA 1TZOA 1W8WA 2JKBA 4LIUA 5IVFA 1AR73 4K21A 4PIYA 2JB8A 1XSRA 4QHBA 1QWRA 5FY1A 1XXNA 5A1AA 3WP4A 4CP0A 2QQJA 4LORA 5T3NA 1OFSA 4OMDA 1S0CA 2JIGA 2QQMA 2I07B 3BPSA 4HXCA 4C91A 5DZFA 4RFRB 3BTYA 1SFNA 1OOPC 1SLCA 3PUQA 5DAXA 2RDQA 4RGGA 1OVSA 3M2MA 5EFUA 3MZHA 3RZZA 2VMHA 3LA7A 3UL2A 1T2XA 4NHKA 1QH6A 3ORJA 1DQ2A 4B7EA 1UD1A 4FPYA 3LOIA 4OUSA 3O5SA 1PO12 5FYMA 4BXFA 1AL21 2QVSB 2WDBA 4XZUG 1PZ7A 1IS5A 3IB3A 2WN3A 3ETQA 4A45A 4IV3C 2FMDA 5IVYA 4R9DA 3RZJA 4LBQB 1DU3D 1ALYA 1RUF2 4LO4B 3MLKA 5A7WB 5L7OA 1RUG1 1JS9A 2R30A 1V6KA 3K4ZA 3KD4A 1YHFA 3RVHA 2HWD2 1PNFA 1F8VA 4RQPC 4XCBA 4FTSA 1QJZA 1GOHA 2QQWA 2WC2A 3APBA 4XHXA 5A7WA 5L7OB 2R0HA 5FPZA 1N3OA 2ID4A 4MSVA 2Q8CA 2F4LA 4Q4V2 4U36A 1CR7A 1QIQA 4NIHA 4DNYA 1UZZA 2HYKA 2W91A 3DKQA 3KV9A 3O1RA 1ST8A 1UNBA 2WYFA 3MPPG 4AE2A 3ZFFA 4BWOA 1VP6A 1RUG3 2HWB1 3J4UH 3LEGA 4GKXA 4E4HA 4ASKA 5T54A 3MIDA 4CDXA 4KG8A 3J8F2 2PYTA 4QX3A 2R6QA 2BVVA 3AFGA 3I59A 3MLJA 4LBMA 5FZ7A 1WMXA 4DY5A 1HN0A 2D43A 1DYOA 4B4PA 4QGNA 2D6OX 1GLHA 2E7AA 3OPTA 3SH4A 3O0XA 5BUVA 1PNGA 2WQ8A 4CYDA 1IKQA 3VHPA 5A3NA 4FPHA 4A7YA 3NKGA 4QPGC 3WG1A 2A6WA 1PMHX 2HWF2 4DS0A 1OA2A 5C3OA 4YVWC 4FPLA 5CKMA 1UY4A 3MUZ1 2QNKA 4JX0A 3AP5A 4TSVA 3PHMA 2B5HA 1EAH1 3B02A 4XAEA 1QJU1 2VZ3A 2WT0A 2XGXA 3U14A 2ZZJA 4ZY9A 1ND2B 4KI5M 3ZFEB 4Z2WA 3TRSB 3BTZA 3I8TA 3DECA 4CXYA 3TEWA 1QOOA 4HVQA 5LRSA 2PLV2 4WM7B 1S0GA 2ZEZA 3ZXLA 4LITA 1PZ8A 4QXBA 1EPZA 1RUD1 2XH6A 3FC0A 2J1SA 3SISA 1UXXX 4HN1A 1ENXA 4M3CE 4ZU5A 3D82A 4HANA 1LCLA 1ND3A 2J1EA 1ENQA 5KHIA 4YGBA 1K5MA 1BQPA 1JMUB 1DQ4A 3MFAA 5D2AA 4CEWA 3NNFA 5BNNC 5IVJA 1FPN2 2W0XA 3DPRA 1AHSA 1IS6A 3LSEA 4COYA 1WW4A 1AR93 4TN7A 3EJKA 3I2KA 3V0AB 1RHI2 1QOSA 4AEDA 1HRI2 3K48A 1SPPB 3VBRC 2NP0A 1VBB1 4LXLA 4A7ZA 4FTEA 2HWC1 1Z7S3 2GC3A 4CDWA 4K3UA 2E63A 2DVBA 1NCRA 1ZBE2 3MW3A 2OIIA 1G9FA 4JDMA 3RZLA 1SPPA 3ZPOA 4IEYA 3PIGA 3C7OA 4QDQA 2HBUA 2WO2A 4PF5A 5T55A 2KD7A 2WZPP 4NHMA 1WBFA 1DZQA 3KVBA 2GN7A 4QU1A 3SKVA 1NLRA 3AP4A 5DMYA 4FOYA 1ND3B 1U5IA 2NMOA 1W2AX 3AMMA 3OUHA 4E8CA 1W28A 1CZTA 1HV0A 1H8TB 1RUG2 4PCRA 3WUDA 4QX7A 3O7OA 4PBPA 5JSPA 1QJY1 2WO1A 1X9TA 1MS0A 1DQ6A 2D7FA 2VL4A 5DZEA 4DXRA 2K9ZA 5FPAA 4E4ZA 5CG9A 2ARBA 4FFGA 1MZFA 2DCZA 4CCKA 3VUOA 1DCSA 1AR61 3B69A 4LK6A 4BU2A 2RJ2A 3BN6A 3E5QA 1C8M2 1GWKA 5LASA 4CP9A 1RMU3 1UYYA 1NA1A 2UYAA 2WFF3 4O65A 2BEOA 2W52A 2FZ1A 4Y20A 4CU9A 4BQWA 1AZDA 4LE4A 4D69A 4EN9B 5KXDA 1W04A 5FY9A 4HG6B 4B1MA 3ZVXA 4OHYA 1W9SA 2H0BA 1TNRA 3QBQA 1RMU1 1POV1 1V6MA 4YVWA 3WF1A 1VALA 2H0VA 2WZR2 3N9OA 3RJRA 3ROUA 4BYYA 4YWAA 1QKQA 3F95A 2XBO2 2ZX0A 1W6PA 4JAAA 3GXUA 1J3RA 2JDNA 1L7QA 2Y6FA 2ZJCA 3HNYM 2NLRA 4ASMB 1APNA 4YGDA 3ZSEA 1WW6A 3ME2A 4WM7C 1HV1A 4NVPA 2PAEA 4Q8LA 4Q4X1 2Z5WA 2VNVA 4D6QA 5AFEA 5HV4A 2QUOA 1DGWA 4MYEA 4MGIE 1DFQA 1H6YA 2RDRA 1QJU2 3AVSA 2JXAA 5J48A 2EVXA 4JCKA 1FXZA 1ULGA 3K4DA 4XQDA 4XE9A 5CKQA 1OLME 4GXLA 4ASLA 1C1LA 1RITA 5LK5A 5D21A 2VTXJ 4CA9A 5FYSA 4CDUB 1G6NA 2DCTA 5FRAA 2XQRA 1AR71 2EXKA 4HLTA 4OUMA 4LBQD 2OYZA 2A6ZA 5GKAC 5LW9A 4TWTA 5A3OA 3U37A 2W5FA 3EB7A 5I93A 3VKLA 3LB9A 4I2OA 1NZIA 4RD7A 2YYOA 2RDSA 1QJY3 1FOD2 2QQNA 3UKVA 1NXMA 4EROA 4PLMA 4DPNA 3WG3A 3SH5A 4QGMA 1LOFC 3LDKA 4Q8KA 5FLJA 5FR3A 2R042 5FV3A 1RYYA 2XUEA 4GB33 5FWEA 4XUTA 2GNBA 5IAVA 3CLPA 1IPJA 1AL23 1N3QA 1S0DA 3I2GA 3P3PA 1KS4A 3PVEA 1BMV1 3HWJA 2OT7A 3CBNA 3I3EA 1RHI1 3OOXA 1MQTC 5JZGB 2CSGA 4F8AA 3QCWA 5FZ6A 3WX5A 5LY1A 2ZS6B 1HQLA 1LGNA 3CQOA 5F2SA 4OQ8A 2ARXA 4MHRA 1V9U3 2A3YA 5DAWA 5F6KA 1VBE1 1CESA 4MZUA 3AYEA 4BK4A 4A7KA
chains in the Genus database with same CATH topology
1NAEA 1GNYA 3WF2A 3I2JA 1SHWB 2PQSA 5IFTA 5J1XA 5G04L 1D7PM 2QQLA 4XUQA 2X05A 3CIHA 1I5PA 4ZXEA 2YC2A 3CKHA 4W8JA 2YFUA 3LPFA 3T0AA 2VMDA 1XNTA 4A42A 1K3IA 5C70A 2CDPA 3HNBM 1W8NA 4OUEA 4DUXA 2WABA 4QB1A 4A44A 3FL7A 3GGLA 1JZ4A 3SKJE 1W9WA 2W1QA 1UMIA 1GOFA 1P8JA 4DEQA 4D0QA 4IUGA 4CU8A 1SDDB 4GZ9A 5IJRA 2XONA 3HOBA 3A21A 3FN9A 2WZ8A 4BDVB 1TG7A 4E8DA 2ORXA 2E26A 2J1RA 2W9XA 1NX9A 2J1AA 2QQIA 2B4KA 3LE0A 1EUUA 3CDZB 3VDBA 2J1UA 1JZ8A 2J1TA 3WF4A 4PT6A 5FUIA 1UY2A 5DPNA 2C9KA 4OMCA 4XVHA 4D8MA 4A4AA 2Y8KA 3HPNA 3HEIA 4W4ZA 2E32A 1O8SA 5CYYA 3W5MA 3T09A 4P5YA 4ARYA 1O59A 3K75B 4UOJA 1W8OA 1UY3A 5EIYB 1L7RA 2EIEA 2BBAA 2WZEA 3MO4A 2ZEYA 3C7GA 5C71A 2ZEXA 2DCKA 4XUNA 3E1F1 2VZOA 2Y6LA 4MO3M 2Z4FA 1WKYA 3C7FA 3LEIA 4QB6A 4QX1A 2YC4A 3OG2A 1UYXA 1O8PA 2W94A 1F4AA 2J7MA 3K46A 2HLEA 1PX4A 4UI9L 3WEZA 3NNGA 5DQ0A 5JXIA 1JYXA 4A3ZA 1DLCA 3BGAA 3CZJA 2XHNA 5IYYA 3CMGA 1R64A 2W46A 4CUCA 4QDSA 5JXJA 4BXSV 3ACIA 3SEPA 2W87A 4CU7A 2VC9A 4OZOA 1CX1A 3MV11 2VOTA 4LQRA 3OBAA 3I2HA 3A7QA 4JKKA 4PQQA 2HYXA 2QQOA 4MGSA 5LA1A 3CZUA 2WN2A 3HJRA 3C7EA 3HNMA 1PMJX 2VZRA 3I97A 2BZDA 2ZEWA 2RVAA 5IFPA 4DXSA 2C26A 4QB2A 2Y6HA 3GM8A 3IAPA 2BGPA 2DCJA 1F4HA 4M4PA 3VD3A 3VDCA 3T0DA 1JU3A 3T0BA 3W5NA 1UWWA 2YFZA 1JU4A 2VZSA 1CIYA 2J1VA 2LS6A 3K4AA 2E33A 1JZ6A 1JZ5A 1UYZA 2E31A 5JR2A 5B4NA 2YB7A 2VCBA 2JDAA 2VQTA 4P02B 3VD9A 3WNPA 4A41A 3DYMA 1DP0A 4JKLA 5JXGA 1NUKA 1GMMA 1PX3A 4XUOA 3UESA 4GWIA 3FHAA 2R7EB 3T2QA 4L0PA 4LHSA 2W47A 4OYUA 3T2PA 4CVUA 5LCWL 1KGYA 3MBWA 2YG0A 2WAAA 3THCA 3NRUA 3WNMA 2VMEA 1GQPA 4DEVA 3JXSA 4KMQA 1JZ7A 1JYNA 3UETA 3SEEA 1CZVA 2WUHA 4QPWA 5HXMA 2W1SA 2VM9A 4DUWA 2B9VA 2VR4A 3WNOA 5HPOA 5A1AA 2QQJA 4OMDA 2QQMA 2W1UA 4W50A 1OF4A 2VMFA 4JHZA 3NQHA 1T2XA 4MADA 4TTGA 2WDBA 4XZUG 3IB3A 2WN3A 4A45A 2VMCA 2JKXA 4DUVA 4CUBA 3P6BA 2QQKA 3VD4A 2VO5A 1JYVA 3WF3A 2JE8A 1JYWA 3I2IA 2VCCA 3K4ZA 4TXWA 5LA0A 3OB8A 1GOHA 1UX7A 3F2ZA 2ID4A 5IHRA 4LPLA 2W91A 3WF0A 1J84A 4AG4A 1UY1A 2X10A 1W0NA 4GWJA 3LEGA 3EYPA 2W92A 1K12A 1WCQA 3DYPA 3ACGA 4QX3A 3I3DA 4FI9A 1OF3A 1DYOA 1XNAA 2VZPA 3FHQA 1K42A 2WO3A 2WQ8A 4P08A 2CDOA 2V5DA 1PMHX 1BHGA 1OD3A 2VZ1A 1TVGA 4BK5A 1UY4A 5LA2A 3MUZ1 5JXHA 1J83A 3GDBA 4JX0A 2W1WA 2VZ3A 4ZZ8A 4ZY9A 3T08A 4KI5M 1W99A 1UXZA 2Y64A 3DECA 1US2A 3LPGA 5JMOA 4AAXA 2RV9A 3IDAA 4DXTA 2EIBA 2ZEZA 4XUPA 3ACHA 3ECQA 1EUTA 3OGVA 2J1SA 1UXXX 3VD7A 2C4XA 2DDUA 3OEBA 2J1EA 2W3JA 4KWUA 3I3BA 2W95A 3P1IA 5EJ1B 4ARXA 4RYDA 1SG3A 1W9TA 1OT5A 5DN2A 4BJ0A 1UZ0A 3WNLA 3I2KA 5C7GA 3ACFA 2WBKA 3WQBA 3OEAA 4QX2A 1KEXA 5G05L 2OKXA 3K77A 1UY0A 3HN3A 2L9LA 1ULOA 3C7OA 3VD5A 2EICA 4QDQA 2VZTA 2WO2A 2X09A 3VDAA 2KD7A 4MGQA 4CUAA 4A6OA 3SKVA 1IQDC 5DMYA 1LNSA 2BGOA 1CZTA 1GUIA 2VTFA 4P00B 4ZZ5A 4CU6A 5F7UA 2WO1A 1JHJA 2Y6GA 2V72A 2VL4A 3LEKA 3MV01 4DXRA 5CZKA 3I2FA 2QBXA 2VJXA 2Y6JA 3AC0A 1ULPA 3OGRA 2J22A 2XQXA 4M4RA 3UNPA 2RJ2A 3BN6A 4E8CA 3J7HA 1JZ3A 2BERA 1UYYA 1HN1A 4CU9A 1MPXA 4HG6B 1JZ2A 1W9SA 1CZSA 3OGSA 4XURA 3NJVA 3WF1A 4YPJA 1GOGA 2VZUA 4MOAA 4PF1A 2EIDA 2XOMA 3WNNA 1K45A 3A22A 3GXUA 1L7QA 3PUHA 3HNYM 3D3AA 4LKSA 4QAWA 1H6XA 4RN5A 3ABZA 1H6YA 2ZXQA 2VZVA 3K4DA 3C7HA 4QDRA 3DYOA 1XC6A 3ETPA 3MUY1 1GU3A 1UMHA 2ORZA 4UAPA 3WSOA 4JKMA 3U37A 2W5FA 3EB7A 5JUVA 2JD9A 2V4VA 3THDA 2QQNA 2VQUA 1XPWA 3A23A 2WYSA 1OH4A 3ZM8A 1JI6A 3IIIA 3C8XA 3T2OA 1NKGA 1RYYA 3IAQA 4XUTA 1YQ2A 3NJXA 5I0DA 3LQCA 3I2GA 4ET7A 3I3EA 4QX0A 4Z2AA 3CQOA 2VCAA 3WNKA 5EJZB 2VZQA 5B4XA 1US3A 2WAOA 3PUIA 2Y6KA 2LW8A 