3UJOA

Galactose-specific seed lectin from dolichos lablab in complex with adenine and galactose
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
253
structure length
253
Chain Sequence
ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKEDEENKLAIFNLEGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Legume lectin
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
total genus 43
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ujoA00
1C1LA 4DFSA 3UL2A 3H0OA 4AGVA 5HCAA 1VALA 2GNDA 3OJBA 4LBJA 3ZSMA 1MZ6A 4WZFA 1Q8PA 1G7YA 1SLLA 1Q8SA 2PHRA 2VU9A 2ZACA 4YZ2A 1F9KA 3NV2A 3WG3A 1AF9A 3WVJA 4TZDA 1ULEA 4LBQB 1S0GA 2DVAA 4XMIA 4DRVA 1OQ1A 1YIFA 3OPZA 5H9RA 2A3YA 2ZGNA 1LU2A 2ZHMA 4YZ3A 1FAYA 5GZCA 3VKOA 1V6LA 1SBFA 1MVQA 5JLVA 4XBQA 3AFKA 4GALA 1B09A 2R0HA 1W6NA 1G9FA 1ULDA 1Y7BA 4DPNA 4Y20A 2R0FA 2D6OX 2D3SA 2NM1A 1AX0A 1DQ5A 3KQRA 3WDYA 3WUDA 5IK4A 1SLTA 1MS9A 1HLCA 1UZZA 1LU1A 1QU0A 5E88A 2E7QA 4DRRA 2ES3A 4XTPA 4YZ1A 5FREA 1GSLA 4UW4A 3AZZA 2DYCA 1D2SA 2UU8A 1SBEA 3V64A 1AXKA 2JD4A 5JMCA 2DU1A 2EXKA 2DVBA 1WW7A 2EIGA 4M01A 4LBNA 4Y22A 3WDVA 4JCKA 5H9QA 4Q27A 3A0NA 4Z8BA 4M3CB 3WG4A 4P9YA 4AGRA 1SLAA 3B01A 5DUVA 4R9BA 3A0KA 4XDQA 3ZXFA 1YO8A 3AZVA 3IM0A 4XXPA 1MS8A 2PHUA 1WLCA 4Y1XA 1LGBA 2ZHKA 2A7AA 4L8QA 3W59A 3R4SA 3WZ1A 1LODA 1WUVA 2HYKA 4PF5A 5T54A 3CNAA 1LEMA 4ISRA 5F9TA 5E8AA 3TAYA 4FPYA 4YZ4A 4OZXA 1WW5A 4C1XA 1IS6A 4YZ5A 2B7YA 2D6LX 4FPFA 3N7MA 1GLHA 3D4KA 3V0BB 4CZSA 2AH2A 4P9WA 1AXYA 4FOVA 3ILRA 3TB0A 4FP2A 1N1VA 5GZDA 1FV3A 1YI7A 2UWAA 4U2AA 3B9CA 5DG1A 1D0HA 4FVVA 1W6OA 1H9PA 5IK7A 1YRZA 2SBAA 4UW5A 4Y1VA 4XXAA 1G9CA 1ENRA 2ZMNA 3N7KA 1CR7A 2JDZA 3RSJA 1DQ1A 1QOSA 1BKZA 2DVGA 3AYCA 2C5DA 1ULCA 4MYEA 2V5YA 5T5JA 3A4UA 2W08A 3FLPA 2LTNA 2ZGKA 2OW4A 1W0PA 2NMOA 4WV8A 4YFWA 1IKPA 2DVFA 1GNZA 1ONAA 1S1AA 1LOEA 1DHKB 1GZ9A 3LCPA 3O0VA 2A6ZA 4YFZA 2AYHA 3B3QE 4RL7A 1URXA 4YGCA 1LJ7A 1DQ6A 1QNWA 1W6NB 2ZGRA 3FBYA 4PBOA 3USUA 5CA6A 2P3KA 3ZYRA 2GNTA 4Y20B 2ENRA 2NYYA 1IOAA 1DIWA 4W65A 1G9BA 2VH9A 1UKGA 1SFYA 1YXWA 2DVDA 4LBMA 4M00A 3ILFA 4XJZA 4YM0A 2P2KA 5BYNA 1FV2A 1QF3A 1RIRA 2D44A 2WJSA 1LECA 2CTVA 2XB6C 2YXSA 2ZZJA 3AYAA 3N35A 3ZYPA 1KDMA 5SV8A 4PBPA 4BQ1A 3IMNA 4YM1A 1LOAA 1N1YA 2DUQA 1V6IA 4LBOA 2WLQA 4FPGA 3I8TA 4Y22B 3RMYA 1N1TA 5DZFA 1G9DA 1QDCA 1IS3A 1HDKA 3T1LA 4XTMA 3M3EA 5GM0A 3FLRA 3PJQA 5F5QA 2C9AA 3ATGA 2D6KA 4IQPA 4DQAA 1WCSA 3MEPA 2UWCA 5GLZA 1G86A 2E7TA 5DUWA 1QNYA 2ZKNA 5GZEA 4UW6A 4LBQD 2D6PA 5GALA 4ZKTB 3MW2A 2WQZC 4YG0A 1QKQA 2GMPA 4H55A 3PVEA 4FOQA 2A6WA 4YM3A 3GNEA 3WUCA 3WLUA 3APBA 2WT0A 4AYUA 2EALA 3O12A 1LGCA 3ZSLA 1DQ2A 1MZ5A 3WDXA 1LHWA 4BOWA 1O4YA 1S0JA 2ZGLA 3MW3A 1CIWA 3M3OA 2W68A 2WNEA 3FFZA 1FNYA 1YYNA 1LOFC 2NZ9A 4RA0A 3POSA 1UMZA 3U4XA 2LALA 4D69A 1JBCA 1KRIA 4FPJA 4GWMA 3NV4A 3QLQA 5DUUA 1W6OB 4GA9A 5EXOA 3RS6A 4XHXA 2ARXA 2EXIA 2VXRA 5LK5A 1OFSA 4FPCA 2E6VA 3M2MA 3VKLA 1C4RA 1Q8OA 3WDWA 4U36A 5T55A 2Q5TA 1BZWA 1V6MA 4M3CF 4YLZA 1LOFA 2PHWA 2R16A 4C1WA 2GNBA 4Y1ZA 4XMAA 2EXHA 2ZMLA 1Z78A 3AP6A 3JU9A 1X50A 2PHTA 2KM2A 3SNMA 1CJPA 5DXDA 1SLIA 1G8WA 2VW1A 4FQZA 3SISA 3USUB 3OBRA 4FOYA 3WCSA 2I2SA 2D3RA 1Q8QA 4JRAA 2R49A 3VUOA 2P37A 4PCRA 2E53A 4HL0A 2NMNA 2RHPA 3UJOA 1AJKA 2A71A 4YW1A 1WW4A 2VY0A 5JVVA 1U0AA 2A5ZA 2G4IA 5CAZA 3C2UA 1OKQA 2WKKA 4BLIA 1LOBA 3IKWA 3NWKA 4XJWA 5GZGA 1DYKA 2YZ4A 1C1FA 4ITCA 1SLCA 3INAA 5T5PA 1I3HA 2AUYA 3ZSKA 1V6JA 1XQNA 2D7FA 4XJUA 1GZCA 4SLIA 1W6PA 1SBDA 1LHVA 4BMBA 4FQ4A 4XBNA 1JW6A 3N3HA 4TYSA 4NOTA 3M3CA 2D43A 1LHUA 2W39A 1PZ7A 5IUQA 5HCFA 2JE9A 1AZDA 1ENQA 1DFQA 1RITA 1H30A 4F83A 3D5OA 1AXZA 2DV9A 3OBTA 1IKQA 5GJ6A 4AWDA 4ATFA 3M1HA 4FPOB 1GICA 1N3PA 1G9AA 3T1MA 3RQ0A 3RRDA 2DU0A 2VW0A 3ILNA 1GV9A 1R1ZA 1ULGA 2ZABA 3POWA 4P9XA 5DG2A 4ISQA 3VKNA 4CRQA 1SACA 5H9PA 4DS0A 2P3JA 1JYCA 5KXDA 4M3CE 2GNMA 1LHOA 1GANA 5GLTA 3RG0A 5CBLA 4XJ9A 1J1TA 1W6MA 5DZEA 1W0OA 3IN9A 1WBLA 1APNA 2ZGSA 4YW4A 4LBLA 1MS3A 1GKBA 2D6NA 4I30A 3AP7A 4AGGA 1CPNA 3SITA 2FMDA 4AVTA 2TEPA 4YW2A 2Z42A 3ZVXA 3SLIA 3VKFC 1QDOA 4K1YA 4Q8LA 4XIOA 4LBKA 4XILA 1WBFA 3AXEA 3LSDA 5GLUA 2DUPA 3NV3A 5EYYA 1F5FA 4YGDA 1Z0HA 2JECA 1V6OA 3OY8A 4R9CA 1KQRA 5KXEA 3HMYA 5JOXA 2ZBJA 3WNXA 2PHFA 2VW2A 1S0BA 3AXDA 1DZQA 1UX6A 1BXHA 4GKXA 2OUJA 2ZAAA 1LULA 1NLSA 2D3PA 1CQ9A 5CNAA 1V6NA 5AVAA 5JOZA 1KDKA 1JN2P 1DYPA 2ARBA 2WSVA 3R05A 4K21A 4ASMB 3FUOA 1GZWA 2GMMA 2JJ6A 1AX1A 1JHNA 2NN8A 4YG3A 5L73A 3UJQA 1A8DA 3AP5A 1QGLA 1VIWB 2CNAA 3UK9A 1A78A 4GWNA 4Q1RA 1A3KA 4XYXA 1HKDA 2YMZA 1V6KA 5EYXA 3PMEA 1FATA 1S0IA 2A70A 3O5SA 1MS4A 3VV1A 1AVBA 2XG3A 5KXBA 3WV6A 3IPVA 1S0DA 3SH5A 4Y24A 2DTWA 2A6VA 2WSUA 3BOPA 1CN1A 1RINA 1AX2A 4XIKA 1W6PB 4UW3A 3B00A 3I4IA 4JC1A 2P34A 3BIWE 4P14A 1MACA 1ULFA 2OVUA 4NO4A 3GALA 2NP0A 4XBLA 5KXCA 3V0AA 1MS0A 2CL2A 3QCWA 3T2TA 3ZXEA 4FP3A 5JOYA 1TEIA 2ZGQA 2A3WA 2PELA 3M3QA 4PQ9A 1W6QA 4Q2FA 3AYDA 2CWSA 3ASIA 1LTEA 3OGGA 2BQPA 5IK8A 1EPWA 3WDUA 1UPSA 2H0BA 3AJZA 1MVEA 3Q9OA 2GDFA 2GALA 3LSEA 1S0CA 5T5OA 1LOCA 5GLWA 4YGBA 2E51A 3POYA 3AJYA 1GBGA 5JOWA 4FPKA 1W6MB 3N7LA 