4LPLA

Structure of cbm32-1 from a family 31 glycoside hydrolase from clostridium perfringens
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
b'DPYRNVPKDMKTEWKWGQYSSDEPSKAVDGDDSSQFHSQDSAIDKPFIIDMQKAYTIEKLELLFRKNGNGSVKRAEIYSSLDGVTYEKVFSNAEGSDIAPWATDGEVKTINFNKPIKVRYFKIVTKESIGNFLAMREFRPYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
total genus 36
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4lplA00
3I2IA 2V5DA 2EICA 3NRUA 3C8XA 2JDAA 4OZOA 3GM8A 5IYYA 2QBXA 1GOFA 3OGRA 4QX1A 4ZZ5A 1MPXA 1T2XA 4IUGA 3MV11 4DXTA 2CDOA 4JHZA 1I5PA 3HNMA 3IDAA 4GWJA 4FI9A 3VDAA 4BK4A 5LA1A 2Z4FA 1ULOA 2BBAA 2J7MA 2Y6JA 5EIYB 4ARXA 2BGOA 4LPLA 4A44A 1US2A 2Y6LA 2ORXA 4XUQA 4OMDA 3AC0A 3I2KA 2W94A 1JI6A 5DPNA 4AAXA 4D0QA 2VC9A 3FL7A 2W91A 2V4VA 1O8SA 1UYYA 4UOJA 3LEKA 3OGSA 4QDSA 2WN3A 3DYOA 2WZEA 5DN2A 2E31A 3CMGA 1O59A 4A45A 3C7GA 3K4DA 2L9LA 4HG6B 1GNYA 3I97A 1J84A 2X05A 5FUIA 2HYXA 4QB6A 4DXRA 1JU3A 2WN2A 1TVGA 3A23A 2BGPA 2ZEWA 2VQUA 4QB2A 4QX2A 2WABA 2J1TA 4QB1A 2C4XA 1D7PM 3OEAA 2VZTA 3W5NA 2LW8A 2YC4A 2Y6KA 3OGVA 1UMHA 3OG2A 4JKKA 3DECA 3NQHA 3WNLA 1BHGA 3U37A 2YC2A 4A3ZA 4QPWA 2JKXA 4ET7A 3WEZA 3T2OA 2J1VA 3HN3A 3VDCA 2B4KA 1UXZA 3CQOA 3IB3A 4M4RA 2W1UA 1OF4A 3F2ZA 4GZ9A 4L0PA 2RV9A 5JMOA 4ARYA 3IAQA 1JYNA 2E32A 2VCAA 3LE0A 5IHRA 2VOTA 4E8DA 3K75B 3VD3A 2VZ3A 1K12A 4XVHA 3VD9A 3EYPA 3SKVA 1GOHA 3I2GA 2WUHA 5JR2A 4KMQA 3WSOA 2J1SA 4ZXEA 1P8JA 1UY1A 3CDZB 4CU7A 1L7RA 2Y6GA 1UX7A 2C9KA 3T0DA 4PQQA 2YB7A 2VZPA 4DXSA 1H6XA 2WAAA 1JZ7A 2ZXQA 3HNYM 3WNPA 3HJRA 1LNSA 3I2JA 4MOAA 3T08A 2VMCA 2VTFA 1W8NA 2VCCA 4CU8A 1W99A 1K45A 2ZEXA 1NKGA 2QQOA 4MADA 3THCA 2XOMA 2QQKA 2E26A 3A7QA 1XC6A 2WBKA 1O8PA 5DQ0A 2W5FA 3I3BA 4M4PA 1J83A 4TTGA 2VZRA 2WDBA 4KWUA 2VZQA 3D3AA 3BN6A 2VZSA 4Z2AA 4TXWA 2E33A 1WKYA 3WF2A 2RVAA 2VO5A 1PX4A 2W92A 4XZUG 2J1UA 5DMYA 3DYMA 4QDRA 4E8CA 2VZUA 3A21A 3ZM8A 4XUOA 1KEXA 4P08A 4BK5A 1H6YA 5CYYA 2ORZA 1SHWB 3SEEA 2J22A 3FHAA 2W1QA 2W1SA 3CZJA 2EIBA 1F4HA 5IJRA 2LS6A 2WQ8A 1UMIA 1W0NA 1UY4A 2BERA 1OH4A 1JZ3A 4UI9L 3NJXA 3NJVA 5JXJA 4YPJA 3C7EA 1NUKA 5JXGA 3BGAA 3SEPA 4QDQA 5JUVA 4W50A 2JE8A 3CIHA 4LKSA 5C71A 2J1RA 1R64A 3P1IA 2ID4A 2VCBA 1GQPA 5C70A 3PUIA 1JZ4A 4W8JA 3UESA 4AG4A 3T2QA 1K3IA 1OD3A 5LCWL 4JX0A 3T0AA 2R7EB 1JYWA 1XPWA 5JXIA 2C26A 3PUHA 3NNGA 4CU6A 2JD9A 1W9WA 2DCKA 3MV01 4ZY9A 2PQSA 3K4ZA 4OYUA 1W8OA 2VM9A 3LEGA 1GMMA 3SKJE 2V72A 1CZTA 4RYDA 5G04L 2QQIA 5IFTA 1CX1A 3K46A 1XNTA 1JU4A 3VD7A 4A4AA 2VMFA 1YQ2A 2ZEZA 1SG3A 2WYSA 2W47A 2W46A 3LEIA 1UZ0A 2WO1A 2Y6HA 4A6OA 1K42A 2VJXA 2EIEA 3FN9A 3GDBA 1JYXA 1W9TA 5IFPA 1ULPA 4BDVB 3JXSA 1HN1A 3LPFA 3WNNA 2VR4A 1NX9A 5J1XA 2YG0A 4P5YA 2B9VA 1JZ8A 5LA2A 2DCJA 4RN5A 2QQJA 4CVUA 2W87A 4DUVA 1OF3A 3IAPA 3I2HA 1DYOA 4CU9A 1US3A 4BXSV 5HXMA 1JZ5A 4DUXA 5G05L 4BJ0A 5B4XA 1XNAA 3WF4A 3K77A 2YFUA 3MUZ1 1DLCA 3HPNA 2VZ1A 2EIDA 2BZDA 4CUBA 1UY3A 1UYXA 5CZKA 4XUNA 3VDBA 1GU3A 4DUWA 3IIIA 1OT5A 2WO2A 2RJ2A 4XUPA 2VMDA 3WF0A 3GGLA 1KGYA 3WNMA 3ETPA 3THDA 1IQDC 4GWIA 3DYPA 2J1EA 4CUCA 3WF1A 3WF3A 1L7QA 4PT6A 3OBAA 2W9XA 2WAOA 3C7FA 5I0DA 2VZVA 3CZUA 1UYZA 2W95A 1UXXX 4LQRA 3ACGA 3ACIA 1SDDB 3ACHA 3EB7A 5C7GA 1EUUA 2XONA 3OEBA 4DEQA 1GUIA 2QQLA 3HEIA 3C7HA 3K4AA 2Y8KA 3HOBA 4PF1A 4QAWA 3VD5A 2OKXA 1DP0A 2X09A 1TG7A 2ZEYA 5JXHA 3LPGA 4QX0A 4JKLA 5HPOA 3UETA 3ACFA 3E1F1 4KI5M 4P02B 4ZZ8A 5EJZB 1UY2A 1CZSA 3WNKA 1EUTA 3HNBM 2WO3A 3J7HA 1UWWA 4UAPA 2W3JA 3T2PA 1JZ2A 4JKMA 4XUTA 3I3DA 3P6BA 1W9SA 2Y64A 5A1AA 2DDUA 3T09A 3ECQA 4MGQA 4XURA 4P00B 4DEVA 1WCQA 2QQMA 4D8MA 2WZ8A 2VL4A 2HLEA 4MGSA 1GOGA 4QX3A 3CKHA 2XQXA 3W5MA 5F7UA 2CDPA 3GXUA 5B4NA 1CZVA 1PMHX 2W1WA 1F4AA 3C7OA 2XHNA 3A22A 3I3EA 3LQCA 1UY0A 5LA0A 3UNPA 4OUEA 2VQTA 4CUAA 1JHJA 5EJ1B 4OMCA 3MUY1 4W4ZA 4MO3M 1RYYA 3MBWA 3FHQA 3T0BA 1PX3A 4LHSA 3ABZA 1PMJX 2YFZA 2VMEA 2QQNA 2VZOA 1NAEA 3MO4A 3I2FA 4A41A 4A42A 2KD7A 1CIYA 2X10A 3OB8A 3WNOA 3VD4A 3WQBA 1JYVA 2J1AA 1JZ6A
chains in the Genus database with same CATH superfamily
1OQEA 1UZYA 4Q1PA 1PVXA 2ADDA 4PI2A 3CF6E 4Y5TA 1Q8SA 5C3QA 3ZSJA 3POJA 2JECA 4OZOA 1J1TA 5IYYA 1GOFA 2NMOA 3DPRC 3ITQA 3OGRA 4ISQA 4L11A 4NRPA 3HQRA 4OVEA 2HWF2 4UBGA 1BLZA 4C0BA 3NNFA 4UW6A 3AB0A 3AMMA 5BNOC 2WR9A 1HRV1 5AFEA 1NA1C 2YGMA 2WNUB 3OGJA 4ISRA 2CDOA 3THPA 4LBMA 3OJBA 4GWJA 2VMIA 2JENA 5C8CA 2C6SA 2WSVA 4Q4W2 4KU7A 4MXVA 5FKBA 1N1SA 1ZZ8A 1TMF2 2WSUA 1COV2 2Y6JA 1MZFA 3R0RA 5ACA1 5EIYB 1CAWB 1HRI3 3VBRB 4AZZA 4ARXA 4EYUA 3FUOA 1LEDA 3NV1A 1UNBA 5DZFA 4A44A 5DAWA 2BVVA 3RI8A 3FFZA 4CUGA 1SEFA 2IVJA 2HWE1 1AXZA 1G86A 1YQ6A 3AC0A 3I2KA 2RDRA 3ZXAC 4IW3A 5T5OA 1NQDA 2WS93 5E89A 2BNOA 3WDYA 4NIGA 4UOJA 1J3RA 3OGSA 5LY1A 1DCSA 2WN3A 4QDSA 5FY1A 2K9ZA 1K5MB 2QFEA 4HVQA 2E31A 2CTVA 2PXJA 5GLTA 3JZVA 4Y20A 1GP6A 2BP6A 1PO23 4XJ8A 1LCLA 3I97A 1WMDA 1J84A 2HEWF 2X5IB 3MI8A 4UT5A 1BVVA 4XW3A 4YM1A 4DPNA 5A6YA 1BCXA 1OXCA 1PM4A 2WYFA 4Q4X1 1G6NA 1HRV2 4XXPA 1JU3A 2FDKA 4BLJA 4XMAA 5FZOA 2AR6A 1QNYA 2BGPA 1NLQA 2ZEWA 4NN0A 4WM8B 3LSEA 2XB6C 4NIDA 2E51A 2WABA 4IQPA 1MEC3 2J1TA 4CDXA 5C4WC 3ZN5A 1NY71 4QB1A 5EPAA 1GLHA 1C4RA 2C4XA 3OEAA 5ACA2 4AI3A 5LA9A 1LULA 1HV0A 5GALA 1XE8A 3V0BB 2VZTA 4ZHNA 2BOIA 2TUNA 5C3OA 3O14A 3CLPA 4JKKA 1AYM1 3J7LA 2BTVC 2HWE2 2YC2A 2CGOA 3AX4A 5FY7A 1QU0A 4EQVA 2HEYF 2R041 3HD8B 5L9VA 4L97A 4MXWB 4QWNA 5LEJA 5FP4A 2XVLA 3HN3A 2ZKLA 1Q8QA 4FTEA 4FXKB 5A3TA 5DZEA 4M4RA 3UJOA 2W1UA 4R52A 4OLLA 4IV3C 1C28A 4IDZA 3U75A 2IXCA 2P6CA 4FFHA 2A6XA 2UURA 1LOCA 4LBQD 2XBO2 2GC3A 1W04A 1CD3G 2GSYA 3BB6A 4HXCA 1SFPA 1EV11 5E16A 3IAQA 5J09A 1QJU3 1JYNA 4LO5B 1SCSA 4Q4X2 3GHNA 1WLTA 3RYKA 1CVNA 1Z7S3 1U5YA 1XE7A 1OD5A 1CPNA 2EAAA 3MIFA 5IHRA 2VAUA 3OUHA 3POBA 2A6WA 2DTWA 4EZHA 3ILRA 4E8DA 1G9DA 2QJVA 4HKLA 1K12A 4FVVA 5DUUA 5KC5A 3MLJA 5K0UA 4JRAA 4L2NA 1ND2C 1D4M3 2CV6A 4A2UA 5LB6A 1RIRA 5SV8A 4L92A 1TQ5A 2ILMA 4K7JA 2RM23 2Y60A 1AYM2 1YC61 3FC0A 4IV1A 4K20A 3WDTA 4IERA 4XJUA 4CSWA 4N9HA 1P8JA 1UY1A 1X9TA 2ZHMA 2R042 2Y6GA 4XACA 1UX7A 1WW6A 2EALA 5BNPB 3AP6A 1RUF3 5CKNA 5FTTC 3POSA 5FJKA 1RHI3 5FZDA 1SQ4A 3T0DA 2IFRA 2ZA9A 1Q43A 4I0AA 1UO9A 4AXOA 2VQ0A 3NNJA 4AVAA 2OS2A 3U0ZA 2VZPA 4DXSA 1JZ7A 1GQGA 3VKMA 2HJIA 1SZBA 1VE0A 1RUI3 2JIJA 3I2JA 1LHOA 4TWTA 4UFLA 1OPOA 3UGFA 3VBUB 1UZVA 4YW5A 3KCCA 1SFYA 4XMIA 3J9SA 4C8DA 1EV12 5J36A 3I4IA 5C9AC 1K45A 3G6JB 3O7OA 1JYTA 1DGRA 2CL2A 2GC1A 2GNDA 2QQOA 2RE9A 5FYZA 2VW0A 1WW5A 3SH3A 2IWGB 4UYBA 1RUJ3 1DQ0A 1JXNA 2DV9A 4CCKA 1REDA 3ZSEA 2A3WA 2R30A 2WNUA 3DKQA 4Y22B 5IVEA 1LB2A 4P9IA 3AL6A 3BTAA 3NKTA 2W5FA 5L19A 5C5UA 3HR9A 3W21A 5T50A 5L73A 4UF0B 4B7EA 2V09A 2VH9A 3HT2A 4TTGA 5A6ZA 1ZZ7A 3CHXA 4QM8A 1CAWA 4LA3A 3BOWA 1H4HA 3VBRA 4CEYA 4Z2AA 5CFDC 4GWMA 4XF9A 5A7QA 2UYBA 4V2VA 5GLZA 4ASMB 4B1LA 1RB8G 3NV2A 1C8M3 1DGWA 3MGUA 3ZM8A 1TNFA 4MZUA 3Q9OA 1KEXA 3PU3A 1H8TB 1C8NA 1H6YA 1STMA 2PAMA 5CYYA 3WG4A 4E4ZA 1GZ9A 4XJAA 1JUHA 5FZFA 2J22A 1K5MA 3WNXA 5KBFA 1LODA 4L99A 3ZYJB 4YW6A 3H7YA 3O12A 1UF2C 4COWA 2EIBA 4Q8KA 4YZ1A 2LS6A 2WQ8A 5GLVA 2C9AA 4XQDA 4MGTA 1AR62 2ZABA 1UAIA 1YFXA 2IFWA 2X5IA 3LA2A 5LBCA 3H3ZA 4COVA 2MHFA 3POFA 1UKRA 1UY4A 5IATA 1RMU1 4EWEA 2PHLA 3LD8A 4BQ1A 3NJXA 1PGSA 2C24A 3JBG3 2W52A 4YM2A 2PLV1 2RG4A 4WM8A 3ZIXA 5CA6A 4I3GA 3LKJA 5FZ6A 5F2SA 4AQ2A 4FPCA 5IK7A 1SCRA 4BYYA 4EN6B 2B46X 5GKAC 2Q8EA 3V0BA 2JDYA 1LGNA 2ZMLA 4K9SA 1R1A1 3JB8A 1Q56A 1I3HA 1HW5A 3ZFFC 4ONUA 5A6XA 1K5JA 1A8MA 4J1WA 4MHRA 4LBJA 2JE8A 3CIHA 1O3QA 3R4SA 3EJKA 2WLQA 3ZPYA 5A1LA 4P9JA 2AYHA 4MXWA 1N3PA 1SBDA 1ZZ6A 2QZ2A 4EWAA 1GQPA 3IIAA 4FOQA 3DPRB 4P5HA 3HMYA 2H6BA 4BMEA 4AG4A 5F6LB 3T2QA 1S0DA 1N3QA 1OD3A 2Q5TA 5BNNC 4HLTA 4JX0A 3T0AA 5BNOB 4G9SB 4E2QA 1NA1B 1PIV1 4AI1A 4FAGA 1WLDA 2AUYA 1FXZA 1KJLA 4RR3C 3OYWB 1OLME 4Y1UA 3E6DA 1RMU2 1JBCA 1WBFA 3GZEA 1L3JA 1QJY3 2QKDA 3ME2A 2RR11 2DCKA 4DMIA 1R092 2CWSA 1ZREA 4OYUA 4UFKA 4FFFA 4O9GA 1BBT3 2ZX0A 1W05A 4K1ZA 5IW0A 3WQ1A 1OA2A 3OY8B 4I0BA 1U12A 3D4KA 1G9BA 4RYDA 1LOGA 1X8MA 3WCRA 1S0FA 4NPRA 1C3HA 3TAYA 4QPGC 5IFTA 2RHPA 4N7UA 2WT2A 4IE4A 1BK1A 1NLSA 4OZXA 2XXZA 4OFGA 4PCRA 5FY4A 3VD7A 4I09A 4LBLA 4A4AA 3QD6A 4J25A 1YQ2A 3ZXLA 1F9KA 1PO13 1SG3A 1XBFA 4OHVA 1GZWB 1NE4A 5BNPA 1OA4A 2A5ZA 1VRBA 4MG2A 1UL9A 2BVBA 4TYSA 2WO1A 3HWJA 2EIEA 3GDBA 5K4LA 4CCEA 3D6EA 4NMIA 4WV8A 2ZGQA 3N9NA 3DN7A 4PLMA 4BDVB 1Q5OA 2RMU1 3VBUA 1PIV2 1ENSA 3JXSA 5EV7A 4M00A 2I07B 2KXLA 4QHZA 4HVRA 3RSJA 4HBNA 2PHWA 1GQHA 4PIZA 5C4WB 2ZZJA 1BEV2 5LA2A 3WCSA 1DZQA 2QQJA 1YI9A 2ZJCA 4NIAA 4AVBA 1OF3A 1RL3A 2ARXA 2H0BA 2BW8A 1W6QB 1GKBA 3D0SA 3E6BA 3KD4A 1LECA 1AYN3 2ZAHA 5FXXA 4S2DA 4Y22A 1ASJ2 2LRPA 3HT1A 4BJ0A 4CDQC 4AQ6A 3GJBA 5CEHA 1YIPA 1PO22 3KM5A 1GBGA 1H2LA 2YFUA 4UF0A 4J6GA 4BHPA 2VZ1A 1YHFA 3O1UA 3AYDA 4HL0A 3ZMNA 1UYXA 2VBBA 5A32B 2V4AA 3RDIA 1GICA 4XILA 2HWD3 3OPZA 4IEPA 4IV3B 4QPYA 1UYPA 2WO2A 4OHXA 4Q4V1 5I93A 4INDA 4LK7A 1WCDJ 4XUPA 2RS33 5B2GB 2VMDA 2FD8A 3BYWA 1RUE3 1H8TA 3O1MA 1VIWB 5F3EA 2PHXA 3ATGA 3THDA 2BPA2 2RMU2 5A7WB 1IQDC 1GZTA 2WWSA 3DYPA 4CCMA 3RZMA 2QDNA 5FZLA 3E6CC 3IKWA 4OULA 1XSQA 1AL21 3U07A 4YGBA 3V65A 3O0VA 4AI8A 3AMNA 1ND2B 1UOGA 2W9XA 3OBAA 1Y3TA 3KCXA 3OSDA 4RA0A 4COYA 3O1SA 3V56A 1YXWA 4S2FA 3RZLA 5CIRA 3AFGA 1UYZA 2OYZA 2WA4A 4YW2A 3I2DA 3ACLA 1W06A 4YW3A 2D6KA 5IWFA 5A33B 2SLIA 5EHDA 1SDDB 3ACHA 1S0JA 3UGGA 3AZZA 1QJX3 2GU9A 4QXHA 4AGVA 3WW4A 1WLCA 1D0GA 4DEQA 4KG0A 2QQLA 1RUG3 2O0OA 4FT8A 2VNRA 1VBA2 2GC0A 2OQ7A 1HB2A 3K4AA 4RHV1 3JUUA 3W20A 4AQTA 1W90A 4Y20B 5HCAA 4Q4V2 3PVEA 1CPMA 1GFF2 4WZFA 3ALQA 3VD5A 1DP0A 2D98A 2P34A 2PHUA 5GM0A 2X09A 4LOTA 5GZEA 1TME2 3ROUA 1HIXA 5C9AB 3ENRA 3DPRA 2EVXA 5C6CA 1AX2A 1IQAA 2BNNA 3MIBA 1O3SA 1CJPA 4AVCA 4YFZA 3RVHA 3S0MA 5KR7A 3ACFA 5FZ4A 1H1AA 1AL22 1FNZA 4KI5M 1XYOA 1NA1A 1LESA 2VY0A 3K3NA 4JRLA 4QXCA 2PHFA 2D6OX 1QQP3 4QHOA 3OYWA 2WO3A 3W59A 1W6PB 5CB7A 1IZ3A 4UAPA 3JD73 3OBRA 2GNBA 4JKMA 5F5QA 5CFDB 2H0VA 4RGAA 1VR3A 5F37A 3M3IA 4GD4A 5FZKA 4EWDA 3L2YA 3DGTA 3OY8A 3VD9A 3BUCA 4LBKA 4P9XA 5F3CA 1G9CA 1UD1A 1W9SA 5JZGC 3ZFEC 4COZA 1KDKA 3WDUA 2BGCA 1WD3A 5CG8A 1C5HA 3PVBB 4XURA 1NCRC 2PAKA 4PDWC 5LBFA 1O5LA 1GZWA 3GZAA 2Q8DA 3ZN4A 4AF9A 4CDWC 1R083 1V70A 4D8MA 4P9WA 1AR93 1H2KA 4MGSA 3AJZA 1GOGA 3AMQA 4X6QB 3IDBB 3USSA 2FHRA 3BTYA 3W5MA 1W3XA 1Z78A 2CDPA 3VKOA 3O1VA 1QJEA 1RXGA 4JQTA 5JSOA 1W9FA 2PN5A 2YC0A 1PMHX 3CEWA 2W1WA 1F4AA 4I3PA 1X50A 3A22A 3I3QA 3I3EA 4V1PA 4AI0A 5JPNB 3LQCA 4NROA 3W9AA 2A73B 2YBPA 4MYEA 5C4WA 3RZZA 2A70A 5BNQA 5JI7A 2MNGA 1V00A 5E6HA 4EN7B 