3UJOA

Galactose-specific seed lectin from dolichos lablab in complex with adenine and galactose
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
253
structure length
253
Chain Sequence
ANLISFTFKKFNETNLILQRDATVSSGKLRITKAAENGVPTAGSLGRAFYSTPIQIWDNTTGTVASWATSFTFNLQAPNAASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDTFYNGGWDPTERHIGIDVNSIKSIKTTSWDFANGENAEVLITYDSSTNLLVASLVHPSQKTSFIVSERVDLTSVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSINKEDEENKLAIFNLEGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legume lectin
publication title Affinity of a galactose-specific legume lectin from Dolichos lablab to adenine revealed by X-ray cystallography.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 43
structure length 253
sequence length 253
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ujoA00
4XHBA 4YLZA 5GM0A 4AGVA 4NOTA 2D3PA 3WZ1A 5IK7A 2W39A 1J1TA 2D6NA 3I8TA 1C57A 4M00A 5EYYA 4R9BA 2R0FA 3AYDA 4JCKA 1A8DA 2CY6A 5GLWA 3C2UA 2YROA 4PBPA 3H0OA 3RG0A 1LU2A 1S0DA 3IKWA 2YZ4A 2CYFA 3FLRA 3WLUA 1ENQA 2PELA 3UJQA 4YM0A 4XMIA 3WDUA 1G7YA 2AH2A 1QDCA 3OJBA 3U4XA 3WCRA 3MPPG 2JDZA 4HL0A 4R9DA 4K1ZA 1QNYA 2D6KA 5GLVA 2A5ZA 3RS6A 2AENA 2JD4A 4YZ3A 3SISA 4YZ1A 2OUHA 3ILRA 1SBDA 4DRRA 1JYIA 2ZAAA 1KRIA 1MS9A 2ZKNA 3ZSMA 2NMOA 1R1ZA 4YG6A 5GZEA 1CPMA 2ZGOA 3INAA 1DGLA 1GNZA 1SLIA 4XXPA 1FATA 3B3QE 2ARBA 1CPNA 3AK0A 1G8WA 4LBNA 1JUIA 2TEPA 3POYA 1N1TA 4H55A 1JBCA 1S0CA 3VKOA 4CRQA 1G9AA 5IT6A 1C1FA 3OPZA 5JOYA 3WVJA 3AP9A 2OW4A 3ZXEA 5GLTA 1V6MA 3SNMA 5BYNA 1IKPA 3V0BA 2P2KA 3NV4A 1DQ1A 3O0WA 2DVGA 3WG4A 4BMBA 2NM1A 1OQ1A 4Q2FA 5DZFA 1D2SA 4YW3A 4BLIA 1DQ2A 5L73A 4C1WA 1LOCA 1JHNA 5FREA 1F31A 2AYHA 1OFSA 4LBQA 4XIOA 3TAYA 3WG1A 3BOPA 2JJ6A 3SITA 1GZ9A 1JXNA 1OKQA 2DU0A 3O0XA 3ILFA 1UX6A 1Q8VA 1G9BA 1Q8QA 3NV2A 5GLUA 