4LPLA

Structure of cbm32-1 from a family 31 glycoside hydrolase from clostridium perfringens
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
DPYRNVPKDMKTEWKWGQYSSDEPSKAVDGDDSSQFHSQDSAIDKPFIIDMQKAYTIEKLELLFRKNGNGSVKRAEIYSSLDGVTYEKVFSNAEGSDIAPWATDGEVKTINFNKPIKVRYFKIVTKESIGNFLAMREFRPYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 36
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4lplA00
4XURA 1XNTA 2ORZA 2VCCA 3ACGA 1DP0A 3I2IA 5EJZB 3LPFA 2VZ3A 3A21A 1UXXX 1UY0A 2Y6JA 4A4AA 5CZKA 3I2JA 5LA0A 1W9TA 1GUIA 1GNYA 2BZDA 2X09A 3HJRA 2B4KA 5EIYB 1P8JA 3FHQA 3I2FA 2V5DA 3PUIA 3WNOA 4D0QA 4QX0A 4P00B 4ZY9A 5DQ0A 4CU7A 2QQKA 2W91A 1K3IA 3OGRA 1J84A 3OEAA 3IIIA 3OGSA 4GWJA 2VZVA 3OG2A 1SG3A 5JXIA 3A23A 3W5NA 2Y6KA 2YG0A 3K4ZA 3NJVA 4MGSA 1UY3A 4M4RA 3ACIA 4CUAA 4XUPA 2XONA 3DECA 2VO5A 3WQBA 4OYUA 2YC2A 1NX9A 4IUGA 3HEIA 3WF3A 1GOHA 3C7FA 3T0AA 4ZZ8A 1NAEA 3LEGA 2BGOA 1EUUA 4ET7A 1ULOA 2VTFA 1JYVA 3HOBA 2C9KA 2VQTA 3T2QA 2ZXQA 3VD5A 1CIYA 2HYXA 1DYOA 1F4AA 2W92A 3IDAA 1TG7A 3CQOA 2J1EA 3THCA 2EICA 2VQUA 5EJ1B 1OF3A 4RN5A 4LHSA 3OGVA 4QX2A 4CU8A 2C26A 2XQXA 5DMYA 4OMDA 2VZUA 3MBWA 3C7HA 3MUY1 3E1F1 3GDBA 2XOMA 2J22A 5C7GA 1K42A 1KGYA 2QBXA 4JHZA 3LEIA 3C7OA 3SKVA 2BBAA 4QX1A 3ACHA 2W5FA 4XUOA 4CUBA 3VD4A 3LQCA 3ECQA 3VD7A 5I0DA 2RVAA 5IFTA 3ACFA 4QDRA 3LPGA 1K45A 1R64A 4FI9A 4UOJA 4LQRA 4KMQA 4L0PA 2ZEZA 3DYPA 3T09A 2WDBA 2V4VA 1JZ4A 2WQ8A 5JR2A 3I3EA 1T2XA 2E31A 1XNAA 4CU9A 3ETPA 1JZ5A 1ULPA 4JKKA 2WO3A 3WNNA 1PX3A 4QDQA 5DPNA 3NNGA 3HNMA 3I97A 2X05A 5F7UA 4W50A 3SKJE 1J83A 3VD3A 4KI5M 3OEBA 5JMOA 2YB7A 4QPWA 2J7MA 2EIEA 1US3A 3CKHA 4P5YA 5JXHA 1BHGA 1L7RA 4ZZ5A 1D7PM 3P1IA 3CMGA 2WBKA 2JD9A 4XZUG 2LS6A 3GXUA 4E8DA 3T0DA 2WUHA 4QDSA 3I2KA 3WF2A 4DUVA 3VDBA 1GU3A 1SHWB 2J1RA 1RYYA 2R7EB 2E33A 4M4PA 1O8PA 2VMCA 1H6YA 4OUEA 5G04L 1I5PA 1CZVA 3I2HA 2W87A 2OKXA 1PMHX 1O59A 3T2OA 4AG4A 1CZSA 1UYXA 1CZTA 3BN6A 3IAQA 2PQSA 2QQJA 3NRUA 4DXRA 1W0NA 3CDZB 3IAPA 4XUNA 4QB6A 4UAPA 1JZ3A 3MO4A 1EUTA 5G05L 1OF4A 2VZRA 3I2GA 3I3DA 3ZM8A 3UETA 3OBAA 1JYXA 3LEKA 2DCJA 2VL4A 1YQ2A 2JKXA 4XVHA 4DXSA 4LKSA 1UYYA 1SDDB 1WKYA 2W46A 2ID4A 1OT5A 2X10A 3UNPA 2YFUA 1H6XA 2W1WA 4DUWA 2YFZA 3HPNA 3SEEA 2QQLA 2Y6LA 3VD9A 3GGLA 1UYZA 2WN2A 2DDUA 2VMFA 4BK4A 2RJ2A 4W8JA 3WF0A 2YC4A 5LA1A 2J1SA 2WZ8A 5LA2A 3F2ZA 2QQMA 4CU6A 4A6OA 2VCBA 3IB3A 1IQDC 5IYYA 2VMEA 1W99A 4LPLA 4DEVA 1US2A 5C71A 4XUQA 2J1AA 1PX4A 1W9SA 2KD7A 2VM9A 1JI6A 3WEZA 2JDAA 3NJXA 5B4XA 5HXMA 1JU4A 2ZEWA 1DLCA 1GMMA 1W8NA 4BK5A 1JZ6A 5B4NA 4UI9L 2WO1A 1JZ2A 3VDAA 3HN3A 3W5MA 3DYMA 2VMDA 4A45A 4D8MA 4GZ9A 2Y8KA 4ZXEA 4BJ0A 3EB7A 3T2PA 1O8SA 2EIDA 3C8XA 4P08A 4BXSV 3FL7A 2CDOA 4OZOA 5CYYA 4A42A 1GOGA 2W47A 1WCQA 3WNPA 2E26A 2VZOA 1JU3A 3CZUA 4TTGA 2XHNA 2W3JA 5JUVA 3SEPA 4GWIA 5HPOA 3VDCA 2VCAA 4PF1A 2VZPA 5J1XA 3K75B 1TVGA 5LCWL 2VC9A 4MOAA 5JXJA 2HLEA 3AC0A 2C4XA 2WAOA 1JYWA 2Y6HA 4Z2AA 2QQOA 2V72A 4QB2A 2VZSA 5IFPA 1CX1A 2QQIA 3PUHA 1UMIA 1PMJX 2E32A 2W9XA 3WNMA 2EIBA 3WNLA 1KEXA 4RYDA 1XPWA 5IJRA 3K4AA 4JKMA 3NQHA 3BGAA 1JHJA 3ABZA 4CVUA 5IHRA 3HNBM 4A44A 1XC6A 1K12A 2B9VA 4A41A 2WYSA 1JYNA 3T0BA 2ZEXA 2BGPA 2W94A 1HN1A 4DXTA 2VZQA 2VZTA 4JKLA 1OH4A 1NKGA 4KWUA 4QB1A 3WNKA 1JZ7A 2WO2A 2Z4FA 2LW8A 2W1SA 3WF1A 2W95A 2VR4A 1W8OA 2Y64A 3GM8A 3MV01 3DYOA 4TXWA 2ZEYA 3MUZ1 4W4ZA 4MADA 1L7QA 2J1TA 3THDA 1UWWA 2J1VA 3C7GA 1MPXA 3D3AA 4QX3A 3FN9A 3CZJA 1UZ0A 3EYPA 5A1AA 2W1UA 4QAWA 3T08A 3K77A 4CUCA 4XUTA 3K46A 4ARYA 3HNYM 1JZ8A 5JXGA 2DCKA 2QQNA 2RV9A 2Y6GA 2W1QA 4MO3M 2VJXA 1UXZA 3WSOA 5FUIA 3WF4A 3A22A 4MGQA 4YPJA 4AAXA 1UX7A 2WN3A 2ORXA 4E8CA 2CDPA 2WAAA 1UMHA 4OMCA 5DN2A 4BDVB 5C70A 3FHAA 3LE0A 3MV11 1OD3A 3CIHA 4JX0A 1UY1A 2L9LA 3OB8A 3UESA 4PT6A 3I3BA 2J1UA 3C7EA 4PQQA 2VOTA 2BERA 3J7HA 1UY4A 4ARXA 3U37A 4DEQA 1LNSA 3JXSA 4A3ZA 2VZ1A 2WABA 1W9WA 3K4DA 1F4HA 2WZEA 3A7QA 4P02B 3P6BA 1GOFA 1GQPA 2JE8A 4DUXA 4HG6B 1UY2A 1NUKA
chains in the Genus database with same CATH superfamily
2QJVA 2XBO3 3AKQA 2Q5TA 5JOWA 4QPGC 4FO9A 4RFT0 4RR3B 1PGL1 2RG4A 4WVMA 2VZ3A 1HB4A 3PVBB 4IXLA 4JRAA 4NUBA 3T2TA 1UY0A 4DMIA 3CJIA 4N9HA 1MEC1 1N1YA 3BPZA 3DEMA 4XJZA 2YDEA 1JODA 4ITCA 4LMFA 4CZSA 5A3UA 1GUIA 1GNYA 2BZDA 3HJRA 5BNPB 1DYPA 5EIYB 3PUIA 1CESA 2H6BA 3I3QA 4Q4W3 3WNOA 4D0QA 4DFSA 3AYAA 1OH3A 3MIBA 3KSCA 3AMMA 4Q27A 1DIWA 3O5SA 4CU7A 3RPQA 2Q4SA 3HT1A 2VUDA 3AMHA 4ES9A 2ARAA 3VBRB 3VHRA 3POBA 3VBHB 1YLLA 4GWJA 2R043 2VZVA 3OG2A 4HPKA 2MEV1 5FYSA 1O7FA 1Z7S1 1Y43B 4CTEA 3N4MA 1DGRA 3W58A 2E53A 2R062 2C0ZA 2ARBA 4N43B 1AX0A 1LESA 2RR12 3NJVA 4MGSA 5CVRA 1UY3A 4JGYB 3ACIA 4M4RA 5KXEA 4XUPA 2OPWA 4ASLA 2VO5A 4NJ4A 4NROA 4QX8A 3PJQA 5FPUA 5H9PA 1MS3A 5K9YA 4XMAA 4N9IA 2QZ3A 3AKTA 5T5PA 1PGL2 2GN7A 1K5JA 1VBA1 2GZWA 3MLKA 3HEIA 1W8TA 1QJFA 1GOHA 3JQXA 4HXCA 4IUGA 2Y0IA 3LEGA 1N1VA 3T0AA 3ZFFC 4ZXKA 1LOAA 4BQ1A 4EZ4A 3QD6A 1PK6B 2A71A 1MEC2 4MZUA 2ZJCA 3PHMA 1POV3 2VUCA 4XF0A 2C9KA 2Z42A 1Q56A 2ZXQA 1YEWA 1KFUL 3L2YA 1QIQA 4NHLA 4E2SA 2BWCA 1ZREA 3N9LA 2KXLA 3FE5A 1W90A 1G9FA 2FQPA 2HYXA 1OKQA 2DCYA 3ZMNA 4QM8A 4CRQA 1OI6A 2Y33A 4D69A 1FXZA 1GZ9A 3BOWA 3EMRA 3IDAA 4NIIA 2JDUA 4LUMA 2AR6A 1TG7A 4AXOA 1ASJ2 2EICA 1ZRCA 3ZKYA 3R4DB 1AYM1 3JZVA 4QQPA 5EJ1B 1QKQA 2WS92 1ST8A 4LHSA 3OGVA 1HQWA 4L97A 4ZZ8A 2E6VA 4L99A 3HQRA 5FY0A 2P6CA 1PZ7A 3Q8EA 4I3PA 5DUUA 1X8EA 5FBZA 4AFBA 3C7HA 3BYWA 1C3HA 4TN7A 3R6SA 3ALQA 3S30A 5JAXA 3GDBA 1GP4A 2R063 1PO22 3H8XA 2PTMA 5GALA 5I91A 3O0XA 4MXVA 4N90A 1W28A 1Q8SA 2VVFA 1K42A 1VJ2A 4CDWC 2XB6C 3WT3A 4O65A 1YUDA 5T5JA 4FP2A 1DQ4A 1KGYA 4H7MA 4GWMA 5E89A 5KBFA 3LEIA 1VBE1 5ANNA 4R4ZA 1LEDA 3HBKA 1ZA7A 4Q4X1 5M0TA 1D4VB 2X5IA 1G8WA 1QOSA 3VZKA 2PHDA 5CFCB 1LULA 1O4YA 2QUOA 4CUBA 3LQCA 5IFTA 2RVAA 3BVCA 5FREA 3ACFA 2GNMA 5KWRA 3U1XA 1YRZA 2ZTNA 3A0NA 2HEWF 5ERLA 5FUNA 1OBNA 4BHPA 2YMZA 4GQ7A 3DUIA 3WQ7A 1YQ8A 5GZGA 2XR4A 2ZCWA 4YYOA 4LQRA 4KMQA 4L0PA 4COZA 5A3TA 5K4LA 3FLRA 1V6NA 3T09A 3BU0A 4Q0VA 2PAKA 3MIHA 4KU7A 1MQTB 4CCJA 1GZCA 2UURA 4LTAA 4S2DA 5JR2A 3V0BB 1W2AX 1T2XA 3POEA 2WS93 1FNZA 3IWZA 4B29A 4CU9A 1BMV1 3O1SA 1OFSA 3DKWA 4LLOA 1PNGA 5I0SA 4N7IA 3SH3A 1E5RA 4AGRA 5DPNA 3HNMA 2D98A 1XYOA 1S0DA 3TEYA 4A3XA 3QLQA 4HZFA 4KI5M 5JMOA 1HKDA 1ULEA 4KU8A 3BOPA 4WM8C 3SMHA 4FFHA 4RQPC 4COYA 2B8MA 3E6BA 1US3A 1DZRA 1HJFA 1OLQA 2DWRA 5JXHA 1SMVA 4G4FA 4R52A 1OQEA 1R1ZA 4K40A 3CMGA 4LITA 2OIIA 1WLWA 1OLRA 2JD9A 5FAXA 4Y20A 1YFWA 4LO7A 1UAIA 4BPZA 2LS6A 3GXUA 4EV0A 3T0DA 1W05A 1PZ8A 4EN9B 1FMD3 2WUHA 4QDSA 3WP5A 1S2KA 3ZXEA 3VV1A 2BBVA 4JC1A 1X50A 2BRTA 1RYYA 2R7EB 5HCAA 2XJTA 1YYNA 4GB32 1O8PA 4N7UA 4QPIA 3DPRA 3ZFEC 4LUKA 2HWF1 2PXJA 2P34A 5G04L 2ZGOA 3ZFGA 1I5PA 1WA6X 1RUG3 4ASKA 3IMMA 2VQ0A 2W87A 2PHLA 4XJAA 2JKBA 1PMHX 4I09A 4YG3A 5FZOB 4WBBA 2Z79A 1I9RA 5AC91 1CZSA 3A4UA 3U07A 4CCOA 2PLV3 4BOWA 3USUB 1XE8A 1JH5A 1LECA 1ND3C 1NXD1 3JBG2 5T5LA 5IK5A 1WW7A 4Y22B 1BLZA 5GZEA 4CYDA 5KHGA 3S5QA 5BNOB 5FKCA 1NCQC 2HWE2 1UW8A 4XEZA 1WMDA 1YXWA 1TE1B 4KG8A 4CXWA 5LBBA 3R4UA 3AB0A 3ZSEA 3MO4A 1JZ3A 1EUTA 5CIRA 5G05L 5A7WA 2X29A 3NJZA 3I2GA 4JRLA 3TEZA 3MI8A 4YVSC 2W39A 4XBLA 4XFCA 4BQWA 3OBAA 4CP9B 2ZOEB 2DCJA 1YQ2A 1EAH2 2EF6A 2WNVA 1UYYA 1SDDB 3AFKA 3IIAA 4QKDA 2NN8A 1HQNA 4M3CA 3PMSA 2E7AA 4AQSA 4E9KA 4WM7C 1AX2A 5A6ZA 2QE3A 3KT4A 4DUWA 1LOBA 3NKTA 3ZXAC 3O1PA 2AUYA 2W08A 3HPNA 5DAXA 1RUJ3 1JYCA 5JOZA 1QJX1 2DDUA 1KJLA 2WFF2 3CBNA 2O8OA 4NRPA 5DDJ1 3FBMA 3V64A 2KA3A 4Y26A 1RINA 1EY2A 4MHRA 2GC1A 4K21A 5DUXA 1XOYA 5GZFA 3USSA 4A6OA 5E8AA 1D2SA 4URTA 1LGBA 5K0UC 4META 2IWGB 5DG2A 4EWAA 3VB9A 5A3MA 1DYKA 3H0OA 3N9QA 3CJIB 5H9SA 3RSJA 4TZDA 4YG0A 2NM1A 4P9WA 4AVAA 1OOPC 1WW6A 1W99A 1GANA 1UOBA 1COV3 4FCAA 2ATFA 4CEWC 1AR72 1US2A 4HVRA 1H8TC 5C71A 4XUQA 1AR82 5EV7A 5FZ3A 3FJSA 3L9JT 3U4XA 2OS2A 3GZUC 1O3QA 3VBSA 4F7ZA 3LKJA 1JI6A 3BPSA 4AEDC 5IVVA 3TN93 1DBNA 2CWSA 2ZMNA 1F35A 4XCBA 4XMIA 4Q2FA 3KZ4C 4HSJA 4JCKA 5FUPA 3WUDA 4F83A 5CG8A 2Q8CA 2V5YA 4AQTA 4H55A 3VBUC 5HXMA 3I59A 2AH2A 4QQHA 3MPBA 1DLCA 1PO11 1ZZBA 2RHPA 5B4NA 5ABJA 4UF0A 3B9CA 3BIWE 3VDAA 3WOGA 3HN3A 3BTAA 3RJRA 4D8MA 4GZ9A 2HEVF 4KL1A 1QJEA 4QPGA 1T6BX 1XNCA 1ZVFA 3M1HA 1Q8OA 3FLTA 4PQ9A 3RI9A 3VZMA 1WMEA 5FYCA 1S4CA 4JDMA 2EIDA 3C8XA 3POSA 4P08A 5EXOA 4JDOA 1RUE2 1NXMA 5J3UA 4Q4Y1 4JQRA 1DQ0A 2WFF3 4XAAA 4FAGA 2XVGA 3S5AA 1A6CA 2AZ5A 4HETA 3WINE 4AHXA 4MG2A 2BFUL 2DURA 3VDDC 3QH7A 2E26A 4O7XA 5T50A 3VGIA 2VOXA 2XHKA 1DLLA 1IS3A 2OUHA 1Q8QA 4LO5B 4QPYA 4LK6A 5GLTA 5A3WA 1L7LA 3GZAA 3VKFC 2F17A 4GWIA 5FWEA 3MIGA 3OUJA 2WJSA 5GZDA 3VDCA 5I8TA 4PF1A 1RUI1 2VZPA 1PIV3 2A7AA 1TVGA 2I45A 1H9WA 2ZGRA 3MIEA 3OYWA 4KBZA 4AVSA 1AR83 3JCIA 1BK1A 2WO7A 5F6LB 2DYCA 2G19A 4Y3OA 3KV9A 2YBKA 4XABA 5FY9A 4XE9A 4HL0A 2VXJA 1SCSA 3OUHA 5IK8A 4Z2AA 1RUD3 4AFDA 3GZTB 1WLTA 1RGSA 4U36A 3BI3A 3WDXA 1HLCA 1REEA 5FOJB 2WNOA 2ZHLA 2R073 3VKNA 4UBHA 4QWNA 4XACA 3ZFFA 4LOSA 2QQIA 2JG8C 2PAEA 4XFBA 3PUHA 1IPSA 2XJQA 5BNNC 3RFRA 1REFA 4NE9A 4BQ2A 1W03A 5GLVA 1ND2C 3OCPA 3OTFA 3IZOA 4Z07A 1AXZA 2WWSA 1R083 4OHZA 4RA0A 5C33A 2O1QA 1MS8A 1T6GC 5FZ0A 3PVNA 4JKMA 4B1LA 5CBLA 3NQHA 1VRH2 2HWD2 3ABZA 2VW0A 3RWNA 5IHRA 3AZYA 2RMU2 2Z69A 5K8SA 1D2QA 3BALA 4IE7A 4A41A 1NLRA 1RUI2 1UL9A 2WYSA 5JZGB 1JYNA 4FTBA 3W20A 2BVVA 3H1YA 1LR5A 1UIKA 4WVWA 2H0VA 1YFUA 3JD72 1EP0A 4K7JA 2QQPA 1OA4A 5FZKA 3D4KA 5F1RA 2BP6A 2VZQA 3MF9A 1POV0 4KWUA 1AHSA 1ZNPA 4QB1A 3PUSA 4L11A 1DHKB 1I1EA 2QVSB 4WVVA 4CCLA 3NVCA 4KWLA 4GAZA 1V70A 2Y64A 3QH6A 3GM8A 4PIZA 4XFHA 1A78A 3K51A 3POGA 4TXWA 3VN4A 1SBDA 5E88A 1W39A 2VU9A 5ACA1 3B02A 4F8AA 1EV11 4MADA 3LIHA 3WQ0A 2KR2A 4XIKA 2FDFA 4IV1B 1DF0A 1GWKA 2RS31 3M4FA 2IFWA 1B35C 5C5UA 3D3AA 2CSGA 1RUC3 4I02A 3RZGA 1CAWA 1K5MA 3CZJA 2WQ4A 4B4QA 5FY4A 2NP0A 4M0NA 3E6CC 3S6PA 1YJLA 1W6PB 4CCDA 3AKRA 2HJIA 5A1AA 4IV3B 1KQRA 5BY5A 5D8AC 1QJY1 4CUGA 2HWD3 4PLOA 4W6XA 3K77A 1H4GA 1UMZA 1A8MA 4KGGA 4NIHA 1WCDJ 1J1LA 2RMU3 5FFOC 3PIJA 4GWNA 1PHMA 3THTA 2E9QA 5F3GA 5FMOL 1JZ8A 3TWIA 2FDHA 1KRIA 2D6NA 3VBFA 2RV9A 3N7MA 2W1QA 3JD73 1Q5OA 4DRVA 2VJXA 4J1XA 4Y1VA 1D0GA 2QKDA 1F9KA 3EBRA 4IW3A 4GJZA 4DRRA 1J58A 2WN3A 2ORXA 4QQ2A 1VBD2 2CDPA 4LBNA 4WZFA 1DFQA 5FO8B 1XU1A 1SPPB 4CXYA 4BDVB 4WM8A 3D82A 1LRHA 3KV6A 3ZSMA 1IG3A 2B5HA 1QJU3 2SBAA 3N9PA 2CV6A 3B5LB 4XPVA 1OD3A 1CQ9A 3MLLA 2RS13 3J8F1 4LE4A 2ZAHA 3CIHA 4JX0A 2ZGNA 4X6RB 1UY1A 1ZBA1 1QWRA 3S57A 1VMHA 5L9BA 3MPPG 4D6RA 5C3SA 3OBZA 4UYBA 3UESA 4R9BA 5LATA 1LODA 4UFIA 5IVCA 5A7WB 3ROUA 1YQ6A 2VOTA 3OBRA 3OD0A 