4FSJA 2IXJA 1POV0 1W6QA 4CUAA 4QQHA 5JVVA 1RVF1 4IEOA 1GNHA 2Q4SA 4DRRA 4LBQB 3H8RA 4W4ZA 3ZFFB 3FHQA 4GB33 4B4RA 2YBKA 3AZYA 4Y5SA 3ZYIB 2P3IA 2QQWA 4HN0A 2VMEA 4JHTA 4N8MA 3UV9A 1V6IA 4CCLA 4E2GA 3V0AB 5A32A 5FK8A 2MEV2 1ZRFA 3J7MA 5BNNB 4IV3A 2JE9A 3HBKA 4D94A 1GV9A 4CCNA 4GMP3 5KHGA 4HKOA 1JZ6A 2D6NA 1IGOA 3O1PA 1V9U3 5CKMA 1JHNA 4D69A 3H8XA 2JG9C 4RR3B 1KFUL 1QOOA 1MVQA 1Y9MA 2EXJA 3DXTA 1OLQA 1DQ2A 1POV1 2VQAA 1ZZCA 5A7WA 1HDKA 3ZYRA 4EN8B 5FOBB 1X82A 1LU2A 2QBXA 3MZHA 1C57A 2FMYA 4C1WA 4KL1A 3ES4A 4XFGA 4KNCA 1MPXA 2VOXA 2XMLA 4JGZC 1YQCA 3MV11 1ND2A 4DNYA 2Q8OA 4DXTA 5L7OC 2FDFA 2FDHA 4QPGB 1RVF2 4XTMA 3EXUA 5FY0A 2IXIA 4BK4A 5A33A 1W2UA 1Z0HA 1D2SA 2DVBA 4PIXA 2GALA 2DFCA 3WDWA 2Y26A 3OBZA 4TSVA 3JQWA 2BGOA 5T3NA 2ZGSA 4XBNA 2WQ4A 1MACA 2GP3A 4NVPA 4YVSC 5LY2A 3U10A 2VCMA 4Y1XA 2BRTA 3S7IA 4AR2A 4O9EA 2WRAA 5T5PA 4XOGA 3RQ0A 2WLPA 3FBMA 4D0QA 3TN93 4Q1RA 3MW4A 1FMD1 1F31A 2VC9A 1F5FA 1VMFA 1VBB2 2V4VA 2XVKA 4HFSA 1UYYA 2JKBA 5T55A 3WX5A 4J1XA 2VUAA 2B9UA 2IC1A 2XH6A 2VXRA 3GHMA 3LEKA 5DUVA 5C9AA 3S7EA 2E7TA 4X8PA 2WJSA 5FUNA 4CEWC 2D3RA 3GALA 4EN9B 3C7GA 2PFWA 3I49A 1VP6A 3H50A 2ETEA 4HG6B 2D43A 4KWKA 4YM0A 3SMHA 1DHKB 5FP8A 4NE9A 1ULEA 3TEYA 2XLGA 1C5IA 4LUKA 2HYXA 3X29B 1UU5A 1MR5A 4DXRA 4UFIA 4YZ5A 1ND3C 5FPZA 4FCAA 1HJFA 1TVGA 2D5FA 4TLGA 5GLUA 1ENRA 1WWYA 2E53A 4BQ3A 1W6PA 1RTVA 4RFRB 2HWC3 3IWZA 5CFDA 1LHVA 4LITA 5JSPA 2YPDA 4CTEA 1CGPA 5FZIA 2XWJB 1QKQA 3W5NA 1JH5A 1YFWA 2Y6KA 3OGVA 4M3CF 4UXAA 3DECA 2AEZA 3J4UH 3NQHA 1J58A 1DQ4A 2JICA 3AP7A 1PNFA 2ZAAA 3U37A 1LJ7A 3ZXKA 3MHZA 2ZX1A 1AJOA 5D8AC 2E7QA 3M2MA 4LO7A 4QPWA 2BBVA 2JKXA 4CP2A 2ZGOA 3RFRA 4QQPA 1VAVA 2J1VA 4E4SA 3B9IA 1UXZA 4MHUA 3IB3A 4LKFA 1A8DA 5F32A 2PYTA 3H42B 1OF4A 4JDNA 2JEMA 2P17A 3MFCA 4L0PA 3GCXA 1D0HA 2VMHA 2WINB 3ZYFA 3IDCB 2E32A 1O4YA 1XYPA 5KHIA 3KMHA 4D7TA 5JLVA 4FP2A 3NL1A 3KV6A 2LM3A 1C1LA 3OGGA 3K75B 4G4FA 3S30A 3VD3A 2HWF1 3VDDC 5A7OA 2VZ3A 4XVHA 1MZ5A 4CXXA 4EV0A 1GOHA 2Y0OA 1MS8A 1OI6A 1I6XA 3WG1A 1RUC3 3GCWA 4LBQA 1VMJA 3WW1A 1WA4A 2WUHA 3ZFFA 2KM2A 1UN1A 3R4DB 1SDWA 1AHSA 4XF0A 1SLLA 4Q4W1 5FV3A 1TMF1 4O65A 3KCYA 1COV1 4NR1A 4CU7A 1L7RA 2AACA 3BPZA 5T52A 2ET1A 5TSWA 3POWA 3NV3A 1G9FA 1PHMA 4M3CE 1H1IA 1VPHA 4D7YA 5BNNA 4ZONA 1ODNA 4LOSA 4QGMA 2V73A 2XDVA 1FV3A 2WAAA 4R4XA 2P1BA 4HOOA 5ANNA 1PZ7A 3PNAA 2PTMA 4AFCA 4OHWA 1WA6X 2R6QA 1LNSA 2QTWB 4RR3A 5FZCA 2WT0A 5C3PA 1Q8PA 1W8NA 2VCCA 3PJYA 1JODA 1W99A 4META 2ZEXA 1QOTA 3H8UA 1HKDA 2WQZC 4XDPA 5KWRA 5LRSA 2A3YA 1WCSA 2R063 1XNBA 2WIIB 2A6VA 1VRH3 1YJKA 1BJQA 2QQKA 4R9CA 1S2KA 3AKPA 3ZFEB 1SMVA 5DZGA 3A0NA 4QPGA 1O8PA 5DQ0A 1X33A 2VOKA 2YROA 3MIGA 4M4PA 3ZXJA 4C90A 2WDBA 4KWUA 1W8UA 2EA7A 2ZMNA 2DUQA 4LIUA 3ZN6B 1NCRB 3D3AA 3AYEA 4PDWB 3BN6A 2VZSA 2VBPA 4XAEA 1OKQA 4CDWB 3IN9A 5IVVA 2E33A 2PLV3 1PVC3 4GMP0 1VAMA 3WUDA 1PX4A 2W92A 1FYUA 2J1UA 2EXIA 1ZBA1 3HIFA 2D6LX 4QDRA 5FBJA 2VZUA 1KS4A 1SACA 2DBNA 3B02A 3LA7A 1DZTA 3I59B 4BK5A 3ZOIA 1R1A3 4BB3A 1SHWB 3SEEA 1SLAA 2R073 2E9QA 2N7GA 2R0HA 2W1QA 4CRQA 4ZU4A 3U4SA 2W39A 4K6BA 3CZJA 5FZGA 5FZ1A 4GKYA 2WZR1 1VBE3 3LFMA 3RMYA 3WG3A 1QGLA 1IOAA 2O14A 5DDJ1 2XBO1 3KHBA 2MPFA 3POGA 4BQWA 4CDQA 1TE1B 3WHUA 1JZ3A 3NJVA 4LHLA 1QH6A 4Y26A 4IXLA 4XAAA 3KSCA 1MVEA 4IEZA 3C7EA 5F3IA 4E2SA 1ST8A 3FE5A 1U0AA 4W6XA 1ENQA 2RR13 5KXDA 1AUYA 4QM9A 1LRHA 5FZ9A 4Z92B 3KQRA 2ZS6B 2DTYA 4GWNA 4O61A 4WM7C 1S0IA 3UGHA 3VLBB 4YZ4A 4QDQA 3VN4A 4B29A 1ZBA2 2G4IA 5JUVA 3BOPA 5JPMB 2BOJA 3WV6A 2JG9B 3MPBA 5F6KA 2YGLA 4JTOA 2DCTA 3P1IA 4Q0QA 3SH4A 4BQ5A 5L9RA 4RGKA 1FOD3 2KA3A 1XNKA 2YZ4A 3KT1A 4UFHA 3ETQA 4W8JA 4HK8A 4BE3A 4AAPA 3H9AA 2P37A 5FPVA 1GWKA 1K3IA 3ZLIA 4CA9A 4BQ2A 5LCWL 4JGZB 1ZA7A 2CYFA 5L7OB 2P3JA 1W6NB 2EIGA 2OQ6A 5T5LA 1JYWA 1XPWA 2RJKA 2WZR2 1FPN1 2C26A 1W8WA 1ZZ9A 1REFA 4K3UA 2RS13 4YZ3A 5DDJ2 2VU9A 4NPLA 3N9OA 2OZ6A 1E57A 3WG2A 1EPZA 4Q29A 3VHOA 3K4ZA 2ZHLA 1GZCA 4IEUA 1V9U2 1YFYA 3VZOA 3O1TA 3KF3A 4UW4A 4E4HA 5IAXA 3J8F2 5BV6A 1NT0A 4XFIA 3AFKA 4LHKA 2DFBA 4YVSB 3TB0A 1CZTA 4XFAA 1BVP1 1MS4A 1LTEA 2QQIA 1QXPA 4PLOA 4C0HA 2D3PA 1RUD3 2OPWA 4GJYA 3VZMA 3ZDSA 3N9QA 4NUBA 5FMBA 3OBTA 2VMFA 5H9PA 1W2TA 2ZEZA 3FLRA 5FYHA 2PMWB 2HKXA 3A4UA 1SFNA 4CEWB 5IK4A 1KFXL 1LGBA 1UZ0A 2RS51 2Y6HA 2YXSA 3U78A 4A6OA 4BQYA 3FN9A 1DDLA 5FYBA 2GAUA 2OVUA 2DWRA 2AZ5A 2GMEA 3MPPG 3PMSA 3SH5A 3S57A 4FTBA 2RDNA 3AKTA 3LPFA 3WNNA 1ND3B 4NOTA 3VHPA 4CCOA 4Y4YA 2YY1A 1FPN2 4IEQA 3KGLA 5J1XA 2HBUA 1O7FA 1JUIA 1TEIA 2B9VA 2HH9A 2YG0A 1PMIA 4P5YA 4A6SA 5AC93 1JZ8A 1F5JA 2ZBJA 4XF4A 2DCJA 2XJSA 4CVUA 4F8AA 2W87A 4GAZA 5FAXA 1IS5A 4QU1A 3UL2A 3I2HA 2ES3A 1UU4A 4R9BA 4U36A 4KH9A 4Q27A 5HXMA 4DUXA 1AR61 1JZ5A 5JZGA 4XBLA 3ZFEA 5G05L 1AR71 1YQ5A 1BZWA 5B4XA 5KHJA 1NLRA 5D8AB 3MUZ1 3VHRA 1DLCA 2QVSB 3HPNA 4MGZE 2D6MA 3ZN6A 1NCRA 4PDWA 3HQUA 2A71A 4CUBA 4CDWA 1UY3A 2JX9A 5FZBA 3AM2A 3POYA 1MZEA 3NO8A 4JDOA 4RSUA 4XDQA 5JCTA 2EXKA 1GU3A 3VBHC 4XJZA 5APAA 4BM8A 1LHNA 4W65A 5CAZA 2FMDA 3NWKA 2RS52 4HSLA 2RJ2A 3VKNA 1MS0A 1T6BX 5FZMA 4OHYA 3I59A 4LLOA 2UWAA 3WF0A 1KGYA 4GH4C 3WNMA 1UCXA 1DYKA 3M3EA 1AXYA 4RHV3 4PBOA 4XPVA 4BCUA 4CP9B 4KU8A 2J1EA 2DVAA 3AXEA 4BOWA 4AL9A 3VDDB 1L7QA 3KS7A 4JAAA 2XQRA 4ZS3A 4AFMA 4JGYC 3ZYHA 5FDBA 3C7FA 2NP0A 2W95A 4PIYA 1UXXX 1WW4A 2WFF3 1HV1A 1QNWA 4QMAA 3VKLA 1O3RA 1AR72 1LGCA 1V6OA 2Y0IA 4FP3A 5LBEA 3WD5A 4AFAA 3E5UA 4GKXA 4F83A 1R091 1UU6A 2XONA 4KWJA 4Y3OA 2OUHA 3DF0A 4KWLA 4QKBA 4EE2A 4A7ZA 5CFCC 1GUIA 1NZCA 4AHYA 2QE3A 2Y6FA 1N1TA 4XE9A 4MGKE 1LAJA 1D2QA 3OD0A 4MX3A 3AKRA 4RQPC 2OXBA 4PF1A 2B39A 2JG9A 3UYJA 5H9SA 1OA3A 4P9YA 2D44A 5K7PA 4FPHA 2WC2A 1RUC2 1PGL1 2AREA 2XUEA 3B7MA 3LPGA 4HKWA 4QX0A 1KRIA 1KS5A 5FLHA 3GBFA 2LALA 3ILNA 3UETA 5LEKA 2VVEA 2ZGKA 4JGZA 1QOSA 5L7OA 1EAH3 1W6NA 4P02B 1HRI1 3K3OA 2I45A 3JB4C 5EJZB 5FYSA 1AR83 1UY2A 5A3NA 2UY9A 3WNKA 5FUPA 3ZFGC 4AGRA 1W8HA 1ZRRA 2W3JA 1DYPA 5H9RA 2VE1A 2ARCA 2DUOA 4Q4Y3 3VZLA 4AVVA 1BEV1 2WS91 1XU2A 4FPFA 4U2AA 1PGW2 2ZGMA 3GBWA 5LK5A 2JE7A 5HCHA 1YEWA 4YVSA 1XYNA 3IMMA 5IUQA 3ORJA 5F3GA 2ATFA 2R062 2R16A 4Q0SA 1ASJ1 1VRH2 2Y64A 1JOBA 5A1AA 1PO21 1Q8VA 1UOBA 5I0UA 5A80A 3T09A 5J96B 3N4MA 2NYYA 4PI0A 2QUOA 5FYYA 1VB4A 2XG3A 3ECQA 4IGPA 5JIUA 4P00B 1GP4A 1YIFA 5FMCA 4I2OA 2ZGNA 1WCQA 4CEWA 4Z2WA 1OOPC 2GNTA 3FMGA 3SLIA 3Q8AA 5C3SA 4YNIA 4MGYE 2WZ8A 3PUSA 2VL4A 1PGL2 3NW4A 3AKSA 4NJ4A 1GSLA 1ZBE3 2CU5A 1MEC1 4KG8A 4XETA 5FZ7A 3M1HA 1CZVA 2NZ9A 2CY6A 5F8PA 1HRI2 1GP5A 2FZ1A 1ND3A 1NE6A 3LAGA 1OKOA 1HB1A 1I1EA 3UNPA 5GZGA 5LK7B 1QIQA 4M0NA 1UZWA 4HETA 3OOXA 1KXGA 1SLBA 2VQTA 4GULA 5GLWA 3QBQA 2GDFA 4K21A 2WS92 1JN2P 2R072 5EJ1B 4HN1A 4WM7B 1E5HA 3I54A 4KQ7A 4MO3M 3T0BA 1IG0A 4LHSA 1S0CA 5D8AA 3AXDA 3UKVA 1FI2A 3RWNA 4WVMB 1VBE2 2ZGTA 4Q0UA 1BXHA 4MV2A 5F5CA 3ASIA 3C2UA 1YUDA 2G9ZA 3MO4A 5C3RA 1QJU1 1WLWA 4LKEA 4FQ4A 2KD7A 3VB9A 1CIYA 1DBNA 2K0GA 3M4FA 1AZDA 3OB8A 3QH7A 3AKQA 3WNOA 3KWVA 3WQBA 5CU1A 3S6PA 1QF3A 2ZGLA 1VBA1 1LOEA 1DGRN 3BODA 1O4TA 2V5DA 3SC7X 4DY3A 3NRUA 3TEZA 5EZWA 1MEC2 3LOIA 2VOWA 3PUAA 1VBC3 2JDAA 3IBMA 2WFPA 1D4M1 3GM8A 1TME1 4CP9A 4IGOA 2DVGA 2RM21 4FPKA 1SLCA 2VECA 1HXS3 3VDDA 1T2XA 1KQRA 5HV0A 3Q8FA 3VL9A 1EPWA 5A7NA 2ZX2A 2P3KA 1ODMA 2PHTA 1JOPA 4WVVA 4JHZA 3IDAA 3J26N 3W58A 1RHI1 2YPJA 3S5QA 3VDAA 5LA1A 3WP4A 2GH2A 3AZWA 3WINE 2BBAA 3OCPA 3T2TA 2J7MA 4NWVA 5JDBA 5J3UA 1RUI1 2VPVA 4BQXA 3HN1A 1US2A 2ORXA 5C33A 5HV4A 3PURA 4NWWA 4XUQA 1QJU2 5FPLA 1RUH3 4D3WA 3NNLA 4OUMA 2JDMA 1M4WA 1Z7S2 2W94A 4BXFA 4NIHA 4HANA 4BIFA 4QQOA 1RUJ1 2IZWA 2BDRA 3APBA 3KB5A 4BU2A 2HWB3 1BMV1 3PJQA 2XVGA 5BY5A 2WZEA 2PA7A 2BQPA 3QOPA 5DN2A 5KXBA 1D4M2 1E5RA 4HSJA 5HXVA 1NYWA 3LDRA 4QHBA 2RM22 4AGGA 1DG6A 2G9FA 4H7MA 2VUCA 2TNFA 5A70A 3PTYA 2ZPXA 1CN1A 1H1MA 4QB6A 1VALA 2JD4A 3CJIC 4CCJA 5A6QA 2WN2A 1C8M1 1RUF2 3RYRA 1RHI2 1OURA 1LOFC 3GF6A 3H1WA 4Q5OA 1QWRA 1U5ZA 1D7PM 4EROA 1VBD3 1CX4A 3CJXA 2A6YA 3VBHB 1RUI2 3GJAA 1HQNA 2ZCWA 3MFAA 3MLLA 4I30A 1UMHA 4NRQA 2HWF3 3OUIA 4EN0A 1S55A 1JW6A 3WNLA 5KXEA 4DZGA 4Y1VA 2JWPA 5FWJA 4GH4B 4A3ZA 2Q30A 2IVIB 2XWBB 3CO2A 3MW2A 4ET7A 2WKKA 3T2OA 2DUPA 1RUJ2 3N3HA 4K1YA 1CAVB 3VDCA 1BMV2 4Q4W3 2B4KA 1YI7A 4OI2A 1TMF3 5FZ8A 2MEV1 3ZYGA 1HB3A 3U1XA 3WLUA 3F2ZA 1XJAA 2BJSA 4JGYB 3WZ1A 5JMOA 3RNSA 4LLFA 2VULA 4I02A 4P9GA 3N35A 1OFNA 4B1MA 3T1MA 1AL0G 1S0BA 3LE0A 5FIXA 1C8M2 4ZS2A 2GNMA 5A3LA 4C91A 5JOWA 4TLFA 2HBTA 4FPOB 3KQ4B 5FYMA 5FKCA 1JOJA 5CFCB 2GZWA 2Z42A 1H9WA 4WM7A 2GC2A 3ZPOA 3UKTA 4LBOA 2TEPA 4P14A 4RQPB 5KHHA 3WP3A 5EYYA 2Z69A 3ZXFA 2CSGA 2CGPA 3GZTB 2J42A 5JR2A 4KMQA 3WSOA 4CP0A 4WVMA 2FQPA 1HRV3 2J1SA 1UZZA 2XL9A 4ZXEA 3HQXA 3VL8A 3SCFA 2C9KA 2Q8CA 3QACA 1YWKA 5FRAA 4NIIA 1CWPA 1IS3A 3MYXA 2EF6A 2LUWA 5F1RA 1QJY1 3MICA 1X8EA 2YB7A 3B9CA 4BQ4A 5FMDA 2O8OA 1IKPA 3JBG2 1OPMA 1B35C 5ACA3 4FPGA 1W9YA 2ZXQA 3HNYM 3WHTA 1BBT1 5DG1A 3EBRA 1RJ8A 1UW8A 2YDEA 4IL7A 2PHRA 4L9BA 1ZNPA 2VXJA 1VBB1 2YYOA 4QQ2A 3ZFGB 4XJWA 4CU8A 2BYVE 4CPBA 3N9MA 3E5QA 2HWE3 3O0XA 3M8LA 5ISLA 3KVAA 4UFJA 2ZX4A 4XTPA 1OVSA 2BWAA 2XOMA 3IM0A 1CAXB 2XR4A 5KHKA 5HCFA 2E26A 3DCQA 1PO11 3A7QA 1DQ5A 2XPJA 2WBKA 3KV5A 2P6HA 3I3BA 5I8SA 4QPIC 2VZRA 2P3YA 3BU0A 4MH0E 2VZQA 3J7NA 4Q4X3 4CYDA 1OOPB 1WKYA 3MIEA 4Y24A 4XZUG 1XB9A 1AXKA 1RINA 1LHUA 3MF9A 4Q2FA 3EHKA 3DYMA 3KT7A 4E8CA 4Q4Y2 4D6RA 1OHFA 1QJY2 1OFSA 1DQ6A 3VKFC 4AVTA 2OW4A 1ZYBA 2ORZA 2P2KA 1BBT2 4MVTA 1IPSA 1AYN1 3EQEA 1AYM3 4LIVA 2K2SA 3T4HB 3WY6A 1VLNA 1W39A 2XLAA 2DVFA 4FOYA 3RPQA 2PQQA 1Y9QA 2DCYA 4NHMA 1F4HA 5FXWA 4RGGA 5F2WA 4E4DX 4HPKB 2R043 4QX8A 2ZACA 4NHYA 4N43C 5ABJC 1PO12 3L9JT 1OH4A 3ZXEA 3ZO0B 4PF5A 1TZOA 2ZTNA 4Z82A 3VGIA 2HWD1 4RS5C 4Z1VA 3USUB 1X9PA 4YPJA 3CL1A 5IVFA 2JB4A 4LXLA 4CDQB 1EY2A 2UWCA 2XJQA 4JTNA 2RS31 1NUKA 2VGDA 4KBZA 1RUE1 3N9LA 1EV13 3ZKUA 4OQ9A 5JOXA 3T1LA 3VBHA 4O7XA 3JU9A 4MGIE 1HB4A 1SPPB 2Y38A 3SEPA 2JXAA 1YCIA 1DQ1A 1Y7BA 2ENRA 1CAUB 2IXHA 2Z2SB 4AVSA 5FO7B 2QNKA 3K2OA 1YRZA 4GH4A 3WP6A 2FDJA 4YGEA 3SCGA 2R49A 2ID4A 2VCBA 2XJRA 3NV4A 4MOAA 1UMZA 3ZVXA 1CAVA 2JJ6A 4LR4A 4RL7A 5I91A 3DXUA 3RGBA 4IGQA 4D6QA 1AYN2 3PMEA 5DUXA 4BA6A 3R4UA 4CDUC 2Q1MA 2RDQA 4E27A 1UQXA 1IPKA 4XQWA 4JGYA 4XC9A 4LMFA 1V6KA 4I0WB 1S0GA 2R7EB 1QJX1 4LT5A 1GYKA 1WBLA 5JXIA 2TBVA 3SHRA 1OBNA 1RUG1 1ULCA 2R32A 3WW3A 2JD9A 4ZXKA 1W9WA 5IAVA 1X36A 2HWD2 1MS3A 2PQSA 3AVRA 3MV01 4IETA 5EXOA 4ZY9A 3WDXA 4BMBA 2VVDA 1LENA 2RS32 3LEGA 4QKNA 3N7LA 5CFCA 1RUE2 1LEMA 2WWUA 5JR7B 2V72A 2Z5WA 5FYUA 3NJZA 2G1MA 4AI9A 4SBVA 1ZZBA 1CX1A 5HI0A 4RQPA 