4BM8A 4FQ4A 1O4ZA 1YXWA 3T1LA 1SCSA 2A6XA 4Y22A 2A6ZA 4YM2A 5DUVA 3V64A 3L2YA 1W6QA 3IM0A 4FPHA 4YGCA 4Y20A 1AX0A 1QKQA 4RL7A 4XJUA 2DVFA 2PHFA 4XYXA 2PHXA 1ZM1A 2GALA 5HCBA 2NP0A 1Q8SA 1GICA 3AP6A 4M3CA 4P9WA 3WUDA 2A3WA 3AJYA 4R9CA 3FLTA 5T5PA 1BJQA 1V6JA 2SLIA 3O0VA 2GNMA 5GZDA 4FPFA 2D3SA 2GN7A 4XJZA 2EXHA 1CVNA 1YO8A 4GALA 4WV8A 3AXDA 2A3XA 4YGDA 2WSUA 4R9AA 1UKGA 4XE9A 5E89A 5EYXA 2NMNA 1W6MB 3POSA 4FP2A 2A75A 2FMDA 3UJOA 5T55A 1QF3A 1KJRA 1FX5A 3RMYA 4C1XA 1Q8PA 1HQLA 2ZHLA 3VUOA 1B09A 1Q8OA 1JW6A 2DVBA 4K20A 1FYUA 1IOAA 4LBOA 4Y1YA 3ZXLA 2ZGQA 4MYEA 3WDVA 1DHKB 3OBTA 1CESA 3A4UA 3CNAA 3TB0A 1W6PB 4YW4A 4XDQA 4FOYA 1S0JA 2A6WA 2VUAA 2E7TA 4ATEA 2ZACA 1LOFC 4ATFA 2CL2A 4DPNA 1LESA 3T2TA 5H9QA 3FLPA 3AP4A 5FRAA 2GNTA 3ZPYA 2VH9A 3SH5A 1DFQA 2EAKA 2LALA 2WKKA 3N7KA 1DQ4A 1GZWB 4AGRA 2ZGMA 4LBKA 4Y1XA 3A0NA 3AFKA 5T5JA 3D4KA 2DURA 3LSDA 4UW3A 2V5YA 4UW6A 4Y1VA 3OYWA 2EF6A 3IPVA 5H9RA 4AVSA 3Q9OA 2ZGPA 4P9YA 3WUCA 3M3EA 3WHUA 1CONA 1ULDA 1BQPA 3ENRA 4XIKA 4D69A 1QOOA 1LOGA 1MS8A 1LEDA 1N1VA 4FPEA 1YI7A 2ZGRA 5CNAA 3N36A 1MACA 1SBEA 1ULGA 5SV8A 3UL2A 3ASIA 5JOWA 4YG3A 4LBLA 1V6LA 5DG2A 3ZXKA 3M3QA 1XQNA 1KDMA 5GLZA 1HQWA 3M3CA 3M2MA 1SLBA 3WCSA 4BOWA 1UZZA 3B69A 2CWSA 3FBYA 5F5QA 1AJKA 3ZXFA 4XBLA 1Q56A 3MW4A 1H9WA 4ASMB 3DGTA 5DXDA 1DQ5A 1LHWA 2SBAA 1WBFA 2DV9A 3OY8A 2D3RA 1MZ5A 4Y1ZA 4FP3A 3V0BB 5E88A 1W0PA 1F9KA 2XB6C 3DUIA 3D6EA 3ATGA 4YFZA 2Q5TA 4XJ9A 1LTEA 1W6NB 4I30A 4KBBA 4Z8BA 2D6OX 1W6OA 3NWKA 2AGSA 1QU0A 4LBQB 3AYCA 4XILA 3W59A 4DS0A 3AZXA 3V0AB 2NN8A 4PBOA 1ENSA 5T52A 4GWNA 2CWMA 1V00A 5JMCA 1KDKA 2P34A 1W6QB 1S0GA 1GSLA 2W08A 3N7MA 4Y20B 2LTNA 2WT1A 1NLSA 1GANA 3NV3A 2PHUA 2GDFA 4TZDA 4AYUA 3AYEA 2ERFA 4DRVA 3HR9A 5T50A 4AGGA 2WNEA 1GBGA 4PF5A 1AXZA 3ZSJA 2ZHNA 3V65A 2PHTA 1WLDA 1N3QA 1NXD1 4Y1UA 2D6PA 2ZHMA 2RHPA 1U0AA 