4IESA 3J7HA 4LNVA 1UY4A 2HKXA 5C3RA 4ARXA 3U37A 4DEQA 3P5BA 2H6CA 1JYIA 3JXSA 4YFWA 2ARCA 2RS51 3D0SA 3ZFEA 3K4DA 3PUAA 3ZXDA 1JOJA 2FMYA 3IDCB 1V6LA 1VAKA 2GMMA 4FT8A 2DUOA 3VHOA 1GQHA 3ES1A 2G9ZA 4DUXA 5L36A 4JGZB 1O4ZA 1S2EA 2JG9C 3TAYA 4I2OA 1CPMA 1NUKA 3IM0A 1G9AA 1R091 4UXAA 1AYN1 2ORZA 4PJYA 5CADA 1VBC1 1OA3A 2VOVA 2D44A 1VE0A 3ACGA 3QACA 1UD1A 3TYJA 5AFEA 1DP0A 1CAVB 1HV0A 2DUPA 4R9CA 4COUA 4ES8A 5LY1A 1ND3A 4PDWB 5FV3A 3A21A 3R0RA 5JI9A 1UXXX 1IZ3A 2IXJA 3CO2A 5CZKA 2V73A 1IKPA 1WD4A 2GC0A 1RMU1 4O9EA 3RJ2X 4Z92B 3J8F2 3AYEA 2VMIA 1VBD3 5E6HA 4AQ2A 4BM8A 4AE2A 1QDCA 3AZXA 2BFUS 3OY8A 2Y0OA 2C6SA 4QX0A 4XOGA 4XQDA 5C9AB 3PTYA 3RYRA 2JEMA 3INAA 2VNRA 4KGQA 5CFDA 5FK8A 5F3CA 4Q0SA 5DQ0A 2W91A 3RQ0A 1TME1 4YVSA 3OEAA 3WX5A 3IIIA 1UZYA 4NWVA 4C0BA 1F31A 3ES4A 3MIFA 1VMJA 3A23A 4MH0E 2Q8DA 4XJUA 5JXIA 1ULDA 4YFZA 2RDQA 2WT2A 1WCUA 3NNLA 5LASA 3VBSB 4WM7A 4Y1ZA 2RDRA 3MW2A 3DECA 5FZAA 4F3JA 2ZGMA 1DGLA 2EXHA 1AYN2 2YU1A 2PFWA 2EXKA 4PLMA 3I59B 4XQ4A 2WQZC 1S1AA 1IPJA 5F6KA 1N1SA 1NX9A 4XBQA 5ABJB 3VHNA 1O5UA 4UF0B 4P9JA 1X82A 4CDUB 1J59A 1W6MB 1RVF1 3OD4A 4Y5TA 5C8CC 2VVEA 2OA2A 4P9YA 5FMBA 1E5IA 2BU9A 2VTFA 1BKZA 4RS5C 2ZX3A 2E63A 2ZZQA 3TB0A 5K0UA 1PVC3 3X29B 3ZIXA 4OULA 2RE9A 2YHJA 1UCXA 4XILA 1H8VA 4NO4A 4YGBA 1V6IA 4YSFA 3APBA 1UX6A 1U12A 3URFA 1OOPA 2CWMA 1BZWA 2AC1A 3WDWA 1F4AA 5A7PA 2HWB1 3SLIA 4ATEA 4CEWA 1H8TA 2FZ2A 1TME2 1GR3A 2XBO1 1VP6A 4L2NA 4Q5OA 4XQWA 3CQOA 3SCGA 2J1EA 2XH6A 3T4HB 1YO8A 1ENQA 2VQUA 4I0AA 4B4PA 4KG0A 4MXWB 1OF3A 3ZPOA 4AEDA 2RDNA 1QU0A 1LHOA 5F5IA 4ZU5A 5C5TA 4IGOA 2ZKLA 5F39A 2JDPA 3VBUA 1H0BA 5DMYA 1AJKA 4OMDA 4YW6A 2VULA 2VZUA 3MBWA 1Y9GA 5FZ1A 5A3OA 1APNA 3V0AA 2G9FA 1Z78A 4MHUA 1HRI3 3T1LA 1WBLA 1LOEA 2XDVA 2Y6FA 5HV0A 1UOJA 3IPVA 1OQ1A 4NMIA 4IE4A 5FXWA 2J42A 1V00A 2G9GA 3I2DA 2B9UA 5A33A 1MACA 1XYNA 1NCRA 2YZ4A 4AVVA 1PM4A 5BXXA 4HKOA 2BBAA 4QX1A 4XUOA 4S2HA 4O61A 4Y1YA 1FI2A 1AX1A 5F2WA 3VDDA 2HWB2 4O9GA 2DVGA 2JDHA 2YROA 5FZHA 4GH4B 4S2FA 4XF3A 4LIVA 4N53A 2OQ7A 2XMLA 3AP7A 4GMP3 2ERFA 2YUEA 2DTYA 1HRV2 4H3WA 5APAA 2IXCA 1RUOA 3O1MA 1CONA 4XYXA 4P9XA 5CKQA 4YZ3A 5FO7B 4QXHA 5J7MA 2R49A 2LUWA 3RVHA 2ZEZA 4LE3A 1POV1 2ZZJA 4XW3A 3H8UA 4GJYA 5FZGA 4BIOA 4Q29A 2VBDA 1QEXA 5FMOS 3TEWA 1LGNA 1YI7A 3HAGA 3OOXA 4JQTA 3H9AA 1HV1A 3BKZA 1XNAA 5KR7A 1BK0A 3GYDA 2HWC1 2X8KA 2WO3A 3WNNA 3IMNA 1ZM1A 4QDQA 5F7UA 1J3QA 2C5DA 3ZYGA 1XSRA 4OCTA 2JG8A 4LKEA 3VD3A 3OEBA 5BNNA 2VXRA 4CDXB 4QPWA 4CDWB 2J7MA 2P2KA 3ZN4A 2JDKA 4M3CF 4PI0A 1ND2A 2WNUB 4HFSA 1RL3A 1HX6A 2EIEA 1G9DA 4XHBA 4ZZ5A 1L7RA 2CHHA 4IEYA 1N3OA 3P1IA 3AL6A 2Y38A 3NMBA 3JB4C 1LOGA 3OJBA 4YW4A 4K1YA 4FAHA 4UFMA 1UPIA 2DVDA 4YVWB 1NY71 2ZHMA 2BPA2 5F9TA 1CAWB 2ZX2A 2VNGA 3FMGA 3WF2A 4Q4V3 1VAVA 1J3PA 2JENA 3WV6A 1SHWB 1GZWA 2JD4A 3D5OA 2E33A 1VLNA 3GBGA 3BTZA 2PHFA 4OUEA 2Q0AA 1PGW1 4RHV3 1Y3TA 2UY8A 1UYPA 2D6OX 3O1VA 5KC6A 2HWC2 2B39A 1X9TA 2GU9A 1LCLA 1YIPA 5GZCA 1V9U3 5DABA 2VD7A 3NAPC 1UZWA 1OMIA 5FZDA 1TMF3 4B7KA 3NV4A 4AAPA 2LROA 1DZTA 2ZACA 1AR63 3AVRA 1RUF1 3GHNA 4CCKA 5CKMA 5JDBA 1QF3A 2BQPA 3POWA 4BE3A 2GP5A 3HBZA 2VPVA 5FYMA 2SLIA 2PQSA 2QQJA 2ZX1A 3TBDA 3WNXA 1UNBA 1W0NA 3KCYA 4XXAA 4RSUA 3U0ZA 4QKNA 1XXNA 1B35A 4RQPB 4OQ8A 2AREA 1FPN1 4QXKA 3WG4A 3DCQA 5JPNB 3ZSJA 1OF4A 1SLIA 1G9CA 2FDJA 5FP4A 4I3GA 5A7QA 1WCKA 4HN1A 2B46X 3BUCA 5D8AA 2FDIA 1XNBA 1YHFA 4FPJA 1HQLA 3GJAA 3J7NA 2ZMKA 3DV8A 1KD7A 5FP3A 3I3MA 4LKSA 2VNVA 4YGCA 1C8M1 2MEV2 1ONAA 4IQPA 1Z7S2 4FPCA 3UJOA 3LDBA 2W46A 4AYUA 1OT5A 2GC2A 3M3OA 1N1TA 5KHJA 3OGJA 1WA4A 3ZFEB 4FOWA 2YFZA 2PQQA 3ZN6B 3SEEA 3RZJA 4E2GA 1WW5A 2GP3A 5FZIA 2Y6LA 3GGLA 4BK4A 2VMFA 5EWSA 2RJ2A 4JV4A 4GULA 2JXAA 3VKOA 3WF0A 1C57A 2XJUA 1BYHA 2YYOA 4NR1A 4CDQA 4DNYA 5B2GB 4X8NA 1VBA2 3F2ZA 2A1XA 5F3EA 4HBNA 1RUH1 4EN8B 5C4WA 2RR13 3AP6A 5FPLA 4QHBA 1TNRA 4DOUA 4K1ZA 3LB9A 3IB3A 3B3QE 3KT7A 5T5OA 4NOTA 3VZJA 3AJYA 3U4SA 1TNFA 4BQ4A 4IDZA 1F5JA 1O3RA 5KXDA 1RUG1 5FO9B 1NCQB 2QCSB 4LPLA 1HDKA 4DEVA 2EXIA 1GZTA 1EYBA 1H1AA 1MEC3 4E4DX 2R0HA 4IE0A 4LO4B 2ZKNA 3GBFA 3W9AA 2KD7A 1IS5A 2PLV1 2WLQA 4QQOA 1K5MC 4Z2WA 1C8M2 1SCRA 1R1A1 4LBJA 1AYM2 3ZDVA 2JDAA 3EJKA 5KHHA 3ST7A 4RR3C 1AR91 5B4XA 2BVBA 3H1MA 3WHTA 2R0FA 4D6SA 1W8NA 1NE4A 1JXNA 2JG9A 1JZ2A 1ASJ3 3FLPA 2MEV3 1Z7S3 1W6OA 1OSGA 4XETA 1MS9A 1BCXA 2XJSA 4ZXEA 1MZEA 4BJ0A 3VBFC 1JBCA 4JZRA 5LB6A 1X8MA 1ZZ9A 4J25A 2W0XA 2MNGA 1O8SA 3AXDA 4XXPA 4MGZE 2CDOA 1OA2A 1QOOA 2XUEA 4A42A 5LZ6A 2DBIA 3JUUA 4AHYA 3OSDA 1VBE2 3BTXA 1CR7A 2K2SA 1PO23 1G7YA 4MGKE 3VBHC 4NIGA 4Q4X2 1MZ5A 2Q1FA 2IZWA 4R9DA 2PHUA 2VZOA 2FBEA 3M3IA 5C3QA 4BQ5A 1C28A 2A3XA 2XHNA 3KQ4B 2A6YA 1RUJ1 1OOPB 3FUQA 2D6MA 3H7YA 4JGYC 4UT5A 3Q8FA 2D93A 4IGPA 5HPOA 2ET7A 3AP4A 3RZKA 1NQJA 3K75B 5LCWL 2YPJA 4EYUA 4LEJA 4AI3A 3O0WA 3UGHA 1JYTA 4AEDB 3B01A 1OLME 2D40A 2C4XA 1CAUA 2WAOA 2HBUA 1SFNA 4YZ5A 5C6CA 4NHMA 2V72A 5EP9A 4HKLA 5IVBA 5DAWA 1W04A 5I0RA 1BMV2 4D6QA 4FXGB 2VE1A 1Y4WA 4FPKA 3RMXA 5IFPA 1FV2A 3V0AB 1RTVA 4PIXA 5FMDA 4DINB 5C8CA 4X8PA 1UMIA 4B8EA 4C91A 1PMJX 2DVBA 4RS5A 4JHTA 1QXRA 3O1TA 2PMWB 3WNLA 3SXWA 2Q8EA 4AQ6A 3IPVB 1XPWA 5FKBA 5IJRA 4PHZA 1SLLA 5A33B 3ZDSA 5HI0A 1AXYA 2VBPA 1JHJA 4ZS3A 5A32B 1FX5A 1LOFC 1UKGA 4LA3A 2D3SA 5C8WA 2GC3A 1VBE3 1GSLA 4QGLA 2EA7A 1K12A 3MEPA 3MFCA 5A80A 5L7OA 1C4RA 3SCFA 4EN0A 3NWKA 4FPGA 5CFDC 3T0BA 1L3JA 3LIGA 4JAAA 1MS1A 2OVUA 4FPYA 2W94A 1HN1A 2P6HA 1SLAA 3EXUA 4E27A 4Q26A 3GF6A 1H2NA 4XF1A 1E5SA 2HWF2 1W6NA 4FTSA 4XAEA 3IBMA 2Z4FA 3BODA 2XPJA 4KQ7A 3RZLA 2BEOA 4AEMA 5BNQA 1OQDA 5CFCC 4ORFA 4BQYA 3J26N 2XVKA 4GB33 5AC92 5JPMB 3MV01 4LJHA 3AM2A 2Y60A 1ULCA 5LEJA 4OHWA 1N3PA 2RM21 2ZEYA 3MUZ1 5IVFA 1XU2A 4XFIA 5IAXA 4BCUA 1DQ2A 3ASIA 1AL21 1UWWA 3LA7A 2J1VA 3C7GA 2FZ1A 3AX4A 3WZ1A 4WVMB 4NWWA 3PUQA 4EZHA 1VBB1 2BW8A 4AGVA 1RUD1 5F32A 2ZAAA 2A3YA 2JIJA 3O7OA 1MQTC 3JBG3 4HVOA 1REDA 1C5IA 3KM5A 1WWYA 2VH9A 4AI1A 5C3PA 1WMXA 2W1UA 3WDVA 2X53S 5ISLA 3T08A 2W52A 4AI9A 3RI8A 4AW7A 2HWE3 5GKAC 3POJA 4EQVA 4LLFA 4NPRA 4XUTA 3I8TA 3K46A 4ARYA 2WFPA 5FY7A 1GZWB 3N36A 3N9NA 1R081 3DXUA 5JXGA 2Y6GA 4KWJA 1SLCA 4MO3M 4GALA 2JIGA 3T1MA 1UXZA 1ENXA 1MR5A 4HPKB 3VBOC 3WF4A 1U0AA 2A6ZA 3WDTA 5AFBA 4LBQA 3ILNA 1UX7A 1QJX2 1EAH3 4ISRA 2HWF3 3AK0A 1POQA 1Y9QA 5DDJ2 4GMP0 4Y1UA 3GJBA 5D21A 3UKTA 4ZKTB 3BIEA 5EQUA 1TEIA 3HN1A 2VGDA 1NA1C 3FHAA 3MV11 4LT5A 2CL2A 5AC93 4W65A 4LBQB 2WA3A 1CN1A 1E57A 1VBB2 2A6XA 2PHWA 1NCRC 2XLGA 4YWAA 1KS4A 4DZGA 4NRMA 4OQ9A 4Q1RA 4AOCA 1FAYA 2E7TA 1RHI1 3I3BA 4PT6A 4PQQA 5CNAA 3SQOA 3UT0A 4BQ3A 4IL7A 2HYKA 3THPA 4J1WA 1W6QA 4N53C 2NZ9A 2PAMA 4A3ZA 4BLJA 5DAPA 2WABA 5FYUA 5D8AB 1BQPA 1W9WA 2DF7A 2IFRA 3KS7A 5J98B 4AZZA 2WWUA 3IT8A 1GFF2 4BMBA 1AR73 4CEYA 4DY3A 5H9RA 1GOFA 1GQPA 1CJDA 4CCNA 1XQNA 4YARA 2C1FA 3WQ1A 4HG6B 1UY2A 4RGAA 2WYFA 4LHKA 5BNOC 1OFNA 1PO12 2CAVA 3HIFA 1OUXA 4QD2A 4XURA 1JUIA 2VMGA 1LHWA 4QXBA 2VCCA 3NJYA 3GBWA 3NAPA 3I2IA 4LKFA 1PVXA 3VKLA 2JJ6A 1FYUA 3H8RA 4A4AA 2WR9A 3MICA 3I2JA 5LRSA 5LA0A 3DKQA 2KM2A 2ZGQA 1QJX3 1RITA 4Q4Y2 2UWCA 2B4KA 5DDJ3 4R9AA 1FOD1 1P8JA 3FHQA 3I2FA 4W6YA 3N9MA 2OT7A 3MFAA 2BGCA 2ZHKA 4DQAA 3O1OA 1RHI2 4P00B 5FLIA 3AKSA 4ZY9A 5SV8A 5IVJA 1QQP1 2R16A 2TNFA 4P9IA 1K3IA 4XBNA 4CCMA 1RUE3 3OGRA 4NPMA 2X5IB 4PCRA 1VR3A 3EQEA 4QU2A 4XJ9A 4FPLA 4XFAA 1ZRDA 1KXGA 2Y6KA 3FZ3A 3K4ZA 3QOPA 2WSVA 1N3QA 2OZ6A 3LEMA 3ZYIB 5JR7B 5FQ0A 2RS11 2BNNA 1ZX5A 3QCWA 4ZU7A 5FLHA 4TSVA 2YC2A 1BEV1 2D6LX 3MLJA 2ZGUA 3WF3A 1KS5A 3C7FA 5J48A 4UBGA 4XTPA 1NAEA 1RJ8A 2BGOA 2JDYA 2XLAA 2R1BA 3B7MA 1EUUA 3GZEA 3MGUA 2D5FA 1V6OA 4UFJA 3KCXA 4TYSA 4BXFA 1PO13 1JYVA 2VQTA 5FPXA 4IEXA 3HQXA 3WXPA 3T2QA 1H2LA 5J36A 2A6VA 4Y4YA 4N8MA 5IW0A 3M3EA 1CIYA 4UW4A 1DGWA 3NV1A 5JSOA 3RYPA 1C1FA 1QQP2 3NV2A 1UO9A 4RGKA 3CU7A 2PHTA 5DZFA 1OPOA 3RNSA 2TBVA 1G86A 2XVLA 3PMEA 3PURA 4Y4RA 5FYTA 4OI1A 5BV6A 1OHFA 1ENRA 1FV3A 3ZSKA 3NW4A 1D0HA 4RN5A 3MHZA 4QX2A 5FK7A 4CU8A 2EAKA 3M3QA 4B7EA 4EWEA 3P3PA 4UW6A 4RR3A 4Y20B 4BIFA 1VRH3 1NT0A 3ZKUA 4UFHA 5FTTC 1ZZCA 1O6UA 4YGEA 1KDMA 5JWPA 2P17A 2XOMA 1RUI3 3IDEA 4UW3A 2Q8OA 5BUVA 3QBQA 5FMCA 3K2OA 4PI2A 2RJKA 3AMPA 4QPIB 3DPRB 1KDKA 2FMDA 3LZZA 2ZX0A 2DVAA 2Q1MA 1OVPA 2BWAA 3OPTA 1WGPA 1DCSA 2QBXA 3AFGA 3ZFGB 4JHZA 2FCUA 3H50A 3KHBA 4LO8A 1S0EA 3SKVA 5A6XA 1D4M1 2P5BA 4CDQC 3AXEA 4HSLA 1VB4A 2IUWA 5ACA2 3VBRA 3VBHA 3ACHA 2W5FA 2GMPA 1X36A 1EV12 3FFQA 4J6GA 5C4WC 2WZR1 2D3PA 5LW9A 1IPKA 5I0DA 3DGTA 1H1MA 2RS32 5H9QA 1N47A 1TZOA 1GP5A 4QDRA 2VW1A 3T30A 5FXVA 1K45A 4MV2A 4JGYA 5JSPA 3SCHA 3N7LA 1ZBE1 4FFGA 5FYVA 5LBCA 4A2UA 1WD3A 2WWJA 5FY5A 1QHDA 4URAA 5JVVA 3DYPA 4XDPA 1QJY2 3BTYA 3AP5A 5EHDA 4I0BA 1JZ4A 1I3HA 4YM2A 4K20A 4BU2A 1PK6A 3I3EA 2E31A 3NKGA 4BA6A 4AI0A 3ETPA 5J96B 4P14A 3G6JB 3NNFA 3ORJA 3ZR5A 4JKKA 3H3ZA 3WHUA 2F4PA 3WDYA 5DZEA 3I7DA 5I8SA 3NNGA 2X05A 2WNVB 3KV5A 3N3HA 4W50A 4MUVA 1YJKA 3CL1A 4M3CB 4CSWA 2JDMA 1J83A 2LM3A 2QQVA 2YGLA 4YLZA 1LEMA 2YB7A 5E1RA 3RMYA 2UWAA 2VMHA 2ZGPA 4AVTA 2TEPA 1W8ZA 1H9PA 5HV4A 5D1IA 3VZLA 5JZGC 2C9AA 3CKHA 4P5YA 4SLIA 4OHYA 1HN0A 1LOFA 3M7AA 2CGPA 2WBKA 1X7NA 2XJVA 2ZPXA 3CLPA 3SH4A 5FXXA 1ZBA2 5ACA3 1F5FA 4OFGA 4QKBA 1HRI1 2HH9A 1EV13 1FNYA 1UZVA 2BNMA 1RJ7A 3AZWA 3DN7A 1G6NA 5JMCA 5CKNA 3I2KA 3ZXLA 2RS33 1LJ7A 2IVJA 5A6YA 5KC5A 3I49A 2GAUA 2GDFA 2J1RA 2Q1ZB 5FZCA 2LALA 1NYWA 4M4PA 4BB3A 2IXKA 3CHXA 2NMOA 3HR9A 5F5AA 4IETA 3I4IA 2RS52 3E5XA 2Y34A 4XF4A 1HXS1 3ZR6A 3P3NA 2BTVC 3T2OA 5FPZA 4AG4A 1GWLA 3EO6A 1MS4A 4FFFA 4IV1C 1R092 5CFCA 1UYXA 1CZTA 2WLPA 1UIJA 3M2MA 2WA4A 1VBC2 5IAVA 3BN6A 2WZPP 3WW4A 3ZXGA 3LAGA 3NNMA 1BBT1 3SITA 3M70A 1A3KA 3KGLA 4IV3C 5EZWA 4GIQA 4NPLA 1RMU2 4IEPA 4QPGB 3E97A 3ILRA 3LSDA 4PBOA 2XKPA 1UOFA 1QNWA 4QB6A 3ZVXA 5FYZA 3WVJA 1SACA 2OW4A 1OKOA 4LBKA 4LXLA 1MQTA 3AP9A 5CISA 3V0BA 3J7MA 3I3DA 3ZM8A 4QHZA 4QQLA 5FYHA 4NAMA 1F2NA 3PLQA 4B1MA 4IERA 4XTMA 3J8F3 4MX3A 3RZHA 1IHMA 4RGGA 3LEKA 4DXSA 2VL4A 2JKXA 1ZBA3 5FZLA 5FYYA 2MPFA 1SLTA 3I54A 2WL1A 3C2UA 3RG0A 5L7OC 1ACCA 1HXS2 3S0MA 1RB8G 1WKYA 4DY5A 4D7YA 4NRQA 2X10A 3A0KA 3PNAA 1H6XA 2W1WA 1X33A 4WVZA 2W68A 2QQLA 3VBOA 3OYWB 1UYZA 4LBMA 3MIDA 5FY1A 2A5ZA 5LA1A 3RWKX 2XL9A 4Q4W1 1URXA 1DGWX 2WZ8A 2PN5A 5LA2A 3KGZA 5FJHA 5SV5A 4Q0PA 4BMEA 2QQMA 1IS4A 5FY8A 1RVF2 3NAPB 1R093 1NA1A 2WRAA 1S0GA 3J9SA 3AZZA 3ME2A 1AYN3 2I07B 2R041 2VBBA 2GMEA 2JECA 4QX7A 2VMEA 1JS9A 5FZFA 3WW1A 3ZFFB 5I93A 3K3NA 5IYYA 2BJSA 3LFMA 5FWJA 2J1AA 3AJZA 1PX4A 2WNEA 3C3VA 1ZA4A 1W9SA 1V9U1 4OLLA 4ZU4A 5DXDA 2XBO2 3O0VA 