3UJOA

Galactose-specific seed lectin from dolichos lablab in complex with adenine and galactose
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
253
structure length
253
Chain Sequence
ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKEDEENKLAIFNLEGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legume lectin
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 43
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ujoA00
1FV3A 1IKQA 1DYPA 2JDZA 2VH9A 2ZZJA 1MS9A 4Z8BA 4GXLA 5GZCA 1S0JA 3B69A 3SH5A 4AGVA 5JLVA 1HQLA 1LULA 2ZGLA 1UZYA 2PHXA 2ES3A 2RHPA 1BQPA 2JKBA 3LSEA 4P14A 4XJAA 2C9AA 4WVVA 2OW4A 1W6QB 1UAIA 3AX4A 3FLTA 4PF5A 5DXDA 5T50A 3WNXA 4XIOA 2ZKNA 1WUVA 4L8QA 2EF6A 3D5OA 4FPFA 3OJBA 2D44A 2Q5TA 4ZXKA 2NP0A 2D43A 1C1LA 2JJ6A 3FUQA 2R49A 1W6PA 4YM0A 2D6MA 4WV8A 4XE9A 1O4ZA 1CJPA 2ZMKA 1VAVA 3AZXA 2WJSA 4LBOA 5JMCA 1LOCA 1IS6A 3BOPA 2DUPA 1YXWA 1W6OA 1WLWA 3B9CA 3MEPA 4FPCA 1W6MB 3WDTA 4P9YA 1H9PA 1LEDA 1YI7A 4XMAA 4YW5A 3AYCA 1BJQA 1Q8VA 2PHTA 3VKLA 2ARBA 3V0AA 4UW4A 3WHUA 5GZGA 2WLQA 3AK0A 4XMIA 5KXCA 2PHRA 1C57A 1CONA 4YGEA 1HLCA 2ZBJA 4BPZA 5JVVA 4AWDA 3FFZA 3MW4A 2PHFA 4U2AA 4BOWA 4CZSA 2XB6C 1DYKA 2R1DA 1LOBA 4UW5A 2LALA 1FATA 1DQ0A 1WD3A 4FQ4A 4RL7A 1AVBA 3SNMA 1LHWA 1C4RA 1UL9A 5SV8A 1CIWA 1ULEA 3SH3A 3UJOA 3NWKA 3AXDA 4XILA 1F5FA 1DZQA 1QKQA 3I8TA 5FRAA 4BQ1A 4XYXA 4YZ1A 4YW3A 4DRVA 4GKXA 5T5PA 1HKDA 1I1EA 2DU1A 1S1AA 3ATGA 4NOTA 2UWCA 4R9CA 3V64A 3WDWA 1UKGA 1S0BA 2P34A 4FPLA 4Q8LA 2WNEA 3ZYPA 4AGGA 4Y22A 4Q8KA 5CNAA 1SLIA 5JOYA 4XTPA 3RMYA 2CNAA 2NMOA 3N7KA 2NMNA 3OGGA 1WBLA 2CYFA 1WW7A 4M00A 4BLJA 4R9BA 1MVQA 4D69A 2DU0A 1UZZA 3KQRA 2WSUA 4XZPA 1PZ9A 5DUUA 3PJQA 1VALA 2ENRA 2P3IA 1LOEA 1S0EA 3JUUA 2DVGA 5T5OA 4C1XA 1N1YA 2DVDA 1H9WA 1IS3A 4KBBA 4XIKA 1LTEA 3UL2A 1LGBA 4WZFA 4Y1YA 3ILFA 1MACA 3D4KA 2CWSA 1DHKB 3A4UA 1V6KA 5DZGA 4F83A 3TB0A 3WG2A 2SLIA 4XJUA 1AXYA 4FOVA 2WT2A 2A7AA 2W08A 1W6OB 3POYA 2A6WA 5DG2A 3WCRA 1GICA 1IKPA 3WZ1A 3AP4A 1RIRA 3H0OA 3ZPYA 1AJOA 3ZXKA 4AYUA 3SH4A 1DQ2A 5IT6A 1LU1A 2ZA9A 1GNHA 2ZGUA 2DWRA 2ZMNA 3N35A 1JBCA 1QDCA 3WDXA 2R0FA 1KJRA 2NZ9A 1ZM1A 4FOYA 1Q8OA 4YZ3A 2D6PA 1BXHA 2EXHA 5DUWA 3RQ0A 1N3OA 4TYSA 2YROA 5GLUA 5IK4A 1G9DA 1WLDA 2GNBA 1G9AA 2DTYA 2TEPA 1HDKA 4H55A 4RA0A 1IS5A 1SFYA 5CBLA 2G4IA 1MZ6A 1NLSA 2D3SA 1FAYA 3QLQA 2P3KA 2FHRA 3AZWA 2D3PA 4XJ9A 1V6IA 4YG3A 1LJ7A 3AP9A 3WG1A 1WW6A 2WSVA 1V00A 3AYEA 2ZHNA 3AP6A 1N1TA 4Y22B 1SLLA 4YG6A 1A78A 1MS5A 1BZWA 2DVFA 3WCSA 3WLUA 5CB7A 4YGBA 5IK8A 3O5SA 3OBTA 1V6OA 4Y20A 1DQ1A 3AYAA 4YW2A 1V6JA 2EXJA 2NN8A 3KM5A 5H9PA 3W59A 2UURA 5GZEA 1AXKA 2E7TA 2A3YA 4UW6A 3OY8A 5GLZA 4ATEA 2KM2A 4P9WA 1CVNA 1MVEA 1ONAA 5HCBA 4M3CE 1DQ6A 2VW1A 3M2MA 4XBNA 4XOGA 4YG0A 2LTNA 4Q27A 1S0GA 4R9AA 1YO8A 1GZ9A 1WLCA 2DTWA 4ITCA 4LBQA 3RS6A 5EXOA 1AX2A 2GDFA 1W6NA 3WOGA 2JE7A 2R1BA 3VKOA 5JOXA 3O12A 2NYYA 2DVBA 3M1HA 3ZXLA 3ZXJA 1QMJA 4IQPA 4LBNA 1VIWB 1A8DA 3AFKA 2AUYA 4BLIA 1CPNA 4CRQA 2JECA 2ZHLA 2UWBA 3N3HA 1QNWA 3MW3A 4WVWA 1WW4A 2ZMLA 1QU0A 3V0BA 4Q1PA 3OYWA 1PZ7A 5IUQA 1ENSA 1HQWA 1MS1A 2DYCA 1ZA4A 3PVEA 4Q2FA 1LENA 2EIGA 2AR6A 1O4YA 3MW2A 1LHNA 3B3QE 5GJ6A 5T5JA 1MS3A 2EALA 5EYXA 3WHTA 5E88A 1SCSA 3NV4A 3QCWA 1N1VA 3NV3A 4SLIA 1DQ5A 4PCRA 3T2TA 1G8WA 2H0BA 2A6VA 3ILNA 1WD4A 1ULFA 3PMEA 2E53A 1AX0A 3PVOA 2OUJA 3WDVA 3SITA 1IS4A 1F31A 1LHUA 1MZ5A 2BQPA 4I30A 1EPWA 2EXKA 2D6OX 2E6VA 1ULDA 2A3WA 2DUOA 4BMEA 1I3HA 2VW0A 1LOFA 2DVAA 4AVSA 1J1TA 1G7YA 3JU9A 2ZGMA 4Y20B 5FREA 4YZ5A 4K1ZA 4YW1A 1DBNA 3R4UA 2ARXA 1JXNA 3CNAA 5HCFA 1GZWA 1CR7A 1LEMA 2ZGQA 4LBKA 3ENRA 1AJKA 3AZYA 1Q56A 2E7QA 4YW4A 1Y7BA 1V6LA 1G9CA 1IOAA 2A70A 1OKQA 4LBQB 1WCSA 2WKKA 1JYCA 3O0VA 3RRDA 1D0HA 1JHNA 4Y1ZA 1W6NB 1W6PB 2YV8A 3WVJA 3M3CA 4ATFA 2Z42A 3V65A 2CL2A 5KXBA 4YFZA 1QNYA 2A3XA 3POSA 2ZGOA 2FMDA 2VUAA 2ZGPA 1BYHA 2CTVA 4Y1VA 2D3RA 2PELA 2DV9A 2ZGRA 3AP7A 4ZKTB 3IPVA 5LK5A 1W6QA 4YM3A 3UK9A 3V0AB 4ISRA 3N7MA 2AGSA 3AJYA 5EYYA 3V0BB 1GYKA 3OYWB 5GLVA 1BKZA 5GZFA 3VKNA 1YIFA 4DQAA 1FX5A 1F9KA 2GN3A 5E8AA 5H9RA 4AVVA 5IK5A 4P9XA 3ZVXA 4M3CA 4FP2A 1H30A 1CQ9A 3M3QA 2GNDA 1XQNA 1N47A 1GKBA 1YYNA 2PHWA 5JOWA 1LGCA 1VLNA 3T1LA 3ZSJA 1WW5A 4PBPA 1WBFA 1LHOA 2R0HA 1AX1A 1NXD1 1Z0HA 3A0KA 4GA9A 3ZXEA 5KXDA 1ENQA 4K1YA 3SLIA 2A6YA 1MS4A 4YM1A 4OZXA 4K21A 1W0OA 5JDBA 1KDMA 1C1FA 4NO4A 5H9QA 3W58A 1APNA 1GANA 4M3CF 4XBQA 4Y1XA 2YZ4A 5F5QA 3HN1A 2VU9A 5T55A 1G9BA 5H9SA 1RITA 2ZGKA 1FNZA 2OVUA 2V73A 4TZDA 1GZWB 1QOSA 1GZCA 1Z78A 1R1ZA 3AZZA 5GLTA 2D6LX 1LOFC 4UW3A 1TEIA 1V6NA 5T5LA 2JE9A 1S0IA 1W0PA 2ZGTA 1SLBA 3WDUA 4MYEA 4HANA 4XDQA 5GLWA 3WUCA 4FOWA 1ENRA 3ILRA 1GNZA 4BM8A 2P3JA 4BMBA 1CESA 1LESA 2WT0A 3BIWE 5F9TA 1UX6A 4LBMA 1QGLA 2YXSA 2GN7A 3AZVA 3ZSMA 4DRRA 4M01A 2D7FA 5T54A 3WV6A 1FNYA 3M3OA 4JC1A 4XJ8A 1Q8QA 2ZGNA 3IPVB 1Q8SA 4XJWA 4YGDA 2CWMA 3WG3A 1LU2A 2GNMA 3VV1A 3R05A 1JUIA 2WT1A 1G86A 4GKYA 3FUOA 1LCLA 2ZACA 4FPKA 2GMEA 4YZ2A 3WG4A 4HL0A 3FLRA 3L2YA 4FPJA 5E89A 5HCAA 3N7JA 4FVVA 5DUXA 3HMYA 2ZGSA 3R4SA 2XG3A 2ZABA 1OFSA 2DUQA 1GLHA 1DQ4A 1KJLA 1AF9A 