4LPLA

Structure of cbm32-1 from a family 31 glycoside hydrolase from clostridium perfringens
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
DPYRNVPKDMKTEWKWGQYSSDEPSKAVDGDDSSQFHSQDSAIDKPFIIDMQKAYTIEKLELLFRKNGNGSVKRAEIYSSLDGVTYEKVFSNAEGSDIAPWATDGEVKTINFNKPIKVRYFKIVTKESIGNFLAMREFRPYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
total genus 36
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4lplA00
5J1XA 2DCKA 3FL7A 4GZ9A 3VD3A 2Z4FA 4ZZ5A 2V72A 1EUUA 3CDZB 1CZVA 1UY0A 4PQQA 1F4HA 3GGLA 3VD4A 1GOHA 4TTGA 2YFZA 3P1IA 2VCAA 3LEKA 4P08A 3LPGA 3WEZA 2E32A 3K77A 4ZXEA 4P5YA 1UXZA 4QB6A 4ZY9A 5JMOA 2VTFA 5DMYA 2W46A 3A7QA 4RN5A 2Y6GA 1NUKA 1XC6A 2ORZA 4A6OA 2J1EA 3T0DA 3SKJE 3SEEA 5JXGA 3GDBA 1WKYA 3WQBA 4OZOA 2WAAA 3IAQA 1O8SA 2ZEZA 4JX0A 2X10A 1CX1A 4Z2AA 3WNMA 2VZSA 2WN3A 4GWIA 4QDSA 4D0QA 4A44A 4MADA 5IFPA 4BJ0A 1XNAA 4JKKA 5F7UA 1JZ8A 1J83A 5G05L 2LW8A 4QX0A 4CU6A 2VZPA 3C7GA 4P02B 3SEPA 5HPOA 3IAPA 3PUIA 3LPFA 1W9SA 2J1VA 1L7RA 3VDCA 3ZM8A 1KEXA 1GNYA 2JKXA 4KMQA 1H6XA 4DUWA 2ZXQA 1W99A 2RV9A 1GMMA 2ZEWA 1UMIA 4QDQA 1XNTA 2VZUA 4XUQA 4AAXA 5C7GA 1WCQA 3DYOA 2WZ8A 1H6YA 1GOGA 2W87A 2WAOA 3IB3A 4P00B 3T09A 4A41A 1GQPA 3T2QA 4QB2A 1US2A 2C26A 1XPWA 3C7EA 1LNSA 1GUIA 2WO2A 4DEVA 2J7MA 3HNBM 2Y8KA 3GM8A 5LA2A 2BBAA 2QQMA 2W9XA 3CMGA 3LE0A 5G04L 3FHAA 1OT5A 1UX7A 2QQLA 2VQTA 4KI5M 5LA1A 3THDA 1CIYA 4ARYA 3T0BA 2J1TA 3C7OA 2QQNA 1SDDB 4CUBA 4QDRA 1YQ2A 3MUZ1 4CU7A 4CU9A 4IUGA 2WO1A 3K46A 4PT6A 2W1SA 2VMDA 2PQSA 5IFTA 4L0PA 4QPWA 1UWWA 3HPNA 1JZ5A 1L7QA 1UZ0A 1JZ7A 1MPXA 2HYXA 4D8MA 4QB1A 2EIEA 2ZEXA 2HLEA 2VQUA 3MUY1 2BGPA 3OBAA 4E8CA 1J84A 5B4XA 2Y6JA 3MBWA 2Y64A 2W3JA 3E1F1 3I2KA 4UOJA 3K75B 2JD9A 2V4VA 5LA0A 3W5MA 5IJRA 5DN2A 2CDOA 2DCJA 3LEGA 4JKLA 5A1AA 2WDBA 2XQXA 1DP0A 1JZ6A 2LS6A 4RYDA 3I3DA 1UY1A 2W1UA 4MGQA 3EB7A 3CKHA 4DXSA 2EICA 1P8JA 2VL4A 4LHSA 4DEQA 3UNPA 3I97A 5HXMA 4XZUG 3WNKA 3GXUA 4DUXA 1JYWA 1UY3A 4XVHA 4OMCA 1D7PM 2VMCA 3NJVA 3HEIA 2VCBA 2OKXA 5JR2A 1OD3A 4PF1A 2VMFA 2DDUA 4W50A 3WF3A 1JZ4A 1K42A 3LQCA 3ACFA 3A22A 2RJ2A 3OB8A 1JYNA 4HG6B 2B9VA 3MO4A 1K12A 4CVUA 2W1WA 3K4DA 1JZ3A 4GWJA 5JUVA 4UI9L 1W9WA 5JXJA 2YC2A 4BDVB 4QX2A 1BHGA 2VJXA 1GU3A 2VR4A 3DYMA 4TXWA 1JYXA 1UXXX 2QQIA 3ABZA 2C4XA 2CDPA 3OEAA 2JE8A 3A23A 3I2IA 3NJXA 3IIIA 2Y6HA 2VCCA 3VD9A 5C70A 2B4KA 2EIDA 4FI9A 3W5NA 3P6BA 1JZ2A 1ULOA 2EIBA 3BN6A 2W92A 2WBKA 2X09A 2VC9A 4JKMA 5C71A 3VD5A 2QQOA 2R7EB 1JU4A 4A4AA 2YC4A 1K3IA 1JU3A 4ARXA 3WNOA 1TG7A 3OEBA 2Y6KA 4DXTA 1W8OA 1UYZA 3CZJA 5EJ1B 1W0NA 5CZKA 2C9KA 5FUIA 2XONA 3WNNA 2W94A 2BERA 3ACHA 2WZEA 3C7HA 4OUEA 1T2XA 5JXHA 1W8NA 2JDAA 2VO5A 3VD7A 1IQDC 3U37A 2J1AA 2XOMA 3UESA 4LQRA 1OF3A 3WNLA 1SG3A 2VM9A 3ECQA 3OGSA 4M4PA 4M4RA 3WSOA 2W95A 4W8JA 5EJZB 4LKSA 2W5FA 3F2ZA 2L9LA 3I2HA 3HNMA 1PX3A 1PMHX 1R64A 3FN9A 1CZTA 1O8PA 3I2GA 2VZVA 2WYSA 5IHRA 3IDAA 2QBXA 2J1RA 3T08A 4CUCA 2W47A 1K45A 1OF4A 2VZRA 2YB7A 1UYYA 4BK4A 3JXSA 2ZEYA 4DUVA 3T0AA 3K4ZA 3I2JA 3VDAA 1NX9A 3NQHA 4AG4A 5DQ0A 1UYXA 2XHNA 2ID4A 3ACGA 4DXRA 3CZUA 2Y6LA 2J1SA 2WABA 3MV11 4A45A 5I0DA 2E31A 3VDBA 1PX4A 2W1QA 2VZ1A 4QX3A 2WQ8A 3T2PA 1TVGA 2E26A 1NKGA 3HJRA 1HN1A 4A3ZA 1UY2A 3HN3A 1I5PA 3J7HA 1PMJX 1UMHA 4ZZ8A 3OG2A 1OH4A 1EUTA 2VZTA 3ETPA 3T2OA 3FHQA 2X05A 3WF4A 3BGAA 2BGOA 2WUHA 3EYPA 3NNGA 2VOTA 4MO3M 3C7FA 2QQKA 4XUOA 4QAWA 3DYPA 2YG0A 5CYYA 3WNPA 3HNYM 3I2FA 1W9TA 5DPNA 4MOAA 1US3A 3PUHA 2V5DA 1RYYA 2J1UA 1F4AA 3I3EA 4KWUA 2J22A 4XURA 4YPJA 3DECA 1KGYA 4CUAA 1JYVA 2KD7A 2BZDA 2VMEA 2QQJA 1JI6A 3NRUA 3THCA 2VZOA 4QX1A 1O59A 5EIYB 4E8DA 5B4NA 3A21A 5JXIA 3K4AA 4CU8A 3ACIA 4XUNA 4UAPA 1DLCA 2W91A 4MGSA 2YFUA 2E33A 3SKVA 3C8XA 4A42A 3HOBA 4LPLA 3MV01 3OGVA 3WF1A 2WN2A 3WF0A 1DYOA 1GOFA 3WF2A 4JHZA 1CZSA 2RVAA 3I3BA 3CQOA 4XUTA 4ET7A 5LCWL 2VZQA 3LEIA 5IYYA 3AC0A 3OGRA 4OMDA 4XUPA 4BK5A 1JHJA 3CIHA 2ORXA 2VZ3A 3D3AA 1UY4A 3UETA 4OYUA 4W4ZA 1ULPA 1NAEA 2WO3A 1SHWB 4BXSV
chains in the Genus database with same CATH superfamily
4CDWA 3W20A 2XJRA 5LBFA 1MEC1 3FL7A 3NWKA 4XE9A 1NQJA 4PI2A 3EO6A 2Z4FA 4Q0PA 1GZWB 2ZABA 4DIQA 4D6RA 5JSPA 1YIFA 4X6RB 4AW7A 4Q4X3 2VD7A 3VBRC 2KXLA 4CDXA 4SBVA 1IS6A 1CZVA 1UY0A 2CGOA 1YJLA 4PLMA 4YVWC 3ZPOA 2C1FA 3Q8FA 1C57A 4XFHA 3VD4A 3N4MA 3P1IA 3SCHA 4MVTA 4BWOA 2HWD2 3LEKA 1IZ3A 4FFIA 1X82A 1NZCA 2VULA 4H2AA 5FV3A 4EJRA 1V00A 4UFIA 1PGL2 1N1SA 3WDYA 3S5QA 1QJFA 3ATGA 3UT0A 4ASMB 4NPMA 5FQ0B 3THTA 2P6HA 2ZAHA 4L97A 4BMBA 1SLIA 2BGCA 4NAMA 4G3YC 4CDUB 4INDA 1O5LA 3ENRA 2W52A 5SV8A 1I3HA 4YNIA 4XBLA 5GLTA 3VZLA 4E2QA 2X53S 3ZN6A 4RN5A 2Y6GA 1IS3A 4KGQA 5F6LB 2D6LX 4XJ8A 3AJYA 1D4M3 3ITQA 1HB2A 4J1XA 1D2SA 3WQBA 1CQ9A 1H30A 1VBE3 3AZYA 4OZOA 3KHBA 2XJQA 3LZZA 1Q3EA 2DVAA 3H1MA 5FAXA 1R093 3UYJA 2BDRA 1W6PB 2PTMA 1AL21 4FT8A 4OHVA 2Y33A 5I0TA 1V6IA 2XG3A 2Q8OA 1XSQA 1CX1A 2ZKLA 2LUWA 1RMU1 1OOPC 1RVF1 1XNDA 2JDUA 4K9SA 4AEDA 5AC91 2BWCA 4EN9B 4IEQA 4Z2AA 3ILFA 5FZAA 1LENA 1OD5A 1KDKA 1SBDA 2B8MA 2R6QA 2WN3A 3WNMA 5IVJA 3WR0A 5LA9A 2CWMA 2YGMA 1W6NA 1OHFA 1ULCA 3I7DA 5EYYA 4QU2A 3UL2A 3VGIA 5IAVA 1C8NA 2YV8A 3MICA 4YZ2A 1ZBA3 1EV13 1JZ8A 2VNRA 3IPVB 4QX0A 5JOYA 3N9LA 4PLNA 4LO7A 3C7GA 3AYDA 4LITA 3TN91 3VZKA 1OUSA 1MS1A 1ND3B 1E5HA 1W9SA 3WQ1A 1Q43A 1UU5A 1LKNA 4MX3A 4RFRB 1B35B 3MF6A 3U1XA 4Y24A 3ZFGA 4J1WA 3VKNA 1RUC1 3KT4A 2JKXA 2R043 5JI7A 2DFCA 4BQ5A 2B5HA 3K3NA 1J3RA 1FOD1 3SH3A 4D69A 3KV4A 2WSUA 5CEHA 2ZXQA 3N3HA 4R4XA 2DF7A 2RV9A 4DQAA 4WVVA 3AYCA 1WBLA 4Q4X2 2Z5WA 3AP6A 1V70A 1AR93 2WZ8A 2CU5A 3IB3A 4IE5A 5BV6A 4P00B 4AEDB 4FBFA 2K9ZA 3LEMA 4YZ4A 1Y9GA 1FATA 5LBCA 5CFCA 4WM7A 1GQPA 5JCTA 1KS4A 2C26A 4IV3B 5FJKA 2G1MA 3PUQA 3HR9A 1OFNA 4I0BA 2WO2A 2RS32 2J7MA 5APAA 4DEVA 5K0UB 5G04L 2C9AA 2W9XA 1RINA 4FOQA 1WCUA 3D8CA 1KDMA 1XSRA 2QQLA 3IWZA 4KNCA 1WZXA 2QQUA 2VQTA 3RMXA 2OQ6A 5JLVA 1FOD3 3EJKA 1NCQA 1RUI2 3THDA 1VBD2 2Q0AA 2R072 3AMPA 5FY0A 1YCIA 4LO6B 3PTRB 5FPLA 1WGPA 2J1TA 3RYKA 2ILMA 2X5IA 3LB9A 1PGSA 1ZZ6A 4LMFA 4HPKB 4IL7A 4Q4Y3 3PU3A 1YQ2A 2XDVA 3ZVXA 2ZGLA 5D2AA 5BUVA 3ZFEB 1GYKA 2GH2A 2P1BA 2QDNA 3VL8A 2ARXA 2RHPA 3N9PA 3V0AA 1VJ2A 4L11A 3EMRA 5E16A 4B8EA 1UWWA 1ZZBA 2OA2A 3KMHA 1C5IA 5L9RA 3WHUA 3AM2A 1W6MA 1ACCA 3JUUA 1KFXL 4V2WA 4PDWC 1VBA2 4GMP1 1TME3 4BH9A 2ZEXA 4P9LA 2VU9A 2VQUA 3MUY1 3DKWA 4ATFA 1YFWA 1W2NA 1HX6A 1J84A 4FPYA 3HT2A 2Y64A 4ES8A 1CR7A 2W3JA 1GQGA 3E1F1 3BU7A 3K75B 1XB9A 2JD9A 2KM2A 1COV2 2IXIA 2V4VA 3HD8B 2PXJA 1AR73 1AR83 1OVPA 2EF6A 2SLIA 3B9IA 3RVHA 4QXKA 5T50A 5A3TA 1V6LA 4P9IA 2DU0A 3RPQA 1RIRA 4JDNA 3LEGA 4JKLA 1UZVA 5J98B 5FPVA 2R0HA 2HWC2 1H8VA 2VCMA 3BB6A 3HMYA 3VL9A 1FMD2 1HW5A 1NG0A 4HLTA 1EAH2 1W8UA 3IDBB 3T4VA 1S0IA 1VPHA 2O1QA 3I3DA 4CA9A 2W1UA 4MGQA 1TEIA 1MS9A 3ACLA 1UU4A 1RXGA 2VOXA 4DXSA 3MDPA 1JN2P 1U12A 5FPAA 5EPAA 4C0BA 1P8JA 5E8AA 1W6MB 3H0OA 1PVC1 2ZMLA 4XXPA 4DEQA 3BPSA 3BCWA 3ZDSA 4C91A 4E4DX 3VV1A 1ASJ1 1ENXA 2WA3A 4NRQA 4QD2A 1NLQA 4IESA 1LOFA 3GXUA 2BV4A 1PM7A 4OMCA 2BPA2 2VMCA 2XVKA 5DAXA 2WZR3 4R9DA 1ZBE3 3DPRB 3HEIA 2VCBA 2Y0IA 1TMF3 3VB9A 2V4AA 4XACA 3O1UA 3RZGA 4IV1B 4LHNA 5JR2A 2PQQA 1ZZCA 2HWD3 4AYUA 2VMFA 3KQ4B 4Q4Y2 2AACA 4B29A 5FMOL 5FP3A 3UGGA 1EPWA 3E97A 3BOWA 3IPVA 4XJUA 4YGEA 3O14A 4X8PA 3O0WA 4BISA 3GZUC 3ACFA 5IAXA 3ON7A 2CTVA 2IVJA 3U4XA 1UPIA 4AK3A 1WW4A 2WFF2 1A3KA 4CVUA 2W1WA 2A3WA 2J42A 4QXCA 2CSGA 1JZ3A 3R0RA 2UWCA 1O3RA 1ZBA2 3AYEA 1Q8QA 1X9TA 2FDJA 4GWJA 1WMXA 4HK8A 5JUVA 5IVCA 3ZXKA 1W9WA 3PUSA 1ZBE1 3OBTA 4QX2A 4CEWA 3VLBB 4LT5A 2VJXA 1GU3A 2F4LA 1CESA 4LJHA 3DYMA 3BTAA 1D4M1 4TXWA 1LULA 4ZU5A 4XCBA 4XQWA 3KS7A 1OMIA 5AFBA 4RR3A 3SISA 4K8RB 3ABZA 5CIRA 4E4SA 5CKQA 4L2NA 4E2SA 1ASJ2 1FYUA 1HRI3 4TN7A 4N43C 4LXLA 4S2HA 1LEMA 5GM0A 2ZGKA 4U36A 4A7YA 4ATEA 4BQ3A 2UYAA 2V09A 1N1TA 1SLBA 2CAUA 5LATA 3POSA 4NWVA 5IK4A 1AYM2 1ENRA 2ZGUA 1S0DA 4O9GA 2EIDA 3WUDA 1C8M3 2RMU3 4AI2A 3J9SA 2H0VA 1W6NB 1BXHA 5EFUA 2Y34A 3BVCA 4RSUA 4ES9A 1O5UA 3BN6A 1SCSA 3KVBA 2DVBA 5JOXA 2HJIA 3BOPA 3ZFFB 2E9QA 4BE3A 1OURA 1UPSA 3QH6A 3KV5A 5FLIA 3VHRA 5FY4A 4C1WA 2RS13 3B02A 5BY5A 2RR13 1HRI1 4TLGA 2QCSB 2VQ0A 3OBRA 5FR3A 1TZOA 2ENRA 4MXWA 2G4IA 3WNOA 5BNQA 5FO8B 2Y6KA 3LFMA 3NL1A 1BCXA 2RS53 5I0UA 1XNCA 2VBBA 3CZJA 5GLVA 1AF9A 3CL1A 1X7NA 3SH4A 4XJAA 1GWMA 5FZEA 3AXEA 5A32A 2XMLA 5JOZA 4AEMA 4E4ZA 2C9KA 2WNVA 2VVDA 3WG2A 2BU9A 3IMNA 5FZFA 2OYZA 1NCRB 5FOJB 2W94A 1CWPA 1H9WA 2BERA 3E5XA 4C0HA 3C7HA 5DAVA 5IVFA 1JUIA 3PDQA 3PUAA 2JEMA 2PHTA 4CDUA 3OOXA 5A3NA 2VUDA 2VO5A 2R1BA 4AI0A 5KHIA 4LIVA 3ZSJA 1KXGA 4AQTA 1NZIA 3LDBA 4LBJA 1ULFA 4PIZA 1SG3A 3ECQA 4DS0A 3LDRA 5JWPA 2DBNA 4CXXA 2DTWA 2E6VA 2YZ4A 5EJZB 4K6BA 4Y22A 1RHI3 5GLWA 1HIXA 3IMMA 3I2HA 4OHZA 3WW1A 4D3WA 5A3LA 3PURA 3S57A 5E1RA 2G9ZA 1A78A 3NAPC 2ZZQA 1V6JA 1R64A 1W39A 1VMJA 1WW7A 3AP9A 2WT1A 4KGGA 2GNBA 1GNZA 2AENA 4YGBA 2VZVA 4UWDA 2DCZA 2WYSA 1FAYA 3HQRA 3IDAA 3RJ2X 4Q4Y1 2PHWA 1CIWA 1JYCA 3POFA 2P3KA 4FAHA 1ONAA 1RUF3 1VALA 1RUC2 4K7JA 4LBLA 3T08A 4JGZB 3VDDB 2HWB2 1BBT1 2FBEA 4CXYA 1RUD1 4PHZA 4QGLA 3HT1A 2VUAA 4GALA 3ORJA 3WDTA 1NA1C 3I2JA 2WRAA 4ZPIA 1OBNA 4OHXA 3NQHA 2NN8A 3H7YA 3SCFA 4AG4A 4DRRA 4IV3C 2ZZJA 2P3IA 1VBD3 2NP0A 2ID4A 1AYN1 3ACGA 3ZKYA 4CP9A 2RM23 5A70A 3FMGA 3O1PA 1SDWA 1W90A 2VH9A 3VBHC 1B35A 4COYA 3H8UA 1W2TA 1PVC2 4OUSA 2W1QA 3AKSA 4GD4A 4PIYA 1QJU1 4QX7A 5KHHA 1RUJ3 4XFAA 2ZGPA 3KZ4C 4OVEA 1AR81 4FPFA 5C5TA 4PDWB 1HN1A 1W9YA 3U78A 2E7QA 5LEJA 1KITA 4Y4RA 3HN3A 3RI9A 5LEKA 1VAKA 4L92A 2JDPA 5F3IA 2GSYA 1EV12 1U5YA 1LHVA 1SBEA 4CP1A 2VZTA 5FZDA 4QPGB 1VAMA 3FHQA 2EIGA 3BU0A 1FPN1 3EYPA 3NNGA 1BQPA 4JDOA 3FWEA 3ELNA 2XH6A 4MO3M 4QMAA 1C1FA 5DG1A 1VB4A 3ZYBA 5JPMB 4QHOA 4IW3A 3P3PA 4BHPA 1PGL1 4S2GA 2P3JA 4Y3OA 4AR2A 1W6PA 5C33A 1QJX2 4EWDA 4NOTA 4AFDA 1NQDA 3POBA 3ZYRA 2HWF1 4QQOA 2BFUS 3AFKA 5ACA3 2HWC3 1US3A 1F5JA 4GWMA 1F4AA 1UU6A 2W2IA 4KWUA 1UOBA 4O65A 3AFGA 1LR5A 1S55A 1JOBA 5K8SA 3C2UA 4XURA 2GC2A 4Y22B 2DUPA 4XW3A 1WMDA 2VMHA 2XJVA 4QKBA 1PGW1 2HYKA 1K5JA 2XVGA 3D82A 3THCA 4UF0B 4CCLA 2DWRA 3D6EA 2JX9A 2K0GA 1DQ5A 4WM8C 1YFXA 2HWD1 4E8DA 3N36A 5B4NA 3MI8A 3WT3A 4PF5A 3FLTA 4XFFA 4AE2A 5J48A 3LSDA 4NIHA 1K5MC 3INAA 4UAPA 1UOJA 3TEXA 2YU2A 1V9U2 3NV1A 2LRPA 1VRBA 5C8CC 3WLUA 5FYCA 4P9WA 1UZYA 2GALA 2RG4A 3M3CA 5EV7A 5T5PA 5FLJA 4QQPA 4HKOA 2VMGA 1SFNA 5D21A 4YW3A 5FY8A 4GXLA 1GOFA 2GN7A 2AGSA 4QWNA 3VBFA 2BYVE 5L19A 1DGWA 1CZSA 1OLRA 3L9JT 3OF1A 2Y0OA 3OUHA 4UXAA 3FUQA 5F5IA 4YM3A 1ULEA 4EWEA 1AJOA 2VZQA 3LEIA 1TME1 5FUNA 3CNAA 5DZFA 4YWAA 5HI0A 2WNVC 1RUF1 