1HXS2 1AR63 4YG6A 4AHZA 1XNTA 4OI4A 2GH8A 3ZYPA 3VZNA 2QQPA 3F95A 3MEPA 4AEDA 2BFUL 4LNVA 4EJRA 2CNAA 1Y4WA 1IKQA 1ALYA 3IMNA 4IE5A 1KDMA 4X6RB 4CPBD 1QQP1 4MUVA 2UU8A 5D21A 3T30A 4ES9A 2XJTA 4ORFA 3H3LA 2VUJA 1JYXA 1PK6C 2DVDA 3ELNA 3JD71 1AX0A 5IFPA 5LRRA 1H2NA 1WMXA 4GQ7A 4CZSA 3PVOA 3CJIB 3KLSA 1QJX2 2VR4A 3ZFGA 4DOUA 2F4PA 2UYAA 4W6YA 3TWIA 4A7YA 4H7LA 1RUG2 3M3CA 4ATFA 2D5HA 4JVAA 1U5IA 1REEA 3B93A 4RN5A 4YVWC 4A3XA 4AK3A 3ILFA 1CAXA 2PAEA 5J98B 1W8TA 3MIDA 1DYOA 4PJYA 1US3A 1YFUA 3RYPA 4C1XA 4DIQA 2JG8C 5H9QA 3FFQA 3B3QE 1R081 2JDZA 2VBDA 4E9KA 1AR91 4YZ2A 1DGLA 3WF4A 5JZGB 1APNA 4PLNA 2I2SA 3SQOA 2EIDA 2BZDA 4FPJA 2DF7A 3R05A 1OOPA 1RMU3 3C3VA 5FZ0A 4CP1A 1BK0A 3KGZA 4XUNA 1YLLA 4NAMA 3D0JA 3IIIA 1R093 2GN3A 5CVRA 3AK0A 1QQP2 4ZPIA 3ZXGA 5CKQA 3LF7A 2ZHNA 4XFFA 2PELA 4LA2A 3POEA 3N36A 3NVCA 4BIOA 2JDHA 5FCCA 1OLMA 1CR7A 1VBD2 3GZUC 3JD72 3ETPA 4URAA 5IVBA 5J48A 3ZIWA 3INAA 1JYIA 4CUCA 3WF1A 2YMZA 3I8TA 4GB31 1ENXA 4QX7A 3KV9A 4PQ9A 4HPKA 5D2AA 4QGNA 1URXA 2ZKNA 2WO7A 3PL0A 5I0DA 3B5LB 2GMMA 2O1QA 4Q26A 1XRUA 1A78A 3AVSA 2YHJA 3TOJA 3USUA 1R082 5FOJB 3OTFA 1AR92 4FPLA 4GMP1 2B42B 1QJZA 4URTA 3WW2A 4XYXA 1PIV3 1POQA 3AJYA 1EUUA 2XLFA 3OEBA 1V9U1 4H3WA 4LO8A 3CBNA 2D40A 3LGRA 3ST7A 4FOVA 5T54A 4FFGA 3J8F1 3VBOC 1OC1A 3HEIA 1BEV3 1PNGA 1LOAA 2WWJA 1SPPA 3C7HA 3CU7A 1B35B 2Y8KA 4DRVA 2PHDA 5A3UA 2XKPA 1CAUA 3UJQA 3RRDA 3VUOA 1A6CA 1N47A 1I5ZA 2OKXA 3T4VA 3PLQA 3TEWA 1ASJ3 1TG7A 5DAXA 3THTA 2D3SA 5FR3A 2C1FA 1S0EA 2QQUA 4F7ZA 1QHDA 4IE7A 4N9IA 3FHIB 2DYCA 3M3OA 3A0KA 5HPOA 4LKDA 4GB32 4WVZA 1J1LA 4OCTA 2AC1A 2P4EA 4IE6A 5F5IA 3H1YA 1CZSA 3E97A 4FQZA 2ADEA 1EUTA 2XJPA 3J7HA 1UIKA 4QPIB 2W08A 3LOBA 2AENA 2JB8A 1JMUB 4I01A 1JZ2A 2ARAA 4GIQA 4RD7A 1YJLA 4WBBA 4XFBA 1R1ZA 3TN91 2JDNA 2CHHA 1E5SA 1H2MA 2RMU3 3AZXA 4HVOA 3N7KA 1CJDA 4LE4A 3WR0A 2F17A 3GNEA 3HVDA 5A7PA 2XJVA 1YNAA 4LBNA 5LW9A 5E88A 3WUCA 2VTXA 4CCCA 3QLQA 2WL1A 2F4LA 5ERLA 3ES1A 4YSFA 2X8KA 5DAPA 1DIWA 2YU1A 3JQXA 5K9YA 4MGQA 4KBBA 3U14A 4DEVA 4DO0A 5A3OA 1KD7A 1G7YA 5FBZA 5A3WA 4YG0A 3O1RA 2HLEA 3PUQA 4LHNA 3BVCA 1S1AA 4GALA 4DY5A 5I8YA 2XQXA 5F7UA 4S2GA 4N43B 2HWC1 3NKGA 5B4NA 5E1RA 2ZMKA 4NHLA 4LK6A 3H3UA 5ABJB 4YLZA 1NCQC 1WMEA 3CJIA 4LO6B 1MS5A 1VBA3 2OX0A 2ZGRA 4RS5B 1N1VA 3GBGA 1UY0A 4OUSA 4DS0A 5I0SA 1LOFA 2HYKA 2FDIA 5EP9A 4N53C 4Q4V3 1NY72 3AP9A 1G9AA 1QEXA 3PHMA 2Z79A 3I7DA 5FP7A 1TME3 2H6CA 2IXLA 1HQLA 3EMRA 3TN92 3D5OA 4A7KA 2XHKA 1JHJA 3OF1A 4DINB 1H8VA 2IXKA 2LTNA 5IVJA 4LJHA 3OUJA 1LKNA 4D7SA 3SXWA 2YU2A 3MBWA 3MW3A 4H55A 4NHKA 5IK8A 1OH3A 1AL23 4YARA 3ABZA 3ZSMA 1KITA 1VMHA 1W03A 2VG9A 1QY4A 3BKZA 4FAHA 2WA3A 5DUWA 4R8HA 4G3YC 4A41A 2RJLA 4CDUB 3I3MA 1ZRCA 3AP4A 3V64A 4JZRA 4XJ9A 4QKFA 5JI9A 3RWKX 1JYVA 2J1AA 2A1XA 1I9RA 4UFMA 3I2IA 5FMOL 5IK5A 5AVPA 3MIHA 5FFOC 2EICA 2ZHKA 5FP3A 1H9PA 2HWC2 2Y34A 1H30A 3C8XA 1S2BA 3OPTA 3ZYBA 1RUC1 5DXDA 4FTSA 4QX1A 3NAPC 3PTRB 4ZZ5A 1JS9A 4IUGA 4JQRA 4K8RB 3IDEA 2R1BA 2FDGA 1YO8A 1ZVFA 1W6MB 2A7AA 3ZR5A 3RJRA 3WNPA 1EP0A 1N3OA 1X7NA 2WNVC 1I5PA 3HNMA 3IT8A 3KZ4C 3SCHA 4FI9A 4NAOA 1UX6A 2LROA 4UWDA 5CADA 4F3JA 1O4ZA 2Z4FA 1ULOA 1W6OB 1HQWA 4IEWA 5FO8B 2NMNA 4LPLA 4NHXA 5FY5A 2Y6LA 1PGW1 3P5BA 3AL5A 1PK6B 1OUSA 1W3VA 4OMDA 3LZZA 1B35A 4Q8LA 4ES8A 4OI0A 1W2AX 1JI6A 2R061 5DPNA 4AAXA 3WDVA 2E7AA 5M0TA 1VRH1 2A75A 2DBIA 2W91A 3FL7A 4PBPA 4ZU5A 3Q8EA 1O8SA 4AHWA 3TNPB 3BTZA 1FNYA 3DYOA 1FT9A 1JTZX 3CMGA 1O59A 4A45A 2NN8A 4YVWB 3RMXA 3ZXDA 3K4DA 2L9LA 1AVBA 1GNYA 1WMFA 4FO9A 2OPKA 2JG8B 2X05A 2CAVA 2MEV3 5FUIA 3FZ3A 4CCDA 1PVC1 4IEXA 5FYVA 2X29A 3A23A 4COUA 4QPIA 2VQUA 4QB2A 5AFBA 2SBAA 4LULA 4QX2A 3BI3A 3NSTA 1A34A 4ASLA 4Q0VA 4Y1YA 4M3CB 5BPXA 3WQ7A 5F9TA 4IEYA 1FAYA 2JDKA 1S4CA 2OZJA 2V5YA 3KF5A 4R9DA 5FPBA 2LW8A 5FY9A 4DXZA 2YC4A 2R071 1IHMA 3OG2A 4YGDA 5FYCA 1WUVA 4BH9A 1BHGA 1GANA 4AOCA 3VBFC 1ZX5A 5IVYA 3E5XA 1LHWA 5FZ3A 1L7LA 1W8ZA 1MQTC 2XJUA 3B00A 1E5IA 5EWSA 3B69A 1VBE1 3WEZA 2JIGA 1RVF3 2E6VA 5F39A 2EXHA 4GA9A 3CQOA 5IT6A 3VBSC 2A3XA 4XHXA 1OQDA 4GZ9A 5EFUA 4BISA 2RV9A 4N43A 5JWPA 4D6SA 4CEYC 2GN7A 5LWBA 4ARYA 4QQLA 5ABJA 5LZ6A 1GWMA 4FFIA 3RG0A 2VCAA 2PLV2 3DKWA 1PVC2 4RS5A 1JYCA 5EJ3A 2VMGA 5J7MA 3H1MA 3KV4A 1O3TA 1TNRA 1VBB3 4PHZA 2VOTA 3TNQA 1J3QA 5BYNA 5FXVA 3EYPA 1R1A2 1OSGA 2P5BA 2UWBA 1POV3 4MLOA 3SKVA 3VBOB 4YRDA 3I2GA 1FOD1 5DAVA 5AVAA 2CWMA 1RGSA 4Z07A 5C8CC 2ZGPA 3BTXA 3M3QA 2YUEA 3MDPA 1UIJA 1CONA 4XFCA 5GZCA 2ERFA 2QDRA 3CDZB 1W0OA 2RS11 5JMCA 4CDUA 4L8QA 4PQQA 5CNAA 4CXYA 4QU2A 4YG3A 2B5HA 1H6XA 3H7JA 2NM1A 3AYCA 3H0OA 1Z7S1 2VUDA 3HJRA 2WZPP 4ZU7A 3T08A 2VMCA 1UPIA 1S2EA 2VTFA 3LWCA 2RR12 4CXWA 1LOBA 1GNZA 3LDBA 3WXPA 1NKGA 4YW4A 1RUD1 2VNOA 2B8MA 4MADA 1NZIA 5SV5A 1FMD3 4HT1T 3THCA 3ON7A 3LCPA 3FLTA 3O0WA 1M06G 1W6MA 1XC6A 3L2HA 5FP9A 3U11A 4XF1A 3FLPA 3LEMA 1F15A 4AYUA 1XNDA 1FOD2 1J83A 4AQSA 5FPAA 3TRSB 1RUF1 4FOWA 4CDXC 3D82A 1W6OA 1GWLA 1XE0A 5HBAA 1GR3A 4TXWA 2OUJA 1YQ8A 1F8VA 3WF2A 2D6PA 2RVAA 2VO5A 5K8SA 4QD2A 1EYBA 5CG9A 4UW5A 2YV8A 4QXKA 3QH6A 5DMYA 1NXMA 1PK6A 3M70A 2RS12 3ZDVA 5BUVA 5AC91 3A21A 2QCSB 4XUOA 4QGLA 3ZSLA 4P08A 4H14A 4ITCA 1NCQB 4QKDA 1W28A 3WT3A 1UPSA 4B4PA 3DUIA 4N53B 3FHAA 5BXXA 4XIKA 2W1SA 4YVWA 1ULFA 1BKZA 2NLRA 4SLIA 5IJRA 4XBQA 1RUD2 4XF3A 1ULDA 1UOJA 1UMIA 4Y5Z0 1W0NA 2JG8A 4AEDC 4XXAA 2O8QA 3VZJA 3ZMOA 4DQAA 2BERA 1RC6A 4FPYA 4M0HA 2EAKA 4UI9L 2DU1A 3VV1A 1WCUA 2ZGUA 4XDOA 5JXJA 1Q8OA 3OPWA 4R9AA 5FXZA 4JCKA 3RS6A 3M7AA 1Y43B 2FBEA 3HAGA 1O91A 1MS1A 5FO9B 4AHXA 4Z8BA 4M3CA 2G19A 2DU0A 1HX6A 1ULGA 2B7YA 4FXGB 5K0UC 1W8FA 2VTXJ 5DG2A 5JXGA 3BGAA 5FWEA 1ACCA 3IPVB 1XSRA 4Q0PA 2AGSA 5E8AA 5FK7A 5I0TA 1OVPA 5AC92 4IV1C 4LEJA 4W50A 4LKSA 5C71A 1LU1A 2BV4A 2J1RA 1R64A 5FZEA 1NG0A 3TEXA 4AI2A 4HONA 5EYXA 5L9BA 2QZ3A 3R6SA 5C70A 3PUIA 2VD7A 4BZ4A 1UKGA 4GXLA 4FBFA 1JZ4A 4XCAA 5BNOA 2WFF1 4WVWA 5FZAA 3NAPB 3UESA 4BWOA 1MS9A 2ET7A 2ARBA 4OHZA 1D4VB 2ZZQA 2X53S 5JIAA 2W0XA 1COV3 1IG3A 3JBG1 2WT1A 2AH2A 3N7MA 2WNVB 4AW7A 1LR5A 5A3MA 2G9GA 3WQ0A 3PUHA 1BYHA 1U5XA 3NNGA 4LE3A 1Q3EA 3TYJA 4CU6A 2BFUS 1F35A 3ZSKA 1FV2A 5C8WA 2VNVA 2GP5A 1W8OA 5FYTA 3LIHA 2VM9A 3UT0A 4TZDA 1GMMA 1ZA4A 2RDSA 4K8FA 5FQ0B 3VBOA 3SKJE 4AFDA 3O1OA 3FX3A 4XZPA 5DABA 2WNUC 1VB2A 4QX5A 4RHV2 1H4GA 3LSDA 5G04L 3TBDA 4M01A 4MSVA 1V6MA 2VVFA 3K46A 1AX1A 1A3KA 1XXNA 3VHNA 4XABA 1CIWA 1O6UA 1JU4A 4B3NA 4AEJA 3BPSA 1RITA 4LTAA 1EAH1 2WYSA 3B94A 2W47A 2W46A 1WW7A 1AR81 3VBRC 2D93A 3LEIA 4AWDA 2Q1FA 1SBEA 3HBZA 4YFWA 4ZKTB 3S5AA 4ATEA 3WVJA 3I2OA 1DLLA 3KT4A 4YW1A 1AJKA 3AMPA 2BUKA 1IS4A 2VJXA 2WFF2 1K42A 1SLTA 4AE2A 5ANQA 1W2NA 1W9TA 5T5JA 1V6LA 2UY8A 1V0AA 4XIOA 4XCBA 4Q4Y1 2OA2A 1ULPA 4Y4RA 5CISA 1PZ8A 1VAKA 4YWAA 3RJ2X 4DFSA 3KHCA 1MZ6A 3LA3A 4TN7A 2XUMA 1HN1A 4WZCA 4BPZA 2C5DA 2YBSA 1NX9A 1WGPA 1ZBA3 2GMPA 4GJZA 1YYNA 2AEYA 1K5MC 1RXFA 4H2AA 4HZFA 4NO4A 5FJHA 4KGQA 1FATA 1XNCA 2NPIA 4QXBA 2WNOA 5FZHA 4DUVA 3BALA 3IAPA 3UKNA 4CU9A 4BXSV 2X5IC 3ZX7A 4AEKA 3DL3A 2C0ZA 4YYOA 2HEVF 4R4ZA 3RZJA 2W2IA 5LATA 3VBFB 1T6GC 3FJSA 1XNAA 3K77A 3BU7A 1MQTB 1ZBE1 2CGNA 2FCUA 1QJFA 4WM8C 5FLJA 4QT6A 2WZR3 2VW1A 5DDJ3 2KR2A 1EAH2 2XBO3 1CQ9A 4P9LA 5CZKA 1BQPA 1NOVA 3VDBA 1WD4A 3JCIA 3D8CA 1AR82 3VBSB 4DUWA 1OT5A 4NPMA 2D97A 4N7IA 4K40A 5JOYA 3J8F3 4CEYB 1UOFA 1VJ2A 1B09A 3T3YA 2DURA 3AMHA 4XQ4A 2R0FA 3GGLA 3OD4A 1NCQA 2B45X 2JDUA 2QQVA 3WP5A 2FCTA 1IPJA 4GWIA 3QCWA 1DGWX 1DFQA 4N53A 3RZHA 1DZRA 5F5AA 5GZDA 1O5UA 4UBHA 5LASA 2R1DA 3WF3A 3P3NA 3WOGA 4S2HA 4PT6A 2XGXA 5J37A 2WAOA 2OT7A 1ZM1A 1DF0A 1QH7A 2VZVA 1WZXA 3CZUA 4XFHA 3RZKA 4LQRA 3ACGA 3Q8CA 5C8CB 3AZVA 3ACIA 2XKOA 3MF6A 4OQ8A 3EB7A 1QXRA 3SITA 5C7GA 5FPXA 1ZBE2 2BEOA 3BCWA 1PM7A 1FPN3 1HLCA 3VZKA 2IUWA 3LFIA 1VBC1 4LORA 1SBFA 3SISA 1ZRIA 3IPVA 1SLIA 2ZOEB 3RI9A 3B01A 4HMZA 5LBBA 3RZGA 3HOBA 1HXS1 4QAWA 1W0PA 1OLRA 2BWCA 1ZRDA 2A6ZA 4YGCA 1QXJA 1H0BA 1DU3D 5BNPC 2ZEYA 3UK9A 1N1YA 5JXHA 3PDQA 5HCBA 4JV4A 3AP5A 3NAPA 3LDKA 2FCVA 4JKLA 4HK9A 3E1F1 4JDMA 4ZZ8A 4N90A 1NXD1 2WNVA 1AF9A 2XL7A 5DAQA 3VBUC 3U4XA 3URFA 3HNBM 3H8OA 4DB5A 2RS53 3NJYA 5FZOB 4X8NA 4EZ4A 1UWWA 1RUH1 3Q8BA 4AFBA 4CDXB 4BLIA 3FUQA 3T2PA 5KC6A 1OQ1A 2NQYA 1QDCA 3DV8A 4Y33A 3G7DA 1V6NA 4XUTA 5FQ0A 2HWB1 3DEMA 3I3DA 3P6BA 2F6BA 5CBLA 4IESA 1VBC2 2Y33A 5JOZA 5JAXA 4YW7A 4AEMA 1CESA 1FMD2 3LIGA 2FZ2A 1RUOA 4YM3A 2DDUA 3P3PA 4LO4B 3ZKYA 2VNGA 1OUXA 5GZFA 1F2NA 1ONAA 3NMBA 1G8WA 1QDOA 1XU1A 1AR73 3LB9A 4OI1A 2QQMA 4XHBA 3O5SA 5FYIA 4UW3A 2CAUA 2BNMA 5I0RA 4NRMA 3KVBA 1HJGA 4V2WA 1PZ9A 4QX3A 3CKHA 4Y1ZA 5I8TA 3SNMA 4AEDB 2W68A 3GXUA 5A7SA 2I74A 3PU8A 5GJ6A 1H8TC 5FPUA 3POIA 4ASKA 1VBD1 3C7OA 1XQNA 4IE0A 2XHNA 1NQJA 2Q1ZB 3FWEA 1W2OA 3ZR6A 3FBYA 5LA0A 4XEZA 4OUEA 1OMIA 3BIEA 2VW2A 1J59A 1FX5A 5A3PA 1RUH2 3K48A 5JSRA 1QMJA 4B7KA 3EO6A 2VOVA 1IS6A 1XOYA 3N9PA 3AYAA 3N7JA 4IEVA 1KJRA 2ZX3A 3BIWE 5K0UB 2E63A 3K51A 1J3PA 3PIGA 2K46A 5EQUA 4CE8A 1RUNA 4FPEA 5L36A 2Q0AA 4OMCA 2HWB2 4W6WA 3MUY1 5FMOS 1V6JA 3PIJA 3PVNA 1RYYA 1PX3A 3VBFA 5IVCA 4IV1B 1PMJX 1MQTA 2YFZA 1HN0A 3CNAA 3MLKA 3V0AA 3NNMA 2QQNA 1C1FA 2D7FA 2VZOA 3GYDA 5D1IA 1NAEA 5FY8A 1RJ7A 2JDPA 5KXCA 5A1FA 2BU9A 3I2FA 1WCKA 4A42A 4JC1A 5FREA 1Y9GA 2OIIA 2X10A 3VBSA 4B8EA 5C5TA 3VD4A 3IZOA 4KGGA 4RFT0 5FLIA 4B4QA 2WNEA 4LUMA 2DCZA
chains in the Genus database with same CATH topology