4YZ2A 1V6NA 4FPOB 1GNHA 5EWSA 1KITA 1ULCA 5JVVA 3UK9A 4YM3A 3AZWA 1MVEA 4PCRA 1QDOA 1YIFA 4Y26A 4CZSA 4L8QA 1LENA 4P14A 2OVUA 1LJ7A 4Y24A 1G9CA 4OZXA 1UZYA 5KXCA 4P9XA 1AX2A 4BPZA 4YZ5A 4XBQA 1LECA 2ZMLA 2NYYA 2A6VA 5GZFA 2ZABA 3PMEA 4FOWA 4M3CF 2VW2A 1APNA 4XOGA 1UPSA 2ARXA 2JE9A 3NV1A 2GMEA 2WT0A 2ZMNA 4TYSA 1GKBA 2JECA 1URXA 1Z0HA 5HCAA 1LOAA 3M3OA 2VU9A 2D7FA 5F9TA 3PVNA 1G86A 5CBLA 1LGNA 1KQRA 1LHUA 1SFYA 2KM2A 3GALA 3N3HA 2R49A 4M3CE 5IK8A 1WCSA 3KQRA 5DUWA 2V73A 1I1EA 1N3PA 3HN1A 2YY1A 4FOVA 4ZXKA 1IS5A 4GKXA 3B00A 5JDBA 2NZ9A 4YFWA 2GNBA 2WSVA 4AVVA 1ENRA 1ULEA 1TEIA 5KXDA 1UL9A 2UWCA 2AR6A 1I3HA 2EIGA 2ZGUA 4NO4A 1CIWA 3BIWE 1LU1A 1WLCA 4Q1PA 2D43A 1H30A 3BTAA 3D5OA 1FV2A 2ZMKA 1BKZA 2WJSA 3WDTA 4IQPA 2GMMA 1WBLA 1RIRA 2DYCA 3R4UA 5CA6A 5GZGA 1YRZA 1FV3A 3N35A 1ONAA 2E53A 4FPJA 4XZPA 4PQ9A 1DZQA 2FHRA 1DBNA 4FPGA 2DUQA 5DZGA 3VV1A 1RITA 4GXLA 4YW1A 1SACA 2ZGTA 4AWDA 1F5FA 2JKBA 1VLNA 1N3OA 2C5DA 3M1HA 5T54A 3OY8B 2H0BA 3SH4A 3ZXJA 1QOSA 1WW4A 4DFSA 2A3YA 1MS5A 1VAMA 4W65A 1BYHA 1HDKA 2E6VA 1V6OA 1VALA 2DTWA 4FPKA 3ZYPA 1QGLA 4JC1A 1LHVA 3LCPA 4K21A 2AREA 4XTPA 3RQ0A 1RINA 1DYKA 3SH3A 2YMZA 1MS0A 3VKFC 3AP7A 4YW2A 3WV6A 1W6PA 1AF9A 2D44A 1FAYA 2ENRA 3FFZA 1LOFA 3VKNA 3AJZA 1VAVA 1HLCA 5IK4A 3RRDA 5DZEA 2R0HA 5JOXA 3WDXA 2UU8A 3USUA 5KXBA 3WG3A 1MS4A 1SLCA 3RMXA 1DLLA 1A3KA 1GZWA 1LOEA 1CQ9A 2B7YA 1EPWA 3QCWA 4RA0A 4YW5A 1H9PA 1IS3A 1IS4A 1GZCA 1SLAA 1V6IA 5DUXA 4F83A 3V0AA 1G9DA 4YZ4A 3AXEA 1V6KA 5GJ6A 4LBQD 1WLWA 2WT2A 4XTMA 1FNZA 2C9AA 4ITCA 1PZ9A 4Q27A 3WHTA 2DWRA 5EXOA 2WLQA 2ZBJA 3A0KA 1DYPA 2EXJA 1VIWB 1IKQA 3OBRA 4XJ8A 4YGEA 4Q8KA 1AXKA 1WD4A 4XJAA 2Z42A 2D6MA 3ILNA 3MW2A 2GNDA 4Y22B 5H9SA 4FPLA 1LULA 3WDWA 2DVAA 2P37A 2P3KA 1SCRA 3KM5A 2ES3A 3AZVA 3LSEA 4GA9A 1LODA 1UN1A 1N47A 4FPCA 1HKDA 1WD3A 2ZHKA 4ISRA 4M3CB 