1TMF1 2VM9A 5FZOA 3HT2A 2VECA 4P5HA 1YFXA 1IOAA 3NJXA 3NSTA 1Y9MA 3USUA 5JLVA 1UF2C 1YC61 4PDWC 3KHCA 1NG0A 1JU4A 2ZEWA 4AI8A 1GMMA 4CCCA 4BK5A 1JZ6A 1H1IA 1TME3 3ZIWA 2EALA 1BJQA 4UI9L 2WO1A 4XCAA 3U10A 5BNOA 3W5MA 3DYMA 1GNHA 5F2SA 5TSWA 5HXVA 4Q4W2 3VHPA 1SBFA 4X6QB 2DV9A 2YC0A 3T2PA 4DB5A 5A1FA 4NIAA 1H30A 1YNAA 5JI7A 4L92A 5JSRA 4E4HA 5C9AC 4MGTA 3PU3A 4KWKA 4OZOA 5CYYA 2DFCA 2A73B 4BXSV 4AFAA 1PGSA 2DVFA 4D3WA 3CEWA 1YQ5A 2GNDA 1GOGA 2R042 4Z8BA 3N9OA 1RXGA 2FDKA 1W2UA 1WCQA 3HWJA 3ZYJB 4CPBA 5LK7B 2JDZA 1RVF3 3CZUA 2Y26A 2XWBB 2VQAA 4TTGA 4Y5SA 1NLSA 5JUVA 3SEPA 3WUCA 4D94A 1XJAA 4GXLA 3M8LA 5CEHA 3KF5A 3R05A 2FHRA 2R061 5J1XA 5A3PA 2ENRA 1UOGA 2EXJA 3R4SA 3SNMA 2RR11 2VC9A 4Q0QA 1W9YA 2D97A 2HWB3 3D8CA 2NLRA 2ZHNA 1K5MB 3J7LA 3LD8A 4GKXA 1GP6A 2HLEA 4QM9A 4CDUC 3POIA 4IEVA 1JYWA 3Q8CA 1HRV3 2Y6HA 3SISA 1NLQA 2QQOA 4XJWA 1VPHA 4YRDA 1Q8VA 4D7SA 3CJXA 5IK7A 2ZGTA 4AI2A 5DZGA 2B42B 4CEYC 3GALA 1WBFA 1ODNA 1SDWA 2BOIA 2K46A 4Y1XA 3TRSB 3ITQA 3Q8AA 4B4RA 1CX1A 2R6QA 3VBFB 2E32A 2E51A 2W9XA 3WNMA 2CYFA 2EIBA 5KHKA 1KEXA 2P4EA 4IE6A 3UKNA 1DDLA 4RYDA 1VAMA 1KFXL 3J4UH 3ZX7A 4C90A 5IK4A 3K4AA 5IVEA 3KV4A 2DU1A 1V6JA 5T54A 1LOCA 2OQ6A 2OPKA 4CVUA 1S0FA 4EWDA 2P37A 2GSYA 1QH6A 4G3YC 3MF6A 1ASJ1 4WM8B 4AFCA 1PZ9A 1WZXA 4OVEA 4A44A 1XC6A 3ZMOA 3BU7A 2WS91 4HT1T 5DUVA 5I0TA 2ZMLA 5IVYA 5T55A 3KT1A 3RDIA 1NY72 1HJGA 4H2AA 2VAUA 2ZEXA 1UKRA 3CF6E 4KNCA 1QOTA 2A6WA 1W0PA 1QDOA 4DIQA 5ANQA 2OX0A 1OH4A 1NKGA 1PO21 1VB2A 2I74A 3UV9A 1PGW2 2ZS6B 4OI4A 3RS6A 4AVCA 3OPWA 2CGOA 2AENA 5T52A 3AKPA 2F6BA 4YW3A 3WF1A 4AL9A 1W8OA 1ZZ6A 4Q8KA 4XIOA 2RDSA 4XHXA 1U5IA 4HONA 4GH4C 1W2TA 3EHKA 1A8DA 2JX9A 1LENA 1VALA 4LULA 3WCRA 2XXZA 3VL8A 2HWC3 1RUF2 3THDA 1FMD1 3OF1A 3H7JA 1OD5A 3ZPYA 4UW5A 3KMHA 2HBTA 2R32A 2ZABA 1SEFA 4LKDA 4QGNA 5LK5A 3UKVA 1MPXA 1ND3B 3LFIA 1GYKA 1ZYBA 1W8FA 2YPDA 4QX3A 3FN9A 4FQ4A 1FPN2 5FBJA 3VLBB 1UZ0A 2R30A 3EYPA 4L9BA 4YM3A 3O14A 2O0OA 1UU4A 4R8HA 1NZIA 5FZ7A 2ZBJA 3GCXA 3OY8B 2BOJA 2XKOA 3ACLA 3WR0A 4A7ZA 4XFFA 2JWPA 1GKBA 1JTZX 5CFDB 2QFEA 3HNYM 1KJRA 2P3IA 4MGYE 4ASMB 3KVAA 2DCKA 3SH5A 1S0BA 4CDXC 4YVSB 1OLMA 3AZVA 3D6EA 4RL7A 3FC0A 2WNUC 5FUIA 3VZNA 2YXSA 4HK8A 4ZONA 4AAXA 3KVBA 4LA2A 3TNQA 3WP4A 4WM7B 1UMHA 4IEOA 4V1PA 3ZOIA 3OGGA 1QNYA 1FMD2 4H7LA 5BNPC 5C70A 2CTVA 1RUH2 3LSEA 4YVWC 4PBPA 4P9LA 5JZGA 1OURA 4Z82A 2BV4A 3H3UA 4M00A 1OUSA 1SBEA 3VL9A 5CB7A 3N35A 5EJ3A 5FP8A 3OB8A 4FTEA 3VBRC 1RUF3 1RUG2 1VBA3 4HKWA 4JTOA 2G4IA 5K0UB 3PU8A 1YIFA 5FZBA 3C7EA 2GH8A 3JQWA 2RJLA 2BERA 4FP3A 4N43C 4YG6A 1Y7BA 3FHIB 2WINB 4GB31 4MYEA 4YW2A 4UFLA 4LORA 1LNSA 5IWFA 1FPN3 2VZ1A 1GBGA 3H8OA 1RC6A 2PLV2 3KB5A 4CEWB 4RFRB 1H8TB 1F4HA 1R1A2 2R1DA 4P02B 1QY4A 3P6BA 4TLFA 3AMNA 1AR92 2JE8A 4ATFA 1S55A 4HLTA 2GNBA 1C8NA 3BB6A 3IDBB 4WZCA 4AEKA 1XNTA 3KF3A 4FPHA 1PK6C 1XE7A 1LGCA 4IV1A 4NHYA 4BH9A 2EIGA 3JBG1 1C8M3 4LHLA 5FZ8A 5L19A 4LBOA 5EJZB 3LPFA 2FDGA 1AYM3 3VBOB 3VBUB 4YZ1A 1ODMA 1COV1 2G1MA 4PIYA 3SHRA 2Y6JA 2PELA 2DU0A 1LHNA 4K3UA 1W6PA 1Z0HA 2HWE1 3LF7A 1GNZA 4IV3A 1W9TA 1PMIA 4AWDA 3SC7X 3KQRA 3VKMA 4U2AA 2DTWA 2X09A 5LBFA 3K3OA 3MYXA 1SFYA 5J37A 2O8QA 2VTXJ 2V5DA 4AGGA 3TN91 1NA1B 5FZ6A 2V09A 5CU1A 1NQDA 5D2AA 1RUH3 1NCRB 4MGIE 2YU2A 2QQKA 2DCTA 4ZS2A 3OUIA 4BISA 1G9BA 1RUJ2 1J84A 4YM1A 1EAH1 2ZA9A 3OGSA 5J09A 3VDDB 3ETQA 5CA6A 1J1TA 1SG3A 1AVBA 1SFPA 5F3IA 1V6MA 3W5NA 2VG9A 4Q4X3 2EAAA 1S0JA 1V6KA 3NNJA 2YG0A 3LOBA 4N53B 5F5QA 4CP0A 3HMYA 4CUAA 1AZDA 2XONA 1SPPA 4HN0A 3UGGA 3NL1A 2WFF1 3WQBA 3B9IA 2VUAA 4NAOA 1V0AA 2ZGSA 3LGRA 4KBBA 4OYUA 1CD3G 1R1A3 4M01A 2K9ZA 5AVAA 1COV2 2ETEA 1AR93 5DUWA 4NIDA 5FZMA 3AMQA 3NO8A 1ULOA 2ILMA 2Z5WA 4S2GA 4ET7A 5K7PA 3ELNA 3HOBA 3WP3A 2IXIA 4V2WA 5LBEA 2P3YA 2Z2SB 2UYAA 2BDRA 4COWA 3LA2A 4QXCA 3TN92 1Q3EA 3RYKA 4UWDA 3TEXA 1PIV1 1ZRIA 1CAXA 2K0GA 4DS0A 4Y33A 1AR71 3AL5A 3VD5A 5FOBB 2NPIA 3ZXFA 2JG8B 4A7KA 1AR81 1DYOA 1E5HA 1ZRFA 5BNNB 1JMUB 2W92A 5LRRA 1ND2B 3VUOA 4D7TA 5BYNA 3THCA 1Q8PA 4JGZA 5HBAA 1CGPA 3ON7A 3U11A 2XG3A 4YW7A 3RZZA 1GICA 3UJQA 4OI0A 2A3WA 2D6KA 2C26A 2XQXA 3ZYFA 2R071 1CAVA 1XYPA 2VVDA 3ENRA 3PDQA 4PDWA 4EN6B 1W0OA 1UN1A 1S0CA 3WG1A 3HQUA 3MUY1 3E1F1 2A75A 2GH2A 2ARXA 1HB1A 3PL0A 2J22A 1WMFA 4H14A 1WLDA 1BXHA 4LBLA 5C7GA 1XB9A 1U5YA 2I2SA 3DL3A 3LA3A 1RUE1 2A70A 5C9AA 5FDBA 2UYBA 5FPAA 3C7OA 3WP6A 1LU2A 1UZZA 1YWKA 1CPNA 2AYHA 2AEYA 2RM22 1PIV2 2VOWA 1A34A 4CXXA 4TLGA 3LDKA 5FJKA 3VD4A 4KH9A 1AL22 5A3NA 3ECQA 3VD7A 4EJRA 5L9RA 5FP9A 4A6SA 5JOYA 3ZXKA 5I8YA 3LPGA 2YBPA 1R64A 1OC1A 3POYA 4FI9A 1RUD2 5F8PA 4ZHNA 4UOJA 1H2KA 1NZCA 1B35B 2R072 5L9VA 4M3CE 1LB2A 2GNTA 2WDBA 3AVSA 3B69A 4LO6B 3UGFA 2V4VA 5F5CA 4EROA 1OPMA 2WQ8A 4CDUA 2TUNA 1W6MA 4FFIA 5FZ9A 1CX4A 3ZO0B 2VY0A 2WSUA 1JZ5A 1ULPA 4Y5Z0 4K8RB 1R082 4V2VA 1QMJA 2LTNA 1LAJA 1ULFA 4QKFA 1PX3A 1ULGA 3POFA 3I97A 4NVPA 1IKQA 3SKJE 5C3OA 2WT1A 5JIUA 4QU1A 1RUC1 2BYVE 1IQAA 1XRUA 3AYCA 4ONUA 4GKYA 2AEZA 2UY9A 3ZLIA 1W06A 3GNEA 1HW5A 2DCZA 3T4VA 1MZFA 2NMNA 5KHIA 5FYIA 1VRH1 2HWD1 1BHGA 2IVIB 2XL7A 3MW4A 4MXWA 1D7PM 1Q43A 3S7IA 4CDQB 3LWCA 5JCTA 1W8HA 2C24A 2RMU1 1XBFA 3FUOA 3H3LA 1XSQA 5C4WB 5LA9A 4QGMA 2RM23 1XNKA 1WUVA 3KWVA 4XZUG 4E4SA 4E8DA 3PIGA 4HMZA 4K9SA 4JTNA 1AL23 3JD71 4AVBA 2ZX4A 1QXJA 4DUVA 4B3NA 1CIWA 1GU3A 1CJPA 3VDBA 4EE2A 4HOOA 2VOKA 1VBB3 3ZN5A 2VMCA 4XDQA 1H6YA 4CA9A 4XFGA 4FSJA 1BVP1 5EPAA 1EPWA 5BPXA 1CZVA 2CY6A 2XUMA 3I2HA 1UPSA 3N7JA 2OKXA 1MVQA 1QJU1 1O59A 3BCWA 2YY1A 4FPFA 1LTEA 5FR3A 2OYZA 2D6PA 4TWTA 4BWOA 1J3RA 1RUC2 1GLHA 4Q1PA 3IAQA 3F95A 1XNDA 4GH4A 4OUMA 4BLIA 4YGDA 2OUJA 3OBTA 1C5HA 2XJRA 3CJIC 2JG9B 5FRAA 3ZYPA 1JN2P 2ADEA 2IXLA 1LKNA 3GHMA 3NRUA 5CG9A 1W6OB 4DXRA 3CDZB 5FXZA 2VNOA 2DUQA 1IG0A 3PVOA 1QGLA 1YQCA 3IAPA 3LDRA 3IN9A 1DQ6A 4XUNA 4UAPA 5EFUA 4LHNA 1FOD2 1JOBA 1UQXA 1QXPA 1I6XA 1ENSA 2VZRA 5DG1A 4M0HA 1NE6A 2BUKA 2D7FA 2WT0A 2JE7A 4XZPA 2P3JA 3UETA 1JYXA 4FQZA 1C1LA 3H42B 1QH7A 4G9SB 2D43A 4Q4Y3 3WD5A 2D3RA 4XVHA 2QNKA 2NQYA 4AK3A 2WKKA 2VW2A 2ID4A 3UNPA 1RHI3 2YFUA 1DG6A 4CDXA 2JICA 1QJU2 2PYTA 4CDWA 2XJPA 1X9PA 2WNUA 2ZGKA 2RS12 3VD9A 2VTXA 4MVTA 2MHFA 1VBD1 2WN2A 3HVDA 3M3CA 1RUNA 4W8JA 1H2MA 2GALA 5HCFA 2YC4A 1BEV2 2J1SA 3G7DA 1F15A 3FBYA 1CAUB 4FPOB 5KXCA 4CU6A 5LWBA 2B45X 5BNPA 4YVWA 1JHNA 3Q9OA 2VCBA 3U14A 1IQDC 3O1UA 3PVEA 3FFZA 1SLBA 3FX3A 3TOJA 3WLUA 5KXBA 3V56A 4SBVA 2FCVA 1GV9A 5EYYA 4AFMA 5C8CB 4C1WA 4RS5B 5DAQA 3UK9A 2HEYF 3T3YA 1GWMA 4E4ZA 4YNIA 1JW6A 4QMAA 1OVSA 4N43A 5CAZA 4XF9A 2IXHA 1DQ1A 1FOD3 2AACA 1W8WA 3WEZA 3E5QA 2YBSA 4AF9A 5FYBA 2F4LA 2WC2A 3H1WA 3Q8BA 4YW5A 3U75A 1QQP3 3KLSA 5GM0A 5A1LA 4HANA 5GLZA 1UU6A 2CGNA 1GQGA 5L7OB 4CPBD 1HIXA 1PVC1 1NOVA 2VMDA 1AL0G 3B00A 1O91A 3MW3A 2QZ2A 3D0JA 4A45A 1YI9A 2OXBA 2Y8KA 4E2QA 2FD8A 3ZYHA 3EB7A 3ZXJA 2P3KA 4RQPA 2B7YA 2QQWA 3UYJA 2IC1A 3JB8A 3WCSA 2P1BA 3ZYRA 3RZMA 1BVVA 5FPBA 1O4TA 2PHXA 3B93A 3FL7A 3RGBA 1W6NB 4RD7A 4BYYA 1H4HA 1RXFA 1S2BA 4EN7B 1BEV3 2XGXA 2DBNA 1D4M2 2W47A 2X5IC 4DPNA 3WNPA 5A7OA 4QT6A 1F8VA 1JU3A 5HCBA 3U78A 2JDNA 2WZR2 3HD8B 4AR2A 2W3JA 3MDPA 5JOXA 1B09A 4WV8A 1CAXB 5E16A 5FLJA 5A7SA 2H0BA 5EYXA 4AEJA 1ZBE2 2EVXA 1O5LA 2VCAA 3ZN6A 2OZJA 3O12A 4I30A 1W3XA 1MS0A 5FZ4A 2JB8A 4LR4A 4MOAA 2ZGLA 3WW2A 4C0HA 5IATA 4CP1A 5JXJA 5LEKA 3WG3A 4ZPIA 3AC0A 4OI2A 4YZ2A 3E6DA 1O3SA 1PVC2 2XLFA 3ATGA 4PF5A 2N7GA 3TNPB 1YCIA 4FOYA 2BNOA 2CU5A 2JB4A 2VCMA 4QB2A 2VZSA 1W8UA 3CNAA 4JDNA 2VUJA 1LU1A 1WW4A 4CE8A 1QJY3 4W6WA 1IS6A 1AJOA 4FOVA 5LY2A 4QX5A 4OUSA 1NCQA 3W59A 1TQ5A 3PTRB 1M06G 1DGRN 1ZZ7A 3OPZA 4GMP1 4FVVA 3PJYA 4NHKA 5AVPA 5F37A 2GN3A 4CP2A 1HB2A 4IGQA 5DAVA 4CCEA 3WDUA 3BGAA 4LK7A 1MVEA 3B94A 3DF0A 4LBQD 1OXCA 2UWBA 3KCCA 3I2OA 1DZQA 2XQRA 1AXKA 5FCCA 3HNBM 1D4M3 2B9VA 3DXTA 3JU9A 4FXKB 4DXZA 1W2OA 3RRDA 2QQUA 1HRI2 2O14A 2WZR3 4MLOA 2BGPA 2NYYA 3E5UA 1AUYA 4DXTA 4LIUA 1ZZ8A 4QPIC 3DPRC 2VZTA 4JKLA 1VRBA 4FPEA 2QTWB 3WG2A 1ZBE3 3ZFGC 3ILFA 5A7NA 3WNKA 1U5XA 1JZ7A 2WO2A 4Y24A 1IGOA 1W6QB 1WCSA 1ZRRA 3AYDA 2LW8A 2W1SA 4OHVA 4YW1A 3KD4A 5FIXA 2W95A 4COVA 2VR4A 2YGMA 4NN0A 5I0UA 4P9GA 4IEQA 1CVNA 2UU8A 1FATA 2YV8A 3WY6A 4FBFA 1PM7A 3DYOA 4OHXA 4XJ8A 4CEYB 3LOIA 2RS53 4PLNA 4W4ZA 2W2IA 1W3VA 3VZOA 1HB3A 1FT9A 1L7QA 2J1TA 4GA9A 1BBT2 1MZ6A 4MSVA 1KITA 3K48A 4Q4V1 4L8QA 1SQ4A 2D5HA 2WIIB 3W21A 4LOTA 1W2NA 4I01A 1YFYA 4FOQA 1HRV1 1VBC3 4C8DA 2E7QA 5JIAA 4RHV1 4A7YA 4K6BA 5FZEA 4QAWA 2QDNA 5GLWA 1UU5A 4YZ4A 3ZSLA 3FWEA 5L73A 1JOPA 1RMU3 4HVQA 4AHZA 3N7KA 4CUCA 2WNVC 2Q30A 4JGZC 1XE0A 3S7EA 5A3LA 4IEWA 5IT6A 4R4XA 2PA7A 1ALYA 3LCPA 1RIRA 2QQNA 1AR61 4QHOA 1I5ZA 2XWJB 4IE5A 4ISQA 1DQ5A 2FCTA 3WSOA 2CAUA 1EPZA 3A22A 4INDA 2QDRA 4MGQA 4YPJA 3UL2A 4AHWA 3GCWA 4Y22A 5A6QA 1S0IA 1WLCA 4HK9A 4E8CA 5A32A 2WAAA 1U5ZA 2ES3A 2PHRA 1DU3D 4IEUA 3WW3A 5A70A 4OMCA 5DN2A 1HXS3 5FQ0B 2LRPA 5FPVA 5T3NA 4Q4V2 3LE0A 4OZXA 4Q8LA 3IKWA 1AF9A 4Q0UA 3NV3A 4K8FA 5GLUA 5GJ6A 1W9FA 2ADDA 2L9LA 4IEZA 1STMA 4RHV2 3ZYBA 4XDOA 1M4WA 2JE9A 4CP9A 2CNAA 4Z1VA 4XC9A 1BBT3 4GD4A 4C1XA 1VIWB 1CWPA 2AGSA 2J1UA 1QJZA 3V65A 3O1RA 4DO0A 1LHUA 1PNFA 2V4AA 1V9U2 3VBSC 5HCHA 3L2HA 2DFBA 5IUQA 4BZ4A 4YM0A 1TMF2 1JUHA 1MS5A 4I0WB 1SZBA 2WZEA 3A7QA 1AR62 4JVAA 2ET1A 4UFKA 1O3TA 4NHXA 5FP7A 1LHVA 1VMFA 5ABJC 3MZHA 4BQXA
chains in the Genus database with same CATH topology