1VAVA 2ZGOA 1VAMA 5JDBA 3V65A 4Y26A 1FYUA 3AZYA 4GKYA 5FRAA 4XZPA 3ZSJA 1JXNA 3OYWA 5IK5A 3AK0A 1WW6A 2ZA9A 1V00A 3FUQA 2ZGMA 1DBNA 3SH4A 4ATEA 2SLIA 3OY8B 2FHRA 1QOOA 2AGSA 4YGEA 1IS4A 5E89A 2P3IA 4XHBA 5T52A 4ZXKA 1GYKA 1UAIA 3PVNA 4YM2A 4FPLA 2W52A 1F31A 2CY6A 3DGTA 4R9DA 2EF6A 1S0EA 4HANA 3HN1A 5DUXA 1PZ9A 4R9AA 5GZFA 1N3QA 1N3OA 1N47A 1DQ4A 1GZWB 1PZ8A 4XOGA 2ZGTA 1BYHA 2GN3A 2ZMKA 1IS5A 1KJLA 2VUAA 2A6XA 4GXLA 2ZHLA 4BPZA 2CYFA 2DURA 3R4UA 3MPPG 1CESA 1UN1A 1CPMA 2JKBA 2V73A 4XJAA 5IT6A 4Q26A 3WG1A 1MR5A 4Y1YA 4LBQA 4CTEA 1MS5A 5H9SA 1S0FA 3SH3A 4KBBA 3JUUA 2PHXA 1UZYA 1LCLA 1O4ZA 1SLBA 4FPHA 3IPVB 3ZXJA 1GNHA 1CONA 1LESA 3WDTA 1ZM1A 2DWRA 1UL9A 1LGNA 2GMEA 1CVNA 1JOJA 1KITA 3O0XA 2DUOA 4YW3A 1FX5A 1ZA4A 4Q8KA 1WD3A 3WHUA 2UURA 3NV1A 5GLVA 3V0AB 1DQ0A 1WLWA 1LOGA 4AVSA 1C57A 4WVVA 4YG6A 5EWSA 3WCRA 2GN7A 1FNZA 2ZGUA 3FLTA 5DZGA 4BM8A 3HR9A 2A75A 3AYEA 2AENA 3AZXA 2WT2A 4YW5A 1W6QB 3ZPYA 4K20A 2ZGPA 2AR6A 5CB7A 3AZWA 2OUHA 1JUIA 1DGLA 3W58A 5T50A 4XJ8A 1BJQA 3AX4A 1MS1A 1AJOA 1N1SA 1Q8VA 2DTYA 3D6EA 3WOGA 1NXD1 3DUIA 1LENA 1QOTA 2UWBA 2EAKA 2ZHNA 5HCBA 3RMXA 4M3CA 3B69A 3N36A 1WD4A 2A6YA 2WT1A 4K1ZA 1VLNA 3WHTA 1BQPA 2R1BA 3BTAA 3ENRA 3KM5A 2R1DA 3BODA 2JE7A 5T5LA 4XE9A 3OYWB 3MW4A 4BLJA 4AVVA 2D6MA 2AREA 1WLDA 1H9WA 2A3XA 2EXJA 2YY1A 2ERFA 1JYIA 4FPEA 3O0WA 4WVWA 1SCSA 4BMEA 1I1EA 3N7JA 1SCRA 3AP9A 3WG2A 1QMJA 3ZXKA 4FOWA 1Q56A 1HQLA 3VKMA 1DLLA 4Y1UA 1ENSA 2YROA 3V0BA 1LHNA 3AP4A 3PVOA 3ZXLA 1KJRA 4Q1PA 2CWMA 1LEDA 2YV8A 1HQWA 3L2YA
chains in the Genus database with same CATH superfamily
1XSRA 4AVCA 5DDJ1 5A7NA 3C7FA 5FKBA 4N53B 3KD4A 2J1VA 5KR7A 3GCWA 3MF9A 1Q8SA 2ZEYA 3LEIA 3GJBA 2PLV3 1HB3A 4YZ2A 1F9KA 3GHNA 5KHKA 2Q1ZB 4UAPA 1W8HA 4MGTA 4OUSA 2VTFA 4AVAA 2Y33A 1ZNPA 1DYOA 1S0GA 2DVAA 4B29A 1OQ1A 3OBAA 5FYUA 3H8OA 2A3YA 3ZFEA 2ZHMA 4DUXA 3VKOA 1V6LA 1REEA 1V9U3 1CAXB 2WNUA 5C33A 4IL7A 4IV3B 5A33B 2VZUA 4LIUA 5FZEA 1OA2A 3LD8A 4GALA 4CCKA 2R0HA 3ZN5A 2WZR2 1E5RA 4X6QB 5C3OA 5FZFA 1CZTA 2D3SA 4S2GA 4W6XA 2F6BA 5IK4A 4GMP3 3MZHA 1AHSA 1C8M2 4CP2A 4MGKE 2ES3A 2W1WA 4YZ1A 4D6QA 5FUPA 1HV0A 1GP5A 1RJ7A 2DYCA 4ASKA 2D5FA 3ON7A 2JD4A 3LDKA 5JMCA 3HIFA 1OBNA 4AG4A 4AXOA 4QT6A 2WL1A 3K4ZA 3H1YA 3ORJA 4P9IA 1RMU3 3JD72 4CCEA 1QXPA 4B1LA 1VBD1 1AR73 3VD3A 4G9SB 4Z8BA 3VBFC 1GQPA 1DZRA 4A2UA 4R9BA 2VZRA 2OPWA 1JYTA 4MO3M 4XDQA 4W50A 3AZVA 4CU7A 5L19A 4GB31 4IGQA 5EJ1B 1H4GA 4UXAA 1W8TA 5K0UB 3NKGA 3H9AA 2W2IA 4L8QA 4DXTA 2JDPA 1R1A1 3B94A 4NROA 1KFUL 2A1XA 3DL3A 1LODA 2ZKLA 4QU1A 4QX8A 4N7IA 5BNNC 1ZBA1 3G7DA 1ODNA 3KT7A 2YBKA 1E5IA 5E8AA 4MUVA 4EROA 1IS6A 2B7YA 1REFA 2RS52 4MVTA 2BGOA 3WF3A 1OA3A 1ZREA 2FDFA 2RR13 2YC2A 1AL21 1TMF1 3QD6A 5GZDA 5IYYA 2VOVA 1QEXA 1X9TA 4CSWA 2CHHA 2RDNA 3WQ1A 2BFUL 4FVVA 4RGAA 2K0GA 3KZ4C 3QBQA 3VHOA 4WM8B 5IK7A 4UW5A 4Y1VA 3WW3A 4LORA 4AI1A 4OHVA 2KR2A 1XBFA 2BUKA 5A3TA 2JDZA 5BNNA 1K5MC 1QOSA 3FX3A 4MYEA 2V5YA 3AC0A 5T5JA 3A4UA 3KT4A 5JPNB 1RL3A 3HNBM 1VE0A 2NMOA 4XFIA 3VBSC 4WV8A 1IKPA 1HRI3 3ELNA 4NPLA 1F4HA 3IT8A 1ONAA 3MUZ1 5A6QA 1V70A 2R041 3LCPA 1AR63 2X5IC 3MV01 4RL7A 4DEQA 4YGCA 1LJ7A 2ZGRA 3HQXA 2WAAA 4PBOA 4KU8A 1ALYA 1K5MA 2WAOA 5A7WA 1G9BA 1EAH2 2VH9A 1NAEA 1SFYA 1YXWA 3GZTB 4M00A 4NRPA 1CIYA 3VBOC 2XUMA 1XU1A 2P2KA 1RIRA 2WJSA 2EA7A 2C1FA 2ZZJA 1LECA 3LSEA 1T2XA 5D8AB 3ST7A 2BPA2 1RUH3 3CDZB 4PBPA 3VBSA 4YM1A 1EV13 2DUQA 3HBZA 2G9FA 3TN93 1ZA7A 2YYOA 4QX2A 3RMYA 4OQ9A 1UOBA 2X5IA 1N1TA 2ZZQA 5EP9A 5J36A 5DZFA 3W9AA 4AW7A 1RHI3 4NRMA 1HDKA 3T1LA 4B3NA 5A70A 5GM0A 4Q5OA 1GWKA 2Y60A 3NAPA 3ATGA 2D6KA 1HJGA 3KSCA 4IQPA 1PGL2 4Q4X2 1WCSA 4JDNA 4CCCA 4YVWB 2GH2A 1UMHA 4XAEA 3UGHA 4Y33A 2FZ2A 1H6YA 1UY2A 4IEPA 4HVOA 4LE3A 2RMU1 3WW4A 1UIKA 2ZKNA 2WO3A 4UW6A 1R092 5GALA 1I5ZA 3MLLA 3MW2A 5DN2A 1QKQA 4YM3A 4FOQA 3RYRA 3GNEA 3WR0A 3WLUA 2R7EB 4Q0VA 1VP6A 4HSLA 4QX5A 1IZ3A 4NRQA 3SKJE 3WDXA 1O4YA 1S0JA 3MPBA 4JGYC 4BOWA 1PK6B 1YUDA 3U4SA 4OZOA 1J1LA 5FPUA 1OH4A 4Z92B 5FPVA 3ZIWA 4B7EA 1OOPC 1CX1A 3THDA 1JBCA 1OC1A 1KRIA 4GWMA 3QLQA 3RS6A 1W6OB 2P4EA 3D8CA 4XHXA 2EXIA 4LLFA 5LK5A 5FZ4A 3WNOA 2DCYA 4CP9B 2RS31 2ZX3A 5FYVA 2Y0OA 1MQTC 3BTXA 3VKLA 4IGPA 1Q8OA 5FZOA 3O1TA 1YHFA 2QZ3A 3H7YA 3GZAA 1WCDJ 2WWUA 4OHXA 3VBHC 3VL9A 4U36A 4M3CF 2CSGA 4JGYA 4YLZA 5IAXA 1RUF3 2R16A 1OOPA 4C1WA 1VBE1 4BQ2A 3RGBA 3A23A 2WR9A 1OURA 1EUUA 1VRH2 3GF6A 1ACCA 1OQEA 1W3XA 1Z78A 4XFAA 3O1VA 2PHTA 4IESA 1QQP2 4RR3A 3SNMA 5CVRA 2OKXA 4OFGA 4E2QA 1G8WA 2VW1A 3IIIA 3USUB 2FDIA 4UOJA 3O1UA 5A7QA 1O91A 1VBB2 3I59A 4NAOA 5IW0A 3MYXA 2P37A 1LNSA 1RC6A 2E53A 2L9LA 2QQOA 2RHPA 5FK7A 4F3JA 2VVDA 3HEIA 3UJOA 2A71A 1MEC3 3KGZA 3VZOA 5JVVA 4ARYA 1W9SA 3N9LA 4CU9A 3IAQA 4QQHA 4J6GA 2GSYA 2PLV2 2WKKA 4WBBA 4Q4Y3 1LOBA 4BLIA 4YWAA 1PVC3 1POV0 2DFBA 2Y8KA 1SLCA 2IC1A 2I45A 2IXKA 3NJXA 5T5PA 3DV8A 1V6JA 4GWJA 4LXLA 4QDRA 5FTTC 1GZCA 3MIDA 4SLIA 1W6PA 4QGLA 3X29B 4DOUA 1V9U2 4UF0A 2W46A 4XBNA 1YLLA 3BYWA 1DF0A 4BQYA 3M3CA 2D43A 3PL0A 4S2FA 2JE9A 2XJTA 5F2SA 2H6CA 5FY7A 3AKPA 1Q43A 3OBTA 3NNGA 3LDRA 5A7PA 5FYSA 3DCQA 1NCQC 4AWDA 5JXIA 