4XHXA 1AXYA 4BMEA 4FVVA 1UAIA 1MS1A 3PVEA 5JOZA 2EXIA 4K1YA 3BODA 4YGBA 3ZVXA 4U2AA 3R4SA 3JU9A 1UMZA 4Q1RA 1QOTA 4Q26A 1W0OA 3PJQA 1IS6A 1BZWA 1S1AA 1X50A 1QMJA 2YXSA 3POWA 1O4YA 1GLHA 1PZ7A 1DQ0A 2W68A 1LCLA 3PVOA 2PHRA 1MVQA 1DIWA 1W6NA 1MR5A 4WVWA 2W52A 1GYKA 4BLJA 3B9CA 4UW4A 3JUUA 1PZ8A 4WZFA 3WNXA 4LBJA 5CAZA 1AVBA 2VW1A 1ULFA 5T5LA 3VKLA 5LK5A 1C1LA 3OGGA 4FPYA 2A7AA 2YV8A 5GZCA 1AZDA 2G4IA 3O5SA 2BQPA 2EXKA 3WOGA 3R05A 3QLQA 5AVAA 3ZYRA 2VXRA 4CTEA 4GKYA 3AZZA 2E7QA 2R1BA 3AYAA 4AVTA 5T5OA 2I2SA 4YM1A 2D6LX 1LOBA 3N7LA 2ZA9A 4LBMA 1JOJA 1CN1A 2JE7A 2P3IA 3AZYA 3GNEA 2ZGNA 1G9FA 1WUVA 2CTVA 3OYWB 3IPVB 1FNYA 1QNWA 2UWBA 2VY0A 1AX1A 4XJWA 4XMAA 1CR7A 3IMNA 1D0HA 3APBA 3SLIA 3WDYA 5KXEA 2GN3A 2ZGKA 2DVDA 4FQZA 1CJPA 2EALA 4HANA 5GALA 2DTYA 3FUOA 2R1DA 1C4RA 1LHNA 1SLTA 3MEPA 5DUUA 2AUYA 2P3JA 4Q8LA 5IK5A 2A71A 2HYKA 2A6YA 4ZKTB 3FUQA 4JRAA 4ISQA 5HCFA 3N7JA 2R16A 3AX4A 1WW6A 3B01A 3VKMA 4BQ1A 1N1YA 3I4IA 3HMYA 2ZGLA 1JN2P 1SBFA 2DUOA 1LHOA 2E51A 4U36A 3ZSLA 4DQAA 1W6MA 1N1SA 4FOQA 2A70A 5H9PA 1S0FA 1S0IA 5IUQA 5DG1A 3USUB 1MS3A 2CNAA 2UURA 5CB7A 2ZZJA 2ZGSA 3IN9A 4UW5A 1LGBA 2XG3A 3O12A 2VW0A 4XBNA 4YG0A 2WQZC 1LGCA 3RSJA 3WG2A 3W58A 4SLIA 2GMPA 1MZ6A 1JYCA 1LEMA 1W6OB 1GV9A 1S0EA 1WW7A 2UWAA 1S0BA 4XXAA 5JLVA 2DUPA 3AP5A 1A78A 1BXHA 3T1MA 1DQ6A 1WW5A 2PHWA 3MW3A 4M01A 1Y7BA 1ZA4A 1Z78A 4GWMA 4WVVA 5E8AA 1YYNA 3ZSKA 1SLLA 2OUJA 1AJOA 2DU1A 1KJLA
chains in the Genus database with same CATH superfamily
4XHBA 5JZGC 4NOTA 2D3PA 3WZ1A 1XNBA 4NN0A 4QXCA 3J7MA 4OI1A 4BA6A 3I8TA 4MX3A 1W8HA 4QPIB 3A23A 1U5IA 3AMMA 5J96B 4FTBA 3C2UA 2XQXA 1ZRCA 3H0OA 3JXSA 5FPLA 3OPTA 3IKWA 3WQBA 4NRPA 3VD5A 4CU7A 2PELA 3QOPA 2XKPA 4PI0A 5FCCA 5A7OA 4E9KA 4YM0A 4CPBD 4AE2A 1WCQA 1TMF1 1CAWA 1QDCA 2BWCA 3OJBA 5FLHA 2MHFA 1BEV3 2VOKA 1UF2C 2JDZA 4YVWB 