2XLAA 4QHZA 3OGRA 4OMDA 1N1YA 4XUPA 1JHNA 1JHJA 4CXWA 1G86A 3FUOA 3WG1A 1OOPB 1XXNA 2BUKA 5FZ1A 3D3AA 1POV1 2HEYF 1UY4A 3FE5A 1YHFA 3VBOA 4W4ZA 4BIOA 4DXZA 4FTSA 3VBOC 3MLJA 4AGVA 4MV2A 3W58A 3PVBB 1AR71 4RA0A 3QLQA 5L7OC 4CDWB 5FZGA 4GZ9A 4MGYE 3B93A 3S5AA 4K1YA 3VD3A 4AQSA 2Y6FA 4R9AA 1TQ5A 4FP3A 5CFDC 1AX2A 3GZEA 4HSLA 5D8AB 4B4QA 4ZZ5A 5LW9A 1NE6A 4KBZA 2V72A 1XJAA 3MW2A 5IVYA 4PQQA 3WUCA 4XTMA 3GGLA 2MNGA 1H2NA 1LODA 2YFZA 3ES1A 1OC1A 4FVVA 4OLLA 4RR3B 4YARA 1NT0A 2WR9A 4OULA 4BZ4A 4P08A 2B9UA 1RUG2 3HBKA 4Y5TA 3LPGA 4W6WA 5GZCA 3ETQA 4EV0A 5GJ6A 5FOBB 4P5YA 1DZQA 4DINB 4GH4B 1QKQA 1QMJA 1UXZA 2JDYA 1AYM3 3ZYJB 1UO9A 5DDJ2 5CKNA 5LK7B 4DRVA 3KQRA 2WS93 2ZGMA 3MLKA 1NLSA 3V64A 5KBFA 2I45A 1U5IA 5FZHA 2ORZA 4A6OA 3BYWA 2GMMA 1DZRA 3KT7A 1X8MA 4A7ZA 1LGNA 2XQRA 3VN4A 5DUVA 4RGAA 1WKYA 3AXDA 5JXGA 3Q8CA 2D6NA 4CDXC 3OSDA 3WP6A 2MEV1 1X9PA 1VBA1 4AXOA 2HWF2 4NIGA 1QJX1 1O8SA 4AFCA 2NYYA 1CX4A 1T6BX 2GC1A 4FQ4A 1EP0A 2GNTA 2ZEZA 4NAOA 2YXSA 2ZHNA 3J8F3 1IPKA 3VBRA 2WO7A 4Q4W1 3HQXA 1MQTB 4JC1A 4O61A 4QPGA 4JDMA 5GZDA 1RUI1 2GP5A 3Q8BA 2ZPXA 4R4ZA 4OQ8A 3ZXAC 4HK9A 4UFKA 3VZNA 4AVAA 5BNNA 5CG9A 3BPZA 4UT5A 3KF5A 4H7LA 4MGKE 1DFQA 2QQVA 3KT1A 1OA3A 4M3CB 1FXZA 5FYMA 4WM8B 2YPJA 5F7UA 1HB4A 1S0GA 4Y4YA 5CFDB 4MGTA 1RUG3 1J83A 4ZU4A 1GV9A 4RS5C 2MEV3 3I54A 4XZPA 2VZPA 3AMMA 3O12A 4JQRA 3SEPA 5CAZA 3IAPA 3WQ7A 3LPFA 3KB5A 1ZBE2 3PVEA 4DFSA 5A7WA 3U14A 3VDCA 1EYBA 3ZM8A 3FLRA 5JI9A 5IVBA 4GB33 3LGRA 4DUWA 2K2SA 4HL0A 1W99A 3OYWA 3WDUA 2A6WA 2JD4A 4QDQA 1O4YA 1Y3TA 3WW2A 4AAXA 5C7GA 2R1DA 3RZLA 1GOGA 4YRDA 1XOYA 4A41A 1QOTA 4GKXA 3AL6A 4QB2A 2OX0A 5C4WA 4IE6A 1US2A 3C3VA 4ISRA 4WVMB 2B46X 4UBGA 1O4TA 4SLIA 1G8WA 3J8F2 2EXJA 4XIOA 1GUIA 3OPWA 2VVFA 4IGQA 3ZSMA 1RUE1 3GM8A 3HWJA 3WY6A 1OPMA 5LA2A 1APNA 3CMGA 1UX7A 1VBE1 4MGZE 1W9FA 3IBMA 4QX5A 2CY6A 1OQDA 4GB31 5IUQA 5LA1A 4FPGA 2R16A 3SH5A 4MHUA 4XMAA 4YZ3A 2A75A 1DGWX 2DTYA 4XF3A 4XJZA 3GF6A 5LBBA 4ARYA 4F8AA 2BQPA 1JOJA 4WZFA 4M0NA 4QDRA 3IKWA 5FZOA 4D6SA 3MUZ1 2WWJA 4CU7A 3VBSA 2WO1A 3ALQA 4NMIA 4PCRA 2VMDA 1S0CA 3VKOA 4UFHA 5IFTA 1OKOA 4L0PA 4FFGA 4KWKA 4QPWA 3PHMA 1SPPB 5JMCA 4AL9A 4AZZA 2VUCA 2C0ZA 4FPLA 2ET7A 4HONA 4A2UA 3LKJA 1ND3C 2LALA 4N43A 2ZKNA 5BNOA 3CU7A 3RWKX 2GNDA 3OBAA 5A1FA 3BTZA 4Q1PA 1F5FA 3PLQA 3Q8EA 3RYPA 4XDQA 3IM0A 5CG8A 2RE9A 1ZA4A 2ZBJA 3I2KA 4ZS2A 1GR3A 1H2MA 2JG9B 3ZFFA 5LA0A 3R6SA 3W5MA 5IJRA 1F35A 1MZEA 1NCQC 1VBA3 4YLZA 1V6NA 4XTPA 1MEC3 1DBNA 4UYBA 5DN2A 2EVXA 2DCJA 4P9YA 3WCSA 2DCYA 4CZSA 2ZGRA 2ET1A 3JBG2 3AZWA 3GCXA 4NPLA 1NE4A 4D6QA 3VBHA 2UWBA 2XQXA 1DP0A 1DCSA 4GH4C 2BEOA 1JZ6A 3POEA 2DCTA 3WQ0A 4GB32 4L99A 1L3JA 1OLMA 3TB0A 4Y5SA 2Q5TA 3AP4A 1QXPA 2EXKA 3EB7A 1J3PA 1UD1A 4IEZA 4BPZA 3H8XA 2YU1A 4XDOA 1CD3G 3F95A 2E63A 2FD8A 4MHRA 4BM8A 4CEYA 4M3CA 1PK6B 2V5YA 4MH0E 3KHCA 3UNPA 5ISLA 3VBFC 2RS51 2ARCA 3WZ1A 1URXA 3I97A 3U10A 4Q29A 4U2AA 4I0WB 5C3SA 4CP9B 2YDEA 1J58A 3HIFA 3PNAA 1W05A 4XZUG 5IK5A 3M3IA 4GULA 1MQTC 3GHMA 4HBNA 4HVOA 3UKNA 1VBC3 4CDUC 4CEWB 2XWJB 1J1LA 1PO12 3H42B 2JIGA 2R32A 1UKGA 3GCWA 3POWA 4I0AA 5FWEA 3W9AA 3MIHA 4A6SA 5AFEA 1R092 2JDMA 2VNGA 1QHDA 1R091 3S0MA 2JKBA 4LOTA 2QNKA 3PIJA 5FPUA 3ZPYA 4HOOA 2PLV3 2R061 4LBNA 5FYIA 4PF1A 2ZA9A 2OIIA 3FZ3A 1HRV3 2IXCA 1YI7A 3CJXA 4OI1A 2WZR1 1SLTA 1X8EA 2JDZA 3RSJA 5KXBA 4W50A 2A6XA 1IHMA 1K42A 5FY5A 2IXHA 2NM1A 5L9BA 3VHPA 3I3QA 2CHHA 2JG8C 2RJ2A 3M1HA 4AFMA 1WA4A 4IV1A 3AP5A 1QGLA 3MO4A 3BALA 1JS9A 1SPPA 2D3SA 3NV3A 4TWTA 5C3QA 1SFYA 1PGW2 4UI9L 1DU3D 1ALYA 4MGIE 4QQ2A 5AVAA 1CGPA 4AGRA 2VAUA 1BHGA 1RUD3 1W0PA 5FYYA 2Q30A 1WCKA 3T30A 4DB5A 5L9VA 4A7KA 2QZ2A 3OEAA 4EWAA 2D7FA 5C8WA 1DQ2A 4OI0A 3A23A 4LA3A 4R8HA 5ABJB 3QH7A 3NSTA 1AYN3 3ZXFA 3VZMA 4AEKA 3IIIA 4E4HA 3AZZA 1LECA 1OKQA 1HQNA 2Y6HA 3AKQA 2QQPA 4UW4A 5A33A 1D4VB 5C70A 1PO22 3GYDA 4BQ1A 1RL3A 1UZWA 2PHLA 3N7MA 3N9NA 1BBT3 5CB7A 1RUJ1 2YY1A 4LBQD 1AL0G 4AAPA 3GZAA 1ULOA 2RS33 1ND2B 1ND2A 2X29A 4QHBA 4MSVA 2Q1FA 2ZX1A 1HXS1 3H8OA 4H14A 1YQ8A 1S0EA 3H3LA 3MGUA 1FX5A 4LE4A 5EWSA 1UAIA 3IT8A 1YFYA 4AI1A 4Q8KA 1JU4A 5ACA2 1K3IA 4NN0A 4XF0A 4BB3A 4COUA 4QPGC 5J96B 5L7OA 2IFWA 2ZGNA 4FFHA 4UFMA 1TG7A 2FCVA 3OEBA 4LK7A 4S2DA 2ZGQA 1D2QA 3MIFA 4YW2A 1UYZA 3ZIXA 1PZ8A 2PAKA 2ZACA 2RS11 4XMIA 5CZKA 1UZZA 2HWE3 1K5MB 1UOFA 3K48A 2UURA 2WNUB 2YC0A 4QPYA 1BLZA 1UW8A 5FUIA 2MHFA 5FMDA 3WNNA 4BQXA 2JIJA 2WFF1 4OUEA 2FCTA 3Q8AA 5FIXA 2D43A 2JE7A 4QPIC 1LOFC 3VD7A 1IQDC 2GDFA 5FTTC 3U37A 2ARAA 2DVGA 2J1AA 3UESA 4N7UA 5JIUA 5CBLA 3VHNA 4QXBA 2HEWF 5F5CA 5KR7A 1Y9QA 4IGOA 4N90A 3M8LA 5FFOC 4QM9A 1IKQA 3F2ZA 1PX3A 1W6QB 3I8TA 1OLME 5BXXA 4RQPB 5A7SA 3V65A 5A1LA 3VDDC 1SLLA 5FYHA 1MEC2 3FN9A 3USUA 4CCMA 2ZTNA 2FDKA 1PNGA 4RHV1 5FPZA 5FYZA 5DZGA 5JZGA 3RFRA 1AR92 3TOJA 1O7FA 4N7IA 2J1RA 3PL0A 1R083 3NVCA 3TN93 3AMQA 1RHI2 5C3OA 1PIV2 2A6VA 4LHKA 5F8PA 3WDWA 4K20A 4QGNA 3KCXA 1PIV1 4YM2A 2F4PA 1OF4A 3SHRA 1IPSA 2VW0A 3QCWA 2OZJA 1SQ4A 3B5LB 2RDSA 4G4FA 3SC7X 4FPHA 2JXAA 3E5UA 4IE0A 1NX9A 1ZRRA 3VBUB 4GQ7A 1UYXA 3RZZA 2OUJA 1MS4A 2C5DA 1FOD2 5JPNB 4YG3A 1Y4WA 1ND3A 4BA6A 1PK6C 5A3WA 1KJRA 4QX8A 3KGLA 1O3QA 1SLCA 3JD71 1N47A 1S0FA 4F3JA 3VDBA 1AVBA 1R1A3 3QOPA 1SLAA 4QX3A 3NAPA 1TVGA 2E26A 2ZHLA 3SCGA 3EBRA 3PMEA 1U5XA 1JYIA 3ZYPA 1W04A 2D98A 5L7OB 1HN0A 4OI4A 5I0RA 1G7YA 1X33A 1I5PA 5GZGA 4Z92B 1T6GC 2BVBA 5HCAA 3OG2A 1EUTA 1OH4A 3T2OA 4N53B 5FY9A 4AQ2A 4AHYA 4JGZC 2WUHA 2BOJA 4V1PA 4YGCA 1V0AA 3LA7A 1V6MA 2HWE2 4A3XA 5FYSA 3ZMNA 2P5BA 2HWF3 1H0BA 4XYXA 4GKYA 3I59A 1OSGA 4N9IA 2X5IC 1GANA 3M3OA 5JSOA 1JUHA 1HXS2 4OHYA 5DDJ1 3DYPA 2BTVC 1DLLA 4P9XA 2YG0A 3O5SA 1GWKA 4FCAA 4Y1ZA 2D3PA 5A7NA 3OPTA 4DNYA 1W9TA 4GA9A 2ZGSA 3GALA 1RC6A 4CEYC 1G9BA 4M3CE 4MOAA 1W6OB 2V5DA 3I3EA 4CSWA 3DL3A 2FDIA 1HV1A 1GKBA 3JZVA 2NLRA 4CUAA 4YZ5A 5IT6A 1JYVA 2HH9A 1OVSA 1O4ZA 1ZNPA 4QM8A 4YVSC 4CP2A 4EN0A 3V0AB 5A80A 4EQVA 2VZOA 4JRAA 4UF0A 1O59A 4EYUA 4AI8A 1RUOA 1YFUA 5EHDA 5SV5A 2XUMA 3ZKUA 5DAQA 5JXIA 3BKZA 3K4AA 1G9FA 3ACIA 4CU8A 5FMCA 4XUNA 4IXLA 4FPJA 4AVBA 2D97A 5FZ9A 3ZR6A 2D5HA 1W2AX 3TBDA 3WINE 1LB2A 2Z79A 3MFAA 1DLCA 4MGSA 4XFBA 3AMHA 4Z82A 2YFUA 3ZOIA 3ZXGA 3OTFA 4DMIA 3DEMA 1LOGA 4M3CF 5K0UC 4A42A 1SBFA 3IDCB 3HOBA 4LPLA 5J09A 3OGVA 1HKDA 3NNLA 1DGRN 1CAXB 1LJ7A 1Z7S1 4NO4A 2RJKA 4V2VA 3WP5A 3WF0A 1S2BA 1AXZA 1E57A 3ILRA 1DQ6A 3LIHA 3ZDVA 4Y20B 1H2LA 5FO9B 2SBAA 4PQ9A 4AHWA 1G9DA 5E6HA 3JB8A 3B94A 1Y7BA 1ZVFA 1A6CA 2AYHA 2Y38A 2D5FA 3MW3A 5IYYA 5FXVA 2OZ6A 4XQDA 2H6CA 1C3HA 1TNFA 1LOEA 4YVSB 4Y1VA 4COZA 4BU2A 3ME2A 3H50A 1ZM1A 5LASA 2VZ3A 5DZEA 3SITA 5A7WB 1DG6A 5JZGC 1B35C 3USSA 5C9AB 1XYOA 2OW4A 2XJTA 2Q1ZB 1H8TB 1SHWB 4HN1A 5C8CB 4OHWA 4GWNA 2W68A 4CEYB 4NHXA 2O0OA 2DCKA 1QJY1 4ZHNA 1XNKA 4Y1UA 2XUEA 3APBA 3RWNA 2I2SA 3WW3A 1Z0HA 4YW5A 1JH5A 5F9TA 2D6MA 3ROUA 2EAAA 1EUUA 2A6YA 3MHZA 4HVRA 3JBG1 4CCEA 3WVJA 1GOHA 4TTGA 1YO8A 1B09A 3NJZA 2XB6C 2VCAA 4ZXKA 3FFQA 1IG0A 4IGPA 4YYOA 1IQAA 4NIIA 4BQ4A 5JIAA 4WM7C 2FQPA 1IOAA 4LEJA 4Y1YA 4DOUA 5KXEA 1D0HA 3CJIB 4ZXEA 2ADEA 4AVSA 4QB6A 4ZY9A 5JMOA 4YVWA 2QE3A 3TAYA 2VTFA 4FO9A 3BTYA 1FMD1 5T5JA 1RMU2 5H9QA 3LWCA 2W46A 1RUC3 2ZGOA 5T54A 4HVQA 1BMV1 3A7QA 3OGGA 4TLFA 3TEZA 2D3RA 1XC6A 2GAUA 2FMDA 4XF1A 1O3TA 1LCLA 2CV6A 2Y26A 3SEEA 3VKFC 2VBPA 3T0DA 1MVQA 2D40A 2DUQA 2YBPA 5FP9A 4Q26A 3W59A 1S4CA 1S2KA 1LOAA 4IV1C 2WAAA 2QDRA 3MW4A 2OXBA 5FPBA 1PO21 3THPA 5DDJ3 4AOCA 3EQEA 3TEWA 4HKWA 2UY9A 4C1XA 3LD8A 2UY8A 1OQEA 1N3PA 3FC0A 3FJSA 5FZBA 4I30A 4GH4A 4WBBA 4YSFA 2CNAA 5JAXA 5KXCA 3FLPA 2VG9A 4B7EA 2R041 3EHKA 4CTEA 3W21A 4XF4A 5FZOB 1MS3A 3VUOA 1C8M1 2JWPA 2XKOA 4GWIA 1GICA 4QDSA 5A6QA 1SFPA 4D0QA 3WDVA 4EZ4A 1GQHA 4HZFA 5FWJA 3OY8A 4I01A 2WNUA 1MR5A 2BOIA 2V73A 3D4KA 4BJ0A 3T2TA 1C4RA 1XNAA 4JKKA 3POYA 1N3OA 1RUH3 1AR72 1MACA 2LW8A 5FMBA 2YBKA 4XFGA 1GZWA 4P02B 1RJ8A 3DV8A 4Q5OA 5H9PA 4LK6A 2X8KA 3BTXA 4Y5Z0 3BIWE 1RUD2 2ES3A 2J1VA 3VBOB 4YFZA 1FMD3 2RR12 2PHFA 3I59B 4YG0A 2Y60A 4GMP0 1GNYA 4W6XA 2JB4A 4KMQA 3WDXA 3UV9A 3AK0A 1Z7S2 3OPZA 2B45X 5A6XA 1NXD1 1DQ0A 4RHV2 5FZLA 3PU8A 3QACA 1REEA 1AR63 3RYRA 2ZAAA 3AP7A 2PMWB 3DYOA 2WAOA 4BIFA 3T09A 2RMU2 3JCIA 3TN92 3N7KA 1R1A1 5BNNC 1VBB1 4WZCA 3K2OA 3AB0A 1XPWA 3C7EA 4EROA 1ZYBA 1LNSA 3LF7A 4ZONA 1YQCA 3RI8A 5JDBA 2Y8KA 1H8TC 2W08A 2BBAA 3LE0A 1OT5A 2R062 4P14A 5I8SA 2JG8A 5CFDA 4LO4B 3UK9A 2G9GA 2R30A 2WLPA 2WNOA 1G9AA 3ZFEC 1Y43B 1W8TA 2F17A 4QGMA 1CIYA 5FK7A 3T0BA 4IE4A 5LY1A 2YMZA 5FZ7A 1C1LA 3TNPB 1VRH1 3C7OA 2RS52 5ANNA 1AXYA 1SDDB 4LBOA 1IG3A 1CAVA 5FBZA 3FX3A 4IUGA 5B2GB 3AKPA 2OPKA 5M0TA 4LO8A 5KWRA 3UGFA 3ZXEA 1A34A 1AZDA 2WFF3 4AFAA 2VECA 3PVOA 3POGA 4EE2A 5LB6A 5IVVA 1JZ7A 5BNPA 2HYXA 3KVAA 2AH2A 5T52A 2EIEA 1QOSA 4HMZA 1CAWA 5FK8A 4CPBD 5IW0A 1I1EA 4HANA 1J59A 1LTEA 2PN5A 4IV3A 2XJSA 2BGPA 5GLZA 4FOWA 3VKLA 5B4XA 3MBWA 4GAZA 5BNPC 2RDNA 3X29B 2BRTA 4JGYB 2JB8A 2BJSA 3V0BA 1STMA 4M01A 2WFPA 1LESA 5C8CA 5A3UA 2MPFA 3I2OA 3DPRA 2O14A 1O91A 3LIGA 4QKDA 4S2FA 3ASIA 1W28A 3H1YA 4I3GA 3CO2A 5KHKA 1UIJA 2WDBA 1RUJ2 4Q4V3 3MF9A 2WQZC 3GBGA 3B7MA 3O1OA 4NPRA 1ZRFA 3U75A 1RVF3 1GNHA 1W0OA 3V0BB 4AWDA 5FREA 2RDQA 2PHRA 2B7YA 5L73A 3OUJA 5BYNA 1LGBA 2WA4A 1ULGA 1FPN2 1UY1A 2NQYA 5A6ZA 3S7IA 3AVRA 1H8TA 1W8ZA 2EICA 2OT7A 3HVDA 5C9AA 2VL4A 3PIGA 5FXZA 5BNPB 1H1AA 2E53A 1UKRA 2PFWA 2XBO2 3RQ0A 5CADA 1QNWA 3AKRA 1QNYA 1MZFA 2IWGB 4IQPA 1GWLA 2FHRA 1YWKA 4NWWA 3TEYA 4NIDA 2ZHMA 2RS31 3WNKA 4D7YA 4QPIA 5F37A 5CKMA 2WIIB 1BVP1 2DFBA 1NA1B 2WNEA 1FT9A 3KV9A 1D7PM 4K21A 4JZRA 2JG9A 2PHUA 1Q8SA 4M0HA 3VDDA 3K3OA 2XGXA 3NJVA 2QTWB 5H9RA 3RZHA 4DZGA 5FBJA 3ZYFA 3QD6A 3VHOA 1QJY3 2WZPP 4Z07A 3VBFB 1S1AA 1W06A 5DUXA 2VTXJ 2BNOA 4H7MA 4LLOA 3JQWA 2XXZA 3O1SA 3MPPG 1VP6A 2DDUA 1JZ4A 5FP7A 3LQCA 4XC9A 3M3EA 2FZ2A 3MYXA 2C24A 4KBBA 5EQUA 3OB8A 3VBUC 2FDFA 4HG6B 4Z8BA 5FP8A 1UOGA 3AMNA 5FYUA 1BK0A 1K12A 3DUIA 3N9QA 1YUDA 2OUHA 1FV2A 4P9GA 3RJRA 4K8FA 1O3SA 5FQ0A 2A1XA 1UMZA 1G6NA 1V6KA 5JXJA 3WOGA 2YC2A 4BXFA 2PYTA 1H1IA 4N8MA 1MVEA 1PHMA 2X5IB 4M00A 4DPNA 4I2OA 1JMUB 4LULA 2I07B 3CLPA 1VRH3 5FLHA 1RB8G 2TBVA 2JDKA 2LTNA 2QQIA 5FKBA 5FJHA 2C4XA 1COV3 2CDPA 5BNOC 2R042 2VNOA 3LAGA 5A7QA 2VQAA 1KS5A 3WX5A 1ODMA 1DGRA 1GLHA 3O1TA 2VUJA 1DQ1A 3KLSA 2VE1A 1REDA 4MXWB 4JRLA 3G7DA 3P3NA 3ZSKA 1F9KA 2ZX4A 4B4PA 2QVSB 4XBQA 2FMYA 3JD73 2AEYA 2Z69A 4Q4W2 5EZWA 4CCJA 1Y9MA 2PHXA 4GIQA 5F5AA 4WM7B 3W5NA 2P3YA 2GN3A 5F6KA 2PAMA 3P6BA 5FRAA 1JZ2A 2EIBA 4QPIB 4AEDC 3P5BA 3WW4A 4CDQB 4BQ2A 4XPVA 2W92A 4JCKA 1SACA 