4LPLA

Structure of cbm32-1 from a family 31 glycoside hydrolase from clostridium perfringens
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
DPYRNVPKDMKTEWKWGQYSSDEPSKAVDGDDSSQFHSQDSAIDKPFIIDMQKAYTIEKLELLFRKNGNGSVKRAEIYSSLDGVTYEKVFSNAEGSDIAPWATDGEVKTINFNKPIKVRYFKIVTKESIGNFLAMREFRPYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Sugar binding protein
molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
total genus 36
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4lplA00
2E31A 4OMCA 2VZQA 4KMQA 2WAOA 5JMOA 4P02B 4ZY9A 3I2KA 1WCQA 2E33A 2YFZA 5B4XA 1JI6A 2V5DA 5JR2A 2QQKA 3DECA 5IJRA 3D3AA 3NRUA 3WNNA 1LNSA 3IB3A 5IFTA 2LW8A 2VZUA 1ULOA 1UYXA 2JDAA 2ID4A 1T2XA 2CDOA 2Y6LA 3I97A 4CU7A 5JXIA 2W1UA 4PQQA 2W95A 3K4AA 5EJZB 1O59A 3HNMA 2J1UA 5JXHA 3PUHA 2VZ3A 2W91A 4LPLA 1JZ6A 3LEKA 3WF0A 3P1IA 2XONA 1JZ7A 4MGSA 4P5YA 3UNPA 5DPNA 3ACFA 2Y6KA 2VQTA 4A41A 1NX9A 1DP0A 5JXGA 1GNYA 1JHJA 3VD7A 3VD4A 4W8JA 4RN5A 4GWIA 3FN9A 2Y6HA 3NJVA 2J1RA 2VZPA 4JKKA 3C7FA 2VCAA 3C8XA 2EIEA 3A22A 3OEBA 2L9LA 2W1WA 3I3BA 5FUIA 4KI5M 2WDBA 1GUIA 3I2HA 1PX4A 2VZRA 1JZ4A 2J1TA 2Y8KA 1UWWA 5LCWL 1GMMA 2Y6JA 4ARXA 3OGRA 3LPFA 3P6BA 3OGSA 1JYXA 1JU3A 4LKSA 4A6OA 3VDCA 4PT6A 1UY4A 2Z4FA 1UY3A 5A1AA 4GWJA 4JKMA 1XC6A 3HJRA 1PMHX 3OEAA 4IUGA 2BGOA 3CZJA 4BJ0A 5C70A 3K46A 2BZDA 4JKLA 3LEGA 1J83A 3T2OA 2OKXA 1TVGA 3T2QA 2DCKA 2VZ1A 3SKVA 3EYPA 4CU8A 3MUZ1 2ZEXA 3WQBA 2WYSA 4RYDA 3HNYM 1UX7A 1CZVA 2WBKA 3AC0A 5DQ0A 5G05L 2RJ2A 1SHWB 3GXUA 1UYZA 1W9WA 3C7EA 3GM8A 2EIDA 1O8PA 3E1F1 3WSOA 2WABA 4BXSV 1SDDB 4P00B 2W1SA 2E26A 3I2FA 4XVHA 2WO3A 4MO3M 3NQHA 4XUQA 5HXMA 3WF2A 4A44A 1OD3A 1W9TA 3CDZB 2J7MA 5G04L 3J7HA 1PMJX 1O8SA 1UY1A 2J1AA 4OMDA 4MOAA 4BK4A 2WN2A 3HPNA 3WNLA 3F2ZA 4QPWA 5J1XA 3CMGA 1J84A 2QQNA 4XZUG 2B9VA 1US2A 2R7EB 2J1EA 2JKXA 3UETA 2VC9A 1CZTA 2B4KA 4M4PA 4CU6A 2W92A 1JZ3A 2VJXA 1GQPA 2LS6A 4MADA 3A23A 2ORZA 1GU3A 3U37A 1ULPA 4ZXEA 3CIHA 2WQ8A 2WZEA 4P08A 1CX1A 3IAPA 1CIYA 1W9SA 2DDUA 3CQOA 3OG2A 4YPJA 2W87A 4KWUA 4QB6A 1L7QA 4ARYA 2ZEYA 3LEIA 3LPGA 2WUHA 2XQXA 3I3DA 2WZ8A 4DUXA 1UMHA 5IFPA 2VM9A 3K77A 3THCA 3HEIA 3LE0A 2QQJA 1EUUA 3ECQA 3MBWA 4E8CA 1JYNA 2QQMA 4CVUA 4QB1A 1H6XA 2QQIA 3WEZA 5CYYA 3HN3A 3DYPA 3W5NA 3CZUA 3C7GA 1EUTA 2VO5A 2C9KA 3WF4A 1SG3A 2C26A 2VTFA 2W94A 3T0BA 4BK5A 4XURA 3K75B 2X10A 3I3EA 3MV01 4M4RA 3I2IA 2QQOA 3ZM8A 4PF1A 1NUKA 2XOMA 2VMDA 1IQDC 5C7GA 2CDPA 1XPWA 1K45A 1JZ8A 3OGVA 5EJ1B 4W4ZA 2YC2A 5DN2A 2VL4A 3HNBM 1JU4A 2HLEA 2BGPA 3BGAA 3SEEA 3W5MA 4GZ9A 2E32A 4TXWA 3FL7A 2X05A 2VZSA 1OF3A 4A4AA 1UMIA 3T08A 3MO4A 4DXRA 5HPOA 3SKJE 1BHGA 2VZOA 1XNTA 4UAPA 4AG4A 5LA0A 4DUVA 5JXJA 1L7RA 4CUBA 1R64A 4QDRA 1UY0A 1PX3A 4ET7A 4A42A 1P8JA 1HN1A 1GOGA 1JYVA 3T2PA 3IIIA 1K12A 2YC4A 3A7QA 1OF4A 3C7OA 3C7HA 4D8MA 2Y6GA 3T09A 1DYOA 4CUAA 2W5FA 3VD5A 3ACHA 1WKYA 3GGLA 3I2JA 3NNGA 4QB2A 2V72A 3K4ZA 3OB8A 2WN3A 1UZ0A 4QX3A 5C71A 5LA1A 4QX2A 1JZ2A 2WAAA 5I0DA 1JYWA 4TTGA 1UXZA 4A45A 2C4XA 4QX1A 3I2GA 1US3A 2VZVA 1GOHA 2W47A 4XUPA 3THDA 4DXSA 2W46A 1W8OA 3PUIA 3WF3A 2BBAA 4Z2AA 4DEQA 3JXSA 5IHRA 4XUTA 3K4DA 3CKHA 1W0NA 2VMCA 3HOBA 1UYYA 4AAXA 3GDBA 2RVAA 1I5PA 3BN6A 1YQ2A 2EIBA 5DMYA 4OZOA 5LA2A 2BERA 2VMEA 5IYYA 1F4AA 4UI9L 2HYXA 3LQCA 1KEXA 1NKGA 2WO1A 1W99A 3ETPA 3DYOA 3VDBA 1OH4A 2QBXA 2W9XA 3WF1A 2VCBA 3VD9A 2W3JA 5EIYB 2XHNA 1W8NA 4QAWA 1UY2A 3NJXA 4E8DA 4CU9A 2YG0A 3ACIA 2VMFA 3T0AA 4QDQA 2X09A 4A3ZA 1D7PM 1OT5A 1NAEA 2VR4A 3FHQA 3OBAA 2ZEWA 3DYMA 1MPXA 4BDVB 5F7UA 4D0QA 4ZZ5A 3VDAA 4OUEA 4DXTA 2J1SA 3VD3A 2W1QA 1TG7A 1DLCA 1K3IA 1GOFA 1RYYA 2VOTA 4XUNA 2DCJA 4LQRA 4MGQA 4DEVA 5CZKA 3IDAA 2YFUA 4XUOA 2VCCA 4DUWA 1CZSA 4L0PA 3ACGA 3EB7A 2ZXQA 1JZ5A 2KD7A 2PQSA 2YB7A 3A21A 2WO2A 3ABZA 1H6YA 2J1VA 3WNPA 2ORXA 2JE8A 3WNOA 3WNKA 4JX0A 2V4VA 4FI9A 3MV11 2J22A 4ZZ8A 3UESA 3SEPA 2RV9A 2EICA 3T0DA 1UXXX 1F4HA 2Y64A 3WNMA 5JUVA 4HG6B 1K42A 4QX0A 2VZTA 4W50A 3FHAA 1XNAA 2ZEZA 1KGYA 2QQLA 3MUY1 2VQUA 4UOJA 4OYUA 4CUCA 4LHSA 4QDSA 5B4NA 2JD9A 4JHZA 3IAQA
chains in the Genus database with same CATH superfamily
1LHWA 2VZQA 1QXRA 2RMU2 2ZGTA 4KMQA 5BNOB 2ZAAA 3WQ1A 4BQ1A 2EAAA 5C9AB 3RZMA 4ES9A 3VV1A 2XLFA 2XPJA 2X5IB 5C4WB 2HWF1 1LR5A 3JZVA 3LB9A 3BPZA 3Q8EA 4QU1A 5CNAA 2D6PA 3DECA 3BODA 3ZDVA 3D3AA 4FFIA 1UOGA 4WZFA 5F6KA 1DGRN 5FRAA 4CEYA 4DZGA 1H8TA 1Q8PA 3ZSJA 4EWDA 5IK4A 5FZ4A 5A32A 2B9UA 2ENRA 1SLBA 1ULOA 4XW3A 1KS4A 3MIFA 4WM7A 3VDDB 1VIWB 5JPMB 1FMD2 1LGCA 1SLCA 2Y6LA 3AMPA 3I97A 4LUKA 5FY5A 5BNPB 3TEYA 4BQWA 1OKQA 1VE0A 1CGPA 3DCQA 3RI8A 2IXIA 4XDQA 5FP7A 5CB7A 3WW1A 3HNMA 5F5CA 2J1UA 5JXHA 5FZ0A 5FYZA 5IK8A 1RXGA 2VZ3A 2W91A 3AZZA 2HH9A 4LPLA 3P1IA 3DPRC 2VNGA 4IW3A 3UYJA 4MGSA 2I07B 1O6UA 1UOFA 2GMPA 4HN0A 3ACFA 3AMNA 3GCXA 3S30A 3CL1A 3H8UA 1VB2A 2B46X 2QJVA 2VBDA 4N53A 4CDQC 1QKQA 1NX9A 3BU7A 4WVMA 2WWJA 1AR92 3LCPA 2D6MA 5JXGA 3MEPA 3JD71 2QTWB 1X9TA 1VALA 3VD4A 4Q4Y3 4RN5A 4ZU4A 1BK1A 1N47A 2V4AA 3FN9A 2Y6HA 1Q56A 1ZRFA 1JODA 2P2KA 5LEKA 2PHXA 2UURA 3C7FA 3U4SA 4AHYA 4CDWB 1QJX3 1EPZA 3A22A 3OUIA 4JV4A 5FR3A 3OOXA 2RS33 3N7LA 3IM0A 3T3YA 4BQXA 4LULA 4S2GA 1A34A 1E5HA 1XJAA 3QCWA 1PMIA 1DG6A 5HI0A 5JWPA 4CRQA 5DAVA 3R4SA 4K6BA 4RSUA 3SCFA 3USUB 1VPHA 2J1TA 1CQ9A 4WM8C 3ZYHA 3IN9A 4JRLA 1JH5A 1RUD2 5JSPA 3P6BA 1WBFA 4XYXA 2CGPA 1VRH3 3VDCA 4LKDA 4PT6A 1RVF1 1GLHA 1PO11 3L9JT 1D4M1 4HZFA 1UY3A 1W0OA 2A1XA 1XYPA 4AR2A 4CDQA 5D8AC 2QZ2A 3M1HA 4JKMA 1W6OA 1NLQA 1FV2A 3VBRA 4B29A 1W8UA 2EALA 3HJRA 2HWB3 4KQ7A 3OEAA 2D93A 2I74A 1RJ8A 2FMYA 2ZHNA 5JOWA 1M4WA 1EAH2 1WW6A 2RJKA 4LLOA 3UJOA 2D7FA 1W6NB 3B5LB 3AKTA 2VCMA 1XB9A 3LEGA 4BXFA 1YFWA 3ZN4A 3OBZA 4KWJA 3PNAA 1OI6A 1RUE1 4QQHA 4XCAA 2VZ1A 3SKVA 4BZ4A 4CTEA 5FXXA 5K9YA 2WYSA 4IL7A 4RYDA 4UW3A 5L9VA 4Z92B 1C5IA 3DKQA 3RZGA 1FAYA 1O3RA 4AI0A 4UFKA 3AC0A 5I8TA 1ZRCA 2RJ2A 5BV6A 1XNBA 1NLSA 5FP4A 3W58A 3C7EA 2ARBA 3GM8A 4NIDA 2VVDA 4GH4A 3LDRA 1CAVA 4PJYA 3WW4A 1FPN1 3J7NA 4BXSV 4FTBA 1POV0 2YY1A 3POBA 2EVXA 2JDPA 4UFLA 4AEDA 5HBAA 2E7AA 5APAA 2E26A 4CA9A 1QJU3 2GALA 1TME1 3IMNA 1OC1A 1UX6A 3PUSA 5HXMA 1REFA 2AH2A 3NL1A 3TBDA 3WF2A 1QGLA 2WZR1 1UYPA 4FPOB 1OA3A 1CAXB 2YC0A 3RQ0A 5ACA3 1NG0A 3N9NA 1OPOA 4Q4V3 2DVBA 5BUVA 5DAWA 5D8AA 4DPNA 1IS5A 1DHKB 1XU1A 3VBFC 1W8FA 2IFWA 3IPVA 3OPTA 3B69A 4O65A 5KWRA 2D98A 4CDWA 4MOAA 1OLQA 2WN2A 2Y0IA 4M0NA 1VBB2 3WNLA 3F2ZA 5DXDA 3GJBA 3ZIWA 3MLKA 4FT8A 2YROA 4W65A 4QPIC 3TN93 3VDDA 2UWCA 4DO0A 1ND2A 1QH7A 4BQYA 1DGWX 2ARXA 1KDKA 2Q8DA 5C3PA 2LM3A 1V9U2 4R9BA 3J4UH 1AYN1 5GLZA 5AFEA 2J1EA 3KZ4C 4GMP0 3P5BA 1A8MA 2B4KA 1XYOA 4JC1A 4XILA 1MS1A 1SMVA 4YVWC 4B4QA 3M3CA 1COV2 4Y5TA 4WV8A 3VBRC 4CU6A 1WCKA 4BIFA 4MGIE 1G8WA 4ITCA 3RYPA 5K0UA 1NZIA 4J25A 4NIHA 3WDYA 1RINA 3V56A 3H0OA 5FYMA 4A3XA 1C4RA 1KDMA 2LTNA 4JTNA 4LHKA 1UOBA 4Y1ZA 2VMHA 1CX1A 1MS0A 4CPBD 2PLV3 3MFCA 3KT4A 4OQ8A 4IESA 2HWB2 5A33A 2JG8B 1RMU3 3IAPA 2PAMA 1DIWA 1PO13 2DUQA 4LOSA 2WNOA 4CUGA 3ZN6A 1YIFA 2WZR2 4AFMA 1LGNA 1W6QB 4LBMA 4YZ1A 3GZAA 4ARYA 3RFRA 2JDNA 3VBUB 1GP5A 2ZEYA 1TME2 3KGLA 4ISRA 1RUD3 1U0AA 3KD4A 2XQXA 1CN1A 4XTMA 2HYKA 1BBT3 1EPWA 1V70A 1UCXA 3K77A 2QNKA 1MVQA 3MIGA 3HEIA 3DXUA 4AFAA 5F3CA 1FPN2 3LE0A 4OI4A 3MBWA 3NNLA 4FPCA 3E97A 4EROA 1ZA4A 5FZ9A 3HN3A 3RG0A 3LFMA 2GH2A 2CV6A 5K0UB 1I5ZA 3MW4A 4OHVA 1UZWA 2C9KA 3PU3A 2Q30A 2R043 1SG3A 2RS51 2C26A 1ULEA 1W6OB 1RC6A 3ORJA 1QEXA 5FZDA 1X36A 2NN8A 4KH9A 1H9WA 1IQAA 1ENQA 3MLJA 5FYVA 3VKFC 4EN7B 4EWAA 4LEJA 2C9AA 5D21A 2A6YA 5DZEA 1AHSA 1SFYA 4BQ4A 3BTZA 1HRI1 1QJZA 3MIEA 4H7MA 1FPN3 4MXVA 1VRBA 1XOYA 2JB8A 5F5IA 2JG9B 2D97A 4YARA 2QQOA 2GDFA 3ZM8A 4PF1A 1NUKA 2RG4A 2ZGPA 2WZPP 5C7GA 1APNA 5LBBA 5C3QA 1S0BA 2JENA 2A6WA 2WQZC 2YBKA 5FY9A 4WVVA 4IERA 2HWD3 5EJ1B 4BWOA 4Q2FA 4Z2WA 2JKBA 5GKAC 2I45A 4QWNA 1ND3C 2EXJA 4AFCA 5IAXA 3HNBM 4B7KA 4Y1YA 5FY8A 4YNIA 1ZZ7A 1FMD3 2BGPA 3ZMNA 1VMFA 1PO12 1OFSA 2EXIA 2ZMNA 3NO8A 4Q0QA 3W5MA 4HK9A 4FFGA 2P3KA 1Q5OA 2VVEA 3GJAA 4XBNA 1S0EA 4A4AA 2JIGA 4YM1A 1J1TA 1VR3A 3N9MA 4LO7A 4DINB 1DYPA 4DXRA 3B7MA 5FV3A 1DGWA 3ZKUA 2D5FA 4I0BA 4WVMB 1GQGA 4NOTA 2UWBA 5FMOL 1X33A 2Q5TA 3POGA 4QKFA 1XNTA 4UAPA 4HBNA 2XDVA 4HVQA 4CCLA 4IQPA 2PTMA 2HWD2 4FQ4A 1S1AA 1LHOA 1W90A 4P9LA 1WA4A 5LASA 2GP5A 3Q9OA 5FWEA 1BMV1 2GU9A 2RM21 1UY0A 3POWA 4RQPB 5CFDC 1LJ7A 1UKRA 3FUOA 4A42A 1PM4A 1HQWA 3SC7X 5K8SA 1NT0A 4LK7A 3IIIA 4LO6B 3NV3A 3A7QA 1ENRA 3EHKA 3AMQA 3FBMA 3UK9A 3W9AA 4XBQA 4A6SA 2Y6GA 1W05A 4S2FA 2W2IA 2A7AA 4GWNA 4WM8B 4QPYA 5IAVA 1DYOA 1MS8A 4CUAA 3S57A 4NHXA 2D6LX 3ZYIB 1C3HA 1WKYA 1GFF2 3GALA 2YV8A 1LOBA 3NNGA 5FZMA 2HEWF 4Q4V2 4HETA 3FWEA 1R1A1 3ZFGC 1TMF1 4DNYA 3K4ZA 1DGLA 2ZX4A 3HVDA 3OB8A 2X29A 1DCSA 2IXJA 4QX3A 3KV5A 1K5MC 2IXKA 3QACA 3THPA 2NMNA 1AVBA 4G9SB 4QM8A 4MVTA 2NM1A 1JS9A 3ZYJB 4K3UA 3WT3A 2WNUA 1UXZA 1WLCA 3M70A 3RPQA 2VBPA 2WC2A 4PBPA 5DUWA 4A45A 2FZ1A 1HX6A 3BPSA 2VAUA 2JX9A 3OY8B 3TWIA 4AK3A 1H4GA 1PIV3 5I8YA 3MICA 1PGL1 5FZIA 3ATGA 3CNAA 4IE6A 4EZHA 2W47A 2E53A 3KS7A 5A7WA 4CDUA 4IGQA 2W0XA 1H8VA 1HW5A 3HBKA 4JGYA 2OPKA 3PJYA 1S0DA 4AXOA 1I1EA 3JXSA 3A0NA 2H6CA 3K4DA 4IEXA 1DF0A 4Q4W3 1D2QA 2ADDA 2IC1A 1SFNA 1V6JA 4XJ9A 4R9AA 4AW7A 5FZ6A 1UF2C 4AAXA 2RVAA 1WCUA 4AEKA 1OMIA 1I5PA 1QNWA 3NMBA 4NUBA 1YQ2A 1HIXA 4AVTA 5DMYA 4N90A 3VZKA 3FLPA 4UFIA 1W2UA 4XQDA 2VUCA 5C6CA 3ZOIA 1NE6A 1SBEA 2F4LA 2RS12 2BWCA 1NCRA 3V0BB 2PN5A 3IKWA 4OULA 1KEXA 1QNYA 3ZN5A 1W99A 3ZYRA 4CEYC 5A3LA 1OH4A 1V6IA 2QBXA 1Y9QA 3U0ZA 1V9U3 1SLTA 1TME3 3AKRA 3NAPB 2JE7A 5EFUA 2B42B 3J26N 2K2SA 1SQ4A 3LFIA 2CL2A 1HLCA 4IV3A 1EV11 1KITA 4AVBA 1OLMA 1CWPA 4LBKA 2KXLA 1GZWA 2XG3A 2ZGLA 5T5JA 3TEXA 4C0BA 4Q4V1 2RS13 1ULFA 4LE4A 3ACIA 4YLZA 5C8WA 3T0AA 4YM3A 4QKDA 4FPYA 4IEZA 5AC92 1AX0A 4OHWA 5DAQA 2OT7A 2Q1MA 2PHFA 2GC3A 3FHQA 3VZJA 2RS32 3RZHA 1FOD2 1YWKA 2ZEWA 1ZZCA 4NHKA 1W04A 3ZXKA 1MPXA 1AL23 5T50A 3POYA 4LMFA 4RHV3 3AM2A 4IEQA 4KU8A 2YYOA 3J8F2 1X9PA 2PFWA 4AQTA 3K48A 4ZS3A 5FDBA 3H50A 1RYYA 2XXZA 4A7ZA 1AR93 2H6BA 1EV12 4CCEA 4HN1A 1E5RA 1Y9MA 3GBFA 4N43A 3IDAA 4JGZA 1WCSA 1MEC2 5A80A 4DUWA 4QMAA 1ND3B 4LBQB 1CPMA 1JYTA 3M3OA 2KD7A 2NYYA 4U2AA 1BXHA 1H6YA 1RUE3 3WNPA 4OHXA 5FPUA 1IS3A 1WWYA 2JE8A 3LSDA 4JX0A 1O5UA 2V4VA 3LDKA 3ES1A 3N4MA 1XRUA 4LIUA 2EAKA 3UESA 1CJPA 3SEPA 4ZZ8A 1LENA 4Y5Z0 3AYCA 2RV9A 1Y7BA 3PL0A 4FTSA 5HXVA 1ST8A 1AR82 1YQCA 3E5QA 1Z7S2 3RSJA 4Y1UA 5BNOA 3RZLA 1BEV1 1YC61 2HWB1 3FHIB 2H0BA 4P9GA 4QX0A 5CG8A 1LOCA 5A3PA 4Q4X3 2UWAA 5IVVA 1RUF2 1XNAA 3IDCB 5FZ8A 2QQLA 1D4M3 3KMHA 1VP6A 1WMDA 