4BK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NAE A;  1GNY A;  3WF2 A;  3I2J A;  1SHW B;  2PQS A;  5IFT A;  5J1X A;  5G04 L;  1D7P M;  2QQL A;  4XUQ A;  2X05 A;  3CIH A;  1I5P A;  4ZXE A;  2YC2 A;  3CKH A;  4W8J A;  2YFU A;  3LPF A;  3T0A A;  2VMD A;  1XNT A;  4A42 A;  1K3I A;  5C70 A;  2CDP A;  3HNB M;  1W8N A;  4OUE A;  4DUX A;  2WAB A;  4QB1 A;  4A44 A;  3FL7 A;  3GGL A;  1JZ4 A;  3SKJ E;  1W9W A;  2W1Q A;  1UMI A;  1GOF A;  1P8J A;  4DEQ A;  4D0Q A;  4IUG A;  4CU8 A;  1SDD B;  4GZ9 A;  5IJR A;  2XON A;  3HOB A;  3A21 A;  3FN9 A;  2WZ8 A;  4BDV B;  1TG7 A;  4E8D A;  2ORX A;  2E26 A;  2J1R A;  2W9X A;  1NX9 A;  2J1A A;  2QQI A;  2B4K A;  3LE0 A;  1EUU A;  3CDZ B;  3VDB A;  2J1U A;  1JZ8 A;  2J1T A;  3WF4 A;  4PT6 A;  5FUI A;  1UY2 A;  5DPN A;  2C9K A;  4OMC A;  4XVH A;  4D8M A;  4A4A A;  2Y8K A;  3HPN A;  3HEI A;  4W4Z A;  2E32 A;  1O8S A;  5CYY A;  3W5M A;  3T09 A;  4P5Y A;  4ARY A;  1O59 A;  3K75 B;  4UOJ A;  1W8O A;  1UY3 A;  5EIY B;  1L7R A;  2EIE A;  2BBA A;  2WZE A;  3MO4 A;  2ZEY A;  3C7G A;  5C71 A;  2ZEX A;  2DCK A;  4XUN A;  3E1F 1;  2VZO A;  2Y6L A;  4MO3 M;  2Z4F A;  1WKY A;  3C7F A;  3LEI A;  4QB6 A;  4QX1 A;  2YC4 A;  3OG2 A;  1UYX A;  1O8P A;  2W94 A;  1F4A A;  2J7M A;  3K46 A;  2HLE A;  1PX4 A;  4UI9 L;  3WEZ A;  3NNG A;  5DQ0 A;  5JXI A;  1JYX A;  4A3Z A;  1DLC A;  3BGA A;  3CZJ A;  2XHN A;  5IYY A;  3CMG A;  1R64 A;  2W46 A;  4CUC A;  4QDS A;  5JXJ A;  4BXS V;  3ACI A;  3SEP A;  2W87 A;  4CU7 A;  2VC9 A;  4OZO A;  1CX1 A;  3MV1 1;  2VOT A;  4LQR A;  3OBA A;  3I2H A;  3A7Q A;  4JKK A;  4PQQ A;  2HYX A;  2QQO A;  4MGS A;  5LA1 A;  3CZU A;  2WN2 A;  3HJR A;  3C7E A;  3HNM A;  1PMJ X;  2VZR A;  3I97 A;  2BZD A;  2ZEW A;  2RVA A;  5IFP A;  4DXS A;  2C26 A;  4QB2 A;  2Y6H A;  3GM8 A;  3IAP A;  2BGP A;  2DCJ A;  1F4H A;  4M4P A;  3VD3 A;  3VDC A;  3T0D A;  1JU3 A;  3T0B A;  3W5N A;  1UWW A;  2YFZ A;  1JU4 A;  2VZS A;  1CIY A;  2J1V A;  2LS6 A;  3K4A A;  2E33 A;  1JZ6 A;  1JZ5 A;  1UYZ A;  2E31 A;  5JR2 A;  5B4N A;  2YB7 A;  2VCB A;  2JDA A;  2VQT A;  4P02 B;  3VD9 A;  3WNP A;  4A41 A;  3DYM A;  1DP0 A;  4JKL A;  5JXG A;  1NUK A;  1GMM A;  1PX3 A;  4XUO A;  3UES A;  4GWI A;  3FHA A;  2R7E B;  3T2Q A;  4L0P A;  4LHS A;  2W47 A;  4OYU A;  3T2P A;  4CVU A;  5LCW L;  1KGY A;  3MBW A;  2YG0 A;  2WAA A;  3THC A;  3NRU A;  3WNM A;  2VME A;  1GQP A;  4DEV A;  3JXS A;  4KMQ A;  1JZ7 A;  1JYN A;  3UET A;  3SEE A;  1CZV A;  2WUH A;  4QPW A;  5HXM A;  2W1S A;  2VM9 A;  4DUW A;  2B9V A;  2VR4 A;  3WNO A;  5HPO A;  5A1A A;  2QQJ A;  4OMD A;  2QQM A;  2W1U A;  4W50 A;  1OF4 A;  2VMF A;  4JHZ A;  3NQH A;  1T2X A;  4MAD A;  4TTG A;  2WDB A;  4XZU G;  3IB3 A;  2WN3 A;  4A45 A;  2VMC A;  2JKX A;  4DUV A;  4CUB A;  3P6B A;  2QQK A;  3VD4 A;  2VO5 A;  1JYV A;  3WF3 A;  2JE8 A;  1JYW A;  3I2I A;  2VCC A;  3K4Z A;  4TXW A;  5LA0 A;  3OB8 A;  1GOH A;  1UX7 A;  3F2Z A;  2ID4 A;  5IHR A;  4LPL A;  2W91 A;  3WF0 A;  1J84 A;  4AG4 A;  1UY1 A;  2X10 A;  1W0N A;  4GWJ A;  3LEG A;  3EYP A;  2W92 A;  1K12 A;  1WCQ A;  3DYP A;  3ACG A;  4QX3 A;  3I3D A;  4FI9 A;  1OF3 A;  1DYO A;  1XNA A;  2VZP A;  3FHQ A;  1K42 A;  2WO3 A;  2WQ8 A;  4P08 A;  2CDO A;  2V5D A;  1PMH X;  1BHG A;  1OD3 A;  2VZ1 A;  1TVG A;  4BK5 A;  1UY4 A;  5LA2 A;  3MUZ 1;  5JXH A;  1J83 A;  3GDB A;  4JX0 A;  2W1W A;  2VZ3 A;  4ZZ8 A;  4ZY9 A;  3T08 A;  4KI5 M;  1W99 A;  1UXZ A;  2Y64 A;  3DEC A;  1US2 A;  3LPG A;  5JMO A;  4AAX A;  2RV9 A;  3IDA A;  4DXT A;  2EIB A;  2ZEZ A;  4XUP A;  3ACH A;  3ECQ A;  1EUT A;  3OGV A;  2J1S A;  1UXX X;  3VD7 A;  2C4X A;  2DDU A;  3OEB A;  2J1E A;  2W3J A;  4KWU A;  3I3B A;  2W95 A;  3P1I A;  5EJ1 B;  4ARX A;  4RYD A;  1SG3 A;  1W9T A;  1OT5 A;  5DN2 A;  4BJ0 A;  1UZ0 A;  3WNL A;  3I2K A;  5C7G A;  3ACF A;  2WBK A;  3WQB A;  3OEA A;  4QX2 A;  1KEX A;  5G05 L;  2OKX A;  3K77 A;  1UY0 A;  3HN3 A;  2L9L A;  1ULO A;  3C7O A;  3VD5 A;  2EIC A;  4QDQ A;  2VZT A;  2WO2 A;  2X09 A;  3VDA A;  2KD7 A;  4MGQ A;  4CUA A;  4A6O A;  3SKV A;  1IQD C;  5DMY A;  1LNS A;  2BGO A;  1CZT A;  1GUI A;  2VTF A;  4P00 B;  4ZZ5 A;  4CU6 A;  5F7U A;  2WO1 A;  1JHJ A;  2Y6G A;  2V72 A;  2VL4 A;  3LEK A;  3MV0 1;  4DXR A;  5CZK A;  3I2F A;  2QBX A;  2VJX A;  2Y6J A;  3AC0 A;  1ULP A;  3OGR A;  2J22 A;  2XQX A;  4M4R A;  3UNP A;  2RJ2 A;  3BN6 A;  4E8C A;  3J7H A;  1JZ3 A;  2BER A;  1UYY A;  1HN1 A;  4CU9 A;  1MPX A;  4HG6 B;  1JZ2 A;  1W9S A;  1CZS A;  3OGS A;  4XUR A;  3NJV A;  3WF1 A;  4YPJ A;  1GOG A;  2VZU A;  4MOA A;  4PF1 A;  2EID A;  2XOM A;  3WNN A;  1K45 A;  3A22 A;  3GXU A;  1L7Q A;  3PUH A;  3HNY M;  3D3A A;  4LKS A;  4QAW A;  1H6X A;  4RN5 A;  3ABZ A;  1H6Y A;  2ZXQ A;  2VZV A;  3K4D A;  3C7H A;  4QDR A;  3DYO A;  1XC6 A;  3ETP A;  3MUY 1;  1GU3 A;  1UMH A;  2ORZ A;  4UAP A;  3WSO A;  4JKM A;  3U37 A;  2W5F A;  3EB7 A;  5JUV A;  2JD9 A;  2V4V A;  3THD A;  2QQN A;  2VQU A;  1XPW A;  3A23 A;  2WYS A;  1OH4 A;  3ZM8 A;  1JI6 A;  3III A;  3C8X A;  3T2O A;  1NKG A;  1RYY A;  3IAQ A;  4XUT A;  1YQ2 A;  3NJX A;  5I0D A;  3LQC A;  3I2G A;  4ET7 A;  3I3E A;  4QX0 A;  4Z2A A;  3CQO A;  2VCA A;  3WNK A;  5EJZ B;  2VZQ A;  5B4X A;  1US3 A;  2WAO A;  3PUI A;  2Y6K A;  2LW8 A;  4BK4 A; 
#chains in the Genus database with same CATH topology
 1TMF 1;  2ZHM A;  3I2J A;  3WW1 A;  1W8U A;  4XF0 A;  1SHW B;  3TAY A;  4BIS A;  2UYB A;  1UOB A;  1GKB A;  4RQP B;  5A7P A;  3N4M A;  3AMN A;  1RUD 2;  4ZU7 A;  1SBE A;  1PK6 C;  2XJV A;  4XUQ A;  4YZ2 A;  2X05 A;  3Q8E A;  4AXO A;  3WDY A;  1RUI 1;  2ZGR A;  5GZC A;  2ES3 A;  3GZU C;  2GP5 A;  5D8A A;  4OI0 A;  1MS9 A;  1SQ4 A;  1NLQ A;  1E5S A;  5I0S A;  2YFU A;  1CAW B;  2FCT A;  1E5H A;  5F39 A;  2VMD A;  2BNN A;  5FYB A;  4A42 A;  1K3I A;  4DXZ A;  1BLZ A;  4U2A A;  2JEC A;  3OUJ A;  3WLU A;  3Q8C A;  3ZFE A;  4A44 A;  3U4S A;  4OCT A;  3GGL A;  2VOX A;  2JDH A;  4A2U A;  1D4M 2;  5ACA 1;  4L92 A;  4UF0 A;  3MF6 A;  2RS1 2;  1MZE A;  1LEN A;  2X8K A;  2W08 A;  1R09 1;  2DUQ A;  2VNG A;  2KM2 A;  2YBP A;  3B9C A;  3SQO A;  3ZMN A;  4I3G A;  3H8X A;  4IUG A;  5FYH A;  2VAU A;  2WII B;  3AZY A;  4FBF A;  4QGL A;  4GZ9 A;  1BXH A;  4OHV A;  3ZXJ A;  5GAL A;  4WM8 C;  3HOB A;  3FN9 A;  4AI3 A;  3V0B B;  4QQP A;  2VBD A;  5K9Y A;  2RMU 3;  3KMH A;  1S0F A;  4PIZ A;  3EHK A;  5C33 A;  4RR3 A;  3LKJ A;  2W9X A;  1NX9 A;  5FXX A;  4XBN A;  1AJK A;  2QQI A;  5HCB A;  2QQV A;  1WUV A;  4LJH A;  5EPA A;  5FPV A;  3NNJ A;  4CCM A;  3WF4 A;  3E5X A;  3WCS A;  4BME A;  3PLQ A;  3THT A;  1T6G C;  4Y26 A;  5F5Q A;  4HKO A;  1GFF 2;  4NHL A;  3VKN A;  1SDW A;  3HT2 A;  4P9I A;  4XJU A;  1AL2 2;  1PIV 1;  2WNV C;  3HPN A;  3N7K A;  3OUI A;  4N53 C;  3FUQ A;  1QMJ A;  1ULE A;  1RJ8 A;  2E32 A;  2FCV A;  2BW8 A;  2IUW A;  3WDW A;  2NMN A;  1RMU 2;  1ULC A;  3LFI A;  1N1V A;  4N90 A;  2R32 A;  3GNE A;  4V1P A;  2JEN A;  1KDM A;  1W8O A;  1NE6 A;  3KV6 A;  4UOJ A;  1LB2 A;  1WA6 X;  5F5I A;  2HWE 1;  1QJX 3;  2WZE A;  4NOT A;  4YVS B;  1AR8 3;  3S30 A;  4CCO A;  4MGY E;  3WHT A;  2VG9 A;  