3E5QA 1WUVA 1A8DA 1JTZX 3O1VA 5DAPA 3VD5A 1NY72 1JOPA 2R7EB 4A4AA 4JAAA 2YC4A 1NY71 1YEWA 4FQZA 2ZX3A 1UN1A 2HWE1 1LAJA 1YRZA 4Q27A 2Q8EA 4ARXA 2BP6A 1OA2A 1SZBA 4YG6A 2GC3A 3NO8A 5F3CA 5JZGB 1PZ7A 1WCDJ 2EA7A 2BWAA 2QFEA 4DXTA 3BI3A 2KA3A 3RS6A 4P9JA 2VW1A 4HXCA 4RFT0 1ZREA 1TMF2 3L2YA 2NMOA 3DF0A 4XIKA 2P34A 2WZEA 3J26N 3NKGA 3KCCA 5JXHA 2Z42A 2XHKA 4JHTA 3JB4C 5LZ6A 2LM3A 3TNQA 1MQTA 3I49A 3NNFA 5IK8A 3ZSLA 2XOMA 4FP2A 3WNXA 1WD3A 2QKDA 4CPBA 2WC2A 2RDRA 2WT0A 3RZJA 4OUMA 4R9CA 4XCAA 1FI2A 1OF3A 5FDBA 1AJKA 1XNBA 2BNMA 3J8F1 3OD0A 3OGSA 4XILA 3WSOA 3JD72 2JECA 2W95A 4Q4W3 5DABA 1LHUA 3CJIC 4URTA 5F2SA 1RUI3 4COWA 1H1MA 2VTXA 4LKSA 2W5FA 4ZKTB 1CAXA 1H4HA 3R05A 3VKMA 3LFIA 1VBD1 2OVUA 3OBZA 4RQPA 2WYFA 3KWVA 3LA3A 1PMHX 3N7LA 1QXRA 5A3OA 2AZ5A 4B1LA 4K40A 3D0SA 2EALA 3ZX7A 3R4DB 1CZTA 1UIKA 1PO11 2E7TA 5FCCA 3I2GA 1YIPA 5IHRA 1WW5A 5FYVA 2HEVF 4OZXA 4E2GA 3RG0A 1OLQA 1LU1A 2QBXA 4R52A 4PBPA 3ZN6B 2WT2A 1C5HA 1EAH3 4LNVA 2W47A 5KC5A 4LO5B 2YB7A 5T3NA 2YROA 4ASLA 5IATA 4BK4A 3TYJA 1TME2 3EXUA 5ACA1 1H4GA 4CDQA 5C9AC 2PA7A 2ZEYA 4JV4A 5EP9A 1UX6A 3J4UH 4QT6A 4Z2WA 2ATFA 3WG3A 3H9AA 2JG8B 4O9EA 5D1IA 3PMSA 1DYKA 2D6KA 4TYSA 2VVEA 5GZFA 5C4WC 2Z2SB 5D8AA 3BUCA 2PHDA 4EN6B 4MG2A 3CZUA 1W6OA 5F5QA 1LHWA 3MV11 4JGYC 4CDXB 4ZU7A 1LOBA 2A6ZA 4FPEA 1UCXA 1RITA 2VOKA 2YBSA 5EXOA 3O7OA 5HXVA 3SMHA 4BYYA 4WVMA 1NKGA 5ABJA 3HJRA 1KJLA 2HWC1 4N53C 4A3ZA 4F7ZA 4QQHA 5T5LA 3JQXA 1UY2A 5FP4A 1HXS3 1MS0A 2DU1A 1PMJX 2GZWA 2TEPA 2A73B 4Y1XA 2JJ6A 2YGLA 2E51A 3B01A 3ETPA 4N53A 4AHXA 4L9BA 2BGOA 3KM5A 4NVPA 1QWRA 5CISA 3I3MA 4IEYA 2NMNA 1BK1A 4XUOA 3LOBA 1QJZA 2UU8A 1GZTA 3Q9OA 3OD4A 5FZ3A 1NYWA 4G9SB 4IDZA 3RMYA 4F83A 4MZUA 5ERLA 1AR82 5T5OA 5CYYA 3KV6A 3WNPA 4LHLA 4LBKA 3I2FA 2ZCWA 1QOOA 5IWFA 3M7AA 2IZWA 1RYYA 2J1UA 1BEV3 3JBG3 4WM8A 3I4IA 1LHNA 1POV3 5LY2A 5KC6A 2Q1MA 4IEXA 4YW4A 3ZYHA 4MYEA 4URAA 1QJEA 3AJZA 2A71A 4GJZA 1XE8A 4YPJA 1VBB3 3B69A 2IUWA 3DECA 1VAVA 3KCYA 3WG4A 1KGYA 3ZFEA 3ES4A 1RUNA 2KD7A 5BNNB 1R081 3T1LA 4YGDA 1FPN3 1AL23 1SMVA 4CE8A 2BZDA 1LHOA 2HBTA 2VMEA 1JI6A 5FMOS 4PIXA 3NNJA 1NA1A 1QU0A 1ZZ9A 2WKKA 5EIYB 3WHTA 3HQUA 5FUPA 4ITCA 3NW4A 4LTAA 4QKFA 2JICA 4DY5A 5IVEA 1RUF2 2XLGA 3ZLIA 5HCFA 5F32A 4BQYA 1ZRCA 2ZGTA 1IKPA 2W91A 4MUVA 3PTYA 5I91A 2E33A 2ADDA 3C8XA 1N1VA 1GP5A 2P37A 3B9CA 5AVPA 3MV01 4CCDA 4Q0SA 1F8VA 1RUH1 3M70A 1MS8A 5KHJA 2QQWA 4XHXA 3WF2A 3O1MA 1QQP1 4JHZA 3ST7A 1ZX5A 2QZ3A 5HCHA 3N35A 5HV0A 1W8WA 2RVAA 3CJIA 3I3BA 3MIGA 2GU9A 2NPIA 3CQOA 4YFWA 1FV3A 2G19A 2XR4A 3E6BA 5FYTA 4LKEA 2HBUA 2FCUA 2O8QA 3AC0A 4LUKA 2DV9A 1DIWA 4YVSA 3D0JA 5A7PA 3T3YA 3O0VA 4Q8LA 5FKCA 3CIHA 4BK5A 3QBQA 5DAWA 1E5IA 4IEOA 5CFCC 3RZMA 3I2DA 4UW5A 3RRDA 4KG8A 2R073 2WO3A 5ANQA 3AYAA 3KF3A 2XWBB 4GJYA 4IETA 4IEUA 4YW1A 1REFA 3H3ZA 3MPBA 4QXHA 4NJ4A 5J1XA 4X6QB 4H3WA 4HETA 2Q4SA 5A6YA 1CAWB 1UL9A 1VMFA 1XQNA 3USUB 1QEXA 1OI6A 5TSWA 4AI3A 4NE9A 4Q4V2 1HRV1 3CDZB 4D94A 1JBCA 1F4HA 2XBO1 3RDIA 2RS12 1UYPA 3RNSA 4H55A 3FBMA 2ZHKA 3UJQA 2PLV2 4Q0QA 1WMFA 1WWYA 1Q5OA 1VE0A 3WEZA 2XJUA 4Y33A 2E32A 3K77A 3DXTA 4Y20A 2K46A 5FZ6A 2A3XA 3J7NA 5DMYA 1DQ4A 2WWSA 3PVNA 3S7EA 5ABJC 2TNFA 3OGJA 3AL5A 1POQA 1WW6A 1NUKA 1A8MA 2J1EA 4CYDA 1K5MA 1VMHA 1HDKA 1AHSA 2A7AA 1FNYA 3SKJE 4AGGA 4UFLA 4COVA 3GDBA 3ZFGC 3DGTA 4IE7A 1WLTA 1XYNA 1PZ9A 1NLRA 2P4EA 1I5ZA 4AEJA 3H7JA 3IAQA 5F1RA 1W3XA 5GZEA 4Z1VA 4XJ9A 5LK5A 1U5ZA 3R4SA 1HQLA 5IK7A 2WWUA 4JX0A 2X10A 4K1ZA 2AC1A 2HKXA 3T4HB 1RXFA 4XABA 2VZSA 1POV0 4X8NA 2VBDA 2XL7A 3AKTA 2YYOA 3GBFA 1CAUB 1WLCA 5F2WA 2WS91 3UKTA 1KQRA 5C5UA 3N7JA 1NCRA 4A44A 5KXDA 3OYWB 2ZOEB 5EYXA 4MADA 5IFPA 1I6XA 3NV2A 1M06G 1E5RA 5I8TA 3NMBA 1ND2C 3UGHA 4NUBA 5A33B 1HQWA 2VMIA 3DN7A 2CGNA 4HN0A 1Z7S3 4XF9A 1QDOA 4Q0UA 5G05L 3SQOA 3ZXDA 3A0NA 4BLIA 4CU6A 2WJSA 4FAGA 4FOVA 4IEWA 1S2EA 3WXPA 2PAEA 5HPOA 3PUIA 4QU1A 4E27A 4MXVA 2JENA 1L7RA 4HFSA 4Q4X1 2C6SA 4FXKB 2ARBA 2NZ9A 4HSJA 1OPOA 1KEXA 1VRH2 5CFCB 4ORFA 1EY2A 1LRHA 2BVVA 5DG2A 5LWBA 1H6XA 4NR1A 2WLQA 1RUH2 4K3UA 3ZXLA 5C6CA 4R9BA 2AREA 4BCUA 4I3PA 1GMMA 2ZEWA 1UMIA 3OUIA 5K4LA 1XNTA 2VZUA 4XUQA 1WCQA 1J3QA 2ZMKA 1H6YA 1XYPA 2W87A 4XEZA 3ZN5A 1ZZ8A 4WV8A 5D8AC 1QJU3 3T2QA 4NHMA 4NHLA 3BODA 3ZMOA 4KWJA 2OQ7A 4UBHA 1N3QA 1IS4A 4C90A 5LBEA 1LU2A 2JDHA 3GJAA 2AR6A 3FFZA 2ZMNA 2VNVA 4XFCA 1IS5A 3HNBM 1AR91 2W0XA 4EN8B 2QQMA 2VGDA 1JODA 5CNAA 3FHAA 4LKDA 2AEZA 5GLUA 3VBUA 3R4UA 5F3GA 1BZWA 4KU8A 4WVWA 4KI5M 3GHNA 5J36A 5DUWA 1S0JA 2GC0A 3UJOA 4YVWB 1AXKA 3DKQA 3VBRB 1H2KA 2B39A 4E9KA 2QQNA 5HBAA 2ETEA 4CUBA 1AX0A 4LOSA 1CAVB 5E88A 3HN1A 4CU9A 3K46A 5FZ0A 4GMP3 4FPOB 4PT6A 2W1SA 5HV4A 2PQSA 4RQPC 3SNMA 1OFSA 4EZHA 4FSJA 1XE0A 1R082 3POIA 3RZKA 1M4WA 2QUOA 3MZHA 1XU1A 1RUE3 2AUYA 3HPNA 3KGZA 4HT1T 1L7QA 1JZ5A 1PVXA 1PK6A 1AL22 1UZ0A 2DVDA 1MPXA 4AVCA 3MIDA 4D8MA 3AZVA 3LSEA 4QB1A 4B7KA 1EPZA 2GMEA 4N43B 2HLEA 5H9SA 5GKAC 4L8QA 4E8CA 1TE1B 3LA2A 2Y6JA 2UWAA 4N9HA 4XHBA 2ZS6B 1VLNA 1RMU3 3LCPA 1RVF2 1GBGA 4UOJA 4AQ6A 4AI9A 4B4RA 4FTBA 1RTVA 3OCPA 4RD7A 2PELA 5L36A 2CDOA 3J7MA 1VBC1 5A1AA 4CCNA 1W2OA 3GNEA 1ZRDA 2D44A 3N9OA 2E7AA 4XJWA 5FY7A 5JVVA 3WP3A 2D6OX 1AUYA 2RJLA 2B42B 4ONUA 2VY0A 4O7XA 1HJFA 1CJDA 2WNVB 2LS6A 1UQXA 3U07A 5A32B 4RYDA 2HWB3 2BBVA 3H8RA 2Q8DA 1WA6X 3PJYA 4Q4V1 2XL9A 3CKHA 1QIQA 1Q8PA 3ZYGA 4QQLA 2WSVA 4BMEA 4AVTA 1KRIA 4IEPA 1I9RA 4LHSA 3DXUA 2BFUL 4LBQA 1OXCA 2BNNA 3MFCA 2CYFA 2P2KA 3NKTA 5A3MA 5HXMA 3DPRC 1CAUA 1RUE2 1W8FA 3H3UA 5FZ4A 5I0SA 2XLFA 4DUXA 1JYWA 4Q0VA 2JE9A 3IN9A 1UY3A 4XVHA 5T55A 3VZJA 2A5ZA 1VBE2 1PVC3 4LR4A 1WD4A 1YQ5A 2ZX0A 3MEPA 4Y26A 1PO23 2EXHA 2IC1A 3VBSC 1CJPA 1D0GA 1IGOA 1BBT2 2HWB1 3LDKA 4RS5B 2OKXA 3WV6A 5CVRA 4KWLA 1OD3A 4JVAA 3U11A 2FDHA 5K7PA 1VR3A 5AC93 2EAKA 1L7LA 1ZZ7A 3WF3A 4XETA 3CBNA 3A22A 1YJKA 1JYNA 1GFF2 1QQP2 1QY4A 2B9VA 4KH9A 5FZCA 2VOWA 3K4DA 4J6GA 4OFGA 3FBYA 4XOGA 4CRQA 4XAEA 2IVIB 3IZOA 5EJ3A 2G9FA 4LIUA 4BDVB 1EAH1 3AX4A 4Q2FA 1DZTA 1GP6A 3WCRA 4YZ1A 5K9YA 1SCRA 2N7GA 2VR4A 1Q8VA 1BVVA 5I8YA 4PJYA 1JYXA 1C8M2 1UXXX 2LROA 5FXWA 2H0BA 3O0XA 1ZA7A 1QH6A 2JE8A 2KR2A 3NAPB 1YYNA 3I2IA 4OQ9A 1HV0A 4PDWA 1C28A 1PO13 2GP3A 4YW6A 3NJXA 1CONA 1XBFA 3GJBA 3AVSA 1W3VA 2BW8A 2VCCA 4LUMA 3VD9A 4RGKA 2B4KA 1COV1 4CEWC 4FFFA 4FI9A 4W6YA 1W8HA 1WMEA 1WLWA 1X36A 2IXJA 3ZN4A 3RGBA 4DO0A 1ASJ3 1FNZA 1HRI2 2CL2A 4ZS3A 4RR3C 5FZ8A 4BOWA 4JQTA 5CA6A 3WP4A 5KHGA 3K51A 5AC92 1HJGA 1QDCA 2WINB 4FOYA 2R0FA 4I09A 1Q8OA 4XAAA 3FHIB 4XDPA 5FZIA 2WBKA 2CAVA 2X09A 2VC9A 1IPJA 1BEV2 1MZ6A 1NCRC 4JKMA 1RUG1 4TSVA 5C71A 1QQP3 4ISQA 2QQOA 1HB3A 4AFBA 1WCSA 2CWSA 2VW2A 5FZMA 1JU3A 1PIV3 4AHZA 3SXWA 2WQ4A 3U0ZA 4NRMA 3JU9A 1ENQA 1F15A 1OA4A 2F6BA 1DYPA 1W8OA 5EJ1B 2TUNA 3IIAA 4CCOA 5DXDA 1W0NA 1BYHA 1JYTA 5BNOB 1W6QA 2FDGA 5JR7B 2DBIA 1PNFA 3MIEA 2R49A 1BMV2 1KD7A 2XONA 4HKLA 2DURA 3ZFFC 1HB1A 1V6OA 3DCQA 2JG9C 1OOPA 4FTEA 3ACHA 2R071 2VPVA 1H9PA 1T2XA 1W8NA 1GZ9A 2JDAA 3MIBA 4UW6A 3NJYA 1LOCA 2I74A 2DVFA 1XU2A 1D4M2 5C3RA 4XBNA 4YM1A 1RHI1 4JTNA 1R1A2 4LQRA 3IDEA 4JGZA 4WVZA 4PBOA 4Q1RA 1BJQA 5J3UA 1NXMA 3AZXA 3WNLA 1LGCA 1R1ZA 2VM9A 2XBO3 3MLLA 4M4PA 4M4RA 3BIEA 3VZOA 2O8OA 4W8JA 4LKFA 3O1RA 2L9LA 3HNMA 3TWIA 5F39A 3N9MA 3U4SA 4NRPA 5HCBA 4EN7B 4FPKA 2XKPA 1PMIA 1ODNA 1O8PA 1ZBA1 5CU1A 1AR62 4TZDA 2CGPA 5F3EA 1DHKB 2IXLA 2P17A 4D7SA 2H6BA 5J7MA 2OPWA 4I02A 3A4UA 1XRUA 3VBSB 3SLIA 4CUCA 2RM22 2GNMA 1GZCA 2YHJA 1OUXA 1K45A 2VZRA 5FXXA 1UYYA 3B3QE 3ZR5A 3S30A 4LLFA 5FZKA 4JTOA 3L2HA 4HPKA 1F2NA 3JXSA 5LRRA 4DUVA 3T0AA 3K4ZA 1E5SA 1AX1A 3VDAA 1X50A 1J1TA 1HLCA 4LBMA 3ZXJA 2DYCA 4NHYA 4W65A 5DQ0A 1NCQB 4LBQB 1SEFA 2XHNA 4RGGA 4PLOA 4QKNA 1V9U1 5I93A 4DXRA 4P5HA 4OCTA 4KL1A 2VOVA 2Y6LA 2J1SA 1LEDA 2WABA 4A45A 5I0DA 4BQWA 4LORA 3OJBA 3GBWA 2E31A 1KFUL 4KU7A 1YLLA 2D6PA 4RHV3 5K0UA 3WD5A 3E6CC 1PX4A 1GSLA 4CP0A 3ZO0B 4CUGA 2A70A 1UF2C 5C4WB 1YQ6A 2VZ1A 2WQ8A 1U0AA 3T2PA 1PM4A 3A0KA 4XFIA 4B1MA 2DUOA 1TMF1 5A7OA 3TRSB 4XXAA 2WS92 1VB2A 3OY8B 1CN1A 2IXKA 3M2MA 1CVNA 1DF0A 3J7HA 4KQ7A 5J37A 1UMHA 3POJA 4LA2A 4ZZ8A 1Z78A 1WBFA 3URFA 3WF4A 2X05A 1UNBA 2MEV2 3BGAA 2JDNA 2VXRA 4RL7A 4CCCA 2VOTA 3C7FA 3ZSEA 5LRSA 2QQKA 1QXJA 3KD4A 4BLJA 3HBZA 4QAWA 2ZX2A 3ZFGB 1BEV1 4CDQC 1MS5A 1BKZA 4JGYA 1DGLA 1JW6A 1O6UA 1W2UA 2WNUC 3NV4A 2VXJA 1VBC2 1YC61 1RJ7A 1QF3A 3HAGA 3HNYM 2P6CA 4NIAA 5DPNA 3H1WA 3T1MA 4MLOA 4D7TA 3PUHA 2D93A 1MZ5A 3M3QA 4B3NA 3V56A 1QH7A 2J22A 4FXGB 1WLDA 2XPJA 1TNRA 3PJQA 4AVVA 4IERA 1QJU2 2EXIA 4C8DA 1V9U3 1DDLA 1HRV2 1ULDA 1QJX3 3B00A 3NRUA 2QQJA 4OI2A 4YM0A 2UYBA 3LOIA 3S6PA 2A3YA 5A3PA 1AYM1 4QX1A 1AYN2 1EV11 2ERFA 2PLV1 2R063 3M4FA 5FY1A 2Q8CA 4NHKA 4AF9A 1G9CA 3A21A 3CEWA 3CF6E 4META 1W03A 1OQ1A 1RGSA 3E6DA 1VBB2 1ENSA 2RMU1 3ZYIB 2GH8A 1S0BA 3GZTB 1ST8A 5DUUA 1VIWB 3D5OA 1YNAA 1GP4A 4LE3A 3SKVA 4UFJA 3NNMA 2XJPA 5FPXA 2YPDA 1YXWA 4FPCA 5FO7B 1YI9A 2XVLA 2WN2A 2WZR2 3WF1A 4CCKA 1DYOA 4NROA 1CPMA 1QJY2 1AR61 4RS5A 4J25A 2RR11 3ILNA 2ZJCA 1Q56A 1OH3A 3VBHB 2QJVA 1NOVA 1F31A 4XUTA 4ET7A 2W39A 1XE7A 2FZ1A 3CHXA 5JSRA 5LCWL 3KSCA 4KG0A 2OS2A 5E89A 2GMPA 1CPNA 2WL1A 2IFRA 3G6JB 4UW3A 5JOWA 3ZIWA 5GALA 2RM21 1ZRIA 2ORXA 4PI0A 2YUEA 3UKVA 4CDWC 5FYBA 5C3PA 4DY3A 4XQ4A 3UETA 4OYUA 1JXNA 1ULPA 1NAEA 3J7LA 4ASKA 4YW7A 4IEVA 4BXSV 5BPXA
chains in the Genus database with same CATH topology