3I2IA 2V5DA 2EICA 3NRUA 3C8XA 2JDAA 4OZOA 3GM8A 5IYYA 2QBXA 1GOFA 3OGRA 4QX1A 4ZZ5A 1MPXA 1T2XA 4IUGA 3MV11 4DXTA 2CDOA 4JHZA 1I5PA 3HNMA 3IDAA 4GWJA 4FI9A 3VDAA 4BK4A 5LA1A 2Z4FA 1ULOA 2BBAA 2J7MA 2Y6JA 5EIYB 4ARXA 2BGOA 4LPLA 4A44A 1US2A 2Y6LA 2ORXA 4XUQA 4OMDA 3AC0A 3I2KA 2W94A 1JI6A 5DPNA 4AAXA 4D0QA 2VC9A 3FL7A 2W91A 2V4VA 1O8SA 1UYYA 4UOJA 3LEKA 3OGSA 4QDSA 2WN3A 3DYOA 2WZEA 5DN2A 2E31A 3CMGA 1O59A 4A45A 3C7GA 3K4DA 2L9LA 4HG6B 1GNYA 3I97A 1J84A 2X05A 5FUIA 2HYXA 4QB6A 4DXRA 1JU3A 2WN2A 1TVGA 3A23A 2BGPA 2ZEWA 2VQUA 4QB2A 4QX2A 2WABA 2J1TA 4QB1A 2C4XA 1D7PM 3OEAA 2VZTA 3W5NA 2LW8A 2YC4A 2Y6KA 3OGVA 1UMHA 3OG2A 4JKKA 3DECA 3NQHA 3WNLA 1BHGA 3U37A 2YC2A 4A3ZA 4QPWA 2JKXA 4ET7A 3WEZA 3T2OA 2J1VA 3HN3A 3VDCA 2B4KA 1UXZA 3CQOA 3IB3A 4M4RA 2W1UA 1OF4A 3F2ZA 4GZ9A 4L0PA 2RV9A 5JMOA 4ARYA 3IAQA 1JYNA 2E32A 2VCAA 3LE0A 5IHRA 2VOTA 4E8DA 3K75B 3VD3A 2VZ3A 1K12A 4XVHA 3VD9A 3EYPA 3SKVA 1GOHA 3I2GA 2WUHA 5JR2A 4KMQA 3WSOA 2J1SA 4ZXEA 1P8JA 1UY1A 3CDZB 4CU7A 1L7RA 2Y6GA 1UX7A 2C9KA 3T0DA 4PQQA 2YB7A 2VZPA 4DXSA 1H6XA 2WAAA 1JZ7A 2ZXQA 3HNYM 3WNPA 3HJRA 1LNSA 3I2JA 4MOAA 3T08A 2VMCA 2VTFA 1W8NA 2VCCA 4CU8A 1W99A 1K45A 2ZEXA 1NKGA 2QQOA 4MADA 3THCA 2XOMA 2QQKA 2E26A 3A7QA 1XC6A 2WBKA 1O8PA 5DQ0A 2W5FA 3I3BA 4M4PA 1J83A 4TTGA 2VZRA 2WDBA 4KWUA 2VZQA 3D3AA 3BN6A 2VZSA 4Z2AA 4TXWA 2E33A 1WKYA 3WF2A 2RVAA 2VO5A 1PX4A 2W92A 4XZUG 2J1UA 5DMYA 3DYMA 4QDRA 4E8CA 2VZUA 3A21A 3ZM8A 4XUOA 1KEXA 4P08A 4BK5A 1H6YA 5CYYA 2ORZA 1SHWB 3SEEA 2J22A 3FHAA 2W1QA 2W1SA 3CZJA 2EIBA 1F4HA 5IJRA 2LS6A 2WQ8A 1UMIA 1W0NA 1UY4A 2BERA 1OH4A 1JZ3A 4UI9L 3NJXA 3NJVA 5JXJA 4YPJA 3C7EA 1NUKA 5JXGA 3BGAA 3SEPA 4QDQA 5JUVA 4W50A 2JE8A 3CIHA 4LKSA 5C71A 2J1RA 1R64A 3P1IA 2ID4A 2VCBA 1GQPA 5C70A 3PUIA 1JZ4A 4W8JA 3UESA 4AG4A 3T2QA 1K3IA 1OD3A 5LCWL 4JX0A 3T0AA 2R7EB 1JYWA 1XPWA 5JXIA 2C26A 3PUHA 3NNGA 4CU6A 2JD9A 1W9WA 2DCKA 3MV01 4ZY9A 2PQSA 3K4ZA 4OYUA 1W8OA 2VM9A 3LEGA 1GMMA 3SKJE 2V72A 1CZTA 4RYDA 5G04L 2QQIA 5IFTA 1CX1A 3K46A 1XNTA 1JU4A 3VD7A 4A4AA 2VMFA 1YQ2A 2ZEZA 1SG3A 2WYSA 2W47A 2W46A 3LEIA 1UZ0A 2WO1A 2Y6HA 4A6OA 1K42A 2VJXA 2EIEA 3FN9A 3GDBA 1JYXA 1W9TA 5IFPA 1ULPA 4BDVB 3JXSA 1HN1A 3LPFA 3WNNA 2VR4A 1NX9A 5J1XA 2YG0A 4P5YA 2B9VA 1JZ8A 5LA2A 2DCJA 4RN5A 2QQJA 4CVUA 2W87A 4DUVA 1OF3A 3IAPA 3I2HA 1DYOA 4CU9A 1US3A 4BXSV 5HXMA 1JZ5A 4DUXA 5G05L 4BJ0A 5B4XA 1XNAA 3WF4A 3K77A 2YFUA 3MUZ1 1DLCA 3HPNA 2VZ1A 2EIDA 2BZDA 4CUBA 1UY3A 1UYXA 5CZKA 4XUNA 3VDBA 1GU3A 4DUWA 3IIIA 1OT5A 2WO2A 2RJ2A 4XUPA 2VMDA 3WF0A 3GGLA 1KGYA 3WNMA 3ETPA 3THDA 1IQDC 4GWIA 3DYPA 2J1EA 4CUCA 3WF1A 3WF3A 1L7QA 4PT6A 3OBAA 2W9XA 2WAOA 3C7FA 5I0DA 2VZVA 3CZUA 1UYZA 2W95A 1UXXX 4LQRA 3ACGA 3ACIA 1SDDB 3ACHA 3EB7A 5C7GA 1EUUA 2XONA 3OEBA 4DEQA 1GUIA 2QQLA 3HEIA 3C7HA 3K4AA 2Y8KA 3HOBA 4PF1A 4QAWA 3VD5A 2OKXA 1DP0A 2X09A 1TG7A 2ZEYA 5JXHA 3LPGA 4QX0A 4JKLA 5HPOA 3UETA 3ACFA 3E1F1 4KI5M 4P02B 4ZZ8A 5EJZB 1UY2A 1CZSA 3WNKA 1EUTA 3HNBM 2WO3A 3J7HA 1UWWA 4UAPA 2W3JA 3T2PA 1JZ2A 4JKMA 4XUTA 3I3DA 3P6BA 1W9SA 2Y64A 5A1AA 2DDUA 3T09A 3ECQA 4MGQA 4XURA 4P00B 4DEVA 1WCQA 2QQMA 4D8MA 2WZ8A 2VL4A 2HLEA 4MGSA 1GOGA 4QX3A 3CKHA 2XQXA 3W5MA 5F7UA 2CDPA 3GXUA 5B4NA 1CZVA 1PMHX 2W1WA 1F4AA 3C7OA 2XHNA 3A22A 3I3EA 3LQCA 1UY0A 5LA0A 3UNPA 4OUEA 2VQTA 4CUAA 1JHJA 5EJ1B 4OMCA 3MUY1 4W4ZA 4MO3M 1RYYA 3MBWA 3FHQA 3T0BA 1PX3A 4LHSA 3ABZA 1PMJX 2YFZA 2VMEA 2QQNA 2VZOA 1NAEA 3MO4A 3I2FA 4A41A 4A42A 2KD7A 1CIYA 2X10A 3OB8A 3WNOA 3VD4A 3WQBA 1JYVA 2J1AA 1JZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I2I A;  2V5D A;  2EIC A;  3NRU A;  3C8X A;  2JDA A;  4OZO A;  3GM8 A;  5IYY A;  2QBX A;  1GOF A;  3OGR A;  4QX1 A;  4ZZ5 A;  1MPX A;  1T2X A;  4IUG A;  3MV1 1;  4DXT A;  2CDO A;  4JHZ A;  1I5P A;  3HNM A;  3IDA A;  4GWJ A;  4FI9 A;  3VDA A;  4BK4 A;  5LA1 A;  2Z4F A;  1ULO A;  2BBA A;  2J7M A;  2Y6J A;  5EIY B;  4ARX A;  2BGO A;  4LPL A;  4A44 A;  1US2 A;  2Y6L A;  2ORX A;  4XUQ A;  4OMD A;  3AC0 A;  3I2K A;  2W94 A;  1JI6 A;  5DPN A;  4AAX A;  4D0Q A;  2VC9 A;  3FL7 A;  2W91 A;  2V4V A;  1O8S A;  1UYY A;  4UOJ A;  3LEK A;  3OGS A;  4QDS A;  2WN3 A;  3DYO A;  2WZE A;  5DN2 A;  2E31 A;  3CMG A;  1O59 A;  4A45 A;  3C7G A;  3K4D A;  2L9L A;  4HG6 B;  1GNY A;  3I97 A;  1J84 A;  2X05 A;  5FUI A;  2HYX A;  4QB6 A;  4DXR A;  1JU3 A;  2WN2 A;  1TVG A;  3A23 A;  2BGP A;  2ZEW A;  2VQU A;  4QB2 A;  4QX2 A;  2WAB A;  2J1T A;  4QB1 A;  2C4X A;  1D7P M;  3OEA A;  2VZT A;  3W5N A;  2LW8 A;  2YC4 A;  2Y6K A;  3OGV A;  1UMH A;  3OG2 A;  4JKK A;  3DEC A;  3NQH A;  3WNL A;  1BHG A;  3U37 A;  2YC2 A;  4A3Z A;  4QPW A;  2JKX A;  4ET7 A;  3WEZ A;  3T2O A;  2J1V A;  3HN3 A;  3VDC A;  2B4K A;  1UXZ A;  3CQO A;  3IB3 A;  4M4R A;  2W1U A;  1OF4 A;  3F2Z A;  4GZ9 A;  4L0P A;  2RV9 A;  5JMO A;  4ARY A;  3IAQ A;  1JYN A;  2E32 A;  2VCA A;  3LE0 A;  5IHR A;  2VOT A;  4E8D A;  3K75 B;  3VD3 A;  2VZ3 A;  1K12 A;  4XVH A;  3VD9 A;  3EYP A;  3SKV A;  1GOH A;  3I2G A;  2WUH A;  5JR2 A;  4KMQ A;  3WSO A;  2J1S A;  4ZXE A;  1P8J A;  1UY1 A;  3CDZ B;  4CU7 A;  1L7R A;  2Y6G A;  1UX7 A;  2C9K A;  3T0D A;  4PQQ A;  2YB7 A;  2VZP A;  4DXS A;  1H6X A;  2WAA A;  1JZ7 A;  2ZXQ A;  3HNY M;  3WNP A;  3HJR A;  1LNS A;  3I2J A;  4MOA A;  3T08 A;  2VMC A;  2VTF A;  1W8N A;  2VCC A;  4CU8 A;  1W99 A;  1K45 A;  2ZEX A;  1NKG A;  2QQO A;  4MAD A;  3THC A;  2XOM A;  2QQK A;  2E26 A;  3A7Q A;  1XC6 A;  2WBK A;  1O8P A;  5DQ0 A;  2W5F A;  3I3B A;  4M4P A;  1J83 A;  4TTG A;  2VZR A;  2WDB A;  4KWU A;  2VZQ A;  3D3A A;  3BN6 A;  2VZS A;  4Z2A A;  4TXW A;  2E33 A;  1WKY A;  3WF2 A;  2RVA A;  2VO5 A;  1PX4 A;  2W92 A;  4XZU G;  2J1U A;  5DMY A;  3DYM A;  4QDR A;  4E8C A;  2VZU A;  3A21 A;  3ZM8 A;  4XUO A;  1KEX A;  4P08 A;  4BK5 A;  1H6Y A;  5CYY A;  2ORZ A;  1SHW B;  3SEE A;  2J22 A;  3FHA A;  2W1Q A;  2W1S A;  3CZJ A;  2EIB A;  1F4H A;  5IJR A;  2LS6 A;  2WQ8 A;  1UMI A;  1W0N A;  1UY4 A;  2BER A;  1OH4 A;  1JZ3 A;  4UI9 L;  3NJX A;  3NJV A;  5JXJ A;  4YPJ A;  3C7E A;  1NUK A;  5JXG A;  3BGA A;  3SEP A;  4QDQ A;  5JUV A;  4W50 A;  2JE8 A;  3CIH A;  4LKS A;  5C71 A;  2J1R A;  1R64 A;  3P1I A;  2ID4 A;  2VCB A;  1GQP A;  5C70 A;  3PUI A;  1JZ4 A;  4W8J A;  3UES A;  4AG4 A;  3T2Q A;  1K3I A;  1OD3 A;  5LCW L;  4JX0 A;  3T0A A;  2R7E B;  1JYW A;  1XPW A;  5JXI A;  2C26 A;  3PUH A;  3NNG A;  4CU6 A;  2JD9 A;  1W9W A;  2DCK A;  3MV0 1;  4ZY9 A;  2PQS A;  3K4Z A;  4OYU A;  1W8O A;  2VM9 A;  3LEG A;  1GMM A;  3SKJ E;  2V72 A;  1CZT A;  4RYD A;  5G04 L;  2QQI A;  5IFT A;  1CX1 A;  3K46 A;  1XNT A;  1JU4 A;  3VD7 A;  4A4A A;  2VMF A;  1YQ2 A;  2ZEZ A;  1SG3 A;  2WYS A;  2W47 A;  2W46 A;  3LEI A;  1UZ0 A;  2WO1 A;  2Y6H A;  4A6O A;  1K42 A;  2VJX A;  2EIE A;  3FN9 A;  3GDB A;  1JYX A;  1W9T A;  5IFP A;  1ULP A;  4BDV B;  3JXS A;  1HN1 A;  3LPF A;  3WNN A;  2VR4 A;  1NX9 A;  5J1X A;  2YG0 A;  4P5Y A;  2B9V A;  1JZ8 A;  5LA2 A;  2DCJ A;  4RN5 A;  2QQJ A;  4CVU A;  2W87 A;  4DUV A;  1OF3 A;  3IAP A;  3I2H A;  1DYO A;  4CU9 A;  1US3 A;  4BXS V;  5HXM A;  1JZ5 A;  4DUX A;  5G05 L;  4BJ0 A;  5B4X A;  1XNA A;  3WF4 A;  3K77 A;  2YFU A;  3MUZ 1;  1DLC A;  3HPN A;  2VZ1 A;  2EID A;  2BZD A;  4CUB A;  1UY3 A;  1UYX A;  5CZK A;  4XUN A;  3VDB A;  1GU3 A;  4DUW A;  3III A;  1OT5 A;  2WO2 A;  2RJ2 A;  4XUP A;  2VMD A;  3WF0 A;  3GGL A;  1KGY A;  3WNM A;  3ETP A;  3THD A;  1IQD C;  4GWI A;  3DYP A;  2J1E A;  4CUC A;  3WF1 A;  3WF3 A;  1L7Q A;  4PT6 A;  3OBA A;  2W9X A;  2WAO A;  3C7F A;  5I0D A;  2VZV A;  3CZU A;  1UYZ A;  2W95 A;  1UXX X;  4LQR A;  3ACG A;  3ACI A;  1SDD B;  3ACH A;  3EB7 A;  5C7G A;  1EUU A;  2XON A;  3OEB A;  4DEQ A;  1GUI A;  2QQL A;  3HEI A;  3C7H A;  3K4A A;  2Y8K A;  3HOB A;  4PF1 A;  4QAW A;  3VD5 A;  2OKX A;  1DP0 A;  2X09 A;  1TG7 A;  2ZEY A;  5JXH A;  3LPG A;  4QX0 A;  4JKL A;  5HPO A;  3UET A;  3ACF A;  3E1F 1;  4KI5 M;  4P02 B;  4ZZ8 A;  5EJZ B;  1UY2 A;  1CZS A;  3WNK A;  1EUT A;  3HNB M;  2WO3 A;  3J7H A;  1UWW A;  4UAP A;  2W3J A;  3T2P A;  1JZ2 A;  4JKM A;  4XUT A;  3I3D A;  3P6B A;  1W9S A;  2Y64 A;  5A1A A;  2DDU A;  3T09 A;  3ECQ A;  4MGQ A;  4XUR A;  4P00 B;  4DEV A;  1WCQ A;  2QQM A;  4D8M A;  2WZ8 A;  2VL4 A;  2HLE A;  4MGS A;  1GOG A;  4QX3 A;  3CKH A;  2XQX A;  3W5M A;  5F7U A;  2CDP A;  3GXU A;  5B4N A;  1CZV A;  1PMH X;  2W1W A;  1F4A A;  3C7O A;  2XHN A;  3A22 A;  3I3E A;  3LQC A;  1UY0 A;  5LA0 A;  3UNP A;  4OUE A;  2VQT A;  4CUA A;  1JHJ A;  5EJ1 B;  4OMC A;  3MUY 1;  4W4Z A;  4MO3 M;  1RYY A;  3MBW A;  3FHQ A;  3T0B A;  1PX3 A;  4LHS A;  3ABZ A;  1PMJ X;  2YFZ A;  2VME A;  2QQN A;  2VZO A;  1NAE A;  3MO4 A;  3I2F A;  4A41 A;  4A42 A;  2KD7 A;  1CIY A;  2X10 A;  3OB8 A;  3WNO A;  3VD4 A;  3WQB A;  1JYV A;  2J1A A;  1JZ6 A; 
#chains in the Genus database with same CATH topology
 1OQE A;  1UZY A;  4Q1P A;  1PVX A;  2ADD A;  4PI2 A;  3CF6 E;  4Y5T A;  1Q8S A;  5C3Q A;  3ZSJ A;  3POJ A;  2JEC A;  4OZO A;  1J1T A;  5IYY A;  1GOF A;  2NMO A;  3DPR C;  3ITQ A;  3OGR A;  4ISQ A;  4L11 A;  4NRP A;  3HQR A;  4OVE A;  2HWF 2;  4UBG A;  1BLZ A;  4C0B A;  3NNF A;  4UW6 A;  3AB0 A;  3AMM A;  5BNO C;  2WR9 A;  1HRV 1;  5AFE A;  1NA1 C;  2YGM A;  2WNU B;  3OGJ A;  4ISR A;  2CDO A;  3THP A;  4LBM A;  3OJB A;  4GWJ A;  2VMI A;  2JEN A;  5C8C A;  2C6S A;  2WSV A;  4Q4W 2;  4KU7 A;  4MXV A;  5FKB A;  1N1S A;  1ZZ8 A;  1TMF 2;  2WSU A;  1COV 2;  2Y6J A;  1MZF A;  3R0R A;  5ACA 1;  5EIY B;  1CAW B;  1HRI 3;  3VBR B;  4AZZ A;  4ARX A;  4EYU A;  3FUO A;  1LED A;  3NV1 A;  1UNB A;  5DZF A;  4A44 A;  5DAW A;  2BVV A;  3RI8 A;  3FFZ A;  4CUG A;  1SEF A;  2IVJ A;  2HWE 1;  1AXZ A;  1G86 A;  1YQ6 A;  3AC0 A;  3I2K A;  2RDR A;  3ZXA C;  4IW3 A;  5T5O A;  1NQD A;  2WS9 3;  5E89 A;  2BNO A;  3WDY A;  4NIG A;  4UOJ A;  1J3R A;  3OGS A;  5LY1 A;  1DCS A;  2WN3 A;  4QDS A;  5FY1 A;  2K9Z A;  1K5M B;  2QFE A;  4HVQ A;  2E31 A;  2CTV A;  2PXJ A;  5GLT A;  3JZV A;  4Y20 A;  1GP6 A;  2BP6 A;  1PO2 3;  4XJ8 A;  1LCL A;  3I97 A;  1WMD A;  1J84 A;  2HEW F;  2X5I B;  3MI8 A;  4UT5 A;  1BVV A;  4XW3 A;  4YM1 A;  4DPN A;  5A6Y A;  1BCX A;  1OXC A;  1PM4 A;  2WYF A;  4Q4X 1;  1G6N A;  1HRV 2;  4XXP A;  1JU3 A;  2FDK A;  4BLJ A;  4XMA A;  5FZO A;  2AR6 A;  1QNY A;  2BGP A;  1NLQ A;  2ZEW A;  4NN0 A;  4WM8 B;  3LSE A;  2XB6 C;  4NID A;  2E51 A;  2WAB A;  4IQP A;  1MEC 3;  2J1T A;  4CDX A;  5C4W C;  3ZN5 A;  1NY7 1;  4QB1 A;  5EPA A;  1GLH A;  1C4R A;  2C4X A;  3OEA A;  5ACA 2;  4AI3 A;  5LA9 A;  1LUL A;  1HV0 A;  5GAL A;  1XE8 A;  3V0B B;  2VZT A;  4ZHN A;  2BOI A;  2TUN A;  5C3O A;  3O14 A;  3CLP A;  4JKK A;  1AYM 1;  3J7L A;  2BTV C;  2HWE 2;  2YC2 A;  2CGO A;  3AX4 A;  5FY7 A;  1QU0 A;  4EQV A;  2HEY F;  2R04 1;  3HD8 B;  5L9V A;  4L97 A;  4MXW B;  4QWN A;  5LEJ A;  5FP4 A;  2XVL A;  3HN3 A;  2ZKL A;  1Q8Q A;  4FTE A;  4FXK B;  5A3T A;  5DZE A;  4M4R A;  3UJO A;  2W1U A;  4R52 A;  4OLL A;  4IV3 C;  1C28 A;  4IDZ A;  3U75 A;  2IXC A;  2P6C A;  4FFH A;  2A6X A;  2UUR A;  1LOC A;  4LBQ D;  2XBO 2;  2GC3 A;  1W04 A;  1CD3 G;  2GSY A;  3BB6 A;  4HXC A;  1SFP A;  1EV1 1;  5E16 A;  3IAQ A;  5J09 A;  1QJU 3;  1JYN A;  4LO5 B;  1SCS A;  4Q4X 2;  3GHN A;  1WLT A;  3RYK A;  1CVN A;  1Z7S 3;  1U5Y A;  1XE7 A;  1OD5 A;  1CPN A;  2EAA A;  3MIF A;  5IHR A;  2VAU A;  3OUH A;  3POB A;  2A6W A;  2DTW A;  4EZH A;  3ILR A;  4E8D A;  1G9D A;  2QJV A;  4HKL A;  1K12 A;  4FVV A;  5DUU A;  5KC5 A;  3MLJ A;  5K0U A;  4JRA A;  4L2N A;  1ND2 C;  1D4M 3;  2CV6 A;  4A2U A;  5LB6 A;  1RIR A;  5SV8 A;  4L92 A;  1TQ5 