2YY1A 3AYDA 3IKWA 4AVTA 1DIWA 1N3PA 2C5DA 4ASMB 3VUOA 4M3CB 1QDOA 1YRZA 4FPGA 3B01A 3U4XA 2A75A 2D6KA 1UN1A 4PQ9A 5GM0A 1A3KA 1B09A 1S0CA 4DS0A 3APBA 2P2KA 2WQZC 1JYIA 4LBJA 3ZYRA 2UWAA 5JOZA 5IK7A 1V6MA 4Y24A 1LECA 3RG0A 3ZXFA 1MS8A 3INAA 1QOTA 5DZFA 1SLTA 1G9FA 4CTEA 2W68A 3USUA 3WDYA 3PVNA 3Q9OA 4Q26A 2AENA 5GZDA 4FPHA 3D6EA 3GNEA 1GBGA 3DGTA 1AZDA 4YGCA 3C2UA 1QF3A 3RSJA 3IM0A 1JN2P 2GALA 1SBFA 3OY8B 1PZ8A 1SLCA 1DFQA 1LHVA 2VXRA 3AJZA 2JD4A 3GALA 2YMZA 3DUIA 1UPSA 2ERFA 2P37A 1DLLA 1UMZA 1LODA 1N1SA 1GSLA 2V5YA 5AVAA 3IMNA 3HR9A 2A6ZA 3AXEA 4FOQA 4DPNA 3NV2A 4XHBA 2NM1A 2A71A 5T52A 2E51A 1S0DA 2CY6A 3ASIA 3VKMA 5L73A 1GV9A 5DZEA 5DUVA 4YFWA 1ULCA 2GMMA 2W52A 1D2SA 2SBAA 1SACA 3LCPA 1FV2A 3B00A 4GWNA 1LOAA 1SBDA 2AREA 1URXA 2OUHA 1KDKA 4GALA 4FPEA 4LBQD 4YZ4A 3VKFC 2A5ZA 3N36A 3UJQA 3ZSKA 4XXAA 4JCKA 4YLZA 4GWMA 5GALA 2EXIA 3FBYA 4FQZA 5KXEA 4R9DA 1SCRA 1OQ1A 3A0NA 3ZSLA 2DURA 1LOGA 3LSDA 2ZHKA 4FP3A 2B7YA 1MR5A 4ISQA 4W65A 2PHUA 3NV1A 3OPZA 3SISA 2HYKA 4AGRA 5CA6A 5EWSA 1VAMA 3TAYA 4XHXA 4K20A 5DG1A 5BYNA 1FYUA 1SBEA 2ZHMA 1W6MA 3O0WA 2R16A 3AP5A 2UU8A 4LBLA 1X50A 1MS0A 3BTAA 4JRAA 4YM2A 3T1MA 1Q8PA 1JW6A 2I2SA 2VY0A 1LGNA 3FLPA 4U36A 3RMXA 3USUB 1SLAA 4XJZA 3M3EA 2AYHA 2A6XA 4XXPA 4C1WA 3MPPG 3IN9A 1S0FA 2VW2A 3WUDA 2GNTA 2W39A 1KRIA 3N7LA 3OBRA 4XTMA 4FPYA 3POWA 2AH2A 5CAZA 1CPMA 4XBLA 4FPOB 3BODA 4DFSA 1CN1A 3I4IA 4Q1RA 4PBOA 1JOJA 3O0XA 4Y26A 1U0AA 2GMPA 2D6NA 1RINA 1KITA 4Y1UA 1ULGA 1KQRA 2ZAAA 1AXZA 2EAKA 1DGLA 1N3QA 1QOOA
chains in the Genus database with same CATH superfamily
4RFRB 4AI8A 4K9SA 1IKQA 3AFGA 1DYPA 4COUA 3JD73 2ZZJA 5E6HA 4GXLA 2Y6FA 3OGVA 1Y4WA 2HWD2 3WF0A 4E4ZA 1TMF3 2XLGA 3PVBB 3TNPB 4AGVA 1IG0A 3F2ZA 1LULA 4JGYB 1JTZX 2PHXA 2WNVB 2J1EA 2LM3A 2QQOA 1PMHX 2XJSA 2E31A 3I3DA 3LSEA 3P1IA 4HONA 5J7MA 2E9QA 2OW4A 2QE3A 3HNMA 4HBNA 3AX4A 3NW4A 4LKEA 5DXDA 5FZ7A 5T50A 4XIOA 3VBHA 5I8TA 1OLME 1FXZA 1WUVA 5DAVA 3IDEA 1OFNA 5C33A 3LQCA 4PJYA 4UYBA 3K4AA 4F7ZA 4XCBA 1D4VB 4L11A 3SCGA 2D43A 2ZCWA 5A6ZA 4UBGA 4BK4A 2R49A 4GAZA 5A32A 4YVWB 2FDKA 4ZONA 4XE9A 1O4ZA 3AZXA 1VAVA 2WJSA 1SFNA 5IHRA 4QKNA 4I3PA 5C3PA 3BOPA 3ZDVA 2DUPA 2JDMA 4N53A 3N9MA 3B9CA 4UFKA 5KBFA 4N90A 4P9YA 1YI7A 1UQXA 2XVGA 4XMAA 3IIIA 4CVUA 4RR3B 1Q8VA 3KD4A 3VKLA 5L7OA 3AK0A 4E8DA 1PK6B 1CONA 4BPZA 1HLCA 2F17A 1OC1A 5FBJA 2WNUC 1W2NA 4LIVA 4AWDA 3FFZA 3ZYGA 2PHFA 4BOWA 3GGLA 1SEFA 1DYKA 2Q4SA 2R1DA 1JZ6A 1LOBA 4SBVA 4Z07A 1CD3G 4FCAA 4NMIA 3MHZA 1QJZA 4PLOA 5IATA 2Z79A 5I0DA 2CDPA 3W9AA 1CIWA 3PIJA 3SH3A 3UJOA 1PVC2 1UY0A 3OUHA 4JX0A 3FZ3A 5FRAA 4CCKA 2JX9A 2AEZA 2BEOA 3S6PA 1KFXL 2W2IA 4AHWA 4GKXA 3Q8BA 2IXCA 4QB1A 1PGSA 1HKDA 2DU1A 5J98B 3V64A 4PLNA 3WDWA 1E5IA 1S0BA 4Q8LA 2HEYF 1U5ZA 3ZYPA 4DEQA 4EE2A 4AGGA 5A1AA 4Q8KA 1SLIA 4JQTA 4CEWB 2NMOA 3OGGA 1WBLA 1FMD2 2CYFA 3UGGA 2LW8A 4BLJA 1W8ZA 2XBO1 1AYM1 3KQRA 3PU8A 3WF2A 3WXPA 1VBD2 2WSUA 5DUUA 1TQ5A 1UMIA 1TG7A 3PUQA 1DGWX 1JYVA 1RJ7A 2ENRA 1YUDA 1NZIA 2ZX2A 5JIAA 4A4AA 1RMU3 2Y33A 3WQBA 2DVGA 2UY8A 4C1XA 2DVDA 4JQRA 1H9WA 2Y6JA 5D8AB 5FPVA 4XIKA 1LGBA 2KD7A 4WZFA 3CDZB 2W1WA 1UD1A 4Y1YA 4YWAA 3WNNA 3D4KA 4MUVA 4NIHA 1GP5A 3PLQA 2VBBA 4V2WA 1FOD1 3MF9A 2A7AA 2W08A 2XBO3 1AYM3 3POJA 5FMDA 3SEPA 1PO23 1QH7A 2E63A 2Q1MA 4Z82A 3I54A 1W9WA 3AP4A 3H50A 4UFMA 3WZ1A 1AJOA 3SQOA 4CDQA 2ZA9A 4N53C 3T2QA 1RUF1 1YFXA 2R0FA 5JAXA 1X9TA 4FOYA 5APAA 2DFCA 4IV1C 1OA3A 1EP0A 4BWOA 5BNNC 3AKQA 5L7OC 2O8OA 5E16A 5ANQA 1N3OA 1V9U3 4QKBA 3RGBA 1FOD3 2P4EA 2PTMA 2AC1A 5F3GA 1VBA2 1H8TA 1XE8A 1VBC2 5FP7A 3BI3A 2WS92 4HN1A 4P9LA 1F15A 1AHSA 4DUXA 5F3CA 2D3SA 1US2A 4Q4X1 3LFMA 5F2WA 3FHIB 1U5YA 5A3NA 3AZWA 1RUF3 2DFBA 2VR4A 4FI9A 2BGPA 4BB3A 5A3OA 3FBMA 3AP9A 4IE5A 2HWB2 4CEYB 4BQ4A 2WRAA 5CG9A 2YGLA 4LO4B 2X29A 5ERLA 4AOCA 4HLTA 4Y22B 4OHZA 3ZR6A 1T2XA 4YG6A 1A78A 1MS5A 2FDHA 4E4DX 2G9FA 1UKRA 3MIGA 1CAWB 4JKKA 4YGBA 5IFPA 4NAMA 3RWNA 5KHGA 5KWRA 3AYAA 5KC5A 2VCMA 3TNQA 2VTXJ 3OB8A 5FY8A 3KVAA 5A7NA 2NN8A 3ZMOA 5C9AB 1PM4A 1REEA 4Q4X3 3UT0A 3W5MA 4LR4A 3U14A 5JMOA 2PLV2 3CJIA 2KM2A 2QDRA 2L9LA 4P9WA 1MVEA 4GULA 1AR92 4OUMA 1PVC1 5LA2A 2RDSA 4YG0A 4R9AA 1CJDA 1YO8A 1WLCA 3DV8A 3GBFA 1ZNPA 2O8QA 4E8CA 3WOGA 4B7KA 4EQVA 5FY1A 3KMHA 2RE9A 2JDUA 2XMLA 3ZXLA 3ZXJA 2IC1A 2R6QA 2HWE1 1YIPA 2WQ8A 4IQPA 1E5HA 4LE4A 3VBFB 1FMD1 1K5JA 3VZOA 3ELNA 1O59A 1CPNA 3VDBA 4CRQA 2B39A 3N3HA 3ZFEA 2ZEWA 4I3GA 4LTAA 3MW3A 2Y6KA 3UESA 4WVWA 3AKTA 4CDQC 4G4FA 3TEXA 2RJKA 2B5HA 3R6SA 3RWKX 5IUQA 1RUJ2 1ENSA 5JSPA 1E57A 1O4YA 4NR1A 4OI4A 5EFUA 1ENXA 3ZN6B 4EV0A 1MS3A 3HBKA 2RR13 1JZ5A 4FTSA 1QJFA 2P6CA 1FPN1 5E88A 1ULPA 5A33B 1N1VA 3NV3A 4SLIA 4QHOA 1RUG2 1DQ5A 3WW3A 3T2TA 1H8TC 1WD4A 1VB4A 3CIHA 2E53A 4BHPA 2BJSA 3PVOA 4LPLA 5FZ1A 2HWC3 2OUJA 1YWKA 4GB32 4MZUA 3GCWA 4CSWA 3N4MA 1YCIA 3BN6A 1ZZ7A 1EUTA 1CIYA 2BP6A 1J1TA 1G7YA 5FREA 2VNOA 1OF3A 4YW1A 1ZYBA 4IEUA 4CCCA 4XDOA 3CNAA 5LEJA 5FYIA 3O1VA 4LBKA 5FZHA 2YG0A 1AJKA 4KWLA 1VBA1 2WS91 4RHV1 2E7QA 3NO8A 4INDA 4YW4A 1M06G 1XC6A 3NJXA 4Q4Y3 2YBKA 3CJIC 2WKKA 1JYCA 3RRDA 5HPOA 1W6PB 3KLSA 