5J1XA 2DCKA 3FL7A 4GZ9A 3VD3A 2Z4FA 4ZZ5A 2V72A 1EUUA 3CDZB 1CZVA 1UY0A 4PQQA 1F4HA 3GGLA 3VD4A 1GOHA 4TTGA 2YFZA 3P1IA 2VCAA 3LEKA 4P08A 3LPGA 3WEZA 2E32A 3K77A 4ZXEA 4P5YA 1UXZA 4QB6A 4ZY9A 5JMOA 2VTFA 5DMYA 2W46A 3A7QA 4RN5A 2Y6GA 1NUKA 1XC6A 2ORZA 4A6OA 2J1EA 3T0DA 3SKJE 3SEEA 5JXGA 3GDBA 1WKYA 3WQBA 4OZOA 2WAAA 3IAQA 1O8SA 2ZEZA 4JX0A 2X10A 1CX1A 4Z2AA 3WNMA 2VZSA 2WN3A 4GWIA 4QDSA 4D0QA 4A44A 4MADA 5IFPA 4BJ0A 1XNAA 4JKKA 5F7UA 1JZ8A 1J83A 5G05L 2LW8A 4QX0A 4CU6A 2VZPA 3C7GA 4P02B 3SEPA 5HPOA 3IAPA 3PUIA 3LPFA 1W9SA 2J1VA 1L7RA 3VDCA 3ZM8A 1KEXA 1GNYA 2JKXA 4KMQA 1H6XA 4DUWA 2ZXQA 1W99A 2RV9A 1GMMA 2ZEWA 1UMIA 4QDQA 1XNTA 2VZUA 4XUQA 4AAXA 5C7GA 1WCQA 3DYOA 2WZ8A 1H6YA 1GOGA 2W87A 2WAOA 3IB3A 4P00B 3T09A 4A41A 1GQPA 3T2QA 4QB2A 1US2A 2C26A 1XPWA 3C7EA 1LNSA 1GUIA 2WO2A 4DEVA 2J7MA 3HNBM 2Y8KA 3GM8A 5LA2A 2BBAA 2QQMA 2W9XA 3CMGA 3LE0A 5G04L 3FHAA 1OT5A 1UX7A 2QQLA 2VQTA 4KI5M 5LA1A 3THDA 1CIYA 4ARYA 3T0BA 2J1TA 3C7OA 2QQNA 1SDDB 4CUBA 4QDRA 1YQ2A 3MUZ1 4CU7A 4CU9A 4IUGA 2WO1A 3K46A 4PT6A 2W1SA 2VMDA 2PQSA 5IFTA 4L0PA 4QPWA 1UWWA 3HPNA 1JZ5A 1L7QA 1UZ0A 1JZ7A 1MPXA 2HYXA 4D8MA 4QB1A 2EIEA 2ZEXA 2HLEA 2VQUA 3MUY1 2BGPA 3OBAA 4E8CA 1J84A 5B4XA 2Y6JA 3MBWA 2Y64A 2W3JA 3E1F1 3I2KA 4UOJA 3K75B 2JD9A 2V4VA 5LA0A 3W5MA 5IJRA 5DN2A 2CDOA 2DCJA 3LEGA 4JKLA 5A1AA 2WDBA 2XQXA 1DP0A 1JZ6A 2LS6A 4RYDA 3I3DA 1UY1A 2W1UA 4MGQA 3EB7A 3CKHA 4DXSA 2EICA 1P8JA 2VL4A 4LHSA 4DEQA 3UNPA 3I97A 5HXMA 4XZUG 3WNKA 3GXUA 4DUXA 1JYWA 1UY3A 4XVHA 4OMCA 1D7PM 2VMCA 3NJVA 3HEIA 2VCBA 2OKXA 5JR2A 1OD3A 4PF1A 2VMFA 2DDUA 4W50A 3WF3A 1JZ4A 1K42A 3LQCA 3ACFA 3A22A 2RJ2A 3OB8A 1JYNA 4HG6B 2B9VA 3MO4A 1K12A 4CVUA 2W1WA 3K4DA 1JZ3A 4GWJA 5JUVA 4UI9L 1W9WA 5JXJA 2YC2A 4BDVB 4QX2A 1BHGA 2VJXA 1GU3A 2VR4A 3DYMA 4TXWA 1JYXA 1UXXX 2QQIA 3ABZA 2C4XA 2CDPA 3OEAA 2JE8A 3A23A 3I2IA 3NJXA 3IIIA 2Y6HA 2VCCA 3VD9A 5C70A 2B4KA 2EIDA 4FI9A 3W5NA 3P6BA 1JZ2A 1ULOA 2EIBA 3BN6A 2W92A 2WBKA 2X09A 2VC9A 4JKMA 5C71A 3VD5A 2QQOA 2R7EB 1JU4A 4A4AA 2YC4A 1K3IA 1JU3A 4ARXA 3WNOA 1TG7A 3OEBA 2Y6KA 4DXTA 1W8OA 1UYZA 3CZJA 5EJ1B 1W0NA 5CZKA 2C9KA 5FUIA 2XONA 3WNNA 2W94A 2BERA 3ACHA 2WZEA 3C7HA 4OUEA 1T2XA 5JXHA 1W8NA 2JDAA 2VO5A 3VD7A 1IQDC 3U37A 2J1AA 2XOMA 3UESA 4LQRA 1OF3A 3WNLA 1SG3A 2VM9A 3ECQA 3OGSA 4M4PA 4M4RA 3WSOA 2W95A 4W8JA 5EJZB 4LKSA 2W5FA 3F2ZA 2L9LA 3I2HA 3HNMA 1PX3A 1PMHX 1R64A 3FN9A 1CZTA 1O8PA 3I2GA 2VZVA 2WYSA 5IHRA 3IDAA 2QBXA 2J1RA 3T08A 4CUCA 2W47A 1K45A 1OF4A 2VZRA 2YB7A 1UYYA 4BK4A 3JXSA 2ZEYA 4DUVA 3T0AA 3K4ZA 3I2JA 3VDAA 1NX9A 3NQHA 4AG4A 5DQ0A 1UYXA 2XHNA 2ID4A 3ACGA 4DXRA 3CZUA 2Y6LA 2J1SA 2WABA 3MV11 4A45A 5I0DA 2E31A 3VDBA 1PX4A 2W1QA 2VZ1A 4QX3A 2WQ8A 3T2PA 1TVGA 2E26A 1NKGA 3HJRA 1HN1A 4A3ZA 1UY2A 3HN3A 1I5PA 3J7HA 1PMJX 1UMHA 4ZZ8A 3OG2A 1OH4A 1EUTA 2VZTA 3ETPA 3T2OA 3FHQA 2X05A 3WF4A 3BGAA 2BGOA 2WUHA 3EYPA 3NNGA 2VOTA 4MO3M 3C7FA 2QQKA 4XUOA 4QAWA 3DYPA 2YG0A 5CYYA 3WNPA 3HNYM 3I2FA 1W9TA 5DPNA 4MOAA 1US3A 3PUHA 2V5DA 1RYYA 2J1UA 1F4AA 3I3EA 4KWUA 2J22A 4XURA 4YPJA 3DECA 1KGYA 4CUAA 1JYVA 2KD7A 2BZDA 2VMEA 2QQJA 1JI6A 3NRUA 3THCA 2VZOA 4QX1A 1O59A 5EIYB 4E8DA 5B4NA 3A21A 5JXIA 3K4AA 4CU8A 3ACIA 4XUNA 4UAPA 1DLCA 2W91A 4MGSA 2YFUA 2E33A 3SKVA 3C8XA 4A42A 3HOBA 4LPLA 3MV01 3OGVA 3WF1A 2WN2A 3WF0A 1DYOA 1GOFA 3WF2A 4JHZA 1CZSA 2RVAA 3I3BA 3CQOA 4XUTA 4ET7A 5LCWL 2VZQA 3LEIA 5IYYA 3AC0A 3OGRA 4OMDA 4XUPA 4BK5A 1JHJA 3CIHA 2ORXA 2VZ3A 3D3AA 1UY4A 3UETA 4OYUA 4W4ZA 1ULPA 1NAEA 2WO3A 1SHWB 4BXSV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1X A;  2DCK A;  3FL7 A;  4GZ9 A;  3VD3 A;  2Z4F A;  4ZZ5 A;  2V72 A;  1EUU A;  3CDZ B;  1CZV A;  1UY0 A;  4PQQ A;  1F4H A;  3GGL A;  3VD4 A;  1GOH A;  4TTG A;  2YFZ A;  3P1I A;  2VCA A;  3LEK A;  4P08 A;  3LPG A;  3WEZ A;  2E32 A;  3K77 A;  4ZXE A;  4P5Y A;  1UXZ A;  4QB6 A;  4ZY9 A;  5JMO A;  2VTF A;  5DMY A;  2W46 A;  3A7Q A;  4RN5 A;  2Y6G A;  1NUK A;  1XC6 A;  2ORZ A;  4A6O A;  2J1E A;  3T0D A;  3SKJ E;  3SEE A;  5JXG A;  3GDB A;  1WKY A;  3WQB A;  4OZO A;  2WAA A;  3IAQ A;  1O8S A;  2ZEZ A;  4JX0 A;  2X10 A;  1CX1 A;  4Z2A A;  3WNM A;  2VZS A;  2WN3 A;  4GWI A;  4QDS A;  4D0Q A;  4A44 A;  4MAD A;  5IFP A;  4BJ0 A;  1XNA A;  4JKK A;  5F7U A;  1JZ8 A;  1J83 A;  5G05 L;  2LW8 A;  4QX0 A;  4CU6 A;  2VZP A;  3C7G A;  4P02 B;  3SEP A;  5HPO A;  3IAP A;  3PUI A;  3LPF A;  1W9S A;  2J1V A;  1L7R A;  3VDC A;  3ZM8 A;  1KEX A;  1GNY A;  2JKX A;  4KMQ A;  1H6X A;  4DUW A;  2ZXQ A;  1W99 A;  2RV9 A;  1GMM A;  2ZEW A;  1UMI A;  4QDQ A;  1XNT A;  2VZU A;  4XUQ A;  4AAX A;  5C7G A;  1WCQ A;  3DYO A;  2WZ8 A;  1H6Y A;  1GOG A;  2W87 A;  2WAO A;  3IB3 A;  4P00 B;  3T09 A;  4A41 A;  1GQP A;  3T2Q A;  4QB2 A;  1US2 A;  2C26 A;  1XPW A;  3C7E A;  1LNS A;  1GUI A;  2WO2 A;  4DEV A;  2J7M A;  3HNB M;  2Y8K A;  3GM8 A;  5LA2 A;  2BBA A;  2QQM A;  2W9X A;  3CMG A;  3LE0 A;  5G04 L;  3FHA A;  1OT5 A;  1UX7 A;  2QQL A;  2VQT A;  4KI5 M;  5LA1 A;  3THD A;  1CIY A;  4ARY A;  3T0B A;  2J1T A;  3C7O A;  2QQN A;  1SDD B;  4CUB A;  4QDR A;  1YQ2 A;  3MUZ 1;  4CU7 A;  4CU9 A;  4IUG A;  2WO1 A;  3K46 A;  4PT6 A;  2W1S A;  2VMD A;  2PQS A;  5IFT A;  4L0P A;  4QPW A;  1UWW A;  3HPN A;  1JZ5 A;  1L7Q A;  1UZ0 A;  1JZ7 A;  1MPX A;  2HYX A;  4D8M A;  4QB1 A;  2EIE A;  2ZEX A;  2HLE A;  2VQU A;  3MUY 1;  2BGP A;  3OBA A;  4E8C A;  1J84 A;  5B4X A;  2Y6J A;  3MBW A;  2Y64 A;  2W3J A;  3E1F 1;  3I2K A;  4UOJ A;  3K75 B;  2JD9 A;  2V4V A;  5LA0 A;  3W5M A;  5IJR A;  5DN2 A;  2CDO A;  2DCJ A;  3LEG A;  4JKL A;  5A1A A;  2WDB A;  2XQX A;  1DP0 A;  1JZ6 A;  2LS6 A;  4RYD A;  3I3D A;  1UY1 A;  2W1U A;  4MGQ A;  3EB7 A;  3CKH A;  4DXS A;  2EIC A;  1P8J A;  2VL4 A;  4LHS A;  4DEQ A;  3UNP A;  3I97 A;  5HXM A;  4XZU G;  3WNK A;  3GXU A;  4DUX A;  1JYW A;  1UY3 A;  4XVH A;  4OMC A;  1D7P M;  2VMC A;  3NJV A;  3HEI A;  2VCB A;  2OKX A;  5JR2 A;  1OD3 A;  4PF1 A;  2VMF A;  2DDU A;  4W50 A;  3WF3 A;  1JZ4 A;  1K42 A;  3LQC A;  3ACF A;  3A22 A;  2RJ2 A;  3OB8 A;  1JYN A;  4HG6 B;  2B9V A;  3MO4 A;  1K12 A;  4CVU A;  2W1W A;  3K4D A;  1JZ3 A;  4GWJ A;  5JUV A;  4UI9 L;  1W9W A;  5JXJ A;  2YC2 A;  4BDV B;  4QX2 A;  1BHG A;  2VJX A;  1GU3 A;  2VR4 A;  3DYM A;  4TXW A;  1JYX A;  1UXX X;  2QQI A;  3ABZ A;  2C4X A;  2CDP A;  3OEA A;  2JE8 A;  3A23 A;  3I2I A;  3NJX A;  3III A;  2Y6H A;  2VCC A;  3VD9 A;  5C70 A;  2B4K A;  2EID A;  4FI9 A;  3W5N A;  3P6B A;  1JZ2 A;  1ULO A;  2EIB A;  3BN6 A;  2W92 A;  2WBK A;  2X09 A;  2VC9 A;  4JKM A;  5C71 A;  3VD5 A;  2QQO A;  2R7E B;  1JU4 A;  4A4A A;  2YC4 A;  1K3I A;  1JU3 A;  4ARX A;  3WNO A;  1TG7 A;  3OEB A;  2Y6K A;  4DXT A;  1W8O A;  1UYZ A;  3CZJ A;  5EJ1 B;  1W0N A;  5CZK A;  2C9K A;  5FUI A;  2XON A;  3WNN A;  2W94 A;  2BER A;  3ACH A;  2WZE A;  3C7H A;  4OUE A;  1T2X A;  5JXH A;  1W8N A;  2JDA A;  2VO5 A;  3VD7 A;  1IQD C;  3U37 A;  2J1A A;  2XOM A;  3UES A;  4LQR A;  1OF3 A;  3WNL A;  1SG3 A;  2VM9 A;  3ECQ A;  3OGS A;  4M4P A;  4M4R A;  3WSO A;  2W95 A;  4W8J A;  5EJZ B;  4LKS A;  2W5F A;  3F2Z A;  2L9L A;  3I2H A;  3HNM A;  1PX3 A;  1PMH X;  1R64 A;  3FN9 A;  1CZT A;  1O8P A;  3I2G A;  2VZV A;  2WYS A;  5IHR A;  3IDA A;  2QBX A;  2J1R A;  3T08 A;  4CUC A;  2W47 A;  1K45 A;  1OF4 A;  2VZR A;  2YB7 A;  1UYY A;  4BK4 A;  3JXS A;  2ZEY A;  4DUV A;  3T0A A;  3K4Z A;  3I2J A;  3VDA A;  1NX9 A;  3NQH A;  4AG4 A;  5DQ0 A;  1UYX A;  2XHN A;  2ID4 A;  3ACG A;  4DXR A;  3CZU A;  2Y6L A;  2J1S A;  2WAB A;  3MV1 1;  4A45 A;  5I0D A;  2E31 A;  3VDB A;  1PX4 A;  2W1Q A;  2VZ1 A;  4QX3 A;  2WQ8 A;  3T2P A;  1TVG A;  2E26 A;  1NKG A;  3HJR A;  1HN1 A;  4A3Z A;  1UY2 A;  3HN3 A;  1I5P A;  3J7H A;  1PMJ X;  1UMH A;  4ZZ8 A;  3OG2 A;  1OH4 A;  1EUT A;  2VZT A;  3ETP A;  3T2O A;  3FHQ A;  2X05 A;  3WF4 A;  3BGA A;  2BGO A;  2WUH A;  3EYP A;  3NNG A;  2VOT A;  4MO3 M;  3C7F A;  2QQK A;  4XUO A;  4QAW A;  3DYP A;  2YG0 A;  5CYY A;  3WNP A;  3HNY M;  3I2F A;  1W9T A;  5DPN A;  4MOA A;  1US3 A;  3PUH A;  2V5D A;  1RYY A;  2J1U A;  1F4A A;  3I3E A;  4KWU A;  2J22 A;  4XUR A;  4YPJ A;  3DEC A;  1KGY A;  4CUA A;  1JYV A;  2KD7 A;  2BZD A;  2VME A;  2QQJ A;  1JI6 A;  3NRU A;  3THC A;  2VZO A;  4QX1 A;  1O59 A;  5EIY B;  4E8D A;  5B4N A;  3A21 A;  5JXI A;  3K4A A;  4CU8 A;  3ACI A;  4XUN A;  4UAP A;  1DLC A;  2W91 A;  4MGS A;  2YFU A;  2E33 A;  3SKV A;  3C8X A;  4A42 A;  3HOB A;  4LPL A;  3MV0 1;  3OGV A;  3WF1 A;  2WN2 A;  3WF0 A;  1DYO A;  1GOF A;  3WF2 A;  4JHZ A;  1CZS A;  2RVA A;  3I3B A;  3CQO A;  4XUT A;  4ET7 A;  5LCW L;  2VZQ A;  3LEI A;  5IYY A;  3AC0 A;  3OGR A;  4OMD A;  4XUP A;  4BK5 A;  1JHJ A;  3CIH A;  2ORX A;  2VZ3 A;  3D3A A;  1UY4 A;  3UET A;  4OYU A;  4W4Z A;  1ULP A;  1NAE A;  2WO3 A;  1SHW B;  4BXS V; 
#chains in the Genus database with same CATH topology
 4CDW A;  3W20 A;  2XJR A;  5LBF A;  1MEC 1;  3FL7 A;  3NWK A;  4XE9 A;  1NQJ A;  4PI2 A;  3EO6 A;  2Z4F A;  4Q0P A;  1GZW B;  2ZAB A;  4DIQ A;  4D6R A;  5JSP A;  1YIF A;  4X6R B;  4AW7 A;  4Q4X 3;  2VD7 A;  3VBR C;  2KXL A;  4CDX A;  4SBV A;  1IS6 A;  1CZV A;  1UY0 A;  2CGO A;  1YJL A;  4PLM A;  4YVW C;  3ZPO A;  2C1F A;  3Q8F A;  1C57 A;  4XFH A;  3VD4 A;  3N4M A;  3P1I A;  3SCH A;  4MVT A;  4BWO A;  2HWD 2;  3LEK A;  1IZ3 A;  4FFI A;  1X82 A;  1NZC A;  2VUL A;  4H2A A;  5FV3 A;  4EJR A;  1V00 A;  4UFI A;  1PGL 2;  1N1S A;  3WDY A;  3S5Q A;  1QJF A;  3ATG A;  3UT0 A;  4ASM B;  4NPM A;  5FQ0 B;  3THT A;  2P6H A;  2ZAH A;  4L97 A;  4BMB A;  1SLI A;  2BGC A;  4NAM A;  4G3Y C;  4CDU B;  4IND A;  1O5L A;  3ENR A;  2W52 A;  5SV8 A;  1I3H A;  4YNI A;  4XBL A;  5GLT A;  3VZL A;  4E2Q A;  2X53 S;  3ZN6 A;  4RN5 A;  2Y6G A;  1IS3 A;  4KGQ A;  5F6L B;  2D6L X;  4XJ8 A;  3AJY A;  1D4M 3;  3ITQ A;  1HB2 A;  4J1X A;  1D2S A;  3WQB A;  1CQ9 A;  1H30 A;  1VBE 3;  3AZY A;  4OZO A;  3KHB A;  2XJQ A;  3LZZ A;  1Q3E A;  2DVA A;  3H1M A;  5FAX A;  1R09 3;  3UYJ A;  2BDR A;  1W6P B;  2PTM A;  1AL2 1;  4FT8 A;  4OHV A;  2Y33 A;  5I0T A;  1V6I A;  2XG3 A;  2Q8O A;  1XSQ A;  1CX1 A;  2ZKL A;  2LUW A;  1RMU 1;  1OOP C;  1RVF 1;  1XND A;  2JDU A;  4K9S A;  4AED A;  5AC9 1;  2BWC A;  4EN9 B;  4IEQ A;  4Z2A A;  3ILF A;  5FZA A;  1LEN A;  1OD5 A;  1KDK A;  1SBD A;  2B8M A;  2R6Q A;  2WN3 A;  3WNM A;  5IVJ A;  3WR0 A;  5LA9 A;  2CWM A;  2YGM A;  1W6N A;  1OHF A;  1ULC A;  3I7D A;  5EYY A;  4QU2 A;  3UL2 A;  3VGI A;  5IAV A;  1C8N A;  2YV8 A;  3MIC A;  4YZ2 A;  1ZBA 3;  1EV1 3;  1JZ8 A;  2VNR A;  3IPV B;  4QX0 A;  5JOY A;  3N9L A;  4PLN A;  4LO7 A;  3C7G A;  3AYD A;  4LIT A;  3TN9 1;  3VZK A;  1OUS A;  1MS1 A;  1ND3 B;  1E5H A;  1W9S A;  3WQ1 A;  1Q43 A;  1UU5 A;  1LKN A;  4MX3 A;  4RFR B;  1B35 B;  3MF6 A;  3U1X A;  4Y24 A;  3ZFG A;  4J1W A;  3VKN A;  1RUC 1;  3KT4 A;  2JKX A;  2R04 3;  5JI7 A;  2DFC A;  4BQ5 A;  2B5H A;  3K3N A;  1J3R A;  1FOD 1;  3SH3 A;  4D69 A;  3KV4 A;  2WSU A;  5CEH A;  2ZXQ A;  3N3H A;  4R4X A;  2DF7 A;  2RV9 A;  4DQA A;  4WVV A;  3AYC A;  1WBL A;  4Q4X 2;  2Z5W A;  3AP6 A;  1V70 A;  1AR9 3;  2WZ8 A;  2CU5 A;  3IB3 A;  4IE5 A;  5BV6 A;  4P00 B;  4AED B;  4FBF A;  2K9Z A;  3LEM A;  4YZ4 A;  1Y9G A;  1FAT A;  5LBC A;  5CFC A;  4WM7 A;  1GQP A;  5JCT A;  1KS4 A;  2C26 A;  4IV3 B;  5FJK A;  2G1M A;  3PUQ A;  3HR9 A;  1OFN A;  4I0B A;  2WO2 A;  2RS3 2;  2J7M A;  5APA A;  4DEV A;  5K0U B;  5G04 L;  2C9A A;  2W9X A;  1RIN A;  4FOQ A;  1WCU A;  3D8C A;  1KDM A;  1XSR A;  2QQL A;  3IWZ A;  4KNC A;  1WZX A;  2QQU A;  2VQT A;  3RMX A;  2OQ6 A;  5JLV A;  1FOD 3;  3EJK A;  1NCQ A;  1RUI 