4LPLA

Structure of cbm32-1 from a family 31 glycoside hydrolase from clostridium perfringens
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
b'DPYRNVPKDMKTEWKWGQYSSDEPSKAVDGDDSSQFHSQDSAIDKPFIIDMQKAYTIEKLELLFRKNGNGSVKRAEIYSSLDGVTYEKVFSNAEGSDIAPWATDGEVKTINFNKPIKVRYFKIVTKESIGNFLAMREFRPYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glycosyl hydrolase, family 31/fibronectin type III domain pr
molecule tags Sugar binding protein
source organism Clostridium perfringens
publication title Diverse modes of galacto-specific carbohydrate recognition by a family 31 glycoside hydrolase from Clostridium perfringens.
pubmed doi rcsb
total genus 36
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4lplA00
2W5FA 2QQOA 3SEEA 1NAEA 1F4HA 3FN9A 1UYXA 5CZKA 2VQTA 1RYYA 4JHZA 3WNPA 3IDAA 2QQJA 2V5DA 2V72A 4ZY9A 1EUUA 3A7QA 2VMCA 3HEIA 2Y6GA 1CZSA 2YB7A 3OB8A 2J1VA 2LS6A 3I2HA 1W8OA 4LKSA 1PMHX 1JZ3A 1JZ7A 3PUHA 1D7PM 4XUNA 1UXZA 2X09A 2B9VA 3NQHA 3CQOA 4ET7A 1K42A 3CZUA 2QQNA 1JU4A 2J1AA 2VL4A 2YFZA 2ZXQA 3LQCA 3WF1A 4CU8A 4BK5A 4TXWA 1DYOA 2QBXA 2VZOA 1JZ4A 2VZQA 3VD7A 4L0PA 3ZM8A 2W92A 1SG3A 2BZDA 1JU3A 2W1UA 2WO1A 3VD5A 2EIBA 5HPOA 1O59A 2W94A 5DPNA 1OH4A 3NJXA 4GZ9A 4D8MA 3NNGA 2W9XA 3WF4A 3K46A 2J1SA 1W0NA 1UWWA 2R7EB 3CMGA 3HNMA 3BGAA 4ZZ5A 2EICA 3HNBM 1GOHA 5LCWL 1F4AA 3WF2A 3LPFA 3T09A 1UX7A 3GM8A 2VCCA 2X10A 3MUZ1 5HXMA 5J1XA 3A23A 4JKKA 4LQRA 2EIEA 3OEAA 2JD9A 3MUY1 2W87A 1GOFA 2YFUA 2JDAA 3C8XA 5DMYA 2VZUA 1US3A 4QX0A 1EUTA 4LPLA 3T0BA 4E8CA 5JXIA 4KI5M 1GNYA 1W9TA 4QB2A 4DEQA 4XUQA 1H6XA 5A1AA 4W4ZA 1IQDC 3ACHA 2WZEA 3ACIA 1PX3A 1GMMA 4XURA 4IUGA 2VCAA 1UMHA 4E8DA 1I5PA 4OMCA 3IB3A 1GUIA 4OZOA 5JXHA 4BK4A 3GXUA 3C7HA 2E32A 4OMDA 5LA0A 1J84A 3K4ZA 2VMFA 3LEIA 2DDUA 2Y6LA 3BN6A 2ZEWA 4FI9A 1LNSA 1GOGA 3I2FA 1OT5A 2YG0A 4PT6A 4ARYA 1JZ6A 1TG7A 4AG4A 4BDVB 3WNMA 4CUCA 1PMJX 1CX1A 1UY2A 1PX4A 2Y64A 3T08A 1CZVA 2V4VA 5CYYA 4DXSA 4QB1A 3UESA 1O8PA 3VDBA 4DXRA 2Y6KA 3MV11 2YC4A 2VCBA 2WQ8A 1L7QA 1JZ5A 3DYMA 3W5NA 3K4AA 1WKYA 3SKJE 3MBWA 4M4PA 2VOTA 3JXSA 3K75B 4A44A 4XUTA 3UETA 4QX1A 2WUHA 3J7HA 5C71A 1XC6A 3I2GA 1JYVA 3K4DA 1JYXA 3CZJA 1JI6A 4QDRA 4RYDA 3LE0A 1KGYA 2HYXA 2VZPA 2WABA 3GDBA 2JKXA 2WO3A 5FUIA 3C7FA 3U37A 5C7GA 3HPNA 1CIYA 2W1WA 2WZ8A 4GWIA 3WNOA 2VMDA 3WNKA 2QQLA 4QPWA 4CVUA 3WNNA 4HG6B 5DN2A 2J1TA 3WSOA 1K3IA 1CZTA 2W47A 5JXJA 3A22A 3UNPA 1GQPA 2J1UA 5LA2A 4ZXEA 2WDBA 1JZ8A 5IYYA 5IFTA 1H6YA 3NJVA 1JHJA 4CU6A 3CDZB 1OF3A 3HJRA 1JYNA 1R64A 4Z2AA 1UYZA 2DCKA 3VDCA 4UI9L 3VD9A 2LW8A 5EJZB 3T0AA 3WEZA 5JMOA 4QX3A 3I3EA 5F7UA 2E33A 4ARXA 4A6OA 1US2A 2CDPA 3I97A 4BXSV 3IAQA 4UOJA 2Y8KA 1T2XA 5JR2A 2VO5A 3OGSA 2E31A 1UYYA 4UAPA 2XHNA 2WO2A 1DP0A 2Z4FA 3HNYM 2B4KA 4MOAA 2WN2A 3C7EA 4CU9A 3SKVA 3E1F1 3WF0A 3ECQA 2VZ1A 4A41A 3ACFA 3GGLA 1YQ2A 4W50A 1UXXX 1GU3A 2W95A 1DLCA 2C4XA 3MO4A 5JUVA 4QDSA 4XUPA 3PUIA 2VZ3A 2RVAA 4P00B 2L9LA 3ACGA 1O8SA 2EIDA 2W91A 5IFPA 2QQMA 1NX9A 2RJ2A 1MPXA 4DUVA 4QAWA 5B4NA 4YPJA 2X05A 4JKMA 2C9KA 2PQSA 4KMQA 4XVHA 3HOBA 1K45A 3OEBA 3FHAA 3I2JA 2BERA 4KWUA 2WAAA 3CIHA 4ZZ8A 4BJ0A 3C7GA 2HLEA 1WCQA 3C7OA 5G05L 4XZUG 2WAOA 2VZVA 2YC2A 1XNAA 4PF1A 5EIYB 3T0DA 3T2PA 4MGQA 2QQKA 4CUBA 1JYWA 2W3JA 5IHRA 2J22A 4PQQA 5C70A 3ABZA 4A3ZA 2VJXA 4P5YA 3W5MA 3DYOA 3THDA 4AAXA 3HN3A 4DEVA 1W99A 4DUWA 1HN1A 1UY1A 2VC9A 3THCA 3I2KA 1ULPA 4CU7A 5LA1A 1OF4A 4M4RA 3VD4A 3WF3A 3OG2A 2Y6HA 3CKHA 4P02B 4DUXA 1XNTA 4MADA 1UY0A 5JXGA 4OYUA 4P08A 1K12A 3MV01 2ORXA 1J83A 1W8NA 3I3BA 2ZEYA 4RN5A 2Y6JA 2VZRA 3SEPA 3AC0A 3ETPA 1UY4A 4OUEA 2KD7A 3FHQA 2OKXA 3FL7A 2W1QA 1UMIA 4TTGA 2WN3A 5DQ0A 4MO3M 2ZEXA 4A4AA 2C26A 2ID4A 2JE8A 3LEGA 3VD3A 3OGRA 2E26A 1BHGA 2QQIA 4A45A 4D0QA 3EB7A 1W9WA 4GWJA 3T2QA 1OD3A 3IIIA 2J7MA 3D3AA 3EYPA 3IAPA 2VZTA 2XQXA 2ZEZA 1W9SA 1NUKA 1UY3A 4DXTA 2BGPA 1UZ0A 1TVGA 2W46A 4A42A 2J1EA 5I0DA 4CUAA 2W1SA 2WYSA 2BGOA 3OBAA 3NRUA 5IJRA 1P8JA 2WBKA 3LEKA 3OGVA 2XOMA 1L7RA 2VQUA 5EJ1B 3I3DA 3P1IA 1XPWA 2J1RA 2DCJA 1SHWB 5B4XA 2BBAA 4QDQA 1KEXA 2VZSA 3F2ZA 1SDDB 3DYPA 5G04L 3A21A 4XUOA 1ULOA 4LHSA 3WNLA 2RV9A 3T2OA 2VM9A 2ORZA 4MGSA 4QB6A 3P6BA 4JKLA 2VTFA 2XONA 4JX0A 3VDAA 3DECA 2CDOA 2VMEA 1NKGA 3LPGA 3WQBA 1JZ2A 4W8JA 4QX2A 2VR4A 3I2IA 3K77A
chains in the Genus database with same CATH superfamily
4D6SA 4AF9A 2VBBA 1XU1A 1U5IA 2RR11 4MX3A 1F4HA 5T5LA 2PHXA 1UYXA 1LENA 2Z79A 1XSQA 4CDWA 1IS3A 1RUG2 2RS53 5FPUA 3V0BA 2PHRA 2P2KA 2ZOEB 4B7KA 1MZ5A 1W6QB 2QQJA 2PAKA 1S2BA 2DUPA 5ERLA 5FZMA 4AFCA 2BEOA 3B69A 4GWNA 1OURA 1AXZA 2J1VA 3MIFA 3T4VA 4AL9A 5L9VA 3AZZA 1SQ4A 4IEYA 3PUAA 1COV2 2AREA 2BVBA 1V9U1 4LBQA 3WOGA 2DCZA 4XUNA 1RUC2 2HWE3 2BVVA 3LDBA 1C5IA 4ET7A 1W6PB 3QD6A 3AMHA 1NT0A 2XVGA 5L19A 2R073 3W20A 5K0UC 1JMUB 3WF1A 3U75A 3LQCA 3AKPA 4XFGA 1CAWB 1LULA 5K8SA 2E7QA 2YUEA 4MXVA 3C3VA 1PNFA 4TXWA 2A6YA 2XJRA 3POJA 1UQXA 1UIJA 5FZOB 1ZVFA 4IETA 5FCCA 1JZ4A 2MEV1 4XXAA 5T3NA 5BNPB 5IK8A 4AQ2A 1B35C 3GHNA 3RDIA 1QXJA 1R091 5LZ6A 1IG3A 5JIAA 2XJUA 1KD7A 2A1XA 1TZOA 1CONA 3AYEA 4YG6A 1PIV3 1Q8VA 1TME1 1FMD2 3UT0A 4Y26A 3ZN6A 2W94A 3N9PA 4FTSA 4E9KA 1VB4A 4GZ9A 2WZPP 1HDKA 4DPNA 1XE0A 1WMDA 3AZVA 2I2SA 1UOJA 2IXIA 2HWC1 5FZLA 3R4UA 3ZO0B 5EFUA 1VBA3 1HQWA 2R043 3ZXAC 3ZR5A 2LM3A 5FPZA 3KV5A 2DVAA 1O4TA 3GBWA 3T1LA 2MHFA 1PGSA 1KITA 3D0SA 1JUIA 1H4HA 3TB0A 1YIFA 1UX7A 2VH9A 4ZS3A 3T09A 4AVSA 3VKNA 4NIHA 3BALA 1D4M2 2VCCA 1NCRB 3K3OA 3OBTA 1YQCA 3R05A 2BPA2 5KHHA 1YEWA 4JKKA 1RITA 4LQRA 4NIIA 2W0XA 4M3CB 1SBEA 3BKZA 3H8XA 2JD9A 1D2QA 4GMP1 4RS5C 4C1XA 4CZSA 4UBGA 5DMYA 4XPVA 3VBRA 1US3A 2AGSA 4QX0A 4L9BA 1ZRDA 4LPLA 4H55A 1X8MA 3T0BA 5JDBA 2AC1A 5FZIA 1C3HA 3MPBA 3JCIA 5BUVA 1GZCA 2RMU2 4Y3OA 5F39A 3O0WA 4WV8A 1OLMA 5FYZA 3BTYA 5CG8A 1VPHA 2MNGA 4YG0A 5LB6A 1SBDA 1SZBA 4FPFA 1IPJA 2QQWA 1WD3A 1GNYA 1W9TA 2ZGQA 4QB2A 2WKKA 4RGKA 4XDPA 3RJ2X 4M3CE 5A6XA 3KV6A 5A1AA 4M0NA 1TEIA 2WJSA 3U14A 3USUB 4FOVA 3WT3A 3N9LA 4COVA 3NKGA 2KA3A 3R4SA 1QQP3 1SACA 2D6PA 2VCAA 4KQ7A 3RI8A 1OOPC 1Q8OA 1CJDA 1STMA 4KH9A 3I2OA 4H7MA 2FCVA 2RHPA 1ND2C 3LOIA 1OMIA 1MR5A 2ZHKA 4IV1A 4LO7A 4AGGA 4DRVA 4OZOA 5JXHA 2DU1A 4AK3A 2RJKA 3AKSA 3GZAA 3OYWB 4LT5A 4GMP0 3GXUA 2YMZA 1ZA7A 4AI8A 5FDBA 3VKFC 4OLLA 2AR6A 3KHBA 2DBIA 5F37A 5LA0A 3N3HA 5L73A 2A6ZA 2W2IA 2XJVA 4FTBA 4B1LA 2VMIA 3OD4A 4UFLA 3N9QA 1LOEA 2PELA 4FI9A 1RXFA 1GP5A 4E2GA 1XNKA 1O3SA 1OT5A 1WWYA 4BLIA 3M3EA 4LLFA 4RS5B 4ARYA 1JZ6A 1H8TA 1TG7A 4PLNA 4AG4A 1DGWX 4CUCA 5BYNA 5LASA 4EN9B 2JE7A 2UY9A 1CX1A 3DPRC 2NQYA 1PX4A 1AYN1 2ZGLA 1CIWA 4GULA 4CEYB 3VLBB 5CYYA 2ET1A 4DXSA 5C9AA 5FY1A 2X5IB 4AYUA 3ILFA 3ZLIA 1O8PA 1VBE3 1H8TC 4FVVA 5FLIA 4NUBA 3UV9A 4Q29A 2VCBA 3JBG3 1W0PA 2MEV3 1JZ5A 3W58A 1IQAA 1E5SA 4N9HA 1PMIA 4ZU4A 2XPJA 1AX1A 4XBLA 3ZYRA 3KGZA 5BNPA 4D6QA 3N35A 2ZKNA 3MIHA 3UETA 1K5MB 1CD3G 1WMXA 5C71A 3WG2A 2ZGUA 1W6MB 1JYXA 3CZJA 4JGZB 3H3UA 1W6OB 1KDMA 1KGYA 1QKQA 3E6BA 1AR62 1GV9A 1W0OA 5AVAA 1FATA 3PJQA 5DZGA 2IWGB 2Q5TA 2WABA 1PM7A 1FPN1 5EHDA 4IV3A 4QPIC 4P9JA 3H7JA 4LKEA 2JKXA 2WO3A 4SLIA 1XRUA 5FUIA 1PVC1 2QCSB 1E5HA 1FMD3 1WLTA 3CLPA 4UYBA 4P9YA 1J3PA 2EF6A 4JGZC 2VOXA 1POV3 3V56A 4C0HA 1KRIA 1VBC3 1LOAA 2D97A 1OUXA 4MGZE 5FK7A 3VZNA 5C3PA 1WCDJ 4LOSA 4CEWC 3HR9A 3WNOA 2WFF2 4WVMA 3WW4A 5CISA 2YPDA 4LHNA 4MHUA 2RR13 3BOPA 5FIXA 2BWCA 1ODNA 4GJYA 3U4SA 1Y9GA 4CDWB 2J1TA 2RDRA 4Q4V2 3WSOA 4MXWB 3PURA 1DZQA 1MS9A 5FYIA 3USUA 5J3UA 5FZ3A 2P3YA 3ZFGC 1DCSA 2WFPA 4G3YC 2DBNA 3WUCA 3M3CA 1AHSA 1RHI1 5BNOA 3VGIA 1Z7S3 2YU2A 2WDBA 2G19A 4QT6A 2Q8DA 1AJKA 3AZXA 4YW4A 5IFTA 1H6YA 2N7GA 3NJVA 2CHHA 5FYCA 4NWVA 2NPIA 5CKQA 3N9MA 4COWA 4AZZA 2VMGA 4BQ5A 1G6NA 5HCFA 2IUWA 3FC0A 4L2NA 4PI2A 5JSOA 2X5IA 1FV2A 1EAH1 5EJZB 3ZDVA 5A3WA 2JDHA 2GH2A 2W68A 4HN1A 5FO9B 5JAXA 1J1TA 4XAAA 4CCNA 1ZBE1 2D6KA 2R062 2NMOA 4QGLA 1ST8A 3VZLA 1ZM1A 4XBNA 4BXSV 4DMIA 4UOJA 4B3NA 1XB9A 1TNFA 2Y8KA 3VBUB 2JENA 1R1ZA 3VBFB 2VPVA 3KS7A 4NR1A 2VO5A 3OGSA 1I9RA 2E31A 3DV8A 3PTRB 1OVPA 2PHFA 3NKTA 1DP0A 4NPMA 3SQOA 4LBLA 3INAA 2B4KA 3EO6A 5CFDC 1DQ6A 1YWKA 4MOAA 3RNSA 3VDDA 5BNNA 4W6WA 3C7EA 3WF0A 3ECQA 2DU0A 1OOPA 4Q8LA 5FZ0A 3MF6A 5LA9A 1ULEA 2EXKA 3VBSB 1DGWA 5FMOL 2HH9A 3U78A 1UXXX 1ZRCA 1VRH3 3H8OA 3VD9A 1YJKA 4IE7A 3VKLA 1WCSA 4YGBA 2GDFA 3ST7A 4COYA 1GICA 2A6WA 4JGYB 1NCQB 2O1QA 4YZ1A 5GLWA 1QHDA 3ACGA 3AB0A 4BQ2A 2PHWA 2W91A 3LFIA 3VBOA 3O14A 5F5CA 5FY5A 4QXBA 3S30A 2WS93 5F5AA 5F2WA 1S55A 2RM22 5JSPA 1ONAA 2W08A 2WFF1 5FKCA 4DUVA 2GN3A 2R49A 4Q4W1 2C9KA 3BPZA 4PLMA 4OUSA 4XCAA 3OUJA 4XVHA 2CSGA 4WM7B 2WLPA 1MACA 1W8ZA 1LHOA 2YYOA 4KL1A 1JODA 5C3QA 3WG1A 2WZR1 2BERA 3I2JA 1VP6A 3LCPA 3URFA 3CIHA 5ABJC 4YM0A 3HN1A 2GZWA 3SXWA 3WDXA 3TEYA 4L97A 4GMP3 4QX8A 3C7OA 3NV1A 5AVPA 2D5FA 3HIFA 2JG9B 1RUG1 1F31A 2YC2A 1XNAA 3RYRA 3HAGA 4PF1A 4XTPA 1UOGA 3QBQA 2OUHA 4R8HA 4RHV3 5I8SA 1GKBA 2IXLA 2WC2A 4INDA 5F6LB 4A7KA 4BZ4A 1S0CA 2Y0IA 3UGGA 3WUDA 2B9UA 2P4EA 2K46A 2OX0A 4Y5Z0 4QQPA 3ZFEB 4FO9A 4MUVA 2TNFA 4AGRA 1DQ5A 1WUVA 3AL6A 4FP3A 4Q0VA 5H9QA 5IVYA 2R041 2Z69A 2VJXA 2JX9A 1EY2A 4I09A 3W59A 4NIGA 5DAPA 4P5YA 1W06A 4R9AA 5JOXA 3T3YA 1C8M2 3I7DA 2ADEA 3N4MA 1TMF1 5KHGA 4Y5TA 4C91A 2HWB2 1YXWA 1AR71 4DUWA 4Y1XA 1HN1A 4YZ3A 4QPGC 4ZXKA 4OHZA 1V6MA 2DCTA 2DYCA 2A70A 1UCXA 2OQ6A 2ARCA 2VC9A 2UWBA 4AHWA 4CU7A 2WWUA 1OFNA 4M4RA 3ZR6A 5A3UA 5FR3A 1SLTA 2HKXA 4OQ9A 1VJ2A 4HPKA 1LESA 5FTTC 1AR83 1Y4WA 5JMCA 3E6DA 2QNKA 2WRAA 2RDSA 1BK1A 1CPNA 2ZMNA 3KV4A 3LDRA 1MZ6A 4CP0A 4QX7A 3MV01 2JG8B 2R061 3LIHA 2CWSA 2P37A 4CDUC 1XU2A 2GMMA 5BV6A 2XWJB 1W8NA 1C8M3 2HWE1 1BMV1 2XB6C 3MICA 1CAVB 1ZBA2 3AL5A 2HBTA 3G6JB 1ULDA 3FHQA 2ET7A 2OKXA 2DF7A 4GA9A 4GIQA 1UMIA 4IDZA 5LRSA 3POGA 4MG2A 1RVF1 2WO7A 1WA6X 5FZCA 4XC9A 1U12A 1QJU2 5FY8A 3V0BB 4MGTA 3MYXA 1QU0A 1RL3A 1CVNA 1FPN2 1RB8G 3LEGA 2ZGTA 3NW4A 1RJ7A 1BHGA 2XLGA 1LOFC 2QQIA 2DTWA 1AZDA 1UPSA 3MDPA 4UFKA 3RWNA 3TN92 5FOJB 1VMFA 1X82A 3BIEA 2FZ1A 4S2HA 4XEZA 1L3JA 1E5IA 4FPEA 5A7SA 4L8QA 2Y0OA 2ARXA 1HQLA 3VL9A 5FQ0A 4BYYA 4EZHA 4PBOA 4E2SA 1SCSA 2CU5A 4DXZA 4LXLA 4EN8B 2OA2A 4TN7A 1LOCA 3S0MA 1ULGA 1UY3A 2QDNA 4DXTA 1IKPA 2BV4A 1UZ0A 2PHLA 2J42A 3HT2A 4WM8C 4UWDA 1COV3 3I3QA 5I0DA 3OYWA 5GKAC 5EP9A 5K0UB 2BGOA 1QJY3 2D44A 2ZTNA 3KV9A 4JRLA 2RG4A 5JR7B 4CDWC 1W8WA 1ND3B 1FYUA 2WBKA 1CPMA 2BGCA 1NYWA 4LO8A 3UK9A 3KT7A 2XL9A 3NJYA 3POSA 3OGGA 4I30A 4I0WB 1ENRA 3HWJA 2QZ3A 1PO12 5A3LA 3M1HA 1KXGA 1QJFA 1EAH2 1ZRIA 4ZU5A 1POV1 2BBAA 3K48A 1LHVA 3SCHA 4QDQA 4PLOA 5LATA 1ND3C 1OHFA 3DXUA 1B35A 1I5ZA 3FZ3A 3GF6A 1OI6A 