A;  2ILM A;  4K7J A;  2RM2 3;  2Y60 A;  1AYM 2;  1YC6 1;  3FC0 A;  4IV1 A;  4K20 A;  3WDT A;  4IER A;  4XJU A;  4CSW A;  4N9H A;  1P8J A;  1UY1 A;  1X9T A;  2ZHM A;  2R04 2;  2Y6G A;  4XAC A;  1UX7 A;  1WW6 A;  2EAL A;  5BNP B;  3AP6 A;  1RUF 3;  5CKN A;  5FTT C;  3POS A;  5FJK A;  1RHI 3;  5FZD A;  1SQ4 A;  3T0D A;  2IFR A;  2ZA9 A;  1Q43 A;  4I0A A;  1UO9 A;  4AXO A;  2VQ0 A;  3NNJ A;  4AVA A;  2OS2 A;  3U0Z A;  2VZP A;  4DXS A;  1JZ7 A;  1GQG A;  3VKM A;  2HJI A;  1SZB A;  1VE0 A;  1RUI 3;  2JIJ A;  3I2J A;  1LHO A;  4TWT A;  4UFL A;  1OPO A;  3UGF A;  3VBU B;  1UZV A;  4YW5 A;  3KCC A;  1SFY A;  4XMI A;  3J9S A;  4C8D A;  1EV1 2;  5J36 A;  3I4I A;  5C9A C;  1K45 A;  3G6J B;  3O7O A;  1JYT A;  1DGR A;  2CL2 A;  2GC1 A;  2GND A;  2QQO A;  2RE9 A;  5FYZ A;  2VW0 A;  1WW5 A;  3SH3 A;  2IWG B;  4UYB A;  1RUJ 3;  1DQ0 A;  1JXN A;  2DV9 A;  4CCK A;  1RED A;  3ZSE A;  2A3W A;  2R30 A;  2WNU A;  3DKQ A;  4Y22 B;  5IVE A;  1LB2 A;  4P9I A;  3AL6 A;  3BTA A;  3NKT A;  2W5F A;  5L19 A;  5C5U A;  3HR9 A;  3W21 A;  5T50 A;  5L73 A;  4UF0 B;  4B7E A;  2V09 A;  2VH9 A;  3HT2 A;  4TTG A;  5A6Z A;  1ZZ7 A;  3CHX A;  4QM8 A;  1CAW A;  4LA3 A;  3BOW A;  1H4H A;  3VBR A;  4CEY A;  4Z2A A;  5CFD C;  4GWM A;  4XF9 A;  5A7Q A;  2UYB A;  4V2V A;  5GLZ A;  4ASM B;  4B1L A;  1RB8 G;  3NV2 A;  1C8M 3;  1DGW A;  3MGU A;  3ZM8 A;  1TNF A;  4MZU A;  3Q9O A;  1KEX A;  3PU3 A;  1H8T B;  1C8N A;  1H6Y A;  1STM A;  2PAM A;  5CYY A;  3WG4 A;  4E4Z A;  1GZ9 A;  4XJA A;  1JUH A;  5FZF A;  2J22 A;  1K5M A;  3WNX A;  5KBF A;  1LOD A;  4L99 A;  3ZYJ B;  4YW6 A;  3H7Y A;  3O12 A;  1UF2 C;  4COW A;  2EIB A;  4Q8K A;  4YZ1 A;  2LS6 A;  2WQ8 A;  5GLV A;  2C9A A;  4XQD A;  4MGT A;  1AR6 2;  2ZAB A;  1UAI A;  1YFX A;  2IFW A;  2X5I A;  3LA2 A;  5LBC A;  3H3Z A;  4COV A;  2MHF A;  3POF A;  1UKR A;  1UY4 A;  5IAT A;  1RMU 1;  4EWE A;  2PHL A;  3LD8 A;  4BQ1 A;  3NJX A;  1PGS A;  2C24 A;  3JBG 3;  2W52 A;  4YM2 A;  2PLV 1;  2RG4 A;  4WM8 A;  3ZIX A;  5CA6 A;  4I3G A;  3LKJ A;  5FZ6 A;  5F2S A;  4AQ2 A;  4FPC A;  5IK7 A;  1SCR A;  4BYY A;  4EN6 B;  2B46 X;  5GKA C;  2Q8E A;  3V0B A;  2JDY A;  1LGN A;  2ZML A;  4K9S A;  1R1A 1;  3JB8 A;  1Q56 A;  1I3H A;  1HW5 A;  3ZFF C;  4ONU A;  5A6X A;  1K5J A;  1A8M A;  4J1W A;  4MHR A;  4LBJ A;  2JE8 A;  3CIH A;  1O3Q A;  3R4S A;  3EJK A;  2WLQ A;  3ZPY A;  5A1L A;  4P9J A;  2AYH A;  4MXW A;  1N3P A;  1SBD A;  1ZZ6 A;  2QZ2 A;  4EWA A;  1GQP A;  3IIA A;  4FOQ A;  3DPR B;  4P5H A;  3HMY A;  2H6B A;  4BME A;  4AG4 A;  5F6L B;  3T2Q A;  1S0D A;  1N3Q A;  1OD3 A;  2Q5T A;  5BNN C;  4HLT A;  4JX0 A;  3T0A A;  5BNO B;  4G9S B;  4E2Q A;  1NA1 B;  1PIV 1;  4AI1 A;  4FAG A;  1WLD A;  2AUY A;  1FXZ A;  1KJL A;  4RR3 C;  3OYW B;  1OLM E;  4Y1U A;  3E6D A;  1RMU 2;  1JBC A;  1WBF A;  3GZE A;  1L3J A;  1QJY 3;  2QKD A;  3ME2 A;  2RR1 1;  2DCK A;  4DMI A;  1R09 2;  2CWS A;  1ZRE A;  4OYU A;  4UFK A;  4FFF A;  4O9G A;  1BBT 3;  2ZX0 A;  1W05 A;  4K1Z A;  5IW0 A;  3WQ1 A;  1OA2 A;  3OY8 B;  4I0B A;  1U12 A;  3D4K A;  1G9B A;  4RYD A;  1LOG A;  1X8M A;  3WCR A;  1S0F A;  4NPR A;  1C3H A;  3TAY A;  4QPG C;  5IFT A;  2RHP A;  4N7U A;  2WT2 A;  4IE4 A;  1BK1 A;  1NLS A;  4OZX A;  2XXZ A;  4OFG A;  4PCR A;  5FY4 A;  3VD7 A;  4I09 A;  4LBL A;  4A4A A;  3QD6 A;  4J25 A;  1YQ2 A;  3ZXL A;  1F9K A;  1PO1 3;  1SG3 A;  1XBF A;  4OHV A;  1GZW B;  1NE4 A;  5BNP A;  1OA4 A;  2A5Z A;  1VRB A;  4MG2 A;  1UL9 A;  2BVB A;  4TYS A;  2WO1 A;  3HWJ A;  2EIE A;  3GDB A;  5K4L A;  4CCE A;  3D6E A;  4NMI A;  4WV8 A;  2ZGQ A;  3N9N A;  3DN7 A;  4PLM A;  4BDV B;  1Q5O A;  2RMU 1;  3VBU A;  1PIV 2;  1ENS A;  3JXS A;  5EV7 A;  4M00 A;  2I07 B;  2KXL A;  4QHZ A;  4HVR A;  3RSJ A;  4HBN A;  2PHW A;  1GQH A;  4PIZ A;  5C4W B;  2ZZJ A;  1BEV 2;  5LA2 A;  3WCS A;  1DZQ A;  2QQJ A;  1YI9 A;  2ZJC A;  4NIA A;  4AVB A;  1OF3 A;  1RL3 A;  2ARX A;  2H0B A;  2BW8 A;  1W6Q B;  1GKB A;  3D0S A;  3E6B A;  3KD4 A;  1LEC A;  1AYN 3;  2ZAH A;  5FXX A;  4S2D A;  4Y22 A;  1ASJ 2;  2LRP A;  3HT1 A;  4BJ0 A;  4CDQ C;  4AQ6 A;  3GJB A;  5CEH A;  1YIP A;  1PO2 2;  3KM5 A;  1GBG A;  1H2L A;  2YFU A;  4UF0 A;  4J6G A;  4BHP A;  2VZ1 A;  1YHF A;  3O1U A;  3AYD A;  4HL0 A;  3ZMN A;  1UYX A;  2VBB A;  5A32 B;  2V4A A;  3RDI A;  1GIC A;  4XIL A;  2HWD 3;  3OPZ A;  4IEP A;  4IV3 B;  4QPY A;  1UYP A;  2WO2 A;  4OHX A;  4Q4V 1;  5I93 A;  4IND A;  4LK7 A;  1WCD J;  4XUP A;  2RS3 3;  5B2G B;  2VMD A;  2FD8 A;  3BYW A;  1RUE 3;  1H8T A;  3O1M A;  1VIW B;  5F3E A;  2PHX A;  3ATG A;  3THD A;  2BPA 2;  2RMU 2;  5A7W B;  1IQD C;  1GZT A;  2WWS A;  3DYP A;  4CCM A;  3RZM A;  2QDN A;  5FZL A;  3E6C C;  3IKW A;  4OUL A;  1XSQ A;  1AL2 1;  3U07 A;  4YGB A;  3V65 A;  3O0V A;  4AI8 A;  3AMN A;  1ND2 B;  1UOG A;  2W9X A;  3OBA A;  1Y3T A;  3KCX A;  3OSD A;  4RA0 A;  4COY A;  3O1S A;  3V56 A;  1YXW A;  4S2F A;  3RZL A;  5CIR A;  3AFG A;  1UYZ A;  2OYZ A;  2WA4 A;  4YW2 A;  3I2D A;  3ACL A;  1W06 A;  4YW3 A;  2D6K A;  5IWF A;  5A33 B;  2SLI A;  5EHD A;  1SDD B;  3ACH A;  1S0J A;  3UGG A;  3AZZ A;  1QJX 3;  2GU9 A;  4QXH A;  4AGV A;  3WW4 A;  1WLC A;  1D0G A;  4DEQ A;  4KG0 A;  2QQL A;  1RUG 3;  2O0O A;  4FT8 A;  2VNR A;  1VBA 2;  2GC0 A;  2OQ7 A;  1HB2 A;  3K4A A;  4RHV 1;  3JUU A;  3W20 A;  4AQT A;  1W90 A;  4Y20 B;  5HCA A;  4Q4V 2;  3PVE A;  1CPM A;  1GFF 2;  4WZF A;  3ALQ A;  3VD5 A;  1DP0 A;  2D98 A;  2P34 A;  2PHU A;  5GM0 A;  2X09 A;  4LOT A;  5GZE A;  1TME 2;  3ROU A;  1HIX A;  5C9A B;  3ENR A;  3DPR A;  2EVX A;  5C6C A;  1AX2 A;  1IQA A;  2BNN A;  3MIB A;  1O3S A;  1CJP A;  4AVC A;  4YFZ A;  3RVH A;  3S0M A;  5KR7 A;  3ACF A;  5FZ4 A;  1H1A A;  1AL2 2;  1FNZ A;  4KI5 M;  1XYO A;  1NA1 A;  1LES A;  2VY0 A;  3K3N A;  4JRL A;  4QXC A;  2PHF A;  2D6O X;  1QQP 3;  4QHO A;  3OYW A;  2WO3 A;  3W59 A;  1W6P B;  5CB7 A;  1IZ3 A;  4UAP A;  3JD7 3;  3OBR A;  2GNB A;  4JKM A;  5F5Q A;  5CFD B;  2H0V A;  4RGA A;  1VR3 A;  5F37 A;  3M3I A;  4GD4 A;  5FZK A;  4EWD A;  3L2Y A;  3DGT A;  3OY8 A;  3VD9 A;  3BUC A;  4LBK A;  4P9X A;  5F3C A;  1G9C A;  1UD1 A;  1W9S A;  5JZG C;  3ZFE C;  4COZ A;  1KDK A;  3WDU A;  2BGC A;  1WD3 A;  5CG8 A;  1C5H A;  3PVB B;  4XUR A;  1NCR C;  2PAK A;  4PDW C;  5LBF A;  1O5L A;  1GZW A;  3GZA A;  2Q8D A;  3ZN4 A;  4AF9 A;  4CDW C;  1R08 3;  1V70 A;  4D8M A;  4P9W A;  1AR9 3;  1H2K A;  4MGS A;  3AJZ A;  1GOG A;  3AMQ A;  4X6Q B;  3IDB B;  3USS A;  2FHR A;  3BTY A;  3W5M A;  1W3X A;  1Z78 A;  2CDP A;  3VKO A;  3O1V A;  1QJE A;  1RXG A;  4JQT A;  5JSO A;  1W9F A;  2PN5 A;  2YC0 A;  1PMH X;  3CEW A;  2W1W A;  1F4A A;  4I3P A;  1X50 A;  3A22 A;  3I3Q A;  3I3E A;  4V1P A;  4AI0 A;  5JPN B;  3LQC A;  4NRO A;  3W9A A;  2A73 B;  2YBP A;  4MYE A;  5C4W A;  3RZZ A;  2A70 A;  5BNQ A;  5JI7 A;  2MNG A;  1V00 A;  5E6H A;  4EN7 B;  4FSJ A;  2IXJ A;  1POV 0;  1W6Q A;  4CUA A;  4QQH A;  5JVV A;  1RVF 1;  4IEO A;  1GNH A;  2Q4S A;  4DRR A;  4LBQ B;  3H8R A;  4W4Z A;  3ZFF B;  3FHQ A;  4GB3 3;  4B4R A;  2YBK A;  3AZY A;  4Y5S A;  3ZYI B;  2P3I A;  2QQW A;  4HN0 A;  2VME A;  4JHT A;  4N8M A;  3UV9 A;  1V6I A;  4CCL A;  4E2G A;  3V0A B;  5A32 A;  5FK8 A;  2MEV 2;  1ZRF A;  3J7M A;  5BNN B;  4IV3 A;  2JE9 A;  3HBK A;  4D94 A;  1GV9 A;  4CCN A;  4GMP 3;  5KHG A;  4HKO A;  1JZ6 A;  2D6N A;  1IGO A;  3O1P A;  1V9U 3;  5CKM A;  1JHN A;  4D69 A;  3H8X A;  2JG9 C;  4RR3 B;  1KFU L;  1QOO A;  1MVQ A;  1Y9M A;  2EXJ A;  3DXT A;  1OLQ A;  1DQ2 A;  1POV 1;  2VQA A;  1ZZC A;  5A7W A;  1HDK A;  3ZYR A;  4EN8 B;  5FOB B;  1X82 A;  1LU2 A;  2QBX A;  3MZH A;  1C57 A;  2FMY A;  4C1W A;  4KL1 A;  3ES4 A;  4XFG A;  4KNC A;  1MPX A;  2VOX A;  2XML A;  4JGZ C;  1YQC A;  3MV1 1;  1ND2 A;  4DNY A;  2Q8O A;  4DXT A;  5L7O C;  2FDF A;  2FDH A;  4QPG B;  1RVF 2;  4XTM A;  3EXU A;  5FY0 A;  2IXI A;  4BK4 A;  5A33 A;  1W2U A;  1Z0H A;  1D2S A;  2DVB A;  4PIX A;  2GAL A;  2DFC A;  3WDW A;  2Y26 A;  3OBZ A;  4TSV A;  3JQW A;  2BGO A;  5T3N A;  2ZGS A;  4XBN A;  2WQ4 A;  1MAC A;  2GP3 A;  4NVP A;  4YVS C;  5LY2 A;  3U10 A;  2VCM A;  4Y1X A;  2BRT A;  3S7I A;  4AR2 A;  4O9E A;  2WRA A;  5T5P A;  4XOG A;  3RQ0 A;  2WLP A;  3FBM A;  4D0Q A;  3TN9 3;  4Q1R A;  3MW4 A;  1FMD 1;  1F31 A;  2VC9 A;  1F5F A;  1VMF A;  1VBB 2;  2V4V A;  2XVK A;  4HFS A;  1UYY A;  2JKB A;  5T55 A;  3WX5 A;  4J1X A;  2VUA A;  2B9U A;  2IC1 A;  2XH6 A;  2VXR A;  3GHM A;  3LEK A;  5DUV A;  5C9A A;  3S7E A;  2E7T A;  4X8P A;  2WJS A;  5FUN A;  4CEW C;  2D3R A;  3GAL A;  4EN9 B;  3C7G A;  2PFW A;  3I49 A;  1VP6 A;  3H50 A;  2ETE A;  4HG6 B;  2D43 A;  4KWK A;  4YM0 A;  3SMH A;  1DHK B;  5FP8 A;  4NE9 A;  1ULE A;  3TEY A;  2XLG A;  1C5I A;  4LUK A;  2HYX A;  3X29 B;  1UU5 A;  1MR5 A;  4DXR A;  4UFI A;  4YZ5 A;  1ND3 C;  5FPZ A;  4FCA A;  1HJF A;  1TVG A;  2D5F A;  4TLG A;  5GLU A;  1ENR A;  1WWY A;  2E53 A;  4BQ3 A;  1W6P A;  1RTV A;  4RFR B;  2HWC 3;  3IWZ A;  5CFD A;  1LHV A;  4LIT A;  5JSP A;  2YPD A;  4CTE A;  1CGP A;  5FZI A;  2XWJ B;  1QKQ A;  3W5N A;  1JH5 A;  1YFW A;  2Y6K A;  3OGV A;  4M3C F;  4UXA A;  3DEC A;  2AEZ A;  3J4U H;  3NQH A;  1J58 A;  1DQ4 A;  2JIC A;  3AP7 A;  1PNF A;  2ZAA A;  3U37 A;  1LJ7 A;  3ZXK A;  3MHZ A;  2ZX1 A;  1AJO A;  5D8A C;  2E7Q A;  3M2M A;  4LO7 A;  4QPW A;  2BBV A;  2JKX A;  4CP2 A;  2ZGO A;  3RFR A;  4QQP A;  1VAV A;  2J1V A;  4E4S A;  3B9I A;  1UXZ A;  4MHU A;  3IB3 A;  4LKF A;  1A8D A;  5F32 A;  2PYT A;  3H42 B;  1OF4 A;  4JDN A;  2JEM A;  2P17 A;  3MFC A;  4L0P A;  3GCX A;  1D0H A;  2VMH A;  2WIN B;  3ZYF A;  3IDC B;  2E32 A;  1O4Y A;  1XYP A;  5KHI A;  3KMH A;  4D7T A;  5JLV A;  4FP2 A;  3NL1 A;  3KV6 A;  2LM3 A;  1C1L A;  3OGG A;  3K75 B;  4G4F A;  3S30 A;  3VD3 A;  2HWF 1;  3VDD C;  5A7O A;  2VZ3 A;  4XVH A;  1MZ5 A;  4CXX A;  4EV0 A;  1GOH A;  2Y0O A;  1MS8 A;  1OI6 A;  1I6X A;  3WG1 A;  1RUC 3;  3GCW A;  4LBQ A;  1VMJ A;  3WW1 A;  1WA4 A;  2WUH A;  3ZFF A;  2KM2 A;  1UN1 A;  3R4D B;  1SDW A;  1AHS A;  4XF0 A;  1SLL A;  4Q4W 1;  5FV3 A;  1TMF 1;  4O65 A;  3KCY A;  1COV 1;  4NR1 A;  4CU7 A;  1L7R A;  2AAC A;  3BPZ A;  5T52 A;  2ET1 A;  5TSW A;  3POW A;  3NV3 A;  1G9F A;  1PHM A;  4M3C E;  1H1I A;  1VPH A;  4D7Y A;  5BNN A;  4ZON A;  1ODN A;  4LOS A;  4QGM A;  2V73 A;  2XDV A;  1FV3 A;  2WAA A;  4R4X A;  2P1B A;  4HOO A;  5ANN A;  1PZ7 A;  3PNA A;  