2;  3THD A;  1VBD 2;  2Q0A A;  2R07 2;  3AMP A;  5FY0 A;  1YCI A;  4LO6 B;  3PTR B;  5FPL A;  1WGP A;  2J1T A;  3RYK A;  2ILM A;  2X5I A;  3LB9 A;  1PGS A;  1ZZ6 A;  4LMF A;  4HPK B;  4IL7 A;  4Q4Y 3;  3PU3 A;  1YQ2 A;  2XDV A;  3ZVX A;  2ZGL A;  5D2A A;  5BUV A;  3ZFE B;  1GYK A;  2GH2 A;  2P1B A;  2QDN A;  3VL8 A;  2ARX A;  2RHP A;  3N9P A;  3V0A A;  1VJ2 A;  4L11 A;  3EMR A;  5E16 A;  4B8E A;  1UWW A;  1ZZB A;  2OA2 A;  3KMH A;  1C5I A;  5L9R A;  3WHU A;  3AM2 A;  1W6M A;  1ACC A;  3JUU A;  1KFX L;  4V2W A;  4PDW C;  1VBA 2;  4GMP 1;  1TME 3;  4BH9 A;  2ZEX A;  4P9L A;  2VU9 A;  2VQU A;  3MUY 1;  3DKW A;  4ATF A;  1YFW A;  1W2N A;  1HX6 A;  1J84 A;  4FPY A;  3HT2 A;  2Y64 A;  4ES8 A;  1CR7 A;  2W3J A;  1GQG A;  3E1F 1;  3BU7 A;  3K75 B;  1XB9 A;  2JD9 A;  2KM2 A;  1COV 2;  2IXI A;  2V4V A;  3HD8 B;  2PXJ A;  1AR7 3;  1AR8 3;  1OVP A;  2EF6 A;  2SLI A;  3B9I A;  3RVH A;  4QXK A;  5T50 A;  5A3T A;  1V6L A;  4P9I A;  2DU0 A;  3RPQ A;  1RIR A;  4JDN A;  3LEG A;  4JKL A;  1UZV A;  5J98 B;  5FPV A;  2R0H A;  2HWC 2;  1H8V A;  2VCM A;  3BB6 A;  3HMY A;  3VL9 A;  1FMD 2;  1HW5 A;  1NG0 A;  4HLT A;  1EAH 2;  1W8U A;  3IDB B;  3T4V A;  1S0I A;  1VPH A;  2O1Q A;  3I3D A;  4CA9 A;  2W1U A;  4MGQ A;  1TEI A;  1MS9 A;  3ACL A;  1UU4 A;  1RXG A;  2VOX A;  4DXS A;  3MDP A;  1JN2 P;  1U12 A;  5FPA A;  5EPA A;  4C0B A;  1P8J A;  5E8A A;  1W6M B;  3H0O A;  1PVC 1;  2ZML A;  4XXP A;  4DEQ A;  3BPS A;  3BCW A;  3ZDS A;  4C91 A;  4E4D X;  3VV1 A;  1ASJ 1;  1ENX A;  2WA3 A;  4NRQ A;  4QD2 A;  1NLQ A;  4IES A;  1LOF A;  3GXU A;  2BV4 A;  1PM7 A;  4OMC A;  2BPA 2;  2VMC A;  2XVK A;  5DAX A;  2WZR 3;  4R9D A;  1ZBE 3;  3DPR B;  3HEI A;  2VCB A;  2Y0I A;  1TMF 3;  3VB9 A;  2V4A A;  4XAC A;  3O1U A;  3RZG A;  4IV1 B;  4LHN A;  5JR2 A;  2PQQ A;  1ZZC A;  2HWD 3;  4AYU A;  2VMF A;  3KQ4 B;  4Q4Y 2;  2AAC A;  4B29 A;  5FMO L;  5FP3 A;  3UGG A;  1EPW A;  3E97 A;  3BOW A;  3IPV A;  4XJU A;  4YGE A;  3O14 A;  4X8P A;  3O0W A;  4BIS A;  3GZU C;  3ACF A;  5IAX A;  3ON7 A;  2CTV A;  2IVJ A;  3U4X A;  1UPI A;  4AK3 A;  1WW4 A;  2WFF 2;  1A3K A;  4CVU A;  2W1W A;  2A3W A;  2J42 A;  4QXC A;  2CSG A;  1JZ3 A;  3R0R A;  2UWC A;  1O3R A;  1ZBA 2;  3AYE A;  1Q8Q A;  1X9T A;  2FDJ A;  4GWJ A;  1WMX A;  4HK8 A;  5JUV A;  5IVC A;  3ZXK A;  1W9W A;  3PUS A;  1ZBE 1;  3OBT A;  4QX2 A;  4CEW A;  3VLB B;  4LT5 A;  2VJX A;  1GU3 A;  2F4L A;  1CES A;  4LJH A;  3DYM A;  3BTA A;  1D4M 1;  4TXW A;  1LUL A;  4ZU5 A;  4XCB A;  4XQW A;  3KS7 A;  1OMI A;  5AFB A;  4RR3 A;  3SIS A;  4K8R B;  3ABZ A;  5CIR A;  4E4S A;  5CKQ A;  4L2N A;  4E2S A;  1ASJ 2;  1FYU A;  1HRI 3;  4TN7 A;  4N43 C;  4LXL A;  4S2H A;  1LEM A;  5GM0 A;  2ZGK A;  4U36 A;  4A7Y A;  4ATE A;  4BQ3 A;  2UYA A;  2V09 A;  1N1T A;  1SLB A;  2CAU A;  5LAT A;  3POS A;  4NWV A;  5IK4 A;  1AYM 2;  1ENR A;  2ZGU A;  1S0D A;  4O9G A;  2EID A;  3WUD A;  1C8M 3;  2RMU 3;  4AI2 A;  3J9S A;  2H0V A;  1W6N B;  1BXH A;  5EFU A;  2Y34 A;  3BVC A;  4RSU A;  4ES9 A;  1O5U A;  3BN6 A;  1SCS A;  3KVB A;  2DVB A;  5JOX A;  2HJI A;  3BOP A;  3ZFF B;  2E9Q A;  4BE3 A;  1OUR A;  1UPS A;  3QH6 A;  3KV5 A;  5FLI A;  3VHR A;  5FY4 A;  4C1W A;  2RS1 3;  3B02 A;  5BY5 A;  2RR1 3;  1HRI 1;  4TLG A;  2QCS B;  2VQ0 A;  3OBR A;  5FR3 A;  1TZO A;  2ENR A;  4MXW A;  2G4I A;  3WNO A;  5BNQ A;  5FO8 B;  2Y6K A;  3LFM A;  3NL1 A;  1BCX A;  2RS5 3;  5I0U A;  1XNC A;  2VBB A;  3CZJ A;  5GLV A;  1AF9 A;  3CL1 A;  1X7N A;  3SH4 A;  4XJA A;  1GWM A;  5FZE A;  3AXE A;  5A32 A;  2XML A;  5JOZ A;  4AEM A;  4E4Z A;  2C9K A;  2WNV A;  2VVD A;  3WG2 A;  2BU9 A;  3IMN A;  5FZF A;  2OYZ A;  1NCR B;  5FOJ B;  2W94 A;  1CWP A;  1H9W A;  2BER A;  3E5X A;  4C0H A;  3C7H A;  5DAV A;  5IVF A;  1JUI A;  3PDQ A;  3PUA A;  2JEM A;  2PHT A;  4CDU A;  3OOX A;  5A3N A;  2VUD A;  2VO5 A;  2R1B A;  4AI0 A;  5KHI A;  4LIV A;  3ZSJ A;  1KXG A;  4AQT A;  1NZI A;  3LDB A;  4LBJ A;  1ULF A;  4PIZ A;  1SG3 A;  3ECQ A;  4DS0 A;  3LDR A;  5JWP A;  2DBN A;  4CXX A;  2DTW A;  2E6V A;  2YZ4 A;  5EJZ B;  4K6B A;  4Y22 A;  1RHI 3;  5GLW A;  1HIX A;  3IMM A;  3I2H A;  4OHZ A;  3WW1 A;  4D3W A;  5A3L A;  3PUR A;  3S57 A;  5E1R A;  2G9Z A;  1A78 A;  3NAP C;  2ZZQ A;  1V6J A;  1R64 A;  1W39 A;  1VMJ A;  1WW7 A;  3AP9 A;  2WT1 A;  4KGG A;  2GNB A;  1GNZ A;  2AEN A;  4YGB A;  2VZV A;  4UWD A;  2DCZ A;  2WYS A;  1FAY A;  3HQR A;  3IDA A;  3RJ2 X;  4Q4Y 1;  2PHW A;  1CIW A;  1JYC A;  3POF A;  2P3K A;  4FAH A;  1ONA A;  1RUF 3;  1VAL A;  1RUC 2;  4K7J A;  4LBL A;  3T08 A;  4JGZ B;  3VDD B;  2HWB 2;  1BBT 1;  2FBE A;  4CXY A;  1RUD 1;  4PHZ A;  4QGL A;  3HT1 A;  2VUA A;  4GAL A;  3ORJ A;  3WDT A;  1NA1 C;  3I2J A;  2WRA A;  4ZPI A;  1OBN A;  4OHX A;  3NQH A;  2NN8 A;  3H7Y A;  3SCF A;  4AG4 A;  4DRR A;  4IV3 C;  2ZZJ A;  2P3I A;  1VBD 3;  2NP0 A;  2ID4 A;  1AYN 1;  3ACG A;  3ZKY A;  4CP9 A;  2RM2 3;  5A70 A;  3FMG A;  3O1P A;  1SDW A;  1W90 A;  2VH9 A;  3VBH C;  1B35 A;  4COY A;  3H8U A;  1W2T A;  1PVC 2;  4OUS A;  2W1Q A;  3AKS A;  4GD4 A;  4PIY A;  1QJU 1;  4QX7 A;  5KHH A;  1RUJ 3;  4XFA A;  2ZGP A;  3KZ4 C;  4OVE A;  1AR8 1;  4FPF A;  5C5T A;  4PDW B;  1HN1 A;  1W9Y A;  3U78 A;  2E7Q A;  5LEJ A;  1KIT A;  4Y4R A;  3HN3 A;  3RI9 A;  5LEK A;  1VAK A;  4L92 A;  2JDP A;  5F3I A;  2GSY A;  1EV1 2;  1U5Y A;  1LHV A;  1SBE A;  4CP1 A;  2VZT A;  5FZD A;  4QPG B;  1VAM A;  3FHQ A;  2EIG A;  3BU0 A;  1FPN 1;  3EYP A;  3NNG A;  1BQP A;  4JDO A;  3FWE A;  3ELN A;  2XH6 A;  4MO3 M;  4QMA A;  1C1F A;  5DG1 A;  1VB4 A;  3ZYB A;  5JPM B;  4QHO A;  4IW3 A;  3P3P A;  4BHP A;  1PGL 1;  4S2G A;  2P3J A;  4Y3O A;  4AR2 A;  1W6P A;  5C33 A;  1QJX 2;  4EWD A;  4NOT A;  4AFD A;  1NQD A;  3POB A;  3ZYR A;  2HWF 1;  4QQO A;  2BFU S;  3AFK A;  5ACA 3;  2HWC 3;  1US3 A;  1F5J A;  4GWM A;  1F4A A;  1UU6 A;  2W2I A;  4KWU A;  1UOB A;  4O65 A;  3AFG A;  1LR5 A;  1S55 A;  1JOB A;  5K8S A;  3C2U A;  4XUR A;  2GC2 A;  4Y22 B;  2DUP A;  4XW3 A;  1WMD A;  2VMH A;  2XJV A;  4QKB A;  1PGW 1;  2HYK A;  1K5J A;  2XVG A;  3D82 A;  3THC A;  4UF0 B;  4CCL A;  2DWR A;  3D6E A;  2JX9 A;  2K0G A;  1DQ5 A;  4WM8 C;  1YFX A;  2HWD 1;  4E8D A;  3N36 A;  5B4N A;  3MI8 A;  3WT3 A;  4PF5 A;  3FLT A;  4XFF A;  4AE2 A;  5J48 A;  3LSD A;  4NIH A;  1K5M C;  3INA A;  4UAP A;  1UOJ A;  3TEX A;  2YU2 A;  1V9U 2;  3NV1 A;  2LRP A;  1VRB A;  5C8C C;  3WLU A;  5FYC A;  4P9W A;  1UZY A;  2GAL A;  2RG4 A;  3M3C A;  5EV7 A;  5T5P A;  5FLJ A;  4QQP A;  4HKO A;  2VMG A;  1SFN A;  5D21 A;  4YW3 A;  5FY8 A;  4GXL A;  1GOF A;  2GN7 A;  2AGS A;  4QWN A;  3VBF A;  2BYV E;  5L19 A;  1DGW A;  1CZS A;  1OLR A;  3L9J T;  3OF1 A;  2Y0O A;  3OUH A;  4UXA A;  3FUQ A;  5F5I A;  4YM3 A;  1ULE A;  4EWE A;  1AJO A;  2VZQ A;  3LEI A;  1TME 1;  5FUN A;  3CNA A;  5DZF A;  4YWA A;  5HI0 A;  2WNV C;  1RUF 1;  2XLA A;  4QHZ A;  3OGR A;  4OMD A;  1N1Y A;  4XUP A;  1JHN A;  1JHJ A;  4CXW A;  1G86 A;  3FUO A;  3WG1 A;  1OOP B;  1XXN A;  2BUK A;  5FZ1 A;  3D3A A;  1POV 1;  2HEY F;  1UY4 A;  3FE5 A;  1YHF A;  3VBO A;  4W4Z A;  4BIO A;  4DXZ A;  4FTS A;  3VBO C;  3MLJ A;  4AGV A;  4MV2 A;  3W58 A;  3PVB B;  1AR7 1;  4RA0 A;  3QLQ A;  5L7O C;  4CDW B;  5FZG A;  4GZ9 A;  4MGY E;  3B93 A;  3S5A A;  4K1Y A;  3VD3 A;  4AQS A;  2Y6F A;  4R9A A;  1TQ5 A;  4FP3 A;  5CFD C;  1AX2 A;  3GZE A;  4HSL A;  5D8A B;  4B4Q A;  4ZZ5 A;  5LW9 A;  1NE6 A;  4KBZ A;  2V72 A;  1XJA A;  3MW2 A;  5IVY A;  4PQQ A;  3WUC A;  4XTM A;  3GGL A;  2MNG A;  1H2N A;  1LOD A;  2YFZ A;  3ES1 A;  1OC1 A;  4FVV A;  4OLL A;  4RR3 B;  4YAR A;  1NT0 A;  2WR9 A;  4OUL A;  4BZ4 A;  4P08 A;  2B9U A;  1RUG 2;  3HBK A;  4Y5T A;  3LPG A;  4W6W A;  5GZC A;  3ETQ A;  4EV0 A;  5GJ6 A;  5FOB B;  4P5Y A;  1DZQ A;  4DIN B;  4GH4 B;  1QKQ A;  1QMJ A;  1UXZ A;  2JDY A;  1AYM 3;  3ZYJ B;  1UO9 A;  5DDJ 2;  5CKN A;  5LK7 B;  4DRV A;  3KQR A;  2WS9 3;  2ZGM A;  3MLK A;  1NLS A;  3V64 A;  5KBF A;  2I45 A;  1U5I A;  5FZH A;  2ORZ A;  4A6O A;  3BYW A;  2GMM A;  1DZR A;  3KT7 A;  1X8M A;  4A7Z A;  1LGN A;  2XQR A;  3VN4 A;  5DUV A;  4RGA A;  1WKY A;  3AXD A;  5JXG A;  3Q8C A;  2D6N A;  4CDX C;  3OSD A;  3WP6 A;  2MEV 1;  1X9P A;  1VBA 1;  4AXO A;  2HWF 2;  4NIG A;  1QJX 1;  1O8S A;  4AFC A;  2NYY A;  1CX4 A;  1T6B X;  2GC1 A;  4FQ4 A;  1EP0 A;  2GNT A;  2ZEZ A;  4NAO A;  2YXS A;  2ZHN A;  3J8F 3;  1IPK A;  3VBR A;  2WO7 A;  4Q4W 1;  3HQX A;  1MQT B;  4JC1 A;  4O61 A;  4QPG A;  4JDM A;  5GZD A;  1RUI 1;  2GP5 A;  3Q8B A;  2ZPX A;  4R4Z A;  4OQ8 A;  3ZXA C;  4HK9 A;  4UFK A;  3VZN A;  4AVA A;  5BNN A;  5CG9 A;  3BPZ A;  4UT5 A;  3KF5 A;  4H7L A;  4MGK E;  1DFQ A;  2QQV A;  3KT1 A;  1OA3 A;  4M3C B;  1FXZ A;  5FYM A;  4WM8 B;  2YPJ A;  5F7U A;  1HB4 A;  1S0G A;  4Y4Y A;  5CFD B;  4MGT A;  1RUG 3;  1J83 A;  4ZU4 A;  1GV9 A;  4RS5 C;  2MEV 3;  3I54 A;  4XZP A;  2VZP A;  3AMM A;  3O12 A;  4JQR A;  3SEP A;  5CAZ A;  3IAP A;  3WQ7 A;  3LPF A;  3KB5 A;  1ZBE 2;  3PVE A;  4DFS A;  5A7W A;  3U14 A;  3VDC A;  1EYB A;  3ZM8 A;  3FLR A;  5JI9 A;  5IVB A;  4GB3 3;  3LGR A;  4DUW A;  2K2S A;  4HL0 A;  1W99 A;  3OYW A;  3WDU A;  2A6W A;  2JD4 A;  4QDQ A;  1O4Y A;  1Y3T A;  3WW2 A;  4AAX A;  5C7G A;  2R1D A;  3RZL A;  1GOG A;  4YRD A;  1XOY A;  4A41 A;  1QOT A;  4GKX A;  3AL6 A;  4QB2 A;  2OX0 A;  5C4W A;  4IE6 A;  1US2 A;  3C3V A;  4ISR A;  4WVM B;  2B46 X;  4UBG A;  1O4T A;  4SLI A;  1G8W A;  3J8F 2;  2EXJ A;  4XIO A;  1GUI A;  3OPW A;  2VVF A;  4IGQ A;  3ZSM A;  1RUE 1;  3GM8 A;  3HWJ A;  3WY6 A;  1OPM A;  5LA2 A;  1APN A;  3CMG A;  1UX7 A;  1VBE 1;  4MGZ E;  1W9F A;  3IBM A;  4QX5 A;  2CY6 A;  1OQD A;  4GB3 1;  5IUQ A;  5LA1 A;  4FPG A;  2R16 A;  3SH5 A;  4MHU A;  4XMA A;  4YZ3 A;  2A75 A;  1DGW X;  2DTY A;  4XF3 A;  4XJZ A;  3GF6 A;  5LBB A;  4ARY A;  4F8A A;  2BQP A;  1JOJ A;  4WZF A;  4M0N A;  4QDR A;  3IKW A;  5FZO A;  4D6S A;  3MUZ 1;  2WWJ A;  4CU7 A;  3VBS A;  2WO1 A;  3ALQ A;  4NMI A;  4PCR A;  2VMD A;  1S0C A;  3VKO A;  4UFH A;  5IFT A;  1OKO A;  4L0P A;  4FFG A;  4KWK A;  4QPW A;  3PHM A;  1SPP B;  5JMC A;  4AL9 A;  4AZZ A;  2VUC A;  2C0Z A;  4FPL A;  2ET7 A;  4HON A;  4A2U A;  3LKJ A;  1ND3 C;  2LAL A;  4N43 A;  2ZKN A;  5BNO A;  3CU7 A;  3RWK X;  2GND A;  3OBA A;  5A1F A;  3BTZ A;  4Q1P A;  1F5F A;  3PLQ A;  3Q8E A;  3RYP A;  4XDQ A;  3IM0 A;  5CG8 A;  2RE9 A;  