1W2NA 1ZZ9A 4S2GA 3A21A 4HLTA 4KNCA 4QXKA 1UAIA 2BP6A 4BIOA 2E6VA 4LA2A 4LHSA 4I0BA 3GNEA 4YLZA 4I02A 3T2OA 1ZRFA 2VM9A 1MZFA 3HD8B 4GB33 3P6BA 3BODA 3KVBA 4JKLA 2WA4A 2EAKA 3J7NA 2ENRA 3FHIB 3VBHC 5IT6A 3WQBA 4YGCA 4AE2A 1G9DA 4B7EA 4W8JA 4HVQA 5CFCC 1OH3A 2JXAA 4GB31 3PVNA 1NCRA 2ZX2A 5FV3A 3DCQA 3HBKA 1Z0HA 4LA3A 3FWEA 4RHV2 4WZFA 3SEEA 1TMF2 3JBG1 3BVCA 4CCMA 3JQXA 2JD4A 4GALA 2F6BA 3WDYA 2RS12 4LBOA 4JCKA 4JHZA 4AHXA 3D0JA 5F6KA 2JDKA 4RL7A 5ANQA 1GFF2 1GZWA 2F4LA 3PDQA 3MIEA 4I0AA 5J96B 1ND2A 4IV1C 2EXJA 2QZ2A 3A7QA 1AL23 3E5XA 4XETA 5KWRA 2YB7A 3ILNA 5J36A 4AHZA 2XJQA 1YQ8A 2D43A 1W6NA 4ISRA 2GAUA 3ME2A 1PMHX 4P9IA 4LHLA 1JZ7A 4Z82A 1D7PM 1NE4A 4GKYA 2BTVC 1OUSA 2X29A 2X09A 1WLCA 2R32A 2GNMA 5I0TA 1IZ3A 2QQVA 5TSWA 4XHXA 1QJX2 3WG3A 1K42A 1HRI2 2IXHA 3F95A 3CZUA 4W6YA 1ZBA1 2R1BA 1VR3A 4FQ4A 3T4HB 1JU4A 3RMYA 5KC6A 3L2HA 4XQ4A 4K9SA 4RSUA 2WZR2 4GKXA 1CAWA 1LEMA 4KWLA 3WLUA 2H0BA 4YW7A 4BK5A 2Q0AA 5JSRA 1JH5A 1VIWB 2QBXA 4HKOA 3POIA 3SH3A 4I01A 3MW2A 5T50A 3RYKA 2W92A 5HBAA 2XQRA 2BYVE 4QMAA 1RUI1 4IEPA 1QF3A 2B8MA 1VBD2 3VD5A 4A3XA 1ZZ7A 4LBQB 3CF6E 1ZREA 1S2EA 4LKFA 3J26N 4QGNA 1V0AA 3Q8EA 1W6NB 3H3ZA 4PCRA 5FYUA 5HPOA 1QJX3 1A6CA 2Q30A 1OH4A 2IXKA 3NJXA 4Q4W2 4YARA 1OLRA 3K46A 4YZ5A 2D3RA 1W0NA 1UWWA 2R7EB 2JG8A 3SLIA 3ZFEA 4ASLA 5IAXA 5KR7A 1RHI2 1LTEA 2R30A 3HNMA 4L92A 2QFEA 1UX6A 4YM2A 4EWDA 2EICA 3HNBM 3TEXA 4XZPA 5FOBB 1F4AA 4TLGA 4EE2A 4HETA 2XL7A 4B1MA 3WDWA 2DVFA 5KXEA 5LWBA 3M4FA 2X10A 5J1XA 3PTYA 3TBDA 3IKWA 2XJSA 4XJZA 1PO21 1H2KA 4FFFA 2EIEA 3OEAA 1WZXA 3WQ7A 1B09A 1H2MA 1UZWA 2W87A 2JDAA 4XQWA 4NAOA 5FWEA 2VULA 1EUTA 1WW5A 1H2LA 1S1AA 3JBG2 4KU7A 4BQYA 1LGNA 1VBB1 2VUAA 1TQ5A 3D4KA 4QPYA 4DRRA 4E8CA 4MZUA 1UZVA 2ZGPA 4DIQA 4CDXA 2WYFA 4AHYA 3N36A 1SLCA 4AOCA 1AR73 3V0AB 4FPYA 1LJ7A 2G1MA 3LB9A 4LORA 4Q0QA 3RMXA 3USSA 1RC6A 3ZXDA 1MQTC 5FY0A 5KXCA 5JPNB 4DEQA 1N3OA 1CX4A 4BB3A 2FMDA 1H6XA 1D4VB 2Q8EA 1HRI3 3KF3A 2IXJA 4NN0A 3ACHA 1IPKA 2WZEA 3AXDA 4XFIA 4Y24A 1X33A 5FMCA 2CY6A 2R0HA 3ZYHA 5KHJA 3BPSA 1VE0A 2GP5A 4CXXA 1BCXA 5FMOS 4E8DA 1G9AA 4HVRA 4KG0A 3RVHA 3RGBA 3RZGA 3IB3A 1UU5A 4RHV1 1XNBA 4AVVA 3KSCA 4BK4A 2LUWA 3GZTB 2HEWF 1KJRA 4AI0A 2E32A 1PO23 4OMDA 1AXYA 2EVXA 4GJZA 1MVQA 1J84A 4OCTA 3JQWA 3K4ZA 2VMFA 4RQPB 4CDQC 1XJAA 2Y6LA 1AYN2 2VU9A 4GD4A 1DQ0A 4IEXA 3RS6A 3VHPA 2PYTA 4LIVA 2WZR3 4M01A 3E5QA 3WHUA 3AM2A 1LNSA 1RUJ1 3KCCA 3ZN5A 1RVF2 1U5ZA 1W3VA 1J58A 5M0TA 1DIWA 4CE8A 3PU8A 4Q0SA 3TEZA 1XYPA 4QU1A 2JWPA 3WNMA 4XYXA 5GZGA 4Z92B 1O3QA 5DG2A 4YVWC 5A6ZA 2E63A 3KB5A 5CFCB 1AF9A 3PVOA 2WNUC 1OQEA 5C4WA 3ZXKA 5KBFA 4E4ZA 3OY8A 1Q43A 4JRAA 3RJRA 4XHBA 3GCWA 5HCHA 3OBZA 2C5DA 1RUH3 5JZGC 4DXRA 1RTVA 5L9BA 2I07B 3MV11 4ONUA 3ZFGA 3MEPA 5F1RA 3DYMA 3W5NA 4OQ8A 5C9AB 1AR61 3E5UA 4AFMA 3WX5A 5KXBA 2VOTA 4Y1VA 2O0OA 3O1TA 4J25A 1VLNA 1OBNA 3OUIA 4F3JA 4FXKB 5JIUA 1FV3A 2GMEA 5HCAA 3U1XA 4ISQA 1N47A 1ZBA3 3BIWE 4QX1A 2WUHA 1FOD2 4OUMA 3AP9A 3FUOA 1OPOA 4WM8B 3VBUA 3VBFA 5FZGA 3K4DA 4C90A 1JYVA 1QMJA 5GJ6A 3O1VA 1VRBA 2D7FA 4N43B 4QDRA 2JDNA 5EJ3A 2PLV3 1GLHA 2YY1A 3W21A 5DDJ1 3AYAA 3GDBA 4QPIA 4IV3C 1NY71 5FPBA 2UYBA 3C7FA 3DKWA 1CAXA 1W8UA 1OLME 1EP0A 3U37A 5CU1A 5A3NA 4IQPA 2R16A 3PIJA 2PN5A 3VHNA 2A3XA 2XKPA 3A0NA 2W1WA 4D7SA 2CAUA 3WNNA 4A7ZA 2XBO2 1OKOA 4HG6B 4YVWB 5BNPC 2QQPA 4FPLA 3TNQA 5BNOB 1AYM1 1HRV3 4IW3A 1OQDA 3AKQA 5DN2A 1DLLA 3KGLA 4MXWA 2ES3A 2JDZA 1NY72 2VNOA 4MGYE 2KXLA 5I93A 3DEMA 1GQPA 2A7AA 2OVUA 4AVAA 3VBHB 1JZ8A 2ILMA 2BFUS 1Y9MA 4LE4A 4AR2A 3U0ZA 3NNLA 2P5BA 2HYKA 4UXAA 4H3WA 4W65A 5B2GB 4CU6A 3CDZB 3IM0A 5FP9A 5K0UA 1R64A 1JYNA 3IWZA 2D3SA 2FD8A 5FP3A 2DCKA 3VDCA 1UW8A 4UI9L 5DAQA 2LW8A 3UKTA 2JJ6A 2VUDA 2B5HA 2GC0A 3ZKUA 1DBNA 1GP6A 3MHZA 4IL7A 3WEZA 3TWIA 5FJHA 4CEYA 1W05A 4QX3A 4YNIA 5DAWA 1CGPA 5L36A 4CPBD 2JB8A 4Y22A 3SNMA 4DY5A 2WNVB 4QPGB 1APNA 4LMFA 2CDPA 3DKQA 1NG0A 3N7MA 2GALA 4YSFA 1T2XA 1PVC3 2VOWA 4ASMB 5JR2A 4QHBA 4G4FA 1WCUA 4PDWB 4P9GA 1UYYA 4UAPA 2XHNA 2WO2A 4XBQA 3PU3A 1LECA 1PK6C 1F35A 4ZONA 1JS9A 3SKVA 3E1F1 5GLTA 1CN1A 2VZ1A 1EYBA 4XFHA 3O1RA 4WVVA 4E4DX 1C1FA 1QNYA 5E1RA 2ZZQA 3CEWA 3U10A 5FUNA 3WD5A 3WZ1A 1CAVA 1S0BA 5C5UA 2ZAHA 2C4XA 4IGQA 4N53C 3R0RA 1PVC2 3AZWA 4QHOA 1J1LA 4QDSA 3LA2A 2EAAA 4EYUA 1BJQA 1DYPA 2QKDA 4XUPA 4PJYA 4YYOA 1YJLA 5A3TA 4H7LA 2VZ3A 1DGRN 4D69A 4DZGA 3LZZA 1O8SA 1ZZ6A 1HX6A 1V6JA 1VB2A 1YI9A 4JDOA 5KC5A 2B45X 2LRPA 4QPGA 4HXCA 1HRI1 2CTVA 4HPKB 1C8NA 2E9QA 1RUC1 1QGLA 3AKRA 1RVF3 4PF5A 4QAWA 1HXS2 5DUVA 2X05A 4JQRA 3VDDC 5B4NA 3BUCA 1LB2A 3QH6A 1GSLA 4P9LA 2E7AA 3NMBA 4RFT0 1R1A3 4XJ8A 1JYCA 2YZ4A 1QH6A 1BBT3 3ZN4A 4CCDA 3LKJA 2QTWB 1JBCA 2HWD1 4ZZ8A 5FPXA 2FDIA 1XOYA 2VBDA 1JTZX 1WCQA 5G05L 4LUMA 2XUEA 1H9PA 4P5HA 4JDMA 2WAOA 2YROA 2FCUA 3RSJA 2DURA 4QM8A 5HI0A 3ZSKA 3T2PA 4A2UA 2PHUA 1YI7A 3H8RA 4OHVA 4B4QA 2RS32 2HWD3 4MGQA 1JOPA 5F3EA 4AEDB 3AVSA 1MS5A 2JG9A 3AP7A 1UYPA 5GZDA 3V0AA 1QOTA 1Z7S2 1MVEA 3ABZA 4NRMA 3V65A 4A3ZA 1JUHA 2EALA 5FP8A 5FY4A 3DF0A 3W5MA 3DYOA 1SFNA 1CAXB 3RYPA 1LOFA 2JIGA 1FOD1 1FX5A 3VBUC 3HN3A 1X36A 2RJLA 2QJVA 3CJXA 3VBFC 1V6IA 1LR5A 4A6SA 1X7NA 2BJSA 4PIZA 3THCA 3LAGA 3I2KA 1BVP1 1OF4A 5FZ8A 5CFDB 5A7NA 3R6SA 3FFQA 5FREA 1VBA2 1GWKA 5CADA 2KM2A 4NO4A 3ZIXA 3UGHA 3CKHA 1HQNA 1ENQA 3DXTA 2XG3A 3X29B 1UKGA 4JGZA 4YVSC 4BWOA 2AACA 2ZGRA 4NHYA 1BXHA 2WNUB 1R092 4TZDA 4U2AA 5CKMA 3ZXGA 3ORJA 3QLQA 1K12A 5F5QA 4XF4A 3JB8A 4QX5A 4JGYA 2ORXA 1U0AA 4FAGA 4FXGB 2CNAA 1NOVA 2JEMA 2XBO1 5IK5A 3ZXJA 5LEKA 2ZEYA 3ATGA 3H1WA 1N1SA 2Y6JA 2RM21 3AJZA 2Y33A 3ZSLA 3POEA 2KR2A 4RGGA 2XJPA 1HV1A 2PHTA 3AC0A 3C2UA 1UY4A 4PBPA 5I91A 1PZ8A 1VBA1 5CIRA 2NM1A 1NA1A 4Q4W3 2E53A 5DQ0A 3Q8CA 4MO3M 4AGVA 4QXHA 1CAUB 2D3PA 2IFRA 2Y6FA 4NRPA 3Q9OA 4LNVA 3GALA 2ZHNA 1H9WA 1BEV2 3WV6A 3FBMA 4CTEA 2I74A 4JVAA 3S5AA 5A3PA 1PIV1 1TME3 3VBRC 2ARBA 4X8NA 5F3CA 3BU7A 4N9IA 3MW4A 4FTEA 1NCQC 4R4ZA 4TYSA 1LKNA 1W9WA 3UYJA 4O9EA 3POFA 3I8TA 3RZZA 5L7OA 5FZEA 1VRH1 2WNVC 2D40A 2WA3A 4Y22B 1URXA 2VZTA 2ZEZA 3NAPB 1W9SA 2ZPXA 2WT0A 1N3QA 3VHRA 3MZHA 3I2DA 5DZEA 2GC2A 2W46A 1WCKA 2UWCA 4K8FA 4CUAA 5K4LA 4XF0A 3TNPB 3PUQA 4IEUA 2WYSA 3RG0A 2NYYA 5BNOC 4I2OA 1H30A 2AZ5A 3OBAA 4A7YA 4Q4X3 5FY9A 1P8JA 4FPOB 2ZZJA 4QU2A 5A7WB 4AEMA 5K9YA 1ASJ3 3OGVA 4GQ7A 2VVDA 1L7RA 5D8AA 3H9AA 3I3DA 5C6CA 4AQ6A 4UF0B 1MEC1 2BNOA 4LOTA 4ORFA 1XYOA 2DCJA 4CUGA 2UWAA 4PDWA 3VBSC 2VW0A 1QJZA 5KHIA 2UU8A 3IT8A 5APAA 5A3OA 1AYM2 2ADDA 2P3JA 4C8DA 1OPMA 5FAXA 3P5BA 1F5JA 3F2ZA 4Y1ZA 4WVMB 1ULOA 4X6QB 1MS3A 3WNLA 1JOJA 2F4PA 2PA7A 2RV9A 3FUQA 4BQ4A 5FMBA 3WXPA 4CCLA 4HANA 1X9PA 4AEKA 2XONA 4JX0A 4DINB 2WNOA 5LEJA 3B9CA 4LO4B 1Z7S1 4QPIB 1H4GA 5IK7A 4RR3C 4F83A 4LBJA 2C1FA 4P9WA 1HN0A 4IE0A 4I3GA 3K77A 4NIDA 1O6UA 3FLTA 3ZVXA 4EV0A 1AR63 1UN1A 2BOJA 1ULFA 1NAEA 3KQ4B 4KGGA 1WBLA 2OQ7A 4IE4A 4EN0A 1DFQA 4Z2WA 3ZSJA 3WW2A 1K5MA 1LEDA 1RUH1 4PIXA 3PJYA 4LK6A 5DUXA 2D98A 2BUKA 2VTXA 3IDAA 4AI3A 1I3HA 2PFWA 1C1LA 1UZZA 2IZWA 2WIIB 1DQ1A 4EWEA 3HEIA 3G7DA 1VMHA 1MEC3 1S0FA 2JIJA 3THPA 1CZSA 3OB8A 5J7MA 3ZFGB 4Q4Y2 5C8CB 2HBUA 2ZX3A 1W8OA 2RDNA 1Q56A 4R9BA 1FPN3 5C8WA 4LKSA 4QGMA 2VMHA 3U07A 3ZN6B 1Z78A 3NNMA 3PUHA 3MW3A 1VBE2 2WT2A 2IVIB 5JWPA 1G8WA 2FCTA 1RMU2 3AJYA 4IERA 3CQOA 1O7FA 4SBVA 1A8DA 2VXJA 5C8CC 1PGW1 2QQNA 3SISA 2VL4A 4X6RB 2YFZA 2ZXQA 1SPPB 3WHTA 4EN7B 4WZCA 3PIGA 4BM8A 4GB32 1DYOA 3UL2A 1F5FA 1RINA 1AR81 2LALA 2WLQA 5LRRA 4L0PA 1UMZA 3ENRA 3S6PA 1JU3A 2WO1A 4AEDC 2QE3A 3IMNA 1QJY2 2FMYA 4HSLA 3TYJA 3KLSA 1EV12 5DPNA 4BHPA 4AEJA 1TMF3 2BNMA 5KHKA 1GZWB 1MS0A 1MS1A 1AYN3 1OKQA 1PGW2 1RMU3 2D5HA 2W9XA 3ES1A 4LUKA 3PHMA 4XFCA 5FPLA 3WF4A 4ES8A 3QH7A 2JG8C 3VBHA 3WDUA 5E6HA 2D93A 3OPWA 3AFGA 2WWSA 4B8EA 3A0KA 3BGAA 1AR82 1GOHA 3D6EA 1S0IA 3VV1A 3K3NA 2BFUL 1X9TA 3WF2A 2ZMLA 4EWAA 3N7KA 1RUE2 2XHKA 1I1EA 3GM8A 4YZ2A 1W2UA 2NMNA 2X8KA 3MUZ1 5CB7A 3UJQA 5HXMA 4J1WA 1ZZ8A 2EXHA 3H0OA 2UY8A 1WD4A 1IG0A 1GOFA 2YFUA 4QKDA 3C8XA 3IMMA 3TRSB 3ES4A 2VZUA 1XSRA 4O7XA 4NPLA 1HRV2 1UOFA 3VUOA 4R9CA 5ACA2 1H0BA 1QQP1 4OZXA 3NL1A 5JXIA 3APBA 2JG9C 1N1VA 3EQEA 4KI5M 5DDJ2 3ZYPA 3N9OA 3W9AA 1RUD3 5FZFA 1WMEA 4ZHNA 1W8FA 3AMPA 5IWFA 5E16A 2XR4A 3JD71 4JZRA 4XUQA 2CGOA 3JD73 2VW1A 4YGDA 2JKBA 4WM8A 4XJWA 3Q8BA 1IQDC 1F9KA 3LIGA 4W4ZA 3B93A 1PX3A 4XJUA 4Q8KA 1QJX1 4OVEA 4D3WA 4IUGA 5A7WA 2PLV2 3GJBA 4D7TA 2VNRA 2ARAA 4N7UA 1XQNA 1IGOA 1W2OA 4HN0A 3MF9A 3ZSEA 1U5XA 3MLKA 4HKWA 1GUIA 3H3LA 3NV4A 4LKDA 2XJTA 2K9ZA 1O4ZA 2JDUA 5CA6A 5D1IA 1K5MC 1VBD1 2DVGA 1EV13 2BU9A 3SCGA 2IXCA 3NAPC 1ODMA 5C3RA 5DABA 5T52A 1OSGA 5LBFA 2R6QA 5CFCA 2ZGSA 3LSEA 2ZEWA 2ZMKA 4Q1PA 4QM9A 4BXFA 3BI3A 2BW8A 1ACCA 1GOGA 4P9XA 2FDGA 3VBOB 2DCYA 4D6RA 4PT6A 5I8TA 4QWNA 4GWMA 2CYFA 4EJRA 2PXJA 1PMJX 3NWKA 1UY2A 4FPCA 4HFSA 1RMU1 3TOJA 1SLIA 2VOKA 3O12A 5IW0A 1ENXA 4CCEA 2V4VA 5FYBA 1HKDA 1Y7BA 1QDOA 1JYTA 2PAEA 4L99A 3AFKA 4QB1A 2VW2A 4OFGA 3UESA 4PIYA 5FXXA 3ELNA 1YO8A 2A71A 3O1SA 2A6XA 4YVSA 5FPAA 3ZSMA 1MS4A 2DFBA 4GH4C 3VDBA 1DHKB 1ZA4A 1LGBA 2FBEA 2H0VA 2WQ8A 4ASKA 2BOIA 1IHMA 1UD1A 1PK6A 3MBWA 3WVJA 4HT1T 4M4PA 3ZMNA 2ZGNA 3JXSA 4HL0A 1GYKA 2A6VA 5FYMA 4YG3A 5D8AC 2X53S 4XUTA 3VZKA 5AC91 5I0UA 3I2GA 3BCWA 4G9SB 2XWBB 3O5SA 1V6LA 2Y26A 3T30A 1JI6A 3LSDA 3VKOA 4R9DA 3OSDA 3IN9A 4DS0A 3KHCA 2SLIA 1ZYBA 3B3QE 1QXPA 1OLQA 1CJPA 3TN91 4LE3A 3UGFA 3VKMA 5GZCA 3SHRA 1UL9A 3LWCA 5C7GA 4AFAA 4NHXA 4FOWA 4S2FA 3HMYA 3N7LA 4AVTA 2WZ8A 3H50A 1WLDA 4R4XA 4GWIA 1FMD1 2VVFA 5A33B 2BRTA 4QPWA 4CVUA 3TN93 4XF3A 1NLSA 3ZFFA 3I49A 3B5LB 1NXD1 4C1WA 1AR72 1LOBA 3DUIA 5DAXA 2XKOA 4QKFA 4Q26A 2VGDA 1RUNA 3PVBB 4N53B 2IFWA 4KWKA 1QJY1 1K3IA 2W47A 1NXMA 4UW5A 5A80A 3O7OA 1D0GA 4BMBA 2F17A 2ETEA 3A22A 4HSJA 4JC1A 5JXJA 1OFSA 2J1UA 4ZXEA 4EZ4A 1DU3D 5AC93 4CCJA 5IYYA 3P3PA 1Y3TA 5C5TA 3DGTA 2NN8A 1JHJA 3GZEA 1OF3A 4MLOA 1HJGA 1FI2A 1X50A 3ITQA 1YFXA 2YXSA 4PHZA 3ZMOA 2GMPA 5DAVA 3U11A 5JOYA 4XDQA 5A32A 1KQRA 2DV9A 2OPKA 2FDHA 4RA0A 5FXVA 3J8F1 1J3RA 3RQ0A 1YYNA 1HB2A 4CDUB 3OCPA 2E33A 3CJIC 4NHKA 3OUHA 4ARXA 1POV0 3TAYA 4YM1A 3WW3A 5LBEA 1US2A 3I97A 1R082 2C0ZA 4JV4A 3IAQA 4CDQB 3RZMA 3FFZA 4CEWB 3E6CC 1HV0A 3O0XA 5FZ1A 4NHLA 3KT1A 4NROA 1XE8A 1NCQA 4AQSA 1NQDA 4AXOA 5A1FA 1CR7A 4Q4X1 3HNYM 4IEOA 3IBMA 5F9TA 2DWRA 5FMDA 1YC61 2V09A 1I6XA 4CU9A 1DZTA 2ZA9A 4WVWA 1WW7A 4FFHA 1A3KA 4AVCA 3MPPG 5T5JA 4M00A 4CCKA 5C8CA 1YQ2A 1DQ4A 1O91A 1VBC2 4W50A 5H9SA 1G9CA 4QQLA 2W95A 3IDCB 1GQGA 1DLCA 1R081 3LA7A 1N3PA 1BKZA 1JN2P 1AJOA 5HV0A 4GXLA 3KVAA 5DG1A 1NLQA 5BY5A 3RZHA 4AFBA 4EN6B 3DPRB 3CL1A 