2DYCA 2VQUA 2WNVA 1IPKA 3JU9A 1O5LA 1NXD1 2XWBB 3O0WA 4RD7A 2J42A 3QH7A 1OVSA 5FREA 4AZZA 3LIHA 5C4WC 3ZX7A 1ZZ8A 4JHZA 3L2YA 5F39A 4FFHA 3C2UA 2SBAA 2A73B 2E31A 1DZQA 3ZFFA 3O1MA 3AZVA 4BM8A 5FY4A 3UV9A 1SZBA 2WAOA 1HXS1 4BMEA 3IMMA 1LEDA 2G9FA 4YG3A 2YFZA 2YGLA 3AZXA 5B4XA 5CVRA 1BYHA 5GLTA 4M0HA 2HWE3 1XSRA 1UW8A 5JR2A 4W6XA 1G9DA 4QX8A 5IJRA 1ASJ2 3M3EA 1RUF1 3GHMA 3NRUA 2VUAA 2CYFA 2RS52 4QQOA 4YW1A 4X8PA 1OURA 1LHVA 3AMMA 2FD8A 5A1FA 1S0CA 3IB3A 3N9OA 1CR7A 5A70A 1H0BA 5FY1A 3LSEA 1LEMA 2FDFA 2R32A 5CFDB 5LBEA 3W59A 2QDNA 1LCLA 1PM7A 4GMP1 2ID4A 2BTVC 3WDTA 3FE5A 1F31A 3O14A 1S0GA 4E4ZA 3HIFA 4NRMA 3ZFGA 5JXIA 4AI3A 2F17A 2W68A 4L99A 2W1UA 4PQQA 4SLIA 4R52A 4Y24A 2W95A 4IXLA 1KFXL 3VB9A 5KR7A 4BHPA 2B7YA 4TLGA 2AGSA 2WNUB 3PUHA 4DFSA 1DDLA 3LEKA 3KLSA 2XONA 1STMA 2JG9A 1ULCA 3Q8BA 3PIGA 3R4DB 5IWFA 4AVSA 5F9TA 4V1PA 5CA6A 3UNPA 2LALA 2TUNA 2CNAA 4Q0PA 4XBLA 5DPNA 5C8CA 1J3QA 4XF1A 4CP9A 5J36A 2VQTA 4UWDA 2A75A 5JMCA 3ITQA 5FBJA 5FZ1A 4OI1A 2E51A 1JYCA 4IGOA 3ZSLA 2DVFA 4YW7A 2ZACA 4XFCA 3VGIA 5KC6A 1MR5A 3VD7A 4OLLA 2VU9A 2ZX1A 4IE0A 1L3JA 2VQ0A 4M3CA 3LZZA 1C8M3 4PCRA 4AQSA 4JCKA 2XVKA 3WCSA 4E2SA 3E6DA 1GICA 1OLRA 3B9CA 4JKKA 3OUHA 1POV3 4F3JA 3T30A 1YNAA 4EJRA 5BXXA 3OEBA 2V5YA 3M7AA 2W1WA 3I59A 3LGRA 4JDMA 3DKWA 4WBBA 5FUIA 2BW8A 2WDBA 4BQ2A 1R081 1F8VA 2R041 2RS53 2JIJA 1PX4A 3I8TA 2WIIB 1Z78A 5A3MA 1PGW2 2AYHA 4XABA 1N1TA 1W6PB 3MF9A 4FVVA 4SBVA 5LK5A 2ZABA 4BH9A 4Z1VA 2D6KA 5LCWL 1GMMA 2P3IA 1BEV3 3AZWA 3W21A 3WW2A 1QJY2 1PGW1 3LPFA 2VOWA 2R0FA 3OGSA 2DBIA 1JU3A 2VBBA 5DAXA 5FK7A 2FDHA 3BTXA 4A6OA 1GSLA 1C8M1 1X50A 2NZ9A 1Q8QA 2JICA 3EJKA 3WNXA 1LB2A 4COVA 3ON7A 3DUIA 3RJRA 3JD73 1GZWB 4OCTA 3MGUA 5JOXA 2AZ5A 4ORFA 2CAUA 3TN92 5A1AA 4YRDA 4GWJA 4E2QA 4Q1PA 1CAUB 1JOBA 4KBZA 1UL9A 3FMGA 4XHBA 3DPRB 1UOJA 1GWMA 5CU1A 5FUPA 4JDOA 1C1LA 1W2OA 2OQ7A 3CZJA 3G6JB 3KSCA 3OGJA 5F5AA 5LRRA 4RGGA 1Q43A 2BZDA 5FPZA 3BU0A 1IKPA 1G6NA 2Q1ZB 1D0GA 5EXOA 2ZGQA 3E6BA 4XJUA 4V2VA 1BCXA 4AYUA 3S5AA 4MV2A 5FYCA 5E88A 4HLTA 3RI9A 4BB3A 1TNFA 4WVWA 4QHOA 4HSLA 1FV3A 2YGMA 2DCZA 1V00A 1RUE2 2WBKA 4Q0SA 5DQ0A 5B2GB 3D82A 4FPKA 4Q27A 2Y34A 2IZWA 2BOJA 1JUHA 2ZKNA 5IW0A 2WABA 1SDDB 2XKPA 1DQ1A 4P00B 2PAKA 2WR9A 3O1VA 1VBD1 2JXAA 3R4UA 2XLGA 1JOJA 1NYWA 2WA4A 5H9PA 3O1OA 3AJYA 1UPSA 2VTXA 1GV9A 2P6HA 2W08A 5FP9A 3NQHA 4FPHA 4TSVA 4OUMA 2D6OX 4RHV2 1VMHA 1RUH2 3AX4A 1AL22 4HK8A 4XDOA 4YGEA 1BQPA 1CAXA 3WG3A 4QX7A 3CBNA 3AKPA 1AYM3 3CDZB 4GJYA 2LRPA 3UGFA 3VL9A 5BYNA 4K1ZA 2J7MA 1QJU1 3J7HA 1JMUB 5A6YA 5FO7B 5EHDA 3BIEA 4CCOA 4J6GA 5L9RA 3IDBB 1PVXA 3FFQA 5FZ7A 3VKMA 1LOAA 1RUJ2 4HKOA 2J1AA 4MGTA 2UY9A 3HPNA 1YEWA 2AREA 4QPWA 2BNOA 4YG6A 2JWPA 4IGPA 5J37A 4PHZA 1J84A 4XC9A 2DVGA 1OA4A 2HJIA 1WLTA 4CP2A 5HCAA 1E5SA 1NXMA 1SDWA 2YPDA 1Q8OA 5FJKA 3OY8A 4P9XA 3UETA 1VRH2 3Q8AA 2VC9A 4X6RB 1VBD3 1W8TA 1IS6A 3ZMOA 4PLOA 2YPJA 2W92A 3U07A 3AJZA 2VW2A 3M8LA 2RE9A 3SCGA 1HB1A 2VJXA 3F95A 1S2BA 2HEYF 4YM2A 5EYYA 4C1XA 3BVCA 4MADA 5L73A 3TNQA 2A71A 1EY2A 4CXWA 4Z8BA 2LUWA 1AR81 3ENRA 5GZGA 2G19A 1VAVA 5K7PA 2ET7A 3CIHA 2ZZJA 1OVPA 2JEMA 1TEIA 1YLLA 3FLRA 3VBRB 1UZZA 4NIIA 4AFDA 1AR91 1AXKA 1RUC2 4IE4A 1RUH1 5EZWA 1VBA3 4CDUB 1CIYA 1W9SA 3CQOA 4YPJA 2Z2SB 4P9IA 4IE5A 3ZKYA 3ROUA 4K8FA 5FYSA 5JZGA 1FNZA 4QB6A 1HRI2 2ZX3A 4TYSA 5JSRA 1OSGA 3KWVA 1PIV2 3WQ7A 5A7OA 2GC2A 2ZAHA 3LEIA 2HWE1 5L19A 1YQ6A 4XACA 2WUHA 3I3DA 2PA7A 1MVEA 1KFUL 4M3CF 2QUOA 2VM9A 2DCTA 4OFGA 2VW1A 5D8AB 5EV7A 5KBFA 5BNPC 3JB8A 4MG2A 3DGTA 5E1RA 1AF9A 5EWSA 3ECQA 2R062 1ZRIA 3K3OA 5T3NA 4CPBA 2VH9A 1VAKA 2QQIA 2VOXA 1MZFA 1ZBA3 3SQOA 4KBBA 1KQRA 5BY5A 5EQUA 4LA3A 5A7PA 4GB33 2VO5A 3M2MA 1QXPA 3BALA 4MHUA 1H2LA 2R30A 3WF4A 1RJ7A 2XJUA 4OQ9A 1OOPC 1R083 2VTFA 2W94A 4IEUA 1QJX2 4UF0A 1RUI3 5T5LA 2LROA 2W52A 3CJIC 5A7NA 3CHXA 3IDEA 3OPWA 1XNDA 3WR0A 1XNCA 3D0SA 2C24A 3I54A 4W6WA 3RMXA 3V64A 5FLJA 2CTVA 4RA0A 3J7LA 2XUMA 3KQ4B 4UW6A 5DUXA 4CXYA 2VMDA 1MQTC 2ZGRA 1FATA 4YZ2A 4MYEA 2CDPA 1OH3A 4ISQA 3MZHA 1K45A 4Y4YA 1N3OA 2ZOEB 4XFFA 3H8OA 4W4ZA 3D0JA 1QQP1 4YZ3A 5KHJA 2BBVA 1UU6A 3U14A 3HWJA 2VVFA 1CJDA 2JDMA 2YU1A 1CIWA 2CY6A 3N9LA 1MS5A 5JIAA 3I2OA 4NROA 4GZ9A 4MGYE 3VBUA 4ZU5A 4Q26A 1LOGA 2A6VA 1ZBE3 4LO4B 3GZEA 1OQDA 4QPIB 4Y1XA 1SPPB 2O8QA 2X05A 1RUF3 5FOBB 1RUNA 5A7WB 3O1UA 5HPOA 4PIXA 1ZX5A 1W9YA 3SKJE 2QVSB 1HDKA 3D4KA 3AL6A 4U36A 5KC5A 5LA0A 5JXJA 2HEVF 4QKBA 2Q8CA 3VBHC 1DGRA 3C3VA 1CAWB 1DQ4A 1MZ5A 4LHLA 5A3TA 5FJHA 1P8JA 4BMBA 5BNNB 1HN1A 2Q4SA 4IEPA 3VDBA 5KHGA 5CFCA 4PI0A 1FT9A 3M4FA 2RR12 1W6QA 2GN3A 2JECA 4KU7A 3VBSA 1OF4A 1Y43B 1YQ5A 3NJZA 3C7OA 3APBA 4H55A 1LHUA 4IDZA 3JB4C 4YW3A 3T09A 4NN0A 5FMDA 1VBC1 1ZZBA 3HBZA 4B7EA 1Y4WA 1KS5A 3LAGA 5AVPA 2JG8A 2W5FA 5F1RA 3O1PA 3ACHA 3PTRB 3RDIA 3ZXLA 1H1IA 1LECA 1SLIA 4LO5B 4XFAA 3I2JA 1HRV2 3E5UA 2Z5WA 3SH5A 1CESA 2KA3A 1QU0A 2A3XA 4YWAA 2Q8OA 4AOCA 1J59A 2V72A 4LBQD 4S2DA 2DWRA 2BNMA 4ATFA 3ASIA 5A6QA 5DABA 2GN7A 1REEA 3QH6A 4NRPA 5FZAA 2EA7A 3WOGA 5FBZA 3ZSEA 3KV6A 5CBLA 2P3JA 1O3SA 2WAAA 4FOVA 4JGZC 1UU4A 3U78A 1O3QA 2HWE2 5KXBA 5EP9A 3U1XA 4MGKE 1PVC2 3H1WA 3HQRA 1H8TC 4L97A 5IVEA 1IZ3A 1GNZA 2C4XA 2P6CA 4IETA 4JQRA 3I2GA 3N7MA 1FXZA 4Q8LA 4BLJA 5IT6A 1B35A 2IXLA 5LWBA 4D6SA 5KHKA 3THDA 1GYKA 2BQPA 1IG0A 2W46A 2XMLA 3TEWA 5A3UA 3PUIA 1YCIA 3WF3A 2BBAA 1WA6X 3SISA 1FX5A 4Z2AA 4DEQA 1L7LA 5IHRA 3GCWA 4META 4O9EA 3BKZA 1QXJA 1W0NA 4ONUA 4Q4X2 5FZGA 4PI2A 3H3LA 2R16A 3Q8FA 3KV9A 1RVF3 1PZ8A 4GALA 3I3QA 4BA6A 4DRRA 3UJQA 4Q8KA 1VBE1 2ILMA 2NMOA 1NY72 2CWMA 5E89A 4CDUC 5JLVA 4OZOA 5LA2A 4P5HA 3HQUA 2JDKA 5BNQA 4YZ5A 1F4AA 1MS9A 1XQNA 2ZS6B 4UI9L 3WUCA 2VD7A 1B09A 4UF0B 4INDA 4YSFA 4JRAA 4NE9A 4QHZA 3RVHA 1NKGA 2WO1A 5FP8A 1VMJA 4N53C 1RUOA 3VBOB 2ZHKA 4QT6A 1AR63 1UU5A 3WF1A 3AKQA 2VCBA 3VD9A 3MIBA 1QY4A 2P5BA 1AR72 5EIYB 2CWSA 1EV13 1QJX1 1W8NA 2MHFA 2PQQA 3NKGA 3RMYA 5L7OC 2B45X 4E8DA 4CU9A 5KXEA 4LJHA 3WV6A 2VMFA 1RHI1 4GQ7A 4M3CE 5LA9A 1B35C 4RS5A 1XXNA 1D7PM 4UYBA 4HOOA 2FCVA 1W6NA 1NCQA 3K3NA 2DFCA 3VBHB 4QKNA 5F7UA 5F8PA 4BOWA 1VBE3 3VDAA 2J1SA 2ZA9A 4NJ4A 2W1QA 3VD3A 1R092 1TG7A 4I0AA 1DLCA 3SCHA 4PLNA 1K5MA 3KV4A 1GOFA 5JPNB 1LAJA 4RFRB 1CAVB 4CDQB 4CCDA 4XUNA 5E16A 1PIV1 3FJSA 4LQRA 4YG0A 4DEVA 5CZKA 3LWCA 3EBRA 3BTYA 4QQ2A 4XUOA 2YFUA 5FXZA 5CFDA 2IXHA 1MACA 4L0PA 3ACGA 4QXKA 2ZXQA 4KWLA 3OD4A 5GLUA 1JZ5A 2VXJA 1G7YA 2PQSA 2YXSA 2QFEA 2WO2A 5A33B 1F2NA 4AVVA 5A1LA 3WUDA 2WT0A 2MEV3 2GNMA 4JHTA 1J3RA 2IXCA 3CJIA 4FI9A 2NPIA 2VE1A 3WP6A 2IVJA 1VRH1 3ELNA 3GNEA 4AEDC 3MI8A 4CCJA 5DAPA 2BRTA 5JUVA 3H9AA 4CCMA 1JHNA 1K42A 2Y33A 1DZRA 3R05A 4G4FA 2VZTA 3FZ3A 2P17A 1E5IA 1PZ7A 3FHAA 4AQ2A 1S2EA 3LD8A 4N7IA 4YW5A 5LATA 3PVEA 3S7IA 5L7OB 3NJYA 2BYVE 4OYUA 1MZ6A 2AR6A 4LHSA 3N7KA 3SNMA 1XE7A 1UNBA 2ZGOA 1V0AA 4AGGA 5BNNC 1G9AA 1AYN2 1AJKA 3PURA 5B4NA 4K1YA 4COYA 3V65A 2XVGA 4OMCA 1ACCA 2RR13 4TWTA 5IK7A 3OD0A 3OCPA 5M0TA 1YI7A 4FPFA 1VBC3 4UBGA 5JMOA 2UY8A 4Q4Y1 3POJA 5JOYA 3AXDA 2GAUA 3FFZA 4LT5A 4O7XA 2GC0A 4UXAA 3R6SA 4WM7C 4AF9A 4Y22A 2E33A 3FBYA 5DZGA 2FQPA 3VDDC 2V5DA 1ZM1A 1ODMA 1DBNA 2YUEA 1UIKA 4O9GA 3ZXDA 5FY7A 3WNNA 3VHOA 1NQDA 4PQ9A 1R091 5IFTA 1PHMA 2LW8A 4GXLA 4OHZA 4N43B 4XEZA 2MEV1 1UYXA 3AKSA 5FPXA 1AX2A 2AEYA 4QGLA 1T2XA 4UBHA 5FWJA 4FFFA 2CDOA 1QQP3 4K8RB 3MF6A 3ZFGB 4ASMB 3V0BA 2RM22 3WLUA 4XJWA 3D8CA 1G86A 1XNKA 1LTEA 1HRV1 4E27A 5EJZB 2VOVA 3CF6E 1D0HA 3IIAA 3KCCA 2V73A 3IPVB 3WX5A 4B8EA 3VBUC 5C5UA 1JZ6A 5GALA 4NWWA 3WF0A 3LEMA 4FO9A 3K51A 2AEZA 2GC1A 1ENXA 4X6QB 4LBNA 2P4EA 4KG8A 1WCDJ 1LOFA 2XVLA 4UFMA 2ERFA 2RHPA 1DYKA 1KD7A 5HCBA 3B02A 1QOTA 2OZ6A 4BISA 2HWF3 2ZGMA 2DU1A 2G1MA 1ZZ9A 3JBG3 1EP0A 2FZ2A 3WDVA 4FOQA 1XBFA 4LTAA 2VNRA 4ZKTB 4RQPC 1IKQA 5C33A 1RXFA 1R093 4GWIA 5DG1A 1REDA 1PNFA 2I2SA 2VZPA 3VHPA 2RR11 4EN9B 5FPBA 4EN8B 1MS3A 3C8XA 2FDIA 4MH0E 2C5DA 5FIXA 2EIEA 5FQ0B 1F15A 1OUSA 5GLWA 4AFBA 3FLTA 3PIJA 5F32A 2GMEA 5C8CB 2H0VA 3MYXA 5EYXA 4N9HA 4CDXC 1GUIA 1UO9A 3HT2A 3I2HA 1YIPA 4AL9A 1Z7S3 4C0HA 1JZ4A 2WS92 2GNTA 2ZJCA 5E6HA 1QDOA 3AP5A 5SV8A 2Y8KA 4RS5B 4CSWA 1UWWA 1RIRA 1LU2A 2ZMLA 4YGCA 2Y6JA 4AVCA 4ARXA 3OGRA 3JQWA 1CONA 3KHCA 1PK6B 4XJ8A 4JZRA 4LKSA 3O1TA 1AR62 1U5IA 3VBSC 3QBQA 5J09A 2A5ZA 4Q4W1 3HT1A 1RITA 2Z4FA 3N36A 4JVAA 2ZGUA 3VBFB 4EN0A 3RZKA 2E7QA 1I9RA 5C3SA 1PGL2 4LBQA 4CP1A 1C28A 1G9BA 4LR4A 1VBB3 1QQP2 3P3PA 4IUGA 4ZPIA 2HWC1 2BGOA 3D6EA 2WYFA 4BJ0A 1CX4A 4HL0A 5C70A 4FTEA 4NIGA 3K46A 4LHNA 4M01A 5A7QA 1S0IA 4P9WA 3AVSA 2K46A 3B9IA 5FPVA 1VBA1 1SFPA 3D5OA 4MUVA 2OKXA 5LBCA 4EQVA 5JOZA 2WT1A 1TVGA 3J7MA 2DCKA 3EYPA 4RHV1 1W3XA 1GBGA 3MUZ1 1R1A2 5JZGC 1OQEA 1PO23 2ZEXA 4HSJA 3WQBA 1F9KA 1Q8SA 2WLPA 4Y4RA 3RYRA 1CZVA 1LOFC 5JR7B 3T1MA 3HMYA 4L11A 2D3SA 2P37A 5CKNA 4J1XA 1UYZA 2XHKA 1O8PA 3E1F1 2NQYA 3WSOA 1JXNA 1CAUA 3LOBA 1HRI3 3NV2A 3O5SA 3L2HA 5T55A 1A78A 1G9CA 1PVC3 1QH6A 1W2AX 2HBTA 4OI2A 1OOPB 2WJSA 3H7YA 1AYN3 3CO2A 3I2FA 4XVHA 4MO3M 1GP6A 3KT7A 4A44A 1OD3A 3KVAA 4BPZA 1W9TA 3WZ1A 5LW9A 3NKTA 3ZVXA 2YDEA 4HVRA 2Y60A 4R4XA 1PMJX 1Q8VA 3EQEA 2VNOA 1O8SA 1UY1A 4QXCA 1O4YA 4QXBA 4Q4W2 4NMIA 1EAH1 1WW4A 4P9JA 1JN2P 2GNBA 4XFIA 1AR61 4H7LA 5LB6A 1AYM1 4XCBA 4LA2A 1HXS2 2UYAA 5A3NA 5JCTA 3O0VA 4MXWB 3HD8B 4QHBA 3CMGA 2R1BA 1F5FA 2QCSB 1BZWA 3MHZA 1UPIA 1OFNA 4XZUG 1NCQC 1RUC1 3BIWE 3JUUA 4MX3A 2B9VA 5FZEA 1US2A 3KM5A 2R7EB 1H9PA 2JKXA 3BOWA 3NAPA 5T5PA 1R1ZA 4NRQA 3MDPA 4DY5A 3I2DA 4IEWA 4GAZA 1GR3A 2BU9A 4KL1A 4RGKA 2X53S 5L9BA 4ZHNA 2Z69A 4TZDA 5BNNA 2OS2A 1JZ3A 4TN7A 4LIVA 2LS6A 3AK0A 4AI1A 1RUG3 4FPLA 1CPNA 2DURA 3A23A 5BPXA 1PO22 3UKNA 2VXRA 1UZYA 3V0AA 4E4HA 4Q5OA 5ERLA 1ULPA 2XBO2 5I91A 3MPBA 4D6QA 3PUQA 2WQ8A 2WZEA 1AYM2 2ZKLA 4P08A 4BE3A 4ES8A 1OLME 1XE0A 4FOWA 2ETEA 4EN6B 3THTA 3KCYA 2GZWA 2MNGA 2EF6A 3LOIA 4V2WA 1S2KA 2DDUA 1QJU2 3OBTA 3ZR5A 2C0ZA 2W87A 1A3KA 1DZTA 3JD72 4JGYB 3OTFA 5IATA 5JVVA 4KWUA 4B1MA 5ISLA 3GBWA 4YM0A 4HMZA 4QU2A 1DU3D 3LPGA 1WGPA 4GJZA 5F3GA 1D2SA 2A3WA 2Z42A 3AYEA 2A6XA 2WZ8A 3IBMA 3UKVA 2D5HA 3WHTA 2TEPA 4WZCA 1BLZA 4GB31 3NAPC 4L8QA 3THCA 3UL2A 1ONAA 5F37A 1NCRC 1SLLA 1NCQB 1ZZ6A 1XE8A 2RS31 3MIDA 3DN7A 5FZ3A 1SCSA 4QB1A 1GQHA 1ZA7A 4K40A 4NAMA 4RQPA 4QQPA 3DXTA 4DQAA 2WINB 2WFF2 5FMOS 3ZPOA 3CZUA 3UGGA 2FMDA 2ATFA 1C57A 1GWLA 3AP9A 1EUTA 2D6NA 2WFPA 3C7GA 1OXCA 4GKYA 2QQVA 4NHYA 4DRVA 4LKEA 4NR1A 4K21A 4UFJA 5FKBA 3NNMA 3T0BA 1NCRB 1FYUA 3WXPA 4F83A 4M00A 5FMBA 3T1LA 1ZBA2 3K75B 3WP3A 4GD4A 3I3EA 3JBG2 2XL7A 4UFHA 2JDZA 4Y33A 2DU0A 3RWKX 1BVVA 4CXXA 2DVDA 4XMIA 