2PTM A;  4AFC A;  4OHW A;  1WA6 X;  2R6Q A;  1LNS A;  2QTW B;  4RR3 A;  5FZC A;  2WT0 A;  5C3P A;  1Q8P A;  1W8N A;  2VCC A;  3PJY A;  1JOD A;  1W99 A;  4MET A;  2ZEX A;  1QOT A;  3H8U A;  1HKD A;  2WQZ C;  4XDP A;  5KWR A;  5LRS A;  2A3Y A;  1WCS A;  2R06 3;  1XNB A;  2WII B;  2A6V A;  1VRH 3;  1YJK A;  1BJQ A;  2QQK A;  4R9C A;  1S2K A;  3AKP A;  3ZFE B;  1SMV A;  5DZG A;  3A0N A;  4QPG A;  1O8P A;  5DQ0 A;  1X33 A;  2VOK A;  2YRO A;  3MIG A;  4M4P A;  3ZXJ A;  4C90 A;  2WDB A;  4KWU A;  1W8U A;  2EA7 A;  2ZMN A;  2DUQ A;  4LIU A;  3ZN6 B;  1NCR B;  3D3A A;  3AYE A;  4PDW B;  3BN6 A;  2VZS A;  2VBP A;  4XAE A;  1OKQ A;  4CDW B;  3IN9 A;  5IVV A;  2E33 A;  2PLV 3;  1PVC 3;  4GMP 0;  1VAM A;  3WUD A;  1PX4 A;  2W92 A;  1FYU A;  2J1U A;  2EXI A;  1ZBA 1;  3HIF A;  2D6L X;  4QDR A;  5FBJ A;  2VZU A;  1KS4 A;  1SAC A;  2DBN A;  3B02 A;  3LA7 A;  1DZT A;  3I59 B;  4BK5 A;  3ZOI A;  1R1A 3;  4BB3 A;  1SHW B;  3SEE A;  1SLA A;  2R07 3;  2E9Q A;  2N7G A;  2R0H A;  2W1Q A;  4CRQ A;  4ZU4 A;  3U4S A;  2W39 A;  4K6B A;  3CZJ A;  5FZG A;  5FZ1 A;  4GKY A;  2WZR 1;  1VBE 3;  3LFM A;  3RMY A;  3WG3 A;  1QGL A;  1IOA A;  2O14 A;  5DDJ 1;  2XBO 1;  3KHB A;  2MPF A;  3POG A;  4BQW A;  4CDQ A;  1TE1 B;  3WHU A;  1JZ3 A;  3NJV A;  4LHL A;  1QH6 A;  4Y26 A;  4IXL A;  4XAA A;  3KSC A;  1MVE A;  4IEZ A;  3C7E A;  5F3I A;  4E2S A;  1ST8 A;  3FE5 A;  1U0A A;  4W6X A;  1ENQ A;  2RR1 3;  5KXD A;  1AUY A;  4QM9 A;  1LRH A;  5FZ9 A;  4Z92 B;  3KQR A;  2ZS6 B;  2DTY A;  4GWN A;  4O61 A;  4WM7 C;  1S0I A;  3UGH A;  3VLB B;  4YZ4 A;  4QDQ A;  3VN4 A;  4B29 A;  1ZBA 2;  2G4I A;  5JUV A;  3BOP A;  5JPM B;  2BOJ A;  3WV6 A;  2JG9 B;  3MPB A;  5F6K A;  2YGL A;  4JTO A;  2DCT A;  3P1I A;  4Q0Q A;  3SH4 A;  4BQ5 A;  5L9R A;  4RGK A;  1FOD 3;  2KA3 A;  1XNK A;  2YZ4 A;  3KT1 A;  4UFH A;  3ETQ A;  4W8J A;  4HK8 A;  4BE3 A;  4AAP A;  3H9A A;  2P37 A;  5FPV A;  1GWK A;  1K3I A;  3ZLI A;  4CA9 A;  4BQ2 A;  5LCW L;  4JGZ B;  1ZA7 A;  2CYF A;  5L7O B;  2P3J A;  1W6N B;  2EIG A;  2OQ6 A;  5T5L A;  1JYW A;  1XPW A;  2RJK A;  2WZR 2;  1FPN 1;  2C26 A;  1W8W A;  1ZZ9 A;  1REF A;  4K3U A;  2RS1 3;  4YZ3 A;  5DDJ 2;  2VU9 A;  4NPL A;  3N9O A;  2OZ6 A;  1E57 A;  3WG2 A;  1EPZ A;  4Q29 A;  3VHO A;  3K4Z A;  2ZHL A;  1GZC A;  4IEU A;  1V9U 2;  1YFY A;  3VZO A;  3O1T A;  3KF3 A;  4UW4 A;  4E4H A;  5IAX A;  3J8F 2;  5BV6 A;  1NT0 A;  4XFI A;  3AFK A;  4LHK A;  2DFB A;  4YVS B;  3TB0 A;  1CZT A;  4XFA A;  1BVP 1;  1MS4 A;  1LTE A;  2QQI A;  1QXP A;  4PLO A;  4C0H A;  2D3P A;  1RUD 3;  2OPW A;  4GJY A;  3VZM A;  3ZDS A;  3N9Q A;  4NUB A;  5FMB A;  3OBT A;  2VMF A;  5H9P A;  1W2T A;  2ZEZ A;  3FLR A;  5FYH A;  2PMW B;  2HKX A;  3A4U A;  1SFN A;  4CEW B;  5IK4 A;  1KFX L;  1LGB A;  1UZ0 A;  2RS5 1;  2Y6H A;  2YXS A;  3U78 A;  4A6O A;  4BQY A;  3FN9 A;  1DDL A;  5FYB A;  2GAU A;  2OVU A;  2DWR A;  2AZ5 A;  2GME A;  3MPP G;  3PMS A;  3SH5 A;  3S57 A;  4FTB A;  2RDN A;  3AKT A;  3LPF A;  3WNN A;  1ND3 B;  4NOT A;  3VHP A;  4CCO A;  4Y4Y A;  2YY1 A;  1FPN 2;  4IEQ A;  3KGL A;  5J1X A;  2HBU A;  1O7F A;  1JUI A;  1TEI A;  2B9V A;  2HH9 A;  2YG0 A;  1PMI A;  4P5Y A;  4A6S A;  5AC9 3;  1JZ8 A;  1F5J A;  2ZBJ A;  4XF4 A;  2DCJ A;  2XJS A;  4CVU A;  4F8A A;  2W87 A;  4GAZ A;  5FAX A;  1IS5 A;  4QU1 A;  3UL2 A;  3I2H A;  2ES3 A;  1UU4 A;  4R9B A;  4U36 A;  4KH9 A;  4Q27 A;  5HXM A;  4DUX A;  1AR6 1;  1JZ5 A;  5JZG A;  4XBL A;  3ZFE A;  5G05 L;  1AR7 1;  1YQ5 A;  1BZW A;  5B4X A;  5KHJ A;  1NLR A;  5D8A B;  3MUZ 1;  3VHR A;  1DLC A;  2QVS B;  3HPN A;  4MGZ E;  2D6M A;  3ZN6 A;  1NCR A;  4PDW A;  3HQU A;  2A71 A;  4CUB A;  4CDW A;  1UY3 A;  2JX9 A;  5FZB A;  3AM2 A;  3POY A;  1MZE A;  3NO8 A;  4JDO A;  4RSU A;  4XDQ A;  5JCT A;  2EXK A;  1GU3 A;  3VBH C;  4XJZ A;  5APA A;  4BM8 A;  1LHN A;  4W65 A;  5CAZ A;  2FMD A;  3NWK A;  2RS5 2;  4HSL A;  2RJ2 A;  3VKN A;  1MS0 A;  1T6B X;  5FZM A;  4OHY A;  3I59 A;  4LLO A;  2UWA A;  3WF0 A;  1KGY A;  4GH4 C;  3WNM A;  1UCX A;  1DYK A;  3M3E A;  1AXY A;  4RHV 3;  4PBO A;  4XPV A;  4BCU A;  4CP9 B;  4KU8 A;  2J1E A;  2DVA A;  3AXE A;  4BOW A;  4AL9 A;  3VDD B;  1L7Q A;  3KS7 A;  4JAA A;  2XQR A;  4ZS3 A;  4AFM A;  4JGY C;  3ZYH A;  5FDB A;  3C7F A;  2NP0 A;  2W95 A;  4PIY A;  1UXX X;  1WW4 A;  2WFF 3;  1HV1 A;  1QNW A;  4QMA A;  3VKL A;  1O3R A;  1AR7 2;  1LGC A;  1V6O A;  2Y0I A;  4FP3 A;  5LBE A;  3WD5 A;  4AFA A;  3E5U A;  4GKX A;  4F83 A;  1R09 1;  1UU6 A;  2XON A;  4KWJ A;  4Y3O A;  2OUH A;  3DF0 A;  4KWL A;  4QKB A;  4EE2 A;  4A7Z A;  5CFC C;  1GUI A;  1NZC A;  4AHY A;  2QE3 A;  2Y6F A;  1N1T A;  4XE9 A;  4MGK E;  1LAJ A;  1D2Q A;  3OD0 A;  4MX3 A;  3AKR A;  4RQP C;  2OXB A;  4PF1 A;  2B39 A;  2JG9 A;  3UYJ A;  5H9S A;  1OA3 A;  4P9Y A;  2D44 A;  5K7P A;  4FPH A;  2WC2 A;  1RUC 2;  1PGL 1;  2ARE A;  2XUE A;  3B7M A;  3LPG A;  4HKW A;  4QX0 A;  1KRI A;  1KS5 A;  5FLH A;  3GBF A;  2LAL A;  3ILN A;  3UET A;  5LEK A;  2VVE A;  2ZGK A;  4JGZ A;  1QOS A;  5L7O A;  1EAH 3;  1W6N A;  4P02 B;  1HRI 1;  3K3O A;  2I45 A;  3JB4 C;  5EJZ B;  5FYS A;  1AR8 3;  1UY2 A;  5A3N A;  2UY9 A;  3WNK A;  5FUP A;  3ZFG C;  4AGR A;  1W8H A;  1ZRR A;  2W3J A;  1DYP A;  5H9R A;  2VE1 A;  2ARC A;  2DUO A;  4Q4Y 3;  3VZL A;  4AVV A;  1BEV 1;  2WS9 1;  1XU2 A;  4FPF A;  4U2A A;  1PGW 2;  2ZGM A;  3GBW A;  5LK5 A;  2JE7 A;  5HCH A;  1YEW A;  4YVS A;  1XYN A;  3IMM A;  5IUQ A;  3ORJ A;  5F3G A;  2ATF A;  2R06 2;  2R16 A;  4Q0S A;  1ASJ 1;  1VRH 2;  2Y64 A;  1JOB A;  5A1A A;  1PO2 1;  1Q8V A;  1UOB A;  5I0U A;  5A80 A;  3T09 A;  5J96 B;  3N4M A;  2NYY A;  4PI0 A;  2QUO A;  5FYY A;  1VB4 A;  2XG3 A;  3ECQ A;  4IGP A;  5JIU A;  4P00 B;  1GP4 A;  1YIF A;  5FMC A;  4I2O A;  2ZGN A;  1WCQ A;  4CEW A;  4Z2W A;  1OOP C;  2GNT A;  3FMG A;  3SLI A;  3Q8A A;  5C3S A;  4YNI A;  4MGY E;  2WZ8 A;  3PUS A;  2VL4 A;  1PGL 2;  3NW4 A;  3AKS A;  4NJ4 A;  1GSL A;  1ZBE 3;  2CU5 A;  1MEC 1;  4KG8 A;  4XET A;  5FZ7 A;  3M1H A;  1CZV A;  2NZ9 A;  2CY6 A;  5F8P A;  1HRI 2;  1GP5 A;  2FZ1 A;  1ND3 A;  1NE6 A;  3LAG A;  1OKO A;  1HB1 A;  1I1E A;  3UNP A;  5GZG A;  5LK7 B;  1QIQ A;  4M0N A;  1UZW A;  4HET A;  3OOX A;  1KXG A;  1SLB A;  2VQT A;  4GUL A;  5GLW A;  3QBQ A;  2GDF A;  4K21 A;  2WS9 2;  1JN2 P;  2R07 2;  5EJ1 B;  4HN1 A;  4WM7 B;  1E5H A;  3I54 A;  4KQ7 A;  4MO3 M;  3T0B A;  1IG0 A;  4LHS A;  1S0C A;  5D8A A;  3AXD A;  3UKV A;  1FI2 A;  3RWN A;  4WVM B;  1VBE 2;  2ZGT A;  4Q0U A;  1BXH A;  4MV2 A;  5F5C A;  3ASI A;  3C2U A;  1YUD A;  2G9Z A;  3MO4 A;  5C3R A;  1QJU 1;  1WLW A;  4LKE A;  4FQ4 A;  2KD7 A;  3VB9 A;  1CIY A;  1DBN A;  2K0G A;  3M4F A;  1AZD A;  3OB8 A;  3QH7 A;  3AKQ A;  3WNO A;  3KWV A;  3WQB A;  5CU1 A;  3S6P A;  1QF3 A;  2ZGL A;  1VBA 1;  1LOE A;  1DGR N;  3BOD A;  1O4T A;  2V5D A;  3SC7 X;  4DY3 A;  3NRU A;  3TEZ A;  5EZW A;  1MEC 2;  3LOI A;  2VOW A;  3PUA A;  1VBC 3;  2JDA A;  3IBM A;  2WFP A;  1D4M 1;  3GM8 A;  1TME 1;  4CP9 A;  4IGO A;  2DVG A;  2RM2 1;  4FPK A;  1SLC A;  2VEC A;  1HXS 3;  3VDD A;  1T2X A;  1KQR A;  5HV0 A;  3Q8F A;  3VL9 A;  1EPW A;  5A7N A;  2ZX2 A;  2P3K A;  1ODM A;  2PHT A;  1JOP A;  4WVV A;  4JHZ A;  3IDA A;  3J26 N;  3W58 A;  1RHI 1;  2YPJ A;  3S5Q A;  3VDA A;  5LA1 A;  3WP4 A;  2GH2 A;  3AZW A;  3WIN E;  2BBA A;  3OCP A;  3T2T A;  2J7M A;  4NWV A;  5JDB A;  5J3U A;  1RUI 1;  2VPV A;  4BQX A;  3HN1 A;  1US2 A;  2ORX A;  5C33 A;  5HV4 A;  3PUR A;  4NWW A;  4XUQ A;  1QJU 2;  5FPL A;  1RUH 3;  4D3W A;  3NNL A;  4OUM A;  2JDM A;  1M4W A;  1Z7S 2;  2W94 A;  4BXF A;  4NIH A;  4HAN A;  4BIF A;  4QQO A;  1RUJ 1;  2IZW A;  2BDR A;  3APB A;  3KB5 A;  4BU2 A;  2HWB 3;  1BMV 1;  3PJQ A;  2XVG A;  5BY5 A;  2WZE A;  2PA7 A;  2BQP A;  3QOP A;  5DN2 A;  5KXB A;  1D4M 2;  1E5R A;  4HSJ A;  5HXV A;  1NYW A;  3LDR A;  4QHB A;  2RM2 2;  4AGG A;  1DG6 A;  2G9F A;  4H7M A;  2VUC A;  2TNF A;  5A70 A;  3PTY A;  2ZPX A;  1CN1 A;  1H1M A;  4QB6 A;  1VAL A;  2JD4 A;  3CJI C;  4CCJ A;  5A6Q A;  2WN2 A;  1C8M 1;  1RUF 2;  3RYR A;  1RHI 2;  1OUR A;  1LOF C;  3GF6 A;  3H1W A;  4Q5O A;  1QWR A;  1U5Z A;  1D7P M;  4ERO A;  1VBD 3;  1CX4 A;  3CJX A;  2A6Y A;  3VBH B;  1RUI 2;  3GJA A;  1HQN A;  2ZCW A;  3MFA A;  3MLL A;  4I30 A;  1UMH A;  4NRQ A;  2HWF 3;  3OUI A;  4EN0 A;  1S55 A;  1JW6 A;  3WNL A;  5KXE A;  4DZG A;  4Y1V A;  2JWP A;  5FWJ A;  4GH4 B;  4A3Z A;  2Q30 A;  2IVI B;  2XWB B;  3CO2 A;  3MW2 A;  4ET7 A;  2WKK A;  3T2O A;  2DUP A;  1RUJ 2;  3N3H A;  4K1Y A;  1CAV B;  3VDC A;  1BMV 2;  4Q4W 3;  2B4K A;  1YI7 A;  4OI2 A;  1TMF 3;  5FZ8 A;  2MEV 1;  3ZYG A;  1HB3 A;  3U1X A;  3WLU A;  3F2Z A;  1XJA A;  2BJS A;  4JGY B;  3WZ1 A;  5JMO A;  3RNS A;  4LLF A;  2VUL A;  4I02 A;  4P9G A;  3N35 A;  1OFN A;  4B1M A;  3T1M A;  1AL0 G;  1S0B A;  3LE0 A;  5FIX A;  1C8M 2;  4ZS2 A;  2GNM A;  5A3L A;  4C91 A;  5JOW A;  4TLF A;  2HBT A;  4FPO B;  3KQ4 B;  5FYM A;  5FKC A;  1JOJ A;  5CFC B;  2GZW A;  2Z42 A;  1H9W A;  4WM7 A;  2GC2 A;  3ZPO A;  3UKT A;  4LBO A;  2TEP A;  4P14 A;  4RQP B;  5KHH A;  3WP3 A;  5EYY A;  2Z69 A;  3ZXF A;  2CSG A;  2CGP A;  3GZT B;  2J42 A;  5JR2 A;  4KMQ A;  3WSO A;  4CP0 A;  4WVM A;  2FQP A;  1HRV 3;  2J1S A;  1UZZ A;  2XL9 A;  4ZXE A;  3HQX A;  3VL8 A;  3SCF A;  2C9K A;  2Q8C A;  3QAC A;  1YWK A;  5FRA A;  4NII A;  1CWP A;  1IS3 A;  3MYX A;  2EF6 A;  2LUW A;  5F1R A;  1QJY 1;  3MIC A;  1X8E A;  2YB7 A;  3B9C A;  4BQ4 A;  5FMD A;  2O8O A;  1IKP A;  3JBG 2;  1OPM A;  1B35 C;  5ACA 3;  4FPG A;  1W9Y A;  2ZXQ A;  3HNY M;  3WHT A;  1BBT 1;  5DG1 A;  3EBR A;  1RJ8 A;  1UW8 A;  2YDE A;  4IL7 A;  2PHR A;  4L9B A;  1ZNP A;  2VXJ A;  1VBB 1;  2YYO A;  4QQ2 A;  3ZFG B;  4XJW A;  4CU8 A;  2BYV E;  4CPB A;  3N9M A;  3E5Q A;  2HWE 3;  3O0X A;  3M8L A;  5ISL A;  3KVA A;  4UFJ A;  2ZX4 A;  4XTP A;  1OVS A;  2BWA A;  2XOM A;  3IM0 A;  1CAX B;  2XR4 A;  5KHK A;  5HCF A;  2E26 A;  3DCQ A;  1PO1 1;  3A7Q A;  1DQ5 A;  2XPJ A;  2WBK A;  3KV5 A;  2P6H A;  3I3B A;  5I8S A;  4QPI C;  2VZR A;  2P3Y A;  3BU0 A;  4MH0 E;  2VZQ A;  3J7N A;  4Q4X 3;  4CYD A;  1OOP B;  1WKY A;  3MIE A;  4Y24 A;  4XZU G;  1XB9 A;  1AXK A;  1RIN A;  1LHU A;  3MF9 A;  4Q2F A;  3EHK A;  3DYM A;  3KT7 A;  4E8C A;  4Q4Y 2;  4D6R A;  1OHF A;  1QJY 2;  1OFS A;  1DQ6 A;  3VKF C;  4AVT A;  2OW4 A;  1ZYB A;  2ORZ A;  2P2K A;  1BBT 