1GICA 1N3PA 3FMGA 1GOFA 1PVXA 4AQSA 3RQ0A 4A3ZA 1H1MA 1NY71 1ULGA 2GP3A 4P9XA 2VZTA 4N7UA 4CRQA 2VCMA 4J1XA 3VZLA 1LHOA 3LEGA 2VMFA 1PMIA 1RMU2 2CV6A 2FCUA 3RG0A 4LA2A 1W0OA 2ZX4A 2ET7A 4X8PA 3ZYHA 4LBLA 1GKBA 2I74A 3HN3A 4K9SA 2WQ4A 3AP7A 5FAXA 3CZJA 2QBXA 4H3WA 2IFRA 4MGIE 4YW2A 2DCZA 3SLIA 3TEXA 4K1YA 3VKFC 5FYBA 4XIOA 1WBFA 3BB6A 3UKTA 5BUVA 4PLNA 4QB1A 4Y5TA 2XKOA 1F5FA 4YGDA 2YGMA 3VDCA 3LAGA 4LKSA 5CU1A 2VW2A 4RGGA 5FYHA 3LGRA 3ZXGA 1DZQA 2WBKA 2X29A 1PO11 1W0NA 1ZBE3 5IVYA 3VBRC 4DO0A 1PIV1 2ZAAA 4LK6A 4P08A 4IXLA 1V6NA 1SEFA 4ZY9A 2RR12 5JOZA 4CCMA 1HXS1 4C91A 3R05A 1AX1A 1GR3A 1JHNA 2HWB3 2VMEA 1S4CA 1S2KA 1ZRFA 1A8DA 5I91A 4QPWA 1RUG1 1QGLA 4FCAA 4AI0A 2VMHA 3UK9A 4GWNA 2F4PA 5ANQA 2Y6FA 4W6WA 2XONA 5CFCC 2JDUA 1K42A 3VBRA 5B4NA 2YFUA 4UFHA 2VVFA 1S0IA 2A70A 2WNOA 3ME2A 3ZFGB 3WV6A 3WNMA 4A7YA 3T4HB 4BZ4A 2R061 2A6VA 2VG9A 2AC1A 3F2ZA 3K3NA 3D82A 4FFHA 4CDQB 5JR7B 1W9FA 1HRI2 1K3IA 3DPRC 2Q8OA 4WVZA 2Y6KA 5APAA 1MACA 2OVUA 3U75A 3GALA 5F5CA 3U11A 2MEV1 1AR62 3V0AA 2ZJCA 4P5YA 2BZDA 5J37A 1RVF2 1R082 3CKHA 3RWKX 1UY4A 3T0AA 5C9AC 1CGPA 2IFWA 1NA1C 2VO5A 5FZ9A 5BY5A 5CFCA 1OVPA 2KD7A 2A3WA 4GULA 1OT5A 4Q2FA 2CWSA 3PUIA 1A8MA 4KWJA 3OGSA 4NWWA 1EPWA 1QXJA 3WDUA 1BHGA 2H0BA 1EV12 2VPVA 2UYAA 3DPRA 4YSFA 5T5OA 1S0CA 5EFUA 1WCUA 3TN92 4BISA 2E51A 1FOD1 2UY9A 4FPKA 3TYJA 3K48A 4AEKA 1COV2 3NSTA 3FBMA 4IV1C 4FI9A 1RHI2 5C9AA 2XUEA 1ASJ1 2ARAA 1FMD1 1VAMA 3V65A 2JE8A 3TEWA 4XAAA 2IUWA 1JZ4A 5F2WA 1JXNA 3PURA 3ZSJA 1VMHA 1TME1 5A6XA 3ZN6B 2PN5A 2ZA9A 3FUQA 5FY1A 5CKQA 4HXCA 1DBNA 3SH4A 3ZFFB 4UFIA 1YQ2A 1JOBA 1OI6A 5FUIA 4FBFA 3RZGA 2AGSA 3N9QA 3I2GA 2R6QA 4AOCA 4IV1A 5IATA 4X8NA 5FMOL 1H8TC 5ISLA 1SPPB 2VQAA 5GZFA 5LK7B 1N3OA 1DG6A 1N47A 1GZWB 3VDDA 1BYHA 1OUSA 1IS5A 1PNFA 4I02A 1OQDA 2ZHLA 1TZOA 3H3UA 3MPPG 1RTVA 2Y0IA 5LBBA 5A3OA 4QXHA 4XJAA 5I0TA 5FYYA 1YEWA 3KV6A 5C8WA 4O7XA 5CADA 5H9SA 3FHAA 2B45X 3JUUA 5IFTA 2JB4A 4COWA 1L7LA 1RUF2 3LF7A 1F4AA 5DAXA 2DWRA 3R6SA 2JG9B 2DUOA 2QE3A 1ND3B 3POEA 4XF0A 1RUI1 2O8QA 2YGLA 3ZR5A 3NV1A 1UCXA 2VCCA 3GZEA 1WLWA 4YVSC 4YW7A 3WEZA 4YG6A 2Z69A 2ZGUA 4IEZA 4BM8A 4HFSA 4EN8B 3POIA 2WT2A 3A21A 4OVEA 2O1QA 1W6QB 4QXKA 3ZPYA 2VMDA 4CDXB 3AZWA 2OUHA 5IAVA 2QUOA 2Y6LA 1BJQA 1MEC2 2D93A 3IBMA 3FHIB 1QJX2 3UESA 2VNVA 3WOGA 1O7FA 1PX4A 2G1MA 3I3EA 2W95A 2E26A 3ZO0B 1XXNA 3GCXA 2J22A 5HCBA 4Q4Y2 1IGOA 4M3CA 3B69A 3N36A 4YVSA 4QKNA 1PVC2 1VMJA 2BYVE 4BWOA 1VBC3 1BQPA 5LY2A 1W2TA 3P5BA 4HVQA 3BTAA 3P3PA 2R32A 5JXHA 3N9OA 2Q4SA 5JXJA 4XE9A 3K77A 2WN2A 3MW4A 1F5JA 4BLJA 1JU4A 5FP3A 5AFEA 2D6MA 2VQ0A 4I0BA 4IE4A 5E6HA 4ZHNA 2A3XA 3LWCA 2YY1A 2XBO1 4WM7C 3VHNA 4FPEA 4BMEA 4WVWA 1SCSA 1RUE3 4G3YC 3JD73 1CAWA 2WIIB 1HJFA 4JX0A 4QHOA 2G9ZA 1ENSA 3GBGA 2VC9A 4M0NA 1S2BA 2IVIB 4MSVA 4PQQA 4EN7B 5BNPC 3AP4A 5C8CC 4Q1PA 3JBG1 1OXCA 3H3LA 1PNGA 2VBDA 4XFCA 4CXXA 3H0OA 1XNCA 2HBTA 1VALA 3OJBA 1ULOA 3J8F2 1DDLA 2OYZA 4IERA 3ZSMA 1Q8PA 1HN1A 2QQKA 1G7YA 4WM7A 2QQPA 3I2DA 4O65A 3IDAA 3UKVA 2HBUA 2VU9A 2YC4A 2JENA 2ZAHA 1AF9A 2B46X 2WDBA 1DP0A 1ULEA 1C5HA 4CUAA 2DF7A 3Q8CA 4OCTA 4LBQB 3J9SA 5C8CA 4XMIA 4DRVA 1JYVA 1YIFA 4O61A 3N9MA 3OPZA 3SEEA 3EMRA 2BV4A 3HNMA 1DGRA 2ZGNA 5H9RA 1SMVA 4YZ3A 2DBIA 5GZCA 3DECA 4MGSA 2NPIA 5JLVA 4IE0A 4L9BA 2Q8EA 3AFKA 4A7ZA 2AEYA 3HOBA 2XJPA 1O3SA 3MFAA 1WMDA 1W6NA 3H1MA 5AFBA 1ZBE2 4MXVA 1UYXA 1YNAA 1W9YA 4A42A 4DPNA 1XNBA 2R0FA 2BGCA 3KV5A 4HG6B 2NM1A 1AX0A 1DQ5A 1Y4WA 2JG8C 3I2JA 3WDYA 5HV0A 1SLTA 1HLCA 1ZYBA 4OI2A 1LU1A 3SKVA 3S5AA 1SFPA 2E7QA 4FTEA 1W2NA 4DRRA 4XTPA 3THTA 3IB3A 4RYDA 2PYTA 4AHXA 1C28A 2OZJA 1D2SA 2HWB2 3U10A 2QQNA 3V64A 4XF4A 1UO9A 2HH9A 1WW7A 4QQOA 1VAKA 2WZR1 2EIGA 2V4AA 1SDDB 2WLPA 4N9IA 4QX0A 4WVMB 3K51A 4SBVA 4Y22A 3WDVA 3ES4A 4JCKA 5H9QA 1H2NA 4PDWB 5F37A 1C8M1 3NJYA 4H2AA 2E32A 3WG4A 4CE8A 5DMYA 5L7OB 4AGRA 4H14A 5FP4A 1QH7A 3A0KA 2JG8A 1EAH3 4TLFA 3ZYGA 2B5HA 4AFBA 1O8PA 1BK1A 4XXPA 1W8WA 4PHZA 3MHZA 5EQUA 1VB4A 1B35B 3JCIA 1WLCA 4Y1XA 2CU5A 2ZHKA 3IIAA 3WZ1A 1WUVA 5LEKA 1AR93 1OPMA 4GD4A 1LEMA 3ACHA 3I3QA 5F9TA 1O4TA 3CHXA 4C1XA 4BH9A 4KG8A 1SQ4A 3PU3A 4UBGA 3S6PA 1FPN1 3V0BB 4P9WA 4D0QA 1AXYA 2OS2A 3ILRA 1BEV2 4CDQA 1YFUA 4K7JA 4U2AA 4Q4X3 4XFFA 2QNKA 5JZGC 5DG1A 3RI8A 5FZ7A 1XU2A 5FPBA 1UZVA 4LHKA 5FY8A 4XXAA 4E27A 1ZVFA 1PM7A 5LB6A 2J42A 2RS51 1UX7A 3T08A 3JQWA 1CR7A 2PA7A 3AL5A 4ZXEA 3SCHA 3AYCA 3E5XA 1ULCA 1XE8A 3NNMA 5FQ0A 5FLIA 4OULA 5L36A 2BWCA 3FC0A 2E33A 4N43B 5FV3A 4BXSV 2OW4A 1XJAA 4BU2A 4NHXA 1W0PA 5JCTA 1AYM3 2AACA 5JZGA 1ND2C 2DVFA 4XPVA 5J3UA 1LOEA 1DHKB 1GZ9A 4TWTA 4YFZA 1QJEA 2AYHA 2WABA 3B3QE 2HWE2 4OHWA 3GHMA 1QNWA 1DQ6A 4CUGA 4DXSA 5LRRA 2XXZA 4XQ4A 4Y20B 4FTSA 1IOAA 2QQVA 1DIWA 2X8KA 4W65A 5FZ0A 3WQBA 5A7OA 2HWF1 1T6GC 1UKGA 4L99A 1K5JA 3BPSA 1QF3A 2RG4A 2CTVA 3N35A 3S30A 5C71A 4UT5A 1D4M3 1EY2A 2VZOA 4KH9A 4LJHA 4QGNA 3I49A 1ND2A 3L9JT 1SZBA 3OGVA 5KBFA 2BDRA 1ZZ9A 1VRH3 4P00B 2WLQA 3I97A 4QPIA 1E5HA 2J1TA 3ACIA 3ZMNA 1X7NA 2TBVA 4GJYA 1CJDA 4QPGC 1OVSA 3ETQA 2C9AA 1VBB3 2YG0A 4D7SA 2DDUA 2WNUC 4DQAA 1JUHA 5G05L 3VBHB 3MEPA 