4XURA 1XNTA 2ORZA 2VCCA 3ACGA 1DP0A 3I2IA 5EJZB 3LPFA 2VZ3A 3A21A 1UXXX 1UY0A 2Y6JA 4A4AA 5CZKA 3I2JA 5LA0A 1W9TA 1GUIA 1GNYA 2BZDA 2X09A 3HJRA 2B4KA 5EIYB 1P8JA 3FHQA 3I2FA 2V5DA 3PUIA 3WNOA 4D0QA 4QX0A 4P00B 4ZY9A 5DQ0A 4CU7A 2QQKA 2W91A 1K3IA 3OGRA 1J84A 3OEAA 3IIIA 3OGSA 4GWJA 2VZVA 3OG2A 1SG3A 5JXIA 3A23A 3W5NA 2Y6KA 2YG0A 3K4ZA 3NJVA 4MGSA 1UY3A 4M4RA 3ACIA 4CUAA 4XUPA 2XONA 3DECA 2VO5A 3WQBA 4OYUA 2YC2A 1NX9A 4IUGA 3HEIA 3WF3A 1GOHA 3C7FA 3T0AA 4ZZ8A 1NAEA 3LEGA 2BGOA 1EUUA 4ET7A 1ULOA 2VTFA 1JYVA 3HOBA 2C9KA 2VQTA 3T2QA 2ZXQA 3VD5A 1CIYA 2HYXA 1DYOA 1F4AA 2W92A 3IDAA 1TG7A 3CQOA 2J1EA 3THCA 2EICA 2VQUA 5EJ1B 1OF3A 4RN5A 4LHSA 3OGVA 4QX2A 4CU8A 2C26A 2XQXA 5DMYA 4OMDA 2VZUA 3MBWA 3C7HA 3MUY1 3E1F1 3GDBA 2XOMA 2J22A 5C7GA 1K42A 1KGYA 2QBXA 4JHZA 3LEIA 3C7OA 3SKVA 2BBAA 4QX1A 3ACHA 2W5FA 4XUOA 4CUBA 3VD4A 3LQCA 3ECQA 3VD7A 5I0DA 2RVAA 5IFTA 3ACFA 4QDRA 3LPGA 1K45A 1R64A 4FI9A 4UOJA 4LQRA 4KMQA 4L0PA 2ZEZA 3DYPA 3T09A 2WDBA 2V4VA 1JZ4A 2WQ8A 5JR2A 3I3EA 1T2XA 2E31A 1XNAA 4CU9A 3ETPA 1JZ5A 1ULPA 4JKKA 2WO3A 3WNNA 1PX3A 4QDQA 5DPNA 3NNGA 3HNMA 3I97A 2X05A 5F7UA 4W50A 3SKJE 1J83A 3VD3A 4KI5M 3OEBA 5JMOA 2YB7A 4QPWA 2J7MA 2EIEA 1US3A 3CKHA 4P5YA 5JXHA 1BHGA 1L7RA 4ZZ5A 1D7PM 3P1IA 3CMGA 2WBKA 2JD9A 4XZUG 2LS6A 3GXUA 4E8DA 3T0DA 2WUHA 4QDSA 3I2KA 3WF2A 4DUVA 3VDBA 1GU3A 1SHWB 2J1RA 1RYYA 2R7EB 2E33A 4M4PA 1O8PA 2VMCA 1H6YA 4OUEA 5G04L 1I5PA 1CZVA 3I2HA 2W87A 2OKXA 1PMHX 1O59A 3T2OA 4AG4A 1CZSA 1UYXA 1CZTA 3BN6A 3IAQA 2PQSA 2QQJA 3NRUA 4DXRA 1W0NA 3CDZB 3IAPA 4XUNA 4QB6A 4UAPA 1JZ3A 3MO4A 1EUTA 5G05L 1OF4A 2VZRA 3I2GA 3I3DA 3ZM8A 3UETA 3OBAA 1JYXA 3LEKA 2DCJA 2VL4A 1YQ2A 2JKXA 4XVHA 4DXSA 4LKSA 1UYYA 1SDDB 1WKYA 2W46A 2ID4A 1OT5A 2X10A 3UNPA 2YFUA 1H6XA 2W1WA 4DUWA 2YFZA 3HPNA 3SEEA 2QQLA 2Y6LA 3VD9A 3GGLA 1UYZA 2WN2A 2DDUA 2VMFA 4BK4A 2RJ2A 4W8JA 3WF0A 2YC4A 5LA1A 2J1SA 2WZ8A 5LA2A 3F2ZA 2QQMA 4CU6A 4A6OA 2VCBA 3IB3A 1IQDC 5IYYA 2VMEA 1W99A 4LPLA 4DEVA 1US2A 5C71A 4XUQA 2J1AA 1PX4A 1W9SA 2KD7A 2VM9A 1JI6A 3WEZA 2JDAA 3NJXA 5B4XA 5HXMA 1JU4A 2ZEWA 1DLCA 1GMMA 1W8NA 4BK5A 1JZ6A 5B4NA 4UI9L 2WO1A 1JZ2A 3VDAA 3HN3A 3W5MA 3DYMA 2VMDA 4A45A 4D8MA 4GZ9A 2Y8KA 4ZXEA 4BJ0A 3EB7A 3T2PA 1O8SA 2EIDA 3C8XA 4P08A 4BXSV 3FL7A 2CDOA 4OZOA 5CYYA 4A42A 1GOGA 2W47A 1WCQA 3WNPA 2E26A 2VZOA 1JU3A 3CZUA 4TTGA 2XHNA 2W3JA 5JUVA 3SEPA 4GWIA 5HPOA 3VDCA 2VCAA 4PF1A 2VZPA 5J1XA 3K75B 1TVGA 5LCWL 2VC9A 4MOAA 5JXJA 2HLEA 3AC0A 2C4XA 2WAOA 1JYWA 2Y6HA 4Z2AA 2QQOA 2V72A 4QB2A 2VZSA 5IFPA 1CX1A 2QQIA 3PUHA 1UMIA 1PMJX 2E32A 2W9XA 3WNMA 2EIBA 3WNLA 1KEXA 4RYDA 1XPWA 5IJRA 3K4AA 4JKMA 3NQHA 3BGAA 1JHJA 3ABZA 4CVUA 5IHRA 3HNBM 4A44A 1XC6A 1K12A 2B9VA 4A41A 2WYSA 1JYNA 3T0BA 2ZEXA 2BGPA 2W94A 1HN1A 4DXTA 2VZQA 2VZTA 4JKLA 1OH4A 1NKGA 4KWUA 4QB1A 3WNKA 1JZ7A 2WO2A 2Z4FA 2LW8A 2W1SA 3WF1A 2W95A 2VR4A 1W8OA 2Y64A 3GM8A 3MV01 3DYOA 4TXWA 2ZEYA 3MUZ1 4W4ZA 4MADA 1L7QA 2J1TA 3THDA 1UWWA 2J1VA 3C7GA 1MPXA 3D3AA 4QX3A 3FN9A 3CZJA 1UZ0A 3EYPA 5A1AA 2W1UA 4QAWA 3T08A 3K77A 4CUCA 4XUTA 3K46A 4ARYA 3HNYM 1JZ8A 5JXGA 2DCKA 2QQNA 2RV9A 2Y6GA 2W1QA 4MO3M 2VJXA 1UXZA 3WSOA 5FUIA 3WF4A 3A22A 4MGQA 4YPJA 4AAXA 1UX7A 2WN3A 2ORXA 4E8CA 2CDPA 2WAAA 1UMHA 4OMCA 5DN2A 4BDVB 5C70A 3FHAA 3LE0A 3MV11 1OD3A 3CIHA 4JX0A 1UY1A 2L9LA 3OB8A 3UESA 4PT6A 3I3BA 2J1UA 3C7EA 4PQQA 2VOTA 2BERA 3J7HA 1UY4A 4ARXA 3U37A 4DEQA 1LNSA 3JXSA 4A3ZA 2VZ1A 2WABA 1W9WA 3K4DA 1F4HA 2WZEA 3A7QA 4P02B 3P6BA 1GOFA 1GQPA 2JE8A 4DUXA 4HG6B 1UY2A 1NUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XUR A;  1XNT A;  2ORZ A;  2VCC A;  3ACG A;  1DP0 A;  3I2I A;  5EJZ B;  3LPF A;  2VZ3 A;  3A21 A;  1UXX X;  1UY0 A;  2Y6J A;  4A4A A;  5CZK A;  3I2J A;  5LA0 A;  1W9T A;  1GUI A;  1GNY A;  2BZD A;  2X09 A;  3HJR A;  2B4K A;  5EIY B;  1P8J A;  3FHQ A;  3I2F A;  2V5D A;  3PUI A;  3WNO A;  4D0Q A;  4QX0 A;  4P00 B;  4ZY9 A;  5DQ0 A;  4CU7 A;  2QQK A;  2W91 A;  1K3I A;  3OGR A;  1J84 A;  3OEA A;  3III A;  3OGS A;  4GWJ A;  2VZV A;  3OG2 A;  1SG3 A;  5JXI A;  3A23 A;  3W5N A;  2Y6K A;  2YG0 A;  3K4Z A;  3NJV A;  4MGS A;  1UY3 A;  4M4R A;  3ACI A;  4CUA A;  4XUP A;  2XON A;  3DEC A;  2VO5 A;  3WQB A;  4OYU A;  2YC2 A;  1NX9 A;  4IUG A;  3HEI A;  3WF3 A;  1GOH A;  3C7F A;  3T0A A;  4ZZ8 A;  1NAE A;  3LEG A;  2BGO A;  1EUU A;  4ET7 A;  1ULO A;  2VTF A;  1JYV A;  3HOB A;  2C9K A;  2VQT A;  3T2Q A;  2ZXQ A;  3VD5 A;  1CIY A;  2HYX A;  1DYO A;  1F4A A;  2W92 A;  3IDA A;  1TG7 A;  3CQO A;  2J1E A;  3THC A;  2EIC A;  2VQU A;  5EJ1 B;  1OF3 A;  4RN5 A;  4LHS A;  3OGV A;  4QX2 A;  4CU8 A;  2C26 A;  2XQX A;  5DMY A;  4OMD A;  2VZU A;  3MBW A;  3C7H A;  3MUY 1;  3E1F 1;  3GDB A;  2XOM A;  2J22 A;  5C7G A;  1K42 A;  1KGY A;  2QBX A;  4JHZ A;  3LEI A;  3C7O A;  3SKV A;  2BBA A;  4QX1 A;  3ACH A;  2W5F A;  4XUO A;  4CUB A;  3VD4 A;  3LQC A;  3ECQ A;  3VD7 A;  5I0D A;  2RVA A;  5IFT A;  3ACF A;  4QDR A;  3LPG A;  1K45 A;  1R64 A;  4FI9 A;  4UOJ A;  4LQR A;  4KMQ A;  4L0P A;  2ZEZ A;  3DYP A;  3T09 A;  2WDB A;  2V4V A;  1JZ4 A;  2WQ8 A;  5JR2 A;  3I3E A;  1T2X A;  2E31 A;  1XNA A;  4CU9 A;  3ETP A;  1JZ5 A;  1ULP A;  4JKK A;  2WO3 A;  3WNN A;  1PX3 A;  4QDQ A;  5DPN A;  3NNG A;  3HNM A;  3I97 A;  2X05 A;  5F7U A;  4W50 A;  3SKJ E;  1J83 A;  3VD3 A;  4KI5 M;  3OEB A;  5JMO A;  2YB7 A;  4QPW A;  2J7M A;  2EIE A;  1US3 A;  3CKH A;  4P5Y A;  5JXH A;  1BHG A;  1L7R A;  4ZZ5 A;  1D7P M;  3P1I A;  3CMG A;  2WBK A;  2JD9 A;  4XZU G;  2LS6 A;  3GXU A;  4E8D A;  3T0D A;  2WUH A;  4QDS A;  3I2K A;  3WF2 A;  4DUV A;  3VDB A;  1GU3 A;  1SHW B;  2J1R A;  1RYY A;  2R7E B;  2E33 A;  4M4P A;  1O8P A;  2VMC A;  1H6Y A;  4OUE A;  5G04 L;  1I5P A;  1CZV A;  3I2H A;  2W87 A;  2OKX A;  1PMH X;  1O59 A;  3T2O A;  4AG4 A;  1CZS A;  1UYX A;  1CZT A;  3BN6 A;  3IAQ A;  2PQS A;  2QQJ A;  3NRU A;  4DXR A;  1W0N A;  3CDZ B;  3IAP A;  4XUN A;  4QB6 A;  4UAP A;  1JZ3 A;  3MO4 A;  1EUT A;  5G05 L;  1OF4 A;  2VZR A;  3I2G A;  3I3D A;  3ZM8 A;  3UET A;  3OBA A;  1JYX A;  3LEK A;  2DCJ A;  2VL4 A;  1YQ2 A;  2JKX A;  4XVH A;  4DXS A;  4LKS A;  1UYY A;  1SDD B;  1WKY A;  2W46 A;  2ID4 A;  1OT5 A;  2X10 A;  3UNP A;  2YFU A;  1H6X A;  2W1W A;  4DUW A;  2YFZ A;  3HPN A;  3SEE A;  2QQL A;  2Y6L A;  3VD9 A;  3GGL A;  1UYZ A;  2WN2 A;  2DDU A;  2VMF A;  4BK4 A;  2RJ2 A;  4W8J A;  3WF0 A;  2YC4 A;  5LA1 A;  2J1S A;  2WZ8 A;  5LA2 A;  3F2Z A;  2QQM A;  4CU6 A;  4A6O A;  2VCB A;  3IB3 A;  1IQD C;  5IYY A;  2VME A;  1W99 A;  4LPL A;  4DEV A;  1US2 A;  5C71 A;  4XUQ A;  2J1A A;  1PX4 A;  1W9S A;  2KD7 A;  2VM9 A;  1JI6 A;  3WEZ A;  2JDA A;  3NJX A;  5B4X A;  5HXM A;  1JU4 A;  2ZEW A;  1DLC A;  1GMM A;  1W8N A;  4BK5 A;  1JZ6 A;  5B4N A;  4UI9 L;  2WO1 A;  1JZ2 A;  3VDA A;  3HN3 A;  3W5M A;  3DYM A;  2VMD A;  4A45 A;  4D8M A;  4GZ9 A;  2Y8K A;  4ZXE A;  4BJ0 A;  3EB7 A;  3T2P A;  1O8S A;  2EID A;  3C8X A;  4P08 A;  4BXS V;  3FL7 A;  2CDO A;  4OZO A;  5CYY A;  4A42 A;  1GOG A;  2W47 A;  1WCQ A;  3WNP A;  2E26 A;  2VZO A;  1JU3 A;  3CZU A;  4TTG A;  2XHN A;  2W3J A;  5JUV A;  3SEP A;  4GWI A;  5HPO A;  3VDC A;  2VCA A;  4PF1 A;  2VZP A;  5J1X A;  3K75 B;  1TVG A;  5LCW L;  2VC9 A;  4MOA A;  5JXJ A;  2HLE A;  3AC0 A;  2C4X A;  2WAO A;  1JYW A;  2Y6H A;  4Z2A A;  2QQO A;  2V72 A;  4QB2 A;  2VZS A;  5IFP A;  1CX1 A;  2QQI A;  3PUH A;  1UMI A;  1PMJ X;  2E32 A;  2W9X A;  3WNM A;  2EIB A;  3WNL A;  1KEX A;  4RYD A;  1XPW A;  5IJR A;  3K4A A;  4JKM A;  3NQH A;  3BGA A;  1JHJ A;  3ABZ A;  4CVU A;  5IHR A;  3HNB M;  4A44 A;  1XC6 A;  1K12 A;  2B9V A;  4A41 A;  2WYS A;  1JYN A;  3T0B A;  2ZEX A;  2BGP A;  2W94 A;  1HN1 A;  4DXT A;  2VZQ A;  2VZT A;  4JKL A;  1OH4 A;  1NKG A;  4KWU A;  4QB1 A;  3WNK A;  1JZ7 A;  2WO2 A;  2Z4F A;  2LW8 A;  2W1S A;  3WF1 A;  2W95 A;  2VR4 A;  1W8O A;  2Y64 A;  3GM8 A;  3MV0 1;  3DYO A;  4TXW A;  2ZEY A;  3MUZ 1;  4W4Z A;  4MAD A;  1L7Q A;  2J1T A;  3THD A;  1UWW A;  2J1V A;  3C7G A;  1MPX A;  3D3A A;  4QX3 A;  3FN9 A;  3CZJ A;  1UZ0 A;  3EYP A;  5A1A A;  2W1U A;  4QAW A;  3T08 A;  3K77 A;  4CUC A;  4XUT A;  3K46 A;  4ARY A;  3HNY M;  1JZ8 A;  5JXG A;  2DCK A;  2QQN A;  2RV9 A;  2Y6G A;  2W1Q A;  4MO3 M;  2VJX A;  1UXZ A;  3WSO A;  5FUI A;  3WF4 A;  3A22 A;  4MGQ A;  4YPJ A;  4AAX A;  1UX7 A;  2WN3 A;  2ORX A;  4E8C A;  2CDP A;  2WAA A;  1UMH A;  4OMC A;  5DN2 A;  4BDV B;  5C70 A;  3FHA A;  3LE0 A;  3MV1 1;  1OD3 A;  3CIH A;  4JX0 A;  1UY1 A;  2L9L A;  3OB8 A;  3UES A;  4PT6 A;  3I3B A;  2J1U A;  3C7E A;  4PQQ A;  2VOT A;  2BER A;  3J7H A;  1UY4 A;  4ARX A;  3U37 A;  4DEQ A;  1LNS A;  3JXS A;  4A3Z A;  2VZ1 A;  2WAB A;  1W9W A;  3K4D A;  1F4H A;  2WZE A;  3A7Q A;  4P02 B;  3P6B A;  1GOF A;  1GQP A;  2JE8 A;  4DUX A;  4HG6 B;  1UY2 A;  1NUK A; 
#chains in the Genus database with same CATH topology
 2QJV A;  2XBO 3;  3AKQ A;  2Q5T A;  5JOW A;  4QPG C;  4FO9 A;  4RFT 0;  4RR3 B;  1PGL 1;  2RG4 A;  4WVM A;  2VZ3 A;  1HB4 A;  3PVB B;  4IXL A;  4JRA A;  4NUB A;  3T2T A;  1UY0 A;  4DMI A;  3CJI A;  4N9H A;  1MEC 1;  1N1Y A;  3BPZ A;  3DEM A;  4XJZ A;  2YDE A;  1JOD A;  4ITC A;  4LMF A;  4CZS A;  5A3U A;  1GUI A;  1GNY A;  2BZD A;  3HJR A;  5BNP B;  1DYP A;  5EIY B;  3PUI A;  1CES A;  2H6B A;  3I3Q A;  4Q4W 3;  3WNO A;  4D0Q A;  4DFS A;  3AYA A;  1OH3 A;  3MIB A;  3KSC A;  3AMM A;  4Q27 A;  1DIW A;  3O5S A;  4CU7 A;  3RPQ A;  2Q4S A;  3HT1 A;  2VUD A;  3AMH A;  4ES9 A;  2ARA A;  3VBR B;  3VHR A;  3POB A;  3VBH B;  1YLL A;  4GWJ A;  2R04 3;  2VZV A;  3OG2 A;  4HPK A;  2MEV 1;  5FYS A;  1O7F A;  1Z7S 1;  1Y43 B;  4CTE A;  3N4M A;  1DGR A;  3W58 A;  2E53 A;  2R06 2;  2C0Z A;  2ARB A;  4N43 B;  1AX0 A;  1LES A;  2RR1 2;  3NJV A;  4MGS A;  5CVR A;  1UY3 A;  4JGY B;  3ACI A;  4M4R A;  5KXE A;  4XUP A;  2OPW A;  4ASL A;  2VO5 A;  4NJ4 A;  4NRO A;  4QX8 A;  3PJQ A;  5FPU A;  5H9P A;  1MS3 A;  5K9Y A;  4XMA A;  4N9I A;  2QZ3 A;  3AKT A;  5T5P A;  1PGL 2;  2GN7 A;  1K5J A;  1VBA 1;  2GZW A;  3MLK A;  3HEI A;  1W8T A;  1QJF A;  1GOH A;  3JQX A;  4HXC A;  4IUG A;  2Y0I A;  3LEG A;  1N1V A;  3T0A A;  3ZFF C;  4ZXK A;  1LOA A;  4BQ1 A;  4EZ4 A;  3QD6 A;  1PK6 B;  2A71 A;  1MEC 2;  4MZU A;  2ZJC A;  3PHM A;  1POV 3;  2VUC A;  4XF0 A;  2C9K A;  2Z42 A;  1Q56 A;  2ZXQ A;  1YEW A;  1KFU L;  3L2Y A;  1QIQ A;  4NHL A;  4E2S A;  2BWC A;  1ZRE A;  3N9L A;  2KXL A;  3FE5 A;  1W90 A;  1G9F A;  2FQP A;  2HYX A;  1OKQ A;  2DCY A;  3ZMN A;  4QM8 A;  4CRQ A;  1OI6 A;  2Y33 A;  4D69 A;  1FXZ A;  1GZ9 A;  3BOW A;  3EMR A;  3IDA A;  4NII A;  2JDU A;  4LUM A;  2AR6 A;  1TG7 A;  4AXO A;  1ASJ 2;  2EIC A;  1ZRC A;  3ZKY A;  3R4D B;  1AYM 1;  3JZV A;  4QQP A;  5EJ1 B;  1QKQ A;  2WS9 2;  1ST8 A;  4LHS A;  3OGV A;  1HQW A;  4L97 A;  4ZZ8 A;  2E6V A;  4L99 A;  3HQR A;  5FY0 A;  2P6C A;  1PZ7 A;  3Q8E A;  4I3P A;  5DUU A;  1X8E A;  5FBZ A;  4AFB A;  3C7H A;  3BYW A;  1C3H A;  4TN7 A;  3R6S A;  3ALQ A;  3S30 A;  5JAX A;  3GDB A;  1GP4 A;  2R06 3;  1PO2 2;  3H8X A;  2PTM A;  5GAL A;  5I91 A;  3O0X A;  4MXV A;  4N90 A;  1W28 A;  1Q8S A;  2VVF A;  1K42 A;  1VJ2 A;  4CDW C;  2XB6 C;  3WT3 A;  4O65 A;  1YUD A;  5T5J A;  4FP2 A;  1DQ4 A;  1KGY A;  4H7M A;  4GWM A;  5E89 A;  5KBF A;  3LEI A;  1VBE 1;  5ANN A;  4R4Z A;  1LED A;  3HBK A;  1ZA7 A;  4Q4X 1;  5M0T A;  1D4V B;  2X5I A;  1G8W A;  1QOS A;  3VZK A;  2PHD A;  5CFC B;  1LUL A;  1O4Y A;  2QUO A;  4CUB A;  3LQC A;  5IFT A;  2RVA A;  3BVC A;  5FRE A;  3ACF A;  2GNM A;  5KWR A;  3U1X A;  1YRZ A;  2ZTN A;  3A0N A;  2HEW F;  5ERL A;  5FUN A;  1OBN A;  4BHP A;  2YMZ A;  