3QH7 A;  4RR3 C;  3WW3 A;  3HQU A;  3NL1 A;  4UW3 A;  3VL8 A;  4MG2 A;  1PO2 2;  3E1F 1;  3TBD A;  2GU9 A;  2Y6L A;  2GME A;  2VQA A;  2XVK A;  3WP3 A;  4AR2 A;  5HBA A;  1AVB A;  5SV8 A;  3C7F A;  1HQW A;  4QX1 A;  3ST7 A;  1A3K A;  2E7T A;  2TNF A;  2YC4 A;  3OG2 A;  2ZX4 A;  1FMD 2;  3K46 A;  2HLE A;  5LEJ A;  2X5I A;  3DL3 A;  3VBS A;  2P2K A;  3MEP A;  3UK9 A;  3NNG A;  1ZX5 A;  1W6O B;  5L73 A;  5K4L A;  4A3Z A;  4FQ4 A;  1ZRI A;  3B3Q E;  3BGA A;  3DXU A;  1Q43 A;  1TE1 B;  4R4X A;  4CUC A;  3USU A;  4BZ4 A;  3POE A;  3ACL A;  4QT6 A;  4AK3 A;  4CU7 A;  4IV1 B;  1IG3 A;  1FOD 3;  3USS A;  2NYY A;  3CNA A;  1A34 A;  2VUL A;  5ANN A;  4DB5 A;  3POW A;  2VOT A;  1UN1 A;  1FX5 A;  2JG9 A;  3LIH A;  3OBA A;  2RS3 3;  4FPG A;  5L9V A;  1REE A;  3JBG 1;  1W2O A;  4N43 A;  3JCI A;  3VKM A;  2A73 B;  1VBB 3;  2WN2 A;  1QDO A;  4UYB A;  1U12 A;  4PQ9 A;  4XJ8 A;  5DZG A;  5BPX A;  4YAR A;  2JDZ A;  4YVS C;  5FY8 A;  3C7E A;  1ONA A;  2O8O A;  4N7I A;  3LD8 A;  4FSJ A;  2VZR A;  3I97 A;  2PEL A;  5A3T A;  1U5X A;  5IVC A;  2BZD A;  4IE4 A;  1GZT A;  2RVA A;  5IFP A;  4LT5 A;  4YZ5 A;  1W3V A;  3JB4 C;  4RQP A;  4XBL A;  1VBD 1;  1G8W A;  5EXO A;  2YRO A;  5DG1 A;  5IT6 A;  3HR9 A;  4YZ3 A;  4HON A;  4WV8 A;  4AI1 A;  4M4P A;  1REF A;  2BRT A;  1JU3 A;  3FUO A;  5A3W A;  1L3J A;  5C6C A;  2D6K A;  1W6N B;  1JU4 A;  2VZS A;  5LRR A;  3NMB A;  2PA7 A;  2JEM A;  3AP7 A;  2VVF A;  3BU7 A;  3DUI A;  4K1Y A;  1C5H A;  1IS4 A;  1IKP A;  3AM2 A;  1JZ5 A;  5ABJ C;  3CL1 A;  3VBU C;  4COZ A;  1W9Y A;  2VNR A;  2WNE A;  4FO9 A;  2RS1 1;  2FDG A;  3OBZ A;  5C3Q A;  2BNM A;  3NAP A;  3CJX A;  3QLQ A;  3IZO A;  2OUH A;  2P6H A;  2P34 A;  4RHV 2;  2ZKL A;  4ES8 A;  2ARE A;  2QE3 A;  2VQT A;  5JWP A;  1VBA 2;  4J25 A;  5FIX A;  3SIT A;  3VBR A;  3WNP A;  1W3X A;  3AB0 A;  1KJR A;  4XQ4 A;  1WW7 A;  5AVA A;  3WQ1 A;  5BNO B;  1ODM A;  4CDQ C;  2NN8 A;  1DLL A;  3FFQ A;  2AGS A;  5FUP A;  5A32 A;  4EZ4 A;  4GD4 A;  3VZK A;  3ES4 A;  4AVB A;  2YXS A;  1PVC 1;  2VMG A;  4OYU A;  4QPG B;  4QPY A;  5JIA A;  4CVU A;  5LCW L;  1KGY A;  4XBQ A;  4WVW A;  2GDF A;  2WWU A;  2JG8 C;  2ADE A;  3USU B;  3WNM A;  2KR2 A;  2HWE 2;  2CAV A;  1GQP A;  1T6B X;  2VME A;  4WVZ A;  1H0B A;  1WMD A;  3TNP B;  4JZR A;  1UOF A;  1Q8Q A;  4ATF A;  4N9I A;  1QF3 A;  4R9A A;  2LRP A;  5C4W A;  1JYN A;  3UET A;  2ZOE B;  4AVS A;  3SEE A;  1UOG A;  4N53 A;  2RM2 3;  4GUL A;  5KHH A;  3N9L A;  1LHO A;  2B9V A;  2VR4 A;  2X29 A;  1PMI A;  3WNO A;  5HPO A;  1D0H A;  5IUQ A;  5A7S A;  1C5I A;  1OQE A;  2A7A A;  1EPW A;  4X6Q B;  1K5J A;  1J3P A;  2RS3 2;  1C3H A;  1ZZ8 A;  2A71 A;  2WO7 A;  3IMN A;  4YLZ A;  4L99 A;  5CVR A;  5KXE A;  2QZ3 A;  5KHG A;  2OUJ A;  4GAL A;  2H6C A;  4JHZ A;  3LCP A;  2PHU A;  2A6Y A;  5BXX A;  1OBN A;  3ASI A;  1OOP B;  5HCA A;  2ZPX A;  5I91 A;  2PN5 A;  4C1W A;  4DZG A;  1OQ1 A;  1CJD A;  1LU1 A;  1RUI 2;  1TEI A;  3CJI B;  1DQ5 A;  3M4F A;  3T4H B;  5KXB A;  1O91 A;  2JKX A;  4DUV A;  5C4W B;  3B5L B;  5HCF A;  3P6B A;  2QQK A;  1GWM A;  5T5J A;  4CXX A;  3MDP A;  2VO5 A;  4J6G A;  4Y3O A;  5GLW A;  2ARC A;  4AVT A;  1JYV A;  2ILM A;  3RI8 A;  1NLS A;  4JGZ A;  1DDL A;  1BVV A;  2VCC A;  4KBB A;  2HKX A;  3GAL A;  2VCM A;  3VB9 A;  3OB8 A;  2PXJ A;  3N36 A;  3DN7 A;  5A1L A;  4O61 A;  2QDN A;  3THP A;  4DY3 A;  1PO2 3;  3U1X A;  3VN4 A;  5IHR A;  4RS5 B;  1F15 A;  5FZA A;  3IIA A;  3LF7 A;  1V0A A;  2VBP A;  3RZK A;  4H7M A;  1R08 3;  3HMY A;  3I2O A;  3H3U A;  2ZGQ A;  1V6O A;  4LBO A;  3POJ A;  4C1X A;  2CGO A;  2G19 A;  4GWJ A;  1D2S A;  4TLG A;  3DYP A;  3VBF A;  3RZG A;  1OLQ A;  4WBB A;  4K7J A;  1V00 A;  4JTN A;  4Q4Y 3;  4AED B;  3KV4 A;  1SAC A;  4NRO A;  1KJL A;  3LIG A;  4B8E A;  5BNN A;  1MS1 A;  1PIV 2;  5GLU A;  1XNA A;  3W59 A;  2BGC A;  5DDJ 3;  2ETE A;  2ZAA A;  4CEW B;  2W68 A;  2CL2 A;  5EV7 A;  2V5D A;  2XJS A;  3D0J A;  3POF A;  1GP4 A;  1O7F A;  1COV 1;  3IWZ A;  1J1L A;  4W6W A;  4MLO A;  3FLT A;  2QFE A;  4AQ2 A;  2LAL A;  1J83 A;  2OZ6 A;  3GDB A;  4C8D A;  1OA3 A;  1YIP A;  2W1W A;  2XVG A;  2ZHL A;  3BCW A;  3DKW A;  2CHH A;  4WM8 A;  4AED C;  4ZZ8 A;  5AC9 1;  2ZGS A;  4M0H A;  2DU0 A;  3A4U A;  4XJW A;  5L9R A;  1ZM1 A;  4Q5O A;  1LGC A;  1CPN A;  2Y64 A;  1O3R A;  5DUX A;  1S1A A;  3ZYB A;  1KQR A;  3LOB A;  1HKD A;  3M3E A;  3WXP A;  4Q1R A;  2XXZ A;  1ZBA 2;  1OD5 A;  1S0I A;  1ND2 A;  4NII A;  2FDI A;  1QU0 A;  3GZE A;  4M0N A;  3CHX A;  5FXV A;  4G4F A;  2VUD A;  4JRL A;  5FPL A;  1HRI 3;  2WIN B;  4Y1U A;  5FP8 A;  1VBE 2;  1SCR A;  4HVR A;  4RS5 C;  4AAP A;  3OGV A;  3MIG A;  4QMA A;  5A6Q A;  1U5Y A;  3GCW A;  1R1A 3;  4XET A;  2VXR A;  4GB3 2;  4ONU A;  1OPO A;  5CIR A;  2NM1 A;  5DUU A;  4AQT A;  1B35 B;  1F5F A;  1WZX A;  2O14 A;  2NPI A;  1HW5 A;  4KWU A;  1ASJ 1;  5EJ1 B;  3P1I A;  3R4D B;  4QPI A;  5FY0 A;  1YQC A;  4ARX A;  1SG3 A;  3DV8 A;  5BYN A;  4H2A A;  5EZW A;  3WIN E;  5B2G B;  4BJ0 A;  1RXF A;  1UZ0 A;  1GSL A;  5FXZ A;  2MEV 1;  3WNL A;  4OUL A;  5FO7 B;  1QQP 2;  1VAK A;  4IER A;  4JQR A;  5C7G A;  2AH2 A;  4M3C A;  2WBK A;  3I59 B;  2EIG A;  1H4G A;  3SC7 X;  2N7G A;  4E2G A;  3WQB A;  4UBH A;  3ZFF C;  2AZ5 A;  1KEX A;  5M0T A;  4IXL A;  2Z2S B;  5L36 A;  3ILF A;  4XF9 A;  1RUH 3;  1VRH 3;  2DVG A;  2UUR A;  2L9L A;  1LED A;  3VV1 A;  4K40 A;  1XE7 A;  4MXW B;  4JC1 A;  1CAV B;  2AR6 A;  4Q27 A;  2B9U A;  4XMA A;  3N7M A;  2VZT A;  1CIW A;  3PVB B;  4ZS2 A;  5C9A A;  2D6L X;  3VDD A;  1IQD C;  2XBO 1;  3URF A;  5C4W C;  4P9L A;  2DF7 A;  3CJI C;  5FPX A;  2PTM A;  3V56 A;  1DHK B;  1U0A A;  1Q8S A;  2W39 A;  1KXG A;  3HQR A;  2XML A;  2BYV E;  3LWC A;  4CU6 A;  3QH6 A;  4LO8 A;  1KFU L;  3U10 A;  2GSY A;  1JHJ A;  1PK6 B;  4YW4 A;  3J7N A;  3KHB A;  1EY2 A;  2IFR A;  2V09 A;  1HQN A;  1W2U A;  1V9U 1;  3BYW A;  5IWF A;  3MV0 1;  3VBH C;  1QXP A;  1J59 A;  4Z07 A;  1DGR A;  2VJX A;  1FAY A;  5KC5 A;  1AR7 2;  1F9K A;  3OPW A;  2J22 A;  4GJZ A;  3A0N A;  1QNW A;  4M4R A;  4K8F A;  2P3J A;  1D0G A;  1JZ3 A;  3D5O A;  5I0R A;  2BER A;  4GB3 1;  3E97 A;  1OPM A;  2RS5 1;  1URX A;  2ZGU A;  2JD4 A;  3VDD B;  5JZG C;  1UW8 A;  3PMS A;  4IEZ A;  1SZB A;  1X36 A;  1GYK A;  3WW2 A;  4XF3 A;  3ZXK A;  4CEY C;  5CEH A;  3JD7 1;  4YNI A;  1H2L A;  3OCP A;  1JN2 P;  4PJY A;  1CAV A;  1C8M 1;  3HIF A;  2Y0O A;  4MXW A;  2BP6 A;  1JYI A;  3SCG A;  1RJ7 A;  4QXH A;  4DOU A;  4YPJ A;  5FMB A;  2MEV 2;  2BU9 A;  5F6L B;  1VBD 2;  2XOM A;  4OI2 A;  4JGY B;  1PO1 3;  1WLC A;  1RL3 A;  1K45 A;  2VUC A;  3A22 A;  5KHJ A;  2GH2 A;  1C57 A;  3M1H A;  4AGR A;  1Y43 B;  3DEM A;  2DUO A;  3UYJ A;  5JDB A;  2IVI B;  5JPN B;  4RN5 A;  1LU2 A;  1W9F A;  2YV8 A;  3ABZ A;  4EV0 A;  1DIW A;  2VZV A;  4K20 A;  4XQW A;  5I0T A;  5EHD A;  3AZX A;  3LA2 A;  3VBU A;  4AI9 A;  3AK0 A;  4WVM B;  5CKN A;  1J58 A;  3M8L A;  4FPC A;  2ORZ A;  4IE7 A;  3WSO A;  1STM A;  1IQA A;  4GH4 B;  4JKM A;  3VBS C;  1XE8 A;  3RYR A;  3M3O A;  5GZF A;  2Y26 A;  