3WVJA 5F5CA 2VUJA 1JYNA 4XUQA 1XU1A 1VE0A 4AAXA 2HWB1 2Z42A 4ATFA 2ZTNA 4BK5A 4ZU7A 2JWPA 2VUDA 4W6WA 5ABJB 4ZY9A 4D8MA 4KWKA 5C4WA 2RS33 3MIBA 1VBE2 2ZGOA 2VL4A 4BU2A 4C0HA 5I8YA 2ZGPA 5FMOS 2CTVA 1OHFA 2DV9A 3AP7A 3OD0A 1NLQA 2ARCA 3IPVA 4HKLA 4JDOA 5FMCA 5JR7B 4CCDA 5KR7A 1W28A 3UK9A 4BCUA 1OVSA 4IGPA 2P5BA 4ISRA 3ZYIB 5EYYA 5FMBA 3V0BB 1OD5A 2PLV1 2GP3A 3WQ0A 1O5UA 4LHNA 3O7OA 1BKZA 5GZFA 3T08A 1NCQA 1YIFA 3VKNA 3WW2A 3ZFEC 1CAUA 4DQAA 1FX5A 1AR91 4JKLA 5IK5A 1NYWA 1BVP1 3A23A 5EJ1B 4IESA 5JXHA 4GMP1 1CQ9A 3A21A 3TYJA 4IE4A 2GNDA 1XQNA 2PHWA 5JOWA 1QH6A 2GH8A 2WYSA 1WW5A 3POGA 2OZJA 5DPNA 5FK8A 3J7HA 1AX1A 1NXD1 3ZXEA 1QJEA 4GA9A 3RNSA 3DECA 1ENQA 3SLIA 5FR3A 3NJZA 4YM1A 4OZXA 2FD8A 3S57A 1GANA 4M3CF 1QJU3 4QPGB 2X10A 4W6XA 1RUC2 4BYYA 1W2AX 2VZQA 3UKVA 5EQUA 1SPPB 4A41A 1DG6A 2OVUA 3MO4A 4A3XA 1GZWB 3KQ4B 2CAVA 4AVCA 4NAOA 3ZXGA 4AFAA 1RUJ1 5GLTA 4QKDA 5AC92 1VAKA 1AR82 3HQUA 1UU6A 3THDA 5FO7B 1SLBA 3C8XA 4AVBA 4XDQA 3MI8A 1RUG1 4LA3A 3WP6A 2XQXA 1L3JA 1W04A 1LESA 1ZZBA 5B4XA 1H4HA 1UX6A 1AL22 4LBMA 2YXSA 3LIHA 2GN7A 4MVTA 3ZSMA 1YQ6A 4DRRA 4YSFA 3WV6A 5IVFA 4PHZA 3U10A 3OPTA 3IDAA 3VZLA 3DYOA 4ES9A 2FBEA 2WAAA 5FYZA 3LOBA 4M4PA 4KH9A 2B42B 3WR0A 5C4WC 3R05A 1JUIA 4I0AA 3FUOA 2PAMA 2GMEA 3WG4A 3L2YA 4FPJA 2JDAA 4FVVA 3I3EA 4QX7A 3R4SA 2XG3A 4O61A 1KJLA 2YY1A 3AYDA 3IKWA 4Z2AA 3T0AA 1WA4A 4HVQA 2C5DA 4URTA 1QDOA 4QAWA 1ODNA 2QKDA 3H3LA 4JHTA 2A75A 3KCCA 1NCQC 1UZVA 4PQ9A 5K0UB 1HV1A 1IG3A 1B09A 2RS53 4DS0A 3APBA 1L7QA 2R073 2BUKA 2D98A 3ZYRA 2UWAA 5A3TA 4JDNA 4RGAA 1VBE1 1O8PA 2KR2A 1LECA 5HCHA 3ECQA 4QQOA 1MPXA 3INAA 1QOTA 2YC4A 4FFFA 5DAXA 4KWJA 4MV2A 2JDNA 2VBDA 4JTNA 2W1QA 4PIXA 3Q9OA 2FCTA 3CO2A 4JRLA 4FPHA 4Q0SA 4YNIA 4BIFA 1GBGA 4EWAA 3VDDC 3DXTA 1YI9A 2PN5A 4FAHA 2VOVA 1QF3A 4D6QA 4X6QB 3E1F1 4META 4OULA 1GWLA 1SBFA 1VPHA 2WZR3 1HRV2 4UXAA 4A3ZA 5LA0A 4QDRA 3KS7A 1XSRA 2XLAA 3VD5A 3CMGA 3KWVA 1UPSA 4WVZA 5FZKA 1PIV3 2IVJA 2MEV3 1TME1 4QXBA 1DLLA 3ZYJB 2V5YA 4XZUG 1YC61 5BUVA 3ZFFA 3IT8A 1C5HA 2W95A 1JODA 4WZCA 3B5LB 5T52A 2JG9B 1S0DA 3E5QA 2FCUA 5F39A 2VMEA 2DCKA 4OVEA 5HXVA 4YFWA 5EIYB 2GMMA 2O14A 1EV11 1D2SA 1VMFA 3LCPA 4KBZA 3I2OA 4IGOA 3H7JA 4QD2A 4XUPA 1SBDA 2AREA 1EY2A 3KZ4C 5IAXA 5IVJA 1PMJX 3CU7A 1TME3 4YZ4A 2HYXA 2A5ZA 3N36A 5J36A 1AR81 1US3A 1J3RA 2VZ3A 4UFJA 4Q4W2 3ZX7A 3ZFGA 1X7NA 4NPLA 2JDHA 1SHWB 4IW3A 2EXIA 2JKXA 4FQZA 3SCFA 3TEYA 2LRPA 3ZSLA 5CU1A 4LJHA 1LOGA 3LSDA 2ZHKA 4ISQA 2B7YA 5CFCB 4CDUB 2J7MA 4FFGA 4W65A 5G04L 3RZKA 1ZRFA 3IB3A 1EV13 1B35B 1AL21 4AGRA 1ZZ9A 1HXS2 1UZWA 2RMU3 3KT7A 5DG1A 1FYUA 1SBEA 2G19A 3AB0A 1C8NA 1W6MA 4N7IA 3O0WA 1JZ3A 2R16A 3CF6E 4BQ3A 4LBLA 3ZOIA 1MS0A 1UY2A 4JRAA 1Q8PA 4QGLA 2I2SA 4RSUA 3RZHA 1LGNA 3AVSA 4HPKA 3USUB 4XJZA 3M3EA 4XXPA 1GP4A 4WM7A 1OLRA 1WWYA 2ADDA 2ET1A 4BE3A 1J3PA 4E2GA 2AH2A 5F6KA 2HWF2 2VNRA 4Q4V2 4RD7A 3W5NA 3D0JA 4XBLA 3PNAA 4FPOB 3UYJA 4DFSA 2XHKA 1JYXA 4C8DA 1RINA 2QQMA 2W1UA 3NJYA 1TVGA 3GDBA 1AXZA 3UETA 4IDZA 5JI7A 3CZUA 2ZEZA 4J25A 4D94A 5A1FA 5BNQA 1OBNA 5LBEA 3KT4A 2JDZA 3MPBA 4PIZA 3FJSA 5GZCA 1S0JA 3B69A 2VC9A 4CE8A 2VGDA 3VD3A 1OA4A 1HQLA 1C5IA 5FZGA 2ZGLA 1UZYA 4P14A 4XJAA 5KHHA 2JKBA 3I59A 3RZJA 3LA2A 3EXUA 1W6QB 2N7GA 3WNXA 4AZZA 2ZKNA 4BZ4A 1C8M1 4LA2A 3LEKA 5LBFA 2EF6A 2GC0A 5AVPA 2KA3A 3OJBA 3JD72 3JXSA 4NWVA 1C28A 1PHMA 3LEGA 1QJY3 2NP0A 1C1LA 1OH3A 1TMF2 2JJ6A 1UIJA 1HRI3 4QX5A 1JI6A 3EMRA 4LORA 5IAVA 3ZFGC 4WV8A 1ND3A 2ZMKA 1CJPA 3MBWA 4D7TA 1XE7A 4LBOA 5F32A 4DY3A 5J48A 1T6BX 5CFDA 4GJZA 2JDYA 1BCXA 1W6OA 1WLWA 4MGSA 2CHHA 1YNAA 1UYPA 3DKWA 1QY4A 3R0RA 4YW5A 4CUCA 5LK7B 3LB9A 3BTYA 5FZMA 4CPBD 1BJQA 2PHTA 2WNUB 2ARBA 5E1RA 4UW4A 5FJHA 3WP3A 2WLQA 4XFIA 4XMIA 2X5IA 1CAXA 4D7SA 2ZBJA 3HNBM 3LEMA 3ES4A 2LS6A 4C91A 4AHXA 4Q4W1 2ORXA 3A7QA 4XFHA 1F2NA 2YGMA 4N43A 1R083 2CGOA 3DL3A 4UW5A 4L0PA 4WM7C 1FATA 3BUCA 3POIA 5F1RA 1WD3A 4FQ4A 1COV1 4IV3A 1C4RA 2BU9A 1CAVB 4NPRA 3WINE 4NE9A 4XILA 2VCAA 2YFUA 1QKQA 1HXS1 2ARAA 3GXUA 2WO2A 4BQ1A 4GQ7A 3K3OA 1ALYA 4YZ1A 5ISLA 4TLGA 3UV9A 1I1EA 2Q0AA 4COZA 2PQSA 2JDKA 4R9CA 1EPZA 4XURA 4XTPA 3ZKUA 5LW9A 3KV4A 1F5JA 4ZHNA 4M00A 1COV3 1UCXA 5FXXA 1J84A 1UNBA 2DU0A 3VBRA 4NHXA 5BXXA 3I97A 1RGSA 2VQAA 1YJKA 5FZ0A 2VJXA 5LEKA 1GOFA 2HWF1 4Q4V1 4UBHA 2P3IA 5JCTA 2OPKA 5HV0A 3I2KA 3AMNA 2RS13 1UWWA 4OYUA 1IS3A 1LTEA 3IMMA 3RYKA 3PHMA 3ACFA 4QMAA 5A32B 4KI5M 2YBPA 2CWSA 1V6KA 4W6YA 1NE4A 2KXLA 4HN0A 4N9HA 5DZGA 3H1YA 3GCXA 3PUHA 4XFBA 3TB0A 5AFEA 2QZ3A 4HSLA 4N53B 4CA9A 4EN0A 1A8MA 2A6WA 5DG2A 1GICA 5FK7A 1IKPA 1RMU2 5A7WA 3VGIA 4IV1B 2QQVA 1H6YA 2R30A 3C7FA 3KHBA 3ZPYA 3ZXKA 3PDQA 5BNNB 3MLLA 3LOIA 4PIYA 4A45A 3VB9A 1LU1A 1STMA 3EBRA 2OYZA 1V0AA 1W0NA 2DWRA 4AK3A 1QDCA 5CFDC 3WDXA 5HV4A 4DNYA 1KJRA 4K3UA 5A6QA 5B2GB 4YZ3A 1VB2A 1UYXA 1BXHA 4GWJA 4AG4A 3O1UA 4IEPA 2XJUA 1J83A 5DUWA 3RQ0A 2WBKA 2XBO2 1AYM2 2XVLA 1OURA 1PO22 1OUXA 1QEXA 2X5IC 2VM9A 2HLEA 2BVBA 3DEMA 4DXRA 1TMF1 3ME2A 4UFLA 1G9AA 1E5RA 3PJYA 3KCYA 3VZNA 4EWDA 4IE0A 4XEZA 1XNKA 4N43C 2VVDA 3QLQA 1IPKA 4EN8B 1UO9A 2J1AA 4UF0A 1GWMA 5FPAA 