4Z07A 4O61A 4HONA 3AFKA 4IE7A 1WLDA 5LRSA 3V0AB 1FMD1 2HWF2 5D2AA 3N7JA 3ZSMA 2XOMA 4XFHA 2R0HA 2O8OA 3O12A 5F5QA 4OVEA 2R6QA 5T5OA 3J9SA 1JZ8A 5FMCA 2WLQA 1T6GC 3KCXA 4IEOA 4YVSC 4GH4C 5DN2A 2VG9A 4LBLA 2VL4A 3MW2A 3ZSKA 4CCKA 3KHBA 5DDJ2 1YJLA 4XXPA 4NIAA 3MW3A 1MZEA 2G9ZA 5IK5A 3AFGA 5FYTA 1K5MB 4IV1A 4JGZB 2VQAA 3BOPA 1HRV3 2VUJA 3MIHA 2VZSA 2VMIA 4W6YA 1SEFA 1UMIA 1VBB1 3T08A 5AFBA 2WNVB 1WW7A 3MO4A 2WRAA 2XBO3 5DDJ3 5FYUA 1H1MA 4QD2A 2VZOA 4XTPA 3H3ZA 4AG4A 2E63A 4HPKA 4XDPA 1L7RA 4CUBA 1R64A 2WS91 3H1MA 5ANNA 5A6XA 1WMFA 4QDRA 4XJAA 3A4UA 3NWKA 4C1WA 2ZGNA 1DQ2A 2G9GA 5FK8A 1VBD2 3VHRA 4LUMA 4NWVA 4PIZA 1G9FA 2WWUA 1MS4A 1IOAA 1VBC2 4R8HA 4RFT0 5FY0A 4YYOA 5LY2A 2WT2A 1BBT2 3RRDA 3X29B 1KXGA 3T2PA 4QPGC 1O7FA 1LESA 3VN4A 1ND3A 2R072 2ZHMA 4D8MA 3NVCA 3KQRA 1NOVA 4B4PA 4NVPA 4YVSA 1HXS3 2BNNA 3S6PA 2E6VA 4XPVA 3JQXA 2VMGA 1H2NA 4Q0UA 5CKQA 3GGLA 1OHFA 1VBA2 3NNJA 3BB6A 3KT1A 3GF6A 4HT1T 2PLV2 3ZXGA 2DCYA 4HXCA 1W28A 2OIIA 5F6LB 3U10A 4CCCA 5CEHA 3OBRA 1LRHA 2FDGA 2RMU1 2WN3A 3ZYBA 2B8MA 5C71A 2BVVA 3RS6A 2MEV2 4Y22B 2CU5A 1ZREA 5FZFA 4GWMA 1IPSA 1PO21 1W2NA 5JSOA 4KG0A 5KXCA 4N9IA 1QIQA 2XJRA 1QDCA 4QX1A 2AUYA 2D43A 4EZ4A 3H8XA 1NLRA 1US3A 2RDQA 5I8SA 3I7DA 4KGQA 4E4DX 5DZFA 1KJLA 5FXVA 3PJQA 4AEMA 1ZVFA 3B01A 2XJTA 2NLRA 1HB3A 3T4VA 2XGXA 2CSGA 4LXLA 2OZJA 4HFSA 2JG9C 2QQUA 5C9AC 4I01A 2VOKA 2RDRA 4LO8A 3BI3A 3ZYFA 4ZU7A 1S0FA 3SH4A 4MGZE 3VKNA 3ZFFC 3P3NA 3HQXA 1R082 2JDHA 4XUTA 5F3EA 3ZIXA 3AB0A 4GMP3 3EO6A 2IVIB 5FZBA 3WHUA 4CP0A 3I49A 4Y3OA 4H14A 2VMCA 1YFXA 3USUA 4PLMA 3PDQA 3N35A 3PTYA 4MSVA 2BP6A 4LORA 1UYYA 1AJOA 1RUG2 2WNEA 2ZCWA 3BN6A 3WY6A 1PZ9A 3S7EA 4AWDA 4YGBA 3RGBA 2QZ3A 2Q1FA 1VJ2A 5GZEA 2BERA 3EMRA 4OUSA 5FZOA 1YJKA 3OGGA 1V9U1 3HN1A 4XF0A 1NA1A 2JDYA 1Z7S1 2QE3A 4LBJA 1W39A 1A6CA 4Q1RA 3DYOA 3AP6A 1LULA 5ABJC 2W9XA 5FUNA 3ZYGA 1WD3A 2R061 3B3QE 1OUXA 3USSA 4CEWB 2XHNA 3ZDSA 2GSYA 4QAWA 3S5QA 1BEV2 5FLHA 5A32B 3ZYPA 3NJXA 1UKGA 3WQ0A 3PUAA 2YG0A 1H8TB 1DLLA 1Y9GA 4QGNA 1PK6C 1C5HA 1IG3A 1W3VA 2R49A 2WS93 3KF3A 4HANA 3POIA 4XMAA 3PMSA 4QXHA 2X09A 1M06G 4NHMA 3PLQA 1ZRDA 3I3MA 4BYYA 3CEWA 1NAEA 2VY0A 2VR4A 4FPJA 3OBAA 5DUVA 3ILNA 1GWKA 3DYMA 4BDVB 2YZ4A 2ZX0A 1UAIA 4NPMA 5JI7A 4D0QA 2KR2A 1HV1A 2WNVC 4ZZ5A 4DXTA 2ARCA 3LIGA 4OHYA 5C5TA 2XWJB 2BV4A 3ZN6B 1N3QA 3N9QA 4PDWB 4XFBA 2VOTA 4CDWC 3AYDA 3WG1A 4MGQA 4DB5A 4DOUA 4YW2A 2BUKA 4FQZA 2DV9A 4HKLA 4AEDB 4D7SA 2PLV1 3GYDA 2VCCA 4FCAA 4G3YC 2W39A 3EB7A 4FPEA 1BK0A 1V6KA 4MXWA 4GH4B 3A21A 3ABZA 4IV3C 2AC1A 1H2MA 5HCFA 2O1QA 3LA2A 3PVNA 3MV11 2J22A 5F2SA 1O3TA 4AHWA 1RHI2 1U5XA 1U12A 3T0DA 1CAWA 5GZDA 2BDRA 5TSWA 4PBOA 1TQ5A 4K7JA 1HV0A 1UIJA 2YMZA 4AI2A 4HG6B 3H8RA 1HB2A 4H2AA 4I0WB 3AP4A 5CG9A 4AI8A 3RYKA 4IEVA 2BFUS 4W50A 1ND2C 2V09A 5EJ3A 1QHDA 2IFRA 4F7ZA 3T4HB 4YVSB 1GZCA 2TNFA 3I4IA 4XZPA 5FKCA 4CEWA 5LZ6A 1X82A 3INAA 4AI9A 2IUWA 2BOIA 4EV0A 3U4XA 1C8M2 2JD9A 4Q4Y2 1B35B 2VGDA 2XJVA 2WWSA 3UGHA 4YFZA 1ASJ3 2ZMKA 5LEJA 1SACA 2R073 1V6LA 3ACLA 3QOPA 5IVBA 4P02B 4ZY9A 5HCHA 4I30A 4COZA 4XAEA 2DF7A 3PVBB 5FYHA 3ETQA 1UMZA 3I2KA 2RDNA 1WCQA 3JBG1 1J3PA 3TYJA 3ZPYA 4H3WA 1JI6A 2Q0AA 2CGNA 3KGZA 5DDJ1 2QQKA 2VECA 2XKOA 2FDKA 2E9QA 4XFGA 2O0OA 4Y20A 4ZXKA 1LNSA 5A3OA 2WL1A 1DQ0A 1HJGA 2PHLA 3POEA 3UKTA 4XIKA 5KXDA 3ZFFB 3KF5A 1QJFA 2BGCA 4BLIA 4AE2A 2VZUA 4Y5SA 4Y26A 2JDAA 1RMU1 2PHDA 5JIUA 1E57A 1UQXA 4CU7A 5D1IA 3ZXJA 3TEZA 2WFF3 1GKBA 3A0KA 4WVZA 3VBOA 3WD5A 1AR83 2JB4A 3K4AA 3VBHA 3AP7A 1C1FA 1O59A 1PK6A 3OSDA 5EPAA 5CFCB 4IV1C 3OPZA 5FZHA 1S55A 4PIYA 4K9SA 4JGYC 1JZ7A 4P5YA 4B3NA 5IVFA 4BU2A 2Y6KA 2WFF1 5SV5A 1S0JA 3IZOA 4PDWC 4A41A 1YQ8A 4C90A 2TBVA 3ZXFA 1DP0A 5J3UA 2OX0A 4XETA 2RMU3 5CKMA 1GNYA 2R1DA 3ILRA 1JHJA 4YW6A 1RUI2 2AENA 4W8JA 1F5JA 3POFA 1GP4A 1NY71 4AAPA 4BQ3A 3NJVA 5GJ6A 1W6MA 4RR3A 1SLAA 4CE8A 1OA2A 1O91A 1VBE2 2J1RA 2DTWA 2VCAA 2X8KA 2ZX2A 2BEOA 1D4M2 2Q8EA 3WDXA 3O1SA 4AHXA 2L9LA 4ZS2A 2YU2A 2HKXA 3I3BA 4KI5M 5I0TA 5AC93 4QPGB 1BMV2 3WCRA 1N1VA 2VZRA 3VZNA 5A3WA 4CEYB 3PMEA 3T2TA 3TB0A 4GA9A 5FZLA 5AVAA 4UT5A 1Y3TA 4C91A 1YUDA 1JYXA 5ABJA 3URFA 4Y1VA 2YHJA 3LKJA 5GM0A 1QJY1 4XIOA 1UY4A 4IV3B 4FAHA 2UU8A 2OUJA 2VNVA 3I59B 3ZFEA 5L36A 1J58A 2WO7A 4PDWA 5A7SA 3O0XA 4Q4X1 5FCCA 1W2TA 1QMJA 1TE1B 4XQ4A 1WMEA 1XC6A 5J48A 3IWZA 2PHRA 1ZYBA 4N53B 1PMHX 4KGGA 2BPA2 3NW4A 4JTOA 3U11A 5L7OA 3J8F3 3B00A 5CIRA 4JKLA 1J83A 1W6PA 1GNHA 3B93A 1FOD3 5FZOB 3T2OA 2FHRA 2FCUA 4OZXA 4YVWB 1TNRA 1V6MA 3VHNA 5GLVA 3T2QA 5CADA 2OUHA 4LE3A 4XJZA 4XOGA 4CU8A 2XJQA 5C9AA 1GZTA 4FP2A 3BUCA 3HNYM 4GIQA 1COV3 1UX7A 3E6CC 2D44A 2ES3A 4NAOA 4NPLA 5ANQA 5G05L 1SHWB 3GXUA 1W9WA 3OF1A 2EIDA 3R0RA 3RZZA 4J1WA 4BCUA 3SITA 4A7KA 4RGAA 2RDSA 2W1SA 2E7TA 4URAA 5FPLA 4EWEA 2EXKA 2XH6A 1CD3G 1RL3A 4FPGA 2WO3A 2ZZQA 1ND2B 4XHXA 1PNGA 4QM9A 5C4WA 1OKOA 4ZXEA 1W03A 4AHZA 3KVBA 1F35A 3WW3A 4FXKB 5ACA2 1NZCA 2R071 5G04L 4XAAA 4D94A 5J96B 3O1RA 3RNSA 1PGSA 1I6XA 3JCIA 4JDNA 1NE4A 4OMDA 2O14A 4B1LA 4BK4A 2PXJA 1AX1A 1FNYA 2C6SA 5H9RA 4QPIA 4B4RA 2PYTA 3BTAA 5T54A 5J1XA 4FXGB 4Z82A 3ZLIA 2K9ZA 2QQNA 3GZTB 3ILFA 4YGDA 4D7TA 5CISA 1NA1B 3NV4A 1HN0A 1YXWA 3FUQA 4N7UA 4XXAA 3SMHA 3WP4A 1ULDA 2PMWB 5J98B 1MEC3 1WW5A 1CZTA 2XR4A 1X7NA 2RJLA 2DUPA 5DG2A 3LA7A 4M4PA 1D4VB 1KRIA 1URXA 5C3OA 4AGVA 2YBPA 2JG8C 3M3IA 4Y20B 1GQPA 2BVBA 2ZGKA 1BJQA 5IVJA 2ORZA 1GU3A 5IVYA 4IEYA 3U37A 1LKNA 3AMHA 4A2UA 2OW4A 1COV1 1YI9A 2GNDA 2ZHLA 2JD4A 3DL3A 4RR3C 4XF3A 1ULGA 1ALYA 1XYNA 2XB6C 5T52A 1WBLA 1V6OA 3LA3A 2PAEA 4K20A 5GZFA 4P9YA 4TLFA 4COWA 3EXUA 1JYIA 2QQWA 1QF3A 3OJBA 3OUJA 1TMF3 3N3HA 3OG2A 5JAXA 3HR9A 2CAVA 4XE9A 5FZKA 4D6RA 2DTYA 1AL21 4UW5A 4LOTA 1GANA 1AR73 1RUJ1 2WA3A 1L7QA 1GZ9A 3H7JA 4IV1B 1YFUA 1N1YA 2ZGSA 5E8AA 1H1AA 5FYBA 3TAYA 2AACA 2FDJA 2PHUA 3B94A 2XJSA 3ME2A 3VZLA 5LY1A 2N7GA 1Q3EA 4DUXA 4CP9B 1ODNA 1UMHA 5IFPA 2GMMA 3M3QA 4BIOA 1SCRA 1KJRA 2EIGA 2OXBA 2Y6FA 3O7OA 1QJY3 3ZFEC 5HV0A 1LHNA 2QQJA 1EUUA 3FX3A 4HPKB 4YZ4A 4E8CA 1ASJ1 1HQLA 2QQMA 5IUQA 3WVJA 4CVUA 1JYNA 5I0UA 1H6XA 1I3HA 2B5HA 1POQA 2VTXJ 2VW0A 5CYYA 1UZVA 3DYPA 3WEZA 3W5NA 4X8NA 2RM23 4XUQA 1RVF2 4YW4A 3QD6A 3W20A 5K4LA 4L2NA 5BNOC 3AVRA 5LK7B 2B39A 1IGOA 3WP5A 1V6NA 1WLWA 2HWC2 5BNPA 5AC91 4GB32 1RUD1 1YYNA 2GP3A 4E9KA 4BK5A 4XURA 5FOJB 3H3UA 4KNCA 2X10A 5IVCA 4EE2A 3MV01 4M4RA 3DF0A 2XLAA 3I2IA 1LODA 2K0GA 3RZJA 5F2WA 3WG4A 5CAZA 3ZO0B 2DBNA 5H9SA 1H2KA 4L9BA 4I2OA 2DUOA 3NNFA 4XQWA 1IQDC 1W9FA 4I3PA 5FTTC 1AXYA 4QQLA 2ET1A 1XPWA 2XJPA 1QOSA 3OGVA 3N9PA 2A70A 1QJEA 2JDUA 3IT8A 1RGSA 3RJ2X 2YC2A 1OBNA 5GZCA 2UYBA 4E2GA 1LU1A 2XL9A 1JU4A 2WSUA 1YO8A 2HLEA 3SEEA 3BGAA 4AGRA 1H30A 1W0PA 1N1SA 1XSQA 2PHWA 2WQ4A 4P14A 2XQRA 2E32A 3VBFA 4DIQA 4TXWA 3FL7A 1K5JA 2HWC3 3WDWA 4S2HA 4DXZA 1OF3A 2R042 1MEC1 5C3RA 3VBSB 2BFUL 5FYYA 1BHGA 3AL5A 1RUI1 1X8MA 3VL8A 1SBFA 1VLNA 4I09A 2QKDA 4ASLA 1AZDA 3HAGA 5H9QA 4LK6A 3DEMA 4DUVA 4I3GA 1RHI3 5FXWA 3ZR6A 4FBFA 1IPJA 4CZSA 2WKKA 4RL7A 4YVWA 4N43C 1IHMA 5FZCA 1PX3A 1WZXA 4ET7A 3CJXA 5FFOC 4ASKA 1GOGA 1JYVA 4KWKA 4AVAA 4AEJA 5KHIA 4CDXB 4HKWA 1K12A 1W8ZA 4XF9A 2X5IA 2YC4A 2YBSA 2P1BA 5C8CC 1TZOA 3C7HA 5J7MA 1FI2A 2WZR3 4GULA 1SPPA 4MLOA 3LDBA 1JBCA 1Z0HA 2GH8A 1C8NA 3VD5A 1TMF2 2PELA 4LNVA 1AR71 1RUJ3 4GKXA 1POV1 1ZBE2 1RMU2 1U5ZA 3RWNA 4D3WA 4QB2A 5DUUA 3ZXEA 3SLIA 5F3IA 1ZRRA 4JAAA 1YHFA 3VKOA 1OQ1A 2DVAA 3AYAA 1RUH3 1BBT1 3FC0A 4F8AA 1JUIA 1UZ0A 5LA1A 4CEWC 1SBDA 1W8WA 4QX2A 1QWRA 1N3PA 1VB4A 1JZ2A 2XBO1 5I0DA 1JYWA 4TTGA 3K2OA 4QPGA 2BWAA 4LLFA 1O4ZA 4FSJA 3OYWB 3H42B 2VUDA 1WD4A 2D40A 4LKFA 4Q29A 4DS0A 2OVUA 1UN1A 4OI0A 5KHHA 2F6BA 2VZVA 1LOEA 1YRZA 2P3YA 4D7YA 3ES4A 2QQPA 1GOHA 1LGBA 4NPRA 4XUPA 5K0UC 1RB8G 5JZGB 2VPVA 4DXSA 2OQ6A 1W8OA 5JDBA 3MPPG 3TRSB 1UD1A 3VZOA 2ADEA 3ZFEB 2D3RA 4NHLA 5FP3A 2C1FA 4FP3A 1QOOA 1W8HA 5JI9A 2QDRA 4R4ZA 1MQTB 1NQJA 1RUC3 4M3CB 3VLBB 3WDUA 4BQ5A 1W06A 4MHRA 3KB5A 1RUG1 3CKHA 3OYWA 5FAXA 3TN91 4QGMA 3PHMA 1H4HA 1J1LA 3HOBA 3GDBA 2ZBJA 2CGOA 1YFYA 1EAH3 2CHHA 1U5YA 3CJIB 4JQTA 3SH3A 3ST7A 2EIBA 2ZTNA 4COUA 3S0MA 2X5IC 4MZUA 2R063 1OOPA 4CYDA 2VMEA 1S4CA 3G7DA 1XU2A 4I02A 5IYYA 2HYXA 3LQCA 4WM8A 2XUEA 3SHRA 3BCWA 4E4SA 3U75A 3ETPA 3CLPA 1W6MB 4RR3B 3PU8A 3QLQA 2VULA 3VKLA 1AUYA 2PHTA 1AL0G 3H1YA 4Q0VA 3GZUC 1OD5A 1ZBA1 2W3JA 4R9DA 3TOJA 5FQ0A 3VZMA 4FOYA 1O4TA 1UY2A 3NSTA 1DQ5A 2FBEA 2P34A 2A6ZA 5FLIA 2ZPXA 2KM2A 5HV4A 4ZONA 4CDXA 5ACA1 2G4IA 4EYUA 4CCNA 2JE9A 2NP0A 3POSA 4QDQA 3VBOC 4D69A 4C8DA 5I0SA 4A3ZA 1OT5A 5I0RA 1NA1C 3NV1A 2EXHA 4HVOA 4FAGA 1PVC1 1ZBE1 1DQ6A 4LBOA 4PF5A 2JJ6A 3WINE 4OUEA 3GHNA 4A7YA 2OPWA 3Q8CA 2Y0OA 1FOD1 1K3IA 3AZYA 4NO4A 3MLLA 3VUOA 2DCJA 4RS5C 1ENSA 2A3YA 1MQTA 3ZXAC 2Y38A 3J8F1 4N8MA 2FCTA 3MFAA 5I93A 1BVP1 4R9CA 1RTVA 1HQNA 1T6BX 4DMIA 3ALQA 3AXEA 1CZSA 2HWD1 1JW6A 2YB7A 2F4PA 4DY3A 2J1VA 1HJFA 1BKZA 2ORXA 4UW4A 2SLIA 3WNOA 2HBUA 2WSVA 3WNKA 3CU7A 2Z79A 3E5XA 1HB4A 1JTZX 1WUVA 4XF4A 1R1A3 3LF7A 4AQ6A 4QX5A 3WG2A 2D3PA 5ABJB 2EICA 5A6ZA 1UXXX 5FPAA 3GBGA 1F4HA 1ZNPA 2Y64A 3WNMA 3UT0A 2ARAA 3TNPB 1CVNA 5CFCC 1OPMA 1X8EA 1VAMA 3PVOA 2WNUC 1A8DA 1EYBA 1WMXA 1KGYA 2DFBA 2ZEZA 5FO9B 5FO8B 2IWGB 3MUY1 5FYIA 2MPFA 3DPRA 4UOJA 4CUCA 1HKDA 2RS11 3BYWA 4LITA 4YFWA 5LBFA 2BJSA 1DFQA 4URTA 2OYZA 3SXWA 4QDSA 1IS4A 2OA2A 2Y26A 3DV8A 3IAQA 1AXZA 4WM7B 4ATEA 4L92A 1JOPA
chains in the Genus database with same CATH topology