4KGG A;  2VEC A;  2CWS A;  3IPV B;  3Q8B A;  5ABJ B;  2BPA 2;  2V4V A;  3JBG 3;  3SH3 A;  2XB6 C;  3ON7 A;  2BFU S;  3MGU A;  2VQU A;  1ENS A;  2ET1 A;  4PI0 A;  3A23 A;  1OHF A;  4ATE A;  1G9B A;  4BQ2 A;  1JOP A;  1OH4 A;  2VW2 A;  4LKF A;  3VL9 A;  5FZC A;  1FYU A;  1XB9 A;  1PGL 2;  2DBN A;  1UZW A;  1GR3 A;  4B4Q A;  2EAK A;  1LGB A;  3LQC A;  4X6R B;  2J42 A;  5DG2 A;  2Q8E A;  3VHO A;  2FHR A;  5AC9 2;  2QQU A;  3AXE A;  2DUP A;  2F4P A;  2HEY F;  4ORF A;  2OA2 A;  1HB1 A;  4Z2A A;  2VUA A;  4AVC A;  2CYF A;  2UWC A;  4LHN A;  5L9B A;  2BFU L;  1POV 3;  3WNK A;  5EJZ B;  1CJP A;  3MIE A;  5B4X A;  4BLJ A;  1US3 A;  1CN1 A;  4BHP A;  1UF2 C;  2WAO A;  4K1Z A;  4YG0 A;  3WQ0 A;  4COV A;  2C0Z A;  2JG9 C;  2Y6K A;  1X82 A;  3DPR B;  3PUI A;  4PDW A;  2BDR A;  1RUC 3;  3EBR A;  2WNU A;  1AX2 A;  2PQS A;  5J1X A;  1H1I A;  1CPM A;  5FQ0 B;  5BNP C;  3BOW A;  1D7P M;  3HBK A;  4ISR A;  2V4A A;  5T5P A;  2W2I A;  2R06 1;  1QJF A;  3CIH A;  1AX0 A;  1VAV A;  3LDR A;  3OY8 A;  3FFZ A;  4ZS3 A;  5FMD A;  1Y9M A;  3IN9 A;  2XLG A;  4FVV A;  4K6B A;  1GQH A;  4HOO A;  1IZ3 A;  3ZFF B;  2ZBJ A;  1X8E A;  3RNS A;  4IV1 C;  2XHK A;  5CU1 A;  5E1R A;  3T0A A;  2HEW F;  4Q4W 3;  3NJZ A;  1VBB 2;  1YUD A;  4FP3 A;  3PU3 A;  1RTV A;  1UMZ A;  4OUE A;  2HWD 3;  3POB A;  4DUX A;  3WQ7 A;  5A70 A;  1S0B A;  2A5Z A;  1VBC 1;  4K8R B;  4QHZ A;  3FL7 A;  2D3S A;  5ABJ A;  4S2D A;  2ZX2 A;  2I45 A;  3HBZ A;  4CEY A;  4R52 A;  4X8P A;  1I1E A;  4JGZ B;  5GZE A;  4EE2 A;  2B7Y A;  5H9P A;  1NCR C;  5C9A C;  4DFS A;  1V6I A;  3S0M A;  5FP4 A;  4XAC A;  3KV5 A;  3MPB A;  4DEQ A;  4DMI A;  2DTW A;  2PHR A;  3H1M A;  1OSG A;  2PHD A;  4GKY A;  1SDD B;  4P9W A;  4Q0S A;  3EQE A;  1JOB A;  1RUH 2;  1VRH 2;  2P37 A;  2HBT A;  2DVD A;  2KXL A;  2WNU C;  3FBY A;  1R08 1;  3J7M A;  2FDJ A;  3VHR A;  1ZRC A;  1OI6 A;  3SMH A;  1F35 A;  1TG7 A;  3TWI A;  4SLI A;  1ZA4 A;  2ZHK A;  2QCS B;  1W2T A;  2ZX3 A;  3H3Z A;  1W6P B;  2ATF A;  4Q0V A;  4BQ5 A;  2YPJ A;  2JG8 B;  4LOT A;  3AYC A;  3ZFG C;  1Q5O A;  1V70 A;  1YNA A;  3JBG 2;  1H9W A;  1EYB A;  4MHU A;  5CA6 A;  4KH9 A;  1EUU A;  2GC0 A;  3MIB A;  4LOS A;  4URT A;  4DQA A;  3CF6 E;  4XDO A;  1ZZB A;  3VGI A;  3WDV A;  4PT6 A;  5FUI A;  1ND2 C;  3A0K A;  2HH9 A;  2WJS A;  2RS5 2;  3KT1 A;  3L2Y A;  5E89 A;  2RHP A;  2WT1 A;  4NR1 A;  1SBD A;  4AFM A;  4MUV A;  4CP9 B;  1MS5 A;  4YW1 A;  3GF6 A;  3JQX A;  3ZIW A;  1O8S A;  4CZS A;  4WZC A;  5CYY A;  4YFZ A;  5I8S A;  1RED A;  4CTE A;  5FYY A;  1W05 A;  4QX5 A;  3WT3 A;  5LWB A;  4ARY A;  3WOG A;  3OD0 A;  3D0S A;  5LBC A;  2BTV C;  2FQP A;  2X53 S;  3IMM A;  2WWS A;  5EIY B;  4NHY A;  1Z78 A;  3OYW A;  3ZKU A;  3RZH A;  3H7J A;  5FKB A;  4QXC A;  1YFY A;  3MO4 A;  1OUX A;  2ZEY A;  4RHV 3;  1VBD 3;  2WZR 3;  3C7G A;  3P3N A;  1UYP A;  4IW3 A;  1KIT A;  4Z82 A;  2RDN A;  4IEW A;  5CBL A;  2DCK A;  3ZN6 B;  4CDU A;  1AR9 2;  4BE3 A;  4RHV 1;  3RQ0 A;  1VRB A;  3B93 A;  3LEI A;  4QB6 A;  1LHW A;  2A1X A;  2OW4 A;  1TME 1;  4UXA A;  1TQ5 A;  4AVA A;  2W94 A;  3NNL A;  4C90 A;  3NW4 A;  1A8M A;  2QTW B;  2ZAB A;  3R05 A;  1PX4 A;  3E6B A;  4UI9 L;  3FHI B;  2ZHN A;  2HJI A;  5JXI A;  2JX9 A;  1JYX A;  2Y38 A;  2XKO A;  3CZJ A;  4XFB A;  4XAA A;  2XHN A;  1RUI 3;  1WA4 A;  1AXY A;  1V6J A;  1LOD A;  2EF6 A;  1VIW B;  2DFB A;  2JDP A;  3CMG A;  4Q0P A;  5C8W A;  1ASJ 3;  1YQ8 A;  4D94 A;  1W90 A;  3MYX A;  4QHO A;  5FXW A;  3RJ2 X;  4XZP A;  1WWY A;  1YFW A;  4GH4 A;  1JOJ A;  1PGW 1;  5IK5 A;  4LQR A;  4GMP 0;  3VZO A;  1WD3 A;  1QXJ A;  5JOY A;  1GZ9 A;  3JD7 2;  1UIK A;  3A7Q A;  2WR9 A;  3I2H A;  2QQO A;  4JKK A;  4UFL A;  4WVM A;  5LA1 A;  2GH8 A;  4Y22 B;  5J37 A;  3CJI A;  3T4V A;  5ISL A;  3TEZ A;  1O3S A;  2GP3 A;  5J98 B;  4QQH A;  4MV2 A;  1BBT 2;  2ZEW A;  1B09 A;  2WFF 2;  2C26 A;  1XYO A;  1V9U 2;  1MQT B;  4BH9 A;  2XJR A;  1LKN A;  2EA7 A;  2RG4 A;  1J1T A;  1XNK A;  4AI2 A;  3ZR5 A;  4N8M A;  4QKF A;  3T0D A;  3VD3 A;  5SV5 A;  3MW4 A;  2RS5 3;  5F3I A;  3FZ3 A;  5EWS A;  3W5N A;  1R09 2;  3AMP A;  3FMG A;  1UWW A;  2QJV A;  3W20 A;  3RYK A;  2AC1 A;  3MIH A;  1OLM A;  1ZYB A;  2LS6 A;  3K4A A;  4Q26 A;  2D5F A;  5JMC A;  2E33 A;  1GAN A;  1A78 A;  3OSD A;  3WY6 A;  1LR5 A;  3AMQ A;  4XOG A;  4BQ1 A;  1AYN 1;  1UYZ A;  3ILN A;  1VMF A;  1I5Z A;  4D6S A;  4EYU A;  2E31 A;  1AR8 1;  4W65 A;  3RDI A;  1RUJ 2;  5JOX A;  1Y9G A;  5GZD A;  4YRD A;  4NWW A;  3R0R A;  3INA A;  2VCB A;  2JDY A;  2JDA A;  1HB4 A;  4EZH A;  3VD9 A;  4IEU A;  5JOW A;  4N7U A;  4X8N A;  4JKL A;  2E9Q A;  3N7J A;  5JXG A;  2A70 A;  1L7L A;  1GMM A;  4GA9 A;  3KGL A;  1SBF A;  2YY1 A;  4GWI A;  2XG3 A;  5GM0 A;  4KGQ A;  2R7E B;  1GBG A;  3PJY A;  1JH5 A;  4XF4 A;  5FZ1 A;  1XYP A;  2GAL A;  4RGA A;  2IXJ A;  3LZZ A;  5FYC A;  5FZD A;  2FDK A;  2Q5T A;  3AX4 A;  3LDB A;  4CPB A;  5FY4 A;  1RUF 3;  5K7P A;  2Y60 A;  2ZGO A;  3LA3 A;  2E53 A;  2ZGK A;  1N1Y A;  3MBW A;  4G9S B;  2YG0 A;  4IGP A;  4RL7 A;  4XDQ A;  5A33 B;  1IHM A;  2WAA A;  3THC A;  4AFD A;  2IZW A;  5C9A B;  4AFA A;  5C8C B;  4L9B A;  4CDW C;  1ULF A;  3IT8 A;  4PDW C;  4CPB D;  3NAP B;  1CAX A;  1JZ7 A;  1O3Q A;  1UU5 A;  5HV0 A;  5C3R A;  5FYZ A;  2RJK A;  4XFC A;  4IEP A;  3WVJ A;  1Y3T A;  4WM8 B;  3OPZ A;  2JIC A;  2WUH A;  1H9P A;  1X8M A;  5HXM A;  2VM9 A;  1LEM A;  5FTT C;  1WW5 A;  3H9A A;  1WCU A;  2W1U A;  3ZXF A;  2OX0 A;  2GND A;  4W50 A;  1DZR A;  1DYP A;  1PM4 A;  2VU9 A;  4FXG B;  1H1A A;  1ZBA 1;  1V6N A;  2CWM A;  2VH9 A;  4TTG A;  5FRE A;  3B7M A;  2BOI A;  4Q1P A;  1H8T C;  3VLB B;  1ULD A;  4F3J A;  1BYH A;  5FPU A;  1S2K A;  1JYT A;  1BCX A;  4CUB A;  3VBO A;  2D97 A;  3WF3 A;  5FAX A;  1COV 2;  3GZA A;  3ITQ A;  1R1Z A;  5C5U A;  1JYW A;  1UOJ A;  2CY6 A;  3I2I A;  2WQZ C;  4D6R A;  3E5U A;  3KHC A;  4TXW A;  1QXR A;  3KM5 A;  4LEJ A;  1Q3E A;  1TME 2;  4IV1 A;  1W0P A;  4QPG A;  5FCC A;  3ZO0 B;  4GQ7 A;  2ZGL A;  2IFW A;  3QOP A;  3H8R A;  5T5O A;  3OJB A;  2WFP A;  5JR7 B;  2BQP A;  4IEO A;  3N9N A;  2MNG A;  4EN8 B;  1MS8 A;  1KFX L;  2R07 2;  1O6U A;  3WF0 A;  1M4W A;  5A7O A;  4IES A;  5TSW A;  2X10 A;  2DBI A;  2YGL A;  1H2K A;  1HRV 3;  4GH4 C;  5FJK A;  4DIN B;  4MGT A;  5BNN B;  2P3K A;  1K12 A;  1UQX A;  1WCQ A;  1XNB A;  3ACG A;  3ZFE C;  3ZYJ B;  5BY5 A;  1PVC 3;  3PL0 A;  4LUM A;  3TNQ A;  3ZX7 A;  1RVF 3;  4MVT A;  3SXW A;  1W06 A;  2V73 A;  3PU8 A;  1OF3 A;  1AR6 3;  1YXW A;  5IVB A;  4OLL A;  1RHI 3;  2PLV 1;  3I7D A;  4JGY A;  3AJZ A;  1EV1 3;  2QDR A;  3BTA A;  4IEV A;  4RFT 0;  1HXS 1;  3GHN A;  5FYV A;  1K42 A;  2WO3 A;  3S5Q A;  4EJR A;  3S5A A;  1Y7B A;  2JDU A;  3L2H A;  1W03 A;  1XU1 A;  1O5U A;  1BHG A;  4FOW A;  3N3H A;  4LBK A;  1OD3 A;  4AHX A;  1TVG A;  2P3Y A;  3ZYR A;  4AOC A;  4E4S A;  4H7L A;  5LA2 A;  1HDK A;  3O0V A;  5JXH A;  4FPJ A;  2D98 A;  4NAM A;  1E5R A;  2DWR A;  1CGP A;  5BV6 A;  1OFN A;  2CGN A;  2XL7 A;  1FAT A;  4KG0 A;  5CFC C;  3UGF A;  1W99 A;  4MGZ E;  