3L9JT 1IZ3A 2D3PA 1V6IA 1O8SA 1W9TA 4IV3C 5FZ3A 1GR3A 1W03A 4Z2WA 4H2AA 3S7IA 1AR61 1GOGA 3WG1A 1V9U2 4P9IA 1HN1A 1FOD2 3AYEA 2Q8EA 2WNOA 1I6XA 1SLLA 5CG8A 3KSCA 3WCSA 3WLUA 2XGXA 4ZU4A 4CCNA 5KHKA 2BVVA 2XOMA 2QZ2A 2WR9A 3HVDA 1V6OA 4L2NA 2IWGB 3NNGA 1RUF2 1V6JA 3KM5A 5H9PA 3FX3A 1O5LA 2UURA 5GZEA 1HIXA 2A3YA 2AZ5A 3OY8A 3VBSA 4BH9A 3VBRC 2R061 4HSJA 1CVNA 1AR63 3M2MA 2VW1A 4QB6A 4Y5SA 4ET7A 4XBNA 3WEZA 3VZJA 1BEV3 4AEJA 2LTNA 1S0GA 3VZKA 3KGZA 1JZ8A 4LE3A 3RS6A 1PGW1 4QGNA 3O1RA 3KGLA 4Q5OA 4HVRA 2JE7A 2VZOA 3ZSEA 4YVSA 3O12A 5BPXA 4Q4X2 4QPIA 2DVBA 5F8PA 5FO8B 5FMOL 2E33A 2ATFA 2XL9A 1ZBA1 3BTZA 4CDQB 3HOBA 1OVPA 1VIWB 2R063 4BLIA 2UWBA 3T4VA 3H42B 2VMCA 1PVXA 3KVBA 3ZKYA 5LATA 5JWPA 4P5YA 2BFUS 4EJRA 1KEXA 4W50A 3GBGA 1CZTA 1ODMA 4FBFA 5C70A 3OYWA 5B4NA 4QU1A 1HQWA 4Q2FA 2IXHA 5GZGA 1XYPA 3NNMA 2AR6A 2ZOEB 1H8TB 1LHNA 1XE0A 2BRTA 5GJ6A 5A7QA 3WX5A 4I2OA 1OQDA 5EYXA 3WHTA 2XWJB 3NV4A 1QJX3 2XDVA 1ASJ3 1ZBA3 2V09A 1TNFA 4PCRA 5FXZA 2H0BA 1G8WA 5BNOC 2J22A 2W92A 5A3PA 4B4RA 3I2IA 1RMU1 2XH6A 5M0TA 1IS4A 3S5AA 1MZ5A 3TEZA 3HD8B 2Z5WA 1FI2A 5CKMA 1W39A 2RR12 4URAA 2E6VA 3MLJA 3THCA 1RXFA 2HWE2 4BMEA 4DIQA 2VW0A 4OMDA 4YZ5A 4AAPA 4WBBA 4K1ZA 5J96B 1NE6A 1ZBE3 2ARXA 1C3HA 2IFRA 1RTVA 3NJVA 4FXGB 5I91A 1EAH3 2ZGQA 1REDA 1PO21 3VHPA 1ZRCA 3ENRA 2HWC2 3B9IA 5F7UA 2OQ7A 3CJIB 3OOXA 5FZ6A 4KNCA 3DPRA 1BHGA 4P9JA 1Q56A 5BNPA 3FHQA 1G9CA 3VBHC 1OKQA 4OI2A 2Y6GA 2VMHA 1D0HA 5DMYA 1UMHA 1FPN2 2K9ZA 1K12A 2R7EB 5ANNA 3WNLA 1V9U1 1W8TA 2VMFA 1O4TA 1IHMA 3LPFA 4YFZA 1QNYA 3POSA 4TLFA 1W8OA 5ACA3 1ZVFA 3MIDA 4JGYA 5C71A 2H0VA 4ZKTB 3LA7A 2PELA 2ZGRA 1NUKA 4YVSC 3U78A 4QPIC 1XNCA 2JIGA 1X33A 2OT7A 4DZGA 4Q4Y2 4EZ4A 3V0AB 3E6CC 1UOBA 4BXFA 3AJYA 4D69A 3K75B 3VZMA 2WLPA 4B8EA 2RS32 4WM8A 4A42A 4HZFA 1JYWA 5E8AA 2OKXA 4HVOA 4XF0A 4CU6A 4M3CA 4FP2A 1H30A 2VCCA 2G9GA 4P02B 4RHV2 5FZEA 2CGNA 1O3SA 1ND2A 1WBFA 5FKBA 1LHOA 2QQNA 3WF1A 3ABZA 1RUI1 4DOUA 2NQYA 5FYVA 4K1YA 1MS4A 3JBG3 3LDRA 5LA1A 4K21A 1W0OA 2YPJA 1C1FA 3EB7A 4IEVA 4AXOA 5JIUA 4PDWA 1APNA 4QX2A 1UY1A 2Z69A 4Y1XA 1CZSA 2VO5A 2B45X 4HFSA 2YZ4A 4XUNA 5JSOA 3DKQA 3HN1A 2VU9A 3WT3A 1G9BA 3H3UA 4XF9A 2ZGKA 4TWTA 5DN2A 1WCKA 2V73A 4CXXA 1QOSA 1GZCA 2CDOA 1W8UA 1H2MA 3AZZA 5L36A 2D6LX 1V6NA 5T5LA 2JE9A 1S0IA 1RUI3 1YFYA 2ZGTA 3GHMA 2J1UA 4COYA 4NHMA 5FZOB 3ZN5A 1QJU2 4HANA 4O65A 2Y26A 5GLWA 3WUCA 4JAAA 2Y60A 4JGZA 4BM8A 2P3JA 3DPRC 3JB8A 4BMBA 2ZX3A 2B9UA 2WT0A 3HPNA 4LHKA 4NIIA 5BNPC 5FYMA 1DYOA 3AMHA 4MGQA 3VBUB 2Y64A 5C4WB 3DXUA 4LMFA 4XAAA 4CEWA 4UAPA 4W4ZA 2RR11 2JB8A 2WWSA 2ZGNA 3F95A 3IPVB 3MFAA 4YGDA 2CWMA 4AF9A 3ALQA 3OGRA 2I45A 4DINB 4B4QA 5FPXA 3VV1A 4AI9A 5FYYA 2BNNA 1G86A 4X6RB 3OGSA 2TBVA 2XHNA 2HWC1 1DF0A 3FLRA 1YFUA 3Q8EA 4OLLA 5DUXA 5E89A 2VVEA 5LZ6A 4RFT0 2ZABA 1OFSA 4Y5TA 5D8AA 1CAUB 1DQ4A 2HEVF 5FP8A 4AVTA 3U0ZA 2DCJA 5L9BA 1N3PA 2VZRA 3H1MA 4A6SA 4ASMB 1GMMA 2XJPA 3U4XA 2PXJA 1MEC3 4RYDA 1R1A1 4IERA 4N7UA 4WM8C 1A3KA 4MGIE 5CIRA 4W8JA 3ES1A 5C7GA 5FIXA 5JOZA 1HN0A 3ZN4A 1D2QA 2VG9A 4XF4A 3RG0A 3ZXFA 4EYUA 2Z2SB 1A6CA 1MS8A 1ND2C 4DEVA 3HEIA 1SLTA 1Y9MA 1W2OA 2VZTA 3IWZA 3VDDB 2ADEA 4K8RB 4Q4Y1 3WDYA 2RG4A 5GZDA 3C7GA 1RB8G 2RS52 4PDWC 3GNEA 4B1MA 3DYPA 2R072 1R1A3 4B29A 3T3YA 2RS31 4IL7A 3NNLA 3IM0A 4GH4A 3U1XA 2C24A 5K4LA 1PZ8A 2E32A 2JD4A 2J1RA 4J6GA 1ZREA 2DBIA 4OUSA 1VBD3 2P37A 1RHI3 4QX3A 4ZXEA 1UMZA 3NNFA 1N1SA 1GSLA 3P5BA 5AVAA 5IVEA 2BNMA 1PO11 4CEYA 3AXEA 1NCRA 2WFF3 3NV2A 2NM1A 2V4AA 4IEXA 4TTGA 1KXGA 1JOPA 1RL3A 2J1SA 4JGZC 1Y43B 2RJLA 5EJ3A 3VKMA 2WZR2 1PM7A 1REFA 3E97A 4O9GA 4OHVA 3UKNA 4D6SA 4E4HA 3JQWA 3ST7A 1ULCA 3LE0A 1X8EA 1FV2A 5FZAA 2JXAA 1GQHA 1UPIA 3CKHA 1KDKA 1BBT1 1JUHA 1OLQA 4S2FA 3TN93 2G1MA 3VKFC 1WMDA 3UJQA 3K4DA 4P08A 5IW0A 3ZSKA 3VD4A 4L9BA 5LRRA 2VD7A 4EN6B 2VXJA 4GWMA 1PO13 2JIJA 5EHDA 5GALA 1PNFA 5KXEA 3I2DA 1QJU1 4PI0A 4AEKA 1OQ1A 4FTBA 1MR5A 3IBMA 2LROA 5FUIA 2RDQA 5D8AC 3T2OA 1DZRA 3RJRA 2HYKA 4NIAA 5CA6A 3MFCA 3RZLA 1TME2 1VAMA 2X09A 2YPDA 2UYAA 4MX3A 1BBT3 3CQOA 3PUIA 1VBC3 4M0NA 4NRMA 1H1AA 4UI9L 5A3WA 3RYRA 3VBFA 2OQ6A 2Y0OA 3AP5A 4CU9A 2WZPP 1JZ2A 5JI9A 3WP4A 3PURA 4G9SB 4YRDA 4LHSA 1YQ2A 5D1IA 5LBBA 2IZWA 2AYHA 3IN9A 4S2DA 3WUDA 5L9VA 1EV12 2W39A 2ZAHA 3N7LA 3O14A 4XTMA 2BBVA 4FPYA 4E4SA 3POWA 4LOTA 5FYBA 5JPMB 2RMU2 5FO9B 5J37A 1GOHA 2JDPA 5FKCA 3Q8FA 4PBOA 1JOJA 3O0XA 4Q1RA 4NWWA 2RDNA 2B8MA 3ROUA 2D6NA 5JSRA 5DAPA 3H8XA 1F8VA 1DGRA 1WGPA 4TXWA 4GH4C 2Q8CA 2EIBA 1DCSA 1R64A 3WY6A 5FZDA 1ACCA 5FY4A 3LIGA 1RC6A 4OHWA 4XC9A 1FV3A 5LA9A 3ZMNA 1S2KA 1DGRN 1KS5A 2VH9A 1GQGA 2VMIA 1MS9A 3WNOA 3ZM8A 3CEWA 3SH5A 2GSYA 4D3WA 1NCRC 1ZZCA 1Y3TA 4BDVB 1W2UA 2Y6LA 2ES3A 5FLJA 3BTXA 1H0BA 3AVRA 2K2SA 5FOBB 2RS51 4BJ0A 1UAIA 2R071 4R4ZA 2RM23 3D5OA 1YJLA 1Q3EA 4KU7A 4AEDA 3ZFGB 4GWIA 2E26A 3H1WA 2Q5TA 4ZXKA 2JD9A 1UOJA 1IQAA 3HAGA 3ZR5A 4Y33A 1NZCA 4J1WA 1W6PA 4YM0A 1NXMA 2XJTA 3NAPA 2D6MA 4V2VA 4LKDA 4RQPB 4J1XA 3BALA 1OA2A 1LOCA 3LAGA 4LEJA 5FY9A 4AHZA 4FPCA 3MEPA 5IWFA 1W6MB 1F4AA 2WZR1 3G7DA 4X8NA 1H9PA 1SFPA 3J7NA 4HMZA 3BU7A 3H8RA 1QJY2 