3PUIA 4HBNA 1BBT2 5LBBA 3ZFEC 5L7OB 2Y38A 4LTAA 2P1BA 5C9AC 2ZAAA 5ANNA 2A3YA 2EIDA 5FZDA 5IFPA 1HB1A 1LU1A 2W52A 4KBZA 1JW6A 5F8PA 2FZ2A 4TWTA 5BNNC 1J59A 1NX9A 2O8QA 2C24A 4CDQA 3EMRA 4IXLA 4OULA 5FP7A 3UKVA 4AI1A 5FLHA 2VG9A 3VL8A 2JB4A 4XF1A 2ZACA 1UZYA 3DN7A 4NVPA 4CEYC 4PQ9A 2PQSA 2FQPA 2OS2A 2TEPA 3HOBA 4JTNA 5CKNA 1W3XA 1LODA 4MH0E 2P6CA 5A7OA 4XQDA 1RUJ3 4COUA 1A34A 1QXRA 5FXWA 1QEXA 1Q5OA 1Q8PA 5GLZA 3FHAA 2ATFA 4FT8A 4KWUA 2WAAA 4IGPA 5F2SA 1XYNA 4KWJA 2OPWA 4BJ0A 5A3MA 5I0RA 3ZYBA 1C5HA 1LCLA 5FPVA 1OVSA 2E7TA 3D8CA 1RUH2 2OIIA 1C4RA 3POBA 1AUYA 1AL0G 2VZVA 2RS11 4BIFA 2WL1A 3OF1A 3ZXEA 5C33A 2ERFA 1Q8QA 2A5ZA 4QXCA 5F3GA 4Q1RA 5IVBA 4UF0A 3EHKA 1M06G 1HB3A 1UF2C 4CUBA 4XTMA 1QJU3 4N53A 1G9FA 4MVTA 3GYDA 1JYWA 5T55A 2W3JA 5IHRA 3JD72 1JHNA 2CL2A 2UURA 1ND3A 1GNZA 4S2DA 4NRQA 4Y5SA 1E57A 2HWC3 3M3OA 3MLLA 3OPZA 3BU0A 4AAXA 1YQ5A 2RMU3 3B01A 2VUCA 2BQPA 4DEVA 1C28A 3ACLA 4Q0UA 4XOGA 2D6LX 4TLFA 1W99A 2ZX4A 2D6MA 4EQVA 4IEVA 2XLFA 3NAPA 5CAZA 1UY1A 3K2OA 4Y20A 5FQ0B 1CQ9A 1ULPA 5LA1A 1VBB3 3JUUA 2FDKA 5IATA 3VD4A 2BDRA 3I4IA 3ON7A 3WF3A 2JICA 3OG2A 2Y6HA 1SPPA 4P02B 1HB4A 4L11A 3WG4A 4DUXA 4AI9A 4Z8BA 1LHWA 1XNDA 1OA4A 2X5IC 4IE5A 4CP2A 5ISLA 3B02A 1GR3A 2V73A 3S57A 1OA2A 1UO9A 2D6OX 3IDEA 3ZYGA 1LAJA 2HWF3 4CXWA 4IEQA 1RUI2 4MYEA 5JXGA 4P08A 5D8AB 3VHOA 2XH6A 2R071 4B29A 1UNBA 4JQTA 3MIDA 1J83A 5LBCA 4Z07A 3FMGA 3IPVA 2GSYA 2DTYA 3ZOIA 3LOBA 2YC0A 4B4PA 3ROUA 1PK6B 3Q8FA 1V9U3 2AYHA 3ETPA 5IUQA 3QACA 1UU6A 1CWPA 2KD7A 3AK0A 4K20A 2Z2SB 3K51A 3I3MA 4TTGA 1UIKA 4PI0A 2YGLA 3OBRA 1FT9A 4Y4YA 1HIXA 2CWMA 4Q27A 2GC3A 1VRH2 2JE8A 5FZKA 4A4AA 4RGAA 1G7YA 5A70A 4K1ZA 2YV8A 5F3IA 3VD3A 4D94A 3OGRA 1FAYA 3NV2A 3PL0A 4XMAA 4CSWA 5FKBA 2YGMA 4AI2A 4LULA 4D0QA 3J8F3 3RRDA 4FPGA 2P17A 3MFAA 2Z5WA 2VUJA 4GWJA 3ZYFA 3RPQA 3T2QA 3T2TA 3O1PA 1R1A2 3IIIA 1CAUA 1FNZA 3S5QA 3D3AA 1H1MA 3EYPA 5EYXA 1RUE3 2NLRA 2DVDA 1YIPA 2XQXA 4CPBA 2OZJA 1BLZA 4XCBA 3HQXA 2GH8A 4UW6A 1LGCA 2A73B 2HWB3 2NP0A 1TVGA 1RHI3 4NOTA 4A42A 5SV5A 5CG9A 1PO22 1TNRA 2W1SA 4FOYA 1KFUL 5FO8B 1W8TA 4K7JA 3KCXA 3KM5A 2H6BA 1WBFA 1OOPB 4XFAA 3I54A 5KXDA 4FSJA 2A75A 1W03A 1VBB2 2XOMA 5EJ1B 3PUSA 5HCBA 4AEDA 4N43C 2ZX1A 3GBGA 2K0GA 3P1IA 2J1RA 1ENSA 1XPWA 1AL21 2V5YA 3M7AA 1VBC1 3OTFA 4LITA 3I59B 5B4XA 1QJEA 2WSUA 1SFPA 5GM0A 4E2QA 1BZWA 2PHDA 5JPMB 1FNYA 1KEXA 4OI4A 1H1IA 4XILA 5FZ7A 4CCCA 1SDDB 2ZHLA 3Q8AA 5ACA3 5G04L 1REFA 1ASJ1 2OW4A 5FXZA 3WDTA 4ZPIA 4YZ4A 1D4M3 3POYA 5IVVA 5F5IA 3U4XA 4R52A 2QUOA 1S4CA 4V1PA 3ETQA 1W9YA 5GLUA 2ORZA 1IKQA 2B42B 3AX4A 4WVZA 4JHTA 4M3CA 4DOUA 2Q1FA 3A4UA 3FLPA 3WDVA 3J4UH 1EPZA 4UW4A 4D8MA 2CV6A 4J6GA 1GQHA 3AKTA 1BK0A 4IV3B 1MS8A 5EQUA 2QQUA 2P6HA 3ZPYA 4BE3A 5I8YA 5LK7B 1WA4A 4Q2FA 3T1MA 2HJIA 1S2KA 4JAAA 2MPFA 4QX2A 3SH5A 2W5FA 3I59A 3N7JA 2QQOA 5FFOC 2RDQA 1V6NA 5J98B 1HRV1 1AYM3 5FZ4A 5C3OA 1NA1C 1ZRRA 3FN9A 4QQOA 5CVRA 4YWAA 4H14A 2VQTA 1RYYA 5CZKA 1GANA 1HLCA 4XFFA 1W28A 1SCRA 2EXIA 1VBE1 4OHWA 3WNPA 4NWWA 5T54A 5EV7A 1F8VA 5A7QA 4XDOA 2V5DA 5FUPA 3D82A 4LK7A 3ZX7A 2V72A 4ZY9A 1EUUA 3POWA 3B00A 2VMCA 2Y6GA 1IPSA 1LU2A 3HVDA 4RFRB 2LS6A 3I2HA 3B7MA 1FXZA 1HJFA 4HVOA 1W39A 3WR0A 1JZ3A 5T5OA 3CO2A 5L7OC 1O5LA 1S0DA 3CJIA 1M4WA 2CGPA 4NIAA 4X8PA 1HXS1 4LBQD 5FZBA 1UXZA 1PVXA 2B9VA 2ZBJA 3NQHA 2WNUA 3FBYA 1UU4A 1MQTA 2FDFA 2YBSA 1GNHA 1RUD2 4Q4V3 5HV4A 4KBBA 5F32A 1W6OA 3S7EA 5H9PA 4CU8A 2J1AA 2OUJA 3AMNA 4OI0A 1EV11 1QNWA 1VBD3 4XXPA 2RS33 4CCOA 5FBZA 4AQTA 2HWE2 2WSVA 3PMSA 3LDKA 2PQQA 5CFDA 2VZOA 4FFIA 3H1MA 3ZPOA 2VZQA 3AYCA 3VD7A 3EBRA 1BYHA 3VN4A 3ZM8A 1SG3A 1ZBE2 1XE7A 2BZDA 2W1UA 1UPIA 2EIBA 5E8AA 3HQRA 3OGJA 4PDWC 5FZHA 4DFSA 1O59A 1SFYA 1KDKA 4FPJA 1GZTA 5DUWA 1BVVA 1AR92 4N7IA 5FRAA 2DUOA 1FOD3 3NNGA 4IV1B 2J1SA 1U5YA 5J37A 4YW1A 4ATEA 3AZYA 4K21A 2WNEA 5IVEA 1O3TA 1PGL1 5LCWL 1XBFA 3AMMA 2Q8CA 1YRZA 3CMGA 3H7YA 1J3QA 2C6SA 5FYYA 4ZZ5A 1AX0A 4XE9A 5FWJA 3UJOA 3WCRA 2JDPA 1H8TB 3ZKYA 1C8M1 3FE5A 4HK8A 4DB5A 2A3WA 2O8OA 2QVSB 4FQZA 3OPTA 4NPRA 5CEHA 3LPFA 5FO7B 3WP3A 3O1UA 5A7PA 4ZKTB 1YFWA 1V6KA 2YDEA 1SLBA 4YVWA 1A78A 1N1TA 2WNVA 4ITCA 1QY4A 4HOOA 2HWF1 1CESA 1HW5A 1AR93 3A23A 4HKLA 4RR3B 1RUOA 1X8EA 2P3KA 1REDA 2B39A 2IC1A 3J7LA 3J8F2 4Y4RA 1ZNPA 3SMHA 1PNGA 3MUY1 4RQPA 1IS6A 1RUF2 1H2NA 2VY0A 2YBKA 4DQAA 5AC92 3JU9A 3AVRA 4FPHA 1RIRA 1VMJA 5BPXA 3VBRB 3PMEA 5A6QA 4QKBA 4Q4Y1 1R1A1 4RR3A 2VD7A 2I45A 3EJKA 3NVCA 4UBHA 4I3PA 1KFXL 4E4HA 2VXRA 1S0EA 1REEA 3M8LA 3EXUA 1W6MA 3ZXFA 4LO5B 5JOWA 1G9BA 2P34A 4UFIA 3ACIA 1GMMA 4XURA 1TE1B 3JZVA 3PLQA 3HT1A 1GZ9A 2XDVA 4QHZA 1QJU1 3AXEA 4TSVA 1C57A 2W39A 3ZFFB 4JGYC 1UMHA 5A33A 1R093 1I5PA 4OMCA 4LIUA 1WLWA 1AVBA 4ES9A 2VQ0A 1YHFA 2ZKLA 2RS13 4Q5OA 2BNNA 5IVCA 1GBGA 4HK9A 4YW5A 1RUG3 1AL22 2BWAA 2R0FA 4UFJA 4XF9A 3C7HA 4NJ4A 2ZS6B 5H9RA 3OY8B 1WGPA 1LHNA 5EWSA 1YUDA 1JYIA 3LEIA 3ZIWA 2DDUA 2WR9A 4E27A 4P14A 2VQAA 1ZX5A 2ZABA 2MEV2 3LD8A 5FZAA 3BN6A 2YBPA 5DZFA 4URAA 5I0SA 4IE6A 2PMWB 1QQP2 2RE9A 3AP6A 3I2FA 5FBJA 4XACA 3HBZA 4RS5A 5GZFA 4B4RA 2YG0A 3GHMA 2GC1A 2JE9A 5GLVA 2LTNA 4BDVB 3RWKX 2WFF3 2GU9A 1MQTB 1W6PA 2YHJA 3DPRA 1POQA 2Y64A 1SMVA 3T08A 4CDUA 1CZVA 2WS91 5EPAA 2SBAA 5LY1A 3CJIB 4XJAA 2Q1ZB 2RS51 2AEYA 5JI9A 1NA1B 4BMEA 5IVFA 5HXVA 2Y6KA 2IVJA 2YC4A 3LEMA 1L7QA 4MGKE 5ABJA 2XMLA 1WKYA 3I2IA 3K4AA 3SKJE 2B7YA 2JDYA 3IPVB 2LROA 4UW3A 4URTA 1R083 2BBVA 3K75B 2RS31 4A44A 4Y1YA 3RI9A 5FZOA 1D0HA 3AYDA 4K3UA 3LGRA 3J7HA 1XC6A 4MGIE 1XXNA 3WW1A 1S0GA 1UKRA 2D6NA 4RYDA 4ATFA 1PZ7A 2VECA 1HXS3 3B9IA 3LE0A 2HYXA 4OHXA 2VZPA 3O1OA 5DXDA 3IZOA 5AFBA 3OOXA 1G86A 1DF0A 4AVBA 1WMFA 1OQ1A 1DYKA 2DVBA 4LBNA 5FYSA 1PIV2 1A8MA 1W2TA 3D5OA 3RFRA 1DGLA 2AH2A 3ILRA 3BTAA 3CU7A 3HPNA 3ZXLA 1JOBA 3NJZA 1CIYA 1ZBE3 2DUQA 5EYYA 4BQ3A 2VMDA 4XJ9A 1YFUA 2QQLA 1ND2B 1TME2 1W8HA 3H42B 3WNKA 1S0JA 3H8UA 1W9FA 4COZA 1QOOA 1EAH3 1XNCA 4MSVA 1WW4A 3WY6A 4BOWA 4N43A 5K7PA 3ZDSA 5DDJ3 1L7LA 5J48A 3MI8A 3R4DB 4K1YA 4Q0PA 3SCFA 3SITA 1OC1A 3AP5A 1CZTA 2FDJA 4JDNA 4F8AA 1DZRA 5JOZA 3S7IA 4XW3A 2FHRA 1LOGA 5LK5A 4XAEA 3VZJA 3UNPA 1VAKA 5LA2A 3OD0A 1YQ6A 3CHXA 3L2YA 4NHMA 2YU1A 4O65A 2QDRA 2XLAA 1NE6A 1PHMA 2AEZA 3DL3A 3ZYIB 1SEFA 4FPKA 4CDXB 1YFYA 4DY3A 2V4AA 5C4WC 4LJHA 4AWDA 5EXOA 3QOPA 5C3SA 1BQPA 3HJRA 4YM3A 1V9U2 4YVSB 3N9NA 3PNAA 4KG8A 1YNAA 4Z2AA 1UYZA 3VBOC 2OXBA 1PO11 4XIOA 2ZCWA 5JI7A 3T0AA 3WP4A 2ZX0A 2OZ6A 4DNYA 5JMOA 3P3NA 3UKNA 3IIAA 1T6BX 3I3EA 2UYAA 5F7UA 2HWF2 3PVEA 4AAPA 2G9FA 4A6OA 1V70A 4CP9B 2WWJA 1ZZCA 3WQ0A 3FX3A 4O9GA 1GP4A 2G4IA 2K2SA 2GNDA 2RS52 4C0BA 1OD5A 4CA9A 3KQRA 4GH4B 4UFMA 2R042 4FBFA 1BEV1 3M70A 5CBLA 2Z4FA 3GZUC 4V2WA 2WN2A 2RM23 2CGNA 4KGQA 4ZS2A 4YW2A 1COV1 2C9AA 2XBO3 3H1YA 3O0VA 4GAZA 4NAMA 2HWB1 2GN7A 2DFCA 3L9JT 5FJKA 4A41A 3SH4A 5IVJA 3M3IA 3ACFA 3HQUA 1Q8SA 3GGLA 3GCXA 1GU3A 1AX2A 1RUE1 4QD2A 3MO4A 4CRQA 4RD7A 4U36A 1W6QA 1IS4A 2HEYF 2R072 3BYWA 3QCWA 5JUVA 3RZJA 3VB9A 2JECA 1E5RA 3KWVA 1MZEA 3MIGA 3GJAA 4XABA 2RVAA 4P00B 2L9LA 4M3CF 4META 2GNBA 5A6YA 1RUF3 5JCTA 2WINB 1NLRA 4FFGA 1ASJ2 3BTZA 3KD4A 1Y43B 4YW6A 5IAVA 2QQMA 5JZGB 5LW9A 1PGL2 2RJ2A 1GWLA 1RUJ2 1MPXA 1GWMA 1QOSA 4OI1A 1IS5A 1BMV2 1W04A 2CAVA 5DUUA 1MEC2 4LBKA 5FZ9A 3WNXA 3J7MA 4YPJA 4JKMA 1W90A 1SDWA 4KMQA 3NV3A 1VALA 4Y20B 2ZGMA 4Q4X2 1K45A 4OHYA 4LR4A 4Q4Y3 3OEBA 1QWRA 4BCUA 3RZLA 1EPWA 5GZEA 3KT4A 3KCYA 3KF5A 1NZIA 2R063 3GBFA 4V2VA 2OT7A 2HLEA 3C7GA 4MV2A 2G9GA 2WS92 4XZUG 3V64A 1KJLA 4QQ2A 4HZFA 3M2MA 1AR91 3KZ4C 4KU8A 4LO6B 5FYVA 5LY2A 5EIYB 3T0DA 3OJBA 5CNAA 5FP4A 5T5PA 3VZMA 1ALYA 4O61A 4AW7A 1DQ2A 2R1DA 5JVVA 3WCSA 3AMQA 4ZU7A 2VTXJ 4LEJA 2QQKA 4UFHA 1BBT1 1RXGA 4NMIA 4DO0A 1H1AA 1V00A 2J22A 4PQQA 5C70A 1VAVA 5E88A 1DG6A 3BOWA 1PZ9A 2VNGA 5FZ6A 2RMU1 4IESA 4LLOA 1RUC3 3THDA 2VCMA 5FY7A 1KS4A 1QH7A 1RUD1 3WP5A 2RR12 4XMIA 4BQWA 4Y33A 1OA3A 1RUF1 3LFMA 3AP4A 1ZZBA 4JTOA 3MGUA 3ZFFC 4XFBA 1RUI3 3NNJA 5FYTA 1B35B 2Y60A 3FLRA 4NE9A 4RQPC 4BQ1A 5A1LA 3NNFA 5AFEA 5IK4A 3BTXA 3NSTA 3CBNA 1XNTA 4MADA 2WT1A 3M3QA 2Q4SA 5FK8A 1O3RA 2VNVA 4WM7C 1O5UA 2ZGOA 4FOQA 3SC7X 1UY0A 2O14A 2P3IA 4OYUA 3FJSA 1F2NA 2Z42A 1WW6A 3MIBA 4Q4V1 1QIQA 1LRHA 2HWC2 2VVEA 1DDLA 5ABJB 2B46X 3I3BA 4RN5A 1SBFA 2VZRA 2VAUA 3SEPA 4BQXA 2VOVA 4LHKA 4OUEA 1NQJA 1BEV3 1KS5A 3FL7A 2W1QA 2Q8OA 2WN3A 5FYHA 3LF7A 4QQHA 4N90A 2ZEXA 3WINE 2C26A 2ID4A 1RGSA 1YCIA 4K6BA 4CDXC 1NCRC 4CP1A 5C4WB 2XUMA 3NO8A 4HMZA 2Q1MA 5JLVA 2E26A 2ZGKA 1UOBA 4A45A 4GH4A 5JZGA 4H2AA 2XVKA 3EB7A 5J09A 3MLJA 4FP2A 1PO13 1T6GC 1V6OA 2JDMA 2WQZC 4CEWA 2ZHMA 4K40A 4YFZA 5D2AA 2H6CA 2XXZA 1SLLA 1OD3A 4LBMA 2WQ4A 1F15A 2J7MA 4W6XA 5FLJA 3IAPA 2PTMA 2XVLA 3B94A 1NUKA 2BGPA 1VAMA 5A32B 4FAHA 4QKNA 2J1EA 5D21A 3TEWA 1O4YA 4BISA 2XGXA 3J9SA 3MFCA 5E89A 3IDBB 3VBSA 2VBPA 5BXXA 5SV8A 4E4SA 1AXKA 4Z1VA 3NRUA 2E51A 3E97A 4Y1UA 4J1XA 5EZWA 3ASIA 2HEVF 1D4M1 2GP3A 3ALQA 4FCAA 5IJRA 4CXYA 1D2SA 1LHUA 3LEKA 4OI2A 3VDDB 4YFWA 4F7ZA 5BNNB 3LA3A 5ACA1 4YGEA 3ZYJB 1SLAA 2VQUA 2PAMA 2Y34A 1N1YA 4IGOA 4D7YA 3O1MA 4BLJA 5BNQA 2AENA 2EA7A 1SHWB 4MHRA 4BA6A 2VE1A 1YLLA 3WQ1A 3THTA 1H8VA 3KMHA 1NZCA 1W2AX 2GNTA 4UT5A 4BU2A 4CP9A 2VZSA 4EROA 3CNAA 4BPZA 3DYPA 2ZJCA 4M0HA 2TBVA 4K8RB 1OXCA 4XUOA 1QDCA 1RJ8A 2HWD2 3JB4C 4YRDA 1Q3EA 4IEZA 4IEWA 2PLV1 3WP6A 5GALA 1DGRA 4MGSA 4QB6A 1Y9QA 3BB6A 4WBBA 4WM7A 3RZKA 2VTFA 3VDAA 2EIGA 2YPJA 3DECA 4CYDA 2CDOA 2VMEA 1NKGA 4AFDA 3LPGA 1PM4A 2OYZA 2NZ9A 1JZ2A 1IOAA 4XIKA 4BH9A 2G9ZA 5L9RA 1K5JA 1ULCA 2TUNA 4N8MA 3VZOA 2VR4A 1JXNA 4YW3A 4HONA 2AUYA
chains in the Genus database with same CATH topology