5AVP A;  1XYN A;  3LPG A;  5JMO A;  2RV9 A;  3C2U A;  1DGL A;  5FZG A;  1I6X A;  4XFH A;  3AKR A;  4M01 A;  5FUN A;  4DXT A;  3WZ1 A;  4LO5 B;  2ADD A;  4XUP A;  1YIF A;  1HJG A;  3ACH A;  2HWD 1;  4AL9 A;  1JW6 A;  4N43 B;  2ET7 A;  3NST A;  3VZN A;  5IK7 A;  3K3O A;  1Z7S 1;  4YYO A;  2GC1 A;  2CTV A;  3PVO A;  4YW3 A;  1AR8 2;  5D8A C;  2C4X A;  1CVN A;  1MS3 A;  2DDU A;  3RFR A;  2W3J A;  2ZX1 A;  3I3B A;  3KWV A;  3J8F 3;  5FDB A;  1OLR A;  4LO7 A;  1W9T A;  5JVV A;  1VPH A;  4OHW A;  2BUK A;  4BIO A;  1UKG A;  5FK7 A;  3ZMO A;  3R4U A;  2WZR 1;  3OF1 A;  3RMX A;  5LBE A;  3TN9 3;  3AZW A;  3DF0 A;  3BPZ A;  2WS9 2;  3HVD A;  3OEA A;  5LA9 A;  3M3I A;  4QX8 A;  5G05 L;  1UO9 A;  1UY0 A;  3HN3 A;  2HEV F;  4PIX A;  1ZZ6 A;  2Z42 A;  1VBA 3;  4FAH A;  3V64 A;  5FO8 B;  3CEW A;  1HXS 3;  2R06 3;  2X09 A;  3VDA A;  4BQX A;  4MGQ A;  4CUA A;  3H42 B;  1DG6 A;  2XKP A;  4Q4W 2;  1LAJ A;  1GNZ A;  3RYP A;  5AC9 3;  3KQ4 B;  3EMR A;  4YVS A;  2Q1F A;  3H3L A;  1QJE A;  4GMP 3;  2BGO A;  4P00 B;  1GUI A;  4ZZ5 A;  2IXI A;  4YGC A;  2BVB A;  4DRR A;  5FZ8 A;  5F7U A;  3ILR A;  2UWB A;  5FPB A;  5BNO A;  3BTX A;  5EYX A;  2FD8 A;  1CAW A;  2GNT A;  4Y4Y A;  1RVF 2;  4HBN A;  2WL1 A;  4ITC A;  5IAX A;  3LEK A;  3M70 A;  5FZ9 A;  3KT4 A;  5CZK A;  2XR4 A;  3MHZ A;  3I2F A;  2QBX A;  4BQY A;  3ZDV A;  1MEC 1;  2A3W A;  2JG9 B;  2Y6J A;  3DPR C;  2XUM A;  5FP9 A;  5C8C C;  1WLW A;  4F83 A;  3I3M A;  2XQX A;  3GZT B;  1AXK A;  1YFU A;  3O1P A;  2OQ7 A;  1SFP A;  4NAO A;  4UFI A;  4XXA A;  3UNP A;  2IVJ A;  3J7H A;  5FQ0 A;  3ZSK A;  1HN1 A;  2GAU A;  2WKK A;  4HKW A;  3T1L A;  2IC1 A;  2ZMK A;  3NKT A;  5IVE A;  1C1F A;  2Q0A A;  1OUS A;  1Y4W A;  1IS3 A;  1IG0 A;  1JZ2 A;  5IK4 A;  4CDU C;  3QD6 A;  2ZGP A;  1AF9 A;  3POS A;  5DUW A;  3NJV A;  2YDE A;  1W6O A;  3PTY A;  3FX3 A;  4MOA A;  5F3E A;  2EID A;  5DAP A;  3DXT A;  1AR9 1;  1GZW B;  2D40 A;  2VW1 A;  4IE6 A;  4XIL A;  1MVE A;  4IE5 A;  4Y1V A;  3WG4 A;  4CDW B;  3PUH A;  4JHT A;  3H50 A;  4QAW A;  1RGS A;  4Y5S A;  2YZ4 A;  1RIR A;  2EXH A;  4HMZ A;  3AMH A;  5DAB A;  1ZRD A;  2WSU A;  3Q9O A;  4LA3 A;  4W6X A;  2F17 A;  3KVA A;  1RUD 3;  2DFC A;  2ZCW A;  3HT1 A;  4UFJ A;  5FZO A;  4Y1Y A;  1W8F A;  5J96 B;  5KXC A;  3ETP A;  2VPV A;  3JZV A;  1C28 A;  2O0O A;  4HSL A;  4V2W A;  4UFH A;  1VB2 A;  2BNO A;  1OC1 A;  3SLI A;  4S2H A;  4ES9 A;  4XTP A;  4PHZ A;  5ACA 3;  1HB3 A;  1YC6 1;  1D4M 1;  1X50 A;  1LHN A;  4IL7 A;  4ZKT B;  2G1M A;  4CXW A;  3U4X A;  2HWE 3;  4AEK A;  5CNA A;  4LUK A;  4LTA A;  4BMB A;  2HWB 3;  1JI6 A;  1W8T A;  4FPK A;  2HWF 1;  4UW5 A;  5A7N A;  3T2O A;  3VKF C;  1AR6 2;  2AUY A;  2PHF A;  3JQW A;  3NJX A;  4XHB A;  2EAL A;  5I0D A;  4R9B A;  3E6D A;  4Q0Q A;  2OXB A;  4CP2 A;  4XJA A;  5DDJ 2;  3J7L A;  2PQQ A;  4NUB A;  1YWK A;  2D3P A;  1SMV A;  5FMO S;  2BBV A;  5JCT A;  1BEV 2;  2VCA A;  5FZF A;  3KQR A;  5L7O C;  2GZW A;  2NZ9 A;  3U11 A;  4GMP 1;  4B4R A;  2DUR A;  4V2V A;  2FDF A;  2RMU 2;  2VOW A;  4QD2 A;  4FQZ A;  4AZZ A;  5FOB B;  4CCJ A;  1AXZ A;  4JDO A;  2VMI A;  4QQL A;  4Y20 B;  5A3L A;  5DUV A;  5FBJ A;  5BNQ A;  5G04 L;  3CU7 A;  3ZN5 A;  4JQT A;  2QQL A;  4FT8 A;  2P5B A;  4HKL A;  4NN0 A;  3ZKY A;  2D6N A;  3OYW B;  1I5P A;  4ZXE A;  2Q1Z B;  5CAD A;  5E8A A;  4ISQ A;  2IWG B;  2YC2 A;  4PBO A;  1LOF A;  5C3P A;  3NO8 A;  2TBV A;  4AGG A;  1QJX 1;  2CGP A;  4IV3 B;  5FZK A;  1A6C A;  1YCI A;  1LOA A;  1NQD A;  1VBE 3;  4OFG A;  1XNT A;  4YFW A;  5FFO C;  3UKT A;  4CP1 A;  1M06 G;  1QHD A;  1YEW A;  5C70 A;  1H1M A;  1W8N A;  4EQV A;  4AVV A;  1NYW A;  2CAU A;  2TUN A;  3AKS A;  4Q4X 3;  2WAB A;  1N1T A;  1GNH A;  5IVV A;  3GJB A;  1JZ4 A;  3SKJ E;  3MI8 A;  1LOC A;  1EV1 1;  3ES1 A;  3ZLI A;  3LFM A;  4LR4 A;  1UMI A;  3ZR6 A;  2F6B A;  1P8J A;  1MEC 3;  4HVO A;  4Y1Z A;  4XJ9 A;  3QAC A;  2VUJ A;  1XND A;  5JSR A;  3H0O A;  2UU8 A;  1R08 2;  3J26 N;  4L2N A;  5FO9 B;  4QM8 A;  1WD4 A;  2R04 1;  1DYK A;  2WA3 A;  1XJA A;  1QJX 2;  3S6P A;  2PHT A;  2K0G A;  1S4C A;  4P9G A;  3C3V A;  4YGE A;  1RUE 2;  4H3W A;  2XON A;  3BAL A;  4Q4W 1;  5JPM B;  1EP0 A;  3A21 A;  3N7L A;  2B42 B;  2K46 A;  4M3C B;  5H9Q A;  1FNY A;  2QKD A;  2SLI A;  2R06 2;  1YQ5 A;  4E8D A;  1Q8P A;  3LSD A;  2E26 A;  4PDW B;  2OPK A;  5FZM A;  5ACA 2;  1FV3 A;  1UPS A;  4JRA A;  5FMC A;  2GMP A;  1RVF 1;  4O9G A;  2RMU 1;  2XJQ A;  4XPV A;  4YVW B;  4QQO A;  4CDX C;  1PGL 1;  2E51 A;  1VJ2 A;  3RPQ A;  5JI9 A;  3LE0 A;  2XL9 A;  4R4Z A;  2OZJ A;  2P3I A;  1JZ8 A;  2J1T A;  4Y4R A;  3KLS A;  2PFW A;  5F9T A;  4AEJ A;  1UY2 A;  2BJS A;  2C9K A;  5A3M A;  4OMC A;  1LOG A;  3RSJ A;  1UX6 A;  4COW A;  2Y8K A;  3N35 A;  3PJQ A;  5T52 A;  4W4Z A;  1MZ6 A;  2OQ6 A;  2XJU A;  5I8Y A;  4AHW A;  5H9R A;  3B94 A;  5FYU A;  4JTO A;  4KWL A;  4XDP A;  1VE0 A;  3W5M A;  2Z69 A;  4FCA A;  2GNM A;  3SCH A;  3T09 A;  3VZL A;  1OVP A;  5LBB A;  2LM3 A;  1RUH 1;  1VRH 1;  4QKD A;  4CEW C;  1LTE A;  3K75 B;  3RS6 A;  1YFX A;  4E27 A;  1UY3 A;  2FMY A;  4NE9 A;  3ZYF A;  3OY8 B;  2BBA A;  4S2G A;  2RE9 A;  5JLV A;  1VR3 A;  3KCC A;  5L19 A;  3WUC A;  2A3X A;  3ZPY A;  2MEV 3;  1GZC A;  2CV6 A;  3OGJ A;  5E88 A;  2WNU B;  1RC6 A;  2ZEX A;  3PME A;  1H4H A;  1Z0H A;  4N9H A;  5F3G A;  5GZG A;  3IDC B;  4KWK A;  1VBC 2;  4CRQ A;  5F5A A;  2Q8O A;  3OD4 A;  4YG3 A;  4LHL A;  1W2N A;  4I02 A;  3VBF B;  1NCR B;  1G9D A;  2D3R A;  1JUH A;  4KU7 A;  2O8Q A;  1ZVF A;  1PZ9 A;  5E16 A;  3RG0 A;  3WEZ A;  3CO2 A;  4BLI A;  1I3H A;  1ZBE 3;  1DLC A;  1OXC A;  1SCS A;  5A1F A;  2JDK A;  1FOD 1;  3UKN A;  3ZYH A;  4R9C A;  1ZRE A;  4GAZ A;  3S7I A;  3WCR A;  5C8C A;  1PHM A;  1R64 A;  5JXJ A;  1MEC 2;  4NRM A;  1DF0 A;  3ACI A;  4OI1 A;  1OH3 A;  3SEP A;  2AYH A;  5A33 A;  3VBF C;  4UWD A;  2VC9 A;  4Q4Y 1;  4OZO A;  3S7E A;  4AHZ A;  1CX1 A;  1DQ1 A;  2I2S A;  1RIN A;  2EXJ A;  3PUA A;  1RUJ 1;  1TME 3;  4LHK A;  4YW7 A;  5FP3 A;  3KF3 A;  3M3C A;  3R6S A;  1W0O A;  2HYX A;  2ZA9 A;  4IV3 A;  4MGS A;  3CZU A;  5APA A;  1O5L A;  4LBN A;  5FZE A;  2C9A A;  4XIO A;  4NIG A;  4DIQ A;  1PK6 A;  1VMH A;  5FP7 A;  3HNM A;  4CDQ A;  2VBB A;  4KQ7 A;  2ARA A;  4NO4 A;  1SLB A;  5LAT A;  4GWN A;  1OQD A;  3PUS A;  5C3S A;  1ZZ7 A;  4YZ1 A;  3ZSL A;  4QB2 A;  1C8M 3;  4CCN A;  4WVV A;  4XAB A;  1YYN A;  2DCJ A;  1RUJ 3;  1YJL A;  5FZ3 A;  5ERL A;  3T30 A;  1RUC 2;  5LBF A;  2WQ4 A;  2WFF 1;  2A6X A;  3WD5 A;  2JIJ A;  3SHR A;  3GCX A;  4BQ3 A;  5CFC B;  3RZM A;  2RM2 2;  2VVE A;  4YM3 A;  5CFC A;  3HQX A;  1DQ0 A;  4IET A;  4CCL A;  2A6V A;  3UGG A;  5F8P A;  3AZV A;  2WLP A;  2JG8 A;  2RR1 1;  5T50 A;  1ZRF A;  5JAX A;  5EP9 A;  3V65 A;  1MVQ A;  4F7Z A;  3D4K A;  2VTX A;  2DVA A;  3KZ4 C;  1JZ6 A;  4JVA A;  4QKB A;  5KR7 A;  2WS9 1;  5JR2 A;  1CWP A;  4IEQ A;  3FLP A;  4ZON A;  4CDX B;  2OVU A;  5FLI A;  1F2N A;  5B4N A;  2YB7 A;  1SEF A;  5KBF A;  4ZHN A;  2ZML A;  4YM2 A;  1Z7S 2;  4A3X A;  1N1S A;  4CDQ B;  3AKQ A;  