3D8CA 4HT1T 2BYVE 1LB2A 1PIV1 4BQWA 2MEV1 3WHUA 4XABA 1RUOA 1HJFA 4QX8A 1HRI2 5F5AA 1GFF2 5FP4A 3V56A 4OHXA 4WM7B 1C57A 2XKPA 4MXWB 3I2GA 2A1XA 5T3NA 4GB33 4QQLA 3E6BA 4U2AA 4MLOA 5BV6A 3ZYHA 4XQWA 1V70A 4UFIA 2LALA 3PUSA 1C8M2 2VVFA 1DQ0A 2K0GA 4LK6A 3SNMA 4AI0A 3OUJA 1LHWA 4B1LA 1UL9A 3OEBA 1ULEA 3OCPA 5SV8A 4E9KA 1VR3A 4BIOA 1J3QA 2IFWA 4B4PA 1F5FA 1DZQA 3I8TA 4UOJA 1UW8A 3D0SA 1JU3A 4LO8A 4XYXA 2C4XA 1S1AA 2XWBB 3ATGA 4XFAA 1R082 2P34A 4FPLA 1W2TA 2QBXA 2XPJA 1G6NA 2EIEA 4LLOA 5JOYA 5CNAA 1SPPA 3RMYA 2CNAA 3N7KA 2NMNA 5J09A 4D7YA 4A6OA 4R9BA 1MVQA 1RXGA 3FWEA 2WO7A 4K6BA 1TE1B 1UZZA 5I0TA 1NX9A 2YC2A 1BLZA 2RMU1 2ZXQA 4LLFA 1VALA 5FOJB 5F3EA 4CDWA 1LOEA 1AYN3 1YQ8A 3JUUA 4C90A 2V5DA 2R041 5T5OA 5FAXA 4KBBA 3UGFA 1RVF1 3PIGA 4AEDC 3U75A 4CP9A 1COV2 1DHKB 4DY5A 2BWCA 1W3XA 4IEOA 4XJUA 2EA7A 4JDMA 4FOVA 2WT2A 5CFDB 3VBOA 1W6OB 2WDBA 1TNRA 3POYA 3RZZA 3NAPC 4DMIA 3S30A 2RS12 5A6YA 5LBCA 1RIRA 1S4CA 4YPJA 1PGL2 3SH4A 4MHUA 1GNHA 1JBCA 2R043 5FPLA 3FFQA 2X5IB 2EVXA 1KD7A 1DZTA 1ZM1A 2BFUL 1CAXB 2W9XA 1L7LA 1Q8OA 4H14A 1RVF3 5FQ0B 4AL9A 5JZGA 4CPBA 3LD8A 3H8UA 4QM9A 2EXHA 1OLMA 3KV6A 2P3YA 4N43B 3NKTA 2YROA 5GLUA 5IK4A 3SHRA 1G9DA 1RUC3 4IUGA 4CDXA 2DTYA 2TEPA 4IV3B 1HDKA 1WKYA 1XNTA 1OD3A 1IS5A 4H55A 5K0UA 1Z7S3 1DLCA 1NLSA 2OXBA 1FAYA 2P3KA 4OMCA 3ACIA 4LK7A 3T0DA 5L9RA 4CUGA 4HG6B 4Z1VA 3H7YA 5LCWL 2Q1ZB 3HIFA 1QJY1 2ZPXA 1V00A 4JZRA 3AP6A 3BVCA 4NHLA 5A3MA 1N1TA 1HRI1 3ZFFC 2DVFA 5IK8A 1OT5A 3O1SA 1JS9A 4QQ2A 5CB7A 1GP6A 3OBTA 3MUZ1 3VBRB 4Y20A 5BY5A 5HXMA 2UY9A 3LA3A 3HT1A 1WMFA 1R091 4P9GA 4ZS2A 4HOOA 1HJGA 1RUE1 3HT2A 4BXSV 1HB3A 4QXCA 1AXKA 2E7TA 3I3MA 1VRBA 4FTEA 1KFUL 1IQDC 5HCBA 2HJIA 1ONAA 2Y38A 4D0QA 4XOGA 4GJYA 4GZ9A 4CDWC 1VBB1 4ITCA 1GZ9A 1IGOA 2DTWA 4LBQA 2B46X 3NSTA 5JR2A 2H6CA 2JG8A 2GDFA 1W6NA 5F6LB 5I8SA 5D2AA 3H9AA 1YHFA 3K4ZA 2PFWA 2QQJA 2NYYA 4RN5A 4LQRA 1R081 2WABA 1R093 3M1HA 4X8PA 5KC6A 1RUE3 1BK0A 1UU4A 2H6BA 3LFIA 5A7WB 1X9PA 5A1LA 2VMDA 3K46A 1QMJA 1RUD1 3KF5A 1AR62 2E7AA 3C7OA 1UYYA 3AKPA 4QX0A 3VBOC 5I0SA 1BEV2 2AUYA 2V72A 4L99A 1K3IA 4XFGA 2ZHLA 4BQ5A 1VRH3 1J58A 5IT6A 1AL0G 4NUBA 1VBB3 4NIDA 4KQ7A 2ZMLA 2BERA 2CAUA 4XUOA 4XDPA 1W9YA 1PZ7A 4MGZE 1PNGA 3BPZA 1NT0A 3PVEA 4AVSA 4LOSA 1ZA4A 2EIGA 3MW2A 2HBUA 3OUIA 5T5JA 3B3QE 3ZIWA 5BNOB 5JZGC 1POV0 4K40A 4CDUA 3JB4C 2EALA 2ZS6B 1QIQA 1SCSA 2R062 1RUD3 1RUH1 1SMVA 1WLTA 2P17A 2PYTA 2PA7A 2A6VA 1J1LA 4UF0B 3WQ1A 4CDXC 1ULFA 2WO3A 1AX0A 5FV3A 2RV9A 1PGW2 1U12A 3SITA 2RS11 3W21A 3GZEA 1PGL1 1EPWA 4AFBA 2C9KA 4QPYA 4WVMA 5FXVA 2EXKA 3OTFA 2D6OX 4HXCA 1ULDA 1W3VA 2DUOA 1QJX2 3E5XA 4XW3A 2DVAA 4HK8A 4CP1A 2VZVA 1ZBA2 3JU9A 5A6XA 2WAOA 4RGGA 2JB4A 3R4UA 2WZ8A 1BVVA 1RUH3 2QDNA 2DCZA 3VBHB 3TEWA 3KB5A 3WF4A 2C26A 2OIIA 2Y0IA 1H2LA 4LO7A 5CKNA 1LNSA 1T6GC 1Y7BA 2UYBA 2A70A 2Q8DA 1XOYA 1WCSA 5A80A 3O0VA 4CU8A 2I74A 2YV8A 1ZBE2 2Q1FA 3ETPA 4OCTA 4HKOA 4YVSB 1EAH2 3V65A 4LT5A 3J8F3 1UU5A 4FXKB 4PF1A 3M4FA 4QPIB 1D0GA 1ZX5A 2CL2A 4RS5A 3SXWA 2BZDA 2W87A 3IDBB 5KXBA 1K42A 4M4RA 2BGOA 2JG8C 2LUWA 1NOVA 2VUAA 4E2SA 3FL7A 4DXSA 3O1PA 1ND3C 2D3RA 3T4HB 1OKOA 1Y9GA 2XL7A 2VECA 5FYTA 1W6QA 3CBNA 5DDJ3 5LK5A 4XUTA 3U07A 1HQNA 2O0OA 5L7OB 1NY71 2TUNA 3U37A 4B7EA 3N7MA 2F6BA 2VBPA 1D4M1 2AGSA 5EZWA 3R4DB 2W0XA 5KHIA 3OYWB 5J1XA 5GLVA 4LHLA 3FN9A 4FAGA 4AFDA 1F9KA 1WA6X 2GN3A 4Q0PA 3ZPOA 4AVVA 5ACA2 1RYYA 4P9XA 3ZXDA 3ZVXA 1UIKA 4I02A 1QQP3 3M3QA 2VNVA 2HEWF 1N47A 1GKBA 1LGCA 1JU4A 1OOPA 1VLNA 3T1LA 3ZSJA 3M3IA 4IXLA 2G9ZA 4FFHA 2C6SA 1ZZ8A 2R0HA 2W94A 4GIQA 3I2HA 5CISA 1VMJA 1Z0HA 2ZX0A 2A6YA 1ZZ6A 1XB9A 1O3TA 1D4M3 3DF0A 3IAQA 1H2KA 5JDBA 4NO4A 5H9QA 3B02A 2CV6A 4MGYE 3ZYBA 3UGHA 1AR71 1BEV1 2VZSA 4XBQA 3KV5A 4NRQA 2ID4A 4B3NA 5F5QA 1W8FA 1W9SA 3CLPA 3THPA 1W9FA 4QXHA 5T55A 5H9SA 3VDAA 1RITA 5C5TA 3O1MA 4R8HA 3GZAA 4LNVA 2VTXA 4TZDA 1UOFA 1WCUA 2QJVA 4Y5Z0 1R1ZA 4CP2A 2VQTA 3JBG2 4Y4RA 3DPRB 4CYDA 3OG2A 4ASLA 1W0PA 5FZLA 3NQHA 5SV5A 3RDIA 2F4LA 5FY7A 4FOWA 2C0ZA 2ILMA 1GNZA 3IZOA 1AR73 1JH5A 1U5IA 2EICA 3GHNA 3MUY1 3BIWE 3THTA 1QGLA 4NPMA 1OUSA 1K5MA 2VZPA 2XKOA 4MGTA 4F3JA 3MV01 4M01A 3O1TA 2MPFA 4ONUA 1RUI2 3M3OA 3DN7A 3JZVA 4XJ8A 4CCJA 4CCLA 2FMYA 5I0UA 1QJX1 4XJWA 3VD7A 1ASJ1 2JENA 3JCIA 4O7XA 2D5HA 3WG3A 4RS5C 3HQXA 5EJZB 2WT1A 4OQ8A 3CHXA 4XFFA 4YZ2A 5F3IA 3SKVA 5HCAA 4MOAA 2Z4FA 2ZGSA 3SKJE 1A34A 2DUQA 4WM8B 4ARXA 1ULOA 1AF9A 1NAEA 4N8MA 1DIWA 4D6RA 2XUEA 1H1MA 3VUOA 3ZXAC 2WWUA 3OPWA 4M3CB 1YRZA 3IDCB 3NNJA 5JXGA 2D6KA 3KT1A 4JKMA 3MGUA 1MQTA 3MIEA 1ZBE1 5FLIA 1ND2B 5KHJA 1EAH1 4I01A 1QXJA 2WQZC 1UX7A 3LPGA 4LIUA 4COVA 5C8CA 1V6MA 4IV1A 3RYPA 1CX1A 5BNNA 1POV1 4EN9B 1OOPC 1RUNA 4QX1A 4PDWB 5DZFA 2BGCA 4BA6A 4QDSA 3PU3A 4CTEA 3FMGA 1XXNA 4L92A 5K7PA 1CGPA 1MEC2 3M70A 1PMIA 5JXJA 2AENA 5J3UA 2WN3A 3D6EA 3LKJA 2PQQA 4ZS3A 1K45A 4NHKA 4NROA 3DGTA 1WMXA 2DCYA 4YGCA 3B94A 4OHYA 3C2UA 2YU1A 5FYUA 2DDUA 2GALA 5ACA1 3C7HA 4U36A 1SLCA 2CSGA 3AMQA 2VXRA 3GALA 3O1OA 5FXWA 3OSDA 1POV3 2DCTA 2IUWA 1NA1A 3ORJA 4JGZB 1LODA 4AI3A 3MYXA 3IMNA 1YQ5A 1H2NA 3LZZA 3VBSC 4ES8A 1R1A2 