2W5FA 2QQOA 3SEEA 1NAEA 1F4HA 3FN9A 1UYXA 5CZKA 2VQTA 1RYYA 4JHZA 3WNPA 3IDAA 2QQJA 2V5DA 2V72A 4ZY9A 1EUUA 3A7QA 2VMCA 3HEIA 2Y6GA 1CZSA 2YB7A 3OB8A 2J1VA 2LS6A 3I2HA 1W8OA 4LKSA 1PMHX 1JZ3A 1JZ7A 3PUHA 1D7PM 4XUNA 1UXZA 2X09A 2B9VA 3NQHA 3CQOA 4ET7A 1K42A 3CZUA 2QQNA 1JU4A 2J1AA 2VL4A 2YFZA 2ZXQA 3LQCA 3WF1A 4CU8A 4BK5A 4TXWA 1DYOA 2QBXA 2VZOA 1JZ4A 2VZQA 3VD7A 4L0PA 3ZM8A 2W92A 1SG3A 2BZDA 1JU3A 2W1UA 2WO1A 3VD5A 2EIBA 5HPOA 1O59A 2W94A 5DPNA 1OH4A 3NJXA 4GZ9A 4D8MA 3NNGA 2W9XA 3WF4A 3K46A 2J1SA 1W0NA 1UWWA 2R7EB 3CMGA 3HNMA 3BGAA 4ZZ5A 2EICA 3HNBM 1GOHA 5LCWL 1F4AA 3WF2A 3LPFA 3T09A 1UX7A 3GM8A 2VCCA 2X10A 3MUZ1 5HXMA 5J1XA 3A23A 4JKKA 4LQRA 2EIEA 3OEAA 2JD9A 3MUY1 2W87A 1GOFA 2YFUA 2JDAA 3C8XA 5DMYA 2VZUA 1US3A 4QX0A 1EUTA 4LPLA 3T0BA 4E8CA 5JXIA 4KI5M 1GNYA 1W9TA 4QB2A 4DEQA 4XUQA 1H6XA 5A1AA 4W4ZA 1IQDC 3ACHA 2WZEA 3ACIA 1PX3A 1GMMA 4XURA 4IUGA 2VCAA 1UMHA 4E8DA 1I5PA 4OMCA 3IB3A 1GUIA 4OZOA 5JXHA 4BK4A 3GXUA 3C7HA 2E32A 4OMDA 5LA0A 1J84A 3K4ZA 2VMFA 3LEIA 2DDUA 2Y6LA 3BN6A 2ZEWA 4FI9A 1LNSA 1GOGA 3I2FA 1OT5A 2YG0A 4PT6A 4ARYA 1JZ6A 1TG7A 4AG4A 4BDVB 3WNMA 4CUCA 1PMJX 1CX1A 1UY2A 1PX4A 2Y64A 3T08A 1CZVA 2V4VA 5CYYA 4DXSA 4QB1A 3UESA 1O8PA 3VDBA 4DXRA 2Y6KA 3MV11 2YC4A 2VCBA 2WQ8A 1L7QA 1JZ5A 3DYMA 3W5NA 3K4AA 1WKYA 3SKJE 3MBWA 4M4PA 2VOTA 3JXSA 3K75B 4A44A 4XUTA 3UETA 4QX1A 2WUHA 3J7HA 5C71A 1XC6A 3I2GA 1JYVA 3K4DA 1JYXA 3CZJA 1JI6A 4QDRA 4RYDA 3LE0A 1KGYA 2HYXA 2VZPA 2WABA 3GDBA 2JKXA 2WO3A 5FUIA 3C7FA 3U37A 5C7GA 3HPNA 1CIYA 2W1WA 2WZ8A 4GWIA 3WNOA 2VMDA 3WNKA 2QQLA 4QPWA 4CVUA 3WNNA 4HG6B 5DN2A 2J1TA 3WSOA 1K3IA 1CZTA 2W47A 5JXJA 3A22A 3UNPA 1GQPA 2J1UA 5LA2A 4ZXEA 2WDBA 1JZ8A 5IYYA 5IFTA 1H6YA 3NJVA 1JHJA 4CU6A 3CDZB 1OF3A 3HJRA 1JYNA 1R64A 4Z2AA 1UYZA 2DCKA 3VDCA 4UI9L 3VD9A 2LW8A 5EJZB 3T0AA 3WEZA 5JMOA 4QX3A 3I3EA 5F7UA 2E33A 4ARXA 4A6OA 1US2A 2CDPA 3I97A 4BXSV 3IAQA 4UOJA 2Y8KA 1T2XA 5JR2A 2VO5A 3OGSA 2E31A 1UYYA 4UAPA 2XHNA 2WO2A 1DP0A 2Z4FA 3HNYM 2B4KA 4MOAA 2WN2A 3C7EA 4CU9A 3SKVA 3E1F1 3WF0A 3ECQA 2VZ1A 4A41A 3ACFA 3GGLA 1YQ2A 4W50A 1UXXX 1GU3A 2W95A 1DLCA 2C4XA 3MO4A 5JUVA 4QDSA 4XUPA 3PUIA 2VZ3A 2RVAA 4P00B 2L9LA 3ACGA 1O8SA 2EIDA 2W91A 5IFPA 2QQMA 1NX9A 2RJ2A 1MPXA 4DUVA 4QAWA 5B4NA 4YPJA 2X05A 4JKMA 2C9KA 2PQSA 4KMQA 4XVHA 3HOBA 1K45A 3OEBA 3FHAA 3I2JA 2BERA 4KWUA 2WAAA 3CIHA 4ZZ8A 4BJ0A 3C7GA 2HLEA 1WCQA 3C7OA 5G05L 4XZUG 2WAOA 2VZVA 2YC2A 1XNAA 4PF1A 5EIYB 3T0DA 3T2PA 4MGQA 2QQKA 4CUBA 1JYWA 2W3JA 5IHRA 2J22A 4PQQA 5C70A 3ABZA 4A3ZA 2VJXA 4P5YA 3W5MA 3DYOA 3THDA 4AAXA 3HN3A 4DEVA 1W99A 4DUWA 1HN1A 1UY1A 2VC9A 3THCA 3I2KA 1ULPA 4CU7A 5LA1A 1OF4A 4M4RA 3VD4A 3WF3A 3OG2A 2Y6HA 3CKHA 4P02B 4DUXA 1XNTA 4MADA 1UY0A 5JXGA 4OYUA 4P08A 1K12A 3MV01 2ORXA 1J83A 1W8NA 3I3BA 2ZEYA 4RN5A 2Y6JA 2VZRA 3SEPA 3AC0A 3ETPA 1UY4A 4OUEA 2KD7A 3FHQA 2OKXA 3FL7A 2W1QA 1UMIA 4TTGA 2WN3A 5DQ0A 4MO3M 2ZEXA 4A4AA 2C26A 2ID4A 2JE8A 3LEGA 3VD3A 3OGRA 2E26A 1BHGA 2QQIA 4A45A 4D0QA 3EB7A 1W9WA 4GWJA 3T2QA 1OD3A 3IIIA 2J7MA 3D3AA 3EYPA 3IAPA 2VZTA 2XQXA 2ZEZA 1W9SA 1NUKA 1UY3A 4DXTA 2BGPA 1UZ0A 1TVGA 2W46A 4A42A 2J1EA 5I0DA 4CUAA 2W1SA 2WYSA 2BGOA 3OBAA 3NRUA 5IJRA 1P8JA 2WBKA 3LEKA 3OGVA 2XOMA 1L7RA 2VQUA 5EJ1B 3I3DA 3P1IA 1XPWA 2J1RA 2DCJA 1SHWB 5B4XA 2BBAA 4QDQA 1KEXA 2VZSA 3F2ZA 1SDDB 3DYPA 5G04L 3A21A 4XUOA 1ULOA 4LHSA 3WNLA 2RV9A 3T2OA 2VM9A 2ORZA 4MGSA 4QB6A 3P6BA 4JKLA 2VTFA 2XONA 4JX0A 3VDAA 3DECA 2CDOA 2VMEA 1NKGA 3LPGA 3WQBA 1JZ2A 4W8JA 4QX2A 2VR4A 3I2IA 3K77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W5F A;  2QQO A;  3SEE A;  1NAE A;  1F4H A;  3FN9 A;  1UYX A;  5CZK A;  2VQT A;  1RYY A;  4JHZ A;  3WNP A;  3IDA A;  2QQJ A;  2V5D A;  2V72 A;  4ZY9 A;  1EUU A;  3A7Q A;  2VMC A;  3HEI A;  2Y6G A;  1CZS A;  2YB7 A;  3OB8 A;  2J1V A;  2LS6 A;  3I2H A;  1W8O A;  4LKS A;  1PMH X;  1JZ3 A;  1JZ7 A;  3PUH A;  1D7P M;  4XUN A;  1UXZ A;  2X09 A;  2B9V A;  3NQH A;  3CQO A;  4ET7 A;  1K42 A;  3CZU A;  2QQN A;  1JU4 A;  2J1A A;  2VL4 A;  2YFZ A;  2ZXQ A;  3LQC A;  3WF1 A;  4CU8 A;  4BK5 A;  4TXW A;  1DYO A;  2QBX A;  2VZO A;  1JZ4 A;  2VZQ A;  3VD7 A;  4L0P A;  3ZM8 A;  2W92 A;  1SG3 A;  2BZD A;  1JU3 A;  2W1U A;  2WO1 A;  3VD5 A;  2EIB A;  5HPO A;  1O59 A;  2W94 A;  5DPN A;  1OH4 A;  3NJX A;  4GZ9 A;  4D8M A;  3NNG A;  2W9X A;  3WF4 A;  3K46 A;  2J1S A;  1W0N A;  1UWW A;  2R7E B;  3CMG A;  3HNM A;  3BGA A;  4ZZ5 A;  2EIC A;  3HNB M;  1GOH A;  5LCW L;  1F4A A;  3WF2 A;  3LPF A;  3T09 A;  1UX7 A;  3GM8 A;  2VCC A;  2X10 A;  3MUZ 1;  5HXM A;  5J1X A;  3A23 A;  4JKK A;  4LQR A;  2EIE A;  3OEA A;  2JD9 A;  3MUY 1;  2W87 A;  1GOF A;  2YFU A;  2JDA A;  3C8X A;  5DMY A;  2VZU A;  1US3 A;  4QX0 A;  1EUT A;  4LPL A;  3T0B A;  4E8C A;  5JXI A;  4KI5 M;  1GNY A;  1W9T A;  4QB2 A;  4DEQ A;  4XUQ A;  1H6X A;  5A1A A;  4W4Z A;  1IQD C;  3ACH A;  2WZE A;  3ACI A;  1PX3 A;  1GMM A;  4XUR A;  4IUG A;  2VCA A;  1UMH A;  4E8D A;  1I5P A;  4OMC A;  3IB3 A;  1GUI A;  4OZO A;  5JXH A;  4BK4 A;  3GXU A;  3C7H A;  2E32 A;  4OMD A;  5LA0 A;  1J84 A;  3K4Z A;  2VMF A;  3LEI A;  2DDU A;  2Y6L A;  3BN6 A;  2ZEW A;  4FI9 A;  1LNS A;  1GOG A;  3I2F A;  1OT5 A;  2YG0 A;  4PT6 A;  4ARY A;  1JZ6 A;  1TG7 A;  4AG4 A;  4BDV B;  3WNM A;  4CUC A;  1PMJ X;  1CX1 A;  1UY2 A;  1PX4 A;  2Y64 A;  3T08 A;  1CZV A;  2V4V A;  5CYY A;  4DXS A;  4QB1 A;  3UES A;  1O8P A;  3VDB A;  4DXR A;  2Y6K A;  3MV1 1;  2YC4 A;  2VCB A;  2WQ8 A;  1L7Q A;  1JZ5 A;  3DYM A;  3W5N A;  3K4A A;  1WKY A;  3SKJ E;  3MBW A;  4M4P A;  2VOT A;  3JXS A;  3K75 B;  4A44 A;  4XUT A;  3UET A;  4QX1 A;  2WUH A;  3J7H A;  5C71 A;  1XC6 A;  3I2G A;  1JYV A;  3K4D A;  1JYX A;  3CZJ A;  1JI6 A;  4QDR A;  4RYD A;  3LE0 A;  1KGY A;  2HYX A;  2VZP A;  2WAB A;  3GDB A;  2JKX A;  2WO3 A;  5FUI A;  3C7F A;  3U37 A;  5C7G A;  3HPN A;  1CIY A;  2W1W A;  2WZ8 A;  4GWI A;  3WNO A;  2VMD A;  3WNK A;  2QQL A;  4QPW A;  4CVU A;  3WNN A;  4HG6 B;  5DN2 A;  2J1T A;  3WSO A;  1K3I A;  1CZT A;  2W47 A;  5JXJ A;  3A22 A;  3UNP A;  1GQP A;  2J1U A;  5LA2 A;  4ZXE A;  2WDB A;  1JZ8 A;  5IYY A;  5IFT A;  1H6Y A;  3NJV A;  1JHJ A;  4CU6 A;  3CDZ B;  1OF3 A;  3HJR A;  1JYN A;  1R64 A;  4Z2A A;  1UYZ A;  2DCK A;  3VDC A;  4UI9 L;  3VD9 A;  2LW8 A;  5EJZ B;  3T0A A;  3WEZ A;  5JMO A;  4QX3 A;  3I3E A;  5F7U A;  2E33 A;  4ARX A;  4A6O A;  1US2 A;  2CDP A;  3I97 A;  4BXS V;  3IAQ A;  4UOJ A;  2Y8K A;  1T2X A;  5JR2 A;  2VO5 A;  3OGS A;  2E31 A;  1UYY A;  4UAP A;  2XHN A;  2WO2 A;  1DP0 A;  2Z4F A;  3HNY M;  2B4K A;  4MOA A;  2WN2 A;  3C7E A;  4CU9 A;  3SKV A;  3E1F 1;  3WF0 A;  3ECQ A;  2VZ1 A;  4A41 A;  3ACF A;  3GGL A;  1YQ2 A;  4W50 A;  1UXX X;  1GU3 A;  2W95 A;  1DLC A;  2C4X A;  3MO4 A;  5JUV A;  4QDS A;  4XUP A;  3PUI A;  2VZ3 A;  2RVA A;  4P00 B;  2L9L A;  3ACG A;  1O8S A;  2EID A;  2W91 A;  5IFP A;  2QQM A;  1NX9 A;  2RJ2 A;  1MPX A;  4DUV A;  4QAW A;  5B4N A;  4YPJ A;  2X05 A;  4JKM A;  2C9K A;  2PQS A;  4KMQ A;  4XVH A;  3HOB A;  1K45 A;  3OEB A;  3FHA A;  3I2J A;  2BER A;  4KWU A;  2WAA A;  3CIH A;  4ZZ8 A;  4BJ0 A;  3C7G A;  2HLE A;  1WCQ A;  3C7O A;  5G05 L;  4XZU G;  2WAO A;  2VZV A;  2YC2 A;  1XNA A;  4PF1 A;  5EIY B;  3T0D A;  3T2P A;  4MGQ A;  2QQK A;  4CUB A;  1JYW A;  2W3J A;  5IHR A;  2J22 A;  4PQQ A;  5C70 A;  3ABZ A;  4A3Z A;  2VJX A;  4P5Y A;  3W5M A;  3DYO A;  3THD A;  4AAX A;  3HN3 A;  4DEV A;  1W99 A;  4DUW A;  1HN1 A;  1UY1 A;  2VC9 A;  3THC A;  3I2K A;  1ULP A;  4CU7 A;  5LA1 A;  1OF4 A;  4M4R A;  3VD4 A;  3WF3 A;  3OG2 A;  2Y6H A;  3CKH A;  4P02 B;  4DUX A;  1XNT A;  4MAD A;  1UY0 A;  5JXG A;  4OYU A;  4P08 A;  1K12 A;  3MV0 1;  2ORX A;  1J83 A;  1W8N A;  3I3B A;  2ZEY A;  4RN5 A;  2Y6J A;  2VZR A;  3SEP A;  3AC0 A;  3ETP A;  1UY4 A;  4OUE A;  2KD7 A;  3FHQ A;  2OKX A;  3FL7 A;  2W1Q A;  1UMI A;  4TTG A;  2WN3 A;  5DQ0 A;  4MO3 M;  2ZEX A;  4A4A A;  2C26 A;  2ID4 A;  2JE8 A;  3LEG A;  3VD3 A;  3OGR A;  2E26 A;  1BHG A;  2QQI A;  4A45 A;  4D0Q A;  3EB7 A;  1W9W A;  4GWJ A;  3T2Q A;  1OD3 A;  3III A;  2J7M A;  3D3A A;  3EYP A;  3IAP A;  2VZT A;  2XQX A;  2ZEZ A;  1W9S A;  1NUK A;  1UY3 A;  4DXT A;  2BGP A;  1UZ0 A;  1TVG A;  2W46 A;  4A42 A;  2J1E A;  5I0D A;  4CUA A;  2W1S A;  2WYS A;  2BGO A;  3OBA A;  3NRU A;  5IJR A;  1P8J A;  2WBK A;  3LEK A;  3OGV A;  2XOM A;  1L7R A;  2VQU A;  5EJ1 B;  3I3D A;  3P1I A;  1XPW A;  2J1R A;  2DCJ A;  1SHW B;  5B4X A;  2BBA A;  4QDQ A;  1KEX A;  2VZS A;  3F2Z A;  1SDD B;  3DYP A;  5G04 L;  3A21 A;  4XUO A;  1ULO A;  4LHS A;  3WNL A;  2RV9 A;  3T2O A;  2VM9 A;  2ORZ A;  4MGS A;  4QB6 A;  3P6B A;  4JKL A;  2VTF A;  2XON A;  4JX0 A;  3VDA A;  3DEC A;  2CDO A;  2VME A;  1NKG A;  3LPG A;  3WQB A;  1JZ2 A;  4W8J A;  4QX2 A;  2VR4 A;  3I2I A;  3K77 A; 
#chains in the Genus database with same CATH topology
 4D6S A;  4AF9 A;  2VBB A;  1XU1 A;  1U5I A;  2RR1 1;  4MX3 A;  1F4H A;  5T5L A;  2PHX A;  1UYX A;  1LEN A;  2Z79 A;  1XSQ A;  4CDW A;  1IS3 A;  1RUG 2;  2RS5 3;  5FPU A;  3V0B A;  2PHR A;  2P2K A;  2ZOE B;  4B7K A;  1MZ5 A;  1W6Q B;  2QQJ A;  2PAK A;  1S2B A;  2DUP A;  5ERL A;  5FZM A;  4AFC A;  2BEO A;  3B69 A;  4GWN A;  1OUR A;  1AXZ A;  2J1V A;  3MIF A;  3T4V A;  4AL9 A;  5L9V A;  3AZZ A;  1SQ4 A;  4IEY A;  3PUA A;  1COV 2;  2ARE A;  2BVB A;  1V9U 1;  4LBQ A;  3WOG A;  2DCZ A;  4XUN A;  1RUC 2;  2HWE 3;  2BVV A;  3LDB A;  1C5I A;  4ET7 A;  1W6P B;  3QD6 A;  3AMH A;  1NT0 A;  2XVG A;  5L19 A;  2R07 3;  3W20 A;  5K0U C;  1JMU B;  3WF1 A;  3U75 A;  3LQC A;  3AKP A;  4XFG A;  1CAW B;  1LUL A;  5K8S A;  2E7Q A;  2YUE A;  4MXV A;  3C3V A;  1PNF A;  4TXW A;  2A6Y A;  2XJR A;  3POJ A;  1UQX A;  1UIJ A;  5FZO B;  1ZVF A;  4IET A;  5FCC A;  1JZ4 A;  2MEV 1;  4XXA A;  5T3N A;  5BNP B;  5IK8 A;  4AQ2 A;  1B35 C;  3GHN A;  3RDI A;  1QXJ A;  1R09 1;  5LZ6 A;  1IG3 A;  5JIA A;  2XJU A;  1KD7 A;  2A1X A;  1TZO A;  1CON A;  3AYE A;  4YG6 A;  1PIV 3;  1Q8V A;  1TME 1;  1FMD 2;  3UT0 A;  4Y26 A;  3ZN6 A;  2W94 A;  3N9P A;  4FTS A;  4E9K A;  1VB4 A;  4GZ9 A;  2WZP P;  1HDK A;  4DPN A;  1XE0 A;  1WMD A;  3AZV A;  2I2S A;  1UOJ A;  2IXI A;  2HWC 1;  5FZL A;  3R4U A;  3ZO0 B;  5EFU A;  1VBA 3;  1HQW A;  2R04 3;  3ZXA C;  3ZR5 A;  2LM3 A;  5FPZ A;  3KV5 A;  2DVA A;  1O4T A;  3GBW A;  3T1L A;  2MHF A;  1PGS A;  1KIT A;  3D0S A;  1JUI A;  1H4H A;  3TB0 A;  1YIF A;  1UX7 A;  2VH9 A;  4ZS3 A;  3T09 A;  4AVS A;  3VKN A;  4NIH A;  3BAL A;  1D4M 2;  2VCC A;  1NCR B;  3K3O A;  3OBT A;  1YQC A;  3R05 A;  2BPA 2;  5KHH A;  1YEW A;  4JKK A;  1RIT A;  4LQR A;  4NII A;  2W0X A;  4M3C B;  1SBE A;  3BKZ A;  3H8X A;  2JD9 A;  1D2Q A;  4GMP 1;  4RS5 C;  4C1X A;  4CZS A;  4UBG A;  5DMY A;  4XPV A;  3VBR A;  1US3 A;  2AGS A;  4QX0 A;  4L9B A;  1ZRD A;  4LPL A;  4H55 A;  1X8M A;  3T0B A;  5JDB A;  2AC1 A;  5FZI A;  1C3H A;  3MPB A;  3JCI A;  5BUV A;  1GZC A;  2RMU 2;  4Y3O A;  5F39 A;  3O0W A;  4WV8 A;  1OLM A;  5FYZ A;  3BTY A;  5CG8 A;  1VPH A;  2MNG A;  4YG0 A;  5LB6 A;  1SBD A;  1SZB A;  4FPF A;  1IPJ A;  2QQW A;  1WD3 A;  1GNY A;  1W9T A;  2ZGQ A;  4QB2 A;  2WKK A;  4RGK A;  4XDP A;  3RJ2 X;  4M3C E;  5A6X A;  3KV6 A;  5A1A A;  4M0N A;  1TEI A;  2WJS A;  3U14 A;  3USU B;  4FOV A;  3WT3 A;  3N9L A;  4COV A;  3NKG A;  2KA3 A;  3R4S A;  1QQP 3;  1SAC A;  2D6P A;  2VCA A;  4KQ7 A;  3RI8 A;  1OOP C;  1Q8O A;  1CJD A;  1STM A;  4KH9 A;  3I2O A;  4H7M A;  2FCV A;  