1ZA4 A;  2ZBJ A;  3I2K A;  4ZS2 A;  1GR3 A;  1H2M A;  2JG9 B;  3ZFF A;  5LA0 A;  3R6S A;  3W5M A;  5IJR A;  1F35 A;  1MZE A;  1NCQ C;  1VBA 3;  4YLZ A;  1V6N A;  4XTP A;  1MEC 3;  1DBN A;  4UYB A;  5DN2 A;  2EVX A;  2DCJ A;  4P9Y A;  3WCS A;  2DCY A;  4CZS A;  2ZGR A;  2ET1 A;  3JBG 2;  3AZW A;  3GCX A;  4NPL A;  1NE4 A;  4D6Q A;  3VBH A;  2UWB A;  2XQX A;  1DP0 A;  1DCS A;  4GH4 C;  2BEO A;  1JZ6 A;  3POE A;  2DCT A;  3WQ0 A;  4GB3 2;  4L99 A;  1L3J A;  1OLM A;  3TB0 A;  4Y5S A;  2Q5T A;  3AP4 A;  1QXP A;  2EXK A;  3EB7 A;  1J3P A;  1UD1 A;  4IEZ A;  4BPZ A;  3H8X A;  2YU1 A;  4XDO A;  1CD3 G;  3F95 A;  2E63 A;  2FD8 A;  4MHR A;  4BM8 A;  4CEY A;  4M3C A;  1PK6 B;  2V5Y A;  4MH0 E;  3KHC A;  3UNP A;  5ISL A;  3VBF C;  2RS5 1;  2ARC A;  3WZ1 A;  1URX A;  3I97 A;  3U10 A;  4Q29 A;  4U2A A;  4I0W B;  5C3S A;  4CP9 B;  2YDE A;  1J58 A;  3HIF A;  3PNA A;  1W05 A;  4XZU G;  5IK5 A;  3M3I A;  4GUL A;  1MQT C;  3GHM A;  4HBN A;  4HVO A;  3UKN A;  1VBC 3;  4CDU C;  4CEW B;  2XWJ B;  1J1L A;  1PO1 2;  3H42 B;  2JIG A;  2R32 A;  1UKG A;  3GCW A;  3POW A;  4I0A A;  5FWE A;  3W9A A;  3MIH A;  4A6S A;  5AFE A;  1R09 2;  2JDM A;  2VNG A;  1QHD A;  1R09 1;  3S0M A;  2JKB A;  4LOT A;  2QNK A;  3PIJ A;  5FPU A;  3ZPY A;  4HOO A;  2PLV 3;  2R06 1;  4LBN A;  5FYI A;  4PF1 A;  2ZA9 A;  2OII A;  3FZ3 A;  1HRV 3;  2IXC A;  1YI7 A;  3CJX A;  4OI1 A;  2WZR 1;  1SLT A;  1X8E A;  2JDZ A;  3RSJ A;  5KXB A;  4W50 A;  2A6X A;  1IHM A;  1K42 A;  5FY5 A;  2IXH A;  2NM1 A;  5L9B A;  3VHP A;  3I3Q A;  2CHH A;  2JG8 C;  2RJ2 A;  3M1H A;  4AFM A;  1WA4 A;  4IV1 A;  3AP5 A;  1QGL A;  3MO4 A;  3BAL A;  1JS9 A;  1SPP A;  2D3S A;  3NV3 A;  4TWT A;  5C3Q A;  1SFY A;  1PGW 2;  4UI9 L;  1DU3 D;  1ALY A;  4MGI E;  4QQ2 A;  5AVA A;  1CGP A;  4AGR A;  2VAU A;  1BHG A;  1RUD 3;  1W0P A;  5FYY A;  2Q30 A;  1WCK A;  3T30 A;  4DB5 A;  5L9V A;  4A7K A;  2QZ2 A;  3OEA A;  4EWA A;  2D7F A;  5C8W A;  1DQ2 A;  4OI0 A;  3A23 A;  4LA3 A;  4R8H A;  5ABJ B;  3QH7 A;  3NST A;  1AYN 3;  3ZXF A;  3VZM A;  4AEK A;  3III A;  4E4H A;  3AZZ A;  1LEC A;  1OKQ A;  1HQN A;  2Y6H A;  3AKQ A;  2QQP A;  4UW4 A;  5A33 A;  1D4V B;  5C70 A;  1PO2 2;  3GYD A;  4BQ1 A;  1RL3 A;  1UZW A;  2PHL A;  3N7M A;  3N9N A;  1BBT 3;  5CB7 A;  1RUJ 1;  2YY1 A;  4LBQ D;  1AL0 G;  4AAP A;  3GZA A;  1ULO A;  2RS3 3;  1ND2 B;  1ND2 A;  2X29 A;  4QHB A;  4MSV A;  2Q1F A;  2ZX1 A;  1HXS 1;  3H8O A;  4H14 A;  1YQ8 A;  1S0E A;  3H3L A;  3MGU A;  1FX5 A;  4LE4 A;  5EWS A;  1UAI A;  3IT8 A;  1YFY A;  4AI1 A;  4Q8K A;  1JU4 A;  5ACA 2;  1K3I A;  4NN0 A;  4XF0 A;  4BB3 A;  4COU A;  4QPG C;  5J96 B;  5L7O A;  2IFW A;  2ZGN A;  4FFH A;  4UFM A;  1TG7 A;  2FCV A;  3OEB A;  4LK7 A;  4S2D A;  2ZGQ A;  1D2Q A;  3MIF A;  4YW2 A;  1UYZ A;  3ZIX A;  1PZ8 A;  2PAK A;  2ZAC A;  2RS1 1;  4XMI A;  5CZK A;  1UZZ A;  2HWE 3;  1K5M B;  1UOF A;  3K48 A;  2UUR A;  2WNU B;  2YC0 A;  4QPY A;  1BLZ A;  1UW8 A;  5FUI A;  2MHF A;  5FMD A;  3WNN A;  4BQX A;  2JIJ A;  2WFF 1;  4OUE A;  2FCT A;  3Q8A A;  5FIX A;  2D43 A;  2JE7 A;  4QPI C;  1LOF C;  3VD7 A;  1IQD C;  2GDF A;  5FTT C;  3U37 A;  2ARA A;  2DVG A;  2J1A A;  3UES A;  4N7U A;  5JIU A;  5CBL A;  3VHN A;  4QXB A;  2HEW F;  5F5C A;  5KR7 A;  1Y9Q A;  4IGO A;  4N90 A;  3M8L A;  5FFO C;  4QM9 A;  1IKQ A;  3F2Z A;  1PX3 A;  1W6Q B;  3I8T A;  1OLM E;  5BXX A;  4RQP B;  5A7S A;  3V65 A;  5A1L A;  3VDD C;  1SLL A;  5FYH A;  1MEC 2;  3FN9 A;  3USU A;  4CCM A;  2ZTN A;  2FDK A;  1PNG A;  4RHV 1;  5FPZ A;  5FYZ A;  5DZG A;  5JZG A;  3RFR A;  1AR9 2;  3TOJ A;  1O7F A;  4N7I A;  2J1R A;  3PL0 A;  1R08 3;  3NVC A;  3TN9 3;  3AMQ A;  1RHI 2;  5C3O A;  1PIV 2;  2A6V A;  4LHK A;  5F8P A;  3WDW A;  4K20 A;  4QGN A;  3KCX A;  1PIV 1;  4YM2 A;  2F4P A;  1OF4 A;  3SHR A;  1IPS A;  2VW0 A;  3QCW A;  2OZJ A;  1SQ4 A;  3B5L B;  2RDS A;  4G4F A;  3SC7 X;  4FPH A;  2JXA A;  3E5U A;  4IE0 A;  1NX9 A;  1ZRR A;  3VBU B;  4GQ7 A;  1UYX A;  3RZZ A;  2OUJ A;  1MS4 A;  2C5D A;  1FOD 2;  5JPN B;  4YG3 A;  1Y4W A;  1ND3 A;  4BA6 A;  1PK6 C;  5A3W A;  1KJR A;  4QX8 A;  3KGL A;  1O3Q A;  1SLC A;  3JD7 1;  1N47 A;  1S0F A;  4F3J A;  3VDB A;  1AVB A;  1R1A 3;  3QOP A;  1SLA A;  4QX3 A;  3NAP A;  1TVG A;  2E26 A;  2ZHL A;  3SCG A;  3EBR A;  3PME A;  1U5X A;  1JYI A;  3ZYP A;  1W04 A;  2D98 A;  5L7O B;  1HN0 A;  4OI4 A;  5I0R A;  1G7Y A;  1X33 A;  1I5P A;  5GZG A;  4Z92 B;  1T6G C;  2BVB A;  5HCA A;  3OG2 A;  1EUT A;  1OH4 A;  3T2O A;  4N53 B;  5FY9 A;  4AQ2 A;  4AHY A;  4JGZ C;  2WUH A;  2BOJ A;  4V1P A;  4YGC A;  1V0A A;  3LA7 A;  1V6M A;  2HWE 2;  4A3X A;  5FYS A;  3ZMN A;  2P5B A;  2HWF 3;  1H0B A;  4XYX A;  4GKY A;  3I59 A;  1OSG A;  4N9I A;  2X5I C;  1GAN A;  3M3O A;  5JSO A;  1JUH A;  1HXS 2;  4OHY A;  5DDJ 1;  3DYP A;  2BTV C;  1DLL A;  4P9X A;  2YG0 A;  3O5S A;  1GWK A;  4FCA A;  4Y1Z A;  2D3P A;  5A7N A;  3OPT A;  4DNY A;  1W9T A;  4GA9 A;  2ZGS A;  3GAL A;  1RC6 A;  4CEY C;  1G9B A;  4M3C E;  4MOA A;  1W6O B;  2V5D A;  3I3E A;  4CSW A;  3DL3 A;  2FDI A;  1HV1 A;  1GKB A;  3JZV A;  2NLR A;  4CUA A;  4YZ5 A;  5IT6 A;  1JYV A;  2HH9 A;  1OVS A;  1O4Z A;  1ZNP A;  4QM8 A;  4YVS C;  4CP2 A;  4EN0 A;  3V0A B;  5A80 A;  4EQV A;  2VZO A;  4JRA A;  4UF0 A;  1O59 A;  4EYU A;  4AI8 A;  1RUO A;  1YFU A;  5EHD A;  5SV5 A;  2XUM A;  3ZKU A;  5DAQ A;  5JXI A;  3BKZ A;  3K4A A;  1G9F A;  3ACI A;  4CU8 A;  5FMC A;  4XUN A;  4IXL A;  4FPJ A;  4AVB A;  2D97 A;  5FZ9 A;  3ZR6 A;  2D5H A;  1W2A X;  3TBD A;  3WIN E;  1LB2 A;  2Z79 A;  3MFA A;  1DLC A;  4MGS A;  4XFB A;  3AMH A;  4Z82 A;  2YFU A;  3ZOI A;  3ZXG A;  3OTF A;  4DMI A;  3DEM A;  1LOG A;  4M3C F;  5K0U C;  4A42 A;  1SBF A;  3IDC B;  3HOB A;  4LPL A;  5J09 A;  3OGV A;  1HKD A;  3NNL A;  1DGR N;  1CAX B;  1LJ7 A;  1Z7S 1;  4NO4 A;  2RJK A;  4V2V A;  3WP5 A;  3WF0 A;  1S2B A;  1AXZ A;  1E57 A;  3ILR A;  1DQ6 A;  3LIH A;  3ZDV A;  4Y20 B;  1H2L A;  5FO9 B;  2SBA A;  4PQ9 A;  4AHW A;  1G9D A;  5E6H A;  3JB8 A;  3B94 A;  1Y7B A;  1ZVF A;  1A6C A;  2AYH A;  2Y38 A;  2D5F A;  3MW3 A;  5IYY A;  5FXV A;  2OZ6 A;  4XQD A;  2H6C A;  1C3H A;  1TNF A;  1LOE A;  4YVS B;  4Y1V A;  4COZ A;  4BU2 A;  3ME2 A;  3H50 A;  1ZM1 A;  5LAS A;  2VZ3 A;  5DZE A;  3SIT A;  5A7W B;  1DG6 A;  5JZG C;  1B35 C;  3USS A;  5C9A B;  1XYO A;  2OW4 A;  2XJT A;  2Q1Z B;  1H8T B;  1SHW B;  4HN1 A;  5C8C B;  4OHW A;  4GWN A;  2W68 A;  4CEY B;  4NHX A;  2O0O A;  2DCK A;  1QJY 1;  4ZHN A;  1XNK A;  4Y1U A;  2XUE A;  3APB A;  3RWN A;  2I2S A;  3WW3 A;  1Z0H A;  4YW5 A;  1JH5 A;  5F9T A;  2D6M A;  3ROU A;  2EAA A;  1EUU A;  2A6Y A;  3MHZ A;  4HVR A;  3JBG 1;  4CCE A;  3WVJ A;  1GOH A;  4TTG A;  1YO8 A;  1B09 A;  3NJZ A;  2XB6 C;  2VCA A;  4ZXK A;  3FFQ A;  1IG0 A;  4IGP A;  4YYO A;  1IQA A;  4NII A;  4BQ4 A;  5JIA A;  4WM7 C;  2FQP A;  1IOA A;  4LEJ A;  4Y1Y A;  4DOU A;  5KXE A;  1D0H A;  3CJI B;  4ZXE A;  2ADE A;  4AVS A;  4QB6 A;  4ZY9 A;  5JMO A;  4YVW A;  2QE3 A;  3TAY A;  2VTF A;  4FO9 A;  3BTY A;  1FMD 1;  5T5J A;  1RMU 2;  5H9Q A;  3LWC A;  2W46 A;  1RUC 3;  2ZGO A;  5T54 A;  4HVQ A;  1BMV 1;  3A7Q A;  3OGG A;  4TLF A;  3TEZ A;  2D3R A;  1XC6 A;  2GAU A;  2FMD A;  4XF1 A;  1O3T A;  1LCL A;  2CV6 A;  2Y26 A;  3SEE A;  3VKF C;  2VBP A;  3T0D A;  1MVQ A;  2D40 A;  2DUQ A;  2YBP A;  5FP9 A;  4Q26 A;  3W59 A;  1S4C A;  1S2K A;  1LOA A;  4IV1 C;  2WAA A;  2QDR A;  3MW4 A;  2OXB A;  5FPB A;  1PO2 1;  3THP A;  5DDJ 3;  4AOC A;  3EQE A;  3TEW A;  4HKW A;  2UY9 A;  4C1X A;  3LD8 A;  2UY8 A;  1OQE A;  1N3P A;  3FC0 A;  3FJS A;  5FZB A;  4I30 A;  4GH4 A;  4WBB A;  4YSF A;  2CNA A;  5JAX A;  5KXC A;  3FLP A;  2VG9 A;  4B7E A;  2R04 1;  3EHK A;  4CTE A;  3W21 A;  4XF4 A;  5FZO B;  1MS3 A;  3VUO A;  1C8M 1;  2JWP A;  2XKO A;  4GWI A;  1GIC A;  4QDS A;  5A6Q A;  1SFP A;  4D0Q A;  3WDV A;  4EZ4 A;  1GQH A;  4HZF A;  5FWJ A;  3OY8 A;  4I01 A;  2WNU A;  1MR5 A;  2BOI A;  2V73 A;  3D4K A;  4BJ0 A;  3T2T A;  1C4R A;  1XNA A;  4JKK A;  3POY A;  1N3O A;  1RUH 3;  1AR7 2;  1MAC A;  2LW8 A;  5FMB A;  2YBK A;  4XFG A;  1GZW A;  4P02 B;  1RJ8 A;  3DV8 A;  4Q5O A;  5H9P A;  4LK6 A;  2X8K A;  3BTX A;  4Y5Z 0;  3BIW E;  1RUD 2;  2ES3 A;  2J1V A;  3VBO B;  4YFZ A;  1FMD 3;  2RR1 2;  2PHF A;  3I59 B;  4YG0 A;  2Y60 A;  4GMP 0;  1GNY A;  4W6X A;  2JB4 A;  4KMQ A;  3WDX A;  3UV9 A;  3AK0 A;  1Z7S 2;  3OPZ A;  2B45 X;  5A6X A;  1NXD 1;  1DQ0 A;  4RHV 2;  5FZL A;  3PU8 A;  3QAC A;  1REE A;  1AR6 3;  3RYR A;  2ZAA A;  3AP7 A;  2PMW B;  3DYO A;  2WAO A;  4BIF A;  3T09 A;  2RMU 2;  3JCI A;  3TN9 2;  3N7K A;  1R1A 1;  5BNN C;  1VBB 1;  4WZC A;  3K2O A;  3AB0 A;  1XPW A;  3C7E A;  4ERO A;  1ZYB A;  1LNS A;  3LF7 A;  4ZON A;  1YQC A;  3RI8 A;  5JDB A;  2Y8K A;  1H8T C;  2W08 A;  2BBA A;  3LE0 A;  1OT5 A;  2R06 2;  4P14 A;  5I8S A;  2JG8 A;  5CFD A;  4LO4 B;  3UK9 A;  2G9G A;  2R30 A;  2WLP A;  2WNO A;  1G9A A;  3ZFE C;  1Y43 B;  1W8T A;  2F17 A;  4QGM A;  1CIY A;  5FK7 A;  3T0B A;  4IE4 A;  5LY1 A;  2YMZ A;  5FZ7 A;  1C1L A;  3TNP B;  1VRH 1;  3C7O A;  2RS5 2;  5ANN A;  1AXY A;  1SDD B;  4LBO A;  1IG3 A;  1CAV A;  5FBZ A;  3FX3 A;  4IUG A;  5B2G B;  3AKP A;  2OPK A;  5M0T A;  4LO8 A;  5KWR A;  3UGF A;  3ZXE A;  1A34 A;  1AZD A;  2WFF 3;  4AFA A;  2VEC A;  3PVO A;  3POG A;  4EE2 A;  5LB6 A;  5IVV A;  1JZ7 A;  5BNP A;  2HYX A;  3KVA A;  2AH2 A;  5T52 A;  2EIE A;  1QOS A;  4HMZ A;  1CAW A;  5FK8 A;  4CPB D;  5IW0 A;  1I1E A;  4HAN A;  1J59 A;  1LTE A;  2PN5 A;  4IV3 A;  2XJS A;  2BGP A;  5GLZ A;  4FOW A;  3VKL A;  5B4X A;  3MBW A;  4GAZ A;  5BNP C;  2RDN A;  3X29 B;  2BRT A;  4JGY B;  2JB8 A;  2BJS A;  3V0B A;  1STM A;  4M01 A;  2WFP A;  1LES A;  5C8C A;  5A3U A;  2MPF A;  3I2O A;  3DPR A;  2O14 A;  1O91 A;  3LIG A;  4QKD A;  4S2F A;  3ASI A;  1W28 A;  3H1Y A;  4I3G A;  3CO2 A;  5KHK A;  1UIJ A;  2WDB A;  1RUJ 2;  4Q4V 3;  3MF9 A;  2WQZ C;  3GBG A;  3B7M A;  3O1O A;  4NPR A;  1ZRF A;  3U75 A;  1RVF 3;  1GNH A;  1W0O A;  3V0B B;  4AWD A;  5FRE A;  2RDQ A;  2PHR A;  2B7Y A;  5L73 A;  3OUJ A;  5BYN A;  1LGB A;  2WA4 A;  1ULG A;  1FPN 2;  1UY1 A;  2NQY A;  5A6Z A;  3S7I A;  3AVR A;  1H8T A;  1W8Z A;  2EIC A;  2OT7 A;  3HVD A;  5C9A A;  2VL4 A;  3PIG A;  5FXZ A;  5BNP B;  1H1A A;  2E53 A;  1UKR A;  2PFW A;  2XBO 2;  3RQ0 A;  5CAD A;  1QNW A;  3AKR A;  1QNY A;  1MZF A;  2IWG B;  