2;  4MVT A;  1IPS A;  1AYN 1;  3EQE A;  1AYM 3;  4LIV A;  2K2S A;  3T4H B;  3WY6 A;  1VLN A;  1W39 A;  2XLA A;  2DVF A;  4FOY A;  3RPQ A;  2PQQ A;  1Y9Q A;  2DCY A;  4NHM A;  1F4H A;  5FXW A;  4RGG A;  5F2W A;  4E4D X;  4HPK B;  2R04 3;  4QX8 A;  2ZAC A;  4NHY A;  4N43 C;  5ABJ C;  1PO1 2;  3L9J T;  1OH4 A;  3ZXE A;  3ZO0 B;  4PF5 A;  1TZO A;  2ZTN A;  4Z82 A;  3VGI A;  2HWD 1;  4RS5 C;  4Z1V A;  3USU B;  1X9P A;  4YPJ A;  3CL1 A;  5IVF A;  2JB4 A;  4LXL A;  4CDQ B;  1EY2 A;  2UWC A;  2XJQ A;  4JTN A;  2RS3 1;  1NUK A;  2VGD A;  4KBZ A;  1RUE 1;  3N9L A;  1EV1 3;  3ZKU A;  4OQ9 A;  5JOX A;  3T1L A;  3VBH A;  4O7X A;  3JU9 A;  4MGI E;  1HB4 A;  1SPP B;  2Y38 A;  3SEP A;  2JXA A;  1YCI A;  1DQ1 A;  1Y7B A;  2ENR A;  1CAU B;  2IXH A;  2Z2S B;  4AVS A;  5FO7 B;  2QNK A;  3K2O A;  1YRZ A;  4GH4 A;  3WP6 A;  2FDJ A;  4YGE A;  3SCG A;  2R49 A;  2ID4 A;  2VCB A;  2XJR A;  3NV4 A;  4MOA A;  1UMZ A;  3ZVX A;  1CAV A;  2JJ6 A;  4LR4 A;  4RL7 A;  5I91 A;  3DXU A;  3RGB A;  4IGQ A;  4D6Q A;  1AYN 2;  3PME A;  5DUX A;  4BA6 A;  3R4U A;  4CDU C;  2Q1M A;  2RDQ A;  4E27 A;  1UQX A;  1IPK A;  4XQW A;  4JGY A;  4XC9 A;  4LMF A;  1V6K A;  4I0W B;  1S0G A;  2R7E B;  1QJX 1;  4LT5 A;  1GYK A;  1WBL A;  5JXI A;  2TBV A;  3SHR A;  1OBN A;  1RUG 1;  1ULC A;  2R32 A;  3WW3 A;  2JD9 A;  4ZXK A;  1W9W A;  5IAV A;  1X36 A;  2HWD 2;  1MS3 A;  2PQS A;  3AVR A;  3MV0 1;  4IET A;  5EXO A;  4ZY9 A;  3WDX A;  4BMB A;  2VVD A;  1LEN A;  2RS3 2;  3LEG A;  4QKN A;  3N7L A;  5CFC A;  1RUE 2;  1LEM A;  2WWU A;  5JR7 B;  2V72 A;  2Z5W A;  5FYU A;  3NJZ A;  2G1M A;  4AI9 A;  4SBV A;  1ZZB A;  1CX1 A;  5HI0 A;  4RQP A;  1HXS 2;  1AR6 3;  4YG6 A;  4AHZ A;  1XNT A;  4OI4 A;  2GH8 A;  3ZYP A;  3VZN A;  2QQP A;  3F95 A;  3MEP A;  4AED A;  2BFU L;  4LNV A;  4EJR A;  2CNA A;  1Y4W A;  1IKQ A;  1ALY A;  3IMN A;  4IE5 A;  1KDM A;  4X6R B;  4CPB D;  1QQP 1;  4MUV A;  2UU8 A;  5D21 A;  3T30 A;  4ES9 A;  2XJT A;  4ORF A;  3H3L A;  2VUJ A;  1JYX A;  1PK6 C;  2DVD A;  3ELN A;  3JD7 1;  1AX0 A;  5IFP A;  5LRR A;  1H2N A;  1WMX A;  4GQ7 A;  4CZS A;  3PVO A;  3CJI B;  3KLS A;  1QJX 2;  2VR4 A;  3ZFG A;  4DOU A;  2F4P A;  2UYA A;  4W6Y A;  3TWI A;  4A7Y A;  4H7L A;  1RUG 2;  3M3C A;  4ATF A;  2D5H A;  4JVA A;  1U5I A;  1REE A;  3B93 A;  4RN5 A;  4YVW C;  4A3X A;  4AK3 A;  3ILF A;  1CAX A;  2PAE A;  5J98 B;  1W8T A;  3MID A;  1DYO A;  4PJY A;  1US3 A;  1YFU A;  3RYP A;  4C1X A;  4DIQ A;  2JG8 C;  5H9Q A;  3FFQ A;  3B3Q E;  1R08 1;  2JDZ A;  2VBD A;  4E9K A;  1AR9 1;  4YZ2 A;  1DGL A;  3WF4 A;  5JZG B;  1APN A;  4PLN A;  2I2S A;  3SQO A;  2EID A;  2BZD A;  4FPJ A;  2DF7 A;  3R05 A;  1OOP A;  1RMU 3;  3C3V A;  5FZ0 A;  4CP1 A;  1BK0 A;  3KGZ A;  4XUN A;  1YLL A;  4NAM A;  3D0J A;  3III A;  1R09 3;  2GN3 A;  5CVR A;  3AK0 A;  1QQP 2;  4ZPI A;  3ZXG A;  5CKQ A;  3LF7 A;  2ZHN A;  4XFF A;  2PEL A;  4LA2 A;  3POE A;  3N36 A;  3NVC A;  4BIO A;  2JDH A;  5FCC A;  1OLM A;  1CR7 A;  1VBD 2;  3GZU C;  3JD7 2;  3ETP A;  4URA A;  5IVB A;  5J48 A;  3ZIW A;  3INA A;  1JYI A;  4CUC A;  3WF1 A;  2YMZ A;  3I8T A;  4GB3 1;  1ENX A;  4QX7 A;  3KV9 A;  4PQ9 A;  4HPK A;  5D2A A;  4QGN A;  1URX A;  2ZKN A;  2WO7 A;  3PL0 A;  5I0D A;  3B5L B;  2GMM A;  2O1Q A;  4Q26 A;  1XRU A;  1A78 A;  3AVS A;  2YHJ A;  3TOJ A;  3USU A;  1R08 2;  5FOJ B;  3OTF A;  1AR9 2;  4FPL A;  4GMP 1;  2B42 B;  1QJZ A;  4URT A;  3WW2 A;  4XYX A;  1PIV 3;  1POQ A;  3AJY A;  1EUU A;  2XLF A;  3OEB A;  1V9U 1;  4H3W A;  4LO8 A;  3CBN A;  2D40 A;  3LGR A;  3ST7 A;  4FOV A;  5T54 A;  4FFG A;  3J8F 1;  3VBO C;  1OC1 A;  3HEI A;  1BEV 3;  1PNG A;  1LOA A;  2WWJ A;  1SPP A;  3C7H A;  3CU7 A;  1B35 B;  2Y8K A;  4DRV A;  2PHD A;  5A3U A;  2XKP A;  1CAU A;  3UJQ A;  3RRD A;  3VUO A;  1A6C A;  1N47 A;  1I5Z A;  2OKX A;  3T4V A;  3PLQ A;  3TEW A;  1ASJ 3;  1TG7 A;  5DAX A;  3THT A;  2D3S A;  5FR3 A;  2C1F A;  1S0E A;  2QQU A;  4F7Z A;  1QHD A;  4IE7 A;  4N9I A;  3FHI B;  2DYC A;  3M3O A;  3A0K A;  5HPO A;  4LKD A;  4GB3 2;  4WVZ A;  1J1L A;  4OCT A;  2AC1 A;  2P4E A;  4IE6 A;  5F5I A;  3H1Y A;  1CZS A;  3E97 A;  4FQZ A;  2ADE A;  1EUT A;  2XJP A;  3J7H A;  1UIK A;  4QPI B;  2W08 A;  3LOB A;  2AEN A;  2JB8 A;  1JMU B;  4I01 A;  1JZ2 A;  2ARA A;  4GIQ A;  4RD7 A;  1YJL A;  4WBB A;  4XFB A;  1R1Z A;  3TN9 1;  2JDN A;  2CHH A;  1E5S A;  1H2M A;  2RMU 3;  3AZX A;  4HVO A;  3N7K A;  1CJD A;  4LE4 A;  3WR0 A;  2F17 A;  3GNE A;  3HVD A;  5A7P A;  2XJV A;  1YNA A;  4LBN A;  5LW9 A;  5E88 A;  3WUC A;  2VTX A;  4CCC A;  3QLQ A;  2WL1 A;  2F4L A;  5ERL A;  3ES1 A;  4YSF A;  2X8K A;  5DAP A;  1DIW A;  2YU1 A;  3JQX A;  5K9Y A;  4MGQ A;  4KBB A;  3U14 A;  4DEV A;  4DO0 A;  5A3O A;  1KD7 A;  1G7Y A;  5FBZ A;  5A3W A;  4YG0 A;  3O1R A;  2HLE A;  3PUQ A;  4LHN A;  3BVC A;  1S1A A;  4GAL A;  4DY5 A;  5I8Y A;  2XQX A;  5F7U A;  4S2G A;  4N43 B;  2HWC 1;  3NKG A;  5B4N A;  5E1R A;  2ZMK A;  4NHL A;  4LK6 A;  3H3U A;  5ABJ B;  4YLZ A;  1NCQ C;  1WME A;  3CJI A;  4LO6 B;  1MS5 A;  1VBA 3;  2OX0 A;  2ZGR A;  4RS5 B;  1N1V A;  3GBG A;  1UY0 A;  4OUS A;  4DS0 A;  5I0S A;  1LOF A;  2HYK A;  2FDI A;  5EP9 A;  4N53 C;  4Q4V 3;  1NY7 2;  3AP9 A;  1G9A A;  1QEX A;  3PHM A;  2Z79 A;  3I7D A;  5FP7 A;  1TME 3;  2H6C A;  2IXL A;  1HQL A;  3EMR A;  3TN9 2;  3D5O A;  4A7K A;  2XHK A;  1JHJ A;  3OF1 A;  4DIN B;  1H8V A;  2IXK A;  2LTN A;  5IVJ A;  4LJH A;  3OUJ A;  1LKN A;  4D7S A;  3SXW A;  2YU2 A;  3MBW A;  3MW3 A;  4H55 A;  4NHK A;  5IK8 A;  1OH3 A;  1AL2 3;  4YAR A;  3ABZ A;  3ZSM A;  1KIT A;  1VMH A;  1W03 A;  2VG9 A;  1QY4 A;  3BKZ A;  4FAH A;  2WA3 A;  5DUW A;  4R8H A;  4G3Y C;  4A41 A;  2RJL A;  4CDU B;  3I3M A;  1ZRC A;  3AP4 A;  3V64 A;  4JZR A;  4XJ9 A;  4QKF A;  5JI9 A;  3RWK X;  1JYV A;  2J1A A;  2A1X A;  1I9R A;  4UFM A;  3I2I A;  5FMO L;  5IK5 A;  5AVP A;  3MIH A;  5FFO C;  2EIC A;  2ZHK A;  5FP3 A;  1H9P A;  2HWC 2;  2Y34 A;  1H30 A;  3C8X A;  1S2B A;  3OPT A;  3ZYB A;  1RUC 1;  5DXD A;  4FTS A;  4QX1 A;  3NAP C;  3PTR B;  4ZZ5 A;  1JS9 A;  4IUG A;  4JQR A;  4K8R B;  3IDE A;  2R1B A;  2FDG A;  1YO8 A;  1ZVF A;  1W6M B;  2A7A A;  3ZR5 A;  3RJR A;  3WNP A;  1EP0 A;  1N3O A;  1X7N A;  2WNV C;  1I5P A;  3HNM A;  3IT8 A;  3KZ4 C;  3SCH A;  4FI9 A;  4NAO A;  1UX6 A;  2LRO A;  4UWD A;  5CAD A;  4F3J A;  1O4Z A;  2Z4F A;  1ULO A;  1W6O B;  1HQW A;  4IEW A;  5FO8 B;  2NMN A;  4LPL A;  4NHX A;  5FY5 A;  2Y6L A;  1PGW 1;  3P5B A;  3AL5 A;  1PK6 B;  1OUS A;  1W3V A;  4OMD A;  3LZZ A;  1B35 A;  4Q8L A;  4ES8 A;  4OI0 A;  1W2A X;  1JI6 A;  2R06 1;  5DPN A;  4AAX A;  3WDV A;  2E7A A;  5M0T A;  1VRH 1;  2A75 A;  2DBI A;  2W91 A;  3FL7 A;  4PBP A;  4ZU5 A;  3Q8E A;  1O8S A;  4AHW A;  3TNP B;  3BTZ A;  1FNY A;  3DYO A;  1FT9 A;  1JTZ X;  3CMG A;  1O59 A;  4A45 A;  2NN8 A;  4YVW B;  3RMX A;  3ZXD A;  3K4D A;  2L9L A;  1AVB A;  1GNY A;  1WMF A;  4FO9 A;  2OPK A;  2JG8 B;  2X05 A;  2CAV A;  2MEV 3;  5FUI A;  3FZ3 A;  4CCD A;  1PVC 1;  4IEX A;  5FYV A;  2X29 A;  3A23 A;  4COU A;  4QPI A;  2VQU A;  4QB2 A;  5AFB A;  2SBA A;  4LUL A;  4QX2 A;  3BI3 A;  3NST A;  1A34 A;  4ASL A;  4Q0V A;  4Y1Y A;  4M3C B;  5BPX A;  3WQ7 A;  5F9T A;  4IEY A;  1FAY A;  2JDK A;  1S4C A;  2OZJ A;  2V5Y A;  3KF5 A;  4R9D A;  5FPB A;  2LW8 A;  5FY9 A;  4DXZ A;  2YC4 A;  2R07 1;  1IHM A;  3OG2 A;  4YGD A;  5FYC A;  1WUV A;  4BH9 A;  1BHG A;  1GAN A;  4AOC A;  3VBF C;  1ZX5 A;  5IVY A;  3E5X A;  1LHW A;  5FZ3 A;  1L7L A;  1W8Z A;  1MQT C;  2XJU A;  3B00 A;  1E5I A;  5EWS A;  3B69 A;  1VBE 1;  3WEZ A;  2JIG A;  1RVF 3;  2E6V A;  5F39 A;  2EXH A;  4GA9 A;  3CQO A;  5IT6 A;  3VBS C;  2A3X A;  4XHX A;  1OQD A;  4GZ9 A;  5EFU A;  4BIS A;  2RV9 A;  4N43 A;  5JWP A;  4D6S A;  4CEY C;  2GN7 A;  5LWB A;  4ARY A;  4QQL A;  5ABJ A;  5LZ6 A;  1GWM A;  4FFI A;  3RG0 A;  2VCA A;  2PLV 2;  3DKW A;  1PVC 2;  4RS5 A;  1JYC A;  5EJ3 A;  2VMG A;  5J7M A;  3H1M A;  3KV4 A;  1O3T A;  1TNR A;  1VBB 3;  4PHZ A;  2VOT A;  3TNQ A;  1J3Q A;  5BYN A;  5FXV A;  3EYP A;  1R1A 2;  1OSG A;  2P5B A;  2UWB A;  1POV 3;  4MLO A;  3SKV A;  3VBO B;  4YRD A;  3I2G A;  1FOD 1;  5DAV A;  5AVA A;  2CWM A;  1RGS A;  4Z07 A;  5C8C C;  2ZGP A;  3BTX A;  3M3Q A;  2YUE A;  3MDP A;  1UIJ A;  1CON A;  4XFC A;  5GZC A;  2ERF A;  2QDR A;  3CDZ B;  1W0O A;  2RS1 1;  5JMC A;  4CDU A;  4L8Q A;  4PQQ A;  5CNA A;  4CXY A;  4QU2 A;  4YG3 A;  2B5H A;  1H6X A;  3H7J A;  2NM1 A;  3AYC A;  3H0O A;  1Z7S 1;  2VUD A;  3HJR A;  2WZP P;  4ZU7 A;  3T08 A;  2VMC A;  1UPI A;  1S2E A;  2VTF A;  3LWC A;  2RR1 2;  4CXW A;  1LOB A;  1GNZ A;  3LDB A;  3WXP A;  1NKG A;  4YW4 A;  1RUD 1;  2VNO A;  2B8M A;  4MAD A;  1NZI A;  5SV5 A;  1FMD 3;  4HT1 T;  3THC A;  3ON7 A;  3LCP A;  3FLT A;  3O0W A;  1M06 G;  1W6M A;  1XC6 A;  3L2H A;  5FP9 A;  3U11 A;  4XF1 A;  3FLP A;  3LEM A;  1F15 A;  4AYU A;  1XND A;  1FOD 2;  1J83 A;  4AQS A;  5FPA A;  3TRS B;  1RUF 1;  4FOW A;  4CDX C;  3D82 A;  1W6O A;  1GWL A;  1XE0 A;  5HBA A;  1GR3 A;  4TXW A;  2OUJ A;  1YQ8 A;  1F8V A;  3WF2 A;  2D6P A;  2RVA A;  2VO5 A;  5K8S A;  4QD2 A;  1EYB A;  5CG9 A;  4UW5 A;  2YV8 A;  4QXK A;  3QH6 A;  5DMY A;  1NXM A;  1PK6 A;  3M70 A;  2RS1 2;  3ZDV A;  5BUV A;  5AC9 1;  3A21 A;  2QCS B;  4XUO A;  4QGL A;  3ZSL A;  4P08 A;  4H14 A;  4ITC A;  1NCQ B;  4QKD A;  1W28 A;  3WT3 A;  1UPS A;  4B4P A;  3DUI A;  4N53 B;  3FHA A;  5BXX A;  4XIK A;  2W1S A;  4YVW A;  1ULF A;  1BKZ A;  2NLR A;  4SLI A;  5IJR A;  4XBQ A;  1RUD 2;  4XF3 A;  1ULD A;  1UOJ A;  1UMI A;  4Y5Z 0;  1W0N A;  2JG8 A;  4AED C;  4XXA A;  2O8Q A;  3VZJ A;  3ZMO A;  4DQA A;  2BER A;  1RC6 A;  4FPY A;  4M0H A;  2EAK A;  4UI9 L;  2DU1 A;  3VV1 A;  1WCU A;  2ZGU A;  4XDO A;  5JXJ A;  1Q8O A;  3OPW A;  4R9A A;  5FXZ A;  4JCK A;  3RS6 A;  3M7A A;  1Y43 B;  2FBE A;  3HAG A;  1O91 A;  1MS1 A;  5FO9 B;  4AHX A;  4Z8B A;  4M3C A;  2G19 A;  2DU0 A;  1HX6 A;  1ULG A;  2B7Y A;  4FXG B;  5K0U C;  1W8F A;  2VTX J;  5DG2 A;  5JXG A;  3BGA A;  5FWE A;  1ACC A;  3IPV B;  1XSR A;  4Q0P A;  2AGS A;  5E8A A;  5FK7 A;  5I0T A;  1OVP A;  5AC9 2;  4IV1 C;  4LEJ A;  4W50 A;  4LKS A;  5C71 A;  1LU1 A;  2BV4 A;  2J1R A;  1R64 A;  5FZE A;  1NG0 A;  3TEX A;  4AI2 A;  4HON A;  5EYX A;  5L9B A;  2QZ3 A;  3R6S A;  5C70 A;  3PUI A;  2VD7 A;  4BZ4 A;  1UKG A;  4GXL A;  4FBF A;  1JZ4 A;  4XCA A;  5BNO A;  