4P9J A;  4Q4X 2;  4JGY C;  4L11 A;  4AHY A;  2MPF A;  3PNA A;  3DYM A;  1DP0 A;  2QQP A;  3KGZ A;  3FJS A;  3H1W A;  3IPV A;  3NWK A;  4LKD A;  3UES A;  3FHA A;  5A32 B;  3T2Q A;  4XFA A;  4L0P A;  4LHS A;  2W47 A;  5LY2 A;  4CEY B;  3FWE A;  3PDQ A;  1BMV 2;  1KD7 A;  2B45 X;  3VBU B;  5FKC A;  5J3U A;  2RS3 1;  5FZO B;  1RUE 3;  2KA3 A;  4NPM A;  3Q8A A;  1QJY 2;  1QH7 A;  4L8Q A;  4OVE A;  3ZXG A;  4LLO A;  5F3C A;  3W9A A;  4DEV A;  3JXS A;  4KMQ A;  5F32 A;  4CSW A;  4LBQ A;  4YW2 A;  1WCK A;  5IW0 A;  2EAA A;  4OI4 A;  2HWC 2;  5EJ3 A;  1H8V A;  2XJP A;  3MF9 A;  4LMF A;  1CZV A;  2VOV A;  4QPW A;  4PLN A;  3LEM A;  4UFM A;  1UPI A;  1IPS A;  2W1S A;  3VDD C;  5K0U B;  4DUW A;  5F1R A;  4KWJ A;  1S2B A;  1D2Q A;  1UU4 A;  2GC2 A;  1GIC A;  4C0H A;  4KNC A;  1J3Q A;  3O1O A;  1R1A 1;  2AAC A;  4UFK A;  5C5T A;  1GP6 A;  4FFI A;  3RI9 A;  3ZN6 A;  1OF4 A;  2ZGM A;  3I3Q A;  2VMF A;  1COV 3;  3UV9 A;  4COU A;  1G9A A;  1AL0 G;  3OBR A;  1K5M B;  4UT5 A;  3NQH A;  1YQ6 A;  1AYN 3;  3AL5 A;  4FPE A;  1VAM A;  4MAD A;  1IOA A;  1LOB A;  5JZG A;  3GBW A;  2P6C A;  4FOV A;  4NPR A;  2CNA A;  1RB8 G;  1NCQ B;  2XBO 3;  2BWA A;  5HCH A;  1BZW A;  2LTN A;  4FPO B;  1IGO A;  4HET A;  4OHZ A;  1N3P A;  4UW4 A;  4Q29 A;  1X33 A;  3PIJ A;  2VMC A;  1HJF A;  1N47 A;  2JJ6 A;  4ZXK A;  3NV4 A;  2JE7 A;  3VD4 A;  2K2S A;  4HPK B;  1E5I A;  4RS5 A;  1XE0 A;  1AX1 A;  5GJ6 A;  5HXV A;  2JE8 A;  3KCX A;  4B29 A;  4YM1 A;  3I2D A;  2WS9 3;  3TN9 1;  4ZPI A;  1EAH 2;  2DVF A;  5LA0 A;  1ZZ9 A;  3IDE A;  3EO6 A;  3K51 A;  4S2F A;  1S0J A;  5FK8 A;  1D4V B;  3WR0 A;  1PVC 2;  3AJY A;  1UX7 A;  4AGV A;  1HIX A;  4IGO A;  4FFH A;  5FZB A;  2PHX A;  3F2Z A;  5KHK A;  2UY9 A;  1MZ5 A;  4Q2F A;  4LPL A;  1EV1 2;  2AEY A;  5FZ4 A;  2PAM A;  1FT9 A;  2D5H A;  1J84 A;  2Q4S A;  1O4Y A;  1U5Z A;  1UY1 A;  3PTR B;  1QGL A;  1VLN A;  1W0N A;  4AG4 A;  1ZNP A;  2YHJ A;  5HI0 A;  2Q30 A;  1JBC A;  2W92 A;  3EYP A;  4HL0 A;  3RWK X;  2JWP A;  2D44 A;  1RUE 1;  3I3D A;  2G9G A;  5CFD A;  4FI9 A;  4XIK A;  4AI0 A;  3NAP C;  1A8D A;  2VQ0 A;  3U07 A;  2C1F A;  3AP9 A;  4RA0 A;  3NNM A;  4Q4V 3;  1QQP 3;  2VZP A;  2BOJ A;  5IAT A;  3FHQ A;  3WDU A;  1BK1 A;  3MIF A;  1XOY A;  4UW6 A;  1CON A;  2VGD A;  4P08 A;  4QPI B;  2CDO A;  1TNF A;  5EQU A;  4P9Y A;  2D6M A;  1WGP A;  2YU1 A;  2VZ1 A;  4QPI C;  3SNM A;  3GYD A;  1JOD A;  4BK5 A;  3AKT A;  3G7D A;  5A6Z A;  4LA2 A;  4N53 B;  1LUL A;  4B3N A;  4XFI A;  4H14 A;  4J1X A;  4HSJ A;  4XXP A;  1KS5 A;  3ZOI A;  1DGR N;  3RRD A;  3T08 A;  4E4D X;  1UXZ A;  4QWN A;  4Q4V 1;  4EWA A;  1US2 A;  3NVC A;  4YW5 A;  2NQY A;  4XJZ A;  5DDJ 1;  3ZSM A;  4AAX A;  2RM2 1;  3IDA A;  4IQP A;  4E2S A;  2EIB A;  2BV4 A;  3DCQ A;  2C6S A;  1NA1 C;  5CB7 A;  2Q8D A;  3U0Z A;  3ECQ A;  2GMM A;  2HWB 2;  3HAG A;  4NMI A;  3TN9 2;  2C24 A;  4KU8 A;  1WLD A;  1EUT A;  4O9E A;  4P14 A;  3WDX A;  4BA6 A;  2X5I C;  1CAU B;  3MFC A;  1MR5 A;  3AYA A;  4XC9 A;  3VD7 A;  3SCF A;  3BOP A;  5A6Y A;  1BEV 1;  1KDK A;  1UU6 A;  3FLR A;  1QY4 A;  3OEB A;  5A3U A;  2P1B A;  1R09 3;  2IXK A;  2W95 A;  3ZSJ A;  1E57 A;  5KWR A;  2IXH A;  4RYD A;  1W6M B;  3JUU A;  1OT5 A;  4EN7 B;  4AYU A;  2LUW A;  5DN2 A;  1JUI A;  2D6P A;  3GJA A;  3O14 A;  1PIV 3;  2ENR A;  4Y5T A;  3ACF A;  2Y33 A;  2DU1 A;  2XDV A;  1NOV A;  2WLQ A;  3KF5 A;  1UZY A;  3BKZ A;  4FFF A;  4QX2 A;  2OKX A;  1Q56 A;  4EN6 B;  3K77 A;  2DV9 A;  3R4S A;  1GZW A;  2B46 X;  1UCX A;  1FMD 1;  4LBJ A;  2R0F A;  1W39 A;  1MS4 A;  5FZ0 A;  1NY7 1;  1ULO A;  1X9P A;  2LRO A;  5DAQ A;  5FLH A;  5A80 A;  2WT2 A;  3VD5 A;  4D7T A;  3V0A A;  1WLT A;  2EIC A;  3AFK A;  2AEN A;  2O1Q A;  3WHU A;  1IPK A;  3J8F 1;  4SBV A;  2WWJ A;  4XF1 A;  3WNX A;  4A6O A;  3NJY A;  4M00 A;  1HX6 A;  1LNS A;  2R1D A;  1F31 A;  5BNP A;  3O1V A;  3LGR A;  3BB6 A;  1QOT A;  3BU0 A;  3G6J B;  1QNY A;  4HFS A;  2VTF A;  4PLO A;  5I8T A;  3J9S A;  4BCU A;  3JD7 3;  2SBA A;  3O1S A;  4RSU A;  5A3P A;  2HWC 3;  3IM0 A;  4Q0U A;  2Y6G A;  5F2W A;  2YBS A;  3TOJ A;  3VBO B;  1R1A 2;  1K5M C;  4WM7 A;  2V72 A;  3H7Y A;  1JXN A;  5D8A B;  4RGK A;  4I01 A;  1FPN 1;  4D3W A;  5FZL A;  3B00 A;  1AJO A;  1OKQ A;  2XWB B;  4CCE A;  4P5H A;  3AC0 A;  1PO1 1;  1ULP A;  3OGR A;  1XSQ A;  3UT0 A;  2JE9 A;  4WZF A;  4N43 C;  3IBM A;  4LNV A;  5CFD C;  1MPX A;  4FXK B;  2WNV A;  1UIJ A;  3MLL A;  3T3Y A;  5K0U C;  4AW7 A;  3PVN A;  3BIE A;  3NV1 A;  2WA4 A;  4TLF A;  1W6N A;  3OTF A;  5LZ6 A;  3ELN A;  1CZS A;  3OGS A;  4FAG A;  4XUR A;  4IE0 A;  1GOG A;  4MXV A;  2VZU A;  4PF1 A;  3IDB B;  5EYY A;  1C8N A;  2PLV 3;  3DGT A;  3HN1 A;  3WNN A;  5FJH A;  2X5I B;  5J36 A;  4NIA A;  1W8H A;  1AYM 2;  3RMY A;  4AI8 A;  1RUO A;  5JSO A;  1GWL A;  3D3A A;  4LKS A;  3H8U A;  3N9M A;  2PHL A;  3NV3 A;  3JU9 A;  3BOD A;  1H6X A;  2R49 A;  2B8M A;  4I0A A;  1FMD 3;  1ZRR A;  3KCY A;  4FTB A;  2JDM A;  1WCS A;  2XLF A;  2ZXQ A;  1EAH 3;  3BVC A;  1W6M A;  5BNO C;  2ZAC A;  3JB8 A;  3FBM A;  1LEC A;  3C7H A;  4QDR A;  2P4E A;  4E2Q A;  3DYO A;  1XC6 A;  3MUY 1;  1XQN A;  2FCU A;  1GU3 A;  5I0U A;  3B01 A;  1LHV A;  1UMH A;  4W6Y A;  4UAP A;  1WMF A;  3AP6 A;  3L9J T;  1UAI A;  4LIV A;  1LRH A;  2DYC A;  4P9X A;  3TEY A;  4I30 A;  3O1T A;  1YO8 A;  4NRQ A;  5IK8 A;  2R07 3;  5JUV A;  5FWJ A;  1VBA 1;  2I74 A;  2JD9 A;  1YJK A;  3ZFG B;  1WME A;  3THD A;  1TMF 3;  3OGG A;  3BIW E;  1HRV 2;  1XPW A;  3POG A;  5FMO L;  1JYC A;  2WYS A;  3VKO A;  1ODN A;  4A6S A;  2PAK A;  3III A;  3GHM A;  1SLI A;  2ZMN A;  3C8X A;  5E6H A;  1NKG A;  2CU5 A;  2E6V A;  3Q8F A;  2FDH A;  1C4R A;  3IAQ A;  5A6X A;  1YQ2 A;  4R8H A;  5K8S A;  1PM7 A;  3I4I A;  1POQ A;  3B9I A;  1NZC A;  3D6E A;  3KSC A;  4ET7 A;  2WSV A;  1QQP 1;  4G3Y C;  4QX0 A;  4AQS A;  1ZA7 A;  2VY0 A;  4FPF A;  4Y5Z 0;  1FPN 3;  2MHF A;  1UL9 A;  2VZQ A;  1NT0 A;  4JV4 A;  2YU2 A;  4XEZ A;  1YI9 A;  3ZM8 A;  2H6B A;  2LW8 A;  4JGZ C;  4XMI A;  1XNC A;  1NAE A;  1GNY A;  3WF2 A;  3ZXA C;  1GV9 A;  1W6Q B;  1YI7 A;  5JI7 A;  3T1M A;  4AFC A;  5IFT A;  1QEX A;  1PGS A;  4QQ2 A;  4MGK E;  1NXD 1;  1V6L A;  1LES A;  1CQ9 A;  3AZZ A;  1B35 A;  1SLT A;  3AKP A;  4H55 A;  3RGB A;  1W8Z A;  2IXC A;  3ATG A;  4BPZ A;  1VMJ A;  5LK7 B;  1ACC A;  2C5D A;  3P5B A;  4I0B A;  4CE8 A;  2OS2 A;  3WG2 A;  3MW2 A;  3CKH A;  1JHN A;  4HT1 T;  4NRP A;  1ND3 C;  4L97 A;  5LEK A;  3NV2 A;  4W8J A;  3ZYI B;  3IKW A;  3LPF A;  1VBC 3;  1DBN A;  3WDT A;  4QU2 A;  3M7A A;  2WRA A;  1S0E A;  3VHN A;  4CUG A;  2CDP A;  1RUC 1;  3HNB M;  4UF0 B;  2ERF A;  1F5J A;  2YC0 A;  4KL1 A;  3M3Q A;  4CCC A;  5FY5 A;  4XTM A;  2ZKN A;  1SFY A;  4QB1 A;  5BNP B;  5FOJ B;  1NE4 A;  4Z8B A;  4HK8 A;  1W9W A;  2W1Q A;  3WV6 A;  1AYM 3;  5AFB A;  3WW4 A;  4UBG A;  1GOF A;  4AEM A;  1S2E A;  1OMI A;  1LOE A;  2DTY A;  2YGM A;  4HPK A;  2ZGT A;  4LE3 A;  3VBR B;  3VZJ A;  4GWM A;  4DO0 A;  2RR1 2;  4AQ6 A;  1QJU 3;  2VXJ A;  4D0Q A;  4CU8 A;  1UKR A;  1UZV