1QJU2 5GLZA 2E7TA 5DUWA 5ACA2 1QNYA 3KF5A 4CP1A 5J48A 3UNPA 2D6PA 1IQAA 4QQPA 1AYN3 2P1BA 2TNFA 4ZKTB 2WA3A 4CU8A 4RS5C 4XUPA 3WUCA 4KWKA 2X09A 3KWVA 2XWJB 1YI9A 2WFF3 3WW2A 4QPGA 1CAUB 1LHWA 1J83A 3Q8AA 4H7MA 3ZYFA 3MW3A 1CIWA 5C3RA 3M3OA 1FNYA 2HWC1 3PNAA 4RA0A 4C0BA 4O9GA 5FZ8A 1UMZA 4GZ9A 1R091 4D69A 4EE2A 1ND3A 3NJVA 4FPJA 1VBA1 2GP5A 3NV4A 4XEZA 5DUUA 5B4XA 4FSJA 2ARXA 1UYYA 1OFSA 3M8LA 1CAVB 3CJIC 4FPCA 3OBZA 3VDAA 5FPAA 1IPJA 1Y3TA 2QQMA 1VBC2 4JKMA 4RS5A 4NE9A 1C4RA 1QJY3 2XOMA 4Z2AA 1K45A 4IEOA 4ES9A 4CDXA 2Q5TA 1BZWA 4JGZB 4CCLA 2XVLA 3IDEA 3KV4A 4BIOA 3HNYM 3POFA 4LKFA 1RUOA 4MGYE 4NJ4A 3I2FA 5K7PA 1POV1 1RUE2 2LW8A 2RS12 2W9XA 1FT9A 2ZMLA 4MXWB 4E8DA 4UFKA 3CJIA 5DXDA 2XGXA 3LEKA 2ZS6B 3SISA 4AAPA 2BEOA 3WCSA 4CUCA 3AVRA 5HPOA 2V09A 3EO6A 4JRAA 3WNPA 4PCRA 4BQ3A 2JX9A 5FMBA 2IXLA 4CDUB 2EIBA 1RUD2 1W3VA 1AJKA 1W99A 1NUKA 4FFFA 4Q4V1 5JMOA 5GKAC 1QQP1 5CG9A 2A5ZA 5CAZA 2OA2A 4XQWA 2HWD3 1OKQA 4A6SA 2OT7A 3IKWA 1NKGA 3NWKA 5GZGA 1CZSA 3P3NA 4AK3A 1DYKA 4R52A 1SG3A 1BVVA 1C1FA 2QTWB 2LM3A 2BBVA 4UWDA 1I3HA 4V1PA 3WP5A 4NHLA 3ZSKA 4HONA 4XJUA 2W91A 1WA6X 4OI1A 4BMBA 4PI2A 2C4XA 2PHLA 3MIBA 4QKDA 2BJSA 2PLV1 4UI9L 2OIIA 2W39A 5IUQA 3T30A 1O3QA 1AZDA 1DFQA 3PUQA 4BJ0A 1RITA 2VGDA 2YC0A 4LQRA 1PGSA 2VZPA 4IEYA 5GJ6A 4HN0A 3KCYA 1V9U1 4PT6A 5FOJB 2IXCA 1UOGA 3CMGA 3O1PA 4KNCA 3RYPA 4OMCA 4B4RA 3ILNA 1GV9A 1R1ZA 2NLRA 3POWA 2A73B 2R072 5DG2A 5A3NA 4DS0A 2P3JA 5KXDA 2E63A 4LMFA 2GNMA 2IWGB 1GANA 5I0DA 3ECQA 3UKNA 3WF0A 4XJ9A 3MF6A 5ANNA 1RVF3 1R083 3IN9A 1WBLA 1DGWA 4GMP1 4KGQA 2RVAA 3BKZA 1MS3A 2D6NA 4LEJA 2XMLA 3MLKA 1PM4A 4QU2A 3E5UA 2FMDA 3MI8A 2TEPA 1X9PA 1NQDA 3NAPC 3SITA 3IDBB 4CDWB 1UQXA 1VR3A 2GAUA 4XILA 3CU7A 3LA7A 2HLEA 2Z79A 3LSDA 5GLUA 3SMHA 3RJ2X 5A32A 4QM8A 1L7QA 1RMU1 2JECA 3OY8A 5FZ1A 1D0GA 1RUJ2 2XLGA 2RDSA 5E1RA 2ADDA 1AR71 1UY1A 1RGSA 1AR92 4R4XA 3WNXA 1H1IA 1AR83 5FJHA 1S0BA 5K9YA 1S2EA 1UX6A 1COV3 3QOPA 4QDSA 4RQPB 2Y6JA 3S57A 2PTMA 1UYPA 1BBT3 2D3PA 2WWJA 3OD0A 1D4VB 1NA1B 4ZZ8A 5FDBA 4I01A 4TXWA 1DYPA 1NCRC 4R8HA 4YYOA 3EYPA 2K2SA 4A6OA 4BE3A 3CEWA 1W28A 1IHMA 4JRLA 2NN8A 5L73A 5FLHA 5FO8B 3LDBA 3AP5A 3MDPA 4CCNA 4COYA 4EV0A 3AMHA 5G04L 4Q1RA 2B9UA 2V4VA 4HK8A 4XYXA 1HKDA 2YMZA 4D94A 5EYXA 2RR11 4D6SA 3PMEA 3MFCA 1FATA 2CDOA 2Y64A 1HQNA 5E16A 3J26N 3SQOA 3VV1A 2XG3A 1XYPA 5KXBA 3IPVA 3PHMA 3MIEA 1S0DA 2JDHA 3CIHA 2DTWA 2O8OA 2CGNA 1RINA 3BOPA 4QQLA 1AX2A 4GH4C 1NCRA 1AYM2 3B00A 5EJ3A 4JC1A 5JAXA 5CKMA 1ULFA 3GBFA 4I0WB 3H50A 5IFPA 5KXCA 1HN0A 5J7MA 5FYZA 4RR3C 4D3WA 5FP7A 2EIEA 3J7NA 2P5BA 2CL2A 2XVKA 3M4FA 2VOXA 3ZXEA 5IVJA 2ZOEB 3WF1A 3RJRA 2XPJA 1JZ2A 3ALQA 4HETA 4NIDA 3O1SA 4PQ9A 5HXMA 5I0SA 2FQPA 1HRI1 3C7HA 4N43A 3WQ7A 1PHMA 3VZKA 1XB9A 2CGOA 1D4M2 1GUIA 4GH4A 3AJZA 1AR61 4ZU5A 4C8DA 4DNYA 4Q4W3 2GDFA 2J1SA 3T2OA 4I0AA 1LOCA 2FMYA 3U1XA 4YGBA 3POYA 2B9VA 3LE0A 4YW6A 5JOWA 4Q0QA 5LBFA 1W6MB 2XJSA 3VBUC 2C6SA 2PQSA 4MADA 4COVA 5A3LA 5BNOC 4K40A 5FBZA 2F17A 5C4WA 4KL1A 1UU5A 1VBD2 1RUH1 2ZEZA 4DIQA 3ITQA 3AZYA 4MX3A 1EV11 4XCAA 2GC1A 4S2DA 3EXUA 5ABJB 5L9VA 3OYWA 3AK0A 1WW6A 4N53C 3TN91 5C3QA 1V00A 2ZGMA 4GB32 3ZN4A 4ATEA 1QJX3 2SLIA 3KF3A 1NYWA 2YU1A 1UY3A 1RHI1 1QOOA 4EYUA 1AYN2 3HT2A 1IS4A 4AFAA 5F3GA 1OF3A 2JDKA 4JQTA 3VBUA 5KC5A 5BNOA 3KQ4B 1UAIA 4YM2A 4FPLA 2VAUA 2WFF2 1ZBA2 3Q8EA 3DYMA 1F31A 4NIAA 4HANA 5FCCA 1PZ9A 4CEWB 4KWUA 1OKOA 1W06A 4IV3C 2LROA 4NHMA 2YFZA 4DINB 1DQ4A 1PZ8A 1UYZA 2BGPA 3L2HA 4N53A 2ZGTA 1NZCA 1R64A 2ZMKA 1AL22 1NE6A 1J3RA 2YDEA 5KHJA 1SDWA 2DURA 3R4UA 3RZLA 3T0BA 4H7LA 4Q29A 2JKBA 1CPMA 2V73A 1UXXX 3E6DA 3K46A 4YARA 4Y1YA 1QJY2 1O5UA 2VBPA 4AEDB 4RHV3 1S0FA 1HB1A 3VZNA 1UZYA 2QDRA 4CU6A 3LIHA 4E4DX 3HBKA 2B39A 4XUOA 1BLZA 5JXGA 3OEBA 1CAXA 1UL9A 4IV3A 5A33A 3IAPA 1JOJA 4Q8KA 3J8F3 1FX5A 1ZA4A 5CFDB 3VZMA 3WHUA 2UURA 2VZQA 4URAA 2CDPA 4QDQA 4EN0A 5FYCA 5FY0A 3WF4A 5GLVA 3GYDA 4AVSA 1YWKA 3FZ3A 5EWSA 3POBA 3WCRA 4AFCA 3RYKA 1FNZA 2R042 2WA4A 4RFRB 5DZGA 3DF0A 2AENA 3AZXA 5DAQA 1RUF1 4BK5A 2JWPA 3USSA 4COZA 5K0UC 5JUVA 3ZIXA 5BNPB 4MGQA 5FXXA 5CB7A 1DGLA 3W58A 3WW1A 3KGLA 1XNKA 3WNKA 3TOJA 3E6CC 2DCJA 1GP6A 1N1SA 1Q8VA 2YPJA 5A7SA 1H2KA 1YIPA 1DZTA 3PLQA 2HWD2 1JU3A 1XSQA 3RMXA 1BVP1 1UF2C 3JB8A 2WS93 4AFMA 4HN1A 3T4VA 2A6YA 4K1ZA 1VLNA 4JQRA 3ENRA 1GOHA 4GMP0 3I2OA 4CEYB 1MEC1 5K0UA 3B5LB 4QM9A 4WM8C 2AREA 2QCSB 3R4DB 4Q4Y1 5C5TA 1I1EA 4E4ZA 1RXFA 1PVC1 3N7JA 1JZ3A 1WCKA 1DCSA 1QMJA 4UFLA 3S5QA 1W8ZA 1WZXA 3WG2A 3ZXKA 3W5MA 3MUY1 3WP6A 2ET1A 5FPLA 1UU6A 5IVFA 2WO1A 3PVOA 4KG0A 3HQUA 1KJRA 1NQJA 4LKEA 1AUYA 3NQHA 1TQ5A 3L2YA 1C5IA 3UL2A 1ZZ7A 4AGVA 4GIQA 2GNDA 4AEJA 4FXKB 4WM8A 5J96B 4WZFA 1YCIA 3LEMA 5BXXA 3LKJA 2PHRA 4K3UA 1RB8G 4OUEA 3WVJA 2FD8A 2QFEA 2ORZA 4DXZA 1UKRA 2GC2A 2XQXA 2RS32 5D8AC 4AAXA 3BI3A 1QWRA 2WUHA 3T09A 1BEV3 1RYYA 4FFIA 3POGA 2OQ6A 4PIXA 2ZX1A 4LITA 2VJXA 2VBBA 4I2OA 3ETPA 4XBQA 2YUEA 1AR82 2D5HA 1B09A 4S2HA 3ZMOA 2HKXA 2BNNA 4E4HA 3BTZA 4GWIA 1G9FA 1ULDA 1Y7BA 2HEYF 3IDCB 3LB9A 1VBE2 1BBT2 1ST8A 4IW3A 3WUDA 3DYOA 3EB7A 1PGW1 4HPKB 1JI6A 1UZZA 