4IQP A;  1GWL A;  2FHR A;  1YWK A;  4NWW A;  3TEY A;  4NID A;  2ZHM A;  2RS3 1;  3WNK A;  4D7Y A;  4QPI A;  5F37 A;  5CKM A;  2WII B;  1BVP 1;  2DFB A;  1NA1 B;  2WNE A;  1FT9 A;  3KV9 A;  1D7P M;  4K21 A;  4JZR A;  2JG9 A;  2PHU A;  1Q8S A;  4M0H A;  3VDD A;  3K3O A;  2XGX A;  3NJV A;  2QTW B;  5H9R A;  3RZH A;  4DZG A;  5FBJ A;  3ZYF A;  3QD6 A;  3VHO A;  1QJY 3;  2WZP P;  4Z07 A;  3VBF B;  1S1A A;  1W06 A;  5DUX A;  2VTX J;  2BNO A;  4H7M A;  4LLO A;  3JQW A;  2XXZ A;  3O1S A;  3MPP G;  1VP6 A;  2DDU A;  1JZ4 A;  5FP7 A;  3LQC A;  4XC9 A;  3M3E A;  2FZ2 A;  3MYX A;  2C24 A;  4KBB A;  5EQU A;  3OB8 A;  3VBU C;  2FDF A;  4HG6 B;  4Z8B A;  5FP8 A;  1UOG A;  3AMN A;  5FYU A;  1BK0 A;  1K12 A;  3DUI A;  3N9Q A;  1YUD A;  2OUH A;  1FV2 A;  4P9G A;  3RJR A;  4K8F A;  1O3S A;  5FQ0 A;  2A1X A;  1UMZ A;  1G6N A;  1V6K A;  5JXJ A;  3WOG A;  2YC2 A;  4BXF A;  2PYT A;  1H1I A;  4N8M A;  1MVE A;  1PHM A;  2X5I B;  4M00 A;  4DPN A;  4I2O A;  1JMU B;  4LUL A;  2I07 B;  3CLP A;  1VRH 3;  5FLH A;  1RB8 G;  2TBV A;  2JDK A;  2LTN A;  2QQI A;  5FKB A;  5FJH A;  2C4X A;  1COV 3;  2CDP A;  5BNO C;  2R04 2;  2VNO A;  3LAG A;  5A7Q A;  2VQA A;  1KS5 A;  3WX5 A;  1ODM A;  1DGR A;  1GLH A;  3O1T A;  2VUJ A;  1DQ1 A;  3KLS A;  2VE1 A;  1RED A;  4MXW B;  4JRL A;  3G7D A;  3P3N A;  3ZSK A;  1F9K A;  2ZX4 A;  4B4P A;  2QVS B;  4XBQ A;  2FMY A;  3JD7 3;  2AEY A;  2Z69 A;  4Q4W 2;  5EZW A;  4CCJ A;  1Y9M A;  2PHX A;  4GIQ A;  5F5A A;  4WM7 B;  3W5N A;  2P3Y A;  2GN3 A;  5F6K A;  2PAM A;  3P6B A;  5FRA A;  1JZ2 A;  2EIB A;  4QPI B;  4AED C;  3P5B A;  3WW4 A;  4CDQ B;  4BQ2 A;  4XPV A;  2W92 A;  4JCK A;  1SAC A;  3E5Q A;  1WUV A;  1A8D A;  1JTZ X;  3O1V A;  5DAP A;  3VD5 A;  1NY7 2;  1JOP A;  2R7E B;  4A4A A;  4JAA A;  2YC4 A;  1NY7 1;  1YEW A;  4FQZ A;  2ZX3 A;  1UN1 A;  2HWE 1;  1LAJ A;  1YRZ A;  4Q27 A;  2Q8E A;  4ARX A;  2BP6 A;  1OA2 A;  1SZB A;  4YG6 A;  2GC3 A;  3NO8 A;  5F3C A;  5JZG B;  1PZ7 A;  1WCD J;  2EA7 A;  2BWA A;  2QFE A;  4DXT A;  3BI3 A;  2KA3 A;  3RS6 A;  4P9J A;  2VW1 A;  4HXC A;  4RFT 0;  1ZRE A;  1TMF 2;  3L2Y A;  2NMO A;  3DF0 A;  4XIK A;  2P34 A;  2WZE A;  3J26 N;  3NKG A;  3KCC A;  5JXH A;  2Z42 A;  2XHK A;  4JHT A;  3JB4 C;  5LZ6 A;  2LM3 A;  3TNQ A;  1MQT A;  3I49 A;  3NNF A;  5IK8 A;  3ZSL A;  2XOM A;  4FP2 A;  3WNX A;  1WD3 A;  2QKD A;  4CPB A;  2WC2 A;  2RDR A;  2WT0 A;  3RZJ A;  4OUM A;  4R9C A;  4XCA A;  1FI2 A;  1OF3 A;  5FDB A;  1AJK A;  1XNB A;  2BNM A;  3J8F 1;  3OD0 A;  3OGS A;  4XIL A;  3WSO A;  3JD7 2;  2JEC A;  2W95 A;  4Q4W 3;  5DAB A;  1LHU A;  3CJI C;  4URT A;  5F2S A;  1RUI 3;  4COW A;  1H1M A;  2VTX A;  4LKS A;  2W5F A;  4ZKT B;  1CAX A;  1H4H A;  3R05 A;  3VKM A;  3LFI A;  1VBD 1;  2OVU A;  3OBZ A;  4RQP A;  2WYF A;  3KWV A;  3LA3 A;  1PMH X;  3N7L A;  1QXR A;  5A3O A;  2AZ5 A;  4B1L A;  4K40 A;  3D0S A;  2EAL A;  3ZX7 A;  3R4D B;  1CZT A;  1UIK A;  1PO1 1;  2E7T A;  5FCC A;  3I2G A;  1YIP A;  5IHR A;  1WW5 A;  5FYV A;  2HEV F;  4OZX A;  4E2G A;  3RG0 A;  1OLQ A;  1LU1 A;  2QBX A;  4R52 A;  4PBP A;  3ZN6 B;  2WT2 A;  1C5H A;  1EAH 3;  4LNV A;  2W47 A;  5KC5 A;  4LO5 B;  2YB7 A;  5T3N A;  2YRO A;  4ASL A;  5IAT A;  4BK4 A;  3TYJ A;  1TME 2;  3EXU A;  5ACA 1;  1H4G A;  4CDQ A;  5C9A C;  2PA7 A;  2ZEY A;  4JV4 A;  5EP9 A;  1UX6 A;  3J4U H;  4QT6 A;  4Z2W A;  2ATF A;  3WG3 A;  3H9A A;  2JG8 B;  4O9E A;  5D1I A;  3PMS A;  1DYK A;  2D6K A;  4TYS A;  2VVE A;  5GZF A;  5C4W C;  2Z2S B;  5D8A A;  3BUC A;  2PHD A;  4EN6 B;  4MG2 A;  3CZU A;  1W6O A;  5F5Q A;  1LHW A;  3MV1 1;  4JGY C;  4CDX B;  4ZU7 A;  1LOB A;  2A6Z A;  4FPE A;  1UCX A;  1RIT A;  2VOK A;  2YBS A;  5EXO A;  3O7O A;  5HXV A;  3SMH A;  4BYY A;  4WVM A;  1NKG A;  5ABJ A;  3HJR A;  1KJL A;  2HWC 1;  4N53 C;  4A3Z A;  4F7Z A;  4QQH A;  5T5L A;  3JQX A;  1UY2 A;  5FP4 A;  1HXS 3;  1MS0 A;  2DU1 A;  1PMJ X;  2GZW A;  2TEP A;  2A73 B;  4Y1X A;  2JJ6 A;  2YGL A;  2E51 A;  3B01 A;  3ETP A;  4N53 A;  4AHX A;  4L9B A;  2BGO A;  3KM5 A;  4NVP A;  1QWR A;  5CIS A;  3I3M A;  4IEY A;  2NMN A;  1BK1 A;  4XUO A;  3LOB A;  1QJZ A;  2UU8 A;  1GZT A;  3Q9O A;  3OD4 A;  5FZ3 A;  1NYW A;  4G9S B;  4IDZ A;  3RMY A;  4F83 A;  4MZU A;  5ERL A;  1AR8 2;  5T5O A;  5CYY A;  3KV6 A;  3WNP A;  4LHL A;  4LBK A;  3I2F A;  2ZCW A;  1QOO A;  5IWF A;  3M7A A;  2IZW A;  1RYY A;  2J1U A;  1BEV 3;  3JBG 3;  4WM8 A;  3I4I A;  1LHN A;  1POV 3;  5LY2 A;  5KC6 A;  2Q1M A;  4IEX A;  4YW4 A;  3ZYH A;  4MYE A;  4URA A;  1QJE A;  3AJZ A;  2A71 A;  4GJZ A;  1XE8 A;  4YPJ A;  1VBB 3;  3B69 A;  2IUW A;  3DEC A;  1VAV A;  3KCY A;  3WG4 A;  1KGY A;  3ZFE A;  3ES4 A;  1RUN A;  2KD7 A;  5BNN B;  1R08 1;  3T1L A;  4YGD A;  1FPN 3;  1AL2 3;  1SMV A;  4CE8 A;  2BZD A;  1LHO A;  2HBT A;  2VME A;  1JI6 A;  5FMO S;  4PIX A;  3NNJ A;  1NA1 A;  1QU0 A;  1ZZ9 A;  2WKK A;  5EIY B;  3WHT A;  3HQU A;  5FUP A;  4ITC A;  3NW4 A;  4LTA A;  4QKF A;  2JIC A;  4DY5 A;  5IVE A;  1RUF 2;  2XLG A;  3ZLI A;  5HCF A;  5F32 A;  4BQY A;  1ZRC A;  2ZGT A;  1IKP A;  2W91 A;  4MUV A;  3PTY A;  5I91 A;  2E33 A;  2ADD A;  3C8X A;  1N1V A;  1GP5 A;  2P37 A;  3B9C A;  5AVP A;  3MV0 1;  4CCD A;  4Q0S A;  1F8V A;  1RUH 1;  3M70 A;  1MS8 A;  5KHJ A;  2QQW A;  4XHX A;  3WF2 A;  3O1M A;  1QQP 1;  4JHZ A;  3ST7 A;  1ZX5 A;  2QZ3 A;  5HCH A;  3N35 A;  5HV0 A;  1W8W A;  2RVA A;  3CJI A;  3I3B A;  3MIG A;  2GU9 A;  2NPI A;  3CQO A;  4YFW A;  1FV3 A;  2G19 A;  2XR4 A;  3E6B A;  5FYT A;  4LKE A;  2HBU A;  2FCU A;  2O8Q A;  3AC0 A;  4LUK A;  2DV9 A;  1DIW A;  4YVS A;  3D0J A;  5A7P A;  3T3Y A;  3O0V A;  4Q8L A;  5FKC A;  3CIH A;  4BK5 A;  3QBQ A;  5DAW A;  1E5I A;  4IEO A;  5CFC C;  3RZM A;  3I2D A;  4UW5 A;  3RRD A;  4KG8 A;  2R07 3;  2WO3 A;  5ANQ A;  3AYA A;  3KF3 A;  2XWB B;  4GJY A;  4IET A;  4IEU A;  4YW1 A;  1REF A;  3H3Z A;  3MPB A;  4QXH A;  4NJ4 A;  5J1X A;  4X6Q B;  4H3W A;  4HET A;  2Q4S A;  5A6Y A;  1CAW B;  1UL9 A;  1VMF A;  1XQN A;  3USU B;  1QEX A;  1OI6 A;  5TSW A;  4AI3 A;  4NE9 A;  4Q4V 2;  1HRV 1;  3CDZ B;  4D94 A;  1JBC A;  1F4H A;  2XBO 1;  3RDI A;  2RS1 2;  1UYP A;  3RNS A;  4H55 A;  3FBM A;  2ZHK A;  3UJQ A;  2PLV 2;  4Q0Q A;  1WMF A;  1WWY A;  1Q5O A;  1VE0 A;  3WEZ A;  2XJU A;  4Y33 A;  2E32 A;  3K77 A;  3DXT A;  4Y20 A;  2K46 A;  5FZ6 A;  2A3X A;  3J7N A;  5DMY A;  1DQ4 A;  2WWS A;  3PVN A;  3S7E A;  5ABJ C;  2TNF A;  3OGJ A;  3AL5 A;  1POQ A;  1WW6 A;  1NUK A;  1A8M A;  2J1E A;  4CYD A;  1K5M A;  1VMH A;  1HDK A;  1AHS A;  2A7A A;  1FNY A;  3SKJ E;  4AGG A;  4UFL A;  4COV A;  3GDB A;  3ZFG C;  3DGT A;  4IE7 A;  1WLT A;  1XYN A;  1PZ9 A;  1NLR A;  2P4E A;  1I5Z A;  4AEJ A;  3H7J A;  3IAQ A;  5F1R A;  1W3X A;  5GZE A;  4Z1V A;  4XJ9 A;  5LK5 A;  1U5Z A;  3R4S A;  1HQL A;  5IK7 A;  2WWU A;  4JX0 A;  2X10 A;  4K1Z A;  2AC1 A;  2HKX A;  3T4H B;  1RXF A;  4XAB A;  2VZS A;  1POV 0;  4X8N A;  2VBD A;  2XL7 A;  3AKT A;  2YYO A;  3GBF A;  1CAU B;  1WLC A;  5F2W A;  2WS9 1;  3UKT A;  1KQR A;  5C5U A;  3N7J A;  1NCR A;  4A44 A;  5KXD A;  3OYW B;  2ZOE B;  5EYX A;  4MAD A;  5IFP A;  1I6X A;  3NV2 A;  1M06 G;  1E5R A;  5I8T A;  3NMB A;  1ND2 C;  3UGH A;  4NUB A;  5A33 B;  1HQW A;  2VMI A;  3DN7 A;  2CGN A;  4HN0 A;  1Z7S 3;  4XF9 A;  1QDO A;  4Q0U A;  5G05 L;  3SQO A;  3ZXD A;  3A0N A;  4BLI A;  4CU6 A;  2WJS A;  4FAG A;  4FOV A;  4IEW A;  1S2E A;  3WXP A;  2PAE A;  5HPO A;  3PUI A;  4QU1 A;  4E27 A;  4MXV A;  2JEN A;  1L7R A;  4HFS A;  4Q4X 1;  2C6S A;  4FXK B;  2ARB A;  2NZ9 A;  4HSJ A;  1OPO A;  1KEX A;  1VRH 2;  5CFC B;  4ORF A;  1EY2 A;  1LRH A;  2BVV A;  5DG2 A;  5LWB A;  1H6X A;  4NR1 A;  2WLQ A;  1RUH 2;  4K3U A;  3ZXL A;  5C6C A;  4R9B A;  2ARE A;  4BCU A;  4I3P A;  1GMM A;  2ZEW A;  1UMI A;  3OUI A;  5K4L A;  1XNT A;  2VZU A;  4XUQ A;  1WCQ A;  1J3Q A;  2ZMK A;  1H6Y A;  1XYP A;  2W87 A;  4XEZ A;  3ZN5 A;  1ZZ8 A;  4WV8 A;  5D8A C;  1QJU 3;  3T2Q A;  4NHM A;  4NHL A;  3BOD A;  3ZMO A;  4KWJ A;  2OQ7 A;  4UBH A;  1N3Q A;  1IS4 A;  4C90 A;  5LBE A;  1LU2 A;  2JDH A;  3GJA A;  2AR6 A;  3FFZ A;  2ZMN A;  2VNV A;  4XFC A;  1IS5 A;  3HNB M;  1AR9 1;  2W0X A;  4EN8 B;  2QQM A;  2VGD A;  1JOD A;  5CNA A;  3FHA A;  4LKD A;  2AEZ A;  5GLU A;  3VBU A;  3R4U A;  5F3G A;  1BZW A;  4KU8 A;  4WVW A;  4KI5 M;  3GHN A;  5J36 A;  5DUW A;  1S0J A;  2GC0 A;  3UJO A;  4YVW B;  1AXK A;  3DKQ A;  3VBR B;  1H2K A;  2B39 A;  4E9K A;  2QQN A;  5HBA A;  2ETE A;  4CUB A;  1AX0 A;  4LOS A;  1CAV B;  5E88 A;  3HN1 A;  4CU9 A;  3K46 A;  5FZ0 A;  4GMP 3;  4FPO B;  4PT6 A;  2W1S A;  5HV4 A;  2PQS A;  4RQP C;  3SNM A;  1OFS A;  4EZH A;  4FSJ A;  1XE0 A;  1R08 2;  3POI A;  3RZK A;  1M4W A;  2QUO A;  3MZH A;  1XU1 A;  1RUE 3;  2AUY A;  3HPN A;  3KGZ A;  4HT1 T;  1L7Q A;  1JZ5 A;  1PVX A;  1PK6 A;  1AL2 2;  1UZ0 A;  2DVD A;  1MPX A;  4AVC A;  3MID A;  4D8M A;  3AZV A;  3LSE A;  4QB1 A;  4B7K A;  1EPZ A;  2GME A;  4N43 B;  2HLE A;  5H9S A;  5GKA C;  4L8Q A;  4E8C A;  1TE1 B;  3LA2 A;  2Y6J A;  2UWA A;  4N9H A;  4XHB A;  2ZS6 B;  1VLN A;  1RMU 3;  3LCP A;  1RVF 2;  1GBG A;  4UOJ A;  4AQ6 A;  4AI9 A;  4B4R A;  4FTB A;  1RTV A;  3OCP A;  4RD7 A;  2PEL A;  5L36 A;  2CDO A;  3J7M A;  1VBC 1;  5A1A A;  4CCN A;  1W2O A;  3GNE A;  1ZRD A;  2D44 A;  3N9O A;  2E7A A;  4XJW A;  5FY7 A;  5JVV A;  3WP3 A;  2D6O X;  1AUY A;  2RJL A;  2B42 B;  4ONU A;  2VY0 A;  4O7X A;  1HJF A;  1CJD A;  2WNV B;  2LS6 A;  1UQX A;  3U07 A;  5A32 B;  4RYD A;  2HWB 3;  2BBV A;  3H8R A;  2Q8D A;  1WA6 X;  3PJY A;  4Q4V 1;  2XL9 A;  3CKH A;  1QIQ A;  1Q8P A;  3ZYG A;  4QQL A;  2WSV A;  4BME A;  4AVT A;  1KRI A;  4IEP A;  1I9R A;  4LHS A;  3DXU A;  2BFU L;  4LBQ A;  1OXC A;  2BNN A;  3MFC A;  2CYF A;  2P2K A;  3NKT A;  5A3M A;  5HXM A;  3DPR C;  1CAU A;  1RUE 2;  1W8F A;  3H3U A;  5FZ4 A;  5I0S A;  2XLF A;  4DUX A;  1JYW A;  4Q0V A;  2JE9 A;  3IN9 A;  1UY3 A;  4XVH A;  5T55 A;  3VZJ A;  2A5Z A;  1VBE 2;  1PVC 3;  4LR4 A;  1WD4 A;  1YQ5 A;  2ZX0 A;  3MEP A;  4Y26 A;  1PO2 3;  2EXH A;  2IC1 A;  3VBS C;  1CJP A;  1D0G A;  1IGO A;  1BBT 2;  2HWB 1;  3LDK A;  4RS5 B;  2OKX A;  3WV6 A;  5CVR A;  4KWL A;  1OD3 A;  4JVA A;  3U11 A;  2FDH A;  5K7P A;  1VR3 A;  5AC9 3;  2EAK A;  1L7L A;  1ZZ7 A;  3WF3 A;  4XET A;  3CBN A;  3A22 A;  1YJK A;  1JYN A;  1GFF 2;  1QQP 2;  1QY4 A;  2B9V A;  4KH9 A;  5FZC A;  2VOW A;  3K4D