5L9BA 5HPOA 1QNYA 3WW1A 2D6KA 1JYVA 3ES1A 3NKTA 3CZJA 1RJ8A 3VZLA 4YZ3A 3KQ4B 3MHZA 3SISA 4YZ1A 3UKNA 2OUHA 3ILRA 1SBDA 3T3YA 5I0UA 4CCNA 1KS5A 3ZSMA 2NMOA 5GZEA 4YG6A 2Y6LA 2ZGOA 1H2NA 1DGLA 2ZTNA 4DXSA 1SLIA 5IVCA 2VBDA 3QH6A 3N9QA 3QACA 4LO8A 3WEZA 3AK0A 2VMGA 3FJSA 2TEPA 1N1TA 5A6XA 1S0CA 5FY7A 4CRQA 4CDQC 1G9AA 3C7EA 4JHZA 3WVJA 5J36A 1RXFA 2QVSB 3AP9A 4RR3C 3BI3A 2R062 2WYFA 1K5MA 1QJX1 5GLTA 2ZX4A 4ZZ5A 1QJY1 3NV4A 3H8OA 1DG6A 1SDWA 1UQXA 1FMD2 2NM1A 3AL6A 5DZFA 3VZMA 4BLIA 1F4HA 3E5XA 4MO3M 5L73A 1JHNA 3E6DA 5FREA 3SXWA 3TAYA 1K42A 2JJ6A 1YJLA 3C3VA 4RGGA 5CZKA 1UO9A 1F4AA 3GHMA 5FBJA 4Y4YA 1JXNA 3IAQA 3O0XA 4GB31 3SITA 5CIRA 1GOGA 2ZX2A 4D6SA 1R64A 4D6QA 2ATFA 4GJYA 3ZIWA 1VP6A 4FQ4A 1SCSA 1CD3G 3LPGA 1CZTA 3GJAA 1W8WA 2G19A 2DCKA 2YG0A 3L2YA 2WIIB 1QKQA 2WYSA 1AYN3 4XUNA 2C0ZA 1RUOA 1UX7A 1ZM1A 4QKBA 3OBZA 3ZFEA 4JGZC 4P9WA 3PTYA 3WUDA 3AJYA 3H8UA 4B7EA 5DDJ1 1PGW2 4XJZA 3RJ2X 5AFBA 1C8M2 4GALA 2BEOA 5FJKA 4XE9A 1OLMA 1UKGA 3MGUA 5E89A 4YWAA 4NE9A 4F8AA 4MGKE 3VDCA 2YFZA 1B09A 1FOD2 4O9GA 1ASJ1 1XBFA 1T2XA 2TBVA 1JW6A 3VZJA 2J1RA 1FPN3 1WZXA 2DVBA 1H6XA 1SFNA 3ETPA 2UY8A 4IETA 5LWBA 5JSPA 3KWVA 5A7SA 4XZUG 3ZMNA 1R082 3MZHA 3OBTA 3CNAA 2WFPA 2W47A 1V9U1 4AQTA 4CDUC 1X36A 3IBMA 1S0JA 5FZ9A 4BHPA 1W9YA 3VZKA 1UZ0A 1HRV3 2QDRA 4CUCA 4XF9A 2IXHA 1ACCA 2Q4SA 2PTMA 2EIBA 2DF7A 2JG8C 3BYWA 1HB1A 4UFKA 4AFMA 5FRAA 3RZZA 2QQKA 2R072 5B2GB 4L9BA 1M06G 2TUNA 2JX9A 2LALA 4B29A 1DYOA 2VOVA 4MLOA 5FY8A 2R042 2YFUA 4KNCA 2ZGMA 2HWF2 3A0NA 1PO23 2XDVA 1G6NA 2DURA 3D4KA 3LSDA 2YC4A 1ZZ8A 3NVCA 1XE7A 1AR82 4GAZA 3J9SA 3BB6A 4PDWA 4Y1VA 3IPVA 5KHHA 1QEXA 4IW3A 4DUVA 3TRSB 1JZ2A 4P9YA 2XQRA 5J3UA 4GH4A 3ENRA 2FMYA 1QOOA 4B4RA 1LOGA 5FO7B 2WS93 4XUOA 5K0UB 2F4PA 2JG9B 2LM3A 4CP9A 5F3IA 5FJHA 1ULGA 3FBMA 5JOWA 4GULA 1JZ7A 4YG3A 1VBB3 2J7MA 