4XHBA 4AVAA 2Y6HA 2A71A 2GU9A 5C3SA 4H3WA 5L73A 2AACA 3C3VA 1GV9A 5DZEA 5IYYA 5EP9A 3I3BA 2VQUA 2SBAA 1SACA 4XETA 4A7KA 3B00A 2WNVA 1K5MC 2GZWA 1RHI2 3KF3A 1JHJA 1AUYA 4LKFA 1URXA 1YEWA 2OUHA 4GALA 4JHZA 3UKTA 3BGAA 3ZFEB 2QQPA 1IPJA 1J59A 2WFF2 1D7PM 3JBG1 3T0BA 3PTRB 4YLZA 4CCMA 4LUKA 3BB6A 1XRUA 1XU2A 2BW8A 2OPWA 1SCRA 2J1VA 2X8KA 4R9DA 2DURA 1JZ4A 2FDFA 4S2GA 5C3OA 1HV0A 2RDRA 4YVWA 1YQCA 1WCDJ 4XAEA 3SISA 3QD6A 4MADA 4BISA 4KGGA 3TN92 2WQ4A 4MO3M 3TAYA 1OMIA 2HWD1 3ACLA 2BDRA 2Q8OA 5BYNA 2RVAA 2WIIB 2YB7A 2ZHMA 1LRHA 3J26N 4GD4A 4P00B 1MQTC 1PO12 1X50A 4RR3A 1UOGA 1JW6A 5C8CC 3NMBA 4KG0A 4GMP0 3FC0A 2FCVA 1O7FA 1SLAA 3S5QA 1PK6A 4C1WA 3MPPG 1S0FA 2GC3A 2J1TA 2VW2A 1KRIA 1SG3A 4ASKA 1QXRA 3TOJA 3AC0A 1BBT2 3WD5A 3BOWA 4GH4B 3BU0A 3B93A 1HB2A 3T30A 1CN1A 3T2PA 3I4IA 3Q8CA 5LB6A 2HWD3 2FDGA 4DUWA 1KITA 2FZ2A 1KQRA 1ULGA 4CXWA 5F2SA 4FO9A 1XNDA 4IE6A 1DGLA 1X36A 2BTVC 2Y34A 2XXZA 1Y9QA 4XFCA 1NCRB 2DF7A 2RJ2A 2Q30A 1NA1C 1O6UA 4ARYA 1UXZA 4LO5B 2VOWA 2X53S 2XONA 4QU2A 4Z8BA 1S55A 4TN7A 5IVYA 3WQ7A 3AM2A 1IPSA 2BOJA 3HN3A 2GH2A 2WA4A 2IVIB 5JLVA 1MEC1 2RHPA 1BQPA 3BPSA 3POFA 2C9AA 4MSVA 4WVVA 3FLTA 4PF5A 5CADA 2XVKA 4DB5A 3AKRA 4IEWA 3SEEA 2FDIA 3HWJA 4L8QA 2VZ1A 4FPFA 4JGYC 2WNVC 5CKQA 5FWJA 1XYNA 3CJXA 3MICA 4DUVA 2WL1A 2D44A 5LWBA 4AQ6A 3RJ2X 3IIAA 2HKXA 3U11A 1NCQB 2VULA 2QCSB 4AQSA 2B9VA 3FUQA 4A44A 2YBSA 2ZX4A 5CYYA 2VOKA 1OPOA 2YHJA 4HETA 5JMCA 1NLRA 1IS6A 2BBAA 1YXWA 2RM22 2VTFA 3T09A 3MLKA 3WDTA 4OFGA 3ITQA 4YVWC 5A3LA 1LEDA 4BQYA 5EV7A 2XLFA 3M7AA 4MG2A 2W1SA 3AYCA 2HH9A 4UWDA 1EYBA 2I07B 3EJKA 1VBD1 3V0AA 1RHI1 1MZEA 2ZKLA 1PVC3 3HQRA 3OBAA 5KXCA 2PHRA 2GAUA 4YGEA 5A7PA 1XYOA 4QKFA 4RR3C 3K77A 5FCCA 2WFF1 5JVVA 4QM8A 2AEYA 4Q0UA 4CZSA 3MW4A 4LITA 2XB6C 4IEQA 3EHKA 1QHDA 4F8AA 1PK6C 3GZTB 4XQDA 4LO6B 2WZEA 2ZZQA 1QWRA 2HWE3 4RL7A 1AVBA 1I9RA 1XBFA 2PHDA 4QXKA 3K48A 5LY1A 1FMD3 2FZ1A 3NWKA 3AXDA 3P3NA 3TN91 1JZ7A 1OI6A 4QQPA 2BV4A 4YW3A 4DRVA 3ZIXA 2D97A 5T5PA 3HBZA 4NOTA 2UWCA 1UKGA 1X82A 4PLMA 2WNEA 1QXPA 2WO1A 2YDEA 3QOPA 4IEYA 4Y22A 4ZZ5A 3OF1A 1W8NA 1CAWA 1FPN3 1WW7A 2VAUA 2J42A 1CX4A 1PIV2 4OZOA 2MEV2 4XZPA 1PZ9A 3PJQA 5C9AA 1O3RA 4CEWC 1VBC1 1NQDA 4AEDB 1GWKA 4LULA 1S0EA 1HB4A 1O91A 4UFHA 5DAWA 5FZOA 1N1YA 3POBA 1WMEA 3KCXA 5HBAA 5A7SA 3UL2A 3PMSA 3ILFA 3N9LA 1MACA 3NAPB 1OQEA 2IXJA 3EQEA 4Y4YA 4AE2A 1F4HA 2W47A 3G6JB 3WW4A 3A4UA 3VBUA 4F83A 3WG2A 2SLIA 1AXYA 4L97A 4Q0QA 5FWEA 3OBZA 3FE5A 5FFOC 3VHRA 4EROA 4A7ZA 4OUEA 4YW6A 3WCRA 4CP0A 1AYN2 3LWCA 4QDQA 3H0OA 1SQ4A 1VBA3 1ZA7A 3Q8AA 1X8MA 4KG8A 5FZBA 4AYUA 2WS93 4RHV3 2VQ0A 1DQ2A 5IVVA 2VOXA 5LRSA 2ZGUA 4OI0A 2ZMNA 3N35A 5FBZA 1LR5A 3DYMA 2NZ9A 4MXVA 2D6PA 2VCBA 4QQHA 5C5UA 2HWB3 4TYSA 4CU7A 2GNBA 1WLDA 2ORZA 3PTYA 5FZ4A 3ZN6A 2QFEA 4RA0A 5CBLA 1SFYA 4PT6A 3QH6A 1P8JA 1NG0A 1PX4A 2BOIA 5FZFA 1M4WA 2G4IA 2IXIA 1UY4A 2R042 1MZ6A 2WYFA 5A33A 3VLBB 1ZRDA 2FHRA 2RM21 1OPMA 1JOBA 1RVF2 4XJ9A 4YG3A 2X05A 2PMWB 3ZFFB 1LJ7A 4XACA 4CCOA 5JXIA 1WW6A 2PLV3 2WSVA 4TSVA 3VDDA 2QQWA 2ZHNA 4KL1A 4AI2A 1RJ8A 2YC0A 1AR93 3I3QA 3J7LA 4NN0A 4NIGA 4I0WB 1BZWA 1VJ2A 1CZVA 3O5SA 4GMP3 1WCQA 1Z7S2 1NQJA 3LGRA 4HKWA 4CEYC 1Q43A 3GJAA 1DQ1A 4MHRA 4YW2A 4OQ9A 2EXJA 2QQUA 3RI8A 3W59A 2W5FA 1KS4A 3D82A 4UW6A 5GLZA 3WP5A 4ATEA 4CDWB 3OD4A 4AHYA 5I0RA 1BMV2 4JVAA 2OS2A 5A7OA 1SZBA 4YYOA 2QQLA 4M3CE 1DQ6A 5LASA 4AI1A 2WUHA 5C9AC 1E5SA 2D40A 4Q27A 4CP9B 5FP3A 5EXOA 1AX2A 1DP0A 3GBWA 2R1BA 3VKOA 2EIDA 4GB31 5JOXA 3VBOB 3BIEA 5ABJA 3E6DA 3BYWA 4ZZ8A 1RUJ3 2YU2A 3WNMA 4N9IA 4I09A 3VBUC 4FFIA 4LBNA 1UF2C 1A8DA 2B4KA 3AFKA 4I0BA 2IXLA 1RUG3 2JECA 2XJQA 4R4XA 5FYSA 4HPKB 4A7YA 5JZGB 1QNWA 5IVBA 2D93A 3J4UH 4HK9A 3VBFC 4S2HA 1WW4A 1QU0A 4LKSA 3V0BA 4Q1PA 2W91A 1R092 1MS1A 1RUE2 3SCHA 2DYCA 4H7LA 4MH0E 1LENA 5FY0A 3C7EA 3LDBA 3OEAA 4CDXB 2W3JA 4IE7A 4BQ2A 5DQ0A 2QUOA 1W8WA 3QCWA 3N9OA 3LDKA 2TNFA 3OGJA 2XJRA 1VRH2 1GZTA 3ILNA 1FT9A 1DU3D 2PHLA 2PAKA 3PMEA 1VBB2 2P1BA 4QGMA 4AFMA 4Z92B 3PL0A 1AYN1 3WDVA 4NVPA 3TRSB 1F31A 1LHUA 1POQA 2BQPA 3H3ZA 2V4VA 4I30A 2P6HA 5FY5A 4QPGA 1S2BA 3TBDA 5D21A 2A3WA 3WNKA 1HB1A 3L2HA 1I3HA 1LOFA 1RUD2 3N9QA 4K7JA 4MGKE 2ZGMA 4Y20B 1DBNA 2OX0A 2BNOA 3I59B 1JXNA 5HCFA 1GZWA 4COWA 1CR7A 1LEMA 1GQPA 3N9PA 3GJBA 1ST8A 3S0MA 3X29B 1SDDB 2C1FA 1VBE3 2O1QA 3ETQA 3AZYA 3A22A 5C8WA 4AQ2A 4E2QA 1V6LA 2R32A 1IOAA 4KU8A 5FLHA 3MV11 3NKGA 4LXLA 3IAPA 4LBQB 3ZO0B 1LAJA 2DBNA 1JHNA 4Y1ZA 2JG8B 2CGPA 1W6NB 2GC1A 3NRUA 3M3CA 3GM8A 1ND3B 4H7MA 2A73B 1H8VA 4Q29A 1RUH2 1U5XA 3ON7A 3ACGA 1DGWA 5K9YA 1RUC1 2A3XA 1OH4A 4YW7A 4DO0A 5FPZA 2FMDA 2ET7A 2IXKA 4QPWA 3MZHA 1VP6A 1BYHA 3URFA 2YFZA 3FHAA 3MIFA 4Y1VA 4DXTA 5FDBA 3BKZA 1Z7S1 1DDLA 4YM3A 5ABJC 2QQKA 2VOTA 5FZ8A 5AC91 2Y8KA 2XUMA 4AFCA 2NPIA 2WN2A 3ACHA 1BMV1 4E27A 1GYKA 2F4PA 3J8F2 5JUVA 2QTWB 1WZXA 5GKAC 5FZCA 2WA3A 3QBQA 5H9RA 3WW1A 1CWPA 1UZ0A 4Y3OA 3HNYM 5TSWA 1SDWA 4A2UA 5AFBA 1W06A 4RQPA 5DDJ2 1YYNA 3SMHA 2YYOA 4EZHA 4KMQA 4PBPA 3QH7A 5FUPA 5FPBA 1VMHA 3VN4A 3A0KA 5KXDA 5AC93 4JV4A 4XPVA 2XQRA 1AR83 4AQTA 4UT5A 3I2JA 3PUAA 1OSGA 