4GQ7 A;  3DUI A;  3WQ7 A;  1YQ8 A;  5GZG A;  2XR4 A;  2ZCW A;  4YYO A;  4LQR A;  4KMQ A;  4L0P A;  4COZ A;  5A3T A;  5K4L A;  3FLR A;  1V6N A;  3T09 A;  3BU0 A;  4Q0V A;  2PAK A;  3MIH A;  4KU7 A;  1MQT B;  4CCJ A;  1GZC A;  2UUR A;  4LTA A;  4S2D A;  5JR2 A;  3V0B B;  1W2A X;  1T2X A;  3POE A;  2WS9 3;  1FNZ A;  3IWZ A;  4B29 A;  4CU9 A;  1BMV 1;  3O1S A;  1OFS A;  3DKW A;  4LLO A;  1PNG A;  5I0S A;  4N7I A;  3SH3 A;  1E5R A;  4AGR A;  5DPN A;  3HNM A;  2D98 A;  1XYO A;  1S0D A;  3TEY A;  4A3X A;  3QLQ A;  4HZF A;  4KI5 M;  5JMO A;  1HKD A;  1ULE A;  4KU8 A;  3BOP A;  4WM8 C;  3SMH A;  4FFH A;  4RQP C;  4COY A;  2B8M A;  3E6B A;  1US3 A;  1DZR A;  1HJF A;  1OLQ A;  2DWR A;  5JXH A;  1SMV A;  4G4F A;  4R52 A;  1OQE A;  1R1Z A;  4K40 A;  3CMG A;  4LIT A;  2OII A;  1WLW A;  1OLR A;  2JD9 A;  5FAX A;  4Y20 A;  1YFW A;  4LO7 A;  1UAI A;  4BPZ A;  2LS6 A;  3GXU A;  4EV0 A;  3T0D A;  1W05 A;  1PZ8 A;  4EN9 B;  1FMD 3;  2WUH A;  4QDS A;  3WP5 A;  1S2K A;  3ZXE A;  3VV1 A;  2BBV A;  4JC1 A;  1X50 A;  2BRT A;  1RYY A;  2R7E B;  5HCA A;  2XJT A;  1YYN A;  4GB3 2;  1O8P A;  4N7U A;  4QPI A;  3DPR A;  3ZFE C;  4LUK A;  2HWF 1;  2PXJ A;  2P34 A;  5G04 L;  2ZGO A;  3ZFG A;  1I5P A;  1WA6 X;  1RUG 3;  4ASK A;  3IMM A;  2VQ0 A;  2W87 A;  2PHL A;  4XJA A;  2JKB A;  1PMH X;  4I09 A;  4YG3 A;  5FZO B;  4WBB A;  2Z79 A;  1I9R A;  5AC9 1;  1CZS A;  3A4U A;  3U07 A;  4CCO A;  2PLV 3;  4BOW A;  3USU B;  1XE8 A;  1JH5 A;  1LEC A;  1ND3 C;  1NXD 1;  3JBG 2;  5T5L A;  5IK5 A;  1WW7 A;  4Y22 B;  1BLZ A;  5GZE A;  4CYD A;  5KHG A;  3S5Q A;  5BNO B;  5FKC A;  1NCQ C;  2HWE 2;  1UW8 A;  4XEZ A;  1WMD A;  1YXW A;  1TE1 B;  4KG8 A;  4CXW A;  5LBB A;  3R4U A;  3AB0 A;  3ZSE A;  3MO4 A;  1JZ3 A;  1EUT A;  5CIR A;  5G05 L;  5A7W A;  2X29 A;  3NJZ A;  3I2G A;  4JRL A;  3TEZ A;  3MI8 A;  4YVS C;  2W39 A;  4XBL A;  4XFC A;  4BQW A;  3OBA A;  4CP9 B;  2ZOE B;  2DCJ A;  1YQ2 A;  1EAH 2;  2EF6 A;  2WNV A;  1UYY A;  1SDD B;  3AFK A;  3IIA A;  4QKD A;  2NN8 A;  1HQN A;  4M3C A;  3PMS A;  2E7A A;  4AQS A;  4E9K A;  4WM7 C;  1AX2 A;  5A6Z A;  2QE3 A;  3KT4 A;  4DUW A;  1LOB A;  3NKT A;  3ZXA C;  3O1P A;  2AUY A;  2W08 A;  3HPN A;  5DAX A;  1RUJ 3;  1JYC A;  5JOZ A;  1QJX 1;  2DDU A;  1KJL A;  2WFF 2;  3CBN A;  2O8O A;  4NRP A;  5DDJ 1;  3FBM A;  3V64 A;  2KA3 A;  4Y26 A;  1RIN A;  1EY2 A;  4MHR A;  2GC1 A;  4K21 A;  5DUX A;  1XOY A;  5GZF A;  3USS A;  4A6O A;  5E8A A;  1D2S A;  4URT A;  1LGB A;  5K0U C;  4MET A;  2IWG B;  5DG2 A;  4EWA A;  3VB9 A;  5A3M A;  1DYK A;  3H0O A;  3N9Q A;  3CJI B;  5H9S A;  3RSJ A;  4TZD A;  4YG0 A;  2NM1 A;  4P9W A;  4AVA A;  1OOP C;  1WW6 A;  1W99 A;  1GAN A;  1UOB A;  1COV 3;  4FCA A;  2ATF A;  4CEW C;  1AR7 2;  1US2 A;  4HVR A;  1H8T C;  5C71 A;  4XUQ A;  1AR8 2;  5EV7 A;  5FZ3 A;  3FJS A;  3L9J T;  3U4X A;  2OS2 A;  3GZU C;  1O3Q A;  3VBS A;  4F7Z A;  3LKJ A;  1JI6 A;  3BPS A;  4AED C;  5IVV A;  3TN9 3;  1DBN A;  2CWS A;  2ZMN A;  1F35 A;  4XCB A;  4XMI A;  4Q2F A;  3KZ4 C;  4HSJ A;  4JCK A;  5FUP A;  3WUD A;  4F83 A;  5CG8 A;  2Q8C A;  2V5Y A;  4AQT A;  4H55 A;  3VBU C;  5HXM A;  3I59 A;  2AH2 A;  4QQH A;  3MPB A;  1DLC A;  1PO1 1;  1ZZB A;  2RHP A;  5B4N A;  5ABJ A;  4UF0 A;  3B9C A;  3BIW E;  3VDA A;  3WOG A;  3HN3 A;  3BTA A;  3RJR A;  4D8M A;  4GZ9 A;  2HEV F;  4KL1 A;  1QJE A;  4QPG A;  1T6B X;  1XNC A;  1ZVF A;  3M1H A;  1Q8O A;  3FLT A;  4PQ9 A;  3RI9 A;  3VZM A;  1WME A;  5FYC A;  1S4C A;  4JDM A;  2EID A;  3C8X A;  3POS A;  4P08 A;  5EXO A;  4JDO A;  1RUE 2;  1NXM A;  5J3U A;  4Q4Y 1;  4JQR A;  1DQ0 A;  2WFF 3;  4XAA A;  4FAG A;  2XVG A;  3S5A A;  1A6C A;  2AZ5 A;  4HET A;  3WIN E;  4AHX A;  4MG2 A;  2BFU L;  2DUR A;  3VDD C;  3QH7 A;  2E26 A;  4O7X A;  5T50 A;  3VGI A;  2VOX A;  2XHK A;  1DLL A;  1IS3 A;  2OUH A;  1Q8Q A;  4LO5 B;  4QPY A;  4LK6 A;  5GLT A;  5A3W A;  1L7L A;  3GZA A;  3VKF C;  2F17 A;  4GWI A;  5FWE A;  3MIG A;  3OUJ A;  2WJS A;  5GZD A;  3VDC A;  5I8T A;  4PF1 A;  1RUI 1;  2VZP A;  1PIV 3;  2A7A A;  1TVG A;  2I45 A;  1H9W A;  2ZGR A;  3MIE A;  3OYW A;  4KBZ A;  4AVS A;  1AR8 3;  3JCI A;  1BK1 A;  2WO7 A;  5F6L B;  2DYC A;  2G19 A;  4Y3O A;  3KV9 A;  2YBK A;  4XAB A;  5FY9 A;  4XE9 A;  4HL0 A;  2VXJ A;  1SCS A;  3OUH A;  5IK8 A;  4Z2A A;  1RUD 3;  4AFD A;  3GZT B;  1WLT A;  1RGS A;  4U36 A;  3BI3 A;  3WDX A;  1HLC A;  1REE A;  5FOJ B;  2WNO A;  2ZHL A;  2R07 3;  3VKN A;  4UBH A;  4QWN A;  4XAC A;  3ZFF A;  4LOS A;  2QQI A;  2JG8 C;  2PAE A;  4XFB A;  3PUH A;  1IPS A;  2XJQ A;  5BNN C;  3RFR A;  1REF A;  4NE9 A;  4BQ2 A;  1W03 A;  5GLV A;  1ND2 C;  3OCP A;  3OTF A;  3IZO A;  4Z07 A;  1AXZ A;  2WWS A;  1R08 3;  4OHZ A;  4RA0 A;  5C33 A;  2O1Q A;  1MS8 A;  1T6G C;  5FZ0 A;  3PVN A;  4JKM A;  4B1L A;  5CBL A;  3NQH A;  1VRH 2;  2HWD 2;  3ABZ A;  2VW0 A;  3RWN A;  5IHR A;  3AZY A;  2RMU 2;  2Z69 A;  5K8S A;  1D2Q A;  3BAL A;  4IE7 A;  4A41 A;  1NLR A;  1RUI 2;  1UL9 A;  2WYS A;  5JZG B;  1JYN A;  4FTB A;  3W20 A;  2BVV A;  3H1Y A;  1LR5 A;  1UIK A;  4WVW A;  2H0V A;  1YFU A;  3JD7 2;  1EP0 A;  4K7J A;  2QQP A;  1OA4 A;  5FZK A;  3D4K A;  5F1R A;  2BP6 A;  2VZQ A;  3MF9 A;  1POV 0;  4KWU A;  1AHS A;  1ZNP A;  4QB1 A;  3PUS A;  4L11 A;  1DHK B;  1I1E A;  2QVS B;  4WVV A;  4CCL A;  3NVC A;  4KWL A;  4GAZ A;  1V70 A;  2Y64 A;  3QH6 A;  3GM8 A;  4PIZ A;  4XFH A;  1A78 A;  3K51 A;  3POG A;  4TXW A;  3VN4 A;  1SBD A;  5E88 A;  1W39 A;  2VU9 A;  5ACA 1;  3B02 A;  4F8A A;  1EV1 1;  4MAD A;  3LIH A;  3WQ0 A;  2KR2 A;  4XIK A;  2FDF A;  4IV1 B;  1DF0 A;  1GWK A;  2RS3 1;  3M4F A;  2IFW A;  1B35 C;  5C5U A;  3D3A A;  2CSG A;  1RUC 3;  4I02 A;  3RZG A;  1CAW A;  1K5M A;  3CZJ A;  2WQ4 A;  4B4Q A;  5FY4 A;  2NP0 A;  4M0N A;  3E6C C;  3S6P A;  1YJL A;  1W6P B;  4CCD A;  3AKR A;  2HJI A;  5A1A A;  4IV3 B;  1KQR A;  5BY5 A;  5D8A C;  1QJY 1;  4CUG A;  2HWD 3;  4PLO A;  4W6X A;  3K77 A;  1H4G A;  1UMZ A;  1A8M A;  4KGG A;  4NIH A;  1WCD J;  1J1L A;  2RMU 3;  5FFO C;  3PIJ A;  4GWN A;  1PHM A;  3THT A;  2E9Q A;  5F3G A;  5FMO L;  1JZ8 A;  3TWI A;  2FDH A;  1KRI A;  2D6N A;  3VBF A;  2RV9 A;  3N7M A;  2W1Q A;  3JD7 3;  1Q5O A;  4DRV A;  2VJX A;  4J1X A;  4Y1V A;  1D0G A;  2QKD A;  1F9K A;  3EBR A;  4IW3 A;  4GJZ A;  4DRR A;  1J58 A;  2WN3 A;  2ORX A;  4QQ2 A;  1VBD 2;  2CDP A;  4LBN A;  4WZF A;  1DFQ A;  5FO8 B;  1XU1 A;  1SPP B;  4CXY A;  4BDV B;  4WM8 A;  3D82 A;  1LRH A;  3KV6 A;  3ZSM A;  1IG3 A;  2B5H A;  1QJU 3;  2SBA A;  3N9P A;  2CV6 A;  3B5L B;  4XPV A;  1OD3 A;  1CQ9 A;  3MLL A;  2RS1 3;  3J8F 1;  4LE4 A;  2ZAH A;  3CIH A;  4JX0 A;  2ZGN A;  4X6R B;  1UY1 A;  1ZBA 1;  1QWR A;  3S57 A;  1VMH A;  5L9B A;  3MPP G;  4D6R A;  5C3S A;  3OBZ A;  4UYB A;  3UES A;  4R9B A;  5LAT A;  1LOD A;  4UFI A;  5IVC A;  5A7W B;  3ROU A;  1YQ6 A;  2VOT A;  3OBR A;  3OD0 A;  4IES A;  3J7H A;  4LNV A;  1UY4 A;  2HKX A;  5C3R A;  4ARX A;  3U37 A;  4DEQ A;  3P5B A;  2H6C A;  1JYI A;  3JXS A;  4YFW A;  2ARC A;  2RS5 1;  3D0S A;  3ZFE A;  3K4D A;  3PUA A;  3ZXD A;  1JOJ A;  2FMY A;  3IDC B;  1V6L A;  1VAK A;  2GMM A;  4FT8 A;  2DUO A;  3VHO A;  1GQH A;  3ES1 A;  2G9Z A;  4DUX A;  5L36 A;  4JGZ B;  1O4Z A;  1S2E A;  2JG9 C;  3TAY A;  4I2O A;  1CPM A;  1NUK A;  3IM0 A;  1G9A A;  1R09 1;  4UXA A;  1AYN 1;  2ORZ A;  4PJY A;  5CAD A;  1VBC 1;  1OA3 A;  2VOV A;  2D44 A;  1VE0 A;  3ACG A;  3QAC A;  1UD1 A;  3TYJ A;  5AFE A;  1DP0 A;  1CAV B;  1HV0 A;  2DUP A;  4R9C A;  4COU A;  4ES8 A;  5LY1 A;  1ND3 A;  4PDW B;  5FV3 A;  3A21 A;  3R0R A;  5JI9 A;  1UXX X;  1IZ3 A;  2IXJ A;  3CO2 A;  5CZK A;  2V73 A;  1IKP A;  1WD4 A;  2GC0 A;  1RMU 1;  4O9E A;  3RJ2 X;  4Z92 B;  3J8F 2;  3AYE A;  2VMI A;  1VBD 3;  5E6H A;  4AQ2 A;  4BM8 A;  4AE2 A;  1QDC A;  3AZX A;  2BFU S;  3OY8 A;  2Y0O A;  2C6S A;  4QX0 A;  4XOG A;  4XQD A;  5C9A B;  3PTY A;  3RYR A;  2JEM A;  3INA A;  2VNR A;  4KGQ A;  5CFD A;  5FK8 A;  5F3C A;  4Q0S A;  5DQ0 A;  2W91 A;  3RQ0 A;  1TME 1;  4YVS A;  3OEA A;  3WX5 A;  3III A;  1UZY A;  4NWV A;  4C0B A;  1F31 A;  3ES4 A;  3MIF A;  1VMJ A;  3A23 A;  4MH0 E;  2Q8D A;  4XJU A;  5JXI A;  1ULD A;  4YFZ A;  2RDQ A;  2WT2 A;  1WCU A;  3NNL A;  5LAS A;  3VBS B;  4WM7 A;  4Y1Z A;  2RDR A;  3MW2 A;  3DEC A;  5FZA A;  4F3J A;  2ZGM A;  1DGL A;  2EXH A;  1AYN 2;  2YU1 A;  2PFW A;  2EXK A;  4PLM A;  3I59 B;  4XQ4 A;  2WQZ C;  1S1A A;  1IPJ A;  5F6K A;  1N1S A;  1NX9 A;  4XBQ A;  5ABJ B;  3VHN A;  1O5U A;  4UF0 B;  4P9J A;  1X82 A;  4CDU B;  1J59 A;  1W6M B;  1RVF 1;  3OD4 A;  4Y5T A;  5C8C C;  2VVE A;  2OA2 A;  4P9Y A;  5FMB A;  1E5I A;  2BU9 A;  2VTF A;  1BKZ A;  4RS5 C;  2ZX3 A;  2E63 A;  2ZZQ A;  3TB0 A;  5K0U A;  1PVC 3;  3X29 B;  3ZIX A;  4OUL A;  2RE9 A;  2YHJ A;  1UCX A;  4XIL A;  1H8V A;  4NO4 A;  4YGB A;  1V6I A;  4YSF A;  3APB A;  1UX6 A;  1U12 A;  3URF A;  1OOP A;  2CWM A;  1BZW A;  2AC1 A;  3WDW A;  1F4A A;  5A7P A;  2HWB 1;  3SLI A;  4ATE A;  4CEW A;  1H8T A;  2FZ2 A;  1TME 2;  1GR3 A;  2XBO 1;  1VP6 A;  4L2N A;  4Q5O A;  4XQW A;  3CQO A;  3SCG A;  2J1E A;  2XH6 A;  3T4H B;  1YO8 A;  1ENQ A;  2VQU A;  4I0A A;  4B4P A;  4KG0 A;  4MXW B;  1OF3 A;  3ZPO A;  4AED A;  2RDN A;  1QU0 A;  1LHO A;  5F5I A;  4ZU5 A;  5C5T A;  4IGO A;  2ZKL A;  5F39 A;  2JDP A;  3VBU A;  1H0B A;  5DMY A;  1AJK A;  4OMD A;  4YW6 A;  2VUL A;  2VZU A;  3MBW A;  1Y9G A;  5FZ1 A;  5A3O A;  1APN A;  3V0A A;  2G9F A;  1Z78 A;  4MHU A;  1HRI 3;  3T1L A;  1WBL A;  1LOE A;  2XDV A;  2Y6F A;  5HV0 A;  1UOJ A;  3IPV A;  1OQ1 A;  4NMI A;  4IE4 A;  5FXW A;  2J42 A;  1V00 A;  2G9G A;  3I2D A;  2B9U A;  5A33 A;  1MAC A;  1XYN A;  1NCR A;  2YZ4 A;  4AVV A;  1PM4 A;  5BXX A;  4HKO A;  2BBA A;  4QX1 A;  4XUO A;  4S2H A;  4O61 A;  4Y1Y A;  1FI2 A;  1AX1 A;  5F2W A;  3VDD A;  2HWB 2;  4O9G A;  2DVG A;  2JDH A;  2YRO A;  5FZH A;  4GH4 B;  4S2F A;  4XF3 A;  4LIV A;  4N53 A;  2OQ7 A;  2XML A;  3AP7 A;  4GMP 3;  2ERF A;  2YUE A;  2DTY A;  1HRV 2;  4H3W A;  5APA A;  2IXC A;  1RUO A;  3O1M A;  1CON A;  4XYX A;  4P9X A;  5CKQ A;  4YZ3 A;  5FO7 B;  4QXH A;  5J7M A;  2R49 A;  2LUW A;  3RVH A;  2ZEZ A;  4LE3 A;  1POV 1;  2ZZJ A;  4XW3 A;  3H8U A;  4GJY A;  5FZG A;  4BIO A;  4Q29 A;  2VBD A;  1QEX A;  5FMO S;  3TEW A;  1LGN A;  1YI7 A;  3HAG A;  3OOX A;  4JQT A;  3H9A A;  1HV1 A;  3BKZ A;  1XNA A;  5KR7 A;  1BK0 A;  3GYD