2RHP A;  1ND2 C;  3LOI A;  1OMI A;  1MR5 A;  2ZHK A;  4IV1 A;  4LO7 A;  4AGG A;  4DRV A;  4OZO A;  5JXH A;  2DU1 A;  4AK3 A;  2RJK A;  3AKS A;  3GZA A;  3OYW B;  4LT5 A;  4GMP 0;  3GXU A;  2YMZ A;  1ZA7 A;  4AI8 A;  5FDB A;  3VKF C;  4OLL A;  2AR6 A;  3KHB A;  2DBI A;  5F37 A;  5LA0 A;  3N3H A;  5L73 A;  2A6Z A;  2W2I A;  2XJV A;  4FTB A;  4B1L A;  2VMI A;  3OD4 A;  4UFL A;  3N9Q A;  1LOE A;  2PEL A;  4FI9 A;  1RXF A;  1GP5 A;  4E2G A;  1XNK A;  1O3S A;  1OT5 A;  1WWY A;  4BLI A;  3M3E A;  4LLF A;  4RS5 B;  4ARY A;  1JZ6 A;  1H8T A;  1TG7 A;  4PLN A;  4AG4 A;  1DGW X;  4CUC A;  5BYN A;  5LAS A;  4EN9 B;  2JE7 A;  2UY9 A;  1CX1 A;  3DPR C;  2NQY A;  1PX4 A;  1AYN 1;  2ZGL A;  1CIW A;  4GUL A;  4CEY B;  3VLB B;  5CYY A;  2ET1 A;  4DXS A;  5C9A A;  5FY1 A;  2X5I B;  4AYU A;  3ILF A;  3ZLI A;  1O8P A;  1VBE 3;  1H8T C;  4FVV A;  5FLI A;  4NUB A;  3UV9 A;  4Q29 A;  2VCB A;  3JBG 3;  1W0P A;  2MEV 3;  1JZ5 A;  3W58 A;  1IQA A;  1E5S A;  4N9H A;  1PMI A;  4ZU4 A;  2XPJ A;  1AX1 A;  4XBL A;  3ZYR A;  3KGZ A;  5BNP A;  4D6Q A;  3N35 A;  2ZKN A;  3MIH A;  3UET A;  1K5M B;  1CD3 G;  1WMX A;  5C71 A;  3WG2 A;  2ZGU A;  1W6M B;  1JYX A;  3CZJ A;  4JGZ B;  3H3U A;  1W6O B;  1KDM A;  1KGY A;  1QKQ A;  3E6B A;  1AR6 2;  1GV9 A;  1W0O A;  5AVA A;  1FAT A;  3PJQ A;  5DZG A;  2IWG B;  2Q5T A;  2WAB A;  1PM7 A;  1FPN 1;  5EHD A;  4IV3 A;  4QPI C;  4P9J A;  3H7J A;  4LKE A;  2JKX A;  2WO3 A;  4SLI A;  1XRU A;  5FUI A;  1PVC 1;  2QCS B;  1E5H A;  1FMD 3;  1WLT A;  3CLP A;  4UYB A;  4P9Y A;  1J3P A;  2EF6 A;  4JGZ C;  2VOX A;  1POV 3;  3V56 A;  4C0H A;  1KRI A;  1VBC 3;  1LOA A;  2D97 A;  1OUX A;  4MGZ E;  5FK7 A;  3VZN A;  5C3P A;  1WCD J;  4LOS A;  4CEW C;  3HR9 A;  3WNO A;  2WFF 2;  4WVM A;  3WW4 A;  5CIS A;  2YPD A;  4LHN A;  4MHU A;  2RR1 3;  3BOP A;  5FIX A;  2BWC A;  1ODN A;  4GJY A;  3U4S A;  1Y9G A;  4CDW B;  2J1T A;  2RDR A;  4Q4V 2;  3WSO A;  4MXW B;  3PUR A;  1DZQ A;  1MS9 A;  5FYI A;  3USU A;  5J3U A;  5FZ3 A;  2P3Y A;  3ZFG C;  1DCS A;  2WFP A;  4G3Y C;  2DBN A;  3WUC A;  3M3C A;  1AHS A;  1RHI 1;  5BNO A;  3VGI A;  1Z7S 3;  2YU2 A;  2WDB A;  2G19 A;  4QT6 A;  2Q8D A;  1AJK A;  3AZX A;  4YW4 A;  5IFT A;  1H6Y A;  2N7G A;  3NJV A;  2CHH A;  5FYC A;  4NWV A;  2NPI A;  5CKQ A;  3N9M A;  4COW A;  4AZZ A;  2VMG A;  4BQ5 A;  1G6N A;  5HCF A;  2IUW A;  3FC0 A;  4L2N A;  4PI2 A;  5JSO A;  2X5I A;  1FV2 A;  1EAH 1;  5EJZ B;  3ZDV A;  5A3W A;  2JDH A;  2GH2 A;  2W68 A;  4HN1 A;  5FO9 B;  5JAX A;  1J1T A;  4XAA A;  4CCN A;  1ZBE 1;  2D6K A;  2R06 2;  2NMO A;  4QGL A;  1ST8 A;  3VZL A;  1ZM1 A;  4XBN A;  4BXS V;  4DMI A;  4UOJ A;  4B3N A;  1XB9 A;  1TNF A;  2Y8K A;  3VBU B;  2JEN A;  1R1Z A;  3VBF B;  2VPV A;  3KS7 A;  4NR1 A;  2VO5 A;  3OGS A;  1I9R A;  2E31 A;  3DV8 A;  3PTR B;  1OVP A;  2PHF A;  3NKT A;  1DP0 A;  4NPM A;  3SQO A;  4LBL A;  3INA A;  2B4K A;  3EO6 A;  5CFD C;  1DQ6 A;  1YWK A;  4MOA A;  3RNS A;  3VDD A;  5BNN A;  4W6W A;  3C7E A;  3WF0 A;  3ECQ A;  2DU0 A;  1OOP A;  4Q8L A;  5FZ0 A;  3MF6 A;  5LA9 A;  1ULE A;  2EXK A;  3VBS B;  1DGW A;  5FMO L;  2HH9 A;  3U78 A;  1UXX X;  1ZRC A;  1VRH 3;  3H8O A;  3VD9 A;  1YJK A;  4IE7 A;  3VKL A;  1WCS A;  4YGB A;  2GDF A;  3ST7 A;  4COY A;  1GIC A;  2A6W A;  4JGY B;  1NCQ B;  2O1Q A;  4YZ1 A;  5GLW A;  1QHD A;  3ACG A;  3AB0 A;  4BQ2 A;  2PHW A;  2W91 A;  3LFI A;  3VBO A;  3O14 A;  5F5C A;  5FY5 A;  4QXB A;  3S30 A;  2WS9 3;  5F5A A;  5F2W A;  1S55 A;  2RM2 2;  5JSP A;  1ONA A;  2W08 A;  2WFF 1;  5FKC A;  4DUV A;  2GN3 A;  2R49 A;  4Q4W 1;  2C9K A;  3BPZ A;  4PLM A;  4OUS A;  4XCA A;  3OUJ A;  4XVH A;  2CSG A;  4WM7 B;  2WLP A;  1MAC A;  1W8Z A;  1LHO A;  2YYO A;  4KL1 A;  1JOD A;  5C3Q A;  3WG1 A;  2WZR 1;  2BER A;  3I2J A;  1VP6 A;  3LCP A;  3URF A;  3CIH A;  5ABJ C;  4YM0 A;  3HN1 A;  2GZW A;  3SXW A;  3WDX A;  3TEY A;  4L97 A;  4GMP 3;  4QX8 A;  3C7O A;  3NV1 A;  5AVP A;  2D5F A;  3HIF A;  2JG9 B;  1RUG 1;  1F31 A;  2YC2 A;  1XNA A;  3RYR A;  3HAG A;  4PF1 A;  4XTP A;  1UOG A;  3QBQ A;  2OUH A;  4R8H A;  4RHV 3;  5I8S A;  1GKB A;  2IXL A;  2WC2 A;  4IND A;  5F6L B;  4A7K A;  4BZ4 A;  1S0C A;  2Y0I A;  3UGG A;  3WUD A;  2B9U A;  2P4E A;  2K46 A;  2OX0 A;  4Y5Z 0;  4QQP A;  3ZFE B;  4FO9 A;  4MUV A;  2TNF A;  4AGR A;  1DQ5 A;  1WUV A;  3AL6 A;  4FP3 A;  4Q0V A;  5H9Q A;  5IVY A;  2R04 1;  2Z69 A;  2VJX A;  2JX9 A;  1EY2 A;  4I09 A;  3W59 A;  4NIG A;  5DAP A;  4P5Y A;  1W06 A;  4R9A A;  5JOX A;  3T3Y A;  1C8M 2;  3I7D A;  2ADE A;  3N4M A;  1TMF 1;  5KHG A;  4Y5T A;  4C91 A;  2HWB 2;  1YXW A;  1AR7 1;  4DUW A;  4Y1X A;  1HN1 A;  4YZ3 A;  4QPG C;  4ZXK A;  4OHZ A;  1V6M A;  2DCT A;  2DYC A;  2A70 A;  1UCX A;  2OQ6 A;  2ARC A;  2VC9 A;  2UWB A;  4AHW A;  4CU7 A;  2WWU A;  1OFN A;  4M4R A;  3ZR6 A;  5A3U A;  5FR3 A;  1SLT A;  2HKX A;  4OQ9 A;  1VJ2 A;  4HPK A;  1LES A;  5FTT C;  1AR8 3;  1Y4W A;  5JMC A;  3E6D A;  2QNK A;  2WRA A;  2RDS A;  1BK1 A;  1CPN A;  2ZMN A;  3KV4 A;  3LDR A;  1MZ6 A;  4CP0 A;  4QX7 A;  3MV0 1;  2JG8 B;  2R06 1;  3LIH A;  2CWS A;  2P37 A;  4CDU C;  1XU2 A;  2GMM A;  5BV6 A;  2XWJ B;  1W8N A;  1C8M 3;  2HWE 1;  1BMV 1;  2XB6 C;  3MIC A;  1CAV B;  1ZBA 2;  3AL5 A;  2HBT A;  3G6J B;  1ULD A;  3FHQ A;  2ET7 A;  2OKX A;  2DF7 A;  4GA9 A;  4GIQ A;  1UMI A;  4IDZ A;  5LRS A;  3POG A;  4MG2 A;  1RVF 1;  2WO7 A;  1WA6 X;  5FZC A;  4XC9 A;  1U12 A;  1QJU 2;  5FY8 A;  3V0B B;  4MGT A;  3MYX A;  1QU0 A;  1RL3 A;  1CVN A;  1FPN 2;  1RB8 G;  3LEG A;  2ZGT A;  3NW4 A;  1RJ7 A;  1BHG A;  2XLG A;  1LOF C;  2QQI A;  2DTW A;  1AZD A;  1UPS A;  3MDP A;  4UFK A;  3RWN A;  3TN9 2;  5FOJ B;  1VMF A;  1X82 A;  3BIE A;  2FZ1 A;  4S2H A;  4XEZ A;  1L3J A;  1E5I A;  4FPE A;  5A7S A;  4L8Q A;  2Y0O A;  2ARX A;  1HQL A;  3VL9 A;  5FQ0 A;  4BYY A;  4EZH A;  4PBO A;  4E2S A;  1SCS A;  2CU5 A;  4DXZ A;  4LXL A;  4EN8 B;  2OA2 A;  4TN7 A;  1LOC A;  3S0M A;  1ULG A;  1UY3 A;  2QDN A;  4DXT A;  1IKP A;  2BV4 A;  1UZ0 A;  2PHL A;  2J42 A;  3HT2 A;  4WM8 C;  4UWD A;  1COV 3;  3I3Q A;  5I0D A;  3OYW A;  5GKA C;  5EP9 A;  5K0U B;  2BGO A;  1QJY 3;  2D44 A;  2ZTN A;  3KV9 A;  4JRL A;  2RG4 A;  5JR7 B;  4CDW C;  1W8W A;  1ND3 B;  1FYU A;  2WBK A;  1CPM A;  2BGC A;  1NYW A;  4LO8 A;  3UK9 A;  3KT7 A;  2XL9 A;  3NJY A;  3POS A;  3OGG A;  4I30 A;  4I0W B;  1ENR A;  3HWJ A;  2QZ3 A;  1PO1 2;  5A3L A;  3M1H A;  1KXG A;  1QJF A;  1EAH 2;  1ZRI A;  4ZU5 A;  1POV 1;  2BBA A;  3K48 A;  1LHV A;  3SCH A;  4QDQ A;  4PLO A;  5LAT A;  1ND3 C;  1OHF A;  3DXU A;  1B35 A;  1I5Z A;  3FZ3 A;  3GF6 A;  1OI6 A;  1W2N A;  1ZZ9 A;  4S2G A;  3A21 A;  4HLT A;  4KNC A;  4QXK A;  1UAI A;  2BP6 A;  4BIO A;  2E6V A;  4LA2 A;  4LHS A;  4I0B A;  3GNE A;  4YLZ A;  4I02 A;  3T2O A;  1ZRF A;  2VM9 A;  1MZF A;  3HD8 B;  4GB3 3;  3P6B A;  3BOD A;  3KVB A;  4JKL A;  2WA4 A;  2EAK A;  3J7N A;  2ENR A;  3FHI B;  3VBH C;  5IT6 A;  3WQB A;  4YGC A;  4AE2 A;  1G9D A;  4B7E A;  4W8J A;  4HVQ A;  5CFC C;  1OH3 A;  2JXA A;  4GB3 1;  3PVN A;  1NCR A;  2ZX2 A;  5FV3 A;  3DCQ A;  3HBK A;  1Z0H A;  4LA3 A;  3FWE A;  4RHV 2;  4WZF A;  3SEE A;  1TMF 2;  3JBG 1;  3BVC A;  4CCM A;  3JQX A;  2JD4 A;  4GAL A;  2F6B A;  3WDY A;  2RS1 2;  4LBO A;  4JCK A;  4JHZ A;  4AHX A;  3D0J A;  5F6K A;  2JDK A;  4RL7 A;  5ANQ A;  1GFF 2;  1GZW A;  2F4L A;  3PDQ A;  3MIE A;  4I0A A;  5J96 B;  1ND2 A;  4IV1 C;  2EXJ A;  2QZ2 A;  3A7Q A;  1AL2 3;  3E5X A;  4XET A;  5KWR A;  2YB7 A;  3ILN A;  5J36 A;  4AHZ A;  2XJQ A;  1YQ8 A;  2D43 A;  1W6N A;  4ISR A;  2GAU A;  3ME2 A;  1PMH X;  4P9I A;  4LHL A;  1JZ7 A;  4Z82 A;  1D7P M;  1NE4 A;  4GKY A;  2BTV C;  1OUS A;  2X29 A;  2X09 A;  1WLC A;  2R32 A;  2GNM A;  5I0T A;  1IZ3 A;  2QQV A;  5TSW A;  4XHX A;  1QJX 2;  3WG3 A;  1K42 A;  1HRI 2;  2IXH A;  3F95 A;  3CZU A;  4W6Y A;  1ZBA 1;  2R1B A;  1VR3 A;  4FQ4 A;  3T4H B;  1JU4 A;  3RMY A;  5KC6 A;  3L2H A;  4XQ4 A;  4K9S A;  4RSU A;  2WZR 2;  4GKX A;  1CAW A;  1LEM A;  4KWL A;  3WLU A;  2H0B A;  4YW7 A;  4BK5 A;  2Q0A A;  5JSR A;  1JH5 A;  1VIW B;  2QBX A;  4HKO A;  3POI A;  3SH3 A;  4I01 A;  3MW2 A;  5T50 A;  3RYK A;  2W92 A;  5HBA A;  2XQR A;  2BYV E;  4QMA A;  1RUI 1;  4IEP A;  1QF3 A;  2B8M A;  1VBD 2;  3VD5 A;  4A3X A;  1ZZ7 A;  4LBQ B;  3CF6 E;  1ZRE A;  1S2E A;  4LKF A;  3J26 N;  4QGN A;  1V0A A;  3Q8E A;  1W6N B;  3H3Z A;  4PCR A;  5FYU A;  5HPO A;  1QJX 3;  1A6C A;  2Q30 A;  1OH4 A;  2IXK A;  3NJX A;  4Q4W 2;  4YAR A;  1OLR A;  3K46 A;  4YZ5 A;  2D3R A;  1W0N A;  1UWW A;  2R7E B;  2JG8 A;  3SLI A;  3ZFE A;  4ASL A;  5IAX A;  5KR7 A;  1RHI 2;  1LTE A;  2R30 A;  3HNM A;  4L92 A;  2QFE A;  1UX6 A;  4YM2 A;  4EWD A;  2EIC A;  3HNB M;  3TEX A;  4XZP A;  5FOB B;  1F4A A;  4TLG A;  4EE2 A;  4HET A;  2XL7 A;  4B1M A;  3WDW A;  2DVF A;  5KXE A;  5LWB A;  3M4F A;  2X10 A;  5J1X A;  3PTY A;  3TBD A;  3IKW A;  2XJS A;  4XJZ A;  1PO2 1;  1H2K A;  4FFF A;  2EIE A;  3OEA A;  1WZX A;  3WQ7 A;  1B09 A;  1H2M A;  1UZW A;  2W87 A;  2JDA A;  4XQW A;  4NAO A;  5FWE A;  2VUL A;  1EUT A;  1WW5 A;  1H2L A;  1S1A A;  3JBG 2;  4KU7 A;  4BQY A;  1LGN A;  1VBB 1;  2VUA A;  1TQ5 A;  3D4K A;  4QPY A;  4DRR A;  4E8C A;  4MZU A;  1UZV A;  2ZGP A;  4DIQ A;  4CDX A;  2WYF A;  4AHY A;  3N36 A;  1SLC A;  4AOC A;  1AR7 3;  3V0A B;  4FPY A;  1LJ7 A;  2G1M A;  3LB9 A;  4LOR A;  4Q0Q A;  3RMX A;  3USS A;  1RC6 A;  3ZXD A;  1MQT C;  5FY0 A;  5KXC A;  5JPN B;  4DEQ A;  1N3O A;  1CX4 A;  4BB3 A;  2FMD A;  1H6X A;  1D4V B;  2Q8E A;  1HRI 3;  3KF3 A;  2IXJ A;  4NN0 A;  3ACH A;  1IPK A;  2WZE A;  3AXD A;  4XFI A;  4Y24 A;  1X33 A;  5FMC A;  2CY6 A;  2R0H A;  3ZYH A;  5KHJ A;  3BPS A;  1VE0 A;  2GP5 A;  4CXX A;  1BCX A;  5FMO S;  4E8D A;  1G9A A;  4HVR A;  4KG0 A;  3RVH A;  3RGB A;  3RZG A;  3IB3 A;  1UU5 A;  4RHV 1;  1XNB A;  4AVV A;  3KSC A;  4BK4 A;  2LUW A;  3GZT B;  2HEW F;  1KJR A;  4AI0 A;  2E32 A;  1PO2 3;  4OMD A;  1AXY A;  2EVX A;  4GJZ A;  1MVQ A;  1J84 A;  4OCT A;  3JQW A;  3K4Z A;  2VMF A;  4RQP B;  4CDQ C;  1XJA A;  2Y6L A;  1AYN 2;  2VU9 A;  4GD4 A;  1DQ0 A;  4IEX A;  3RS6 A;  3VHP A;  2PYT A;  4LIV A;  2WZR 3;  4M01 A;  3E5Q A;  3WHU A;  3AM2 A;  1LNS A;  1RUJ 1;  3KCC A;  3ZN5 A;  1RVF 2;  1U5Z A;  1W3V A;  1J58 A;  5M0T A;  1DIW A;  4CE8 A;  3PU8 A;  4Q0S A;  3TEZ A;  1XYP A;  4QU1 A;  2JWP A;  3WNM A;  4XYX A;  5GZG A;  4Z92 B;  1O3Q A;  5DG2 A;  4YVW