1V6LA 4LUKA 3GBFA 3ZXKA 3FE5A 4QHOA 3I3EA 4MHRA 5FR3A 2VTFA 4R4ZA 5JUVA 3FBYA 1DF0A 1V70A 3ZXFA 1JODA 3GDBA 1H9WA 3OGRA 3AVRA 4Z1VA 3RPQA 1AR93 2VOWA 1F2NA 2WO2A 3FC0A 2F6BA 4QPGC 3VBSA 4BQ5A 4FXGB 4Y1ZA 3BTZA 1OVSA 5J37A 1GQHA 4YARA 4IE7A 2LS6A 1OF4A 2NLRA 3I97A 5JXJA 4LO4B 1F9KA 3ATGA 4XJ9A 3VL8A 4P08A 2D6OX 2XBO2 3CKHA 3ZOIA 1QU0A 1W2TA 3AMHA 1V0AA 3SMHA 2BJSA 5JXIA 1VRH2 4BQ2A 3U78A 1UOFA 4Y3OA 3TNQA 3A7QA 3WF3A 1AR73 1TZOA 3U1XA 2YDEA 2R061 3IAPA 5JMCA 3CDZB 3MIBA 4W6WA 4EZ4A 3MLLA 1ZVFA 4JQTA 2YUEA 1FMD1 1QWRA 2LTNA 3ITQA 1TME2 5C5UA 4Q4W2 2PHUA 4TZDA 3LEGA 1NCRA 5T50A 4G9SB 2HJIA 2WNEA 3RZMA 1AXZA 2PHTA 1NXD1 2D6PA 2ZHMA 3NQHA 2RHPA 4R8HA 5F5AA 1U0AA 2MPFA 2HLEA 3Q8AA 1UU6A 3RWKX 4YZ2A 2D98A 5E1RA 5C71A 5EWSA 1KITA 1I9RA 3BTYA 2V4AA 2XWJB 3W20A 1OD5A 5D8AA 3RNSA 4TWTA 4NJ4A 3I2JA 4L8QA 1C8NA 3HAGA 1Z7S3 3CO2A 4RN5A 3LPFA 4XF3A 4YW7A 4OZXA 3U14A 1QJU2 2CDOA 4KGQA 5J09A 2A1XA 3WF1A 4P9XA 5LATA 4YZ5A 1PGW1 1VMFA 4XBQA 5FLIA 2ZMLA 1C8M1 2NYYA 5GZFA 2ZABA 3PMEA 3MV11 3RVHA 2R6QA 4C8DA 2VNRA 2JE9A 2QQIA 4AQ6A 2BP6A 3H3ZA 4TYSA 1AR63 2JECA 4FXKB 2VBPA 4CXXA 4K9SA 4HK8A 3I2KA 1TE1B 2JB8A 5F3CA 5K7PA 4QQ2A 1OMIA 4UOJA 3ABZA 2D7FA 5A32B 1LHUA 4AFDA 1SFYA 2KM2A 2O0OA 1GWMA 1OBNA 3N3HA 4I09A 4ARYA 4ZU7A 5IK8A 1MQTC 1NA1B 1R081 1W2UA 1I1EA 3HN1A 4E4DX 1OH4A 2FDJA 4UBGA 2X5IB 5JDBA 3HNMA 4YFWA 4JTNA 3HNYM 4H14A 3H7YA 1ENRA 1QXJA 4CEYC 1PK6C 5KXDA 4I2OA 4HKOA 1IG0A 4LO6B 1I3HA 5A6YA 2ZGUA 4NO4A 2R071 1CIWA 1LU1A 4Q1PA 3GYDA 5FXZA 1AHSA 3BTAA 5HCHA 2ZX1A 3VBFC 5L19A 2R041 1AL23 4RGAA 4XCAA 3WDTA 1NG0A 4XQWA 2GMMA 5FKCA 4FBFA 2HWF1 3OGVA 4MSVA 2DYCA 5FPZA 1AR81 4WM8B 1ONAA 1RUC3 1ND2C 4PQ9A 3LDBA 4F7ZA 4XUTA 5DAVA 4K7JA 3N4MA 2E31A 4RQPC 1EV11 5FO9B 2XLFA 5DZGA 1RITA 3VV1A 1CWPA 3DPRA 2ZGTA 3P3NA 4IE0A 4AWDA 4NMIA 2C5DA 1AYM2 1XNKA 1C5HA 5T54A 