1KDMA 3J9SA 1GNYA 1W8HA 1GUIA 2VE1A 3W58A 1KGYA 2BPA2 4WVMB 3ZDSA 1XNBA 4AW7A 2VPVA 3NL1A 1QQP2 2BWAA 4QT6A 4MXWA 2XJVA 4RGKA 3RZMA 2GP5A 3U4SA 3W20A 1FNZA 5FZ9A 3VHOA 1AL23 5FTTC 2JEMA 4QPGC 4XCAA 1Z78A 1O3QA 4QHBA 1NY72 1LOFC 3D3AA 1TEIA 4UW3A 1D4M2 3RZGA 1TZOA 1EUUA 2VZUA 3WDUA 4QWNA 4MYEA 5FPUA 5L19A 1UYZA 5HI0A 1ENRA 1VRH1 3ILRA 3RVHA 1MZFA 4C0BA 5A3UA 5G05L 3S7EA 1CESA 5IVCA 2JICA 5F9TA 4FT8A 2QQIA 2WWJA 2JG9A 3AMPA 3AZVA 4RS5B 4AEMA 3ZYFA 2D7FA 5T54A 3HJRA 1FNYA 5CEHA 3AKSA 4JC1A 2VMGA 1Q8QA 4XQ4A 1XSQA 1Q8SA 1LU2A 5C3RA 2GNMA 4AR2A 1ZRRA 1AR72 4GKYA 4R52A 4PQQA 1LCLA 2ZACA 3K51A 1HRV1 4HL0A 5A70A 4XVHA 3MIHA 3N7JA 2WFPA 1HW5A 3HMYA 1GLHA 3E5UA 3JQXA 3RPQA 4PI2A 3I7DA 3M8LA 3LEIA 4FPGA 4Q0VA 3B01A 1S2EA 4EWEA 1UN1A 2OZ6A 3N9NA 5CFCA 5GM0A 1OOPB 3GYDA 3P3PA 2YUEA 4G3YC 4KWUA 1B35A 1HX6A 1S0CA 4ORFA 1UXXX 2P2KA 1JYIA 3P6BA 4LBJA 3POEA 1UY3A 5IK7A 3TWIA 1C8M3 1H6XA 4RQPC 2ZEYA 5EPAA 5FJKA 4Y24A 5K0UC 1HRV3 2QVSB 5I93A 3H8OA 2ZEXA 3I2FA 2MNGA 5DAQA 1G9FA 3USSA 2MHFA 2OA2A 5FP9A 2W68A 3USUA 5FQ0A 3NVCA 3WSOA 4QB2A 4P5HA 3PVNA 2FDJA 4Q26A 5IJRA 1XJAA 1ASJ2 1BK1A 3J8F1 5FZIA 1L7RA 1AZDA 1F35A 3K3NA 3RSJA 5K8SA 1JN2P 2PAEA 2NLRA 4NJ4A 3OY8B 4FPKA 1DFQA 1LHVA 3AJZA 3VBSB 3I49A 2YMZA 3DUIA 1H1IA 3CL1A 2ERFA 5DDJ1 1I5ZA 3QACA 3DCQA 1GU3A 2EAAA 3AL5A 3AL6A 3GF6A 3HR9A 2A6ZA 4IEZA 4FOQA 4DPNA 4CUBA 3CZJA 1ZRIA 1K5MB 4Q4W3 2E51A 2CY6A 3ASIA 4XF3A 4FSJA 1PX3A 1YFWA 4KGQA 5DUVA 3KHCA 2W52A 1JYTA 1QQP1 2JE8A 4GWNA 4ZU5A 1LOAA 2JG9C 2K46A 5DABA 5F37A 4FPEA 4LBQD 3VD9A 1HXS3 3RFRA 4V1PA 4XXAA 1W99A 2CU5A 3J7MA 4JCKA 4CXYA 4YARA 5FYHA 1NKGA 5CZKA 3VDCA 3FBYA 2FQPA 4IETA 3KV9A 3A0NA 1Q5OA 4EN7B 3VL8A 4FP3A 2WC2A 4JTOA 3RI9A 1MQTB 2PHUA 3NV1A 3OPZA 4QHZA 3WF3A 1YLLA 3GZUC 4NRPA 5FUNA 3LF7A 2ZJCA 5EWSA 1W05A 4XHXA 5C8CB 2D5FA 4K20A 4BQXA 2HWF3 4Q4V3 5CFCC 4CDUC 5FYCA 1JMUB 4O9EA 1XNAA 2VNGA 3EYPA 4XF1A 5F5IA 2VUCA 4OI1A 4CCEA 2UU8A 4M0HA 5C6CA 1B35C 2W46A 5LY2A 3BTAA 1XPWA 5IFTA 1LKNA 2GC2A 4YM2A 2VY0A 2WNUA 3AMMA 3MDPA 5CVRA 3T1MA 3WNPA 4DXZA 3FLPA 3RMXA 1I5PA 3K2OA 4K8FA 3SC7X 2ZX1A 4NHYA 2A6XA 5C3QA 2QNKA 5JPNB 1W90A 2GNTA 4CUAA 3JD71 2WINB 1OF4A 2ETEA 3MF6A 3OBRA 3EO6A 4LUMA 5CAZA 5BNOA 3BCWA 1CPMA 3BODA 2HBTA 4IGQA 4Y26A 1U0AA 3ZLIA 2GMPA 4ZPIA 3UNPA 3VL9A 4Y1UA 1CAVA 1NA1B 5BNPB 2ZAAA 1OXCA 3B7MA 2EAKA 2XR4A 3VHNA 1N3QA 1H4GA 1QOOA
chains in the Genus database with same CATH topology
4AI8A 4K9SA 1IKQA 3AFGA 1DYPA 4COUA 3JD73 2ZZJA 4GXLA 2HWD2 4E4ZA 1TMF3 2XLGA 3PVBB 3TNPB 4AGVA 1LULA 4JGYB 1JTZX 2PHXA 2WNVB 4QD2A 2LM3A 2XJSA 3LSEA 5J7MA 2E9QA 2OW4A 2QE3A 4HBNA 3AX4A 3NW4A 3VBHA 5DXDA 5T50A 5I8TA 4XIOA 1WUVA 1FXZA 3IDEA 1OFNA 5C33A 4PJYA 4F7ZA 1D4VB 4L11A 3SCGA 2D43A 2ZCWA 4UBGA 2R49A 5A32A 4YVWB 4XE9A 1O4ZA 3AZXA 1VAVA 2WJSA 1SFNA 4I3PA 3BOPA 2DUPA 4N53A 3B9CA 5KBFA 4N90A 4P9YA 1YI7A 4XMAA 2XVGA 4RR3B 1Q8VA 3KD4A 3VKLA 5L7OA 3AK0A 1PK6B 1CONA 4BPZA 1HLCA 2WNUC 4AWDA 3FFZA 3ZYGA 2PHFA 4BOWA 1SEFA 1DYKA 2Q4SA 2R1DA 1LOBA 4SBVA 4Z07A 1CD3G 4FCAA 1QJZA 4PLOA 2Z79A 3W9AA 1CIWA 3SH3A 3UJOA 1PVC2 3FZ3A 5FRAA 2JX9A 2BEOA 3S6PA 1KFXL 4AHWA 4GKXA 2IXCA 1PGSA 1HKDA 2DU1A 5J98B 3V64A 4PLNA 3WDWA 1S0BA 4Q8LA 2HEYF 1U5ZA 3ZYPA 4AGGA 4Q8KA 1SLIA 4CEWB 2NMOA 3OGGA 1WBLA 1FMD2 2CYFA 4BLJA 2XBO1 1AYM1 3KQRA 3WXPA 1VBD2 2WSUA 5DUUA 1TQ5A 1DGWX 1RJ7A 2ENRA 1YUDA 2ZX2A 5JIAA 1RMU3 2DVGA 2UY8A 4C1XA 2DVDA 4JQRA 1H9WA 5D8AB 4XIKA 1LGBA 4WZFA 4Y1YA 1UD1A 3D4KA 4MUVA 3PLQA 1FOD1 3MF9A 2A7AA 2W08A 2XBO3 1AYM3 1PO23 1QH7A 2E63A 2Q1MA 4Z82A 3I54A 3WZ1A 3AP4A 3H50A 1AJOA 4CDQA 2ZA9A 4N53C 1RUF1 1YFXA 2R0FA 5JAXA 4FOYA 2DFCA 4IV1C 1OA3A 1EP0A 4BWOA 5BNNC 3AKQA 5L7OC 2O8OA 5E16A 1N3OA 1V9U3 1FOD3 2PTMA 1VBA2 1H8TA 1XE8A 1VBC2 2WS92 4HN1A 4P9LA 1AHSA 2D3SA 4Q4X1 3FHIB 1U5YA 3AZWA 1RUF3 2DFBA 3FBMA 3AP9A 2HWB2 4CEYB 5CG9A 2YGLA 4LO4B 2X29A 4HLTA 4Y22B 4OHZA 4YG6A 1A78A 1MS5A 4E4DX 2G9FA 1UKRA 3MIGA 1CAWB 4YGBA 5KHGA 3RWNA 5KWRA 3AYAA 5KC5A 3TNQA 3ZMOA 2NN8A 5C9AB 1REEA 4Q4X3 4LR4A 2PLV2 3CJIA 2KM2A 2QDRA 4P9WA 1MVEA 4GULA 1AR92 4OUMA 1PVC1 4YG0A 4R9AA 1CJDA 1YO8A 1WLCA 3DV8A 3GBFA 1ZNPA 2O8QA 3WOGA 4B7KA 3KMHA 2RE9A 3ZXLA 3ZXJA 2IC1A 2R6QA 2HWE1 1YIPA 4IQPA 4LE4A 3VBFB 1FMD1 3VZOA 3ELNA 1CPNA 4CRQA 2B39A 3N3HA 3ZFEA 4I3GA 4LTAA 3MW3A 4WVWA 3AKTA 4CDQC 4G4FA 2RJKA 2B5HA 3R6SA 5IUQA 1RUJ2 1ENSA 5JSPA 1E57A 1O4YA 4NR1A 4OI4A 5EFUA 1ENXA 3ZN6B 4EV0A 1MS3A 2RR13 4FTSA 1FPN1 5E88A 5A33B 1N1VA 3NV3A 4SLIA 1RUG2 1DQ5A 3WW3A 3T2TA 1H8TC 1WD4A 1VB4A 2E53A 4BHPA 3PVOA 2HWC3 2OUJA 1YWKA 4GB32 4MZUA 3N4MA 1YCIA 1ZZ7A 1J1TA 1G7YA 5FREA 2VNOA 4YW1A 1ZYBA 4IEUA 3CNAA 5LEJA 4LBKA 1AJKA 4KWLA 1VBA1 2WS91 4RHV1 2E7QA 3NO8A 4INDA 4YW4A 1M06G 4Q4Y3 3CJIC 2WKKA 1JYCA 3RRDA 1W6PB 3KLSA 3WVJA 2VUJA 1XU1A 4ATFA 2HWB1 2Z42A 2ZTNA 4ZU7A 4W6WA 5ABJB 4KWKA 5C4WA 2RS33 3MIBA 1VBE2 2ZGOA 4C0HA 5I8YA 2ZGPA 5FMOS 2CTVA 1OHFA 2DV9A 3AP7A 3OD0A 4HKLA 3IPVA 4JDOA 5JR7B 5HI0A 3UK9A 4BCUA 4ISRA 3ZYIB 5EYYA 3V0BB 1OD5A 2PLV1 3WQ0A 1O5UA 4LHNA 3O7OA 1BKZA 5GZFA 1NCQA 1YIFA 3VKNA 3WW2A 3ZFEC 1CAUA 4DQAA 1FX5A 