2YBPA 1A6CA 4MV2A 2FCTA 5D8AA 5E88A 1JYWA 3VDDC 2W5FA 1GSLA 3PUHA 4DB5A 3AZZA 3PMSA 3RZZA 4CP0A 2DVBA 3CBNA 1WCQA 4CCJA 1ZBE1 5F6LB 4ARXA 1PO23 3MO4A 4LBNA 2XR4A 1W2AX 1G6NA 3SXWA 3C3VA 2HWE3 2VR4A 2N7GA 3C7GA 1BCXA 3FFQA 2KA3A 1E57A 1KFXL 2LRPA 1SLAA 5DUVA 4COUA 3RZMA 3CLPA 1PK6C 2BP6A 3WY6A 4BDVB 2HWB1 5BPXA 3FJSA 2WZ8A 4YVWA 4LOTA 4Y4YA 4XDOA 2PHUA 4AF9A 5I93A 5F39A 1HX6A 2XDVA 1KXGA 2HYKA 2BWAA 2WNVB 2X05A 5T54A 1HRV3 2WFPA 4A44A 1NLQA 2J7MA 4FPYA 4YZ4A 5AC93 4OZXA 1WW5A 3BN6A 1QY4A 2RM23 4FPFA 3URFA 3N7MA 1W90A 1GLHA 2VUDA 1KEXA 3D4KA 4AE2A 2AH2A 1JMUB 4ONUA 4KI5M 5EZWA 1PK6A 5FZHA 1N1VA 1FV3A 2UWAA 3K75B 3B9CA 2HEVF 4Q4W2 5BV6A 1QJU3 3KVAA 1W39A 2ETEA 4XFHA 1NY72 1TE1B 1W6OA 1TNRA 5ACA3 2SBAA 4CP9A 3DKQA 3B02A 1VPHA 1OHFA 2PAKA 1BKZA 2DVGA 2C5DA 3GDBA 4KQ7A 3VD9A 4Z07A 2WN3A 1D2QA 3NVCA 2W08A 4ZS2A 5LASA 2LTNA 2FBEA 2ZGKA 1XNDA 4QHZA 5LA9A 3VHRA 3ZFEB 5FZIA 5FK8A 4BQ4A 2ZEXA 4JHTA 1S1AA 2Q1FA 2JIJA 2BU9A 4PLMA 1JS9A 4XF3A 5FUNA 2A6ZA 2JDNA 3WSOA 4LULA 3FBYA 3USUA 3VD7A 5L9RA 3ZYRA 2GNTA 5F3EA 2NYYA 3I3MA 1PMHX 4L11A 4QX1A 2W92A 2DVDA 1PIV2 3LOIA 5FY9A 5ABJA 5BYNA 2XB6C 2D44A 3MIHA 1FXZA 4P9LA 3ZYPA 1KDMA 3IMNA 4XETA 3H8RA 1HXS2 3RWNA 3B93A 4IGOA 4LNVA 4A3XA 3DN7A 2RS13 4LBOA 4FPGA 5CKNA 4DUWA 2C24A 5JSRA 1JH5A 1X8MA 1QDCA 1IS3A 4RHV2 4XF9A 1GP4A 2VOWA 3A22A 3PDQA 3IMMA 3PJQA 5F5QA 3O7OA 4MHUA 4CXWA 1YFYA 2EVXA 2VZSA 3FHQA 4CEWA 2BTVC 2VMGA 4OUMA 5LCWL 4KU7A 2UWCA 5DQ0A 1RUD3 2MNGA 5FZBA 1G86A 1OLRA 5CG8A 2AZ5A 3GXUA 1V0AA 5GZEA 5A1LA 3KLSA 4UFJA 3B7MA 1F2NA 1I5PA 3RZJA 2WQZC 4YG0A 1GWLA 2GMPA 1DGRN 4HZFA 3PVEA 3BIEA 2A6WA 3APBA 2D40A 1XRUA 2EALA 3W20A 3VBFB 1MZ5A 3OTFA 2XLFA 3PTRB 3SC7X 3BUCA 4AFDA 2W68A 2WNEA 2G19A 4QXBA 1NOVA 3POSA 4MGZE 1UWWA 4BHPA 2LALA 5EPAA 1NLRA 5IWFA 3BOWA 2VQTA 2IXIA 2VXRA 3PU8A 2WS92 3PUSA 3M2MA 3OSDA 4HKWA 4JVAA 5BNNB 1FOD2 1S55A 5T3NA 1M06G 4N90A 4NMIA 4EWDA 1IQDC 4RD7A 4ZS3A 3RVHA 1V6MA 4I09A 1W8NA 2R073 1O5LA 3W5NA 4PIYA 1ENXA 2GNBA 4P5HA 4XMAA 1VBC1 2DCTA 3E6BA 4QGMA 1QH6A 2VM9A 1CJPA 1P8JA 1ODMA 1SLIA 2EIDA 4Z1VA 3OBRA 3NW4A 2I2SA 3J7HA 4CDQC 1K5MB 2VMIA 1Q8QA 5A7WB 2JKXA 5JIUA 3NL1A 2V72A 5L9BA 4I3GA 2FDJA 3VUOA 1SFNA 4HL0A 1UZ0A 3AMQA 1RUE1 3KHBA 4M4PA 3JD71 3LFIA 1RUJ3 5F8PA 3VBSB 3NMBA 3BU0A 4A7KA 3AKTA 2G4IA 1GU3A 4R4ZA 1QXRA 2FDHA 4KMQA 5K8SA 4JTNA 1JODA 2X5IB 3LQCA 3ZFGA 1KS4A 1PMJX 3OF1A 3PIJA 2YZ4A 1XPWA 1WLTA 3VDBA 4HLTA 2YB7A 3GBWA 3Q8BA 1XQNA 4LHSA 1KS5A 2ZTNA 3VD4A 3NAPB 1LHVA 3K4DA 4FQ4A 3VBOB 4IEUA 3AMNA 4TYSA 1Z7S3 4NOTA 1LHUA 2VMCA 1PZ7A 4NR1A 5HCFA 4N8MA 5C6CA 5DDJ3 1ENQA 1JZ5A 1H30A 4F83A 4NPMA 5CEHA 1RUI2 2DV9A 1HV1A 1QJFA 1FI2A 2VOTA 3AM2A 1W8FA 3THCA 1G9AA 3T2PA 4LA3A 2Y34A 5KC6A 3T1MA 5I8TA 2DU0A 1CWPA 3LA3A 3VKNA 1XC6A 1BMV2 4QX7A 2B8MA 1JYCA 4M3CE 4AL9A 1W04A 3ACGA 1JOPA 1PO22 4QPIC 3SHRA 5CBLA 1J1TA 2WZEA 2DCKA 2E31A 3FE5A 1APNA 3AKQA 4YW4A 2VQUA 3EJKA 2Z42A 5FXWA 5FZOB 1QDOA 2QJVA 4BQWA 2Q30A 4Q8LA 2ADEA 4LBKA 4ZPIA 3WT3A 2Q0AA 3ZN6A 1H4HA 5LA0A 4IEXA 2DUPA 4HKOA 1LRHA 4IE6A 5EYYA 1VJ2A 3ZFFA 4JGYB 1Z0HA 5KXEA 4R9CA 2HYXA 3HMYA 2YBSA 1ZRRA 2ZBJA 1OOPB 5FZGA 1HRV2 2IXHA 4XACA 3I2IA 1O6UA 4GKXA 1Y9MA 4PLOA 1EAH1 5TSWA 2OUJA 4OYUA 5EJZB 5AC92 5LEJA 5A6YA 1IG0A 1LULA 2EICA 2RM22 2BRTA 4HBNA 2Y26A 4RR3B 3ZLIA 1C8NA 4HVRA 1CQ9A 1MQTB 3VZJA 1SPPA 1VBD3 4AHYA 3MGUA 2BFUS 3TRSB 1JN2P 4ASMB 2WSVA 2QQWA 2JG9C 3NO8A 3FUOA 1GZWA 3I59B 2GMMA 4K21A 4IUGA 2JXAA 1AR91 1ND3C 3UT0A 1ZRDA 4GB33 3I2HA 1VIWB 2WNVA 4JDOA 4LHNA 4MH0E 2WWSA 4BYYA 5F7UA 1A78A 5I0UA 3J7MA 1R1A3 4A45A 5J09A 2VNOA 3JZVA 3ZOIA 1UOFA 1PGL1 3O5SA 1MS4A 4NHKA 1AVBA 4Q4X1 2AEZA 4CDXC 1ZBA3 3BVCA 1Y9GA 4Y24A 1O3TA 2VD7A 1W6PB 2JG9A 4OLLA 4LUKA 4UW3A 2YHJA 4V2WA 4UF0B 4NPRA 4P14A 2RE9A 4XQDA 1AL23 1TMF3 4FT8A 5FZLA 1UD1A 2NP0A 4XBLA 4ES8A 2ARCA 1MS0A 5SV5A 5AVPA 4LE4A 4FAHA 2DBNA 3C8XA 1T6BX 3QCWA 2QQLA 4FP3A 2XH6A 5FFOC 2LS6A 3T2TA 4AQTA 3NNJA 4N9HA 2ZGQA 2PELA 3M3QA 1W6QA 1AYM1 5CIRA 2K9ZA 3AYDA 3DKWA 3JQXA 2B4KA 3ASIA 1LTEA 3MBWA 2BQPA 5FPXA 4XUNA 5IK8A 4LK7A 3WD5A 3WNNA 1OLMA 4AQ6A 5JSOA 2Z5WA 3FN9A 5K4LA 3RPQA 1UXZA 3WQ0A 2J1UA 4JHZA 3AFGA 1M4WA 1UIJA 3AMPA 3UETA 2CAVA 3N7LA 3GM8A 4K8RB 2QQJA 2R043 2XJUA 1VAVA 2ZGOA 4W8JA 3ZYBA 4NUBA 4XVHA 2WYFA 3POJA 1D4M1 1FYUA 4OQ8A 3BU7A 1NCQB 4GKYA 1OF4A 2C0ZA 4AHZA 5IK5A 3CQOA 4LPLA 5IVCA 1VRH1 2PXJA 4M0HA 4CYDA 2FHRA 5LATA 3CO2A 2ZXQA 3OB8A 4LO5B 1VBB1 3AKSA 2P3IA 1X82A 4ZXKA 3PVNA 1U5ZA 3DXTA 2W52A 2LUWA 4LKDA 1EPZA 2CY6A 3DGTA 4B7KA 1WA4A 1S0EA 3OCPA 1XNTA 3HN1A 4INDA 1XE7A 4R9AA 2QQUA 2XL9A 4XF1A 3SCGA 3A7QA 1N3QA 1FPN2 3WF2A 3MLJA 2VVEA 1AYN1 3VB9A 3O1RA 2ZX2A 2GN3A 1KJLA 1UOJA 1J59A 2VUAA 3ZM8A 2IVJA 4BPZA 2CYFA 4DEVA 2W0XA 5A80A 4B4QA 3N4MA 1PX3A 1UN1A 2WFF1 1NT0A 3U14A 5IT6A 1YQ5A 1NG0A 2RMU3 3WG1A 4Q0PA 2ZX0A 4LBQA 1F15A 1MS5A 2W1UA 4HMZA 4RN5A 4LO4B 3SH3A 3NNLA 4KBBA 3SEPA 3VBRB 3VBFA 1ZRCA 1O4ZA 2VCBA 4XCBA 1GNHA 4MOAA 1CONA 2Y38A 2Q8CA 1ZM1A 4DXRA 4Z2WA 1J3PA 3JXSA 4QMAA 1UU4A 4AI2A 4Z82A 3O1OA 1CVNA 1KITA 2QDNA 2RDRA 4ORFA 1WD3A 4PDWC 3LZZA 1QJY1 3V0AB 1DQ0A 