C;  5A6Z A;  2E63 A;  3KB5 A;  5CFC B;  1AF9 A;  3PVO A;  2WNU C;  1OQE A;  5C4W A;  3ZXK A;  5KBF A;  4E4Z A;  3OY8 A;  1Q43 A;  4JRA A;  3RJR A;  4XHB A;  3GCW A;  5HCH A;  3OBZ A;  2C5D A;  1RUH 3;  5JZG C;  4DXR A;  1RTV A;  5L9B A;  2I07 B;  3MV1 1;  4ONU A;  3ZFG A;  3MEP A;  5F1R A;  3DYM A;  3W5N A;  4OQ8 A;  5C9A B;  1AR6 1;  3E5U A;  4AFM A;  3WX5 A;  5KXB A;  2VOT A;  4Y1V A;  2O0O A;  3O1T A;  4J25 A;  1VLN A;  1OBN A;  3OUI A;  4F3J A;  4FXK B;  5JIU A;  1FV3 A;  2GME A;  5HCA A;  3U1X A;  4ISQ A;  1N47 A;  1ZBA 3;  3BIW E;  4QX1 A;  2WUH A;  1FOD 2;  4OUM A;  3AP9 A;  3FUO A;  1OPO A;  4WM8 B;  3VBU A;  3VBF A;  5FZG A;  3K4D A;  4C90 A;  1JYV A;  1QMJ A;  5GJ6 A;  3O1V A;  1VRB A;  2D7F A;  4N43 B;  4QDR A;  2JDN A;  5EJ3 A;  2PLV 3;  1GLH A;  2YY1 A;  3W21 A;  5DDJ 1;  3AYA A;  3GDB A;  4QPI A;  4IV3 C;  1NY7 1;  5FPB A;  2UYB A;  3C7F A;  3DKW A;  1CAX A;  1W8U A;  1OLM E;  1EP0 A;  3U37 A;  5CU1 A;  5A3N A;  4IQP A;  2R16 A;  3PIJ A;  2PN5 A;  3VHN A;  2A3X A;  2XKP A;  3A0N A;  2W1W A;  4D7S A;  2CAU A;  3WNN A;  4A7Z A;  2XBO 2;  1OKO A;  4HG6 B;  4YVW B;  5BNP C;  2QQP A;  4FPL A;  3TNQ A;  5BNO B;  1AYM 1;  1HRV 3;  4IW3 A;  1OQD A;  3AKQ A;  5DN2 A;  1DLL A;  3KGL A;  4MXW A;  2ES3 A;  2JDZ A;  1NY7 2;  2VNO A;  4MGY E;  2KXL A;  5I93 A;  3DEM A;  1GQP A;  2A7A A;  2OVU A;  4AVA A;  3VBH B;  1JZ8 A;  2ILM A;  2BFU S;  1Y9M A;  4LE4 A;  4AR2 A;  3U0Z A;  3NNL A;  2P5B A;  2HYK A;  4UXA A;  4H3W A;  4W65 A;  5B2G B;  4CU6 A;  3CDZ B;  3IM0 A;  5FP9 A;  5K0U A;  1R64 A;  1JYN A;  3IWZ A;  2D3S A;  2FD8 A;  5FP3 A;  2DCK A;  3VDC A;  1UW8 A;  4UI9 L;  5DAQ A;  2LW8 A;  3UKT A;  2JJ6 A;  2VUD A;  2B5H A;  2GC0 A;  3ZKU A;  1DBN A;  1GP6 A;  3MHZ A;  4IL7 A;  3WEZ A;  3TWI A;  5FJH A;  4CEY A;  1W05 A;  4QX3 A;  4YNI A;  5DAW A;  1CGP A;  5L36 A;  4CPB D;  2JB8 A;  4Y22 A;  3SNM A;  4DY5 A;  2WNV B;  4QPG B;  1APN A;  4LMF A;  2CDP A;  3DKQ A;  1NG0 A;  3N7M A;  2GAL A;  4YSF A;  1T2X A;  1PVC 3;  2VOW A;  4ASM B;  5JR2 A;  4QHB A;  4G4F A;  1WCU A;  4PDW B;  4P9G A;  1UYY A;  4UAP A;  2XHN A;  2WO2 A;  4XBQ A;  3PU3 A;  1LEC A;  1PK6 C;  1F35 A;  4ZON A;  1JS9 A;  3SKV A;  3E1F 1;  5GLT A;  1CN1 A;  2VZ1 A;  1EYB A;  4XFH A;  3O1R A;  4WVV A;  4E4D X;  1C1F A;  1QNY A;  5E1R A;  2ZZQ A;  3CEW A;  3U10 A;  5FUN A;  3WD5 A;  3WZ1 A;  1CAV A;  1S0B A;  5C5U A;  2ZAH A;  2C4X A;  4IGQ A;  4N53 C;  3R0R A;  1PVC 2;  3AZW A;  4QHO A;  1J1L A;  4QDS A;  3LA2 A;  2EAA A;  4EYU A;  1BJQ A;  1DYP A;  2QKD A;  4XUP A;  4PJY A;  4YYO A;  1YJL A;  5A3T A;  4H7L A;  2VZ3 A;  1DGR N;  4D69 A;  4DZG A;  3LZZ A;  1O8S A;  1ZZ6 A;  1HX6 A;  1V6J A;  1VB2 A;  1YI9 A;  4JDO A;  5KC5 A;  2B45 X;  2LRP A;  4QPG A;  4HXC A;  1HRI 1;  2CTV A;  4HPK B;  1C8N A;  2E9Q A;  1RUC 1;  1QGL A;  3AKR A;  1RVF 3;  4PF5 A;  4QAW A;  1HXS 2;  5DUV A;  2X05 A;  4JQR A;  3VDD C;  5B4N A;  3BUC A;  1LB2 A;  3QH6 A;  1GSL A;  4P9L A;  2E7A A;  3NMB A;  4RFT 0;  1R1A 3;  4XJ8 A;  1JYC A;  2YZ4 A;  1QH6 A;  1BBT 3;  3ZN4 A;  4CCD A;  3LKJ A;  2QTW B;  1JBC A;  2HWD 1;  4ZZ8 A;  5FPX A;  2FDI A;  1XOY A;  2VBD A;  1JTZ X;  1WCQ A;  5G05 L;  4LUM A;  2XUE A;  1H9P A;  4P5H A;  4JDM A;  2WAO A;  2YRO A;  2FCU A;  3RSJ A;  2DUR A;  4QM8 A;  5HI0 A;  3ZSK A;  3T2P A;  4A2U A;  2PHU A;  1YI7 A;  3H8R A;  4OHV A;  4B4Q A;  2RS3 2;  2HWD 3;  4MGQ A;  1JOP A;  5F3E A;  4AED B;  3AVS A;  1MS5 A;  2JG9 A;  3AP7 A;  1UYP A;  5GZD A;  3V0A A;  1QOT A;  1Z7S 2;  1MVE A;  3ABZ A;  4NRM A;  3V65 A;  4A3Z A;  1JUH A;  2EAL A;  5FP8 A;  5FY4 A;  3DF0 A;  3W5M A;  3DYO A;  1SFN A;  1CAX B;  3RYP A;  1LOF A;  2JIG A;  1FOD 1;  1FX5 A;  3VBU C;  3HN3 A;  1X36 A;  2RJL A;  2QJV A;  3CJX A;  3VBF C;  1V6I A;  1LR5 A;  4A6S A;  1X7N A;  2BJS A;  4PIZ A;  3THC A;  3LAG A;  3I2K A;  1BVP 1;  1OF4 A;  5FZ8 A;  5CFD B;  5A7N A;  3R6S A;  3FFQ A;  5FRE A;  1VBA 2;  1GWK A;  5CAD A;  2KM2 A;  4NO4 A;  3ZIX A;  3UGH A;  3CKH A;  1HQN A;  1ENQ A;  3DXT A;  2XG3 A;  3X29 B;  1UKG A;  4JGZ A;  4YVS C;  4BWO A;  2AAC A;  2ZGR A;  4NHY A;  1BXH A;  2WNU B;  1R09 2;  4TZD A;  4U2A A;  5CKM A;  3ZXG A;  3ORJ A;  3QLQ A;  1K12 A;  5F5Q A;  4XF4 A;  3JB8 A;  4QX5 A;  4JGY A;  2ORX A;  1U0A A;  4FAG A;  4FXG B;  2CNA A;  1NOV A;  2JEM A;  2XBO 1;  5IK5 A;  3ZXJ A;  5LEK A;  2ZEY A;  3ATG A;  3H1W A;  1N1S A;  2Y6J A;  2RM2 1;  3AJZ A;  2Y33 A;  3ZSL A;  3POE A;  2KR2 A;  4RGG A;  2XJP A;  1HV1 A;  2PHT A;  3AC0 A;  3C2U A;  1UY4 A;  4PBP A;  5I91 A;  1PZ8 A;  1VBA 1;  5CIR A;  2NM1 A;  1NA1 A;  4Q4W 3;  2E53 A;  5DQ0 A;  3Q8C A;  4MO3 M;  4AGV A;  4QXH A;  1CAU B;  2D3P A;  2IFR A;  2Y6F A;  4NRP A;  3Q9O A;  4LNV A;  3GAL A;  2ZHN A;  1H9W A;  1BEV 2;  3WV6 A;  3FBM A;  4CTE A;  2I74 A;  4JVA A;  3S5A A;  5A3P A;  1PIV 1;  1TME 3;  3VBR C;  2ARB A;  4X8N A;  5F3C A;  3BU7 A;  4N9I A;  3MW4 A;  4FTE A;  1NCQ C;  4R4Z A;  4TYS A;  1LKN A;  1W9W A;  3UYJ A;  4O9E A;  3POF A;  3I8T A;  3RZZ A;  5L7O A;  5FZE A;  1VRH 1;  2WNV C;  2D40 A;  2WA3 A;  4Y22 B;  1URX A;  2VZT A;  2ZEZ A;  3NAP B;  1W9S A;  2ZPX A;  2WT0 A;  1N3Q A;  3VHR A;  3MZH A;  3I2D A;  5DZE A;  2GC2 A;  2W46 A;  1WCK A;  2UWC A;  4K8F A;  4CUA A;  5K4L A;  4XF0 A;  3TNP B;  3PUQ A;  4IEU A;  2WYS A;  3RG0 A;  2NYY A;  5BNO C;  4I2O A;  1H30 A;  2AZ5 A;  3OBA A;  4A7Y A;  4Q4X 3;  5FY9 A;  1P8J A;  4FPO B;  2ZZJ A;  4QU2 A;  5A7W B;  4AEM A;  5K9Y A;  1ASJ 3;  3OGV A;  4GQ7 A;  2VVD A;  1L7R A;  5D8A A;  3H9A A;  3I3D A;  5C6C A;  4AQ6 A;  4UF0 B;  1MEC 1;  2BNO A;  4LOT A;  4ORF A;  1XYO A;  2DCJ A;  4CUG A;  2UWA A;  4PDW A;  3VBS C;  2VW0 A;  1QJZ A;  5KHI A;  2UU8 A;  3IT8 A;  5APA A;  5A3O A;  1AYM 2;  2ADD A;  2P3J A;  4C8D A;  1OPM A;  5FAX A;  3P5B A;  1F5J A;  3F2Z A;  4Y1Z A;  4WVM B;  1ULO A;  4X6Q B;  1MS3 A;  3WNL A;  1JOJ A;  2F4P A;  2PA7 A;  2RV9 A;  3FUQ A;  4BQ4 A;  5FMB A;  3WXP A;  4CCL A;  4HAN A;  1X9P A;  4AEK A;  2XON A;  4JX0 A;  4DIN B;  2WNO A;  5LEJ A;  3B9C A;  4LO4 B;  1Z7S 1;  4QPI B;  1H4G A;  5IK7 A;  4RR3 C;  4F83 A;  4LBJ A;  2C1F A;  4P9W A;  1HN0 A;  4IE0 A;  4I3G A;  3K77 A;  4NID A;  1O6U A;  3FLT A;  3ZVX A;  4EV0 A;  1AR6 3;  1UN1 A;  2BOJ A;  1ULF A;  1NAE A;  3KQ4 B;  4KGG A;  1WBL A;  2OQ7 A;  4IE4 A;  4EN0 A;  1DFQ A;  4Z2W A;  3ZSJ A;  3WW2 A;  1K5M A;  1LED A;  1RUH 1;  4PIX A;  3PJY A;  4LK6 A;  5DUX A;  2D98 A;  2BUK A;  2VTX A;  3IDA A;  4AI3 A;  1I3H A;  2PFW A;  1C1L A;  1UZZ A;  2IZW A;  2WII B;  1DQ1 A;  4EWE A;  3HEI A;  3G7D A;  1VMH A;  1MEC 3;  1S0F A;  2JIJ A;  3THP A;  1CZS A;  3OB8 A;  5J7M A;  3ZFG B;  4Q4Y 2;  5C8C B;  2HBU A;  2ZX3 A;  1W8O A;  2RDN A;  1Q56 A;  4R9B A;  1FPN 3;  5C8W A;  4LKS A;  4QGM A;  2VMH A;  3U07 A;  3ZN6 B;  1Z78 A;  3NNM A;  3PUH A;  3MW3 A;  1VBE 2;  2WT2 A;  2IVI B;  5JWP A;  1G8W A;  2FCT A;  1RMU 2;  3AJY A;  4IER A;  3CQO A;  1O7F A;  4SBV A;  1A8D A;  2VXJ A;  5C8C C;  1PGW 1;  2QQN A;  3SIS A;  2VL4 A;  4X6R B;  2YFZ A;  2ZXQ A;  1SPP B;  3WHT A;  4EN7 B;  4WZC A;  3PIG A;  4BM8 A;  4GB3 2;  1DYO A;  3UL2 A;  1F5F A;  1RIN A;  1AR8 1;  2LAL A;  2WLQ A;  5LRR A;  4L0P A;  1UMZ A;  3ENR A;  3S6P A;  1JU3 A;  2WO1 A;  4AED C;  2QE3 A;  3IMN A;  1QJY 2;  2FMY A;  4HSL A;  3TYJ A;  3KLS A;  1EV1 2;  5DPN A;  4BHP A;  4AEJ A;  1TMF 3;  2BNM A;  5KHK A;  1GZW B;  1MS0 A;  1MS1 A;  1AYN 3;  1OKQ A;  1PGW 2;  1RMU 3;  2D5H A;  2W9X A;  3ES1 A;  4LUK A;  3PHM A;  4XFC A;  5FPL A;  3WF4 A;  4ES8 A;  3QH7 A;  2JG8 C;  3VBH A;  3WDU A;  5E6H A;  2D93 A;  3OPW A;  3AFG A;  2WWS A;  4B8E A;  3A0K A;  3BGA A;  1AR8 2;  1GOH A;  3D6E A;  1S0I A;  3VV1 A;  3K3N A;  2BFU L;  1X9T A;  3WF2 A;  2ZML A;  4EWA A;  3N7K A;  1RUE 2;  2XHK A;  1I1E A;  3GM8 A;  4YZ2 A;  1W2U A;  2NMN A;  2X8K A;  3MUZ 1;  5CB7 A;  3UJQ A;  5HXM A;  4J1W A;  1ZZ8 A;  2EXH A;  3H0O A;  2UY8 A;  1WD4 A;  1IG0 A;  1GOF A;  2YFU A;  4QKD A;  3C8X A;  3IMM A;  3TRS B;  3ES4 A;  2VZU A;  1XSR A;  4O7X A;  4NPL A;  1HRV 2;  1UOF A;  3VUO A;  4R9C A;  5ACA 2;  1H0B A;  1QQP 1;  4OZX A;  3NL1 A;  5JXI A;  3APB A;  2JG9 C;  1N1V A;  3EQE A;  4KI5 M;  5DDJ 2;  3ZYP A;  3N9O A;  3W9A A;  1RUD 3;  5FZF A;  1WME A;  4ZHN A;  1W8F A;  3AMP A;  5IWF A;  5E16 A;  2XR4 A;  3JD7 1;  4JZR A;  4XUQ A;  2CGO A;  3JD7 3;  2VW1 A;  4YGD A;  2JKB A;  4WM8 A;  4XJW A;  3Q8B A;  1IQD C;  1F9K A;  3LIG A;  4W4Z A;  3B93 A;  1PX3 A;  4XJU A;  4Q8K A;  1QJX 1;  4OVE A;  4D3W A;  4IUG A;  5A7W A;  2PLV 2;  3GJB A;  4D7T A;  2VNR A;  2ARA A;  4N7U A;  1XQN A;  1IGO A;  1W2O A;  4HN0 A;  3MF9 A;  3ZSE A;  1U5X A;  3MLK A;  4HKW A;  1GUI A;  3H3L A;  3NV4 A;  4LKD A;  2XJT A;  2K9Z A;  1O4Z A;  2JDU A;  5CA6 A;  5D1I A;  1K5M C;  1VBD 1;  2DVG A;  1EV1 3;  2BU9 A;  3SCG A;  2IXC A;  3NAP C;  1ODM A;  5C3R A;  5DAB A;  5T52 A;  1OSG A;  5LBF A;  2R6Q A;  5CFC A;  2ZGS A;  3LSE A;  2ZEW A;  2ZMK A;  4Q1P A;  4QM9 A;  4BXF A;  3BI3 A;  2BW8 A;  1ACC A;  1GOG A;  4P9X A;  2FDG A;  3VBO B;  2DCY A;  4D6R A;  4PT6 A;  5I8T A;  4QWN A;  4GWM A;  2CYF A;  4EJR A;  2PXJ A;  1PMJ X;  3NWK A;  1UY2 A;  4FPC A;  4HFS A;  1RMU 1;  3TOJ A;  1SLI A;  2VOK A;  3O12 A;  5IW0 A;  1ENX A;  4CCE A;  2V4V A;  5FYB A;  1HKD A;  1Y7B A;  1QDO A;  1JYT A;  2PAE A;  4L99 A;  3AFK A;  4QB1 A;  2VW2 A;  4OFG A;  3UES A;  4PIY A;  5FXX A;  3ELN A;  1YO8 A;  2A71 A;  3O1S A;  2A6X A;  4YVS A;  5FPA A;  3ZSM A;  1MS4 A;  2DFB A;  4GH4 C;  3VDB A;  1DHK B;  1ZA4 A;  1LGB A;  2FBE A;  2H0V A;  2WQ8 A;  4ASK A;  2BOI A;  1IHM A;  1UD1 A;  1PK6 A;  3MBW A;  3WVJ A;  4HT1 T;  4M4P A;  3ZMN A;  2ZGN A;  3JXS A;  4HL0 A;  1GYK A;  2A6V A;  5FYM A;  4YG3 A;  5D8A C;  2X53 S;  4XUT A;  3VZK A;  5AC9 1;  5I0U A;  3I2G A;  3BCW A;  4G9S B;  2XWB B;  3O5S A;  1V6L A;  2Y26 A;  3T30 A;  1JI6 A;  3LSD A;  3VKO A;  4R9D A;  3OSD A;  3IN9 A;  4DS0 A;  3KHC A;  2SLI A;  1ZYB A;  3B3Q E;  1QXP A;  1OLQ A;  1CJP A;  3TN9 1;  4LE3 A;  3UGF A;  3VKM A;  5GZC A;  3SHR A;  1UL9 A;  3LWC A;  5C7G A;  4AFA A;  4NHX A;  4FOW A;  4S2F A;  3HMY A;  3N7L A;  4AVT A;  2WZ8 A;  3H50 A;  1WLD A;  4R4X A;  4GWI A;  1FMD 1;  2VVF A;  5A33 B;  2BRT A;  4QPW A;  4CVU A;  3TN9 3;  4XF3 A;  1NLS A;  3ZFF A;  3I49 A;  3B5L B;  1NXD 1;  4C1W A;  1AR7 2;  1LOB A;  3DUI A;  5DAX A;  2XKO A;  4QKF A;  4Q26 A;  2VGD A;  1RUN