2E31A 4OMCA 2VZQA 4KMQA 2WAOA 5JMOA 4P02B 4ZY9A 3I2KA 1WCQA 2E33A 2YFZA 5B4XA 1JI6A 2V5DA 5JR2A 2QQKA 3DECA 5IJRA 3D3AA 3NRUA 3WNNA 1LNSA 3IB3A 5IFTA 2LW8A 2VZUA 1ULOA 1UYXA 2JDAA 2ID4A 1T2XA 2CDOA 2Y6LA 3I97A 4CU7A 5JXIA 2W1UA 4PQQA 2W95A 3K4AA 5EJZB 1O59A 3HNMA 2J1UA 5JXHA 3PUHA 2VZ3A 2W91A 4LPLA 1JZ6A 3LEKA 3WF0A 3P1IA 2XONA 1JZ7A 4MGSA 4P5YA 3UNPA 5DPNA 3ACFA 2Y6KA 2VQTA 4A41A 1NX9A 1DP0A 5JXGA 1GNYA 1JHJA 3VD7A 3VD4A 4W8JA 4RN5A 4GWIA 3FN9A 2Y6HA 3NJVA 2J1RA 2VZPA 4JKKA 3C7FA 2VCAA 3C8XA 2EIEA 3A22A 3OEBA 2L9LA 2W1WA 3I3BA 5FUIA 4KI5M 2WDBA 1GUIA 3I2HA 1PX4A 2VZRA 1JZ4A 2J1TA 2Y8KA 1UWWA 5LCWL 1GMMA 2Y6JA 4ARXA 3OGRA 3LPFA 3P6BA 3OGSA 1JYXA 1JU3A 4LKSA 4A6OA 3VDCA 4PT6A 1UY4A 2Z4FA 1UY3A 5A1AA 4GWJA 4JKMA 1XC6A 3HJRA 1PMHX 3OEAA 4IUGA 2BGOA 3CZJA 4BJ0A 5C70A 3K46A 2BZDA 4JKLA 3LEGA 1J83A 3T2OA 2OKXA 1TVGA 3T2QA 2DCKA 2VZ1A 3SKVA 3EYPA 4CU8A 3MUZ1 2ZEXA 3WQBA 2WYSA 4RYDA 3HNYM 1UX7A 1CZVA 2WBKA 3AC0A 5DQ0A 5G05L 2RJ2A 1SHWB 3GXUA 1UYZA 1W9WA 3C7EA 3GM8A 2EIDA 1O8PA 3E1F1 3WSOA 2WABA 4BXSV 1SDDB 4P00B 2W1SA 2E26A 3I2FA 4XVHA 2WO3A 4MO3M 3NQHA 4XUQA 5HXMA 3WF2A 4A44A 1OD3A 1W9TA 3CDZB 2J7MA 5G04L 3J7HA 1PMJX 1O8SA 1UY1A 2J1AA 4OMDA 4MOAA 4BK4A 2WN2A 3HPNA 3WNLA 3F2ZA 4QPWA 5J1XA 3CMGA 1J84A 2QQNA 4XZUG 2B9VA 1US2A 2R7EB 2J1EA 2JKXA 3UETA 2VC9A 1CZTA 2B4KA 4M4PA 4CU6A 2W92A 1JZ3A 2VJXA 1GQPA 2LS6A 4MADA 3A23A 2ORZA 1GU3A 3U37A 1ULPA 4ZXEA 3CIHA 2WQ8A 2WZEA 4P08A 1CX1A 3IAPA 1CIYA 1W9SA 2DDUA 3CQOA 3OG2A 4YPJA 2W87A 4KWUA 4QB6A 1L7QA 4ARYA 2ZEYA 3LEIA 3LPGA 2WUHA 2XQXA 3I3DA 2WZ8A 4DUXA 1UMHA 5IFPA 2VM9A 3K77A 3THCA 3HEIA 3LE0A 2QQJA 1EUUA 3ECQA 3MBWA 4E8CA 1JYNA 2QQMA 4CVUA 4QB1A 1H6XA 2QQIA 3WEZA 5CYYA 3HN3A 3DYPA 3W5NA 3CZUA 3C7GA 1EUTA 2VO5A 2C9KA 3WF4A 1SG3A 2C26A 2VTFA 2W94A 3T0BA 4BK5A 4XURA 3K75B 2X10A 3I3EA 3MV01 4M4RA 3I2IA 2QQOA 3ZM8A 4PF1A 1NUKA 2XOMA 2VMDA 1IQDC 5C7GA 2CDPA 1XPWA 1K45A 1JZ8A 3OGVA 5EJ1B 4W4ZA 2YC2A 5DN2A 2VL4A 3HNBM 1JU4A 2HLEA 2BGPA 3BGAA 3SEEA 3W5MA 4GZ9A 2E32A 4TXWA 3FL7A 2X05A 2VZSA 1OF3A 4A4AA 1UMIA 3T08A 3MO4A 4DXRA 5HPOA 3SKJE 1BHGA 2VZOA 1XNTA 4UAPA 4AG4A 5LA0A 4DUVA 5JXJA 1L7RA 4CUBA 1R64A 4QDRA 1UY0A 1PX3A 4ET7A 4A42A 1P8JA 1HN1A 1GOGA 1JYVA 3T2PA 3IIIA 1K12A 2YC4A 3A7QA 1OF4A 3C7OA 3C7HA 4D8MA 2Y6GA 3T09A 1DYOA 4CUAA 2W5FA 3VD5A 3ACHA 1WKYA 3GGLA 3I2JA 3NNGA 4QB2A 2V72A 3K4ZA 3OB8A 2WN3A 1UZ0A 4QX3A 5C71A 5LA1A 4QX2A 1JZ2A 2WAAA 5I0DA 1JYWA 4TTGA 1UXZA 4A45A 2C4XA 4QX1A 3I2GA 1US3A 2VZVA 1GOHA 2W47A 4XUPA 3THDA 4DXSA 2W46A 1W8OA 3PUIA 3WF3A 2BBAA 4Z2AA 4DEQA 3JXSA 5IHRA 4XUTA 3K4DA 3CKHA 1W0NA 2VMCA 3HOBA 1UYYA 4AAXA 3GDBA 2RVAA 1I5PA 3BN6A 1YQ2A 2EIBA 5DMYA 4OZOA 5LA2A 2BERA 2VMEA 5IYYA 1F4AA 4UI9L 2HYXA 3LQCA 1KEXA 1NKGA 2WO1A 1W99A 3ETPA 3DYOA 3VDBA 1OH4A 2QBXA 2W9XA 3WF1A 2VCBA 3VD9A 2W3JA 5EIYB 2XHNA 1W8NA 4QAWA 1UY2A 3NJXA 4E8DA 4CU9A 2YG0A 3ACIA 2VMFA 3T0AA 4QDQA 2X09A 4A3ZA 1D7PM 1OT5A 1NAEA 2VR4A 3FHQA 3OBAA 2ZEWA 3DYMA 1MPXA 4BDVB 5F7UA 4D0QA 4ZZ5A 3VDAA 4OUEA 4DXTA 2J1SA 3VD3A 2W1QA 1TG7A 1DLCA 1K3IA 1GOFA 1RYYA 2VOTA 4XUNA 2DCJA 4LQRA 4MGQA 4DEVA 5CZKA 3IDAA 2YFUA 4XUOA 2VCCA 4DUWA 1CZSA 4L0PA 3ACGA 3EB7A 2ZXQA 1JZ5A 2KD7A 2PQSA 2YB7A 3A21A 2WO2A 3ABZA 1H6YA 2J1VA 3WNPA 2ORXA 2JE8A 3WNOA 3WNKA 4JX0A 2V4VA 4FI9A 3MV11 2J22A 4ZZ8A 3UESA 3SEPA 2RV9A 2EICA 3T0DA 1UXXX 1F4HA 2Y64A 3WNMA 5JUVA 4HG6B 1K42A 4QX0A 2VZTA 4W50A 3FHAA 1XNAA 2ZEZA 1KGYA 2QQLA 3MUY1 2VQUA 4UOJA 4OYUA 4CUCA 4LHSA 4QDSA 5B4NA 2JD9A 4JHZA 3IAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E31 A;  4OMC A;  2VZQ A;  4KMQ A;  2WAO A;  5JMO A;  4P02 B;  4ZY9 A;  3I2K A;  1WCQ A;  2E33 A;  2YFZ A;  5B4X A;  1JI6 A;  2V5D A;  5JR2 A;  2QQK A;  3DEC A;  5IJR A;  3D3A A;  3NRU A;  3WNN A;  1LNS A;  3IB3 A;  5IFT A;  2LW8 A;  2VZU A;  1ULO A;  1UYX A;  2JDA A;  2ID4 A;  1T2X A;  2CDO A;  2Y6L A;  3I97 A;  4CU7 A;  5JXI A;  2W1U A;  4PQQ A;  2W95 A;  3K4A A;  5EJZ B;  1O59 A;  3HNM A;  2J1U A;  5JXH A;  3PUH A;  2VZ3 A;  2W91 A;  4LPL A;  1JZ6 A;  3LEK A;  3WF0 A;  3P1I A;  2XON A;  1JZ7 A;  4MGS A;  4P5Y A;  3UNP A;  5DPN A;  3ACF A;  2Y6K A;  2VQT A;  4A41 A;  1NX9 A;  1DP0 A;  5JXG A;  1GNY A;  1JHJ A;  3VD7 A;  3VD4 A;  4W8J A;  4RN5 A;  4GWI A;  3FN9 A;  2Y6H A;  3NJV A;  2J1R A;  2VZP A;  4JKK A;  3C7F A;  2VCA A;  3C8X A;  2EIE A;  3A22 A;  3OEB A;  2L9L A;  2W1W A;  3I3B A;  5FUI A;  4KI5 M;  2WDB A;  1GUI A;  3I2H A;  1PX4 A;  2VZR A;  1JZ4 A;  2J1T A;  2Y8K A;  1UWW A;  5LCW L;  1GMM A;  2Y6J A;  4ARX A;  3OGR A;  3LPF A;  3P6B A;  3OGS A;  1JYX A;  1JU3 A;  4LKS A;  4A6O A;  3VDC A;  4PT6 A;  1UY4 A;  2Z4F A;  1UY3 A;  5A1A A;  4GWJ A;  4JKM A;  1XC6 A;  3HJR A;  1PMH X;  3OEA A;  4IUG A;  2BGO A;  3CZJ A;  4BJ0 A;  5C70 A;  3K46 A;  2BZD A;  4JKL A;  3LEG A;  1J83 A;  3T2O A;  2OKX A;  1TVG A;  3T2Q A;  2DCK A;  2VZ1 A;  3SKV A;  3EYP A;  4CU8 A;  3MUZ 1;  2ZEX A;  3WQB A;  2WYS A;  4RYD A;  3HNY M;  1UX7 A;  1CZV A;  2WBK A;  3AC0 A;  5DQ0 A;  5G05 L;  2RJ2 A;  1SHW B;  3GXU A;  1UYZ A;  1W9W A;  3C7E A;  3GM8 A;  2EID A;  1O8P A;  3E1F 1;  3WSO A;  2WAB A;  4BXS V;  1SDD B;  4P00 B;  2W1S A;  2E26 A;  3I2F A;  4XVH A;  2WO3 A;  4MO3 M;  3NQH A;  4XUQ A;  5HXM A;  3WF2 A;  4A44 A;  1OD3 A;  1W9T A;  3CDZ B;  2J7M A;  5G04 L;  3J7H A;  1PMJ X;  1O8S A;  1UY1 A;  2J1A A;  4OMD A;  4MOA A;  4BK4 A;  2WN2 A;  3HPN A;  3WNL A;  3F2Z A;  4QPW A;  5J1X A;  3CMG A;  1J84 A;  2QQN A;  4XZU G;  2B9V A;  1US2 A;  2R7E B;  2J1E A;  2JKX A;  3UET A;  2VC9 A;  1CZT A;  2B4K A;  4M4P A;  4CU6 A;  2W92 A;  1JZ3 A;  2VJX A;  1GQP A;  2LS6 A;  4MAD A;  3A23 A;  2ORZ A;  1GU3 A;  3U37 A;  1ULP A;  4ZXE A;  3CIH A;  2WQ8 A;  2WZE A;  4P08 A;  1CX1 A;  3IAP A;  1CIY A;  1W9S A;  2DDU A;  3CQO A;  3OG2 A;  4YPJ A;  2W87 A;  4KWU A;  4QB6 A;  1L7Q A;  4ARY A;  2ZEY A;  3LEI A;  3LPG A;  2WUH A;  2XQX A;  3I3D A;  2WZ8 A;  4DUX A;  1UMH A;  5IFP A;  2VM9 A;  3K77 A;  3THC A;  3HEI A;  3LE0 A;  2QQJ A;  1EUU A;  3ECQ A;  3MBW A;  4E8C A;  1JYN A;  2QQM A;  4CVU A;  4QB1 A;  1H6X A;  2QQI A;  3WEZ A;  5CYY A;  3HN3 A;  3DYP A;  3W5N A;  3CZU A;  3C7G A;  1EUT A;  2VO5 A;  2C9K A;  3WF4 A;  1SG3 A;  2C26 A;  2VTF A;  2W94 A;  3T0B A;  4BK5 A;  4XUR A;  3K75 B;  2X10 A;  3I3E A;  3MV0 1;  4M4R A;  3I2I A;  2QQO A;  3ZM8 A;  4PF1 A;  1NUK A;  2XOM A;  2VMD A;  1IQD C;  5C7G A;  2CDP A;  1XPW A;  1K45 A;  1JZ8 A;  3OGV A;  5EJ1 B;  4W4Z A;  2YC2 A;  5DN2 A;  2VL4 A;  3HNB M;  1JU4 A;  2HLE A;  2BGP A;  3BGA A;  3SEE A;  3W5M A;  4GZ9 A;  2E32 A;  4TXW A;  3FL7 A;  2X05 A;  2VZS A;  1OF3 A;  4A4A A;  1UMI A;  3T08 A;  3MO4 A;  4DXR A;  5HPO A;  3SKJ E;  1BHG A;  2VZO A;  1XNT A;  4UAP A;  4AG4 A;  5LA0 A;  4DUV A;  5JXJ A;  1L7R A;  4CUB A;  1R64 A;  4QDR A;  1UY0 A;  1PX3 A;  4ET7 A;  4A42 A;  1P8J A;  1HN1 A;  1GOG A;  1JYV A;  3T2P A;  3III A;  1K12 A;  2YC4 A;  3A7Q A;  1OF4 A;  3C7O A;  3C7H A;  4D8M A;  2Y6G A;  3T09 A;  1DYO A;  4CUA A;  2W5F A;  3VD5 A;  3ACH A;  1WKY A;  3GGL A;  3I2J A;  3NNG A;  4QB2 A;  2V72 A;  3K4Z A;  3OB8 A;  2WN3 A;  1UZ0 A;  4QX3 A;  5C71 A;  5LA1 A;  4QX2 A;  1JZ2 A;  2WAA A;  5I0D A;  1JYW A;  4TTG A;  1UXZ A;  4A45 A;  2C4X A;  4QX1 A;  3I2G A;  1US3 A;  2VZV A;  1GOH A;  2W47 A;  4XUP A;  3THD A;  4DXS A;  2W46 A;  1W8O A;  3PUI A;  3WF3 A;  2BBA A;  4Z2A A;  4DEQ A;  3JXS A;  5IHR A;  4XUT A;  3K4D A;  3CKH A;  1W0N A;  2VMC A;  3HOB A;  1UYY A;  4AAX A;  3GDB A;  2RVA A;  1I5P A;  3BN6 A;  1YQ2 A;  2EIB A;  5DMY A;  4OZO A;  5LA2 A;  2BER A;  2VME A;  5IYY A;  1F4A A;  4UI9 L;  2HYX A;  3LQC A;  1KEX A;  1NKG A;  2WO1 A;  1W99 A;  3ETP A;  3DYO A;  3VDB A;  1OH4 A;  2QBX A;  2W9X A;  3WF1 A;  2VCB A;  3VD9 A;  2W3J A;  5EIY B;  2XHN A;  1W8N A;  4QAW A;  1UY2 A;  3NJX A;  4E8D A;  4CU9 A;  2YG0 A;  3ACI A;  2VMF A;  3T0A A;  4QDQ A;  2X09 A;  4A3Z A;  1D7P M;  1OT5 A;  1NAE A;  2VR4 A;  3FHQ A;  3OBA A;  2ZEW A;  3DYM A;  1MPX A;  4BDV B;  5F7U A;  4D0Q A;  4ZZ5 A;  3VDA A;  4OUE A;  4DXT A;  2J1S A;  3VD3 A;  2W1Q A;  1TG7 A;  1DLC A;  1K3I A;  1GOF A;  1RYY A;  2VOT A;  4XUN A;  2DCJ A;  4LQR A;  4MGQ A;  4DEV A;  5CZK A;  3IDA A;  2YFU A;  4XUO A;  2VCC A;  4DUW A;  1CZS A;  4L0P A;  3ACG A;  3EB7 A;  2ZXQ A;  1JZ5 A;  2KD7 A;  2PQS A;  2YB7 A;  3A21 A;  2WO2 A;  3ABZ A;  1H6Y A;  2J1V A;  3WNP A;  2ORX A;  2JE8 A;  3WNO A;  3WNK A;  4JX0 A;  2V4V A;  4FI9 A;  3MV1 1;  2J22 A;  4ZZ8 A;  3UES A;  3SEP A;  2RV9 A;  2EIC A;  3T0D A;  1UXX X;  1F4H A;  2Y64 A;  3WNM A;  5JUV A;  4HG6 B;  1K42 A;  4QX0 A;  2VZT A;  4W50 A;  3FHA A;  1XNA A;  2ZEZ A;  1KGY A;  2QQL A;  3MUY 1;  2VQU A;  4UOJ A;  4OYU A;  4CUC A;  4LHS A;  4QDS A;  5B4N A;  2JD9 A;  4JHZ A;  3IAQ A; 
#chains in the Genus database with same CATH topology
 1LHW A;  2VZQ A;  1QXR A;  2RMU 2;  2ZGT A;  4KMQ A;  5BNO B;  2ZAA A;  3WQ1 A;  4BQ1 A;  2EAA A;  5C9A B;  3RZM A;  4ES9 A;  3VV1 A;  2XLF A;  2XPJ A;  2X5I B;  5C4W B;  2HWF 1;  1LR5 A;  3JZV A;  3LB9 A;  3BPZ A;  3Q8E A;  4QU1 A;  5CNA A;  2D6P A;  3DEC A;  3BOD A;  3ZDV A;  3D3A A;  4FFI A;  1UOG A;  4WZF A;  5F6K A;  1DGR N;  5FRA A;  4CEY A;  4DZG A;  1H8T A;  1Q8P A;  3ZSJ A;  4EWD A;  5IK4 A;  5FZ4 A;  5A32 A;  2B9U A;  2ENR A;  1SLB A;  1ULO A;  4XW3 A;  1KS4 A;  3MIF A;  4WM7 A;  3VDD B;  1VIW B;  5JPM B;  1FMD 2;  1LGC A;  1SLC A;  2Y6L A;  3AMP A;  3I97 A;  4LUK A;  5FY5 A;  5BNP B;  3TEY A;  4BQW A;  1OKQ A;  1VE0 A;  1CGP A;  3DCQ A;  3RI8 A;  2IXI A;  4XDQ A;  5FP7 A;  5CB7 A;  3WW1 A;  3HNM A;  5F5C A;  2J1U A;  5JXH A;  5FZ0 A;  5FYZ A;  5IK8 A;  1RXG A;  2VZ3 A;  2W91 A;  3AZZ A;  2HH9 A;  4LPL A;  3P1I A;  3DPR C;  2VNG A;  4IW3 A;  3UYJ A;  4MGS A;  2I07 B;  1O6U A;  1UOF A;  2GMP A;  4HN0 A;  3ACF A;  3AMN A;  3GCX A;  3S30 A;  3CL1 A;  3H8U A;  1VB2 A;  2B46 X;  2QJV A;  2VBD A;  4N53 A;  4CDQ C;  1QKQ A;  1NX9 A;  3BU7 A;  4WVM A;  2WWJ A;  1AR9 2;  3LCP A;  2D6M A;  5JXG A;  3MEP A;  3JD7 1;  2QTW B;  1X9T A;  1VAL A;  3VD4 A;  4Q4Y 3;  4RN5 A;  4ZU4 A;  1BK1 A;  1N47 A;  2V4A A;  3FN9 A;  2Y6H A;  1Q56 A;  1ZRF A;  1JOD A;  2P2K A;  5LEK A;  2PHX A;  2UUR A;  3C7F A;  3U4S A;  4AHY A;  4CDW B;  1QJX 3;  1EPZ A;  3A22 A;  3OUI A;  4JV4 A;  5FR3 A;  3OOX A;  2RS3 3;  3N7L A;  3IM0 A;  3T3Y A;  4BQX A;  4LUL A;  4S2G A;  1A34 A;  1E5H A;  1XJA A;  3QCW A;  1PMI A;  1DG6 A;  5HI0 A;  5JWP A;  4CRQ A;  5DAV A;  3R4S A;  4K6B A;  4RSU A;  3SCF A;  3USU B;  1VPH A;  2J1T A;  1CQ9 A;  4WM8 C;  3ZYH A;  3IN9 A;  4JRL A;  1JH5 A;  1RUD 2;  5JSP A;  3P6B A;  1WBF A;  4XYX A;  2CGP A;  1VRH 3;  3VDC A;  4LKD A;  4PT6 A;  1RVF 1;  1GLH A;  1PO1 1;  3L9J T;  1D4M 1;  4HZF A;  1UY3 A;  1W0O A;  2A1X A;  1XYP A;  4AR2 A;  4CDQ A;  5D8A C;  2QZ2 A;  3M1H A;  4JKM A;  1W6O A;  1NLQ A;  1FV2 A;  3VBR A;  4B29 A;  1W8U A;  2EAL A;  3HJR A;  2HWB 3;  4KQ7 A;  3OEA A;  2D93 A;  2I74 A;  1RJ8 A;  2FMY A;  2ZHN A;  5JOW A;  1M4W A;  1EAH 2;  1WW6 A;  2RJK A;  4LLO A;  3UJO A;  2D7F A;  1W6N B;  3B5L B;  3AKT A;  2VCM A;  1XB9 A;  3LEG A;  4BXF A;  1YFW A;  3ZN4 A;  3OBZ A;  4KWJ A;  3PNA A;  1OI6 A;  1RUE 1;  4QQH A;  4XCA A;  2VZ1 A;  3SKV A;  4BZ4 A;  4CTE A;  5FXX A;  5K9Y A;  2WYS A;  4IL7 A;  4RYD A;  4UW3 A;  5L9V A;  4Z92 B;  1C5I A;  3DKQ A;  3RZG A;  1FAY A;  1O3R A;  4AI0 A;  4UFK A;  3AC0 A;  5I8T A;  1ZRC A;  2RJ2 A;  5BV6 A;  1XNB A;  1NLS A;  5FP4 A;  3W58 A;  3C7E A;  2ARB A;  3GM8 A;  4NID A;  2VVD A;  4GH4 A;  