2WFF 1;  4WVW A;  5FZA A;  3NAP B;  3UES A;  4BWO A;  1MS9 A;  2ET7 A;  2ARB A;  4OHZ A;  1D4V B;  2ZZQ A;  2X53 S;  5JIA A;  2W0X A;  1COV 3;  1IG3 A;  3JBG 1;  2WT1 A;  2AH2 A;  3N7M A;  2WNV B;  4AW7 A;  1LR5 A;  5A3M A;  2G9G A;  3WQ0 A;  3PUH A;  1BYH A;  1U5X A;  3NNG A;  4LE3 A;  1Q3E A;  3TYJ A;  4CU6 A;  2BFU S;  1F35 A;  3ZSK A;  1FV2 A;  5C8W A;  2VNV A;  2GP5 A;  1W8O A;  5FYT A;  3LIH A;  2VM9 A;  3UT0 A;  4TZD A;  1GMM A;  1ZA4 A;  2RDS A;  4K8F A;  5FQ0 B;  3VBO A;  3SKJ E;  4AFD A;  3O1O A;  3FX3 A;  4XZP A;  5DAB A;  2WNU C;  1VB2 A;  4QX5 A;  4RHV 2;  1H4G A;  3LSD A;  5G04 L;  3TBD A;  4M01 A;  4MSV A;  1V6M A;  2VVF A;  3K46 A;  1AX1 A;  1A3K A;  1XXN A;  3VHN A;  4XAB A;  1CIW A;  1O6U A;  1JU4 A;  4B3N A;  4AEJ A;  3BPS A;  1RIT A;  4LTA A;  1EAH 1;  2WYS A;  3B94 A;  2W47 A;  2W46 A;  1WW7 A;  1AR8 1;  3VBR C;  2D93 A;  3LEI A;  4AWD A;  2Q1F A;  1SBE A;  3HBZ A;  4YFW A;  4ZKT B;  3S5A A;  4ATE A;  3WVJ A;  3I2O A;  1DLL A;  3KT4 A;  4YW1 A;  1AJK A;  3AMP A;  2BUK A;  1IS4 A;  2VJX A;  2WFF 2;  1K42 A;  1SLT A;  4AE2 A;  5ANQ A;  1W2N A;  1W9T A;  5T5J A;  1V6L A;  2UY8 A;  1V0A A;  4XIO A;  4XCB A;  4Q4Y 1;  2OA2 A;  1ULP A;  4Y4R A;  5CIS A;  1PZ8 A;  1VAK A;  4YWA A;  3RJ2 X;  4DFS A;  3KHC A;  1MZ6 A;  3LA3 A;  4TN7 A;  2XUM A;  1HN1 A;  4WZC A;  4BPZ A;  2C5D A;  2YBS A;  1NX9 A;  1WGP A;  1ZBA 3;  2GMP A;  4GJZ A;  1YYN A;  2AEY A;  1K5M C;  1RXF A;  4H2A A;  4HZF A;  4NO4 A;  5FJH A;  4KGQ A;  1FAT A;  1XNC A;  2NPI A;  4QXB A;  2WNO A;  5FZH A;  4DUV A;  3BAL A;  3IAP A;  3UKN A;  4CU9 A;  4BXS V;  2X5I C;  3ZX7 A;  4AEK A;  3DL3 A;  2C0Z A;  4YYO A;  2HEV F;  4R4Z A;  3RZJ A;  2W2I A;  5LAT A;  3VBF B;  1T6G C;  3FJS A;  1XNA A;  3K77 A;  3BU7 A;  1MQT B;  1ZBE 1;  2CGN A;  2FCU A;  1QJF A;  4WM8 C;  5FLJ A;  4QT6 A;  2WZR 3;  2VW1 A;  5DDJ 3;  2KR2 A;  1EAH 2;  2XBO 3;  1CQ9 A;  4P9L A;  5CZK A;  1BQP A;  1NOV A;  3VDB A;  1WD4 A;  3JCI A;  3D8C A;  1AR8 2;  3VBS B;  4DUW A;  1OT5 A;  4NPM A;  2D97 A;  4N7I A;  4K40 A;  5JOY A;  3J8F 3;  4CEY B;  1UOF A;  1VJ2 A;  1B09 A;  3T3Y A;  2DUR A;  3AMH A;  4XQ4 A;  2R0F A;  3GGL A;  3OD4 A;  1NCQ A;  2B45 X;  2JDU A;  2QQV A;  3WP5 A;  2FCT A;  1IPJ A;  4GWI A;  3QCW A;  1DGW X;  1DFQ A;  4N53 A;  3RZH A;  1DZR A;  5F5A A;  5GZD A;  1O5U A;  4UBH A;  5LAS A;  2R1D A;  3WF3 A;  3P3N A;  3WOG A;  4S2H A;  4PT6 A;  2XGX A;  5J37 A;  2WAO A;  2OT7 A;  1ZM1 A;  1DF0 A;  1QH7 A;  2VZV A;  1WZX A;  3CZU A;  4XFH A;  3RZK A;  4LQR A;  3ACG A;  3Q8C A;  5C8C B;  3AZV A;  3ACI A;  2XKO A;  3MF6 A;  4OQ8 A;  3EB7 A;  1QXR A;  3SIT A;  5C7G A;  5FPX A;  1ZBE 2;  2BEO A;  3BCW A;  1PM7 A;  1FPN 3;  1HLC A;  3VZK A;  2IUW A;  3LFI A;  1VBC 1;  4LOR A;  1SBF A;  3SIS A;  1ZRI A;  3IPV A;  1SLI A;  2ZOE B;  3RI9 A;  3B01 A;  4HMZ A;  5LBB A;  3RZG A;  3HOB A;  1HXS 1;  4QAW A;  1W0P A;  1OLR A;  2BWC A;  1ZRD A;  2A6Z A;  4YGC A;  1QXJ A;  1H0B A;  1DU3 D;  5BNP C;  2ZEY A;  3UK9 A;  1N1Y A;  5JXH A;  3PDQ A;  5HCB A;  4JV4 A;  3AP5 A;  3NAP A;  3LDK A;  2FCV A;  4JKL A;  4HK9 A;  3E1F 1;  4JDM A;  4ZZ8 A;  4N90 A;  1NXD 1;  2WNV A;  1AF9 A;  2XL7 A;  5DAQ A;  3VBU C;  3U4X A;  3URF A;  3HNB M;  3H8O A;  4DB5 A;  2RS5 3;  3NJY A;  5FZO B;  4X8N A;  4EZ4 A;  1UWW A;  1RUH 1;  3Q8B A;  4AFB A;  4CDX B;  4BLI A;  3FUQ A;  3T2P A;  5KC6 A;  1OQ1 A;  2NQY A;  1QDC A;  3DV8 A;  4Y33 A;  3G7D A;  1V6N A;  4XUT A;  5FQ0 A;  2HWB 1;  3DEM A;  3I3D A;  3P6B A;  2F6B A;  5CBL A;  4IES A;  1VBC 2;  2Y33 A;  5JOZ A;  5JAX A;  4YW7 A;  4AEM A;  1CES A;  1FMD 2;  3LIG A;  2FZ2 A;  1RUO A;  4YM3 A;  2DDU A;  3P3P A;  4LO4 B;  3ZKY A;  2VNG A;  1OUX A;  5GZF A;  1F2N A;  1ONA A;  3NMB A;  1G8W A;  1QDO A;  1XU1 A;  1AR7 3;  3LB9 A;  4OI1 A;  2QQM A;  4XHB A;  3O5S A;  5FYI A;  4UW3 A;  2CAU A;  2BNM A;  5I0R A;  4NRM A;  3KVB A;  1HJG A;  4V2W A;  1PZ9 A;  4QX3 A;  3CKH A;  4Y1Z A;  5I8T A;  3SNM A;  4AED B;  2W68 A;  3GXU A;  5A7S A;  2I74 A;  3PU8 A;  5GJ6 A;  1H8T C;  5FPU A;  3POI A;  4ASK A;  1VBD 1;  3C7O A;  1XQN A;  4IE0 A;  2XHN A;  1NQJ A;  2Q1Z B;  3FWE A;  1W2O A;  3ZR6 A;  3FBY A;  5LA0 A;  4XEZ A;  4OUE A;  1OMI A;  3BIE A;  2VW2 A;  1J59 A;  1FX5 A;  5A3P A;  1RUH 2;  3K48 A;  5JSR A;  1QMJ A;  4B7K A;  3EO6 A;  2VOV A;  1IS6 A;  1XOY A;  3N9P A;  3AYA A;  3N7J A;  4IEV A;  1KJR A;  2ZX3 A;  3BIW E;  5K0U B;  2E63 A;  3K51 A;  1J3P A;  3PIG A;  2K46 A;  5EQU A;  4CE8 A;  1RUN A;  4FPE A;  5L36 A;  2Q0A A;  4OMC A;  2HWB 2;  4W6W A;  3MUY 1;  5FMO S;  1V6J A;  3PIJ A;  3PVN A;  1RYY A;  1PX3 A;  3VBF A;  5IVC A;  4IV1 B;  1PMJ X;  1MQT A;  2YFZ A;  1HN0 A;  3CNA A;  3MLK A;  3V0A A;  3NNM A;  2QQN A;  1C1F A;  2D7F A;  2VZO A;  3GYD A;  5D1I A;  1NAE A;  5FY8 A;  1RJ7 A;  2JDP A;  5KXC A;  5A1F A;  2BU9 A;  3I2F A;  1WCK A;  4A42 A;  4JC1 A;  5FRE A;  1Y9G A;  2OII A;  2X10 A;  3VBS A;  4B8E A;  5C5T A;  3VD4 A;  3IZO A;  4KGG A;  4RFT 0;  5FLI A;  4B4Q A;  2WNE A;  4LUM A;  2DCZ A; 
#chains in the Genus database with same CATH homology
 3I2I A;  2V5D A;  2EIC A;  3NRU A;  3C8X A;  2JDA A;  4OZO A;  3GM8 A;  5IYY A;  2QBX A;  1GOF A;  3OGR A;  4QX1 A;  4ZZ5 A;  1MPX A;  1T2X A;  4IUG A;  3MV1 1;  4DXT A;  2CDO A;  4JHZ A;  1I5P A;  3HNM A;  3IDA A;  4GWJ A;  4FI9 A;  3VDA A;  4BK4 A;  5LA1 A;  2Z4F A;  1ULO A;  2BBA A;  2J7M A;  2Y6J A;  5EIY B;  4ARX A;  2BGO A;  4LPL A;  4A44 A;  1US2 A;  2Y6L A;  2ORX A;  4XUQ A;  4OMD A;  3AC0 A;  3I2K A;  2W94 A;  1JI6 A;  5DPN A;  4AAX A;  4D0Q A;  2VC9 A;  3FL7 A;  2W91 A;  2V4V A;  1O8S A;  1UYY A;  4UOJ A;  3LEK A;  3OGS A;  4QDS A;  2WN3 A;  3DYO A;  2WZE A;  5DN2 A;  2E31 A;  3CMG A;  1O59 A;  4A45 A;  3C7G A;  3K4D A;  2L9L A;  4HG6 B;  1GNY A;  3I97 A;  1J84 A;  2X05 A;  5FUI A;  2HYX A;  4QB6 A;  4DXR A;  1JU3 A;  2WN2 A;  1TVG A;  3A23 A;  2BGP A;  2ZEW A;  2VQU A;  4QB2 A;  4QX2 A;  2WAB A;  2J1T A;  4QB1 A;  2C4X A;  1D7P M;  3OEA A;  2VZT A;  3W5N A;  2LW8 A;  2YC4 A;  2Y6K A;  3OGV A;  1UMH A;  3OG2 A;  4JKK A;  3DEC A;  3NQH A;  3WNL A;  1BHG A;  3U37 A;  2YC2 A;  4A3Z A;  4QPW A;  2JKX A;  4ET7 A;  3WEZ A;  3T2O A;  2J1V A;  3HN3 A;  3VDC A;  2B4K A;  1UXZ A;  3CQO A;  3IB3 A;  4M4R A;  2W1U A;  1OF4 A;  3F2Z A;  4GZ9 A;  4L0P A;  2RV9 A;  5JMO A;  4ARY A;  3IAQ A;  1JYN A;  2E32 A;  2VCA A;  3LE0 A;  5IHR A;  2VOT A;  4E8D A;  3K75 B;  3VD3 A;  2VZ3 A;  1K12 A;  4XVH A;  3VD9 A;  3EYP A;  3SKV A;  1GOH A;  3I2G A;  2WUH A;  5JR2 A;  4KMQ A;  3WSO A;  2J1S A;  4ZXE A;  1P8J A;  1UY1 A;  3CDZ B;  4CU7 A;  1L7R A;  2Y6G A;  1UX7 A;  2C9K A;  3T0D A;  4PQQ A;  2YB7 A;  2VZP A;  4DXS A;  1H6X A;  2WAA A;  1JZ7 A;  2ZXQ A;  3HNY M;  3WNP A;  3HJR A;  1LNS A;  3I2J A;  4MOA A;  3T08 A;  2VMC A;  2VTF A;  1W8N A;  2VCC A;  4CU8 A;  1W99 A;  1K45 A;  2ZEX A;  1NKG A;  2QQO A;  4MAD A;  3THC A;  2XOM A;  2QQK A;  2E26 A;  3A7Q A;  1XC6 A;  2WBK A;  1O8P A;  5DQ0 A;  2W5F A;  3I3B A;  4M4P A;  1J83 A;  4TTG A;  2VZR A;  2WDB A;  4KWU A;  2VZQ A;  3D3A A;  3BN6 A;  2VZS A;  4Z2A A;  4TXW A;  2E33 A;  1WKY A;  3WF2 A;  2RVA A;  2VO5 A;  1PX4 A;  2W92 A;  4XZU G;  2J1U A;  5DMY A;  3DYM A;  4QDR A;  4E8C A;  2VZU A;  3A21 A;  3ZM8 A;  4XUO A;  1KEX A;  4P08 A;  4BK5 A;  1H6Y A;  5CYY A;  2ORZ A;  1SHW B;  3SEE A;  2J22 A;  3FHA A;  2W1Q A;  2W1S A;  3CZJ A;  2EIB A;  1F4H A;  5IJR A;  2LS6 A;  2WQ8 A;  1UMI A;  1W0N A;  1UY4 A;  2BER A;  1OH4 A;  1JZ3 A;  4UI9 L;  3NJX A;  3NJV A;  5JXJ A;  4YPJ A;  3C7E A;  1NUK A;  5JXG A;  3BGA A;  3SEP A;  4QDQ A;  5JUV A;  4W50 A;  2JE8 A;  3CIH A;  4LKS A;  5C71 A;  2J1R A;  1R64 A;  3P1I A;  2ID4 A;  2VCB A;  1GQP A;  5C70 A;  3PUI A;  1JZ4 A;  4W8J A;  3UES A;  4AG4 A;  3T2Q A;  1K3I A;  1OD3 A;  5LCW L;  4JX0 A;  3T0A A;  2R7E B;  1JYW A;  1XPW A;  5JXI A;  2C26 A;  3PUH A;  3NNG A;  4CU6 A;  2JD9 A;  1W9W A;  2DCK A;  3MV0 1;  4ZY9 A;  2PQS A;  3K4Z A;  4OYU A;  1W8O A;  2VM9 A;  3LEG A;  1GMM A;  3SKJ E;  2V72 A;  1CZT A;  4RYD A;  5G04 L;  2QQI A;  5IFT A;  1CX1 A;  3K46 A;  1XNT A;  1JU4 A;  3VD7 A;  4A4A A;  2VMF A;  1YQ2 A;  2ZEZ A;  1SG3 A;  2WYS A;  2W47 A;  2W46 A;  3LEI A;  1UZ0 A;  2WO1 A;  2Y6H A;  4A6O A;  1K42 A;  2VJX A;  2EIE A;  3FN9 A;  3GDB A;  1JYX A;  1W9T A;  5IFP A;  1ULP A;  4BDV B;  3JXS A;  1HN1 A;  3LPF A;  3WNN A;  2VR4 A;  1NX9 A;  5J1X A;  2YG0 A;  4P5Y A;  2B9V A;  1JZ8 A;  5LA2 A;  2DCJ A;  4RN5 A;  2QQJ A;  4CVU A;  2W87 A;  4DUV A;  1OF3 A;  3IAP A;  3I2H A;  1DYO A;  4CU9 A;  1US3 A;  4BXS V;  5HXM A;  1JZ5 A;  4DUX A;  5G05 L;  4BJ0 A;  5B4X A;  1XNA A;  3WF4 A;  3K77 A;  2YFU A;  3MUZ 1;  1DLC A;  3HPN A;  2VZ1 A;  2EID A;  2BZD A;  4CUB A;  1UY3 A;  1UYX A;  5CZK A;  4XUN A;  3VDB A;  1GU3 A;  4DUW A;  3III A;  1OT5 A;  2WO2 A;  2RJ2 A;  4XUP A;  2VMD A;  3WF0 A;  3GGL A;  1KGY A;  3WNM A;  3ETP A;  3THD A;  1IQD C;  4GWI A;  3DYP A;  2J1E A;  4CUC A;  3WF1 A;  3WF3 A;  1L7Q A;  4PT6 A;  3OBA A;  2W9X A;  2WAO A;  3C7F A;  5I0D A;  2VZV A;  3CZU A;  1UYZ A;  2W95 A;  1UXX X;  4LQR A;  3ACG A;  3ACI A;  1SDD B;  3ACH A;  3EB7 A;  5C7G A;  1EUU A;  2XON A;  3OEB A;  4DEQ A;  1GUI A;  2QQL A;  3HEI A;  3C7H A;  3K4A A;  2Y8K A;  3HOB A;  4PF1 A;  4QAW A;  3VD5 A;  2OKX A;  1DP0 A;  2X09 A;  1TG7 A;  2ZEY A;  5JXH A;  3LPG A;  4QX0 A;  4JKL A;  5HPO A;  3UET A;  3ACF A;  3E1F 1;  4KI5 M;  4P02 B;  4ZZ8 A;  5EJZ B;  1UY2 A;  1CZS A;  3WNK A;  1EUT A;  3HNB M;  2WO3 A;  3J7H A;  1UWW A;  4UAP A;  2W3J A;  3T2P A;  1JZ2 A;  4JKM A;  4XUT A;  3I3D A;  3P6B A;  1W9S A;  2Y64 A;  5A1A A;  2DDU A;  3T09 A;  3ECQ A;  4MGQ A;  4XUR A;  4P00 B;  4DEV A;  1WCQ A;  2QQM A;  4D8M A;  2WZ8 A;  2VL4 A;  2HLE A;  4MGS A;  1GOG A;  4QX3 A;  3CKH A;  2XQX A;  3W5M A;  5F7U A;  2CDP A;  3GXU A;  5B4N A;  1CZV A;  1PMH X;  2W1W A;  1F4A A;  3C7O A;  2XHN A;  3A22 A;  3I3E A;  3LQC A;  1UY0 A;  5LA0 A;  3UNP A;  4OUE A;  2VQT A;  4CUA A;  1JHJ A;  5EJ1 B;  4OMC A;  3MUY 1;  4W4Z A;  4MO3 M;  1RYY A;  3MBW A;  3FHQ A;  3T0B A;  1PX3 A;  4LHS A;  3ABZ A;  1PMJ X;  2YFZ A;  2VME A;  2QQN A;  2VZO A;  1NAE A;  3MO4 A;  3I2F A;  4A41 A;  4A42 A;  2KD7 A;  1CIY A;  2X10 A;  3OB8 A;  3WNO A;  3VD4 A;  3WQB A;  1JYV A;  2J1A A;  1JZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...