A;  4J6G A;  4OFG A;  3FBY A;  4XOG A;  4CRQ A;  4XAE A;  2IVI B;  3IZO A;  5EJ3 A;  2G9F A;  4LIU A;  4BDV B;  1EAH 1;  3AX4 A;  4Q2F A;  1DZT A;  1GP6 A;  3WCR A;  4YZ1 A;  5K9Y A;  1SCR A;  2N7G A;  2VR4 A;  1Q8V A;  1BVV A;  5I8Y A;  4PJY A;  1JYX A;  1C8M 2;  1UXX X;  2LRO A;  5FXW A;  2H0B A;  3O0X A;  1ZA7 A;  1QH6 A;  2JE8 A;  2KR2 A;  3NAP B;  1YYN A;  3I2I A;  4OQ9 A;  1HV0 A;  4PDW A;  1C28 A;  1PO1 3;  2GP3 A;  4YW6 A;  3NJX A;  1CON A;  1XBF A;  3GJB A;  3AVS A;  1W3V A;  2BW8 A;  2VCC A;  4LUM A;  3VD9 A;  4RGK A;  2B4K A;  1COV 1;  4CEW C;  4FFF A;  4FI9 A;  4W6Y A;  1W8H A;  1WME A;  1WLW A;  1X36 A;  2IXJ A;  3ZN4 A;  3RGB A;  4DO0 A;  1ASJ 3;  1FNZ A;  1HRI 2;  2CL2 A;  4ZS3 A;  4RR3 C;  5FZ8 A;  4BOW A;  4JQT A;  5CA6 A;  3WP4 A;  5KHG A;  3K51 A;  5AC9 2;  1HJG A;  1QDC A;  2WIN B;  4FOY A;  2R0F A;  4I09 A;  1Q8O A;  4XAA A;  3FHI B;  4XDP A;  5FZI A;  2WBK A;  2CAV A;  2X09 A;  2VC9 A;  1IPJ A;  1BEV 2;  1MZ6 A;  1NCR C;  4JKM A;  1RUG 1;  4TSV A;  5C71 A;  1QQP 3;  4ISQ A;  2QQO A;  1HB3 A;  4AFB A;  1WCS A;  2CWS A;  2VW2 A;  5FZM A;  1JU3 A;  1PIV 3;  4AHZ A;  3SXW A;  2WQ4 A;  3U0Z A;  4NRM A;  3JU9 A;  1ENQ A;  1F15 A;  1OA4 A;  2F6B A;  1DYP A;  1W8O A;  5EJ1 B;  2TUN A;  3IIA A;  4CCO A;  5DXD A;  1W0N A;  1BYH A;  1JYT A;  5BNO B;  1W6Q A;  2FDG A;  5JR7 B;  2DBI A;  1PNF A;  3MIE A;  2R49 A;  1BMV 2;  1KD7 A;  2XON A;  4HKL A;  2DUR A;  3ZFF C;  1HB1 A;  1V6O A;  3DCQ A;  2JG9 C;  1OOP A;  4FTE A;  3ACH A;  2R07 1;  2VPV A;  1H9P A;  1T2X A;  1W8N A;  1GZ9 A;  2JDA A;  3MIB A;  4UW6 A;  3NJY A;  1LOC A;  2I74 A;  2DVF A;  1XU2 A;  1D4M 2;  5C3R A;  4XBN A;  4YM1 A;  1RHI 1;  4JTN A;  1R1A 2;  4LQR A;  3IDE A;  4JGZ A;  4WVZ A;  4PBO A;  4Q1R A;  1BJQ A;  5J3U A;  1NXM A;  3AZX A;  3WNL A;  1LGC A;  1R1Z A;  2VM9 A;  2XBO 3;  3MLL A;  4M4P A;  4M4R A;  3BIE A;  3VZO A;  2O8O A;  4W8J A;  4LKF A;  3O1R A;  2L9L A;  3HNM A;  3TWI A;  5F39 A;  3N9M A;  3U4S A;  4NRP A;  5HCB A;  4EN7 B;  4FPK A;  2XKP A;  1PMI A;  1ODN A;  1O8P A;  1ZBA 1;  5CU1 A;  1AR6 2;  4TZD A;  2CGP A;  5F3E A;  1DHK B;  2IXL A;  2P17 A;  4D7S A;  2H6B A;  5J7M A;  2OPW A;  4I02 A;  3A4U A;  1XRU A;  3VBS B;  3SLI A;  4CUC A;  2RM2 2;  2GNM A;  1GZC A;  2YHJ A;  1OUX A;  1K45 A;  2VZR A;  5FXX A;  1UYY A;  3B3Q E;  3ZR5 A;  3S30 A;  4LLF A;  5FZK A;  4JTO A;  3L2H A;  4HPK A;  1F2N A;  3JXS A;  5LRR A;  4DUV A;  3T0A A;  3K4Z A;  1E5S A;  1AX1 A;  3VDA A;  1X50 A;  1J1T A;  1HLC A;  4LBM A;  3ZXJ A;  2DYC A;  4NHY A;  4W65 A;  5DQ0 A;  1NCQ B;  4LBQ B;  1SEF A;  2XHN A;  4RGG A;  4PLO A;  4QKN A;  1V9U 1;  5I93 A;  4DXR A;  4P5H A;  4OCT A;  4KL1 A;  2VOV A;  2Y6L A;  2J1S A;  1LED A;  2WAB A;  4A45 A;  5I0D A;  4BQW A;  4LOR A;  3OJB A;  3GBW A;  2E31 A;  1KFU L;  4KU7 A;  1YLL A;  2D6P A;  4RHV 3;  5K0U A;  3WD5 A;  3E6C C;  1PX4 A;  1GSL A;  4CP0 A;  3ZO0 B;  4CUG A;  2A70 A;  1UF2 C;  5C4W B;  1YQ6 A;  2VZ1 A;  2WQ8 A;  1U0A A;  3T2P A;  1PM4 A;  3A0K A;  4XFI A;  4B1M A;  2DUO A;  1TMF 1;  5A7O A;  3TRS B;  4XXA A;  2WS9 2;  1VB2 A;  3OY8 B;  1CN1 A;  2IXK A;  3M2M A;  1CVN A;  1DF0 A;  3J7H A;  4KQ7 A;  5J37 A;  1UMH A;  3POJ A;  4LA2 A;  4ZZ8 A;  1Z78 A;  1WBF A;  3URF A;  3WF4 A;  2X05 A;  1UNB A;  2MEV 2;  3BGA A;  2JDN A;  2VXR A;  4RL7 A;  4CCC A;  2VOT A;  3C7F A;  3ZSE A;  5LRS A;  2QQK A;  1QXJ A;  3KD4 A;  4BLJ A;  3HBZ A;  4QAW A;  2ZX2 A;  3ZFG B;  1BEV 1;  4CDQ C;  1MS5 A;  1BKZ A;  4JGY A;  1DGL A;  1JW6 A;  1O6U A;  1W2U A;  2WNU C;  3NV4 A;  2VXJ A;  1VBC 2;  1YC6 1;  1RJ7 A;  1QF3 A;  3HAG A;  3HNY M;  2P6C A;  4NIA A;  5DPN A;  3H1W A;  3T1M A;  4MLO A;  4D7T A;  3PUH A;  2D93 A;  1MZ5 A;  3M3Q A;  4B3N A;  3V56 A;  1QH7 A;  2J22 A;  4FXG B;  1WLD A;  2XPJ A;  1TNR A;  3PJQ A;  4AVV A;  4IER A;  1QJU 2;  2EXI A;  4C8D A;  1V9U 3;  1DDL A;  1HRV 2;  1ULD A;  1QJX 3;  3B00 A;  3NRU A;  2QQJ A;  4OI2 A;  4YM0 A;  2UYB A;  3LOI A;  3S6P A;  2A3Y A;  5A3P A;  1AYM 1;  4QX1 A;  1AYN 2;  1EV1 1;  2ERF A;  2PLV 1;  2R06 3;  3M4F A;  5FY1 A;  2Q8C A;  4NHK A;  4AF9 A;  1G9C A;  3A21 A;  3CEW A;  3CF6 E;  4MET A;  1W03 A;  1OQ1 A;  1RGS A;  3E6D A;  1VBB 2;  1ENS A;  2RMU 1;  3ZYI B;  2GH8 A;  1S0B A;  3GZT B;  1ST8 A;  5DUU A;  1VIW B;  3D5O A;  1YNA A;  1GP4 A;  4LE3 A;  3SKV A;  4UFJ A;  3NNM A;  2XJP A;  5FPX A;  2YPD A;  1YXW A;  4FPC A;  5FO7 B;  1YI9 A;  2XVL A;  2WN2 A;  2WZR 2;  3WF1 A;  4CCK A;  1DYO A;  4NRO A;  1CPM A;  1QJY 2;  1AR6 1;  4RS5 A;  4J25 A;  2RR1 1;  3ILN A;  2ZJC A;  1Q56 A;  1OH3 A;  3VBH B;  2QJV A;  1NOV A;  1F31 A;  4XUT A;  4ET7 A;  2W39 A;  1XE7 A;  2FZ1 A;  3CHX A;  5JSR A;  5LCW L;  3KSC A;  4KG0 A;  2OS2 A;  5E89 A;  2GMP A;  1CPN A;  2WL1 A;  2IFR A;  3G6J B;  4UW3 A;  5JOW A;  3ZIW A;  5GAL A;  2RM2 1;  1ZRI A;  2ORX A;  4PI0 A;  2YUE A;  3UKV A;  4CDW C;  5FYB A;  5C3P A;  4DY3 A;  4XQ4 A;  3UET A;  4OYU A;  1JXN A;  1ULP A;  1NAE A;  3J7L A;  4ASK A;  4YW7 A;  4IEV A;  4BXS V;  5BPX A; 
#chains in the Genus database with same CATH homology
 5J1X A;  2DCK A;  3FL7 A;  4GZ9 A;  3VD3 A;  2Z4F A;  4ZZ5 A;  2V72 A;  1EUU A;  3CDZ B;  1CZV A;  1UY0 A;  4PQQ A;  1F4H A;  3GGL A;  3VD4 A;  1GOH A;  4TTG A;  2YFZ A;  3P1I A;  2VCA A;  3LEK A;  4P08 A;  3LPG A;  3WEZ A;  2E32 A;  3K77 A;  4ZXE A;  4P5Y A;  1UXZ A;  4QB6 A;  4ZY9 A;  5JMO A;  2VTF A;  5DMY A;  2W46 A;  3A7Q A;  4RN5 A;  2Y6G A;  1NUK A;  1XC6 A;  2ORZ A;  4A6O A;  2J1E A;  3T0D A;  3SKJ E;  3SEE A;  5JXG A;  3GDB A;  1WKY A;  3WQB A;  4OZO A;  2WAA A;  3IAQ A;  1O8S A;  2ZEZ A;  4JX0 A;  2X10 A;  1CX1 A;  4Z2A A;  3WNM A;  2VZS A;  2WN3 A;  4GWI A;  4QDS A;  4D0Q A;  4A44 A;  4MAD A;  5IFP A;  4BJ0 A;  1XNA A;  4JKK A;  5F7U A;  1JZ8 A;  1J83 A;  5G05 L;  2LW8 A;  4QX0 A;  4CU6 A;  2VZP A;  3C7G A;  4P02 B;  3SEP A;  5HPO A;  3IAP A;  3PUI A;  3LPF A;  1W9S A;  2J1V A;  1L7R A;  3VDC A;  3ZM8 A;  1KEX A;  1GNY A;  2JKX A;  4KMQ A;  1H6X A;  4DUW A;  2ZXQ A;  1W99 A;  2RV9 A;  1GMM A;  2ZEW A;  1UMI A;  4QDQ A;  1XNT A;  2VZU A;  4XUQ A;  4AAX A;  5C7G A;  1WCQ A;  3DYO A;  2WZ8 A;  1H6Y A;  1GOG A;  2W87 A;  2WAO A;  3IB3 A;  4P00 B;  3T09 A;  4A41 A;  1GQP A;  3T2Q A;  4QB2 A;  1US2 A;  2C26 A;  1XPW A;  3C7E A;  1LNS A;  1GUI A;  2WO2 A;  4DEV A;  2J7M A;  3HNB M;  2Y8K A;  3GM8 A;  5LA2 A;  2BBA A;  2QQM A;  2W9X A;  3CMG A;  3LE0 A;  5G04 L;  3FHA A;  1OT5 A;  1UX7 A;  2QQL A;  2VQT A;  4KI5 M;  5LA1 A;  3THD A;  1CIY A;  4ARY A;  3T0B A;  2J1T A;  3C7O A;  2QQN A;  1SDD B;  4CUB A;  4QDR A;  1YQ2 A;  3MUZ 1;  4CU7 A;  4CU9 A;  4IUG A;  2WO1 A;  3K46 A;  4PT6 A;  2W1S A;  2VMD A;  2PQS A;  5IFT A;  4L0P A;  4QPW A;  1UWW A;  3HPN A;  1JZ5 A;  1L7Q A;  1UZ0 A;  1JZ7 A;  1MPX A;  2HYX A;  4D8M A;  4QB1 A;  2EIE A;  2ZEX A;  2HLE A;  2VQU A;  3MUY 1;  2BGP A;  3OBA A;  4E8C A;  1J84 A;  5B4X A;  2Y6J A;  3MBW A;  2Y64 A;  2W3J A;  3E1F 1;  3I2K A;  4UOJ A;  3K75 B;  2JD9 A;  2V4V A;  5LA0 A;  3W5M A;  5IJR A;  5DN2 A;  2CDO A;  2DCJ A;  3LEG A;  4JKL A;  5A1A A;  2WDB A;  2XQX A;  1DP0 A;  1JZ6 A;  2LS6 A;  4RYD A;  3I3D A;  1UY1 A;  2W1U A;  4MGQ A;  3EB7 A;  3CKH A;  4DXS A;  2EIC A;  1P8J A;  2VL4 A;  4LHS A;  4DEQ A;  3UNP A;  3I97 A;  5HXM A;  4XZU G;  3WNK A;  3GXU A;  4DUX A;  1JYW A;  1UY3 A;  4XVH A;  4OMC A;  1D7P M;  2VMC A;  3NJV A;  3HEI A;  2VCB A;  2OKX A;  5JR2 A;  1OD3 A;  4PF1 A;  2VMF A;  2DDU A;  4W50 A;  3WF3 A;  1JZ4 A;  1K42 A;  3LQC A;  3ACF A;  3A22 A;  2RJ2 A;  3OB8 A;  1JYN A;  4HG6 B;  2B9V A;  3MO4 A;  1K12 A;  4CVU A;  2W1W A;  3K4D A;  1JZ3 A;  4GWJ A;  5JUV A;  4UI9 L;  1W9W A;  5JXJ A;  2YC2 A;  4BDV B;  4QX2 A;  1BHG A;  2VJX A;  1GU3 A;  2VR4 A;  3DYM A;  4TXW A;  1JYX A;  1UXX X;  2QQI A;  3ABZ A;  2C4X A;  2CDP A;  3OEA A;  2JE8 A;  3A23 A;  3I2I A;  3NJX A;  3III A;  2Y6H A;  2VCC A;  3VD9 A;  5C70 A;  2B4K A;  2EID A;  4FI9 A;  3W5N A;  3P6B A;  1JZ2 A;  1ULO A;  2EIB A;  3BN6 A;  2W92 A;  2WBK A;  2X09 A;  2VC9 A;  4JKM A;  5C71 A;  3VD5 A;  2QQO A;  2R7E B;  1JU4 A;  4A4A A;  2YC4 A;  1K3I A;  1JU3 A;  4ARX A;  3WNO A;  1TG7 A;  3OEB A;  2Y6K A;  4DXT A;  1W8O A;  1UYZ A;  3CZJ A;  5EJ1 B;  1W0N A;  5CZK A;  2C9K A;  5FUI A;  2XON A;  3WNN A;  2W94 A;  2BER A;  3ACH A;  2WZE A;  3C7H A;  4OUE A;  1T2X A;  5JXH A;  1W8N A;  2JDA A;  2VO5 A;  3VD7 A;  1IQD C;  3U37 A;  2J1A A;  2XOM A;  3UES A;  4LQR A;  1OF3 A;  3WNL A;  1SG3 A;  2VM9 A;  3ECQ A;  3OGS A;  4M4P A;  4M4R A;  3WSO A;  2W95 A;  4W8J A;  5EJZ B;  4LKS A;  2W5F A;  3F2Z A;  2L9L A;  3I2H A;  3HNM A;  1PX3 A;  1PMH X;  1R64 A;  3FN9 A;  1CZT A;  1O8P A;  3I2G A;  2VZV A;  2WYS A;  5IHR A;  3IDA A;  2QBX A;  2J1R A;  3T08 A;  4CUC A;  2W47 A;  1K45 A;  1OF4 A;  2VZR A;  2YB7 A;  1UYY A;  4BK4 A;  3JXS A;  2ZEY A;  4DUV A;  3T0A A;  3K4Z A;  3I2J A;  3VDA A;  1NX9 A;  3NQH A;  4AG4 A;  5DQ0 A;  1UYX A;  2XHN A;  2ID4 A;  3ACG A;  4DXR A;  3CZU A;  2Y6L A;  2J1S A;  2WAB A;  3MV1 1;  4A45 A;  5I0D A;  2E31 A;  3VDB A;  1PX4 A;  2W1Q A;  2VZ1 A;  4QX3 A;  2WQ8 A;  3T2P A;  1TVG A;  2E26 A;  1NKG A;  3HJR A;  1HN1 A;  4A3Z A;  1UY2 A;  3HN3 A;  1I5P A;  3J7H A;  1PMJ X;  1UMH A;  4ZZ8 A;  3OG2 A;  1OH4 A;  1EUT A;  2VZT A;  3ETP A;  3T2O A;  3FHQ A;  2X05 A;  3WF4 A;  3BGA A;  2BGO A;  2WUH A;  3EYP A;  3NNG A;  2VOT A;  4MO3 M;  3C7F A;  2QQK A;  4XUO A;  4QAW A;  3DYP A;  2YG0 A;  5CYY A;  3WNP A;  3HNY M;  3I2F A;  1W9T A;  5DPN A;  4MOA A;  1US3 A;  3PUH A;  2V5D A;  1RYY A;  2J1U A;  1F4A A;  3I3E A;  4KWU A;  2J22 A;  4XUR A;  4YPJ A;  3DEC A;  1KGY A;  4CUA A;  1JYV A;  2KD7 A;  2BZD A;  2VME A;  2QQJ A;  1JI6 A;  3NRU A;  3THC A;  2VZO A;  4QX1 A;  1O59 A;  5EIY B;  4E8D A;  5B4N A;  3A21 A;  5JXI A;  3K4A A;  4CU8 A;  3ACI A;  4XUN A;  4UAP A;  1DLC A;  2W91 A;  4MGS A;  2YFU A;  2E33 A;  3SKV A;  3C8X A;  4A42 A;  3HOB A;  4LPL A;  3MV0 1;  3OGV A;  3WF1 A;  2WN2 A;  3WF0 A;  1DYO A;  1GOF A;  3WF2 A;  4JHZ A;  1CZS A;  2RVA A;  3I3B A;  3CQO A;  4XUT A;  4ET7 A;  5LCW L;  2VZQ A;  3LEI A;  5IYY A;  3AC0 A;  3OGR A;  4OMD A;  4XUP A;  4BK5 A;  1JHJ A;  3CIH A;  2ORX A;  2VZ3 A;  3D3A A;  1UY4 A;  3UET A;  4OYU A;  4W4Z A;  1ULP A;  1NAE A;  2WO3 A;  1SHW B;  4BXS V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...