3LDR A;  1CAV A;  4PJY A;  3WW4 A;  1FPN 1;  3J7N A;  4BXS V;  4FTB A;  1POV 0;  2YY1 A;  3POB A;  2EVX A;  2JDP A;  4UFL A;  4AED A;  5HBA A;  2E7A A;  5APA A;  2E26 A;  4CA9 A;  1QJU 3;  2GAL A;  1TME 1;  3IMN A;  1OC1 A;  1UX6 A;  3PUS A;  5HXM A;  1REF A;  2AH2 A;  3NL1 A;  3TBD A;  3WF2 A;  1QGL A;  2WZR 1;  1UYP A;  4FPO B;  1OA3 A;  1CAX B;  2YC0 A;  3RQ0 A;  5ACA 3;  1NG0 A;  3N9N A;  1OPO A;  4Q4V 3;  2DVB A;  5BUV A;  5DAW A;  5D8A A;  4DPN A;  1IS5 A;  1DHK B;  1XU1 A;  3VBF C;  1W8F A;  2IFW A;  3IPV A;  3OPT A;  3B69 A;  4O65 A;  5KWR A;  2D98 A;  4CDW A;  4MOA A;  1OLQ A;  2WN2 A;  2Y0I A;  4M0N A;  1VBB 2;  3WNL A;  3F2Z A;  5DXD A;  3GJB A;  3ZIW A;  3MLK A;  4FT8 A;  2YRO A;  4W65 A;  4QPI C;  3TN9 3;  3VDD A;  2UWC A;  4DO0 A;  1ND2 A;  1QH7 A;  4BQY A;  1DGW X;  2ARX A;  1KDK A;  2Q8D A;  5C3P A;  2LM3 A;  1V9U 2;  4R9B A;  3J4U H;  1AYN 1;  5GLZ A;  5AFE A;  2J1E A;  3KZ4 C;  4GMP 0;  3P5B A;  1A8M A;  2B4K A;  1XYO A;  4JC1 A;  4XIL A;  1MS1 A;  1SMV A;  4YVW C;  4B4Q A;  3M3C A;  1COV 2;  4Y5T A;  4WV8 A;  3VBR C;  4CU6 A;  1WCK A;  4BIF A;  4MGI E;  1G8W A;  4ITC A;  3RYP A;  5K0U A;  1NZI A;  4J25 A;  4NIH A;  3WDY A;  1RIN A;  3V56 A;  3H0O A;  5FYM A;  4A3X A;  1C4R A;  1KDM A;  2LTN A;  4JTN A;  4LHK A;  1UOB A;  4Y1Z A;  2VMH A;  1CX1 A;  1MS0 A;  4CPB D;  2PLV 3;  3MFC A;  3KT4 A;  4OQ8 A;  4IES A;  2HWB 2;  5A33 A;  2JG8 B;  1RMU 3;  3IAP A;  2PAM A;  1DIW A;  1PO1 3;  2DUQ A;  4LOS A;  2WNO A;  4CUG A;  3ZN6 A;  1YIF A;  2WZR 2;  4AFM A;  1LGN A;  1W6Q B;  4LBM A;  4YZ1 A;  3GZA A;  4ARY A;  3RFR A;  2JDN A;  3VBU B;  1GP5 A;  2ZEY A;  1TME 2;  3KGL A;  4ISR A;  1RUD 3;  1U0A A;  3KD4 A;  2XQX A;  1CN1 A;  4XTM A;  2HYK A;  1BBT 3;  1EPW A;  1V70 A;  1UCX A;  3K77 A;  2QNK A;  1MVQ A;  3MIG A;  3HEI A;  3DXU A;  4AFA A;  5F3C A;  1FPN 2;  3LE0 A;  4OI4 A;  3MBW A;  3NNL A;  4FPC A;  3E97 A;  4ERO A;  1ZA4 A;  5FZ9 A;  3HN3 A;  3RG0 A;  3LFM A;  2GH2 A;  2CV6 A;  5K0U B;  1I5Z A;  3MW4 A;  4OHV A;  1UZW A;  2C9K A;  3PU3 A;  2Q30 A;  2R04 3;  1SG3 A;  2RS5 1;  2C26 A;  1ULE A;  1W6O B;  1RC6 A;  3ORJ A;  1QEX A;  5FZD A;  1X36 A;  2NN8 A;  4KH9 A;  1H9W A;  1IQA A;  1ENQ A;  3MLJ A;  5FYV A;  3VKF C;  4EN7 B;  4EWA A;  4LEJ A;  2C9A A;  5D21 A;  2A6Y A;  5DZE A;  1AHS A;  1SFY A;  4BQ4 A;  3BTZ A;  1HRI 1;  1QJZ A;  3MIE A;  4H7M A;  1FPN 3;  4MXV A;  1VRB A;  1XOY A;  2JB8 A;  5F5I A;  2JG9 B;  2D97 A;  4YAR A;  2QQO A;  2GDF A;  3ZM8 A;  4PF1 A;  1NUK A;  2RG4 A;  2ZGP A;  2WZP P;  5C7G A;  1APN A;  5LBB A;  5C3Q A;  1S0B A;  2JEN A;  2A6W A;  2WQZ C;  2YBK A;  5FY9 A;  4WVV A;  4IER A;  2HWD 3;  5EJ1 B;  4BWO A;  4Q2F A;  4Z2W A;  2JKB A;  5GKA C;  2I45 A;  4QWN A;  1ND3 C;  2EXJ A;  4AFC A;  5IAX A;  3HNB M;  4B7K A;  4Y1Y A;  5FY8 A;  4YNI A;  1ZZ7 A;  1FMD 3;  2BGP A;  3ZMN A;  1VMF A;  1PO1 2;  1OFS A;  2EXI A;  2ZMN A;  3NO8 A;  4Q0Q A;  3W5M A;  4HK9 A;  4FFG A;  2P3K A;  1Q5O A;  2VVE A;  3GJA A;  4XBN A;  1S0E A;  4A4A A;  2JIG A;  4YM1 A;  1J1T A;  1VR3 A;  3N9M A;  4LO7 A;  4DIN B;  1DYP A;  4DXR A;  3B7M A;  5FV3 A;  1DGW A;  3ZKU A;  2D5F A;  4I0B A;  4WVM B;  1GQG A;  4NOT A;  2UWB A;  5FMO L;  1X33 A;  2Q5T A;  3POG A;  4QKF A;  1XNT A;  4UAP A;  4HBN A;  2XDV A;  4HVQ A;  4CCL A;  4IQP A;  2PTM A;  2HWD 2;  4FQ4 A;  1S1A A;  1LHO A;  1W90 A;  4P9L A;  1WA4 A;  5LAS A;  2GP5 A;  3Q9O A;  5FWE A;  1BMV 1;  2GU9 A;  2RM2 1;  1UY0 A;  3POW A;  4RQP B;  5CFD C;  1LJ7 A;  1UKR A;  3FUO A;  4A42 A;  1PM4 A;  1HQW A;  3SC7 X;  5K8S A;  1NT0 A;  4LK7 A;  3III A;  4LO6 B;  3NV3 A;  3A7Q A;  1ENR A;  3EHK A;  3AMQ A;  3FBM A;  3UK9 A;  3W9A A;  4XBQ A;  4A6S A;  2Y6G A;  1W05 A;  4S2F A;  2W2I A;  2A7A A;  4GWN A;  4WM8 B;  4QPY A;  5IAV A;  1DYO A;  1MS8 A;  4CUA A;  3S57 A;  4NHX A;  2D6L X;  3ZYI B;  1C3H A;  1WKY A;  1GFF 2;  3GAL A;  2YV8 A;  1LOB A;  3NNG A;  5FZM A;  2HEW F;  4Q4V 2;  4HET A;  3FWE A;  1R1A 1;  3ZFG C;  1TMF 1;  4DNY A;  3K4Z A;  1DGL A;  2ZX4 A;  3HVD A;  3OB8 A;  2X29 A;  1DCS A;  2IXJ A;  4QX3 A;  3KV5 A;  1K5M C;  2IXK A;  3QAC A;  3THP A;  2NMN A;  1AVB A;  4G9S B;  4QM8 A;  4MVT A;  2NM1 A;  1JS9 A;  3ZYJ B;  4K3U A;  3WT3 A;  2WNU A;  1UXZ A;  1WLC A;  3M70 A;  3RPQ A;  2VBP A;  2WC2 A;  4PBP A;  5DUW A;  4A45 A;  2FZ1 A;  1HX6 A;  3BPS A;  2VAU A;  2JX9 A;  3OY8 B;  3TWI A;  4AK3 A;  1H4G A;  1PIV 3;  5I8Y A;  3MIC A;  1PGL 1;  5FZI A;  3ATG A;  3CNA A;  4IE6 A;  4EZH A;  2W47 A;  2E53 A;  3KS7 A;  5A7W A;  4CDU A;  4IGQ A;  2W0X A;  1H8V A;  1HW5 A;  3HBK A;  4JGY A;  2OPK A;  3PJY A;  1S0D A;  4AXO A;  1I1E A;  3JXS A;  3A0N A;  2H6C A;  3K4D A;  4IEX A;  1DF0 A;  4Q4W 3;  1D2Q A;  2ADD A;  2IC1 A;  1SFN A;  1V6J A;  4XJ9 A;  4R9A A;  4AW7 A;  5FZ6 A;  1UF2 C;  4AAX A;  2RVA A;  1WCU A;  4AEK A;  1OMI A;  1I5P A;  1QNW A;  3NMB A;  4NUB A;  1YQ2 A;  1HIX A;  4AVT A;  5DMY A;  4N90 A;  3VZK A;  3FLP A;  4UFI A;  1W2U A;  4XQD A;  2VUC A;  5C6C A;  3ZOI A;  1NE6 A;  1SBE A;  2F4L A;  2RS1 2;  2BWC A;  1NCR A;  3V0B B;  2PN5 A;  3IKW A;  4OUL A;  1KEX A;  1QNY A;  3ZN5 A;  1W99 A;  3ZYR A;  4CEY C;  5A3L A;  1OH4 A;  1V6I A;  2QBX A;  1Y9Q A;  3U0Z A;  1V9U 3;  1SLT A;  1TME 3;  3AKR A;  3NAP B;  2JE7 A;  5EFU A;  2B42 B;  3J26 N;  2K2S A;  1SQ4 A;  3LFI A;  2CL2 A;  1HLC A;  4IV3 A;  1EV1 1;  1KIT A;  4AVB A;  1OLM A;  1CWP A;  4LBK A;  2KXL A;  1GZW A;  2XG3 A;  2ZGL A;  5T5J A;  3TEX A;  4C0B A;  4Q4V 1;  2RS1 3;  1ULF A;  4LE4 A;  3ACI A;  4YLZ A;  5C8W A;  3T0A A;  4YM3 A;  4QKD A;  4FPY A;  4IEZ A;  5AC9 2;  1AX0 A;  4OHW A;  5DAQ A;  2OT7 A;  2Q1M A;  2PHF A;  2GC3 A;  3FHQ A;  3VZJ A;  2RS3 2;  3RZH A;  1FOD 2;  1YWK A;  2ZEW A;  1ZZC A;  4NHK A;  1W04 A;  3ZXK A;  1MPX A;  1AL2 3;  5T50 A;  3POY A;  4LMF A;  4RHV 3;  3AM2 A;  4IEQ A;  4KU8 A;  2YYO A;  3J8F 2;  1X9P A;  2PFW A;  4AQT A;  3K48 A;  4ZS3 A;  5FDB A;  3H50 A;  1RYY A;  2XXZ A;  4A7Z A;  1AR9 3;  2H6B A;  1EV1 2;  4CCE A;  4HN1 A;  1E5R A;  1Y9M A;  3GBF A;  4N43 A;  3IDA A;  4JGZ A;  1WCS A;  1MEC 2;  5A80 A;  4DUW A;  4QMA A;  1ND3 B;  4LBQ B;  1CPM A;  1JYT A;  3M3O A;  2KD7 A;  2NYY A;  4U2A A;  1BXH A;  1H6Y A;  1RUE 3;  3WNP A;  4OHX A;  5FPU A;  1IS3 A;  1WWY A;  2JE8 A;  3LSD A;  4JX0 A;  1O5U A;  2V4V A;  3LDK A;  3ES1 A;  3N4M A;  1XRU A;  4LIU A;  2EAK A;  3UES A;  1CJP A;  3SEP A;  4ZZ8 A;  1LEN A;  4Y5Z 0;  3AYC A;  2RV9 A;  1Y7B A;  3PL0 A;  4FTS A;  5HXV A;  1ST8 A;  1AR8 2;  1YQC A;  3E5Q A;  1Z7S 2;  3RSJ A;  4Y1U A;  5BNO A;  3RZL A;  1BEV 1;  1YC6 1;  2HWB 1;  3FHI B;  2H0B A;  4P9G A;  4QX0 A;  5CG8 A;  1LOC A;  5A3P A;  4Q4X 3;  2UWA A;  5IVV A;  1RUF 2;  1XNA A;  3IDC B;  5FZ8 A;  2QQL A;  1D4M 3;  3KMH A;  1VP6 A;  1WMD A;  2DYC A;  2VQU A;  2WNV A;  1IPK A;  3JU9 A;  1O5L A;  1NXD 1;  2XWB B;  3O0W A;  4RD7 A;  2J42 A;  3QH7 A;  1OVS A;  5FRE A;  4AZZ A;  3LIH A;  5C4W C;  3ZX7 A;  1ZZ8 A;  4JHZ A;  3L2Y A;  5F39 A;  4FFH A;  3C2U A;  2SBA A;  2A73 B;  2E31 A;  1DZQ A;  3ZFF A;  3O1M A;  3AZV A;  4BM8 A;  5FY4 A;  3UV9 A;  1SZB A;  2WAO A;  1HXS 1;  4BME A;  3IMM A;  1LED A;  2G9F A;  4YG3 A;  2YFZ A;  2YGL A;  3AZX A;  5B4X A;  5CVR A;  1BYH A;  5GLT A;  4M0H A;  2HWE 3;  1XSR A;  1UW8 A;  5JR2 A;  4W6X A;  1G9D A;  4QX8 A;  5IJR A;  1ASJ 2;  3M3E A;  1RUF 1;  3GHM A;  3NRU A;  2VUA A;  2CYF A;  2RS5 2;  4QQO A;  4YW1 A;  4X8P A;  1OUR A;  1LHV A;  3AMM A;  2FD8 A;  5A1F A;  1S0C A;  3IB3 A;  3N9O A;  1CR7 A;  5A70 A;  1H0B A;  5FY1 A;  3LSE A;  1LEM A;  2FDF A;  2R32 A;  5CFD B;  5LBE A;  3W59 A;  2QDN A;  1LCL A;  1PM7 A;  4GMP 1;  2ID4 A;  2BTV C;  3WDT A;  3FE5 A;  1F31 A;  3O14 A;  1S0G A;  4E4Z A;  3HIF A;  4NRM A;  3ZFG A;  5JXI A;  4AI3 A;  2F17 A;  2W68 A;  4L99 A;  2W1U A;  4PQQ A;  4SLI A;  4R52 A;  4Y24 A;  2W95 A;  4IXL A;  1KFX L;  3VB9 A;  5KR7 A;  4BHP A;  2B7Y A;  4TLG A;  2AGS A;  2WNU B;  3PUH A;  4DFS A;  1DDL A;  3LEK A;  3KLS A;  2XON A;  1STM A;  2JG9 A;  1ULC A;  3Q8B A;  3PIG A;  3R4D B;  5IWF A;  4AVS A;  5F9T A;  4V1P A;  5CA6 A;  3UNP A;  2LAL A;  2TUN A;  2CNA A;  4Q0P A;  4XBL A;  5DPN A;  5C8C A;  1J3Q A;  4XF1 A;  4CP9 A;  5J36 A;  2VQT A;  4UWD A;  2A75 A;  5JMC A;  3ITQ A;  5FBJ A;  5FZ1 A;  4OI1 A;  2E51 A;  1JYC A;  4IGO A;  3ZSL A;  2DVF A;  4YW7 A;  2ZAC A;  4XFC A;  3VGI A;  5KC6 A;  1MR5 A;  3VD7 A;  4OLL A;  2VU9 A;  2ZX1 A;  4IE0 A;  1L3J A;  2VQ0 A;  4M3C A;  3LZZ A;  1C8M 3;  4PCR A;  4AQS A;  4JCK A;  2XVK A;  3WCS A;  4E2S A;  3E6D A;  1GIC A;  1OLR A;  3B9C A;  4JKK A;  3OUH A;  1POV 3;  4F3J A;  3T30 A;  1YNA A;  4EJR A;  5BXX A;  3OEB A;  2V5Y A;  3M7A A;  2W1W A;  3I59 A;  3LGR A;  4JDM A;  3DKW A;  4WBB A;  5FUI A;  2BW8 A;  2WDB A;  4BQ2 A;  1R08 1;  1F8V A;  2R04 1;  2RS5 3;  2JIJ A;  1PX4 A;  3I8T A;  2WII B;  1Z78 A;  5A3M A;  1PGW 2;  2AYH A;  4XAB A;  1N1T A;  1W6P B;  3MF9 A;  4FVV A;  4SBV A;  5LK5 A;  2ZAB A;  4BH9 A;  4Z1V A;  2D6K A;  5LCW L;  1GMM A;  2P3I A;  1BEV 3;  3AZW A;  3W21 A;  3WW2 A;  1QJY 2;  1PGW 1;  3LPF A;  2VOW A;  2R0F A;  3OGS A;  2DBI A;  1JU3 A;  2VBB A;  5DAX A;  5FK7 A;  2FDH A;  3BTX A;  4A6O A;  1GSL A;  1C8M 1;  1X50 A;  2NZ9 A;  1Q8Q A;  2JIC A;  3EJK A;  3WNX A;  1LB2 A;  4COV A;  3ON7 A;  3DUI A;  3RJR A;  3JD7 3;  1GZW B;  4OCT A;  3MGU A;  5JOX A;  2AZ5 A;  4ORF A;  2CAU A;  3TN9 2;  5A1A A;  4YRD A;  4GWJ A;  4E2Q A;  4Q1P A;  1CAU B;  1JOB A;  4KBZ A;  1UL9 A;  3FMG A;  4XHB A;  3DPR B;  1UOJ A;  1GWM A;  5CU1 A;  5FUP A;  4JDO A;  1C1L A;  1W2O A;  2OQ7 A;  3CZJ A;  3G6J B;  3KSC A;  3OGJ A;  5F5A A;  5LRR A;  4RGG A;  1Q43 A;  2BZD A;  5FPZ A;  3BU0 A;  1IKP A;  1G6N A;  2Q1Z B;  1D0G A;  5EXO A;  2ZGQ A;  3E6B A;  4XJU A;  4V2V A;  1BCX A;  4AYU A;  3S5A A;  4MV2 A;  5FYC A;  5E88 A;  4HLT A;  3RI9 A;  4BB3 A;  1TNF A;  4WVW A;  4QHO A;  4HSL A;  1FV3 A;  2YGM A;  2DCZ A;  1V00 A;  1RUE 2;  2WBK A;  4Q0S A;  5DQ0 A;  5B2G B;  3D82 A;  4FPK A;  4Q27 A;  2Y34 A;  2IZW A;  2BOJ A;  1JUH A;  2ZKN A;  5IW0 A;  2WAB A;  1SDD B;  2XKP A;  1DQ1 A;  4P00 B;  2PAK A;  2WR9 A;  3O1V A;  1VBD 1;  2JXA A;  3R4U A;  2XLG A;  1JOJ A;  1NYW A;  2WA4 A;  5H9P A;  3O1O A;  3AJY A;  1UPS A;  2VTX A;  1GV9 A;  2P6H A;  2W08 A;  5FP9 A;  3NQH A;  4FPH A;  4TSV A;  4OUM A;  2D6O X;  4RHV 2;  1VMH A;  1RUH 2;  