A;  3PVB B;  4N53 B;  2IFW A;  4KWK A;  1QJY 1;  1K3I A;  2W47 A;  1NXM A;  4UW5 A;  5A80 A;  3O7O A;  1D0G A;  4BMB A;  2F17 A;  2ETE A;  3A22 A;  4HSJ A;  4JC1 A;  5JXJ A;  1OFS A;  2J1U A;  4ZXE A;  4EZ4 A;  1DU3 D;  5AC9 3;  4CCJ A;  5IYY A;  3P3P A;  1Y3T A;  5C5T A;  3DGT A;  2NN8 A;  1JHJ A;  3GZE A;  1OF3 A;  4MLO A;  1HJG A;  1FI2 A;  1X50 A;  3ITQ A;  1YFX A;  2YXS A;  4PHZ A;  3ZMO A;  2GMP A;  5DAV A;  3U11 A;  5JOY A;  4XDQ A;  5A32 A;  1KQR A;  2DV9 A;  2OPK A;  2FDH A;  4RA0 A;  5FXV A;  3J8F 1;  1J3R A;  3RQ0 A;  1YYN A;  1HB2 A;  4CDU B;  3OCP A;  2E33 A;  3CJI C;  4NHK A;  3OUH A;  4ARX A;  1POV 0;  3TAY A;  4YM1 A;  3WW3 A;  5LBE A;  1US2 A;  3I97 A;  1R08 2;  2C0Z A;  4JV4 A;  3IAQ A;  4CDQ B;  3RZM A;  3FFZ A;  4CEW B;  3E6C C;  1HV0 A;  3O0X A;  5FZ1 A;  4NHL A;  3KT1 A;  4NRO A;  1XE8 A;  1NCQ A;  4AQS A;  1NQD A;  4AXO A;  5A1F A;  1CR7 A;  4Q4X 1;  3HNY M;  4IEO A;  3IBM A;  5F9T A;  2DWR A;  5FMD A;  1YC6 1;  2V09 A;  1I6X A;  4CU9 A;  1DZT A;  2ZA9 A;  4WVW A;  1WW7 A;  4FFH A;  1A3K A;  4AVC A;  3MPP G;  5T5J A;  4M00 A;  4CCK A;  5C8C A;  1YQ2 A;  1DQ4 A;  1O91 A;  1VBC 2;  4W50 A;  5H9S A;  1G9C A;  4QQL A;  2W95 A;  3IDC B;  1GQG A;  1DLC A;  1R08 1;  3LA7 A;  1N3P A;  1BKZ A;  1JN2 P;  1AJO A;  5HV0 A;  4GXL A;  3KVA A;  5DG1 A;  1NLQ A;  5BY5 A;  3RZH A;  4AFB A;  4EN6 B;  3DPR B;  3CL1 A;  3PUI A;  4HBN A;  1BBT 2;  5LBB A;  3ZFE C;  5L7O B;  2Y38 A;  4LTA A;  2P1B A;  5C9A C;  2ZAA A;  5ANN A;  2A3Y A;  2EID A;  5FZD A;  5IFP A;  1HB1 A;  1LU1 A;  2W52 A;  4KBZ A;  1JW6 A;  5F8P A;  2FZ2 A;  4TWT A;  5BNN C;  1J59 A;  1NX9 A;  2O8Q A;  2C24 A;  4CDQ A;  3EMR A;  4IXL A;  4OUL A;  5FP7 A;  3UKV A;  4AI1 A;  5FLH A;  2VG9 A;  3VL8 A;  2JB4 A;  4XF1 A;  2ZAC A;  1UZY A;  3DN7 A;  4NVP A;  4CEY C;  4PQ9 A;  2PQS A;  2FQP A;  2OS2 A;  2TEP A;  3HOB A;  4JTN A;  5CKN A;  1W3X A;  1LOD A;  4MH0 E;  2P6C A;  5A7O A;  4XQD A;  1RUJ 3;  4COU A;  1A34 A;  1QXR A;  5FXW A;  1QEX A;  1Q5O A;  1Q8P A;  5GLZ A;  3FHA A;  2ATF A;  4FT8 A;  4KWU A;  2WAA A;  4IGP A;  5F2S A;  1XYN A;  4KWJ A;  2OPW A;  4BJ0 A;  5A3M A;  5I0R A;  3ZYB A;  1C5H A;  1LCL A;  5FPV A;  1OVS A;  2E7T A;  3D8C A;  1RUH 2;  2OII A;  1C4R A;  3POB A;  1AUY A;  1AL0 G;  2VZV A;  2RS1 1;  4BIF A;  2WL1 A;  3OF1 A;  3ZXE A;  5C33 A;  2ERF A;  1Q8Q A;  2A5Z A;  4QXC A;  5F3G A;  4Q1R A;  5IVB A;  4UF0 A;  3EHK A;  1M06 G;  1HB3 A;  1UF2 C;  4CUB A;  4XTM A;  1QJU 3;  4N53 A;  1G9F A;  4MVT A;  3GYD A;  1JYW A;  5T55 A;  2W3J A;  5IHR A;  3JD7 2;  1JHN A;  2CL2 A;  2UUR A;  1ND3 A;  1GNZ A;  4S2D A;  4NRQ A;  4Y5S A;  1E57 A;  2HWC 3;  3M3O A;  3MLL A;  3OPZ A;  3BU0 A;  4AAX A;  1YQ5 A;  2RMU 3;  3B01 A;  2VUC A;  2BQP A;  4DEV A;  1C28 A;  3ACL A;  4Q0U A;  4XOG A;  2D6L X;  4TLF A;  1W99 A;  2ZX4 A;  2D6M A;  4EQV A;  4IEV A;  2XLF A;  3NAP A;  5CAZ A;  1UY1 A;  3K2O A;  4Y20 A;  5FQ0 B;  1CQ9 A;  1ULP A;  5LA1 A;  1VBB 3;  3JUU A;  2FDK A;  5IAT A;  3VD4 A;  2BDR A;  3I4I A;  3ON7 A;  3WF3 A;  2JIC A;  3OG2 A;  2Y6H A;  1SPP A;  4P02 B;  1HB4 A;  4L11 A;  3WG4 A;  4DUX A;  4AI9 A;  4Z8B A;  1LHW A;  1XND A;  1OA4 A;  2X5I C;  4IE5 A;  4CP2 A;  5ISL A;  3B02 A;  1GR3 A;  2V73 A;  3S57 A;  1OA2 A;  1UO9 A;  2D6O X;  3IDE A;  3ZYG A;  1LAJ A;  2HWF 3;  4CXW A;  4IEQ A;  1RUI 2;  4MYE A;  5JXG A;  4P08 A;  5D8A B;  3VHO A;  2XH6 A;  2R07 1;  4B29 A;  1UNB A;  4JQT A;  3MID A;  1J83 A;  5LBC A;  4Z07 A;  3FMG A;  3IPV A;  2GSY A;  2DTY A;  3ZOI A;  3LOB A;  2YC0 A;  4B4P A;  3ROU A;  1PK6 B;  3Q8F A;  1V9U 3;  2AYH A;  3ETP A;  5IUQ A;  3QAC A;  1UU6 A;  1CWP A;  2KD7 A;  3AK0 A;  4K20 A;  2Z2S B;  3K51 A;  3I3M A;  4TTG A;  1UIK A;  4PI0 A;  2YGL A;  3OBR A;  1FT9 A;  4Y4Y A;  1HIX A;  2CWM A;  4Q27 A;  2GC3 A;  1VRH 2;  2JE8 A;  5FZK A;  4A4A A;  4RGA A;  1G7Y A;  5A70 A;  4K1Z A;  2YV8 A;  5F3I A;  3VD3 A;  4D94 A;  3OGR A;  1FAY A;  3NV2 A;  3PL0 A;  4XMA A;  4CSW A;  5FKB A;  2YGM A;  4AI2 A;  4LUL A;  4D0Q A;  3J8F 3;  3RRD A;  4FPG A;  2P17 A;  3MFA A;  2Z5W A;  2VUJ A;  4GWJ A;  3ZYF A;  3RPQ A;  3T2Q A;  3T2T A;  3O1P A;  1R1A 2;  3III A;  1CAU A;  1FNZ A;  3S5Q A;  3D3A A;  1H1M A;  3EYP A;  5EYX A;  1RUE 3;  2NLR A;  2DVD A;  1YIP A;  2XQX A;  4CPB A;  2OZJ A;  1BLZ A;  4XCB A;  3HQX A;  2GH8 A;  4UW6 A;  1LGC A;  2A73 B;  2HWB 3;  2NP0 A;  1TVG A;  1RHI 3;  4NOT A;  4A42 A;  5SV5 A;  5CG9 A;  1PO2 2;  1TNR A;  2W1S A;  4FOY A;  1KFU L;  5FO8 B;  1W8T A;  4K7J A;  3KCX A;  3KM5 A;  2H6B A;  1WBF A;  1OOP B;  4XFA A;  3I54 A;  5KXD A;  4FSJ A;  2A75 A;  1W03 A;  1VBB 2;  2XOM A;  5EJ1 B;  3PUS A;  5HCB A;  4AED A;  4N43 C;  2ZX1 A;  3GBG A;  2K0G A;  3P1I A;  2J1R A;  1ENS A;  1XPW A;  1AL2 1;  2V5Y A;  3M7A A;  1VBC 1;  3OTF A;  4LIT A;  3I59 B;  5B4X A;  1QJE A;  2WSU A;  1SFP A;  5GM0 A;  4E2Q A;  1BZW A;  2PHD A;  5JPM B;  1FNY A;  1KEX A;  4OI4 A;  1H1I A;  4XIL A;  5FZ7 A;  4CCC A;  1SDD B;  2ZHL A;  3Q8A A;  5ACA 3;  5G04 L;  1REF A;  1ASJ 1;  2OW4 A;  5FXZ A;  3WDT A;  4ZPI A;  4YZ4 A;  1D4M 3;  3POY A;  5IVV A;  5F5I A;  3U4X A;  4R52 A;  2QUO A;  1S4C A;  4V1P A;  3ETQ A;  1W9Y A;  5GLU A;  2ORZ A;  1IKQ A;  2B42 B;  3AX4 A;  4WVZ A;  4JHT A;  4M3C A;  4DOU A;  2Q1F A;  3A4U A;  3FLP A;  3WDV A;  3J4U H;  1EPZ A;  4UW4 A;  4D8M A;  2CV6 A;  4J6G A;  1GQH A;  3AKT A;  1BK0 A;  4IV3 B;  1MS8 A;  5EQU A;  2QQU A;  2P6H A;  3ZPY A;  4BE3 A;  5I8Y A;  5LK7 B;  1WA4 A;  4Q2F A;  3T1M A;  2HJI A;  1S2K A;  4JAA A;  2MPF A;  4QX2 A;  3SH5 A;  2W5F A;  3I59 A;  3N7J A;  2QQO A;  5FFO C;  2RDQ A;  1V6N A;  5J98 B;  1HRV 1;  1AYM 3;  5FZ4 A;  5C3O A;  1NA1 C;  1ZRR A;  3FN9 A;  4QQO A;  5CVR A;  4YWA A;  4H14 A;  2VQT A;  1RYY A;  5CZK A;  1GAN A;  1HLC A;  4XFF A;  1W28 A;  1SCR A;  2EXI A;  1VBE 1;  4OHW A;  3WNP A;  4NWW A;  5T54 A;  5EV7 A;  1F8V A;  5A7Q A;  4XDO A;  2V5D A;  5FUP A;  3D82 A;  4LK7 A;  3ZX7 A;  2V72 A;  4ZY9 A;  1EUU A;  3POW A;  3B00 A;  2VMC A;  2Y6G A;  1IPS A;  1LU2 A;  3HVD A;  4RFR B;  2LS6 A;  3I2H A;  3B7M A;  1FXZ A;  1HJF A;  4HVO A;  1W39 A;  3WR0 A;  1JZ3 A;  5T5O A;  3CO2 A;  5L7O C;  1O5L A;  1S0D A;  3CJI A;  1M4W A;  2CGP A;  4NIA A;  4X8P A;  1HXS 1;  4LBQ D;  5FZB A;  1UXZ A;  1PVX A;  2B9V A;  2ZBJ A;  3NQH A;  2WNU A;  3FBY A;  1UU4 A;  1MQT A;  2FDF A;  2YBS A;  1GNH A;  1RUD 2;  4Q4V 3;  5HV4 A;  4KBB A;  5F32 A;  1W6O A;  3S7E A;  5H9P A;  4CU8 A;  2J1A A;  2OUJ A;  3AMN A;  4OI0 A;  1EV1 1;  1QNW A;  1VBD 3;  4XXP A;  2RS3 3;  4CCO A;  5FBZ A;  4AQT A;  2HWE 2;  2WSV A;  3PMS A;  3LDK A;  2PQQ A;  5CFD A;  2VZO A;  4FFI A;  3H1M A;  3ZPO A;  2VZQ A;  3AYC A;  3VD7 A;  3EBR A;  1BYH A;  3VN4 A;  3ZM8 A;  1SG3 A;  1ZBE 2;  1XE7 A;  2BZD A;  2W1U A;  1UPI A;  2EIB A;  5E8A A;  3HQR A;  3OGJ A;  4PDW C;  5FZH A;  4DFS A;  1O59 A;  1SFY A;  1KDK A;  4FPJ A;  1GZT A;  5DUW A;  1BVV A;  1AR9 2;  4N7I A;  5FRA A;  2DUO A;  1FOD 3;  3NNG A;  4IV1 B;  2J1S A;  1U5Y A;  5J37 A;  4YW1 A;  4ATE A;  3AZY A;  4K21 A;  2WNE A;  5IVE A;  1O3T A;  1PGL 1;  5LCW L;  1XBF A;  3AMM A;  2Q8C A;  1YRZ A;  3CMG A;  3H7Y A;  1J3Q A;  2C6S A;  5FYY A;  4ZZ5 A;  1AX0 A;  4XE9 A;  5FWJ A;  3UJO A;  3WCR A;  2JDP A;  1H8T B;  3ZKY A;  1C8M 1;  3FE5 A;  4HK8 A;  4DB5 A;  2A3W A;  2O8O A;  2QVS B;  4FQZ A;  3OPT A;  4NPR A;  5CEH A;  3LPF A;  5FO7 B;  3WP3 A;  3O1U A;  5A7P A;  4ZKT B;  1YFW A;  1V6K A;  2YDE A;  1SLB A;  4YVW A;  1A78 A;  1N1T A;  2WNV A;  4ITC A;  1QY4 A;  4HOO A;  2HWF 1;  1CES A;  1HW5 A;  1AR9 3;  3A23 A;  4HKL A;  4RR3 B;  1RUO A;  1X8E A;  2P3K A;  1RED A;  2B39 A;  2IC1 A;  3J7L A;  3J8F 2;  4Y4R A;  1ZNP A;  3SMH A;  1PNG A;  3MUY 1;  4RQP A;  1IS6 A;  1RUF 2;  1H2N A;  2VY0 A;  2YBK A;  4DQA A;  5AC9 2;  3JU9 A;  3AVR A;  4FPH A;  1RIR A;  1VMJ A;  5BPX A;  3VBR B;  3PME A;  5A6Q A;  4QKB A;  4Q4Y 1;  1R1A 1;  4RR3 A;  2VD7 A;  2I45 A;  3EJK A;  3NVC A;  4UBH A;  4I3P A;  1KFX L;  4E4H A;  2VXR A;  1S0E A;  1REE A;  3M8L A;  3EXU A;  1W6M A;  3ZXF A;  4LO5 B;  5JOW A;  1G9B A;  2P34 A;  4UFI A;  3ACI A;  1GMM A;  4XUR A;  1TE1 B;  3JZV A;  3PLQ A;  3HT1 A;  1GZ9 A;  2XDV A;  4QHZ A;  1QJU 1;  3AXE A;  4TSV A;  1C57 A;  2W39 A;  3ZFF B;  4JGY C;  1UMH A;  5A33 A;  1R09 3;  1I5P A;  4OMC A;  4LIU A;  1WLW A;  1AVB A;  4ES9 A;  2VQ0 A;  1YHF A;  2ZKL A;  2RS1 3;  4Q5O A;  2BNN A;  5IVC A;  1GBG A;  4HK9 A;  4YW5 A;  1RUG 3;  1AL2 2;  2BWA A;  2R0F A;  4UFJ A;  4XF9 A;  3C7H A;  4NJ4 A;  2ZS6 B;  5H9R A;  3OY8 B;  1WGP A;  1LHN A;  5EWS A;  1YUD A;  1JYI A;  3LEI A;  3ZIW A;  2DDU A;  2WR9 A;  4E27 A;  4P14 A;  2VQA A;  1ZX5 A;  2ZAB A;  2MEV 2;  3LD8 A;  5FZA A;  3BN6 A;  2YBP A;  5DZF A;  4URA A;  5I0S A;  4IE6 A;  2PMW B;  1QQP 2;  2RE9 A;  3AP6 A;  3I2F A;  5FBJ A;  4XAC A;  3HBZ A;  4RS5 A;  5GZF A;  4B4R A;  2YG0 A;  3GHM A;  2GC1 A;  2JE9 A;  5GLV A;  2LTN A;  4BDV B;  3RWK X;  2WFF 3;  2GU9 A;  1MQT B;  1W6P A;  2YHJ A;  3DPR A;  1POQ A;  2Y64 A;  1SMV A;  3T08 A;  4CDU A;  1CZV A;  2WS9 1;  5EPA A;  2SBA A;  5LY1 A;  3CJI B;  4XJA A;  2Q1Z B;  2RS5 1;  2AEY A;  5JI9 A;  1NA1 B;  4BME A;  5IVF A;  5HXV A;  2Y6K A;  2IVJ A;  2YC4 A;  3LEM A;  1L7Q A;  4MGK E;  5ABJ A;  2XML A;  1WKY A;  3I2I A;  3K4A A;  3SKJ E;  2B7Y A;  2JDY A;  3IPV B;  2LRO A;  4UW3 A;  4URT A;  1R08 3;  2BBV A;  3K75 B;  2RS3 1;  4A44 A;  4Y1Y A;  3RI9 A;  5FZO A;  1D0H A;  3AYD A;  4K3U A;  3LGR A;  3J7H A;  1XC6 A;  4MGI E;  1XXN A;  3WW1 A;  1S0G A;  1UKR A;  2D6N A;  4RYD A;  4ATF A;  1PZ7 A;  2VEC A;  1HXS 3;  3B9I A;  3LE0 A;  2HYX A;  4OHX A;  2VZP A;  3O1O A;  5DXD A;  3IZO A;  5AFB A;  3OOX A;  1G86 A;  1DF0 A;  4AVB A;  1WMF A;  1OQ1 A;  1DYK A;  2DVB A;  4LBN A;  5FYS A;  1PIV 2;  1A8M A;  1W2T A;  3D5O A;  3RFR A;  1DGL A;  2AH2 A;  3ILR A;  3BTA A;  3CU7 A;  3HPN A;  3ZXL A;  1JOB A;  3NJZ A;  1CIY A;  1ZBE 3;  2DUQ A;  5EYY A;  4BQ3 A;  2VMD A;  4XJ9 A;  1YFU A;  2QQL A;  1ND2 B;  1TME 2;  1W8H A;  3H42 B;  3WNK A;  1S0J A;  3H8U A;  1W9F A;  4COZ A;  1QOO A;  1EAH 3;  1XNC A;  4MSV A;  1WW4 A;  3WY6 A;  4BOW A;  4N43 A;  5K7P A;  3ZDS A;  5DDJ 3;  1L7L A;  5J48 A;  3MI8 A;  3R4D B;  4K1Y A;  4Q0P A;  3SCF A;  3SIT A;  1OC1 A;  3AP5 A;  1CZT A;  2FDJ A;  4JDN A;  4F8A A;  1DZR A;  5JOZ A;  3S7I A;  4XW3 A;  2FHR A;  1LOG A;  5LK5 A;  4XAE A;  