A;  4AFB A;  3VBS B;  5IJR A;  2D93 A;  5ANQ A;  1H30 A;  1NCQ A;  2YMZ A;  1X7N A;  4RR3 B;  1NQJ A;  3TEX A;  2WZ8 A;  2YBK A;  1D4M 3;  1JTZ X;  4BDV B;  5FYT A;  1W6Q A;  2XJT A;  4Q4Y 2;  1PVX A;  1HXS 2;  4IDZ A;  4TYS A;  2ORX A;  4E9K A;  1AYM 1;  2J1R A;  1KRI A;  4TZD A;  5GLZ A;  1NG0 A;  3AYD A;  3H8O A;  4XFG A;  3AXD A;  4BM8 A;  2OPW A;  2J1A A;  3D8C A;  4PI2 A;  5J7M A;  3O1M A;  2B4K A;  5GLT A;  3U78 A;  4YSF A;  1OUR A;  3CDZ B;  1CX4 A;  1ZZC A;  5K0U A;  3VDB A;  2J1U A;  3LAG A;  3ZXD A;  1SLL A;  4XYX A;  4NWV A;  4Z92 B;  4LUL A;  2R04 3;  2WNV B;  4GIQ A;  3K2O A;  5DPN A;  4XVH A;  5JOZ A;  4D8M A;  1PGW 2;  4YZ4 A;  1YRZ A;  5KC6 A;  1I9R A;  2Q1M A;  2VE1 A;  3HEI A;  3POY A;  4NHX A;  4A4A A;  1ASJ 2;  1H2N A;  2XLA A;  1BVP 1;  4XFF A;  5H9S A;  3ZIX A;  4B7K A;  2GN3 A;  2FZ2 A;  3UGH A;  5GLV A;  3ZDS A;  3E6C C;  3ZN4 A;  1ENR A;  5D1I A;  1ZBA 3;  3X29 B;  2ZAH A;  3PUR A;  4P5Y A;  1HLC A;  1O59 A;  1WBL A;  1XRU A;  4J1W A;  1OA4 A;  1OOP A;  1L7R A;  2EIE A;  2VD7 A;  2Z79 A;  3TB0 A;  4BB3 A;  1HRI 1;  1GP5 A;  2TEP A;  5T5L A;  3VBH B;  3POI A;  1LJ7 A;  1DGW X;  2DCY A;  3UJQ A;  3I49 A;  4D7S A;  3VBO C;  2YPD A;  1CD3 G;  4KBZ A;  1O4Z A;  4FP2 A;  5FZH A;  3I54 A;  4QKN A;  3TYJ A;  3U75 A;  3VZM A;  3ZYG A;  2VW0 A;  4AF9 A;  4EWD A;  5C71 A;  5CG8 A;  4XUN A;  3KS7 A;  2VZO A;  2P17 A;  4MO3 M;  5FYI A;  1H2M A;  4C0B A;  2Z4F A;  1AUY A;  1WKY A;  4IEX A;  1XU2 A;  4CCD A;  4YG6 A;  4MH0 E;  5CFD B;  3K3N A;  3MIC A;  1Y9Q A;  3W21 A;  1G9C A;  2UWA A;  1UYX A;  3O0W A;  1O8P A;  5FY7 A;  1F4A A;  2J7M A;  3N9P A;  5JIU A;  4GJY A;  4EWE A;  1AYN 2;  2A75 A;  1NCQ C;  4DRV A;  4QM9 A;  4FOQ A;  5DQ0 A;  2R1B A;  3W58 A;  1Q8V A;  1VB4 A;  2IXL A;  2PHW A;  2R07 1;  2RS1 3;  2V5Y A;  4LK7 A;  5DXD A;  4OQ9 A;  4D7Y A;  5IYY A;  1CAX B;  1XBF A;  2W46 A;  1FV2 A;  4QDS A;  2JB4 A;  4BQ4 A;  4BXS V;  1MQT A;  4LKE A;  3ZFG A;  1SLA A;  2W87 A;  4BIF A;  1RUN A;  3VBH A;  2R16 A;  1Q8O A;  1TMF 2;  2UY8 A;  1G86 A;  1NY7 2;  3GBF A;  2Y0I A;  4HZF A;  2BWC A;  3MV1 1;  2ZZQ A;  5DAV A;  3ZXE A;  3KB5 A;  4PQQ A;  3T2T A;  3AVR A;  4HN0 A;  4YM0 A;  4Y24 A;  3H1Y A;  1POV 0;  1BJQ A;  2VVD A;  1FI2 A;  3HJR A;  3OBT A;  4EN0 A;  4BOW A;  1B35 C;  4URA A;  2G9Z A;  4AWD A;  1PMJ X;  5A7Q A;  2XVL A;  1PO2 1;  5F5C A;  1DZT A;  4Y1X A;  2RJL A;  3HD8 B;  5J09 A;  4MX3 A;  3GBG A;  1WCD J;  5LB6 A;  1BEV 3;  4DXS A;  2FBE A;  4Y33 A;  2Y6H A;  2ZGN A;  3GM8 A;  3IAP A;  4I09 A;  2BGP A;  2EXI A;  1F4H A;  4QXK A;  2XWJ B;  4LLF A;  3VDC A;  2XPJ A;  5FBZ A;  3T0B A;  3RWN A;  2PMW B;  2WNO A;  2YFZ A;  5CIS A;  3S57 A;  2B39 A;  4XCA A;  1CIY A;  2J1V A;  2ZTN A;  4Z1V A;  4NJ4 A;  2VOK A;  1O3T A;  1NA1 B;  1YLL A;  4M3C F;  3UJO A;  3V0B A;  3EXU A;  4HK9 A;  1GQG A;  3KT7 A;  4NPL A;  3BUC A;  4I3P A;  2E7Q A;  1OKO A;  3ALQ A;  1RXG A;  4P02 B;  4JDN A;  1S55 A;  4Y22 A;  4NID A;  3ZYP A;  4A41 A;  4O7X A;  4LBL A;  5CAZ A;  3BI3 A;  1NUK A;  2VNO A;  1RUF 1;  4YW6 A;  1PX3 A;  4XUO A;  2G9F A;  3N9Q A;  4IGQ A;  3WP5 A;  1CAU A;  1MAC A;  1H8T A;  4I0W B;  1O4T A;  4MET A;  3ENR A;  2RR1 3;  4ZU4 A;  4IND A;  5F37 A;  3T2P A;  2AEZ A;  1ZBE 1;  4XW3 A;  1BBT 3;  3FE5 A;  2HWF 3;  3WP6 A;  1HB2 A;  1BKZ A;  1FNZ A;  4OHX A;  3NRU A;  1LHU A;  2YUE A;  3O12 A;  4LO6 B;  4K9S A;  5FZI A;  1G7Y A;  3AL6 A;  1HRV 1;  2G4I A;  1BK0 A;  1QDC A;  2QZ2 A;  2Y34 A;  4B1L A;  1BBT 1;  4OZX A;  3O1U A;  1TZO A;  1W8W A;  2JKB A;  4LIU A;  5IVF A;  1AR7 3;  4K21 A;  4PIY A;  2JB8 A;  1XSR A;  4QHB A;  1QWR A;  5FY1 A;  1XXN A;  5A1A A;  3WP4 A;  4CP0 A;  2QQJ A;  4LOR A;  5T3N A;  1OFS A;  4OMD A;  1S0C A;  2JIG A;  2QQM A;  2I07 B;  3BPS A;  4HXC A;  4C91 A;  5DZF A;  4RFR B;  3BTY A;  1SFN A;  1OOP C;  1SLC A;  3PUQ A;  5DAX A;  2RDQ A;  4RGG A;  1OVS A;  3M2M A;  5EFU A;  3MZH A;  3RZZ A;  2VMH A;  3LA7 A;  3UL2 A;  1T2X A;  4NHK A;  1QH6 A;  3ORJ A;  1DQ2 A;  4B7E A;  1UD1 A;  4FPY A;  3LOI A;  4OUS A;  3O5S A;  1PO1 2;  5FYM A;  4BXF A;  1AL2 1;  2QVS B;  2WDB A;  4XZU G;  1PZ7 A;  1IS5 A;  3IB3 A;  2WN3 A;  3ETQ A;  4A45 A;  4IV3 C;  2FMD A;  5IVY A;  4R9D A;  3RZJ A;  4LBQ B;  1DU3 D;  1ALY A;  1RUF 2;  4LO4 B;  3MLK A;  5A7W B;  5L7O A;  1RUG 1;  1JS9 A;  2R30 A;  1V6K A;  3K4Z A;  3KD4 A;  1YHF A;  3RVH A;  2HWD 2;  1PNF A;  1F8V A;  4RQP C;  4XCB A;  4FTS A;  1QJZ A;  1GOH A;  2QQW A;  2WC2 A;  3APB A;  4XHX A;  5A7W A;  5L7O B;  2R0H A;  5FPZ A;  1N3O A;  2ID4 A;  4MSV A;  2Q8C A;  2F4L A;  4Q4V 2;  4U36 A;  1CR7 A;  1QIQ A;  4NIH A;  4DNY A;  1UZZ A;  2HYK A;  2W91 A;  3DKQ A;  3KV9 A;  3O1R A;  1ST8 A;  1UNB A;  2WYF A;  3MPP G;  4AE2 A;  3ZFF A;  4BWO A;  1VP6 A;  1RUG 3;  2HWB 1;  3J4U H;  3LEG A;  4GKX A;  4E4H A;  4ASK A;  5T54 A;  3MID A;  4CDX A;  4KG8 A;  3J8F 2;  2PYT A;  4QX3 A;  2R6Q A;  2BVV A;  3AFG A;  3I59 A;  3MLJ A;  4LBM A;  5FZ7 A;  1WMX A;  4DY5 A;  1HN0 A;  2D43 A;  1DYO A;  4B4P A;  4QGN A;  2D6O X;  1GLH A;  2E7A A;  3OPT A;  3SH4 A;  3O0X A;  5BUV A;  1PNG A;  2WQ8 A;  4CYD A;  1IKQ A;  3VHP A;  5A3N A;  4FPH A;  4A7Y A;  3NKG A;  4QPG C;  3WG1 A;  2A6W A;  1PMH X;  2HWF 2;  4DS0 A;  1OA2 A;  5C3O A;  4YVW C;  4FPL A;  5CKM A;  1UY4 A;  3MUZ 1;  2QNK A;  4JX0 A;  3AP5 A;  4TSV A;  3PHM A;  2B5H A;  1EAH 1;  3B02 A;  4XAE A;  1QJU 1;  2VZ3 A;  2WT0 A;  2XGX A;  3U14 A;  2ZZJ A;  4ZY9 A;  1ND2 B;  4KI5 M;  3ZFE B;  4Z2W A;  3TRS B;  3BTZ A;  3I8T A;  3DEC A;  4CXY A;  3TEW A;  1QOO A;  4HVQ A;  5LRS A;  2PLV 2;  4WM7 B;  1S0G A;  2ZEZ A;  3ZXL A;  4LIT A;  1PZ8 A;  4QXB A;  1EPZ A;  1RUD 1;  2XH6 A;  3FC0 A;  2J1S A;  3SIS A;  1UXX X;  4HN1 A;  1ENX A;  4M3C E;  4ZU5 A;  3D82 A;  4HAN A;  1LCL A;  1ND3 A;  2J1E A;  1ENQ A;  5KHI A;  4YGB A;  1K5M A;  1BQP A;  1JMU B;  1DQ4 A;  3MFA A;  5D2A A;  4CEW A;  3NNF A;  5BNN C;  5IVJ A;  1FPN 2;  2W0X A;  3DPR A;  1AHS A;  1IS6 A;  3LSE A;  4COY A;  1WW4 A;  1AR9 3;  4TN7 A;  3EJK A;  3I2K A;  3V0A B;  1RHI 2;  1QOS A;  4AED A;  1HRI 2;  3K48 A;  1SPP B;  3VBR C;  2NP0 A;  1VBB 1;  4LXL A;  4A7Z A;  4FTE A;  2HWC 1;  1Z7S 3;  2GC3 A;  4CDW A;  4K3U A;  2E63 A;  2DVB A;  1NCR A;  1ZBE 2;  3MW3 A;  2OII A;  1G9F A;  4JDM A;  3RZL A;  1SPP A;  3ZPO A;  4IEY A;  3PIG A;  3C7O A;  4QDQ A;  2HBU A;  2WO2 A;  4PF5 A;  5T55 A;  2KD7 A;  2WZP P;  4NHM A;  1WBF A;  1DZQ A;  3KVB A;  2GN7 A;  4QU1 A;  3SKV A;  1NLR A;  3AP4 A;  5DMY A;  4FOY A;  1ND3 B;  1U5I A;  2NMO A;  1W2A X;  3AMM A;  3OUH A;  4E8C A;  1W28 A;  1CZT A;  1HV0 A;  1H8T B;  1RUG 2;  4PCR A;  3WUD A;  4QX7 A;  3O7O A;  4PBP A;  5JSP A;  1QJY 1;  2WO1 A;  1X9T A;  1MS0 A;  1DQ6 A;  2D7F A;  2VL4 A;  5DZE A;  4DXR A;  2K9Z A;  5FPA A;  4E4Z A;  5CG9 A;  2ARB A;  4FFG A;  1MZF A;  2DCZ A;  4CCK A;  3VUO A;  1DCS A;  1AR6 1;  3B69 A;  4LK6 A;  4BU2 A;  2RJ2 A;  3BN6 A;  3E5Q A;  1C8M 2;  1GWK A;  5LAS A;  4CP9 A;  1RMU 3;  1UYY A;  1NA1 A;  2UYA A;  2WFF 3;  4O65 A;  2BEO A;  2W52 