3VN4A 2XHNA 1DLCA 3B9IA 1LOGA 4AZZA 3DXUA 5L7OC 1C57A 4QWNA 4WVVA 2WYSA 3HR9A 2A75A 3AYEA 4XURA 1H8VA 4AVBA 5FZCA 5CFCB 1NX9A 2RS33 4YW5A 1WMFA 2JEMA 3PUAA 1B35C 4IE5A 4K20A 2ZGPA 2D98A 3H42B 5T50A 4QB6A 3HVDA 2HWF2 4IEVA 3AX4A 2BNOA 1MS1A 3ZYJB 2DTYA 1RUC2 3D6EA 1H1AA 3DPRB 4WVMA 1JZ8A 1WMXA 3KB5A 1ZZBA 2ZPXA 3DUIA 1LENA 1QOTA 4PDWA 4NIIA 3QACA 5DPNA 5KWRA 1VBE3 1X8EA 5L7OA 5C9AB 1RUNA 2VCAA 3GJAA 4XFBA 4JTOA 4ET7A 2R1BA 1GNYA 3LA2A 5FYIA 4EZ4A 3OEAA 1LAJA 2R1DA 5I8YA 5JIAA 3OPTA 3OPWA 1B35A 2Y6HA 3ZX7A 4B4PA 1KD7A 4OMDA 3M7AA 2HWD1 1ZRIA 4AVVA 1WLDA 1Z7S2 1H9WA 5LRSA 2ERFA 1JYIA 3WXPA 3O0WA 4XDPA 5DDJ2 5F6KA 2ID4A 4FOWA 1Q56A 2XQRA 3VKMA 3ZFEC 2J1RA 4Y1UA 2YROA 2KXLA 3LPGA 1CX4A 3V0BA 1LHNA 1LR5A 4IV1B 3OUIA 4N43C 3ZXLA 2CWMA 5KHGA 4C0HA 1LB2A 1HQWA 5F3IA 5FREA 3VBOA 3G6JB 1C1LA 4DFSA 2XHKA 4CVUA 5HCAA 5C70A 5C3SA 3VDDB 5FBJA 3I3DA 1RXGA 2XLAA 4LBJA 2W1SA 1MZ6A 2HWC2 1F8VA 4Y4RA 1MZEA 1SLLA 5FLJA 2ZACA 4NWVA 3NV2A 3WG3A 1VBA2 5LA2A 5C4WC 4TZDA 4B8EA 5DAWA 1OLME 1ZZ8A 2QVSB 4QHBA 5M0TA 3I54A 5FYMA 3IWZA 1LU2A 1H8TB 1FAYA 5LY1A 2PAEA 2VUCA 1JTZX 2V5DA 4FO9A 1RVF1 1R081 1SBFA 4E8CA 1MVQA 1POQA 4PJYA 3RNSA 3V56A 1JYNA 1VB2A 1OH3A 2RJLA 2VOKA 4AI8A 2CGPA 5FZ6A 3P6BA 3LIGA 4Y20A 1A34A 5A3WA 3TEYA 2D6OX 3KQRA 4QKFA 2W1QA 1MS9A 4XABA 4LUMA 1QU0A 3NNFA 1ZZCA 5FMCA 2VNGA 4ASLA 2J1EA 5HV4A 1XYNA 2PQQA 1JYXA 2I07B 2JDMA 4UW4A 3ZXAC 3HT1A 1AR81 1SBEA 2UU8A 1AXKA 1J84A 3LPFA 2DU1A 2EXKA 1COV1 3BCWA 3LFMA 4GJZA 2DFCA 1YC61 2MPFA 2OQ7A 4M01A 1BBT1 5FIXA 5FZ3A 2ORXA 2W47A 4GQ7A 1KGYA 1R1A2 4Q4V2 1US2A 2Z2SB 3HPNA 4Q27A 3A0NA 4Q0SA 1MZFA 4M3CB 2JDAA 4YVSB 1GOGA 2K46A 4P9YA 1MQTA 2JDYA 3B01A 5D21A 3ZKYA 4BK4A 4RSUA 1PO13 3CF6E 4K8FA 1YO8A 3D3AA 1TNFA 3ZXFA 1PIV3 5B2GB 3IM0A 1MS8A 3N9NA 3VBHA 3BTYA 4HK9A 5A3PA 4W4ZA 2IXJA 5DAVA 4ZZ5A 1LGBA 1GMMA 4LTAA 4BXFA 1TMF2 1HXS3 2A7AA 3W59A 2WINB 3R4SA 2FDKA 4ZONA 2RJKA 3U37A 3HD8B 5FP9A 2H6BA 4PF5A 3CNAA 3THPA 3VD5A 4ISRA 3WINE 1CAWB 1H6XA 2BBAA 1RUG3 3TAYA 4YPJA 4YNIA 4RFT0 1H2MA 2X10A 2C26A 2D6LX 3WP4A 4LR4A 4HKLA 4NN0A 4AI3A 4CZSA 1CAUA 4EWEA 4RGKA 4JGZC 4FOVA 4Y5Z0 3M70A 4JKLA 3TB0A 2XJVA 4FP2A 1YI7A 5CYYA 1D0HA 5FY4A 4LO6B 2R063 4AQ2A 3DYPA 2Y6GA 1H9PA 2O0OA 1YRZA 1XOYA 1G9CA 2W87A 4URTA 4PIZA 1ENRA 1CAVA 4LO7A 2GZWA 4UYBA 1OFNA 2ZMNA 4JAAA 4KWLA 2P6CA 3N7KA 1AL0G 4WM7B 2WO7A 4BQ5A 4EWAA 3RSJA 5C5UA 1DQ1A 2MEV3 4LLOA 3ZDSA 3I7DA 5EV7A 1WGPA 1NZIA 4LHLA 3F95A 1EYBA 2HJIA 2XJRA 4Q4W1 5C8CB 4JGZA 1O59A 4CDUC 4EZHA 3FLPA 4TTGA 2W3JA 3TEZA 4P9GA 3DEMA 4YFWA 1QHDA 1GNZA 2VXJA 4QPYA 3AKRA 1U5IA 4MXWA 3E97A 4BQXA 3O1MA 3O0VA 5FYTA 4D7TA 3FWEA 1URXA 2H0VA 1W6NB 4UBHA 4F8AA 1AR72 1YJKA 5FMOS 3T2QA 5CA6A 2P3KA 5IHRA 4D6RA 2ENRA 1FOD3 4QAWA 1NCQA 1TVGA 4LBMA 4YM0A 3ILFA 1ASJ3 2WRAA 1QJX1 4XJZA 1FV2A 3ZVXA 1FMD3 3AYAA 4CDUA 2YXSA 4Q0UA 5KHIA 4LIVA 3QH7A 3NKTA 5SV8A 4BQ1A 5LA1A 4J1WA 4NHYA 3ZDVA 2VNRA 1LOAA 4Y3OA 1N1YA 1TME3 1V6IA 3AB0A 1CZVA 1VMFA 2WQ8A 4XUQA 3I8TA 4Y22B 2OZ6A 3S7IA 2RMU2 1O3RA 5JR2A 1XNAA 1G9DA 4XTMA 3M3EA 2R30A 3FLRA 5FY5A 3TWIA 2JG8B 2VZ1A 1I9RA 3H7JA 4EJRA 5A1FA 3KHCA 4X6RB 4QQ2A 4QX3A 3J4UH 4IETA 4AHWA 4LBQD 3S7EA 1U5XA 2HEWF 2PHDA 4L92A 1E5SA 4RHV1 3VL8A 3MIGA 4OHZA 4H55A 4XFGA 2ILMA 4QB2A 4CDWC 2WT0A 3MV11 4AYUA 3O12A 1STMA 3H8UA 3SCFA 2W94A 1LGCA 3ZSLA 1DQ2A 5DAPA 2P17A 3J8F1 2ZGLA 1D7PM 5FXZA 4E9KA 3FFZA 4JZRA 1YYNA 1LOFC 2GC3A 1LKNA 2NZ9A 5EIYB 4WZCA 5I8SA 3Q8FA 1W9TA 3OOXA 3U4XA 4CCOA 5FO7B 5EXOA 4GA9A 4RQPC 1OD5A 5DABA 2YPDA 4MG2A 2E6VA 4TLGA 1RUI3 3N9PA 1I6XA 2BNMA 4CDWA 1HW5A 3WDWA 5FQ0B 5FZDA 5LWBA 4YVWC 5T55A 3ZKUA 4XUTA 4PI0A 4BA6A 5FZAA 2CAUA 1H2LA 3HQRA 4HOOA 5FJKA 5LBCA 4CA9A 1LOFA 1RUH2 2PHWA 5CISA 4MZUA 5LBEA 5JZGB 1YFWA 2WS91 4Y1ZA 4DZGA 4LT5A 2EXHA 4CPBA 1WKYA 3AP6A 3JU9A 4RQPA 1X50A 2KM2A 4ZU4A 1YFXA 2PAMA 3K4AA 2QQIA 1X33A 2JB8A 4FOYA 4FQZA 2GH8A 1NA1A 3ZR6A 2D3RA 5F5IA 4L0PA 3ZXDA 3K2OA 5F32A 5F3CA 1OD3A 4MLOA 2R49A 3HAGA 1NE4A 1W9WA 2NMNA 2XWBB 3C7OA 1IPSA 4AR2A 4YW1A 1WW4A 2VUJA 2VY0A 4IEWA 1U0AA 1ND2B 1JZ7A 2P3YA 5FO9B 3C2UA 3RZHA 3ACFA 1U5YA 5IJRA 1EUTA 4QPIB 3ROUA 3TBDA 1OLQA 2XBO3 2WC2A 3QH6A 4XJWA 2B42B 5HBAA 2GC0A 4B1MA 2XKPA 5JSPA 4ITCA 4NIGA 3INAA 2AUYA 1WMEA 3ACLA 4TSVA 3H3ZA 2D7FA 1YQ8A 2OPKA 4QKBA 3BALA 3U78A 1SBDA 1H0BA 5KHHA 4EQVA 3WNLA 2BERA 3MIFA 4OHYA 1JW6A 1GQGA 3JBG3 3N3HA 2UY8A 2MHFA 1W8OA 4TN7A 3PJYA 4Y5SA 1VRBA 2PFWA 1TG7A 3KVBA 3D5OA 1DU3D 1C3HA 1AXZA 1BEV1 1W03A 1IKQA 5A3MA 1OA4A 4ATFA 5IVVA 3UGFA 3M1HA 1UZWA 4FPOB 5ABJC 1UW8A 5FZKA 5FOBB 3RRDA 2VW0A 4QPGB 4BCUA 1H8TA 2ZABA 1Q5OA 4ISQA 1SACA 5H9PA 2VE1A 2WNUB 1BK0A 2J1AA 4F7ZA 1IG3A 4LOSA 5GLTA 5DZEA 5ERLA 1W6MA 3OGJA 1OPOA 2ZGSA 1Y43B 2XVGA 5FWEA 4I30A 5HXVA 3UV9A 4AGGA 4RS5B 1CPNA 3GZUC 4MHRA 1PO12 4AVTA 4D7YA 1RJ8A 2VZVA 1BMV1 4CEWC 4AEMA 4E4SA 1ZZ6A 2IZWA 4IDZA 1K12A 3AXEA 3KV9A 3CJXA 1PO21 3NV3A 1F35A 1V6OA 1KQRA 2HWE1 4L2NA 2VTXJ 3VLBB 2VULA 2XJQA 1YQ6A 5JOXA 3I3BA 5HCHA 3RI9A 2PHFA 4HT1T 5FZMA 1W8UA 3AXDA 1BXHA 2JIGA 4P9JA 4AEDC 1RUG2 2WZR3 4CCDA 3CZUA 1NLSA 3CJIB 4V2VA 4NIHA 1UPIA 1GWMA 5CNAA 5AVAA 3M3IA 5D2AA 3H1WA 5LZ6A 1KDKA 3VHPA 1C8M3 2ARBA 2RJ2A 2BVBA 2JJ6A 5J1XA 3EQEA 5CFDC 1HRV1 2P6HA 3HWJA 2R062 5JI7A 4YG3A 3UJQA 5FR3A 3ZPOA 2GU9A 2CNAA 5AC91 3LOBA 3BPZA 4XW3A 2RM21 1GQHA 4NVPA 2FCVA 4BB3A 5LW9A 3OGRA 1A3KA 5JWPA 2MEV2 3AL6A 1DGWX 1V6KA 3C7EA 3CL1A 1XE0A 4AEDA 5C7GA 4P02B 4XZUG 2X53S 5EHDA 1QJU1 3HJRA 3J7LA 3SH5A 4E2GA 4AI9A 2PMWB 1IPKA 2WSUA 1CN1A 4J25A 5ACA1 4XIKA 5JPMB 1FPN3 3KT1A 2VL4A 3I4IA 5CFDA 2P34A 2BW8A 3BIWE 3PVBB 3T3YA 4NO4A 1NXMA 1X36A 5IVBA 1QIQA 1YQCA 3OD4A 1Y9QA 2FDGA 5JOYA 4DY5A 1GZTA 3RDIA 1TEIA 4LO8A 2EAAA 4CEYC 3KCCA 2RS53 2JD9A 4FXGB 5BNPA 1ASJ2 3OGGA 1J3QA 4KBZA 2Z4FA 1FMD2 2Q1MA 1ZX5A 5FXVA 3BGAA 4KGGA 1UPSA 1PGW2 1MVEA 3UGGA 3Q9OA 1ULPA 2GALA 4OI4A 5CZKA 1TME2 5GLWA 2G9GA 4UFMA 3AJYA 1XYOA 1GBGA 3ZFGC 3AVSA 3RFRA 2YU2A 4OI0A 1WWYA 5JDBA 4DY3A 5IVEA 2WO2A 3OUJA 4HSJA 3I2KA 4Y26A 4CEYA 4DUVA 3PTYA 2VTXA 5BNQA 4JV4A 4XZPA 5FRAA 2Q8DA 1J58A 5A32B 2HWF3 2RS11 4W6YA 4PF1A 3D0JA 1RUC3 3OY8B 4FAGA 3U07A 2E7AA 2QKDA 4M4RA 4YGEA 1OSGA 1HB2A 5E89A 4XHBA 5T52A 1GYKA 1YJLA 4L97A 4YRDA 5HI0A 3S0MA 1JHJA 1U12A 1RUD1 1W2UA 5DUXA 4R9DA 1REDA 2EF6A 3GGLA 3RZKA 4IE7A 3ES1A 1CD3G 5F5AA 1OMIA 2BVVA 4XOGA 5I0RA 4DMIA 3O14A 3EBRA 4GXLA 2F4LA 2A6XA 2BOJA 3NRUA 5F1RA 3NJZA 1CESA 4NAMA 1O8SA 3KCXA 3TNQA 4CUBA 3R0RA 4Q26A 1MR5A 2OXBA 3UYJA 4BIFA 4FTBA 2BOIA 4CTEA 3FL7A 2PHXA 4FPHA 1LCLA 1SLBA 3EHKA 3IPVB 3ZXJA 3ZFFC 1LESA 3WDTA 2TUNA 5FPZA 3TNPB 4EN9B 4FFGA 1NCRB 1HB4A 1LGNA 5FKCA 5C3PA 2GMEA 2O14A 3O0XA 4E2SA 4YW3A 3JB4C 2HWC3 4GAZA 3OUHA 3D0SA 3U0ZA 1R093 5FWJA 5JI9A 1Q3EA 1UY0A 1VBA3 3KS7A 4O9EA 2GN7A 3FLTA 5A3UA 3T0DA 3IZOA 4HPKA 2R071 4EN6B 2VECA 4K6BA 4QD2A 4QXCA 3ABZA 1HIXA 4YZ5A 1QJZA 1W05A 2AR6A 4A4AA 1JUIA 1L3JA 4CPBD 2ZCWA 4XJ8A 4D8MA 5A1AA 4IEQA 4GH4B 1L7RA 2WNVC 1AJOA 5J98B 2ATFA 1SHWB 2D97A 2QZ2A 1NXD1 2UWBA 2ZHNA 2EAKA 3PIGA 1JZ6A 2XBO2 3ZSEA 2VZ3A 2OX0A 1POV3 1MPXA 4JDMA 1WD4A 2WT1A 3WHTA 5FMDA 5A6ZA 3KM5A 3H8XA 5C4WB 3WP3A 3BODA 1RUJ1 2JE7A 2XL7A 3E5QA 5T5LA 2C9KA 4CXYA 2WZPP 1EP0A 1RUC1 2RV9A 2ZEWA 3OG2A 3JBG2 3OYWB 4JKKA 4ZU7A 5FP8A 2JICA 3AMMA 2EXJA 2NQYA 3W21A 1OUXA 1SCRA 1GFF2 2RDQA 3AP9A 3WX5A 1W2OA 3KMHA 4Q4V3 4C90A 2FZ1A 4META 1HQLA 1QQP3 1DLLA 3K3OA 3P1IA 4XC9A 1UMIA 4A41A 2UYBA 3VBUB 1UNBA 5BNOB 4G4FA 3ZYIB 5D1IA 3VGIA 1LEDA 2YV8A 1US3A 3E1F1 4I3PA 1Z7S1 3MICA 2E9QA
chains in the Genus database with same CATH topology
4AVCA 5DDJ1 4N53B 3KD4A 3MF9A 1Q8SA 2PLV3 4YZ2A 1F9KA 3GHNA 5KHKA 2Q1ZB 4OUSA 4AVAA 1ZNPA 1S0GA 2DVAA 4B29A 1OQ1A 2A3YA 3ZFEA 2ZHMA 3VKOA 1V6LA 1REEA 1V9U3 1CAXB 2WNUA 5C33A 4IL7A 4IV3B 5A33B 1OA2A 4GALA 2R0HA 3ZN5A 2WZR2 4X6QB 2D3SA 4S2GA 4W6XA 2F6BA 5IK4A 4GMP3 3MZHA 1AHSA 1C8M2 4CP2A 4MGKE 2ES3A 4YZ1A 1HV0A 1RJ7A 2DYCA 2D5FA 5JMCA 2JD4A 3HIFA 4AG4A 4AXOA 4QT6A 2WL1A 3H1YA 4P9IA 1RMU3 3JD72 1QXPA 1VBD1 1AR73 4Z8BA 4G9SB 3VBFC 1DZRA 4A2UA 4R9BA 4XDQA 3AZVA 5L19A 4GB31 1H4GA 4UXAA 5K0UB 3NKGA 3H9AA 4L8QA 1R1A1 3B94A 1KFUL 3DL3A 1LODA 2ZKLA 4N7IA 5BNNC 1ZBA1 3G7DA 5E8AA 3KT7A 4MUVA 4EROA 1IS6A 2B7YA 1REFA 2RS52 4MVTA 1ZREA 1OA3A 2RR13 1AL21 1TMF1 3QD6A 5GZDA 2VOVA 3WQ1A 2BFUL 4FVVA 4RGAA 2K0GA 3KZ4C 3QBQA 3VHOA 4WM8B 5IK7A 4UW5A 4Y1VA 3WW3A 4AI1A 4OHVA 2BUKA 2JDZA 5BNNA 1K5MC 1QOSA 3FX3A 4MYEA 2V5YA 5T5JA 3A4UA 3KT4A 5JPNB 1RL3A 4XFIA 2NMOA 3VBSC 4WV8A 1IKPA 1HRI3 3ELNA 3IT8A 1ONAA 1V70A 2R041 3LCPA 1AR63 2X5IC 4RL7A 4YGCA 1LJ7A 2ZGRA 3HQXA 4PBOA 4KU8A 1ALYA 1K5MA 1G9BA 1EAH2 2VH9A 1SFYA 1YXWA 3GZTB 4M00A 3VBOC 3VL8A 2XUMA 2P2KA 1XU1A 1RIRA 2WJSA 2EA7A 2C1FA 2ZZJA 1LECA 3LSEA 5D8AB 3ST7A 2BPA2 1RUH3 4PBPA 3VBSA 4YM1A 1EV13 2DUQA 3HBZA 2G9FA 3TN93 2YYOA 3RMYA 2X5IA 1N1TA 2ZZQA 5J36A 5DZFA 3W9AA 4AW7A 1RHI3 1HDKA 3T1LA 4B3NA 5GM0A 3NAPA 3ATGA 2D6KA 3KSCA 4IQPA 1PGL2 4Q4X2 1WCSA 4JDNA 4YVWB 2GH2A 2FZ2A 3WW4A 4IEPA 4HVOA 4LE3A 2RMU1 1UIKA 2ZKNA 4UW6A 1R092 5GALA 1I5ZA 3MLLA 3MW2A 1QKQA 4YM3A 4FOQA 3RYRA 3GNEA 3WR0A 3WLUA 4Q0VA 1VP6A 4HSLA 4QX5A 1IZ3A 3WDXA 4BOWA 1O4YA 1S0JA 3MPBA 4JGYC 1PK6B 1YUDA 1J1LA 4Z92B 3ZIWA 4B7EA 1OOPC 1JBCA 1KRIA 4GWMA 3QLQA 3RS6A 1W6OB 4XHXA 3D8CA 2EXIA 4LLFA 5LK5A 2DCYA 2RS31 2ZX3A 2Y0OA 1MQTC 3VKLA 1Q8OA 1YHFA 2QZ3A 3H7YA 3GZAA 1WCDJ 3VBHC 4OHXA 3VL9A 4U36A 4M3CF 4JGYA 4YLZA 1RUF3 2R16A 1OOPA 4C1WA 1VBE1 1VRH2 3GF6A 1OQEA 1Z78A 4XFAA 2PHTA 4IESA 1QQP2 4RR3A 3SNMA 5CVRA 4OFGA 4E2QA 1G8WA 2VW1A 3USUB 1O91A 1VBB2 3I59A 3MYXA 2P37A 1RC6A 2E53A 4F3JA 2RHPA 2VVDA 3UJOA 2A71A 1MEC3 3KGZA 3VZOA 5JVVA 4QQHA 4J6GA 2GSYA 2PLV2 2WKKA 4WBBA 4Q4Y3 1LOBA 4BLIA 1PVC3 1POV0 2DFBA 1SLCA 2IC1A 2I45A 2IXKA 5T5PA 3DV8A 1V6JA 5FTTC 1GZCA 3MIDA 4SLIA 1W6PA 4QGLA 3X29B 4DOUA 1V9U2 4XBNA 1YLLA 1DF0A 3M3CA 2D43A 4S2FA 2JE9A 2XJTA 2H6CA 3AKPA 1Q43A 3OBTA 4AWDA 1NCQC 1GICA 1N3PA 3FMGA 1PVXA 4AQSA 3RQ0A 1H1MA 1NY71 1ULGA 4P9XA 4N7UA 4CRQA 4J1XA 3VZLA 1LHOA 1PMIA 1RMU2 2CV6A 3RG0A 4LA2A 1W0OA 2ZX4A 2ET7A 4X8PA 4LBLA 1GKBA 2I74A 4K9SA 2WQ4A 3AP7A 5FAXA 4H3WA 4MGIE 2IFRA 4YW2A 2DCZA 3SLIA 3VKFC 4K1YA 4XIOA 1WBFA 3BB6A 3UKTA 5BUVA 4PLNA 2XKOA 1F5FA 4YGDA 2YGMA 