1AR91 5IK5A 1NYWA 1BVP1 4IESA 4GMP1 1CQ9A 3TYJA 2GNDA 1XQNA 2PHWA 5JOWA 1QH6A 2GH8A 1WW5A 2OZJA 1AX1A 1NXD1 3ZXEA 4GA9A 3RNSA 1ENQA 3SLIA 3NJZA 4YM1A 4OZXA 1GANA 4M3CF 1QJU3 4QPGB 4W6XA 1RUC2 4BYYA 3UKVA 1DG6A 2OVUA 4A3XA 1GZWB 2CAVA 4AVCA 3ZXGA 4AFAA 1RUJ1 5GLTA 5AC92 1VAKA 1AR82 1UU6A 5FO7B 1SLBA 4AVBA 4XDQA 3MI8A 1RUG1 4LA3A 3WP6A 1L3JA 1LESA 1ZZBA 1H4HA 1UX6A 1AL22 4LBMA 2YXSA 2GN7A 4MVTA 3ZSMA 4DRRA 4YSFA 3WV6A 3U10A 3VZLA 4ES9A 2FBEA 3LOBA 4KH9A 2B42B 3WR0A 5C4WC 3R05A 1JUIA 4I0AA 3FUOA 2PAMA 2GMEA 3WG4A 3L2YA 4FPJA 4FVVA 3R4SA 2XG3A 1KJLA 2YY1A 3AYDA 3IKWA 1WA4A 4HVQA 2C5DA 4URTA 1QDOA 2QKDA 2A75A 3KCCA 1NCQC 5K0UB 4PQ9A 1HV1A 1B09A 2RS53 4DS0A 3APBA 2R073 2BUKA 2D98A 3ZYRA 2UWAA 4JDNA 4RGAA 1VBE1 1LECA 3ECQA 4QQOA 3INAA 1QOTA 4KWJA 4MV2A 4JTNA 4PIXA 3Q9OA 4JRLA 3CO2A 4Q0SA 4FPHA 4YNIA 4BIFA 1GBGA 4EWAA 3VDDC 1YI9A 2PN5A 4FAHA 2VOVA 1QF3A 4X6QB 4META 4OULA 1SBFA 2WZR3 1HRV2 4UXAA 3KS7A 2XLAA 1UPSA 4WVZA 1PIV3 2MEV3 1TME1 1DLLA 3ZYJB 2V5YA 5BUVA 3ZFFA 3IT8A 1C5HA 4WZCA 3B5LB 5T52A 2JG9B 1S0DA 3E5QA 2DCKA 4OVEA 5HXVA 4YFWA 2GMMA 1EV11 1D2SA 3LCPA 3H7JA 1SBDA 2AREA 1EY2A 3KZ4C 3CU7A 1TME3 4YZ4A 2A5ZA 3N36A 5J36A 1AR81 1J3RA 3ZX7A 4Q4W2 3ZFGA 1X7NA 2EXIA 4FQZA 3SCFA 3ZSLA 5CU1A 1LOGA 3LSDA 2ZHKA 4ISQA 2B7YA 5CFCB 4CDUB 4W65A 1ZRFA 1EV13 1B35B 1AL21 4AGRA 1ZZ9A 1HXS2 2RMU3 3KT7A 5DG1A 1FYUA 1SBEA 3AB0A 1C8NA 1W6MA 4N7IA 3O0WA 2R16A 3CF6E 4LBLA 1MS0A 4JRAA 1Q8PA 4QGLA 2I2SA 4RSUA 1LGNA 4HPKA 3USUB 4XJZA 3M3EA 4XXPA 4WM7A 1OLRA 2ET1A 4BE3A 1J3PA 4E2GA 2AH2A 5F6KA 2HWF2 2VNRA 4Q4V2 4RD7A 3D0JA 4XBLA 3PNAA 4FPOB 4DFSA 2XHKA 1RINA 1AXZA 5JI7A 4D94A 5BNQA 3KT4A 2JDZA 3MPBA 4PIZA 3FJSA 5GZCA 1S0JA 3B69A 2VGDA 1OA4A 1HQLA 1C5IA 5KHHA 2ZGLA 1UZYA 4P14A 4XJAA 2JKBA 3I59A 3LA2A 3EXUA 1W6QB 2N7GA 3WNXA 2ZKNA 4BZ4A 1C8M1 4LA2A 2EF6A 2GC0A 5AVPA 2KA3A 3OJBA 3JD72 4NWVA 1C28A 1PHMA 1QJY3 2NP0A 1C1LA 2JJ6A 1TMF2 1UIJA 1HRI3 4QX5A 3ZFGC 4WV8A 1ND3A 2ZMKA 1CJPA 4D7TA 1XE7A 4LBOA 4DY3A 5J48A 5CFDA 1BCXA 1W6OA 1WLWA 1YNAA 3DKWA 3R0RA 1QY4A 5LK7B 4YW5A 3LB9A 1BJQA 2PHTA 2WNUB 2ARBA 5E1RA 4UW4A 3WP3A 2WLQA 4XFIA 4XMIA 2X5IA 1CAXA 4D7SA 2ZBJA 3ES4A 4C91A 4AHXA 4Q4W1 4XFHA 1F2NA 2YGMA 4N43A 1R083 2CGOA 3DL3A 4UW5A 4WM7C 1FATA 5F1RA 1WD3A 4FQ4A 1COV1 4IV3A 1C4RA 1CAVB 4NPRA 3WINE 4XILA 1QKQA 1HXS1 4BQ1A 4GQ7A 4YZ1A 1ALYA 3UV9A 1I1EA 2Q0AA 4COZA 4R9CA 1EPZA 4XTPA 1F5JA 4M00A 1COV3 1UCXA 4D69A 2DU0A 3VBRA 5BXXA 1RGSA 2VQAA 1YJKA 5LEKA 2HWF1 4Q4V1 4UBHA 2P3IA 5JCTA 2OPKA 3AMNA 2RS13 1IS3A 1LTEA 3RYKA 3PHMA 4QMAA 5A32B 2CWSA 1V6KA 4W6YA 1NE4A 2KXLA 4HN0A 4N9HA 5DZGA 3H1YA 4XFBA 3TB0A 5AFEA 2QZ3A 4HSLA 4N53B 4EN0A 1A8MA 2A6WA 5DG2A 1GICA 1IKPA 1RMU2 3VGIA 4IV1B 3ZPYA 2R30A 3ZXKA 5BNNB 3MLLA 3LOIA 4PIYA 4AK3A 1LU1A 3EBRA 2OYZA 5CFDC 5IT6A 2DWRA 1QDCA 3WDXA 4DNYA 1KJRA 4K3UA 5B2GB 4YZ3A 1VB2A 1BXHA 4AG4A 4IEPA 2XJUA 5DUWA 3RQ0A 2XVLA 2XBO2 1AYM2 1PO22 2X5IC 2BVBA 1G9AA 1TMF1 3ME2A 3PJYA 3KCYA 3VZNA 4EWDA 4XEZA 1XNKA 4N43C 2VVDA 3QLQA 1IPKA 4EN8B 3L9JT 1IZ3A 2D3PA 1V6IA 4IV3C 1GR3A 4Z2WA 3S7IA 1AR61 3WG1A 1V9U2 4P9IA 1FOD2 3AYEA 1I6XA 1SLLA 5CG8A 3KSCA 3WCSA 3WLUA 2XGXA 4ZU4A 5KHKA 2BVVA 2QZ2A 4L2NA 1V6OA 2IWGB 1RUF2 1V6JA 3KM5A 5H9PA 3FX3A 1O5LA 2UURA 5GZEA 1HIXA 2A3YA 2AZ5A 3OY8A 3VBSA 4BH9A 3VBRC 2R061 4HSJA 1CVNA 1AR63 3M2MA 2VW1A 4XBNA 4AEJA 3VZJA 1BEV3 2LTNA 1S0GA 3VZKA 3KGZA 4LE3A 3RS6A 1PGW1 4QGNA 3KGLA 4HVRA 2JE7A 3ZSEA 4YVSA 3O12A 5BPXA 4Q4X2 4QPIA 2DVBA 5FO8B 5FMOL 2ATFA 2XL9A 1ZBA1 4CDQB 1VIWB 2R063 4BLIA 2UWBA 1PVXA 5JWPA 2BFUS 4EJRA 3GBGA 4FBFA 3OYWA 1HQWA 4Q2FA 2IXHA 5GZGA 1XYPA 2AR6A 2ZOEB 1H8TB 1LHNA 5GJ6A 3WX5A 4I2OA 1OQDA 5EYXA 3WHTA 2XWJB 3NV4A 1QJX3 1ASJ3 1ZBA3 2V09A 1TNFA 4PCRA 1G8WA 2H0BA 5BNOC 4B4RA 1RMU1 2XH6A 1IS4A 1MZ5A 3HD8B 2Z5WA 1FI2A 1W39A 2RR12 2E6VA 3MLJA 2HWE2 4BMEA 2VW0A 4YZ5A 4WBBA 4K1ZA 5J96B 1NE6A 1ZBE3 2ARXA 1C3HA 2IFRA 1RTVA 4FXGB 5I91A 1EAH3 2ZGQA 1REDA 1PO21 3VHPA 1ZRCA 3ENRA 2HWC2 3B9IA 3CJIB 4KNCA 3DPRA 4P9JA 1Q56A 5BNPA 1G9CA 3VBHC 1OKQA 4OI2A 2VMHA 1D0HA 1FPN2 2K9ZA 1V9U1 1O4TA 1IHMA 4YFZA 1QNYA 3POSA 4TLFA 5ACA3 1ZVFA 3MIDA 4JGYA 2H0VA 4ZKTB 3LA7A 2PELA 2ZGRA 4YVSC 4QPIC 1XNCA 4DZGA 1X33A 4Q4Y2 3V0AB 3E6CC 3AJYA 3VZMA 2WLPA 4B8EA 2RS32 4WM8A 4HZFA 5E8AA 4HVOA 4XF0A 4M3CA 4FP2A 1H30A 2G9GA 4RHV2 2CGNA 1O3SA 1ND2A 1WBFA 1LHOA 1RUI1 4DOUA 2NQYA 4K1YA 1MS4A 3JBG3 4K21A 1W0OA 2YPJA 1C1FA 4IEVA 4AXOA 5JIUA 4PDWA 1APNA 2Z69A 4Y1XA 2B45X 4HFSA 2YZ4A 5JSOA 3HN1A 2VU9A 3WT3A 1G9BA 3H3UA 4XF9A 2ZGKA 4TWTA 1WCKA 2V73A 1QOSA 1GZCA 1H2MA 3AZZA 5L36A 2D6LX 1V6NA 5T5LA 2JE9A 1S0IA 1RUI3 1YFYA 2ZGTA 3GHMA 4COYA 4NHMA 3ZN5A 1QJU2 4HANA 2Y26A 5GLWA 3WUCA 4JAAA 4JGZA 4BM8A 2P3JA 3DPRC 3JB8A 4BMBA 2ZX3A 2B9UA 2WT0A 4LHKA 5BNPC 3AMHA 3VBUB 5C4WB 4CEWA 2RR11 2WWSA 2ZGNA 3IPVB 3MFAA 4YGDA 2CWMA 4AF9A 3ALQA 4DINB 2I45A 4B4QA 5FPXA 3VV1A 2BNNA 1G86A 4X6RB 2TBVA 3FLRA 2HWC1 1DF0A 4OLLA 1YFUA 5E89A 5I0UA 5DUXA 2VVEA 4RFT0 2ZABA 1OFSA 5D8AA 1CAUB 1DQ4A 2HEVF 3U0ZA 4AVTA 2DCJA 1N3PA 4ASMB 3H1MA 2XJPA 3U4XA 1MEC3 1R1A1 4IERA 4N7UA 4WM8C