A;  2HWC 1;  2X8K A;  2WO3 A;  3WNN A;  3IMN A;  1ZM1 A;  4QDQ A;  5F7U A;  1J3Q A;  2C5D A;  3ZYG A;  1XSR A;  4OCT A;  2JG8 A;  4LKE A;  3VD3 A;  3OEB A;  5BNN A;  2VXR A;  4CDX B;  4QPW A;  4CDW B;  2J7M A;  2P2K A;  3ZN4 A;  2JDK A;  4M3C F;  4PI0 A;  1ND2 A;  2WNU B;  4HFS A;  1RL3 A;  1HX6 A;  2EIE A;  1G9D A;  4XHB A;  4ZZ5 A;  1L7R A;  2CHH A;  4IEY A;  1N3O A;  3P1I A;  3AL6 A;  2Y38 A;  3NMB A;  3JB4 C;  1LOG A;  3OJB A;  4YW4 A;  4K1Y A;  4FAH A;  4UFM A;  1UPI A;  2DVD A;  4YVW B;  1NY7 1;  2ZHM A;  2BPA 2;  5F9T A;  1CAW B;  2ZX2 A;  2VNG A;  3FMG A;  3WF2 A;  4Q4V 3;  1VAV A;  1J3P A;  2JEN A;  3WV6 A;  1SHW B;  1GZW A;  2JD4 A;  3D5O A;  2E33 A;  1VLN A;  3GBG A;  3BTZ A;  2PHF A;  4OUE A;  2Q0A A;  1PGW 1;  4RHV 3;  1Y3T A;  2UY8 A;  1UYP A;  2D6O X;  3O1V A;  5KC6 A;  2HWC 2;  2B39 A;  1X9T A;  2GU9 A;  1LCL A;  1YIP A;  5GZC A;  1V9U 3;  5DAB A;  2VD7 A;  3NAP C;  1UZW A;  1OMI A;  5FZD A;  1TMF 3;  4B7K A;  3NV4 A;  4AAP A;  2LRO A;  1DZT A;  2ZAC A;  1AR6 3;  3AVR A;  1RUF 1;  3GHN A;  4CCK A;  5CKM A;  5JDB A;  1QF3 A;  2BQP A;  3POW A;  4BE3 A;  2GP5 A;  3HBZ A;  2VPV A;  5FYM A;  2SLI A;  2PQS A;  2QQJ A;  2ZX1 A;  3TBD A;  3WNX A;  1UNB A;  1W0N A;  3KCY A;  4XXA A;  4RSU A;  3U0Z A;  4QKN A;  1XXN A;  1B35 A;  4RQP B;  4OQ8 A;  2ARE A;  1FPN 1;  4QXK A;  3WG4 A;  3DCQ A;  5JPN B;  3ZSJ A;  1OF4 A;  1SLI A;  1G9C A;  2FDJ A;  5FP4 A;  4I3G A;  5A7Q A;  1WCK A;  4HN1 A;  2B46 X;  3BUC A;  5D8A A;  2FDI A;  1XNB A;  1YHF A;  4FPJ A;  1HQL A;  3GJA A;  3J7N A;  2ZMK A;  3DV8 A;  1KD7 A;  5FP3 A;  3I3M A;  4LKS A;  2VNV A;  4YGC A;  1C8M 1;  2MEV 2;  1ONA A;  4IQP A;  1Z7S 2;  4FPC A;  3UJO A;  3LDB A;  2W46 A;  4AYU A;  1OT5 A;  2GC2 A;  3M3O A;  1N1T A;  5KHJ A;  3OGJ A;  1WA4 A;  3ZFE B;  4FOW A;  2YFZ A;  2PQQ A;  3ZN6 B;  3SEE A;  3RZJ A;  4E2G A;  1WW5 A;  2GP3 A;  5FZI A;  2Y6L A;  3GGL A;  4BK4 A;  2VMF A;  5EWS A;  2RJ2 A;  4JV4 A;  4GUL A;  2JXA A;  3VKO A;  3WF0 A;  1C57 A;  2XJU A;  1BYH A;  2YYO A;  4NR1 A;  4CDQ A;  4DNY A;  5B2G B;  4X8N A;  1VBA 2;  3F2Z A;  2A1X A;  5F3E A;  4HBN A;  1RUH 1;  4EN8 B;  5C4W A;  2RR1 3;  3AP6 A;  5FPL A;  4QHB A;  1TNR A;  4DOU A;  4K1Z A;  3LB9 A;  3IB3 A;  3B3Q E;  3KT7 A;  5T5O A;  4NOT A;  3VZJ A;  3AJY A;  3U4S A;  1TNF A;  4BQ4 A;  4IDZ A;  1F5J A;  1O3R A;  5KXD A;  1RUG 1;  5FO9 B;  1NCQ B;  2QCS B;  4LPL A;  1HDK A;  4DEV A;  2EXI A;  1GZT A;  1EYB A;  1H1A A;  1MEC 3;  4E4D X;  2R0H A;  4IE0 A;  4LO4 B;  2ZKN A;  3GBF A;  3W9A A;  2KD7 A;  1IS5 A;  2PLV 1;  2WLQ A;  4QQO A;  1K5M C;  4Z2W A;  1C8M 2;  1SCR A;  1R1A 1;  4LBJ A;  1AYM 2;  3ZDV A;  2JDA A;  3EJK A;  5KHH A;  3ST7 A;  4RR3 C;  1AR9 1;  5B4X A;  2BVB A;  3H1M A;  3WHT A;  2R0F A;  4D6S A;  1W8N A;  1NE4 A;  1JXN A;  2JG9 A;  1JZ2 A;  1ASJ 3;  3FLP A;  2MEV 3;  1Z7S 3;  1W6O A;  1OSG A;  4XET A;  1MS9 A;  1BCX A;  2XJS A;  4ZXE A;  1MZE A;  4BJ0 A;  3VBF C;  1JBC A;  4JZR A;  5LB6 A;  1X8M A;  1ZZ9 A;  4J25 A;  2W0X A;  2MNG A;  1O8S A;  3AXD A;  4XXP A;  4MGZ E;  2CDO A;  1OA2 A;  1QOO A;  2XUE A;  4A42 A;  5LZ6 A;  2DBI A;  3JUU A;  4AHY A;  3OSD A;  1VBE 2;  3BTX A;  1CR7 A;  2K2S A;  1PO2 3;  1G7Y A;  4MGK E;  3VBH C;  4NIG A;  4Q4X 2;  1MZ5 A;  2Q1F A;  2IZW A;  4R9D A;  2PHU A;  2VZO A;  2FBE A;  3M3I A;  5C3Q A;  4BQ5 A;  1C28 A;  2A3X A;  2XHN A;  3KQ4 B;  2A6Y A;  1RUJ 1;  1OOP B;  3FUQ A;  2D6M A;  3H7Y A;  4JGY C;  4UT5 A;  3Q8F A;  2D93 A;  4IGP A;  5HPO A;  2ET7 A;  3AP4 A;  3RZK A;  1NQJ A;  3K75 B;  5LCW L;  2YPJ A;  4EYU A;  4LEJ A;  4AI3 A;  3O0W A;  3UGH A;  1JYT A;  4AED B;  3B01 A;  1OLM E;  2D40 A;  2C4X A;  1CAU A;  2WAO A;  2HBU A;  1SFN A;  4YZ5 A;  5C6C A;  4NHM A;  2V72 A;  5EP9 A;  4HKL A;  5IVB A;  5DAW A;  1W04 A;  5I0R A;  1BMV 2;  4D6Q A;  4FXG B;  2VE1 A;  1Y4W A;  4FPK A;  3RMX A;  5IFP A;  1FV2 A;  3V0A B;  1RTV A;  4PIX A;  5FMD A;  4DIN B;  5C8C A;  4X8P A;  1UMI A;  4B8E A;  4C91 A;  1PMJ X;  2DVB A;  4RS5 A;  4JHT A;  1QXR A;  3O1T A;  2PMW B;  3WNL A;  3SXW A;  2Q8E A;  4AQ6 A;  3IPV B;  1XPW A;  5FKB A;  5IJR A;  4PHZ A;  1SLL A;  5A33 B;  3ZDS A;  5HI0 A;  1AXY A;  2VBP A;  1JHJ A;  4ZS3 A;  5A32 B;  1FX5 A;  1LOF C;  1UKG A;  4LA3 A;  2D3S A;  5C8W A;  2GC3 A;  1VBE 3;  1GSL A;  4QGL A;  2EA7 A;  1K12 A;  3MEP A;  3MFC A;  5A80 A;  5L7O A;  1C4R A;  3SCF A;  4EN0 A;  3NWK A;  4FPG A;  5CFD C;  3T0B A;  1L3J A;  3LIG A;  4JAA A;  1MS1 A;  2OVU A;  4FPY A;  2W94 A;  1HN1 A;  2P6H A;  1SLA A;  3EXU A;  4E27 A;  4Q26 A;  3GF6 A;  1H2N A;  4XF1 A;  1E5S A;  2HWF 2;  1W6N A;  4FTS A;  4XAE A;  3IBM A;  2Z4F A;  3BOD A;  2XPJ A;  4KQ7 A;  3RZL A;  2BEO A;  4AEM A;  5BNQ A;  1OQD A;  5CFC C;  4ORF A;  4BQY A;  3J26 N;  2XVK A;  4GB3 3;  5AC9 2;  5JPM B;  3MV0 1;  4LJH A;  3AM2 A;  2Y60 A;  1ULC A;  5LEJ A;  4OHW A;  1N3P A;  2RM2 1;  2ZEY A;  3MUZ 1;  5IVF A;  1XU2 A;  4XFI A;  5IAX A;  4BCU A;  1DQ2 A;  3ASI A;  1AL2 1;  1UWW A;  3LA7 A;  2J1V A;  3C7G A;  2FZ1 A;  3AX4 A;  3WZ1 A;  4WVM B;  4NWW A;  3PUQ A;  4EZH A;  1VBB 1;  2BW8 A;  4AGV A;  1RUD 1;  5F32 A;  2ZAA A;  2A3Y A;  2JIJ A;  3O7O A;  1MQT C;  3JBG 3;  4HVO A;  1RED A;  1C5I A;  3KM5 A;  1WWY A;  2VH9 A;  4AI1 A;  5C3P A;  1WMX A;  2W1U A;  3WDV A;  2X53 S;  5ISL A;  3T08 A;  2W52 A;  4AI9 A;  3RI8 A;  4AW7 A;  2HWE 3;  5GKA C;  3POJ A;  4EQV A;  4LLF A;  4NPR A;  4XUT A;  3I8T A;  3K46 A;  4ARY A;  2WFP A;  5FY7 A;  1GZW B;  3N36 A;  3N9N A;  1R08 1;  3DXU A;  5JXG A;  2Y6G A;  4KWJ A;  1SLC A;  4MO3 M;  4GAL A;  2JIG A;  3T1M A;  1UXZ A;  1ENX A;  1MR5 A;  4HPK B;  3VBO C;  3WF4 A;  1U0A A;  2A6Z A;  3WDT A;  5AFB A;  4LBQ A;  3ILN A;  1UX7 A;  1QJX 2;  1EAH 3;  4ISR A;  2HWF 3;  3AK0 A;  1POQ A;  1Y9Q A;  5DDJ 2;  4GMP 0;  4Y1U A;  3GJB A;  5D21 A;  3UKT A;  4ZKT B;  3BIE A;  5EQU A;  1TEI A;  3HN1 A;  2VGD A;  1NA1 C;  3FHA A;  3MV1 1;  4LT5 A;  2CL2 A;  5AC9 3;  4W65 A;  4LBQ B;  2WA3 A;  1CN1 A;  1E57 A;  1VBB 2;  2A6X A;  2PHW A;  1NCR C;  2XLG A;  4YWA A;  1KS4 A;  4DZG A;  4NRM A;  4OQ9 A;  4Q1R A;  4AOC A;  1FAY A;  2E7T A;  1RHI 1;  3I3B A;  4PT6 A;  4PQQ A;  5CNA A;  3SQO A;  3UT0 A;  4BQ3 A;  4IL7 A;  2HYK A;  3THP A;  4J1W A;  1W6Q A;  4N53 C;  2NZ9 A;  2PAM A;  4A3Z A;  4BLJ A;  5DAP A;  2WAB A;  5FYU A;  5D8A B;  1BQP A;  1W9W A;  2DF7 A;  2IFR A;  3KS7 A;  5J98 B;  4AZZ A;  2WWU A;  3IT8 A;  1GFF 2;  4BMB A;  1AR7 3;  4CEY A;  4DY3 A;  5H9R A;  1GOF A;  1GQP A;  1CJD A;  4CCN A;  1XQN A;  4YAR A;  2C1F A;  3WQ1 A;  4HG6 B;  1UY2 A;  4RGA A;  2WYF A;  4LHK A;  5BNO C;  1OFN A;  1PO1 2;  2CAV A;  3HIF A;  1OUX A;  4QD2 A;  4XUR A;  1JUI A;  2VMG A;  1LHW A;  4QXB A;  2VCC A;  3NJY A;  3GBW A;  3NAP A;  3I2I A;  4LKF A;  1PVX A;  3VKL A;  2JJ6 A;  1FYU A;  3H8R A;  4A4A A;  2WR9 A;  3MIC A;  3I2J A;  5LRS A;  5LA0 A;  3DKQ A;  2KM2 A;  2ZGQ A;  1QJX 3;  1RIT A;  4Q4Y 2;  2UWC A;  2B4K A;  5DDJ 3;  4R9A A;  1FOD 1;  1P8J A;  3FHQ A;  3I2F A;  4W6Y A;  3N9M A;  2OT7 A;  3MFA A;  2BGC A;  2ZHK A;  4DQA A;  3O1O A;  1RHI 2;  4P00 B;  5FLI A;  3AKS A;  4ZY9 A;  5SV8 A;  5IVJ A;  1QQP 1;  2R16 A;  2TNF A;  4P9I A;  1K3I A;  4XBN A;  4CCM A;  1RUE 3;  3OGR A;  4NPM A;  2X5I B;  4PCR A;  1VR3 A;  3EQE A;  4QU2 A;  4XJ9 A;  4FPL A;  4XFA A;  1ZRD A;  1KXG A;  2Y6K A;  3FZ3 A;  3K4Z A;  3QOP A;  2WSV A;  1N3Q A;  2OZ6 A;  3LEM A;  3ZYI B;  5JR7 B;  5FQ0 A;  2RS1 1;  2BNN A;  1ZX5 A;  3QCW A;  4ZU7 A;  5FLH A;  4TSV A;  2YC2 A;  1BEV 1;  2D6L X;  3MLJ A;  2ZGU A;  3WF3 A;  1KS5 A;  3C7F A;  5J48 A;  4UBG A;  4XTP A;  1NAE A;  1RJ8 A;  2BGO A;  2JDY A;  2XLA A;  2R1B A;  3B7M A;  1EUU A;  3GZE A;  3MGU A;  2D5F A;  1V6O A;  4UFJ A;  3KCX A;  4TYS A;  4BXF A;  1PO1 3;  1JYV A;  2VQT A;  5FPX A;  4IEX A;  3HQX A;  3WXP A;  3T2Q A;  1H2L A;  5J36 A;  2A6V A;  4Y4Y A;  4N8M A;  5IW0 A;  3M3E A;  1CIY A;  4UW4 A;  1DGW A;  3NV1 A;  5JSO A;  3RYP A;  1C1F A;  1QQP 2;  3NV2 A;  1UO9 A;  4RGK A;  3CU7 A;  2PHT A;  5DZF A;  1OPO A;  3RNS A;  2TBV A;  1G86 A;  2XVL A;  3PME A;  3PUR A;  4Y4R A;  5FYT A;  4OI1 A;  5BV6 A;  1OHF A;  1ENR A;  1FV3 A;  3ZSK A;  3NW4 A;  1D0H A;  4RN5 A;  3MHZ A;  4QX2 A;  5FK7 A;  4CU8 A;  2EAK A;  3M3Q A;  4B7E A;  4EWE A;  3P3P A;  4UW6 A;  4RR3 A;  4Y20 B;  4BIF A;  1VRH 3;  1NT0 A;  3ZKU A;  4UFH A;  5FTT C;  1ZZC A;  1O6U A;  4YGE A;  1KDM A;  5JWP A;  2P17 A;  2XOM A;  1RUI 3;  3IDE A;  4UW3 A;  2Q8O A;  5BUV A;  3QBQ A;  5FMC A;  3K2O A;  4PI2 A;  2RJK A;  3AMP A;  4QPI B;  3DPR B;  1KDK A;  2FMD A;  3LZZ A;  2ZX0 A;  2DVA A;  2Q1M A;  1OVP A;  2BWA A;  3OPT A;  1WGP A;  1DCS A;  2QBX A;  3AFG A;  3ZFG B;  4JHZ A;  2FCU A;  3H50 A;  3KHB A;  4LO8 A;  1S0E A;  3SKV A;  5A6X A;  1D4M 1;  2P5B A;  4CDQ C;  3AXE A;  4HSL A;  1VB4 A;  2IUW A;  5ACA 2;  3VBR A;  3VBH A;  3ACH A;  2W5F A;  2GMP A;  1X36 A;  1EV1 2;  3FFQ A;  4J6G A;  5C4W C;  2WZR 1;  2D3P A;  5LW9 A;  1IPK A;  5I0D A;  3DGT A;  1H1M A;  2RS3 2;  5H9Q A;  1N47 A;  1TZO A;  1GP5 A;  4QDR A;  2VW1 A;  3T30 A;  5FXV A;  1K45 A;  4MV2 A;  4JGY A;  5JSP A;  3SCH A;  3N7L A;  1ZBE 1;  4FFG A;  5FYV A;  5LBC A;  4A2U A;  1WD3 A;  2WWJ A;  5FY5 A;  1QHD A;  4URA A;  5JVV A;  3DYP A;  4XDP A;  1QJY 2;  3BTY A;  3AP5 A;  5EHD A;  4I0B A;  1JZ4 A;  1I3H A;  4YM2 A;  4K20 A;  4BU2 A;  1PK6 A;  3I3E A;  2E31 A;  3NKG A;  4BA6 A;  4AI0 A;  3ETP A;  5J96 B;  4P14 A;  3G6J B;  3NNF A;  3ORJ A;  3ZR5 A;  4JKK A;  3H3Z A;  3WHU A;  2F4P A;  3WDY A;  5DZE A;  3I7D A;  5I8S A;  3NNG A;  2X05 A;  2WNV B;  3KV5 A;  3N3H A;  4W50 A;  4MUV A;  1YJK A;  3CL1 A;  4M3C B;  4CSW A;  2JDM A;  1J83 A;  2LM3 A;  2QQV A;  2YGL A;  4YLZ A;  1LEM A;  2YB7 A;  5E1R A;  3RMY A;  2UWA A;  2VMH A;  2ZGP A;  4AVT A;  2TEP A;  1W8Z A;  1H9P A;  5HV4 A;  5D1I A;  3VZL A;  5JZG C;  2C9A A;  3CKH A;  4P5Y A;  4SLI A;  4OHY A;  1HN0 A;  1LOF A;  3M7A A;  2CGP A;  2WBK A;  1X7N A;  2XJV A;  2ZPX A;  3CLP A;  3SH4 A;  5FXX A;  1ZBA 2;  5ACA 3;  1F5F A;  4OFG A;  4QKB A;  1HRI 1;  2HH9 A;  1EV1 3;  1FNY A;  1UZV A;  2BNM A;  1RJ7 A;  3AZW A;  3DN7 A;  1G6N A;  5JMC A;  5CKN A;  3I2K A;  3ZXL A;  2RS3 3;  1LJ7 A;  2IVJ A;  5A6Y A;  5KC5 A;  3I49 A;  2GAU A;  2GDF A;  2J1R A;  2Q1Z B;  5FZC A;  2LAL A;  1NYW A;  4M4P A;  4BB3 A;  2IXK A;  3CHX A;  2NMO A;  