A;  2FZ1 A;  4Y20 A;  4CU9 A;  4BQW A;  1AZD A;  4LE4 A;  4D69 A;  4EN9 B;  5KXD A;  1W04 A;  5FY9 A;  4HG6 B;  4B1M A;  3ZVX A;  4OHY A;  1W9S A;  2H0B A;  1TNR A;  3QBQ A;  1RMU 1;  1POV 1;  1V6M A;  4YVW A;  3WF1 A;  1VAL A;  2H0V A;  2WZR 2;  3N9O A;  3RJR A;  3ROU A;  4BYY A;  4YWA A;  1QKQ A;  3F95 A;  2XBO 2;  2ZX0 A;  1W6P A;  4JAA A;  3GXU A;  1J3R A;  2JDN A;  1L7Q A;  2Y6F A;  2ZJC A;  3HNY M;  2NLR A;  4ASM B;  1APN A;  4YGD A;  3ZSE A;  1WW6 A;  3ME2 A;  4WM7 C;  1HV1 A;  4NVP A;  2PAE A;  4Q8L A;  4Q4X 1;  2Z5W A;  2VNV A;  4D6Q A;  5AFE A;  5HV4 A;  2QUO A;  1DGW A;  4MYE A;  4MGI E;  1DFQ A;  1H6Y A;  2RDR A;  1QJU 2;  3AVS A;  2JXA A;  5J48 A;  2EVX A;  4JCK A;  1FXZ A;  1ULG A;  3K4D A;  4XQD A;  4XE9 A;  5CKQ A;  1OLM E;  4GXL A;  4ASL A;  1C1L A;  1RIT A;  5LK5 A;  5D21 A;  2VTX J;  4CA9 A;  5FYS A;  4CDU B;  1G6N A;  2DCT A;  5FRA A;  2XQR A;  1AR7 1;  2EXK A;  4HLT A;  4OUM A;  4LBQ D;  2OYZ A;  2A6Z A;  5GKA C;  5LW9 A;  4TWT A;  5A3O A;  3U37 A;  2W5F A;  3EB7 A;  5I93 A;  3VKL A;  3LB9 A;  4I2O A;  1NZI A;  4RD7 A;  2YYO A;  2RDS A;  1QJY 3;  1FOD 2;  2QQN A;  3UKV A;  1NXM A;  4ERO A;  4PLM A;  4DPN A;  3WG3 A;  3SH5 A;  4QGM A;  1LOF C;  3LDK A;  4Q8K A;  5FLJ A;  5FR3 A;  2R04 2;  5FV3 A;  1RYY A;  2XUE A;  4GB3 3;  5FWE A;  4XUT A;  2GNB A;  5IAV A;  3CLP A;  1IPJ A;  1AL2 3;  1N3Q A;  1S0D A;  3I2G A;  3P3P A;  1KS4 A;  3PVE A;  1BMV 1;  3HWJ A;  2OT7 A;  3CBN A;  3I3E A;  1RHI 1;  3OOX A;  1MQT C;  5JZG B;  2CSG A;  4F8A A;  3QCW A;  5FZ6 A;  3WX5 A;  5LY1 A;  2ZS6 B;  1HQL A;  1LGN A;  3CQO A;  5F2S A;  4OQ8 A;  2ARX A;  4MHR A;  1V9U 3;  2A3Y A;  5DAW A;  5F6K A;  1VBE 1;  1CES A;  4MZU A;  3AYE A;  4BK4 A;  4A7K A; 
#chains in the Genus database with same CATH homology
 1NAE A;  1GNY A;  3WF2 A;  3I2J A;  1SHW B;  2PQS A;  5IFT A;  5J1X A;  5G04 L;  1D7P M;  2QQL A;  4XUQ A;  2X05 A;  3CIH A;  1I5P A;  4ZXE A;  2YC2 A;  3CKH A;  4W8J A;  2YFU A;  3LPF A;  3T0A A;  2VMD A;  1XNT A;  4A42 A;  1K3I A;  5C70 A;  2CDP A;  3HNB M;  1W8N A;  4OUE A;  4DUX A;  2WAB A;  4QB1 A;  4A44 A;  3FL7 A;  3GGL A;  1JZ4 A;  3SKJ E;  1W9W A;  2W1Q A;  1UMI A;  1GOF A;  1P8J A;  4DEQ A;  4D0Q A;  4IUG A;  4CU8 A;  1SDD B;  4GZ9 A;  5IJR A;  2XON A;  3HOB A;  3A21 A;  3FN9 A;  2WZ8 A;  4BDV B;  1TG7 A;  4E8D A;  2ORX A;  2E26 A;  2J1R A;  2W9X A;  1NX9 A;  2J1A A;  2QQI A;  2B4K A;  3LE0 A;  1EUU A;  3CDZ B;  3VDB A;  2J1U A;  1JZ8 A;  2J1T A;  3WF4 A;  4PT6 A;  5FUI A;  1UY2 A;  5DPN A;  2C9K A;  4OMC A;  4XVH A;  4D8M A;  4A4A A;  2Y8K A;  3HPN A;  3HEI A;  4W4Z A;  2E32 A;  1O8S A;  5CYY A;  3W5M A;  3T09 A;  4P5Y A;  4ARY A;  1O59 A;  3K75 B;  4UOJ A;  1W8O A;  1UY3 A;  5EIY B;  1L7R A;  2EIE A;  2BBA A;  2WZE A;  3MO4 A;  2ZEY A;  3C7G A;  5C71 A;  2ZEX A;  2DCK A;  4XUN A;  3E1F 1;  2VZO A;  2Y6L A;  4MO3 M;  2Z4F A;  1WKY A;  3C7F A;  3LEI A;  4QB6 A;  4QX1 A;  2YC4 A;  3OG2 A;  1UYX A;  1O8P A;  2W94 A;  1F4A A;  2J7M A;  3K46 A;  2HLE A;  1PX4 A;  4UI9 L;  3WEZ A;  3NNG A;  5DQ0 A;  5JXI A;  1JYX A;  4A3Z A;  1DLC A;  3BGA A;  3CZJ A;  2XHN A;  5IYY A;  3CMG A;  1R64 A;  2W46 A;  4CUC A;  4QDS A;  5JXJ A;  4BXS V;  3ACI A;  3SEP A;  2W87 A;  4CU7 A;  2VC9 A;  4OZO A;  1CX1 A;  3MV1 1;  2VOT A;  4LQR A;  3OBA A;  3I2H A;  3A7Q A;  4JKK A;  4PQQ A;  2HYX A;  2QQO A;  4MGS A;  5LA1 A;  3CZU A;  2WN2 A;  3HJR A;  3C7E A;  3HNM A;  1PMJ X;  2VZR A;  3I97 A;  2BZD A;  2ZEW A;  2RVA A;  5IFP A;  4DXS A;  2C26 A;  4QB2 A;  2Y6H A;  3GM8 A;  3IAP A;  2BGP A;  2DCJ A;  1F4H A;  4M4P A;  3VD3 A;  3VDC A;  3T0D A;  1JU3 A;  3T0B A;  3W5N A;  1UWW A;  2YFZ A;  1JU4 A;  2VZS A;  1CIY A;  2J1V A;  2LS6 A;  3K4A A;  2E33 A;  1JZ6 A;  1JZ5 A;  1UYZ A;  2E31 A;  5JR2 A;  5B4N A;  2YB7 A;  2VCB A;  2JDA A;  2VQT A;  4P02 B;  3VD9 A;  3WNP A;  4A41 A;  3DYM A;  1DP0 A;  4JKL A;  5JXG A;  1NUK A;  1GMM A;  1PX3 A;  4XUO A;  3UES A;  4GWI A;  3FHA A;  2R7E B;  3T2Q A;  4L0P A;  4LHS A;  2W47 A;  4OYU A;  3T2P A;  4CVU A;  5LCW L;  1KGY A;  3MBW A;  2YG0 A;  2WAA A;  3THC A;  3NRU A;  3WNM A;  2VME A;  1GQP A;  4DEV A;  3JXS A;  4KMQ A;  1JZ7 A;  1JYN A;  3UET A;  3SEE A;  1CZV A;  2WUH A;  4QPW A;  5HXM A;  2W1S A;  2VM9 A;  4DUW A;  2B9V A;  2VR4 A;  3WNO A;  5HPO A;  5A1A A;  2QQJ A;  4OMD A;  2QQM A;  2W1U A;  4W50 A;  1OF4 A;  2VMF A;  4JHZ A;  3NQH A;  1T2X A;  4MAD A;  4TTG A;  2WDB A;  4XZU G;  3IB3 A;  2WN3 A;  4A45 A;  2VMC A;  2JKX A;  4DUV A;  4CUB A;  3P6B A;  2QQK A;  3VD4 A;  2VO5 A;  1JYV A;  3WF3 A;  2JE8 A;  1JYW A;  3I2I A;  2VCC A;  3K4Z A;  4TXW A;  5LA0 A;  3OB8 A;  1GOH A;  1UX7 A;  3F2Z A;  2ID4 A;  5IHR A;  4LPL A;  2W91 A;  3WF0 A;  1J84 A;  4AG4 A;  1UY1 A;  2X10 A;  1W0N A;  4GWJ A;  3LEG A;  3EYP A;  2W92 A;  1K12 A;  1WCQ A;  3DYP A;  3ACG A;  4QX3 A;  3I3D A;  4FI9 A;  1OF3 A;  1DYO A;  1XNA A;  2VZP A;  3FHQ A;  1K42 A;  2WO3 A;  2WQ8 A;  4P08 A;  2CDO A;  2V5D A;  1PMH X;  1BHG A;  1OD3 A;  2VZ1 A;  1TVG A;  4BK5 A;  1UY4 A;  5LA2 A;  3MUZ 1;  5JXH A;  1J83 A;  3GDB A;  4JX0 A;  2W1W A;  2VZ3 A;  4ZZ8 A;  4ZY9 A;  3T08 A;  4KI5 M;  1W99 A;  1UXZ A;  2Y64 A;  3DEC A;  1US2 A;  3LPG A;  5JMO A;  4AAX A;  2RV9 A;  3IDA A;  4DXT A;  2EIB A;  2ZEZ A;  4XUP A;  3ACH A;  3ECQ A;  1EUT A;  3OGV A;  2J1S A;  1UXX X;  3VD7 A;  2C4X A;  2DDU A;  3OEB A;  2J1E A;  2W3J A;  4KWU A;  3I3B A;  2W95 A;  3P1I A;  5EJ1 B;  4ARX A;  4RYD A;  1SG3 A;  1W9T A;  1OT5 A;  5DN2 A;  4BJ0 A;  1UZ0 A;  3WNL A;  3I2K A;  5C7G A;  3ACF A;  2WBK A;  3WQB A;  3OEA A;  4QX2 A;  1KEX A;  5G05 L;  2OKX A;  3K77 A;  1UY0 A;  3HN3 A;  2L9L A;  1ULO A;  3C7O A;  3VD5 A;  2EIC A;  4QDQ A;  2VZT A;  2WO2 A;  2X09 A;  3VDA A;  2KD7 A;  4MGQ A;  4CUA A;  4A6O A;  3SKV A;  1IQD C;  5DMY A;  1LNS A;  2BGO A;  1CZT A;  1GUI A;  2VTF A;  4P00 B;  4ZZ5 A;  4CU6 A;  5F7U A;  2WO1 A;  1JHJ A;  2Y6G A;  2V72 A;  2VL4 A;  3LEK A;  3MV0 1;  4DXR A;  5CZK A;  3I2F A;  2QBX A;  2VJX A;  2Y6J A;  3AC0 A;  1ULP A;  3OGR A;  2J22 A;  2XQX A;  4M4R A;  3UNP A;  2RJ2 A;  3BN6 A;  4E8C A;  3J7H A;  1JZ3 A;  2BER A;  1UYY A;  1HN1 A;  4CU9 A;  1MPX A;  4HG6 B;  1JZ2 A;  1W9S A;  1CZS A;  3OGS A;  4XUR A;  3NJV A;  3WF1 A;  4YPJ A;  1GOG A;  2VZU A;  4MOA A;  4PF1 A;  2EID A;  2XOM A;  3WNN A;  1K45 A;  3A22 A;  3GXU A;  1L7Q A;  3PUH A;  3HNY M;  3D3A A;  4LKS A;  4QAW A;  1H6X A;  4RN5 A;  3ABZ A;  1H6Y A;  2ZXQ A;  2VZV A;  3K4D A;  3C7H A;  4QDR A;  3DYO A;  1XC6 A;  3ETP A;  3MUY 1;  1GU3 A;  1UMH A;  2ORZ A;  4UAP A;  3WSO A;  4JKM A;  3U37 A;  2W5F A;  3EB7 A;  5JUV A;  2JD9 A;  2V4V A;  3THD A;  2QQN A;  2VQU A;  1XPW A;  3A23 A;  2WYS A;  1OH4 A;  3ZM8 A;  1JI6 A;  3III A;  3C8X A;  3T2O A;  1NKG A;  1RYY A;  3IAQ A;  4XUT A;  1YQ2 A;  3NJX A;  5I0D A;  3LQC A;  3I2G A;  4ET7 A;  3I3E A;  4QX0 A;  4Z2A A;  3CQO A;  2VCA A;  3WNK A;  5EJZ B;  2VZQ A;  5B4X A;  1US3 A;  2WAO A;  3PUI A;  2Y6K A;  2LW8 A;  4BK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...