3VZJ A;  3UNP A;  1VAK A;  5LA2 A;  3OD0 A;  1YQ6 A;  3CHX A;  3L2Y A;  4NHM A;  2YU1 A;  4O65 A;  2QDR A;  2XLA A;  1NE6 A;  1PHM A;  2AEZ A;  3DL3 A;  3ZYI B;  1SEF A;  4FPK A;  4CDX B;  1YFY A;  4DY3 A;  2V4A A;  5C4W C;  4LJH A;  4AWD A;  5EXO A;  3QOP A;  5C3S A;  1BQP A;  3HJR A;  4YM3 A;  1V9U 2;  4YVS B;  3N9N A;  3PNA A;  4KG8 A;  1YNA A;  4Z2A A;  1UYZ A;  3VBO C;  2OXB A;  1PO1 1;  4XIO A;  2ZCW A;  5JI7 A;  3T0A A;  3WP4 A;  2ZX0 A;  2OZ6 A;  4DNY A;  5JMO A;  3P3N A;  3UKN A;  3IIA A;  1T6B X;  3I3E A;  2UYA A;  5F7U A;  2HWF 2;  3PVE A;  4AAP A;  2G9F A;  4A6O A;  1V70 A;  4CP9 B;  2WWJ A;  1ZZC A;  3WQ0 A;  3FX3 A;  4O9G A;  1GP4 A;  2G4I A;  2K2S A;  2GND A;  2RS5 2;  4C0B A;  1OD5 A;  4CA9 A;  3KQR A;  4GH4 B;  4UFM A;  2R04 2;  4FBF A;  1BEV 1;  3M70 A;  5CBL A;  2Z4F A;  3GZU C;  4V2W A;  2WN2 A;  2RM2 3;  2CGN A;  4KGQ A;  4ZS2 A;  4YW2 A;  1COV 1;  2C9A A;  2XBO 3;  3H1Y A;  3O0V A;  4GAZ A;  4NAM A;  2HWB 1;  2GN7 A;  2DFC A;  3L9J T;  5FJK A;  4A41 A;  3SH4 A;  5IVJ A;  3M3I A;  3ACF A;  3HQU A;  1Q8S A;  3GGL A;  3GCX A;  1GU3 A;  1AX2 A;  1RUE 1;  4QD2 A;  3MO4 A;  4CRQ A;  4RD7 A;  4U36 A;  1W6Q A;  1IS4 A;  2HEY F;  2R07 2;  3BYW A;  3QCW A;  5JUV A;  3RZJ A;  3VB9 A;  2JEC A;  1E5R A;  3KWV A;  1MZE A;  3MIG A;  3GJA A;  4XAB A;  2RVA A;  4P00 B;  2L9L A;  4M3C F;  4MET A;  2GNB A;  5A6Y A;  1RUF 3;  5JCT A;  2WIN B;  1NLR A;  4FFG A;  1ASJ 2;  3BTZ A;  3KD4 A;  1Y43 B;  4YW6 A;  5IAV A;  2QQM A;  5JZG B;  5LW9 A;  1PGL 2;  2RJ2 A;  1GWL A;  1RUJ 2;  1MPX A;  1GWM A;  1QOS A;  4OI1 A;  1IS5 A;  1BMV 2;  1W04 A;  2CAV A;  5DUU A;  1MEC 2;  4LBK A;  5FZ9 A;  3WNX A;  3J7M A;  4YPJ A;  4JKM A;  1W90 A;  1SDW A;  4KMQ A;  3NV3 A;  1VAL A;  4Y20 B;  2ZGM A;  4Q4X 2;  1K45 A;  4OHY A;  4LR4 A;  4Q4Y 3;  3OEB A;  1QWR A;  4BCU A;  3RZL A;  1EPW A;  5GZE A;  3KT4 A;  3KCY A;  3KF5 A;  1NZI A;  2R06 3;  3GBF A;  4V2V A;  2OT7 A;  2HLE A;  3C7G A;  4MV2 A;  2G9G A;  2WS9 2;  4XZU G;  3V64 A;  1KJL A;  4QQ2 A;  4HZF A;  3M2M A;  1AR9 1;  3KZ4 C;  4KU8 A;  4LO6 B;  5FYV A;  5LY2 A;  5EIY B;  3T0D A;  3OJB A;  5CNA A;  5FP4 A;  5T5P A;  3VZM A;  1ALY A;  4O61 A;  4AW7 A;  1DQ2 A;  2R1D A;  5JVV A;  3WCS A;  3AMQ A;  4ZU7 A;  2VTX J;  4LEJ A;  2QQK A;  4UFH A;  1BBT 1;  1RXG A;  4NMI A;  4DO0 A;  1H1A A;  1V00 A;  2J22 A;  4PQQ A;  5C70 A;  1VAV A;  5E88 A;  1DG6 A;  3BOW A;  1PZ9 A;  2VNG A;  5FZ6 A;  2RMU 1;  4IES A;  4LLO A;  1RUC 3;  3THD A;  2VCM A;  5FY7 A;  1KS4 A;  1QH7 A;  1RUD 1;  3WP5 A;  2RR1 2;  4XMI A;  4BQW A;  4Y33 A;  1OA3 A;  1RUF 1;  3LFM A;  3AP4 A;  1ZZB A;  4JTO A;  3MGU A;  3ZFF C;  4XFB A;  1RUI 3;  3NNJ A;  5FYT A;  1B35 B;  2Y60 A;  3FLR A;  4NE9 A;  4RQP C;  4BQ1 A;  5A1L A;  3NNF A;  5AFE A;  5IK4 A;  3BTX A;  3NST A;  3CBN A;  1XNT A;  4MAD A;  2WT1 A;  3M3Q A;  2Q4S A;  5FK8 A;  1O3R A;  2VNV A;  4WM7 C;  1O5U A;  2ZGO A;  4FOQ A;  3SC7 X;  1UY0 A;  2O14 A;  2P3I A;  4OYU A;  3FJS A;  1F2N A;  2Z42 A;  1WW6 A;  3MIB A;  4Q4V 1;  1QIQ A;  1LRH A;  2HWC 2;  2VVE A;  1DDL A;  5ABJ B;  2B46 X;  3I3B A;  4RN5 A;  1SBF A;  2VZR A;  2VAU A;  3SEP A;  4BQX A;  2VOV A;  4LHK A;  4OUE A;  1NQJ A;  1BEV 3;  1KS5 A;  3FL7 A;  2W1Q A;  2Q8O A;  2WN3 A;  5FYH A;  3LF7 A;  4QQH A;  4N90 A;  2ZEX A;  3WIN E;  2C26 A;  2ID4 A;  1RGS A;  1YCI A;  4K6B A;  4CDX C;  1NCR C;  4CP1 A;  5C4W B;  2XUM A;  3NO8 A;  4HMZ A;  2Q1M A;  5JLV A;  2E26 A;  2ZGK A;  1UOB A;  4A45 A;  4GH4 A;  5JZG A;  4H2A A;  2XVK A;  3EB7 A;  5J09 A;  3MLJ A;  4FP2 A;  1PO1 3;  1T6G C;  1V6O A;  2JDM A;  2WQZ C;  4CEW A;  2ZHM A;  4K40 A;  4YFZ A;  5D2A A;  2H6C A;  2XXZ A;  1SLL A;  1OD3 A;  4LBM A;  2WQ4 A;  1F15 A;  2J7M A;  4W6X A;  5FLJ A;  3IAP A;  2PTM A;  2XVL A;  3B94 A;  1NUK A;  2BGP A;  1VAM A;  5A32 B;  4FAH A;  4QKN A;  2J1E A;  5D21 A;  3TEW A;  1O4Y A;  4BIS A;  2XGX A;  3J9S A;  3MFC A;  5E89 A;  3IDB B;  3VBS A;  2VBP A;  5BXX A;  5SV8 A;  4E4S A;  1AXK A;  4Z1V A;  3NRU A;  2E51 A;  3E97 A;  4Y1U A;  4J1X A;  5EZW A;  3ASI A;  2HEV F;  1D4M 1;  2GP3 A;  3ALQ A;  4FCA A;  5IJR A;  4CXY A;  1D2S A;  1LHU A;  3LEK A;  4OI2 A;  3VDD B;  4YFW A;  4F7Z A;  5BNN B;  3LA3 A;  5ACA 1;  4YGE A;  3ZYJ B;  1SLA A;  2VQU A;  2PAM A;  2Y34 A;  1N1Y A;  4IGO A;  4D7Y A;  3O1M A;  4BLJ A;  5BNQ A;  2AEN A;  2EA7 A;  1SHW B;  4MHR A;  4BA6 A;  2VE1 A;  1YLL A;  3WQ1 A;  3THT A;  1H8V A;  3KMH A;  1NZC A;  1W2A X;  2GNT A;  4UT5 A;  4BU2 A;  4CP9 A;  2VZS A;  4ERO A;  3CNA A;  4BPZ A;  3DYP A;  2ZJC A;  4M0H A;  2TBV A;  4K8R B;  1OXC A;  4XUO A;  1QDC A;  1RJ8 A;  2HWD 2;  3JB4 C;  4YRD A;  1Q3E A;  4IEZ A;  4IEW A;  2PLV 1;  3WP6 A;  5GAL A;  1DGR A;  4MGS A;  4QB6 A;  1Y9Q A;  3BB6 A;  4WBB A;  4WM7 A;  3RZK A;  2VTF A;  3VDA A;  2EIG A;  2YPJ A;  3DEC A;  4CYD A;  2CDO A;  2VME A;  1NKG A;  4AFD A;  3LPG A;  1PM4 A;  2OYZ A;  2NZ9 A;  1JZ2 A;  1IOA A;  4XIK A;  4BH9 A;  2G9Z A;  5L9R A;  1K5J A;  1ULC A;  2TUN A;  4N8M A;  3VZO A;  2VR4 A;  1JXN A;  4YW3 A;  4HON A;  2AUY A; 
#chains in the Genus database with same CATH homology
 2W5F A;  2QQO A;  3SEE A;  1NAE A;  1F4H A;  3FN9 A;  1UYX A;  5CZK A;  2VQT A;  1RYY A;  4JHZ A;  3WNP A;  3IDA A;  2QQJ A;  2V5D A;  2V72 A;  4ZY9 A;  1EUU A;  3A7Q A;  2VMC A;  3HEI A;  2Y6G A;  1CZS A;  2YB7 A;  3OB8 A;  2J1V A;  2LS6 A;  3I2H A;  1W8O A;  4LKS A;  1PMH X;  1JZ3 A;  1JZ7 A;  3PUH A;  1D7P M;  4XUN A;  1UXZ A;  2X09 A;  2B9V A;  3NQH A;  3CQO A;  4ET7 A;  1K42 A;  3CZU A;  2QQN A;  1JU4 A;  2J1A A;  2VL4 A;  2YFZ A;  2ZXQ A;  3LQC A;  3WF1 A;  4CU8 A;  4BK5 A;  4TXW A;  1DYO A;  2QBX A;  2VZO A;  1JZ4 A;  2VZQ A;  3VD7 A;  4L0P A;  3ZM8 A;  2W92 A;  1SG3 A;  2BZD A;  1JU3 A;  2W1U A;  2WO1 A;  3VD5 A;  2EIB A;  5HPO A;  1O59 A;  2W94 A;  5DPN A;  1OH4 A;  3NJX A;  4GZ9 A;  4D8M A;  3NNG A;  2W9X A;  3WF4 A;  3K46 A;  2J1S A;  1W0N A;  1UWW A;  2R7E B;  3CMG A;  3HNM A;  3BGA A;  4ZZ5 A;  2EIC A;  3HNB M;  1GOH A;  5LCW L;  1F4A A;  3WF2 A;  3LPF A;  3T09 A;  1UX7 A;  3GM8 A;  2VCC A;  2X10 A;  3MUZ 1;  5HXM A;  5J1X A;  3A23 A;  4JKK A;  4LQR A;  2EIE A;  3OEA A;  2JD9 A;  3MUY 1;  2W87 A;  1GOF A;  2YFU A;  2JDA A;  3C8X A;  5DMY A;  2VZU A;  1US3 A;  4QX0 A;  1EUT A;  4LPL A;  3T0B A;  4E8C A;  5JXI A;  4KI5 M;  1GNY A;  1W9T A;  4QB2 A;  4DEQ A;  4XUQ A;  1H6X A;  5A1A A;  4W4Z A;  1IQD C;  3ACH A;  2WZE A;  3ACI A;  1PX3 A;  1GMM A;  4XUR A;  4IUG A;  2VCA A;  1UMH A;  4E8D A;  1I5P A;  4OMC A;  3IB3 A;  1GUI A;  4OZO A;  5JXH A;  4BK4 A;  3GXU A;  3C7H A;  2E32 A;  4OMD A;  5LA0 A;  1J84 A;  3K4Z A;  2VMF A;  3LEI A;  2DDU A;  2Y6L A;  3BN6 A;  2ZEW A;  4FI9 A;  1LNS A;  1GOG A;  3I2F A;  1OT5 A;  2YG0 A;  4PT6 A;  4ARY A;  1JZ6 A;  1TG7 A;  4AG4 A;  4BDV B;  3WNM A;  4CUC A;  1PMJ X;  1CX1 A;  1UY2 A;  1PX4 A;  2Y64 A;  3T08 A;  1CZV A;  2V4V A;  5CYY A;  4DXS A;  4QB1 A;  3UES A;  1O8P A;  3VDB A;  4DXR A;  2Y6K A;  3MV1 1;  2YC4 A;  2VCB A;  2WQ8 A;  1L7Q A;  1JZ5 A;  3DYM A;  3W5N A;  3K4A A;  1WKY A;  3SKJ E;  3MBW A;  4M4P A;  2VOT A;  3JXS A;  3K75 B;  4A44 A;  4XUT A;  3UET A;  4QX1 A;  2WUH A;  3J7H A;  5C71 A;  1XC6 A;  3I2G A;  1JYV A;  3K4D A;  1JYX A;  3CZJ A;  1JI6 A;  4QDR A;  4RYD A;  3LE0 A;  1KGY A;  2HYX A;  2VZP A;  2WAB A;  3GDB A;  2JKX A;  2WO3 A;  5FUI A;  3C7F A;  3U37 A;  5C7G A;  3HPN A;  1CIY A;  2W1W A;  2WZ8 A;  4GWI A;  3WNO A;  2VMD A;  3WNK A;  2QQL A;  4QPW A;  4CVU A;  3WNN A;  4HG6 B;  5DN2 A;  2J1T A;  3WSO A;  1K3I A;  1CZT A;  2W47 A;  5JXJ A;  3A22 A;  3UNP A;  1GQP A;  2J1U A;  5LA2 A;  4ZXE A;  2WDB A;  1JZ8 A;  5IYY A;  5IFT A;  1H6Y A;  3NJV A;  1JHJ A;  4CU6 A;  3CDZ B;  1OF3 A;  3HJR A;  1JYN A;  1R64 A;  4Z2A A;  1UYZ A;  2DCK A;  3VDC A;  4UI9 L;  3VD9 A;  2LW8 A;  5EJZ B;  3T0A A;  3WEZ A;  5JMO A;  4QX3 A;  3I3E A;  5F7U A;  2E33 A;  4ARX A;  4A6O A;  1US2 A;  2CDP A;  3I97 A;  4BXS V;  3IAQ A;  4UOJ A;  2Y8K A;  1T2X A;  5JR2 A;  2VO5 A;  3OGS A;  2E31 A;  1UYY A;  4UAP A;  2XHN A;  2WO2 A;  1DP0 A;  2Z4F A;  3HNY M;  2B4K A;  4MOA A;  2WN2 A;  3C7E A;  4CU9 A;  3SKV A;  3E1F 1;  3WF0 A;  3ECQ A;  2VZ1 A;  4A41 A;  3ACF A;  3GGL A;  1YQ2 A;  4W50 A;  1UXX X;  1GU3 A;  2W95 A;  1DLC A;  2C4X A;  3MO4 A;  5JUV A;  4QDS A;  4XUP A;  3PUI A;  2VZ3 A;  2RVA A;  4P00 B;  2L9L A;  3ACG A;  1O8S A;  2EID A;  2W91 A;  5IFP A;  2QQM A;  1NX9 A;  2RJ2 A;  1MPX A;  4DUV A;  4QAW A;  5B4N A;  4YPJ A;  2X05 A;  4JKM A;  2C9K A;  2PQS A;  4KMQ A;  4XVH A;  3HOB A;  1K45 A;  3OEB A;  3FHA A;  3I2J A;  2BER A;  4KWU A;  2WAA A;  3CIH A;  4ZZ8 A;  4BJ0 A;  3C7G A;  2HLE A;  1WCQ A;  3C7O A;  5G05 L;  4XZU G;  2WAO A;  2VZV A;  2YC2 A;  1XNA A;  4PF1 A;  5EIY B;  3T0D A;  3T2P A;  4MGQ A;  2QQK A;  4CUB A;  1JYW A;  2W3J A;  5IHR A;  2J22 A;  4PQQ A;  5C70 A;  3ABZ A;  4A3Z A;  2VJX A;  4P5Y A;  3W5M A;  3DYO A;  3THD A;  4AAX A;  3HN3 A;  4DEV A;  1W99 A;  4DUW A;  1HN1 A;  1UY1 A;  2VC9 A;  3THC A;  3I2K A;  1ULP A;  4CU7 A;  5LA1 A;  1OF4 A;  4M4R A;  3VD4 A;  3WF3 A;  3OG2 A;  2Y6H A;  3CKH A;  4P02 B;  4DUX A;  1XNT A;  4MAD A;  1UY0 A;  5JXG A;  4OYU A;  4P08 A;  1K12 A;  3MV0 1;  2ORX A;  1J83 A;  1W8N A;  3I3B A;  2ZEY A;  4RN5 A;  2Y6J A;  2VZR A;  3SEP A;  3AC0 A;  3ETP A;  1UY4 A;  4OUE A;  2KD7 A;  3FHQ A;  2OKX A;  3FL7 A;  2W1Q A;  1UMI A;  4TTG A;  2WN3 A;  5DQ0 A;  4MO3 M;  2ZEX A;  4A4A A;  2C26 A;  2ID4 A;  2JE8 A;  3LEG A;  3VD3 A;  3OGR A;  2E26 A;  1BHG A;  2QQI A;  4A45 A;  4D0Q A;  3EB7 A;  1W9W A;  4GWJ A;  3T2Q A;  1OD3 A;  3III A;  2J7M A;  3D3A A;  3EYP A;  3IAP A;  2VZT A;  2XQX A;  2ZEZ A;  1W9S A;  1NUK A;  1UY3 A;  4DXT A;  2BGP A;  1UZ0 A;  1TVG A;  2W46 A;  4A42 A;  2J1E A;  5I0D A;  4CUA A;  2W1S A;  2WYS A;  2BGO A;  3OBA A;  3NRU A;  5IJR A;  1P8J A;  2WBK A;  3LEK A;  3OGV A;  2XOM A;  1L7R A;  2VQU A;  5EJ1 B;  3I3D A;  3P1I A;  1XPW A;  2J1R A;  2DCJ A;  1SHW B;  5B4X A;  2BBA A;  4QDQ A;  1KEX A;  2VZS A;  3F2Z A;  1SDD B;  3DYP A;  5G04 L;  3A21 A;  4XUO A;  1ULO A;  4LHS A;  3WNL A;  2RV9 A;  3T2O A;  2VM9 A;  2ORZ A;  4MGS A;  4QB6 A;  3P6B A;  4JKL A;  2VTF A;  2XON A;  4JX0 A;  3VDA A;  3DEC A;  2CDO A;  2VME A;  1NKG A;  3LPG A;  3WQB A;  1JZ2 A;  4W8J A;  4QX2 A;  2VR4 A;  3I2I A;  3K77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...