3AX4 A;  1AL2 2;  4HK8 A;  4XDO A;  4YGE A;  1BQP A;  1CAX A;  3WG3 A;  4QX7 A;  3CBN A;  3AKP A;  1AYM 3;  3CDZ B;  4GJY A;  2LRP A;  3UGF A;  3VL9 A;  5BYN A;  4K1Z A;  2J7M A;  1QJU 1;  3J7H A;  1JMU B;  5A6Y A;  5FO7 B;  5EHD A;  3BIE A;  4CCO A;  4J6G A;  5L9R A;  3IDB B;  1PVX A;  3FFQ A;  5FZ7 A;  3VKM A;  1LOA A;  1RUJ 2;  4HKO A;  2J1A A;  4MGT A;  2UY9 A;  3HPN A;  1YEW A;  2ARE A;  4QPW A;  2BNO A;  4YG6 A;  2JWP A;  4IGP A;  5J37 A;  4PHZ A;  1J84 A;  4XC9 A;  2DVG A;  1OA4 A;  2HJI A;  1WLT A;  4CP2 A;  5HCA A;  1E5S A;  1NXM A;  1SDW A;  2YPD A;  1Q8O A;  5FJK A;  3OY8 A;  4P9X A;  3UET A;  1VRH 2;  3Q8A A;  2VC9 A;  4X6R B;  1VBD 3;  1W8T A;  1IS6 A;  3ZMO A;  4PLO A;  2YPJ A;  2W92 A;  3U07 A;  3AJZ A;  2VW2 A;  3M8L A;  2RE9 A;  3SCG A;  1HB1 A;  2VJX A;  3F95 A;  1S2B A;  2HEY F;  4YM2 A;  5EYY A;  4C1X A;  3BVC A;  4MAD A;  5L73 A;  3TNQ A;  2A71 A;  1EY2 A;  4CXW A;  4Z8B A;  2LUW A;  1AR8 1;  3ENR A;  5GZG A;  2G19 A;  1VAV A;  5K7P A;  2ET7 A;  3CIH A;  2ZZJ A;  1OVP A;  2JEM A;  1TEI A;  1YLL A;  3FLR A;  3VBR B;  1UZZ A;  4NII A;  4AFD A;  1AR9 1;  1AXK A;  1RUC 2;  4IE4 A;  1RUH 1;  5EZW A;  1VBA 3;  4CDU B;  1CIY A;  1W9S A;  3CQO A;  4YPJ A;  2Z2S B;  4P9I A;  4IE5 A;  3ZKY A;  3ROU A;  4K8F A;  5FYS A;  5JZG A;  1FNZ A;  4QB6 A;  1HRI 2;  2ZX3 A;  4TYS A;  5JSR A;  1OSG A;  3KWV A;  1PIV 2;  3WQ7 A;  5A7O A;  2GC2 A;  2ZAH A;  3LEI A;  2HWE 1;  5L19 A;  1YQ6 A;  4XAC A;  2WUH A;  3I3D A;  2PA7 A;  1MVE A;  1KFU L;  4M3C F;  2QUO A;  2VM9 A;  2DCT A;  4OFG A;  2VW1 A;  5D8A B;  5EV7 A;  5KBF A;  5BNP C;  3JB8 A;  4MG2 A;  3DGT A;  5E1R A;  1AF9 A;  5EWS A;  3ECQ A;  2R06 2;  1ZRI A;  3K3O A;  5T3N A;  4CPB A;  2VH9 A;  1VAK A;  2QQI A;  2VOX A;  1MZF A;  1ZBA 3;  3SQO A;  4KBB A;  1KQR A;  5BY5 A;  5EQU A;  4LA3 A;  5A7P A;  4GB3 3;  2VO5 A;  3M2M A;  1QXP A;  3BAL A;  4MHU A;  1H2L A;  2R30 A;  3WF4 A;  1RJ7 A;  2XJU A;  4OQ9 A;  1OOP C;  1R08 3;  2VTF A;  2W94 A;  4IEU A;  1QJX 2;  4UF0 A;  1RUI 3;  5T5L A;  2LRO A;  2W52 A;  3CJI C;  5A7N A;  3CHX A;  3IDE A;  3OPW A;  1XND A;  3WR0 A;  1XNC A;  3D0S A;  2C24 A;  3I54 A;  4W6W A;  3RMX A;  3V64 A;  5FLJ A;  2CTV A;  4RA0 A;  3J7L A;  2XUM A;  3KQ4 B;  4UW6 A;  5DUX A;  4CXY A;  2VMD A;  1MQT C;  2ZGR A;  1FAT A;  4YZ2 A;  4MYE A;  2CDP A;  1OH3 A;  4ISQ A;  3MZH A;  1K45 A;  4Y4Y A;  1N3O A;  2ZOE B;  4XFF A;  3H8O A;  4W4Z A;  3D0J A;  1QQP 1;  4YZ3 A;  5KHJ A;  2BBV A;  1UU6 A;  3U14 A;  3HWJ A;  2VVF A;  1CJD A;  2JDM A;  2YU1 A;  1CIW A;  2CY6 A;  3N9L A;  1MS5 A;  5JIA A;  3I2O A;  4NRO A;  4GZ9 A;  4MGY E;  3VBU A;  4ZU5 A;  4Q26 A;  1LOG A;  2A6V A;  1ZBE 3;  4LO4 B;  3GZE A;  1OQD A;  4QPI B;  4Y1X A;  1SPP B;  2O8Q A;  2X05 A;  1RUF 3;  5FOB B;  1RUN A;  5A7W B;  3O1U A;  5HPO A;  4PIX A;  1ZX5 A;  1W9Y A;  3SKJ E;  2QVS B;  1HDK A;  3D4K A;  3AL6 A;  4U36 A;  5KC5 A;  5LA0 A;  5JXJ A;  2HEV F;  4QKB A;  2Q8C A;  3VBH C;  1DGR A;  3C3V A;  1CAW B;  1DQ4 A;  1MZ5 A;  4LHL A;  5A3T A;  5FJH A;  1P8J A;  4BMB A;  5BNN B;  1HN1 A;  2Q4S A;  4IEP A;  3VDB A;  5KHG A;  5CFC A;  4PI0 A;  1FT9 A;  3M4F A;  2RR1 2;  1W6Q A;  2GN3 A;  2JEC A;  4KU7 A;  3VBS A;  1OF4 A;  1Y43 B;  1YQ5 A;  3NJZ A;  3C7O A;  3APB A;  4H55 A;  1LHU A;  4IDZ A;  3JB4 C;  4YW3 A;  3T09 A;  4NN0 A;  5FMD A;  1VBC 1;  1ZZB A;  3HBZ A;  4B7E A;  1Y4W A;  1KS5 A;  3LAG A;  5AVP A;  2JG8 A;  2W5F A;  5F1R A;  3O1P A;  3ACH A;  3PTR B;  3RDI A;  3ZXL A;  1H1I A;  1LEC A;  1SLI A;  4LO5 B;  4XFA A;  3I2J A;  1HRV 2;  3E5U A;  2Z5W A;  3SH5 A;  1CES A;  2KA3 A;  1QU0 A;  2A3X A;  4YWA A;  2Q8O A;  4AOC A;  1J59 A;  2V72 A;  4LBQ D;  4S2D A;  2DWR A;  2BNM A;  4ATF A;  3ASI A;  5A6Q A;  5DAB A;  2GN7 A;  1REE A;  3QH6 A;  4NRP A;  5FZA A;  2EA7 A;  3WOG A;  5FBZ A;  3ZSE A;  3KV6 A;  5CBL A;  2P3J A;  1O3S A;  2WAA A;  4FOV A;  4JGZ C;  1UU4 A;  3U78 A;  1O3Q A;  2HWE 2;  5KXB A;  5EP9 A;  3U1X A;  4MGK E;  1PVC 2;  3H1W A;  3HQR A;  1H8T C;  4L97 A;  5IVE A;  1IZ3 A;  1GNZ A;  2C4X A;  2P6C A;  4IET A;  4JQR A;  3I2G A;  3N7M A;  1FXZ A;  4Q8L A;  4BLJ A;  5IT6 A;  1B35 A;  2IXL A;  5LWB A;  4D6S A;  5KHK A;  3THD A;  1GYK A;  2BQP A;  1IG0 A;  2W46 A;  2XML A;  3TEW A;  5A3U A;  3PUI A;  1YCI A;  3WF3 A;  2BBA A;  1WA6 X;  3SIS A;  1FX5 A;  4Z2A A;  4DEQ A;  1L7L A;  5IHR A;  3GCW A;  4MET A;  4O9E A;  3BKZ A;  1QXJ A;  1W0N A;  4ONU A;  4Q4X 2;  5FZG A;  4PI2 A;  3H3L A;  2R16 A;  3Q8F A;  3KV9 A;  1RVF 3;  1PZ8 A;  4GAL A;  3I3Q A;  4BA6 A;  4DRR A;  3UJQ A;  4Q8K A;  1VBE 1;  2ILM A;  2NMO A;  1NY7 2;  2CWM A;  5E89 A;  4CDU C;  5JLV A;  4OZO A;  5LA2 A;  4P5H A;  3HQU A;  2JDK A;  5BNQ A;  4YZ5 A;  1F4A A;  1MS9 A;  1XQN A;  2ZS6 B;  4UI9 L;  3WUC A;  2VD7 A;  1B09 A;  4UF0 B;  4IND A;  4YSF A;  4JRA A;  4NE9 A;  4QHZ A;  3RVH A;  1NKG A;  2WO1 A;  5FP8 A;  1VMJ A;  4N53 C;  1RUO A;  3VBO B;  2ZHK A;  4QT6 A;  1AR6 3;  1UU5 A;  3WF1 A;  3AKQ A;  2VCB A;  3VD9 A;  3MIB A;  1QY4 A;  2P5B A;  1AR7 2;  5EIY B;  2CWS A;  1EV1 3;  1QJX 1;  1W8N A;  2MHF A;  2PQQ A;  3NKG A;  3RMY A;  5L7O C;  2B45 X;  4E8D A;  4CU9 A;  5KXE A;  4LJH A;  3WV6 A;  2VMF A;  1RHI 1;  4GQ7 A;  4M3C E;  5LA9 A;  1B35 C;  4RS5 A;  1XXN A;  1D7P M;  4UYB A;  4HOO A;  2FCV A;  1W6N A;  1NCQ A;  3K3N A;  2DFC A;  3VBH B;  4QKN A;  5F7U A;  5F8P A;  4BOW A;  1VBE 3;  3VDA A;  2J1S A;  2ZA9 A;  4NJ4 A;  2W1Q A;  3VD3 A;  1R09 2;  1TG7 A;  4I0A A;  1DLC A;  3SCH A;  4PLN A;  1K5M A;  3KV4 A;  1GOF A;  5JPN B;  1LAJ A;  4RFR B;  1CAV B;  4CDQ B;  4CCD A;  4XUN A;  5E16 A;  1PIV 1;  3FJS A;  4LQR A;  4YG0 A;  4DEV A;  5CZK A;  3LWC A;  3EBR A;  3BTY A;  4QQ2 A;  4XUO A;  2YFU A;  5FXZ A;  5CFD A;  2IXH A;  1MAC A;  4L0P A;  3ACG A;  4QXK A;  2ZXQ A;  4KWL A;  3OD4 A;  5GLU A;  1JZ5 A;  2VXJ A;  1G7Y A;  2PQS A;  2YXS A;  2QFE A;  2WO2 A;  5A33 B;  1F2N A;  4AVV A;  5A1L A;  3WUD A;  2WT0 A;  2MEV 3;  2GNM A;  4JHT A;  1J3R A;  2IXC A;  3CJI A;  4FI9 A;  2NPI A;  2VE1 A;  3WP6 A;  2IVJ A;  1VRH 1;  3ELN A;  3GNE A;  4AED C;  3MI8 A;  4CCJ A;  5DAP A;  2BRT A;  5JUV A;  3H9A A;  4CCM A;  1JHN A;  1K42 A;  2Y33 A;  1DZR A;  3R05 A;  4G4F A;  2VZT A;  3FZ3 A;  2P17 A;  1E5I A;  1PZ7 A;  3FHA A;  4AQ2 A;  1S2E A;  3LD8 A;  4N7I A;  4YW5 A;  5LAT A;  3PVE A;  3S7I A;  5L7O B;  3NJY A;  2BYV E;  4OYU A;  1MZ6 A;  2AR6 A;  4LHS A;  3N7K A;  3SNM A;  1XE7 A;  1UNB A;  2ZGO A;  1V0A A;  4AGG A;  5BNN C;  1G9A A;  1AYN 2;  1AJK A;  3PUR A;  5B4N A;  4K1Y A;  4COY A;  3V65 A;  2XVG A;  4OMC A;  1ACC A;  2RR1 3;  4TWT A;  5IK7 A;  3OD0 A;  3OCP A;  5M0T A;  1YI7 A;  4FPF A;  1VBC 3;  4UBG A;  5JMO A;  2UY8 A;  4Q4Y 1;  3POJ A;  5JOY A;  3AXD A;  2GAU A;  3FFZ A;  4LT5 A;  4O7X A;  2GC0 A;  4UXA A;  3R6S A;  4WM7 C;  4AF9 A;  4Y22 A;  2E33 A;  3FBY A;  5DZG A;  2FQP A;  3VDD C;  2V5D A;  1ZM1 A;  1ODM A;  1DBN A;  2YUE A;  1UIK A;  4O9G A;  3ZXD A;  5FY7 A;  3WNN A;  3VHO A;  1NQD A;  4PQ9 A;  1R09 1;  5IFT A;  1PHM A;  2LW8 A;  4GXL A;  4OHZ A;  4N43 B;  4XEZ A;  2MEV 1;  1UYX A;  3AKS A;  5FPX A;  1AX2 A;  2AEY A;  4QGL A;  1T2X A;  4UBH A;  5FWJ A;  4FFF A;  2CDO A;  1QQP 3;  4K8R B;  3MF6 A;  3ZFG B;  4ASM B;  3V0B A;  2RM2 2;  3WLU A;  4XJW A;  3D8C A;  1G86 A;  1XNK A;  1LTE A;  1HRV 1;  4E27 A;  5EJZ B;  2VOV A;  3CF6 E;  1D0H A;  3IIA A;  3KCC A;  2V73 A;  3IPV B;  3WX5 A;  4B8E A;  3VBU C;  5C5U A;  1JZ6 A;  5GAL A;  4NWW A;  3WF0 A;  3LEM A;  4FO9 A;  3K51 A;  2AEZ A;  2GC1 A;  1ENX A;  4X6Q B;  4LBN A;  2P4E A;  4KG8 A;  1WCD J;  1LOF A;  2XVL A;  4UFM A;  2ERF A;  2RHP A;  1DYK A;  1KD7 A;  5HCB A;  3B02 A;  1QOT A;  2OZ6 A;  4BIS A;  2HWF 3;  2ZGM A;  2DU1 A;  2G1M A;  1ZZ9 A;  3JBG 3;  1EP0 A;  2FZ2 A;  3WDV A;  4FOQ A;  1XBF A;  4LTA A;  2VNR A;  4ZKT B;  4RQP C;  1IKQ A;  5C33 A;  1RXF A;  1R09 3;  4GWI A;  5DG1 A;  1RED A;  1PNF A;  2I2S A;  2VZP A;  3VHP A;  2RR1 1;  4EN9 B;  5FPB A;  4EN8 B;  1MS3 A;  3C8X A;  2FDI A;  4MH0 E;  2C5D A;  5FIX A;  2EIE A;  5FQ0 B;  1F15 A;  1OUS A;  5GLW A;  4AFB A;  3FLT A;  3PIJ A;  5F32 A;  2GME A;  5C8C B;  2H0V A;  3MYX A;  5EYX A;  4N9H A;  4CDX C;  1GUI A;  1UO9 A;  3HT2 A;  3I2H A;  1YIP A;  4AL9 A;  1Z7S 3;  4C0H A;  1JZ4 A;  2WS9 2;  2GNT A;  2ZJC A;  5E6H A;  1QDO A;  3AP5 A;  5SV8 A;  2Y8K A;  4RS5 B;  4CSW A;  1UWW A;  1RIR A;  1LU2 A;  2ZML A;  4YGC A;  2Y6J A;  4AVC A;  4ARX A;  3OGR A;  3JQW A;  1CON A;  3KHC A;  1PK6 B;  4XJ8 A;  4JZR A;  4LKS A;  3O1T A;  1AR6 2;  1U5I A;  3VBS C;  3QBQ A;  5J09 A;  2A5Z A;  4Q4W 1;  3HT1 A;  1RIT A;  2Z4F A;  3N36 A;  4JVA A;  2ZGU A;  3VBF B;  4EN0 A;  3RZK A;  2E7Q A;  1I9R A;  5C3S A;  1PGL 2;  4LBQ A;  4CP1 A;  1C28 A;  1G9B A;  4LR4 A;  1VBB 3;  1QQP 2;  3P3P A;  4IUG A;  4ZPI A;  2HWC 1;  2BGO A;  3D6E A;  2WYF A;  4BJ0 A;  1CX4 A;  4HL0 A;  5C70 A;  4FTE A;  4NIG A;  3K46 A;  4LHN A;  4M01 A;  5A7Q A;  1S0I A;  4P9W A;  3AVS A;  2K46 A;  3B9I A;  5FPV A;  1VBA 1;  1SFP A;  3D5O A;  4MUV A;  2OKX A;  5LBC A;  4EQV A;  5JOZ A;  2WT1 A;  1TVG A;  3J7M A;  2DCK A;  3EYP A;  4RHV 1;  1W3X A;  1GBG A;  3MUZ 1;  1R1A 2;  5JZG C;  1OQE A;  1PO2 3;  2ZEX A;  4HSJ A;  3WQB A;  1F9K A;  1Q8S A;  2WLP A;  4Y4R A;  3RYR A;  1CZV A;  1LOF C;  5JR7 B;  3T1M A;  3HMY A;  4L11 A;  2D3S A;  2P37 A;  5CKN A;  4J1X A;  1UYZ A;  2XHK A;  1O8P A;  3E1F 1;  2NQY A;  3WSO A;  1JXN A;  1CAU A;  3LOB A;  1HRI 3;  3NV2 A;  3O5S A;  3L2H A;  5T55 A;  1A78 A;  1G9C A;  1PVC 3;  1QH6 A;  1W2A X;  2HBT A;  4OI2 A;  1OOP B;  2WJS A;  3H7Y A;  1AYN 3;  3CO2 A;  3I2F A;  4XVH A;  4MO3 M;  1GP6 A;  3KT7 A;  4A44 A;  1OD3 A;  3KVA A;  4BPZ A;  1W9T A;  3WZ1 A;  5LW9 A;  3NKT A;  3ZVX A;  2YDE A;  4HVR A;  2Y60 A;  4R4X A;  1PMJ X;  1Q8V A;  3EQE A;  2VNO A;  1O8S A;  1UY1 A;  4QXC A;  1O4Y A;  4QXB A;  4Q4W 2;  4NMI A;  1EAH 1;  1WW4 A;  4P9J A;  1JN2 P;  2GNB A;  4XFI A;  1AR6 1;  4H7L A;  5LB6 A;  1AYM 1;  4XCB A;  4LA2 A;  1HXS 2;  2UYA A;  5A3N A;  5JCT A;  3O0V A;  4MXW B;  3HD8 B;  4QHB A;  3CMG A;  2R1B A;  1F5F A;  2QCS B;  1BZW A;  3MHZ A;  1UPI A;  1OFN A;  4XZU G;  1NCQ C;  1RUC 1;  3BIW E;  3JUU A;  4MX3 A;  2B9V A;  5FZE A;  1US2 A;  3KM5 A;  2R7E B;  1H9P A;  2JKX A;  3BOW A;  3NAP A;  5T5P A;  1R1Z A;  4NRQ A;  3MDP A;  4DY5 A;  3I2D A;  4IEW A;  4GAZ A;  1GR3 A;  2BU9 A;  4KL1 A;  4RGK A;  2X53 S;  5L9B A;  4ZHN A;  2Z69 A;  4TZD A;  5BNN A;  2OS2 A;  1JZ3 A;  4TN7 A;  4LIV A;  2LS6 A;  3AK0 A;  4AI1 A;  1RUG 3;  4FPL A;  1CPN A;  2DUR A;  3A23 A;  5BPX A;  1PO2 2;  3UKN A;  2VXR A;  1UZY A;  3V0A A;  4E4H A;  4Q5O A;  5ERL A;  1ULP A;  2XBO 2;  5I91 A;  3MPB A;  4D6Q A;  3PUQ A;  2WQ8 A;  2WZE A;  1AYM 2;  2ZKL A;  4P08 A;  4BE3 A;  4ES8 A;  1OLM E;  1XE0 A;  4FOW A;  2ETE A;  4EN6 B;  3THT A;  3KCY A;  2GZW A;  2MNG A;  2EF6 A;  3LOI A;  4V2W A;  1S2K A;  2DDU A;  1QJU 2;  3OBT A;  3ZR5 A;  2C0Z A;  2W87 A;  1A3K A;  1DZT A;  3JD7 2;  4JGY B;  3OTF A;  5IAT A;  5JVV A;  4KWU A;  4B1M A;  5ISL A;  3GBW A;  4YM0 A;  4HMZ A;  4QU2 A;  1DU3 D;  3LPG A;  1WGP A;  4GJZ A;  5F3G A;  1D2S A;  2A3W A;  2Z42 A;  3AYE A;  2A6X A;  2WZ8 A;  3IBM A;  3UKV A;  2D5H A;  3WHT A;  2TEP A;  4WZC A;  1BLZ A;  4GB3 1;  3NAP C;  4L8Q A;  3THC A;  3UL2 A;  1ONA A;  5F37 A;  1NCR C;  1SLL A;  1NCQ B;  1ZZ6 A;  1XE8 A;  2RS3 1;  3MID A;  3DN7 A;  5FZ3 A;  1SCS A;  4QB1 A;  1GQH A;  1ZA7 A;  4K40 A;  4NAM A;  4RQP A;  4QQP A;  3DXT A;  4DQA A;  2WIN B;  2WFF 2;  5FMO S;  3ZPO A;  3CZU A;  3UGG A;  2FMD A;  2ATF A;  1C57 A;  1GWL A;  3AP9 A;  1EUT A;  2D6N A;  2WFP A;  3C7G A;  1OXC A;  4GKY A;  2QQV A;  4NHY A;  4DRV A;  4LKE A;  4NR1 A;  4K21 A;  4UFJ A;  5FKB A;  3NNM A;  3T0B A;  1NCR B;  1FYU A;  3WXP A;  4F83 A;  4M00 A;  5FMB A;  3T1L A;  1ZBA 2;  3K75 B;  3WP3 A;  4GD4 A;  3I3E A;  3JBG 2;  2XL7 A;  4UFH A;  2JDZ A;  4Y33 A;  2DU0 A;  3RWK X;  1BVV A;  4CXX A;  2DVD A;  4XMI A;  4Z07 A;  4O61 A;  4HON A;  3AFK A;  4IE7 A;  1WLD A;  5LRS A;  3V0A B;  1FMD 1;  2HWF 2;  5D2A A;  3N7J A;  3ZSM A;  2XOM A;  4XFH A;  2R0H A;  2O8O A;  3O12 A;  5F5Q A;  4OVE A;  2R6Q A;  5T5O A;  3J9S A;  1JZ8 A;  5FMC A;  2WLQ A;  1T6G C;  3KCX A;  4IEO A;  4YVS C;  4GH4 C;  5DN2 A;  2VG9 A;  4LBL A;  2VL4 A;  3MW2 A;  3ZSK A;  4CCK A;  3KHB A;  5DDJ 2;  1YJL A;  4XXP A;  4NIA A;  3MW3 A;  1MZE A;  2G9Z A;  5IK5 A;  3AFG A;  5FYT A;  1K5M B;  4IV1 A;  4JGZ B;  2VQA A;  3BOP A;  1HRV 3;  2VUJ A;  3MIH A;  2VZS A;  2VMI A;  4W6Y A;  1SEF A;  1UMI A;  1VBB 1;  3T08 A;  5AFB A;  2WNV B;  1WW7 A;  3MO4 A;  2WRA A;  2XBO 3;  5DDJ 3;  5FYU A;  1H1M A;  4QD2 A;  2VZO A;  4XTP A;  3H3Z A;  4AG4 A;  2E63 A;  4HPK A;  4XDP A;  1L7R A;  4CUB A;  1R64 A;  2WS9 1;  3H1M A;  5ANN A;  5A6X A;  1WMF A;  4QDR A;  4XJA A;  3A4U A;  3NWK A;  4C1W A;  2ZGN A;  1DQ2 A;  2G9G A;  5FK8 A;  1VBD 2;  3VHR A;  4LUM A;  4NWV A;  4PIZ A;  1G9F A;  2WWU A;  1MS4 A;  1IOA A;  1VBC 2;  4R8H A;  4RFT 0;  5FY0 A;  4YYO A;  5LY2 A;  2WT2 A;  1BBT 2;  3RRD A;  3X29 B;  1KXG A;  3T2P A;  4QPG C;  1O7F A;  1LES A;  3VN4 A;  1ND3 A;  2R07 2;  2ZHM A;  4D8M A;  3NVC A;  3KQR A;  1NOV A;  4B4P A;  4NVP A;  4YVS A;  1HXS 3;  2BNN A;  3S6P A;  2E6V A;  4XPV A;  3JQX A;  2VMG A;  1H2N A;  4Q0U A;  5CKQ A;  3GGL A;  1OHF A;  1VBA 2;  3NNJ A;  3BB6 A;  3KT1 A;  3GF6 A;  4HT1 T;  2PLV 2;  3ZXG A;  2DCY A;  4HXC A;  1W28 A;  2OII A;  5F6L B;  3U10 A;  4CCC A;  5CEH A;  3OBR A;  1LRH A;  2FDG A;  2RMU 1;  2WN3 A;  3ZYB A;  2B8M A;  5C71 A;  2BVV A;  3RS6 A;  2MEV 2;  4Y22 B;  2CU5 A;  1ZRE A;  5FZF A;  4GWM A;  1IPS A;  1PO2 1;  1W2N A;  5JSO A;  4KG0 A;  5KXC A;  4N9I A;  1QIQ A;  2XJR A;  1QDC A;  4QX1 A;  2AUY A;  2D43 A;  4EZ4 A;  3H8X A;  1NLR A;  1US3 A;  2RDQ A;  5I8S A;  3I7D A;  4KGQ A;  4E4D X;  5DZF A;  1KJL A;  5FXV A;  3PJQ A;  4AEM A;  1ZVF A;  3B01 A;  2XJT A;  2NLR A;  1HB3 A;  3T4V A;  2XGX A;  2CSG A;  4LXL A;  2OZJ A;  4HFS A;  2JG9 C;  2QQU A;  5C9A C;  4I01 A;  2VOK A;  2RDR A;  4LO8 A;  3BI3 A;  3ZYF A;  4ZU7 A;  1S0F A;  3SH4 A;  4MGZ E;  3VKN A;  3ZFF C;  3P3N A;  3HQX A;  1R08 2;  2JDH A;  4XUT A;  5F3E A;  3ZIX A;  3AB0 A;  4GMP 3;  3EO6 A;  2IVI B;  5FZB A;  3WHU A;  4CP0 A;  3I49 A;  4Y3O A;  4H14 A;  2VMC A;  1YFX A;  3USU A;  4PLM A;  3PDQ A;  3N35 A;  3PTY A;  4MSV A;  2BP6 A;  4LOR A;  1UYY A;  1AJO A;  1RUG 2;  2WNE A;  2ZCW A;  3BN6 A;  3WY6 A;  1PZ9 A;  3S7E A;  4AWD A;  4YGB A;  3RGB A;  2QZ3 A;  2Q1F A;  1VJ2 A;  5GZE A;  2BER A;  3EMR A;  4OUS A;  5FZO A;  1YJK A;  3OGG A;  1V9U 1;  3HN1 A;  4XF0 A;  1NA1 A;  2JDY A;  1Z7S 1;  2QE3 A;  4LBJ A;  1W39 A;  1A6C A;  4Q1R A;  3DYO A;  3AP6 A;  1LUL A;  5ABJ C;  2W9X A;  5FUN A;  3ZYG A;  1WD3 A;  2R06 1;  3B3Q E;  1OUX A;  3USS A;  4CEW B;  2XHN A;  3ZDS A;  2GSY A;  4QAW A;  3S5Q A;  1BEV 2;  5FLH A;  5A32 B;  3ZYP A;  3NJX A;  1UKG A;  3WQ0 A;  3PUA A;  2YG0 A;  1H8T B;  1DLL A;  1Y9G A;  4QGN A;  1PK6 C;  1C5H A;  1IG3 A;  1W3V A;  2R49 A;  2WS9 3;  3KF3 A;  4HAN A;  3POI A;  4XMA A;  3PMS A;  4QXH A;  2X09 A;  1M06 G;  4NHM A;  3PLQ A;  1ZRD A;  3I3M A;  4BYY A;  3CEW A;  1NAE A;  2VY0 A;  2VR4 A;  4FPJ A;  3OBA A;  5DUV A;  3ILN A;  1GWK A;  3DYM A;  4BDV B;  2YZ4 A;  2ZX0 A;  1UAI A;  4NPM A;  5JI7 A;  4D0Q A;  2KR2 A;  1HV1 A;  2WNV C;  4ZZ5 A;  4DXT A;  2ARC A;  3LIG A;  4OHY A;  5C5T A;  2XWJ B;  2BV4 A;  3ZN6 B;  1N3Q A;  3N9Q A;  4PDW B;  4XFB A;  2VOT A;  4CDW C;  3AYD A;  3WG1 A;  4MGQ A;  4DB5 A;  4DOU A;  4YW2 A;  2BUK A;  4FQZ A;  2DV9 A;  4HKL A;  4AED B;  4D7S A;  2PLV 1;  3GYD A;  2VCC A;  4FCA A;  4G3Y C;  2W39 A;  3EB7 A;  4FPE A;  1BK0 A;  1V6K A;  4MXW A;  4GH4 B;  3A21 A;  3ABZ A;  4IV3 C;  2AC1 A;  1H2M A;  5HCF A;  2O1Q A;  3LA2 A;  3PVN A;  3MV1 1;  2J22 A;  5F2S A;  1O3T A;  4AHW A;  1RHI 2;  1U5X A;  1U12 A;  3T0D A;  1CAW A;  5GZD A;  2BDR A;  5TSW A;  4PBO A;  1TQ5 A;  4K7J A;  1HV0 A;  1UIJ A;  2YMZ A;  4AI2 A;  4HG6 B;  3H8R A;  1HB2 A;  4H2A A;  4I0W B;  3AP4 A;  5CG9 A;  4AI8 A;  3RYK A;  4IEV A;  2BFU S;  4W50 A;  1ND2 C;  2V09 A;  5EJ3 A;  1QHD A;  2IFR A;  4F7Z A;  3T4H B;  4YVS B;  1GZC A;  2TNF A;  3I4I A;  4XZP A;  5FKC A;  4CEW A;  5LZ6 A;  1X82 A;  3INA A;  4AI9 A;  2IUW A;  2BOI A;  4EV0 A;  3U4X A;  1C8M 2;  2JD9 A;  4Q4Y 2;  1B35 B;  2VGD A;  2XJV A;  2WWS A;  3UGH A;  4YFZ A;  1ASJ 3;  2ZMK A;  5LEJ A;  1SAC A;  2R07 3;  1V6L A;  3ACL A;  3QOP A;  5IVB A;  4P02 B;  4ZY9 A;  5HCH A;  4I30 A;  4COZ A;  4XAE A;  2DF7 A;  3PVB B;  5FYH A;  3ETQ A;  1UMZ A;  3I2K A;  2RDN A;  1WCQ A;  3JBG 1;  1J3P A;  3TYJ A;  3ZPY A;  4H3W A;  1JI6 A;  2Q0A A;  2CGN A;  3KGZ A;  5DDJ 1;  2QQK A;  2VEC A;  2XKO A;  2FDK A;  2E9Q A;  4XFG A;  2O0O A;  4Y20 A;  4ZXK A;  1LNS A;  5A3O A;  2WL1 A;  1DQ0 A;  1HJG A;  2PHL A;  3POE A;  3UKT A;  4XIK A;  5KXD A;  3ZFF B;  3KF5 A;  1QJF A;  2BGC A;  4BLI A;  4AE2 A;  2VZU A;  4Y5S A;  4Y26 A;  2JDA A;  1RMU 1;  2PHD A;  5JIU A;  1E57 A;  1UQX A;  4CU7 A;  5D1I A;  3ZXJ A;  3TEZ A;  2WFF 3;  1GKB A;  3A0K A;  4WVZ A;  3VBO A;  3WD5 A;  1AR8 3;  2JB4 A;  3K4A A;  3VBH A;  3AP7 A;  1C1F A;  1O59 A;  1PK6 A;  3OSD A;  5EPA A;  5CFC B;  4IV1 C;  3OPZ A;  5FZH A;  1S55 A;  4PIY A;  4K9S A;  4JGY C;  1JZ7 A;  4P5Y A;  4B3N A;  5IVF A;  4BU2 A;  2Y6K A;  2WFF 1;  5SV5 A;  1S0J A;  3IZO A;  4PDW C;  4A41 A;  1YQ8 A;  4C90 A;  2TBV A;  3ZXF A;  1DP0 A;  5J3U A;  2OX0 A;  4XET A;  2RMU 3;  5CKM A;  1GNY A;  2R1D A;  3ILR A;  1JHJ A;  4YW6 A;  1RUI 2;  2AEN A;  4W8J A;  1F5J A;  3POF A;  1GP4 A;  1NY7 1;  4AAP A;  4BQ3 A;  3NJV A;  5GJ6 A;  1W6M A;  4RR3 A;  1SLA A;  4CE8 A;  1OA2 A;  1O91 A;  1VBE 2;  2J1R A;  2DTW A;  2VCA A;  2X8K A;  2ZX2 A;  2BEO A;  1D4M 2;  2Q8E A;  3WDX A;  3O1S A;  4AHX A;  2L9L A;  4ZS2 A;  2YU2 A;  2HKX A;  3I3B A;  4KI5 M;  5I0T A;  5AC9 3;  4QPG B;  1BMV 2;  3WCR A;  1N1V A;  2VZR A;  3VZN A;  5A3W A;  4CEY B;  3PME A;  3T2T A;  3TB0 A;  4GA9 A;  5FZL A;  5AVA A;  4UT5 A;  1Y3T A;  4C91 A;  1YUD A;  1JYX A;  5ABJ A;  3URF A;  4Y1V A;  2YHJ A;  3LKJ A;  5GM0 A;  1QJY 1;  4XIO A;  1UY4 A;  4IV3 B;  4FAH A;  2UU8 A;  2OUJ A;  2VNV A;  3I59 B;  3ZFE A;  5L36 A;  1J58 A;  2WO7 A;  4PDW A;  5A7S A;  3O0X A;  4Q4X 1;  5FCC A;  1W2T A;  1QMJ A;  1TE1 B;  4XQ4 A;  1WME A;  1XC6 A;  5J48 A;  3IWZ A;  2PHR A;  1ZYB A;  4N53 B;  1PMH X;  4KGG A;  2BPA 2;  3NW4 A;  4JTO A;  3U11 A;  5L7O A;  3J8F 3;  3B00 A;  5CIR A;  4JKL A;  1J83 A;  1W6P A;  1GNH A;  3B93 A;  1FOD 3;  5FZO B;  3T2O A;  2FHR A;  2FCU A;  4OZX A;  4YVW B;  1TNR A;  1V6M A;  3VHN A;  5GLV A;  3T2Q A;  5CAD A;  2OUH A;  4LE3 A;  4XJZ A;  4XOG A;  4CU8 A;  2XJQ A;  5C9A A;  1GZT A;  4FP2 A;  3BUC A;  3HNY M;  4GIQ A;  1COV 3;  1UX7 A;  3E6C C;  2D44 A;  2ES3 A;  4NAO A;  4NPL A;  5ANQ A;  5G05 L;  1SHW B;  3GXU A;  1W9W A;  3OF1 A;  2EID A;  3R0R A;  3RZZ A;  4J1W A;  4BCU A;  3SIT A;  4A7K A;  4RGA A;  2RDS A;  2W1S A;  2E7T A;  4URA A;  5FPL A;  4EWE A;  2EXK A;  2XH6 A;  1CD3 G;  1RL3 A;  4FPG A;  2WO3 A;  2ZZQ A;  1ND2 B;  4XHX A;  1PNG A;  4QM9 A;  5C4W A;  1OKO A;  4ZXE A;  1W03 A;  4AHZ A;  3KVB A;  1F35 A;  3WW3 A;  4FXK B;  5ACA 2;  1NZC A;  2R07 1;  5G04 L;  4XAA A;  4D94 A;  5J96 B;  3O1R A;  3RNS A;  1PGS A;  1I6X A;  3JCI A;  4JDN A;  1NE4 A;  4OMD A;  2O14 A;  4B1L A;  4BK4 A;  2PXJ A;  1AX1 A;  1FNY A;  2C6S A;  5H9R A;  4QPI A;  4B4R A;  2PYT A;  3BTA A;  5T54 A;  5J1X A;  4FXG B;  4Z82 A;  3ZLI A;  2K9Z A;  2QQN A;  3GZT B;  3ILF A;  4YGD A;  4D7T A;  5CIS A;  1NA1 B;  3NV4 A;  1HN0 A;  1YXW A;  3FUQ A;  4N7U A;  4XXA A;  3SMH A;  3WP4 A;  1ULD A;  2PMW B;  5J98 B;  1MEC 3;  1WW5 A;  1CZT A;  2XR4 A;  1X7N A;  2RJL A;  2DUP A;  5DG2 A;  3LA7 A;  4M4P A;  1D4V B;  1KRI A;  1URX A;  5C3O A;  4AGV A;  2YBP A;  2JG8 C;  3M3I A;  4Y20 B;  1GQP A;  2BVB A;  2ZGK A;  1BJQ A;  5IVJ A;  2ORZ A;  1GU3 A;  5IVY A;  4IEY A;  3U37 A;  1LKN A;  3AMH A;  4A2U A;  2OW4 A;  1COV 1;  1YI9 A;  2GND A;  2ZHL A;  2JD4 A;  3DL3 A;  4RR3 C;  4XF3 A;  1ULG A;  1ALY A;  1XYN A;  2XB6 C;  5T52 A;  1WBL A;  1V6O A;  3LA3 A;  2PAE A;  4K20 A;  5GZF A;  4P9Y A;  4TLF A;  4COW A;  3EXU A;  1JYI A;  2QQW A;  1QF3 A;  3OJB A;  3OUJ A;  1TMF 3;  3N3H A;  3OG2 A;  5JAX A;  3HR9 A;  2CAV A;  4XE9 A;  5FZK A;  4D6R A;  2DTY A;  1AL2 1;  4UW5 A;  4LOT A;  1GAN A;  1AR7 3;  1RUJ 1;  2WA3 A;  1L7Q A;  1GZ9 A;  3H7J A;  4IV1 B;  1YFU A;  1N1Y A;  2ZGS A;  5E8A A;  1H1A A;  5FYB A;  3TAY A;  2AAC A;  2FDJ A;  2PHU A;  3B94 A;  2XJS A;  3ME2 A;  3VZL A;  5LY1 A;  2N7G A;  1Q3E A;  4DUX A;  4CP9 B;  1ODN A;  1UMH A;  5IFP A;  2GMM A;  3M3Q A;  4BIO A;  1SCR A;  1KJR A;  2EIG A;  