3HR9 A;  5F5A A;  4IET A;  3I4I A;  2RS5 2;  3E5X A;  2Y34 A;  4XF4 A;  1HXS 1;  3ZR6 A;  3P3N A;  2BTV C;  3T2O A;  5FPZ A;  4AG4 A;  1GWL A;  3EO6 A;  1MS4 A;  4FFF A;  4IV1 C;  1R09 2;  5CFC A;  1UYX A;  1CZT A;  2WLP A;  1UIJ A;  3M2M A;  2WA4 A;  1VBC 2;  5IAV A;  3BN6 A;  2WZP P;  3WW4 A;  3ZXG A;  3LAG A;  3NNM A;  1BBT 1;  3SIT A;  3M70 A;  1A3K A;  3KGL A;  4IV3 C;  5EZW A;  4GIQ A;  4NPL A;  1RMU 2;  4IEP A;  4QPG B;  3E97 A;  3ILR A;  3LSD A;  4PBO A;  2XKP A;  1UOF A;  1QNW A;  4QB6 A;  3ZVX A;  5FYZ A;  3WVJ A;  1SAC A;  2OW4 A;  1OKO A;  4LBK A;  4LXL A;  1MQT A;  3AP9 A;  5CIS A;  3V0B A;  3J7M A;  3I3D A;  3ZM8 A;  4QHZ A;  4QQL A;  5FYH A;  4NAM A;  1F2N A;  3PLQ A;  4B1M A;  4IER A;  4XTM A;  3J8F 3;  4MX3 A;  3RZH A;  1IHM A;  4RGG A;  3LEK A;  4DXS A;  2VL4 A;  2JKX A;  1ZBA 3;  5FZL A;  5FYY A;  2MPF A;  1SLT A;  3I54 A;  2WL1 A;  3C2U A;  3RG0 A;  5L7O C;  1ACC A;  1HXS 2;  3S0M A;  1RB8 G;  1WKY A;  4DY5 A;  4D7Y A;  4NRQ A;  2X10 A;  3A0K A;  3PNA A;  1H6X A;  2W1W A;  1X33 A;  4WVZ A;  2W68 A;  2QQL A;  3VBO A;  3OYW B;  1UYZ A;  4LBM A;  3MID A;  5FY1 A;  2A5Z A;  5LA1 A;  3RWK X;  2XL9 A;  4Q4W 1;  1URX A;  1DGW X;  2WZ8 A;  2PN5 A;  5LA2 A;  3KGZ A;  5FJH A;  5SV5 A;  4Q0P A;  4BME A;  2QQM A;  1IS4 A;  5FY8 A;  1RVF 2;  3NAP B;  1R09 3;  1NA1 A;  2WRA A;  1S0G A;  3J9S A;  3AZZ A;  3ME2 A;  1AYN 3;  2I07 B;  2R04 1;  2VBB A;  2GME A;  2JEC A;  4QX7 A;  2VME A;  1JS9 A;  5FZF A;  3WW1 A;  3ZFF B;  5I93 A;  3K3N A;  5IYY A;  2BJS A;  3LFM A;  5FWJ A;  2J1A A;  3AJZ A;  1PX4 A;  2WNE A;  3C3V A;  1ZA4 A;  1W9S A;  1V9U 1;  4OLL A;  4ZU4 A;  5DXD A;  2XBO 2;  3O0V A;  1TMF 1;  2VM9 A;  5FZO A;  3HT2 A;  2VEC A;  4P5H A;  1YFX A;  1IOA A;  3NJX A;  3NST A;  1Y9M A;  3USU A;  5JLV A;  1UF2 C;  1YC6 1;  4PDW C;  3KHC A;  1NG0 A;  1JU4 A;  2ZEW A;  4AI8 A;  1GMM A;  4CCC A;  4BK5 A;  1JZ6 A;  1H1I A;  1TME 3;  3ZIW A;  2EAL A;  1BJQ A;  4UI9 L;  2WO1 A;  4XCA A;  3U10 A;  5BNO A;  3W5M A;  3DYM A;  1GNH A;  5F2S A;  5TSW A;  5HXV A;  4Q4W 2;  3VHP A;  1SBF A;  4X6Q B;  2DV9 A;  2YC0 A;  3T2P A;  4DB5 A;  5A1F A;  4NIA A;  1H30 A;  1YNA A;  5JI7 A;  4L92 A;  5JSR A;  4E4H A;  5C9A C;  4MGT A;  3PU3 A;  4KWK A;  4OZO A;  5CYY A;  2DFC A;  2A73 B;  4BXS V;  4AFA A;  1PGS A;  2DVF A;  4D3W A;  3CEW A;  1YQ5 A;  2GND A;  1GOG A;  2R04 2;  4Z8B A;  3N9O A;  1RXG A;  2FDK A;  1W2U A;  1WCQ A;  3HWJ A;  3ZYJ B;  4CPB A;  5LK7 B;  2JDZ A;  1RVF 3;  3CZU A;  2Y26 A;  2XWB B;  2VQA A;  4TTG A;  4Y5S A;  1NLS A;  5JUV A;  3SEP A;  3WUC A;  4D94 A;  1XJA A;  4GXL A;  3M8L A;  5CEH A;  3KF5 A;  3R05 A;  2FHR A;  2R06 1;  5J1X A;  5A3P A;  2ENR A;  1UOG A;  2EXJ A;  3R4S A;  3SNM A;  2RR1 1;  2VC9 A;  4Q0Q A;  1W9Y A;  2D97 A;  2HWB 3;  3D8C A;  2NLR A;  2ZHN A;  1K5M B;  3J7L A;  3LD8 A;  4GKX A;  1GP6 A;  2HLE A;  4QM9 A;  4CDU C;  3POI A;  4IEV A;  1JYW A;  3Q8C A;  1HRV 3;  2Y6H A;  3SIS A;  1NLQ A;  2QQO A;  4XJW A;  1VPH A;  4YRD A;  1Q8V A;  4D7S A;  3CJX A;  5IK7 A;  2ZGT A;  4AI2 A;  5DZG A;  2B42 B;  4CEY C;  3GAL A;  1WBF A;  1ODN A;  1SDW A;  2BOI A;  2K46 A;  4Y1X A;  3TRS B;  3ITQ A;  3Q8A A;  4B4R A;  1CX1 A;  2R6Q A;  3VBF B;  2E32 A;  2E51 A;  2W9X A;  3WNM A;  2CYF A;  2EIB A;  5KHK A;  1KEX A;  2P4E A;  4IE6 A;  3UKN A;  1DDL A;  4RYD A;  1VAM A;  1KFX L;  3J4U H;  3ZX7 A;  4C90 A;  5IK4 A;  3K4A A;  5IVE A;  3KV4 A;  2DU1 A;  1V6J A;  5T54 A;  1LOC A;  2OQ6 A;  2OPK A;  4CVU A;  1S0F A;  4EWD A;  2P37 A;  2GSY A;  1QH6 A;  4G3Y C;  3MF6 A;  1ASJ 1;  4WM8 B;  4AFC A;  1PZ9 A;  1WZX A;  4OVE A;  4A44 A;  1XC6 A;  3ZMO A;  3BU7 A;  2WS9 1;  4HT1 T;  5DUV A;  5I0T A;  2ZML A;  5IVY A;  5T55 A;  3KT1 A;  3RDI A;  1NY7 2;  1HJG A;  4H2A A;  2VAU A;  2ZEX A;  1UKR A;  3CF6 E;  4KNC A;  1QOT A;  2A6W A;  1W0P A;  1QDO A;  4DIQ A;  5ANQ A;  2OX0 A;  1OH4 A;  1NKG A;  1PO2 1;  1VB2 A;  2I74 A;  3UV9 A;  1PGW 2;  2ZS6 B;  4OI4 A;  3RS6 A;  4AVC A;  3OPW A;  2CGO A;  2AEN A;  5T52 A;  3AKP A;  2F6B A;  4YW3 A;  3WF1 A;  4AL9 A;  1W8O A;  1ZZ6 A;  4Q8K A;  4XIO A;  2RDS A;  4XHX A;  1U5I A;  4HON A;  4GH4 C;  1W2T A;  3EHK A;  1A8D A;  2JX9 A;  1LEN A;  1VAL A;  4LUL A;  3WCR A;  2XXZ A;  3VL8 A;  2HWC 3;  1RUF 2;  3THD A;  1FMD 1;  3OF1 A;  3H7J A;  1OD5 A;  3ZPY A;  4UW5 A;  3KMH A;  2HBT A;  2R32 A;  2ZAB A;  1SEF A;  4LKD A;  4QGN A;  5LK5 A;  3UKV A;  1MPX A;  1ND3 B;  3LFI A;  1GYK A;  1ZYB A;  1W8F A;  2YPD A;  4QX3 A;  3FN9 A;  4FQ4 A;  1FPN 2;  5FBJ A;  3VLB B;  1UZ0 A;  2R30 A;  3EYP A;  4L9B A;  4YM3 A;  3O14 A;  2O0O A;  1UU4 A;  4R8H A;  1NZI A;  5FZ7 A;  2ZBJ A;  3GCX A;  3OY8 B;  2BOJ A;  2XKO A;  3ACL A;  3WR0 A;  4A7Z A;  4XFF A;  2JWP A;  1GKB A;  1JTZ X;  5CFD B;  2QFE A;  3HNY M;  1KJR A;  2P3I A;  4MGY E;  4ASM B;  3KVA A;  2DCK A;  3SH5 A;  1S0B A;  4CDX C;  4YVS B;  1OLM A;  3AZV A;  3D6E A;  4RL7 A;  3FC0 A;  2WNU C;  5FUI A;  3VZN A;  2YXS A;  4HK8 A;  4ZON A;  4AAX A;  3KVB A;  4LA2 A;  3TNQ A;  3WP4 A;  4WM7 B;  1UMH A;  4IEO A;  4V1P A;  3ZOI A;  3OGG A;  1QNY A;  1FMD 2;  4H7L A;  5BNP C;  5C70 A;  2CTV A;  1RUH 2;  3LSE A;  4YVW C;  4PBP A;  4P9L A;  5JZG A;  1OUR A;  4Z82 A;  2BV4 A;  3H3U A;  4M00 A;  1OUS A;  1SBE A;  3VL9 A;  5CB7 A;  3N35 A;  5EJ3 A;  5FP8 A;  3OB8 A;  4FTE A;  3VBR C;  1RUF 3;  1RUG 2;  1VBA 3;  4HKW A;  4JTO A;  2G4I A;  5K0U B;  3PU8 A;  1YIF A;  5FZB A;  3C7E A;  2GH8 A;  3JQW A;  2RJL A;  2BER A;  4FP3 A;  4N43 C;  4YG6 A;  1Y7B A;  3FHI B;  2WIN B;  4GB3 1;  4MYE A;  4YW2 A;  4UFL A;  4LOR A;  1LNS A;  5IWF A;  1FPN 3;  2VZ1 A;  1GBG A;  3H8O A;  1RC6 A;  2PLV 2;  3KB5 A;  4CEW B;  4RFR B;  1H8T B;  1F4H A;  1R1A 2;  2R1D A;  4P02 B;  1QY4 A;  3P6B A;  4TLF A;  3AMN A;  1AR9 2;  2JE8 A;  4ATF A;  1S55 A;  4HLT A;  2GNB A;  1C8N A;  3BB6 A;  3IDB B;  4WZC A;  4AEK A;  1XNT A;  3KF3 A;  4FPH A;  1PK6 C;  1XE7 A;  1LGC A;  4IV1 A;  4NHY A;  4BH9 A;  2EIG A;  3JBG 1;  1C8M 3;  4LHL A;  5FZ8 A;  5L19 A;  4LBO A;  5EJZ B;  3LPF A;  2FDG A;  1AYM 3;  3VBO B;  3VBU B;  4YZ1 A;  1ODM A;  1COV 1;  2G1M A;  4PIY A;  3SHR A;  2Y6J A;  2PEL A;  2DU0 A;  1LHN A;  4K3U A;  1W6P A;  1Z0H A;  2HWE 1;  3LF7 A;  1GNZ A;  4IV3 A;  1W9T A;  1PMI A;  4AWD A;  3SC7 X;  3KQR A;  3VKM A;  4U2A A;  2DTW A;  2X09 A;  5LBF A;  3K3O A;  3MYX A;  1SFY A;  5J37 A;  2O8Q A;  2VTX J;  2V5D A;  4AGG A;  3TN9 1;  1NA1 B;  5FZ6 A;  2V09 A;  5CU1 A;  1NQD A;  5D2A A;  1RUH 3;  1NCR B;  4MGI E;  2YU2 A;  2QQK A;  2DCT A;  4ZS2 A;  3OUI A;  4BIS A;  1G9B A;  1RUJ 2;  1J84 A;  4YM1 A;  1EAH 1;  2ZA9 A;  3OGS A;  5J09 A;  3VDD B;  3ETQ A;  5CA6 A;  1J1T A;  1SG3 A;  1AVB A;  1SFP A;  5F3I A;  1V6M A;  3W5N A;  2VG9 A;  4Q4X 3;  2EAA A;  1S0J A;  1V6K A;  3NNJ A;  2YG0 A;  3LOB A;  4N53 B;  5F5Q A;  4CP0 A;  3HMY A;  4CUA A;  1AZD A;  2XON A;  1SPP A;  4HN0 A;  3UGG A;  3NL1 A;  2WFF 1;  3WQB A;  3B9I A;  2VUA A;  4NAO A;  1V0A A;  2ZGS A;  3LGR A;  4KBB A;  4OYU A;  1CD3 G;  1R1A 3;  4M01 A;  2K9Z A;  5AVA A;  1COV 2;  2ETE A;  1AR9 3;  5DUW A;  4NID A;  5FZM A;  3AMQ A;  3NO8 A;  1ULO A;  2ILM A;  2Z5W A;  4S2G A;  4ET7 A;  5K7P A;  3ELN A;  3HOB A;  3WP3 A;  2IXI A;  4V2W A;  5LBE A;  2P3Y A;  2Z2S B;  2UYA A;  2BDR A;  4COW A;  3LA2 A;  4QXC A;  3TN9 2;  1Q3E A;  3RYK A;  4UWD A;  3TEX A;  1PIV 1;  1ZRI A;  1CAX A;  2K0G A;  4DS0 A;  4Y33 A;  1AR7 1;  3AL5 A;  3VD5 A;  5FOB B;  2NPI A;  3ZXF A;  2JG8 B;  4A7K A;  1AR8 1;  1DYO A;  1E5H A;  1ZRF A;  5BNN B;  1JMU B;  2W92 A;  5LRR A;  1ND2 B;  3VUO A;  4D7T A;  5BYN A;  3THC A;  1Q8P A;  4JGZ A;  5HBA A;  1CGP A;  3ON7 A;  3U11 A;  2XG3 A;  4YW7 A;  3RZZ A;  1GIC A;  3UJQ A;  4OI0 A;  2A3W A;  2D6K A;  2C26 A;  2XQX A;  3ZYF A;  2R07 1;  1CAV A;  1XYP A;  2VVD A;  3ENR A;  3PDQ A;  4PDW A;  4EN6 B;  1W0O A;  1UN1 A;  1S0C A;  3WG1 A;  3HQU A;  3MUY 1;  3E1F 1;  2A75 A;  2GH2 A;  2ARX A;  1HB1 A;  3PL0 A;  2J22 A;  1WMF A;  4H14 A;  1WLD A;  1BXH A;  4LBL A;  5C7G A;  1XB9 A;  1U5Y A;  2I2S A;  3DL3 A;  3LA3 A;  1RUE 1;  2A70 A;  5C9A A;  5FDB A;  2UYB A;  5FPA A;  3C7O A;  3WP6 A;  1LU2 A;  1UZZ A;  1YWK A;  1CPN A;  2AYH A;  2AEY A;  2RM2 2;  1PIV 2;  2VOW A;  1A34 A;  4CXX A;  4TLG A;  3LDK A;  5FJK A;  3VD4 A;  4KH9 A;  1AL2 2;  5A3N A;  3ECQ A;  3VD7 A;  4EJR A;  5L9R A;  5FP9 A;  4A6S A;  5JOY A;  3ZXK A;  5I8Y A;  3LPG A;  2YBP A;  1R64 A;  1OC1 A;  3POY A;  4FI9 A;  1RUD 2;  5F8P A;  4ZHN A;  4UOJ A;  1H2K A;  1NZC A;  1B35 B;  2R07 2;  5L9V A;  4M3C E;  1LB2 A;  2GNT A;  2WDB A;  3AVS A;  3B69 A;  4LO6 B;  3UGF A;  2V4V A;  5F5C A;  4ERO A;  1OPM A;  2WQ8 A;  4CDU A;  2TUN A;  1W6M A;  4FFI A;  5FZ9 A;  1CX4 A;  3ZO0 B;  2VY0 A;  2WSU A;  1JZ5 A;  1ULP A;  4Y5Z 0;  4K8R B;  1R08 2;  4V2V A;  1QMJ A;  2LTN A;  1LAJ A;  1ULF A;  4QKF A;  1PX3 A;  1ULG A;  3POF A;  3I97 A;  4NVP A;  1IKQ A;  3SKJ E;  5C3O A;  2WT1 A;  5JIU A;  4QU1 A;  1RUC 1;  2BYV E;  1IQA A;  1XRU A;  3AYC A;  4ONU A;  4GKY A;  2AEZ A;  2UY9 A;  3ZLI A;  1W06 A;  3GNE A;  1HW5 A;  2DCZ A;  3T4V A;  1MZF A;  2NMN A;  5KHI A;  5FYI A;  1VRH 1;  2HWD 1;  1BHG A;  2IVI B;  2XL7 A;  3MW4 A;  4MXW A;  1D7P M;  1Q43 A;  3S7I A;  4CDQ B;  3LWC A;  5JCT A;  1W8H A;  2C24 A;  2RMU 1;  1XBF A;  3FUO A;  3H3L A;  1XSQ A;  5C4W B;  5LA9 A;  4QGM A;  2RM2 3;  1XNK A;  1WUV A;  3KWV A;  4XZU G;  4E4S A;  4E8D A;  3PIG A;  4HMZ A;  4K9S A;  4JTN A;  1AL2 3;  3JD7 1;  4AVB A;  2ZX4 A;  1QXJ A;  4DUV A;  4B3N A;  1CIW A;  1GU3 A;  1CJP A;  3VDB A;  4EE2 A;  4HOO A;  2VOK A;  1VBB 3;  3ZN5 A;  2VMC A;  4XDQ A;  1H6Y A;  4CA9 A;  4XFG A;  4FSJ A;  1BVP 1;  5EPA A;  1EPW A;  5BPX A;  1CZV A;  2CY6 A;  2XUM A;  3I2H A;  1UPS A;  3N7J A;  2OKX A;  1MVQ A;  1QJU 1;  1O59 A;  3BCW A;  2YY1 A;  4FPF A;  1LTE A;  5FR3 A;  2OYZ A;  2D6P A;  4TWT A;  4BWO A;  1J3R A;  1RUC 2;  1GLH A;  4Q1P A;  3IAQ A;  3F95 A;  1XND A;  4GH4 A;  4OUM A;  4BLI A;  4YGD A;  2OUJ A;  3OBT A;  1C5H A;  2XJR A;  3CJI C;  2JG9 B;  5FRA A;  3ZYP A;  1JN2 P;  2ADE A;  2IXL A;  1LKN A;  3GHM A;  3NRU A;  5CG9 A;  1W6O B;  4DXR A;  3CDZ B;  5FXZ A;  2VNO A;  2DUQ A;  1IG0 A;  3PVO A;  1QGL A;  1YQC A;  3IAP A;  3LDR A;  3IN9 A;  1DQ6 A;  4XUN A;  4UAP A;  5EFU A;  4LHN A;  1FOD 2;  1JOB A;  1UQX A;  1QXP A;  1I6X A;  1ENS A;  2VZR