3LAGA 5CU1A 2VW2A 4RGGA 3LGRA 3ZXGA 1DZQA 1Z7S1 2X29A 1PO11 3VBRC 1ZBE3 1PIV1 2ZAAA 4IXLA 1V6NA 1SEFA 2RR12 5JOZA 1HXS1 4C91A 3R05A 1AX1A 1GR3A 1JHNA 2HWB3 1S2KA 1ZRFA 1A8DA 5I91A 1RUG1 1QGLA 4FCAA 4AI0A 2VMHA 3UK9A 4GWNA 2F4PA 4W6WA 5CFCC 3VBRA 3ZFGB 2VVFA 1S0IA 2A70A 3ME2A 3WV6A 4A7YA 4BZ4A 2R061 2A6VA 2VG9A 4CDQB 3D82A 5JR7B 1HRI2 3DPRC 2Q8OA 4WVZA 1MACA 2OVUA 3GALA 3U11A 2MEV1 1AR62 3V0AA 2ZJCA 5J37A 1RVF2 1R082 5C9AC 1CGPA 2IFWA 1NA1C 5BY5A 5CFCA 2A3WA 4GULA 4Q2FA 2CWSA 1A8MA 4KWJA 4NWWA 1EPWA 1QXJA 3WDUA 2H0BA 1EV12 2VPVA 2UYAA 3DPRA 4YSFA 5T5OA 1S0CA 5EFUA 3TN92 2E51A 1FOD1 2UY9A 4FPKA 3TYJA 3K48A 4AEKA 1COV2 3NSTA 3FBMA 4IV1C 5C9AA 1RHI2 1ASJ1 1FMD1 1VAMA 3V65A 3ZSJA 1JXNA 1TME1 3ZN6B 2PN5A 2ZA9A 3FUQA 3ZFFB 1DBNA 3SH4A 4FBFA 1OI6A 2AGSA 2R6QA 4IV1A 4X8NA 5FMOL 1H8TC 2VQAA 5GZFA 5LK7B 1N3OA 1DG6A 1N47A 1GZWB 3VDDA 1BYHA 1IS5A 1PNFA 4I02A 1OQDA 2ZHLA 3H3UA 3MPPG 1RTVA 2Y0IA 4XJAA 5I0TA 5C8WA 5CADA 5H9SA 2B45X 3JUUA 4COWA 1RUF2 2DWRA 3R6SA 2JG9B 2DUOA 2QE3A 1ND3B 4XF0A 1RUI1 2O8QA 2YGLA 3NV1A 1UCXA 4YVSC 1WLWA 4YG6A 2Z69A 2ZGUA 4IEZA 4BM8A 4HFSA 4EN8B 2WT2A 4OVEA 2O1QA 1W6QB 4QXKA 3ZPYA 4CDXB 3AZWA 2OUHA 2QUOA 1BJQA 1MEC2 2D93A 3IBMA 3FHIB 1QJX2 3WOGA 1O7FA 3ZO0B 1XXNA 5HCBA 4Q4Y2 1IGOA 4M3CA 3B69A 3N36A 4YVSA 1PVC2 2BYVE 4BWOA 1VBC3 1BQPA 4HVQA 3BTAA 3P3PA 2R32A 2Q4SA 4XE9A 3MW4A 1F5JA 4BLJA 5AFEA 2VQ0A 2D6MA 4I0BA 2A3XA 3LWCA 2YY1A 2XBO1 4WM7C 3VHNA 4FPEA 4BMEA 4WVWA 1SCSA 1RUE3 4G3YC 3JD73 1CAWA 2WIIB 1ENSA 3GBGA 4M0NA 1S2BA 5BNPC 4MSVA 4EN7B 5C8CC 3AP4A 4Q1PA 3JBG1 1PNGA 4XFCA 3H0OA 1XNCA 1VALA 3OJBA 1DDLA 3J8F2 2OYZA 4IERA 3ZSMA 1Q8PA 2QQPA 4WM7A 1G7YA 3I2DA 3UKVA 2VU9A 2JENA 2ZAHA 1AF9A 2B46X 1ULEA 1C5HA 2DF7A 4LBQB 3J9SA 5C8CA 4XMIA 4DRVA 1YIFA 3OPZA 5H9RA 1DGRA 2ZGNA 1SMVA 4YZ3A 5GZCA 2NPIA 5JLVA 4L9BA 3AFKA 4A7ZA 1O3SA 2XJPA 3MFAA 1WMDA 1W6NA 3H1MA 5AFBA 1ZBE2 4MXVA 1YNAA 4DPNA 1XNBA 2R0FA 2BGCA 2NM1A 1AX0A 1DQ5A 2JG8C 3WDYA 1SLTA 1HLCA 1ZYBA 4OI2A 1LU1A 2E7QA 4FTEA 4DRRA 4XTPA 3THTA 2PYTA 4AHXA 1C28A 2OZJA 1D2SA 2HWB2 3U10A 3V64A 4XF4A 1WW7A 4QQOA 1VAKA 2WZR1 2EIGA 4N9IA 2WLPA 4WVMB 4Y22A 3K51A 4SBVA 3WDVA 3ES4A 4JCKA 5H9QA 1H2NA 4PDWB 1C8M1 3WG4A 5L7OB 4AGRA 4H14A 1QH7A 3A0KA 2JG8A 1EAH3 4TLFA 3ZYGA 2B5HA 4AFBA 1BK1A 4XXPA 1VB4A 1B35B 3JCIA 1WLCA 4Y1XA 2ZHKA 3IIAA 3WZ1A 1WUVA 5LEKA 1AR93 1OPMA 1LEMA 5F9TA 1O4TA 4C1XA 4BH9A 4KG8A 1SQ4A 4UBGA 3S6PA 3V0BB 1FPN1 4P9WA 1AXYA 3ILRA 1BEV2 4CDQA 1YFUA 4K7JA 4U2AA 4Q4X3 4XFFA 2QNKA 5JZGC 5DG1A 3RI8A 1XU2A 4LHKA 4XXAA 4E27A 1ZVFA 1PM7A 2RS51 3JQWA 1CR7A 2PA7A 3SCHA 3AYCA 3E5XA 1ULCA 1XE8A 5FQ0A 5FLIA 4OULA 5L36A 2BWCA 3FC0A 4N43B 2OW4A 1W0PA 5JCTA 1AYM3 5JZGA 1ND2C 2DVFA 4XPVA 5J3UA 1LOEA 1DHKB 1GZ9A 4TWTA 4YFZA 2AYHA 3B3QE 2HWE2 4OHWA 3GHMA 1QNWA 1DQ6A 5LRRA 4XQ4A 4Y20B 4FTSA 1IOAA 2X8KA 1DIWA 4W65A 2HWF1 1T6GC 1UKGA 4L99A 1QF3A 2CTVA 3N35A 3S30A 1D4M3 1EY2A 4KH9A 4QGNA 1ND2A 3L9JT 5KBFA 1ZZ9A 1VRH3 4QPIA 2WLQA 3ZMNA 1X7NA 2TBVA 1CJDA 4QPGC 3ETQA 2C9AA 1VBB3 4D7SA 2WNUC 4DQAA 1JUHA 3VBHB 3MEPA 1QJU2 5GLZA 2E7TA 5DUWA 5ACA2 1QNYA 4CP1A 5J48A 2D6PA 1IQAA 4QQPA 1AYN3 2TNFA 4ZKTB 2WA3A 4RS5C 3WUCA 4KWKA 2XWJB 1YI9A 2WFF3 3WW2A 4QPGA 1CAUB 1LHWA 4H7MA 3MW3A 1CIWA 3M3OA 1FNYA 2HWC1 3PNAA 4RA0A 4C0BA 4O9GA 1UMZA 1R091 4D69A 1ND3A 4FPJA 1VBA1 3NV4A 4XEZA 5DUUA 4FSJA 2ARXA 1OFSA 3M8LA 1CAVB 3CJIC 4FPCA 1IPJA 1Y3TA 4RS5A 1VBC2 1C4RA 1QJY3 4IEOA 4ES9A 4CDXA 2Q5TA 1BZWA 4JGZB 2XVLA 3IDEA 4BIOA 1RUOA 4MGYE 5K7PA 1POV1 1RUE2 2RS12 1FT9A 2ZMLA 4MXWB 3CJIA 5DXDA 2XGXA 3SISA 2ZS6B 2BEOA 3WCSA 2V09A 3EO6A 4JRAA 4PCRA 2JX9A 2IXLA 4CDUB 1RUD2 1AJKA 4Q4V1 5GKAC 1QQP1 5CG9A 2A5ZA 5CAZA 2OA2A 4XQWA 2HWD3 1OKQA 3IKWA 3NWKA 5GZGA 3P3NA 4AK3A 1DYKA 4R52A 1BVVA 1C1FA 2LM3A 2BBVA 1I3HA 4V1PA 3WP5A 4NHLA 3ZSKA 4XJUA 4OI1A 4BMBA 2PHLA 3MIBA 2PLV1 2OIIA 2W39A 5IUQA 1O3QA 1AZDA 1DFQA 1RITA 2VGDA 2YC0A 1PGSA 4IEYA 5GJ6A 4HN0A 3KCYA 1V9U1 5FOJB 2IXCA 4KNCA 3RYPA 4B4RA 3ILNA 1GV9A 1R1ZA 2NLRA 3POWA 2A73B 2R072 5DG2A 4DS0A 2P3JA 5KXDA 2E63A 2GNMA 2IWGB 1GANA 3ECQA 3UKNA 4XJ9A 3MF6A 1RVF3 1R083 3IN9A 1WBLA 1DGWA 4GMP1 4KGQA 1MS3A 2D6NA 4LEJA 3MLKA 4QU2A 3E5UA 2FMDA 3MI8A 2TEPA 3NAPC 1NQDA 3SITA 4CDWB 3IDBB 1VR3A 2GAUA 4XILA 3CU7A 3LA7A 2Z79A 3LSDA 5GLUA 3SMHA 5A32A 4QM8A 1RMU1 2JECA 3OY8A 1D0GA 1RUJ2 2XLGA 5E1RA 1AR71 1RGSA 1AR92 4R4XA 3WNXA 1H1IA 1AR83 1S0BA 5K9YA 1UX6A 1COV3 3QOPA 4RQPB 2PTMA 1BBT3 2D3PA 3OD0A 1D4VB 1NA1B 5FDBA 4I01A 4BE3A 1DYPA 1NCRC 4R8HA 4YYOA 2K2SA 3CEWA 1IHMA 4JRLA 2NN8A 5L73A 5FLHA 5FO8B 3AP5A 3MDPA 4COYA 4EV0A 3AMHA 4Q1RA 2B9UA 4HK8A 4XYXA 1HKDA 2YMZA 4D94A 5EYXA 2RR11 3PMEA 3MFCA 1FATA 5E16A 1HQNA 3VV1A 3J26N 2XG3A 1XYPA 5KXBA 3IPVA 3PHMA 3MIEA 1S0DA 2DTWA 2O8OA 2CGNA 1RINA 3BOPA 4QQLA 1AX2A 4GH4C 1NCRA 1AYM2 3B00A 5EJ3A 4JC1A 5JAXA 1ULFA 3GBFA 4I0WB 3H50A 5KXCA 5J7MA 4D3WA 4RR3C 2XVKA 2CL2A 3M4FA 2VOXA 3ZXEA 2ZOEB 3RJRA 2XPJA 3ALQA 4HETA 4PQ9A 5I0SA 2FQPA 1HRI1 4N43A 3WQ7A 1PHMA 3VZKA 2CGOA 1D4M2 4GH4A 3AJZA 1AR61 4ZU5A 4DNYA 4Q4W3 2GDFA 4I0AA 1LOCA 2FMYA 4YGBA 3POYA 5JOWA 4Q0QA