2OXB A;  2Y6F A;  3O7O A;  1QJY 3;  3ZFE C;  5HV0 A;  1LHN A;  2QQJ A;  1EUU A;  3FX3 A;  4HPK B;  4YZ4 A;  4E8C A;  1ASJ 1;  1HQL A;  2QQM A;  5IUQ A;  3WVJ A;  4CVU A;  1JYN A;  5I0U A;  1H6X A;  1I3H A;  2B5H A;  1POQ A;  2VTX J;  2VW0 A;  5CYY A;  1UZV A;  3DYP A;  3WEZ A;  3W5N A;  4X8N A;  2RM2 3;  4XUQ A;  1RVF 2;  4YW4 A;  3QD6 A;  3W20 A;  5K4L A;  4L2N A;  5BNO C;  3AVR A;  5LK7 B;  2B39 A;  1IGO A;  3WP5 A;  1V6N A;  1WLW A;  2HWC 2;  5BNP A;  5AC9 1;  4GB3 2;  1RUD 1;  1YYN A;  2GP3 A;  4E9K A;  4BK5 A;  4XUR A;  5FOJ B;  3H3U A;  4KNC A;  2X10 A;  5IVC A;  4EE2 A;  3MV0 1;  4M4R A;  3DF0 A;  2XLA A;  3I2I A;  1LOD A;  2K0G A;  3RZJ A;  5F2W A;  3WG4 A;  5CAZ A;  3ZO0 B;  2DBN A;  5H9S A;  1H2K A;  4L9B A;  4I2O A;  2DUO A;  3NNF A;  4XQW A;  1IQD C;  1W9F A;  4I3P A;  5FTT C;  1AXY A;  4QQL A;  2ET1 A;  1XPW A;  2XJP A;  1QOS A;  3OGV A;  3N9P A;  2A70 A;  1QJE A;  2JDU A;  3IT8 A;  1RGS A;  3RJ2 X;  2YC2 A;  1OBN A;  5GZC A;  2UYB A;  4E2G A;  1LU1 A;  2XL9 A;  1JU4 A;  2WSU A;  1YO8 A;  2HLE A;  3SEE A;  3BGA A;  4AGR A;  1H30 A;  1W0P A;  1N1S A;  1XSQ A;  2PHW A;  2WQ4 A;  4P14 A;  2XQR A;  2E32 A;  3VBF A;  4DIQ A;  4TXW A;  3FL7 A;  1K5J A;  2HWC 3;  3WDW A;  4S2H A;  4DXZ A;  1OF3 A;  2R04 2;  1MEC 1;  5C3R A;  3VBS B;  2BFU L;  5FYY A;  1BHG A;  3AL5 A;  1RUI 1;  1X8M A;  3VL8 A;  1SBF A;  1VLN A;  4I09 A;  2QKD A;  4ASL A;  1AZD A;  3HAG A;  5H9Q A;  4LK6 A;  3DEM A;  4DUV A;  4I3G A;  1RHI 3;  5FXW A;  3ZR6 A;  4FBF A;  1IPJ A;  4CZS A;  2WKK A;  4RL7 A;  4YVW A;  4N43 C;  1IHM A;  5FZC A;  1PX3 A;  1WZX A;  4ET7 A;  3CJX A;  5FFO C;  4ASK A;  1GOG A;  1JYV A;  4KWK A;  4AVA A;  4AEJ A;  5KHI A;  4CDX B;  4HKW A;  1K12 A;  1W8Z A;  4XF9 A;  2X5I A;  2YC4 A;  2YBS A;  2P1B A;  5C8C C;  1TZO A;  3C7H A;  5J7M A;  1FI2 A;  2WZR 3;  4GUL A;  1SPP A;  4MLO A;  3LDB A;  1JBC A;  1Z0H A;  2GH8 A;  1C8N A;  3VD5 A;  1TMF 2;  2PEL A;  4LNV A;  1AR7 1;  1RUJ 3;  4GKX A;  1POV 1;  1ZBE 2;  1RMU 2;  1U5Z A;  3RWN A;  4D3W A;  4QB2 A;  5DUU A;  3ZXE A;  3SLI A;  5F3I A;  1ZRR A;  4JAA A;  1YHF A;  3VKO A;  1OQ1 A;  2DVA A;  3AYA A;  1RUH 3;  1BBT 1;  3FC0 A;  4F8A A;  1JUI A;  1UZ0 A;  5LA1 A;  4CEW C;  1SBD A;  1W8W A;  4QX2 A;  1QWR A;  1N3P A;  1VB4 A;  1JZ2 A;  2XBO 1;  5I0D A;  1JYW A;  4TTG A;  3K2O A;  4QPG A;  2BWA A;  4LLF A;  1O4Z A;  4FSJ A;  3OYW B;  3H42 B;  2VUD A;  1WD4 A;  2D40 A;  4LKF A;  4Q29 A;  4DS0 A;  2OVU A;  1UN1 A;  4OI0 A;  5KHH A;  2F6B A;  2VZV A;  1LOE A;  1YRZ A;  2P3Y A;  4D7Y A;  3ES4 A;  2QQP A;  1GOH A;  1LGB A;  4NPR A;  4XUP A;  5K0U C;  1RB8 G;  5JZG B;  2VPV A;  4DXS A;  2OQ6 A;  1W8O A;  5JDB A;  3MPP G;  3TRS B;  1UD1 A;  3VZO A;  2ADE A;  3ZFE B;  2D3R A;  4NHL A;  5FP3 A;  2C1F A;  4FP3 A;  1QOO A;  1W8H A;  5JI9 A;  2QDR A;  4R4Z A;  1MQT B;  1NQJ A;  1RUC 3;  4M3C B;  3VLB B;  3WDU A;  4BQ5 A;  1W06 A;  4MHR A;  3KB5 A;  1RUG 1;  3CKH A;  3OYW A;  5FAX A;  3TN9 1;  4QGM A;  3PHM A;  1H4H A;  1J1L A;  3HOB A;  3GDB A;  2ZBJ A;  2CGO A;  1YFY A;  1EAH 3;  2CHH A;  1U5Y A;  3CJI B;  4JQT A;  3SH3 A;  3ST7 A;  2EIB A;  2ZTN A;  4COU A;  3S0M A;  2X5I C;  4MZU A;  2R06 3;  1OOP A;  4CYD A;  2VME A;  1S4C A;  3G7D A;  1XU2 A;  4I02 A;  5IYY A;  2HYX A;  3LQC A;  4WM8 A;  2XUE A;  3SHR A;  3BCW A;  4E4S A;  3U75 A;  3ETP A;  3CLP A;  1W6M B;  4RR3 B;  3PU8 A;  3QLQ A;  2VUL A;  3VKL A;  1AUY A;  2PHT A;  1AL0 G;  3H1Y A;  4Q0V A;  3GZU C;  1OD5 A;  1ZBA 1;  2W3J A;  4R9D A;  3TOJ A;  5FQ0 A;  3VZM A;  4FOY A;  1O4T A;  1UY2 A;  3NST A;  1DQ5 A;  2FBE A;  2P34 A;  2A6Z A;  5FLI A;  2ZPX A;  2KM2 A;  5HV4 A;  4ZON A;  4CDX A;  5ACA 1;  2G4I A;  4EYU A;  4CCN A;  2JE9 A;  2NP0 A;  3POS A;  4QDQ A;  3VBO C;  4D69 A;  4C8D A;  5I0S A;  4A3Z A;  1OT5 A;  5I0R A;  1NA1 C;  3NV1 A;  2EXH A;  4HVO A;  4FAG A;  1PVC 1;  1ZBE 1;  1DQ6 A;  4LBO A;  4PF5 A;  2JJ6 A;  3WIN E;  4OUE A;  3GHN A;  4A7Y A;  2OPW A;  3Q8C A;  2Y0O A;  1FOD 1;  1K3I A;  3AZY A;  4NO4 A;  3MLL A;  3VUO A;  2DCJ A;  4RS5 C;  1ENS A;  2A3Y A;  1MQT A;  3ZXA C;  2Y38 A;  3J8F 1;  4N8M A;  2FCT A;  3MFA A;  5I93 A;  1BVP 1;  4R9C A;  1RTV A;  1HQN A;  1T6B X;  4DMI A;  3ALQ A;  3AXE A;  1CZS A;  2HWD 1;  1JW6 A;  2YB7 A;  2F4P A;  4DY3 A;  2J1V A;  1HJF A;  1BKZ A;  2ORX A;  4UW4 A;  2SLI A;  3WNO A;  2HBU A;  2WSV A;  3WNK A;  3CU7 A;  2Z79 A;  3E5X A;  1HB4 A;  1JTZ X;  1WUV A;  4XF4 A;  1R1A 3;  3LF7 A;  4AQ6 A;  4QX5 A;  3WG2 A;  2D3P A;  5ABJ B;  2EIC A;  5A6Z A;  1UXX X;  5FPA A;  3GBG A;  1F4H A;  1ZNP A;  2Y64 A;  3WNM A;  3UT0 A;  2ARA A;  3TNP B;  1CVN A;  5CFC C;  1OPM A;  1X8E A;  1VAM A;  3PVO A;  2WNU C;  1A8D A;  1EYB A;  1WMX A;  1KGY A;  2DFB A;  2ZEZ A;  5FO9 B;  5FO8 B;  2IWG B;  3MUY 1;  5FYI A;  2MPF A;  3DPR A;  4UOJ A;  4CUC A;  1HKD A;  2RS1 1;  3BYW A;  4LIT A;  4YFW A;  5LBF A;  2BJS A;  1DFQ A;  4URT A;  2OYZ A;  3SXW A;  4QDS A;  1IS4 A;  2OA2 A;  2Y26 A;  3DV8 A;  3IAQ A;  1AXZ A;  4WM7 B;  4ATE A;  4L92 A;  1JOP A; 
#chains in the Genus database with same CATH homology
 2E31 A;  4OMC A;  2VZQ A;  4KMQ A;  2WAO A;  5JMO A;  4P02 B;  4ZY9 A;  3I2K A;  1WCQ A;  2E33 A;  2YFZ A;  5B4X A;  1JI6 A;  2V5D A;  5JR2 A;  2QQK A;  3DEC A;  5IJR A;  3D3A A;  3NRU A;  3WNN A;  1LNS A;  3IB3 A;  5IFT A;  2LW8 A;  2VZU A;  1ULO A;  1UYX A;  2JDA A;  2ID4 A;  1T2X A;  2CDO A;  2Y6L A;  3I97 A;  4CU7 A;  5JXI A;  2W1U A;  4PQQ A;  2W95 A;  3K4A A;  5EJZ B;  1O59 A;  3HNM A;  2J1U A;  5JXH A;  3PUH A;  2VZ3 A;  2W91 A;  4LPL A;  1JZ6 A;  3LEK A;  3WF0 A;  3P1I A;  2XON A;  1JZ7 A;  4MGS A;  4P5Y A;  3UNP A;  5DPN A;  3ACF A;  2Y6K A;  2VQT A;  4A41 A;  1NX9 A;  1DP0 A;  5JXG A;  1GNY A;  1JHJ A;  3VD7 A;  3VD4 A;  4W8J A;  4RN5 A;  4GWI A;  3FN9 A;  2Y6H A;  3NJV A;  2J1R A;  2VZP A;  4JKK A;  3C7F A;  2VCA A;  3C8X A;  2EIE A;  3A22 A;  3OEB A;  2L9L A;  2W1W A;  3I3B A;  5FUI A;  4KI5 M;  2WDB A;  1GUI A;  3I2H A;  1PX4 A;  2VZR A;  1JZ4 A;  2J1T A;  2Y8K A;  1UWW A;  5LCW L;  1GMM A;  2Y6J A;  4ARX A;  3OGR A;  3LPF A;  3P6B A;  3OGS A;  1JYX A;  1JU3 A;  4LKS A;  4A6O A;  3VDC A;  4PT6 A;  1UY4 A;  2Z4F A;  1UY3 A;  5A1A A;  4GWJ A;  4JKM A;  1XC6 A;  3HJR A;  1PMH X;  3OEA A;  4IUG A;  2BGO A;  3CZJ A;  4BJ0 A;  5C70 A;  3K46 A;  2BZD A;  4JKL A;  3LEG A;  1J83 A;  3T2O A;  2OKX A;  1TVG A;  3T2Q A;  2DCK A;  2VZ1 A;  3SKV A;  3EYP A;  4CU8 A;  3MUZ 1;  2ZEX A;  3WQB A;  2WYS A;  4RYD A;  3HNY M;  1UX7 A;  1CZV A;  2WBK A;  3AC0 A;  5DQ0 A;  5G05 L;  2RJ2 A;  1SHW B;  3GXU A;  1UYZ A;  1W9W A;  3C7E A;  3GM8 A;  2EID A;  1O8P A;  3E1F 1;  3WSO A;  2WAB A;  4BXS V;  1SDD B;  4P00 B;  2W1S A;  2E26 A;  3I2F A;  4XVH A;  2WO3 A;  4MO3 M;  3NQH A;  4XUQ A;  5HXM A;  3WF2 A;  4A44 A;  1OD3 A;  1W9T A;  3CDZ B;  2J7M A;  5G04 L;  3J7H A;  1PMJ X;  1O8S A;  1UY1 A;  2J1A A;  4OMD A;  4MOA A;  4BK4 A;  2WN2 A;  3HPN A;  3WNL A;  3F2Z A;  4QPW A;  5J1X A;  3CMG A;  1J84 A;  2QQN A;  4XZU G;  2B9V A;  1US2 A;  2R7E B;  2J1E A;  2JKX A;  3UET A;  2VC9 A;  1CZT A;  2B4K A;  4M4P A;  4CU6 A;  2W92 A;  1JZ3 A;  2VJX A;  1GQP A;  2LS6 A;  4MAD A;  3A23 A;  2ORZ A;  1GU3 A;  3U37 A;  1ULP A;  4ZXE A;  3CIH A;  2WQ8 A;  2WZE A;  4P08 A;  1CX1 A;  3IAP A;  1CIY A;  1W9S A;  2DDU A;  3CQO A;  3OG2 A;  4YPJ A;  2W87 A;  4KWU A;  4QB6 A;  1L7Q A;  4ARY A;  2ZEY A;  3LEI A;  3LPG A;  2WUH A;  2XQX A;  3I3D A;  2WZ8 A;  4DUX A;  1UMH A;  5IFP A;  2VM9 A;  3K77 A;  3THC A;  3HEI A;  3LE0 A;  2QQJ A;  1EUU A;  3ECQ A;  3MBW A;  4E8C A;  1JYN A;  2QQM A;  4CVU A;  4QB1 A;  1H6X A;  2QQI A;  3WEZ A;  5CYY A;  3HN3 A;  3DYP A;  3W5N A;  3CZU A;  3C7G A;  1EUT A;  2VO5 A;  2C9K A;  3WF4 A;  1SG3 A;  2C26 A;  2VTF A;  2W94 A;  3T0B A;  4BK5 A;  4XUR A;  3K75 B;  2X10 A;  3I3E A;  3MV0 1;  4M4R A;  3I2I A;  2QQO A;  3ZM8 A;  4PF1 A;  1NUK A;  2XOM A;  2VMD A;  1IQD C;  5C7G A;  2CDP A;  1XPW A;  1K45 A;  1JZ8 A;  3OGV A;  5EJ1 B;  4W4Z A;  2YC2 A;  5DN2 A;  2VL4 A;  3HNB M;  1JU4 A;  2HLE A;  2BGP A;  3BGA A;  3SEE A;  3W5M A;  4GZ9 A;  2E32 A;  4TXW A;  3FL7 A;  2X05 A;  2VZS A;  1OF3 A;  4A4A A;  1UMI A;  3T08 A;  3MO4 A;  4DXR A;  5HPO A;  3SKJ E;  1BHG A;  2VZO A;  1XNT A;  4UAP A;  4AG4 A;  5LA0 A;  4DUV A;  5JXJ A;  1L7R A;  4CUB A;  1R64 A;  4QDR A;  1UY0 A;  1PX3 A;  4ET7 A;  4A42 A;  1P8J A;  1HN1 A;  1GOG A;  1JYV A;  3T2P A;  3III A;  1K12 A;  2YC4 A;  3A7Q A;  1OF4 A;  3C7O A;  3C7H A;  4D8M A;  2Y6G A;  3T09 A;  1DYO A;  4CUA A;  2W5F A;  3VD5 A;  3ACH A;  1WKY A;  3GGL A;  3I2J A;  3NNG A;  4QB2 A;  2V72 A;  3K4Z A;  3OB8 A;  2WN3 A;  1UZ0 A;  4QX3 A;  5C71 A;  5LA1 A;  4QX2 A;  1JZ2 A;  2WAA A;  5I0D A;  1JYW A;  4TTG A;  1UXZ A;  4A45 A;  2C4X A;  4QX1 A;  3I2G A;  1US3 A;  2VZV A;  1GOH A;  2W47 A;  4XUP A;  3THD A;  4DXS A;  2W46 A;  1W8O A;  3PUI A;  3WF3 A;  2BBA A;  4Z2A A;  4DEQ A;  3JXS A;  5IHR A;  4XUT A;  3K4D A;  3CKH A;  1W0N A;  2VMC A;  3HOB A;  1UYY A;  4AAX A;  3GDB A;  2RVA A;  1I5P A;  3BN6 A;  1YQ2 A;  2EIB A;  5DMY A;  4OZO A;  5LA2 A;  2BER A;  2VME A;  5IYY A;  1F4A A;  4UI9 L;  2HYX A;  3LQC A;  1KEX A;  1NKG A;  2WO1 A;  1W99 A;  3ETP A;  3DYO A;  3VDB A;  1OH4 A;  2QBX A;  2W9X A;  3WF1 A;  2VCB A;  3VD9 A;  2W3J A;  5EIY B;  2XHN A;  1W8N A;  4QAW A;  1UY2 A;  3NJX A;  4E8D A;  4CU9 A;  2YG0 A;  3ACI A;  2VMF A;  3T0A A;  4QDQ A;  2X09 A;  4A3Z A;  1D7P M;  1OT5 A;  1NAE A;  2VR4 A;  3FHQ A;  3OBA A;  2ZEW A;  3DYM A;  1MPX A;  4BDV B;  5F7U A;  4D0Q A;  4ZZ5 A;  3VDA A;  4OUE A;  4DXT A;  2J1S A;  3VD3 A;  2W1Q A;  1TG7 A;  1DLC A;  1K3I A;  1GOF A;  1RYY A;  2VOT A;  4XUN A;  2DCJ A;  4LQR A;  4MGQ A;  4DEV A;  5CZK A;  3IDA A;  2YFU A;  4XUO A;  2VCC A;  4DUW A;  1CZS A;  4L0P A;  3ACG A;  3EB7 A;  2ZXQ A;  1JZ5 A;  2KD7 A;  2PQS A;  2YB7 A;  3A21 A;  2WO2 A;  3ABZ A;  1H6Y A;  2J1V A;  3WNP A;  2ORX A;  2JE8 A;  3WNO A;  3WNK A;  4JX0 A;  2V4V A;  4FI9 A;  3MV1 1;  2J22 A;  4ZZ8 A;  3UES A;  3SEP A;  2RV9 A;  2EIC A;  3T0D A;  1UXX X;  1F4H A;  2Y64 A;  3WNM A;  5JUV A;  4HG6 B;  1K42 A;  4QX0 A;  2VZT A;  4W50 A;  3FHA A;  1XNA A;  2ZEZ A;  1KGY A;  2QQL A;  3MUY 1;  2VQU A;  4UOJ A;  4OYU A;  4CUC A;  4LHS A;  4QDS A;  5B4N A;  2JD9 A;  4JHZ A;  3IAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...