A;  5DG1 A;  4M0H A;  1NE6 A;  2BUK A;  2D7F A;  2WT0 A;  2JE7 A;  4XZP A;  2P3J A;  3UET A;  1JYX A;  4FQZ A;  1C1L A;  3H42 B;  1QH7 A;  4G9S B;  2D43 A;  4Q4Y 3;  3WD5 A;  2D3R A;  4XVH A;  2QNK A;  2NQY A;  4AK3 A;  2WKK A;  2VW2 A;  2ID4 A;  3UNP A;  1RHI 3;  2YFU A;  1DG6 A;  4CDX A;  2JIC A;  1QJU 2;  2PYT A;  4CDW A;  2XJP A;  1X9P A;  2WNU A;  2ZGK A;  2RS1 2;  3VD9 A;  2VTX A;  4MVT A;  2MHF A;  1VBD 1;  2WN2 A;  3HVD A;  3M3C A;  1RUN A;  4W8J A;  1H2M A;  2GAL A;  5HCF A;  2YC4 A;  1BEV 2;  2J1S A;  3G7D A;  1F15 A;  3FBY A;  1CAU B;  4FPO B;  5KXC A;  4CU6 A;  5LWB A;  2B45 X;  5BNP A;  4YVW A;  1JHN A;  3Q9O A;  2VCB A;  3U14 A;  1IQD C;  3O1U A;  3PVE A;  3FFZ A;  1SLB A;  3FX3 A;  3TOJ A;  3WLU A;  5KXB A;  3V56 A;  4SBV A;  2FCV A;  1GV9 A;  5EYY A;  4AFM A;  5C8C B;  4C1W A;  4RS5 B;  5DAQ A;  3UK9 A;  2HEY F;  3T3Y A;  1GWM A;  4E4Z A;  4YNI A;  1JW6 A;  4QMA A;  1OVS A;  4N43 A;  5CAZ A;  4XF9 A;  2IXH A;  1DQ1 A;  1FOD 3;  2AAC A;  1W8W A;  3WEZ A;  3E5Q A;  2YBS A;  4AF9 A;  5FYB A;  2F4L A;  2WC2 A;  3H1W A;  3Q8B A;  4YW5 A;  3U75 A;  1QQP 3;  3KLS A;  5GM0 A;  5A1L A;  4HAN A;  5GLZ A;  1UU6 A;  2CGN A;  1GQG A;  5L7O B;  4CPB D;  1HIX A;  1PVC 1;  1NOV A;  2VMD A;  1AL0 G;  3B00 A;  1O91 A;  3MW3 A;  2QZ2 A;  3D0J A;  4A45 A;  1YI9 A;  2OXB A;  2Y8K A;  4E2Q A;  2FD8 A;  3ZYH A;  3EB7 A;  3ZXJ A;  2P3K A;  4RQP A;  2B7Y A;  2QQW A;  3UYJ A;  2IC1 A;  3JB8 A;  3WCS A;  2P1B A;  3ZYR A;  3RZM A;  1BVV A;  5FPB A;  1O4T A;  2PHX A;  3B93 A;  3FL7 A;  3RGB A;  1W6N B;  4RD7 A;  4BYY A;  1H4H A;  1RXF A;  1S2B A;  4EN7 B;  1BEV 3;  2XGX A;  2DBN A;  1D4M 2;  2W47 A;  2X5I C;  4DPN A;  3WNP A;  5A7O A;  4QT6 A;  1F8V A;  1JU3 A;  5HCB A;  3U78 A;  2JDN A;  2WZR 2;  3HD8 B;  4AR2 A;  2W3J A;  3MDP A;  5JOX A;  1B09 A;  4WV8 A;  1CAX B;  5E16 A;  5FLJ A;  5A7S A;  2H0B A;  5EYX A;  4AEJ A;  1ZBE 2;  2EVX A;  1O5L A;  2VCA A;  3ZN6 A;  2OZJ A;  3O12 A;  4I30 A;  1W3X A;  1MS0 A;  5FZ4 A;  2JB8 A;  4LR4 A;  4MOA A;  2ZGL A;  3WW2 A;  4C0H A;  5IAT A;  4CP1 A;  5JXJ A;  5LEK A;  3WG3 A;  4ZPI A;  3AC0 A;  4OI2 A;  4YZ2 A;  3E6D A;  1O3S A;  1PVC 2;  2XLF A;  3ATG A;  4PF5 A;  2N7G A;  3TNP B;  1YCI A;  4FOY A;  2BNO A;  2CU5 A;  2JB4 A;  2VCM A;  4QB2 A;  2VZS A;  1W8U A;  3CNA A;  4JDN A;  2VUJ A;  1LU1 A;  1WW4 A;  4CE8 A;  1QJY 3;  4W6W A;  1IS6 A;  1AJO A;  4FOV A;  5LY2 A;  4QX5 A;  4OUS A;  1NCQ A;  3W59 A;  1TQ5 A;  3PTR B;  1M06 G;  1DGR N;  1ZZ7 A;  3OPZ A;  4GMP 1;  4FVV A;  3PJY A;  4NHK A;  5AVP A;  5F37 A;  2GN3 A;  4CP2 A;  1HB2 A;  4IGQ A;  5DAV A;  4CCE A;  3WDU A;  3BGA A;  4LK7 A;  1MVE A;  3B94 A;  3DF0 A;  4LBQ D;  1OXC A;  2UWB A;  3KCC A;  3I2O A;  1DZQ A;  2XQR A;  1AXK A;  5FCC A;  3HNB M;  1D4M 3;  2B9V A;  3DXT A;  3JU9 A;  4FXK B;  4DXZ A;  1W2O A;  3RRD A;  2QQU A;  1HRI 2;  2O14 A;  2WZR 3;  4MLO A;  2BGP A;  2NYY A;  3E5U A;  1AUY A;  4DXT A;  4LIU A;  1ZZ8 A;  4QPI C;  3DPR C;  2VZT A;  4JKL A;  1VRB A;  4FPE A;  2QTW B;  3WG2 A;  1ZBE 3;  3ZFG C;  3ILF A;  5A7N A;  3WNK A;  1U5X A;  1JZ7 A;  2WO2 A;  4Y24 A;  1IGO A;  1W6Q B;  1WCS A;  1ZRR A;  3AYD A;  2LW8 A;  2W1S A;  4OHV A;  4YW1 A;  3KD4 A;  5FIX A;  2W95 A;  4COV A;  2VR4 A;  2YGM A;  4NN0 A;  5I0U A;  4P9G A;  4IEQ A;  1CVN A;  2UU8 A;  1FAT A;  2YV8 A;  3WY6 A;  4FBF A;  1PM7 A;  3DYO A;  4OHX A;  4XJ8 A;  4CEY B;  3LOI A;  2RS5 3;  4PLN A;  4W4Z A;  2W2I A;  1W3V A;  3VZO A;  1HB3 A;  1FT9 A;  1L7Q A;  2J1T A;  4GA9 A;  1BBT 2;  1MZ6 A;  4MSV A;  1KIT A;  3K48 A;  4Q4V 1;  4L8Q A;  1SQ4 A;  2D5H A;  2WII B;  3W21 A;  4LOT A;  1W2N A;  4I01 A;  1YFY A;  4FOQ A;  1HRV 1;  1VBC 3;  4C8D A;  2E7Q A;  5JIA A;  4RHV 1;  4A7Y A;  4K6B A;  5FZE A;  4QAW A;  2QDN A;  5GLW A;  1UU5 A;  4YZ4 A;  3ZSL A;  3FWE A;  5L73 A;  1JOP A;  1RMU 3;  4HVQ A;  4AHZ A;  3N7K A;  4CUC A;  2WNV C;  2Q30 A;  4JGZ C;  1XE0 A;  3S7E A;  5A3L A;  4IEW A;  5IT6 A;  4R4X A;  2PA7 A;  1ALY A;  3LCP A;  1RIR A;  2QQN A;  1AR6 1;  4QHO A;  1I5Z A;  2XWJ B;  4IE5 A;  4ISQ A;  1DQ5 A;  2FCT A;  3WSO A;  2CAU A;  1EPZ A;  3A22 A;  4IND A;  2QDR A;  4MGQ A;  4YPJ A;  3UL2 A;  4AHW A;  3GCW A;  4Y22 A;  5A6Q A;  1S0I A;  1WLC A;  4HK9 A;  4E8C A;  5A32 A;  2WAA A;  1U5Z A;  2ES3 A;  2PHR A;  1DU3 D;  4IEU A;  3WW3 A;  5A70 A;  4OMC A;  5DN2 A;  1HXS 3;  5FQ0 B;  2LRP A;  5FPV A;  5T3N A;  4Q4V 2;  3LE0 A;  4OZX A;  4Q8L A;  3IKW A;  1AF9 A;  4Q0U A;  3NV3 A;  4K8F A;  5GLU A;  5GJ6 A;  1W9F A;  2ADD A;  2L9L A;  4IEZ A;  1STM A;  4RHV 2;  3ZYB A;  4XDO A;  1M4W A;  2JE9 A;  4CP9 A;  2CNA A;  4Z1V A;  4XC9 A;  1BBT 3;  4GD4 A;  4C1X A;  1VIW B;  1CWP A;  2AGS A;  2J1U A;  1QJZ A;  3V65 A;  3O1R A;  4DO0 A;  1LHU A;  1PNF A;  2V4A A;  1V9U 2;  3VBS C;  5HCH A;  3L2H A;  2DFB A;  5IUQ A;  4BZ4 A;  4YM0 A;  1TMF 2;  1JUH A;  1MS5 A;  4I0W B;  1SZB A;  2WZE A;  3A7Q A;  1AR6 2;  4JVA A;  2ET1 A;  4UFK A;  1O3T A;  4NHX A;  5FP7 A;  1LHV A;  1VMF A;  5ABJ C;  3MZH A;  4BQX A; 
#chains in the Genus database with same CATH homology
 4XUR A;  1XNT A;  2ORZ A;  2VCC A;  3ACG A;  1DP0 A;  3I2I A;  5EJZ B;  3LPF A;  2VZ3 A;  3A21 A;  1UXX X;  1UY0 A;  2Y6J A;  4A4A A;  5CZK A;  3I2J A;  5LA0 A;  1W9T A;  1GUI A;  1GNY A;  2BZD A;  2X09 A;  3HJR A;  2B4K A;  5EIY B;  1P8J A;  3FHQ A;  3I2F A;  2V5D A;  3PUI A;  3WNO A;  4D0Q A;  4QX0 A;  4P00 B;  4ZY9 A;  5DQ0 A;  4CU7 A;  2QQK A;  2W91 A;  1K3I A;  3OGR A;  1J84 A;  3OEA A;  3III A;  3OGS A;  4GWJ A;  2VZV A;  3OG2 A;  1SG3 A;  5JXI A;  3A23 A;  3W5N A;  2Y6K A;  2YG0 A;  3K4Z A;  3NJV A;  4MGS A;  1UY3 A;  4M4R A;  3ACI A;  4CUA A;  4XUP A;  2XON A;  3DEC A;  2VO5 A;  3WQB A;  4OYU A;  2YC2 A;  1NX9 A;  4IUG A;  3HEI A;  3WF3 A;  1GOH A;  3C7F A;  3T0A A;  4ZZ8 A;  1NAE A;  3LEG A;  2BGO A;  1EUU A;  4ET7 A;  1ULO A;  2VTF A;  1JYV A;  3HOB A;  2C9K A;  2VQT A;  3T2Q A;  2ZXQ A;  3VD5 A;  1CIY A;  2HYX A;  1DYO A;  1F4A A;  2W92 A;  3IDA A;  1TG7 A;  3CQO A;  2J1E A;  3THC A;  2EIC A;  2VQU A;  5EJ1 B;  1OF3 A;  4RN5 A;  4LHS A;  3OGV A;  4QX2 A;  4CU8 A;  2C26 A;  2XQX A;  5DMY A;  4OMD A;  2VZU A;  3MBW A;  3C7H A;  3MUY 1;  3E1F 1;  3GDB A;  2XOM A;  2J22 A;  5C7G A;  1K42 A;  1KGY A;  2QBX A;  4JHZ A;  3LEI A;  3C7O A;  3SKV A;  2BBA A;  4QX1 A;  3ACH A;  2W5F A;  4XUO A;  4CUB A;  3VD4 A;  3LQC A;  3ECQ A;  3VD7 A;  5I0D A;  2RVA A;  5IFT A;  3ACF A;  4QDR A;  3LPG A;  1K45 A;  1R64 A;  4FI9 A;  4UOJ A;  4LQR A;  4KMQ A;  4L0P A;  2ZEZ A;  3DYP A;  3T09 A;  2WDB A;  2V4V A;  1JZ4 A;  2WQ8 A;  5JR2 A;  3I3E A;  1T2X A;  2E31 A;  1XNA A;  4CU9 A;  3ETP A;  1JZ5 A;  1ULP A;  4JKK A;  2WO3 A;  3WNN A;  1PX3 A;  4QDQ A;  5DPN A;  3NNG A;  3HNM A;  3I97 A;  2X05 A;  5F7U A;  4W50 A;  3SKJ E;  1J83 A;  3VD3 A;  4KI5 M;  3OEB A;  5JMO A;  2YB7 A;  4QPW A;  2J7M A;  2EIE A;  1US3 A;  3CKH A;  4P5Y A;  5JXH A;  1BHG A;  1L7R A;  4ZZ5 A;  1D7P M;  3P1I A;  3CMG A;  2WBK A;  2JD9 A;  4XZU G;  2LS6 A;  3GXU A;  4E8D A;  3T0D A;  2WUH A;  4QDS A;  3I2K A;  3WF2 A;  4DUV A;  3VDB A;  1GU3 A;  1SHW B;  2J1R A;  1RYY A;  2R7E B;  2E33 A;  4M4P A;  1O8P A;  2VMC A;  1H6Y A;  4OUE A;  5G04 L;  1I5P A;  1CZV A;  3I2H A;  2W87 A;  2OKX A;  1PMH X;  1O59 A;  3T2O A;  4AG4 A;  1CZS A;  1UYX A;  1CZT A;  3BN6 A;  3IAQ A;  2PQS A;  2QQJ A;  3NRU A;  4DXR A;  1W0N A;  3CDZ B;  3IAP A;  4XUN A;  4QB6 A;  4UAP A;  1JZ3 A;  3MO4 A;  1EUT A;  5G05 L;  1OF4 A;  2VZR A;  3I2G A;  3I3D A;  3ZM8 A;  3UET A;  3OBA A;  1JYX A;  3LEK A;  2DCJ A;  2VL4 A;  1YQ2 A;  2JKX A;  4XVH A;  4DXS A;  4LKS A;  1UYY A;  1SDD B;  1WKY A;  2W46 A;  2ID4 A;  1OT5 A;  2X10 A;  3UNP A;  2YFU A;  1H6X A;  2W1W A;  4DUW A;  2YFZ A;  3HPN A;  3SEE A;  2QQL A;  2Y6L A;  3VD9 A;  3GGL A;  1UYZ A;  2WN2 A;  2DDU A;  2VMF A;  4BK4 A;  2RJ2 A;  4W8J A;  3WF0 A;  2YC4 A;  5LA1 A;  2J1S A;  2WZ8 A;  5LA2 A;  3F2Z A;  2QQM A;  4CU6 A;  4A6O A;  2VCB A;  3IB3 A;  1IQD C;  5IYY A;  2VME A;  1W99 A;  4LPL A;  4DEV A;  1US2 A;  5C71 A;  4XUQ A;  2J1A A;  1PX4 A;  1W9S A;  2KD7 A;  2VM9 A;  1JI6 A;  3WEZ A;  2JDA A;  3NJX A;  5B4X A;  5HXM A;  1JU4 A;  2ZEW A;  1DLC A;  1GMM A;  1W8N A;  4BK5 A;  1JZ6 A;  5B4N A;  4UI9 L;  2WO1 A;  1JZ2 A;  3VDA A;  3HN3 A;  3W5M A;  3DYM A;  2VMD A;  4A45 A;  4D8M A;  4GZ9 A;  2Y8K A;  4ZXE A;  4BJ0 A;  3EB7 A;  3T2P A;  1O8S A;  2EID A;  3C8X A;  4P08 A;  4BXS V;  3FL7 A;  2CDO A;  4OZO A;  5CYY A;  4A42 A;  1GOG A;  2W47 A;  1WCQ A;  3WNP A;  2E26 A;  2VZO A;  1JU3 A;  3CZU A;  4TTG A;  2XHN A;  2W3J A;  5JUV A;  3SEP A;  4GWI A;  5HPO A;  3VDC A;  2VCA A;  4PF1 A;  2VZP A;  5J1X A;  3K75 B;  1TVG A;  5LCW L;  2VC9 A;  4MOA A;  5JXJ A;  2HLE A;  3AC0 A;  2C4X A;  2WAO A;  1JYW A;  2Y6H A;  4Z2A A;  2QQO A;  2V72 A;  4QB2 A;  2VZS A;  5IFP A;  1CX1 A;  2QQI A;  3PUH A;  1UMI A;  1PMJ X;  2E32 A;  2W9X A;  3WNM A;  2EIB A;  3WNL A;  1KEX A;  4RYD A;  1XPW A;  5IJR A;  3K4A A;  4JKM A;  3NQH A;  3BGA A;  1JHJ A;  3ABZ A;  4CVU A;  5IHR A;  3HNB M;  4A44 A;  1XC6 A;  1K12 A;  2B9V A;  4A41 A;  2WYS A;  1JYN A;  3T0B A;  2ZEX A;  2BGP A;  2W94 A;  1HN1 A;  4DXT A;  2VZQ A;  2VZT A;  4JKL A;  1OH4 A;  1NKG A;  4KWU A;  4QB1 A;  3WNK A;  1JZ7 A;  2WO2 A;  2Z4F A;  2LW8 A;  2W1S A;  3WF1 A;  2W95 A;  2VR4 A;  1W8O A;  2Y64 A;  3GM8 A;  3MV0 1;  3DYO A;  4TXW A;  2ZEY A;  3MUZ 1;  4W4Z A;  4MAD A;  1L7Q A;  2J1T A;  3THD A;  1UWW A;  2J1V A;  3C7G A;  1MPX A;  3D3A A;  4QX3 A;  3FN9 A;  3CZJ A;  1UZ0 A;  3EYP A;  5A1A A;  2W1U A;  4QAW A;  3T08 A;  3K77 A;  4CUC A;  4XUT A;  3K46 A;  4ARY A;  3HNY M;  1JZ8 A;  5JXG A;  2DCK A;  2QQN A;  2RV9 A;  2Y6G A;  2W1Q A;  4MO3 M;  2VJX A;  1UXZ A;  3WSO A;  5FUI A;  3WF4 A;  3A22 A;  4MGQ A;  4YPJ A;  4AAX A;  1UX7 A;  2WN3 A;  2ORX A;  4E8C A;  2CDP A;  2WAA A;  1UMH A;  4OMC A;  5DN2 A;  4BDV B;  5C70 A;  3FHA A;  3LE0 A;  3MV1 1;  1OD3 A;  3CIH A;  4JX0 A;  1UY1 A;  2L9L A;  3OB8 A;  3UES A;  4PT6 A;  3I3B A;  2J1U A;  3C7E A;  4PQQ A;  2VOT A;  2BER A;  3J7H A;  1UY4 A;  4ARX A;  3U37 A;  4DEQ A;  1LNS A;  3JXS A;  4A3Z A;  2VZ1 A;  2WAB A;  1W9W A;  3K4D A;  1F4H A;  2WZE A;  3A7Q A;  4P02 B;  3P6B A;  1GOF A;  1GQP A;  2JE8 A;  4DUX A;  4HG6 B;  1UY2 A;  1NUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...