3SH4A 3GCXA 1VBC2 1WW4A 4IV3C 4XDPA 3BN6A 1OUXA 1MS5A 2Y0OA 1HDKA 4BCUA 1V6OA 3Q8CA 4QDQA 3LCPA 2HYXA 3HN3A 1M4WA 4HONA 2Q8CA 2PLV3 4HVQA 4V1PA 1UOBA 1YWKA 2NQYA 2ZEXA 1MS0A 3CIHA 5JPMB 2B8MA 3AP7A 3LB9A 3WV6A 4QGMA 2ENRA 2K2SA 3AC0A 3CU7A 3THTA 2BNOA 1LOFA 4RGKA 5FYHA 3VKNA 1K45A 4JVAA 1VAVA 3KT4A 5JPNB 3RZJA 1S4CA 3RRDA 2XWBB 4COUA 1RUG2 3WDXA 3DCQA 5KXBA 3BUCA 2CGPA 4KWLA 4ZU4A 1SLCA 5GKAC 2RMU2 1POV1 4OUSA 4F83A 2XBO1 2QNKA 1RUI2 1V6IA 2WINB 3KCCA 4IE4A 1KFUL 3G7DA 4KGGA 5HXVA 2WZPP 3ZR5A 4BQWA 1NXMA 5F32A 1G9DA 1VRH1 1W9WA 2YC0A 2YU1A 1V6KA 5F39A 3TBDA 3WNKA 4LBQD 2XUMA 1HB2A 1WLWA 1O5UA 1FNZA 2P6HA 2Y34A 3KCYA 4XTMA 4QPYA 5JCTA 5EXOA 4HFSA 2OQ7A 2HWB2 1VIWB 2XJQA 5FUIA 2W46A 2HH9A 3AKTA 2J1TA 2VZVA 1LKNA 5K0UA 2JG9A 2H6BA 3H1MA 3VBHA 5BNPB 1XNTA 5ISLA 3PMSA 4IGQA 2VL4A 1WMFA 2JICA 2P3KA 2ZX0A 4B1LA 2YB7A 1F8VA 4GA9A 1DU3D 1SDDB 1LODA 4XFAA 2HBTA 4Q4W1 4RS5B 5C9AC 1NLRA 4IXLA 2VVFA 4XHXA 1SPPA 2YHJA 1MS1A 3PVEA 4Z07A 5DN2A 3R0RA 4UAPA 4CDQB 5IVBA 4U2AA 1QH7A 1W2AX 1RHI3 3BU7A 4RR3B 1CAXA 4QXBA 1CJDA 2B46X 2PN5A 1R092 4MGQA 4AHWA 4LIUA 1W0OA 3PJQA 1TQ5A 1BZWA 1S1AA 4P9JA 2EIEA 3I2IA 1TVGA 3AL5A 4TN7A 1O4YA 1GLHA 1PZ7A 1W8NA 3NJXA 3PVOA 5BNOB 1MVQA 2XUEA 1YQCA 5LBEA 1GYKA 4UW4A 3FL7A 3J7LA 3D0SA 3N9MA 4WZFA 4IV1C 4LBJA 3KCXA 3POEA 1QJU1 4XAAA 2WBKA 1ULFA 5T5LA 2O8QA 5CEHA 1TG7A 3KV9A 4INDA 4OI2A 5C8WA 1UPIA 4QGLA 3G6JB 4AZZA 5F3GA 2V4VA 3RGBA 5JXGA 2EXKA 4PJYA 1OURA 3QLQA 4QKNA 5AVAA 3MIGA 4DINB 2VXRA 4CTEA 4IEVA 2BGOA 3E6BA 2E7QA 4OHYA 1IGOA 2LUWA 1PMHX 3W5MA 2OT7A 3JQWA 3NNLA 2D6LX 1LOBA 2VG9A 1PVC3 5JSRA 5IVFA 1ZZ6A 3ES4A 3DYPA 3SQOA 2ZGNA 3OBAA 4BDVB 2KA3A 2BBVA 1VE0A 2HWE3 1RB8G 2CTVA 2WNVC 1W0NA 4OMDA 1FNYA 1J3PA 1GOHA 3H1YA 1CR7A 3IMNA 1BBT3 2VCMA 4LA3A 5A33B 3KF5A 5CYYA 4LKDA 3DPRC 3FUOA 1XU1A 1C4RA 2E9QA 2R1DA 1DGWX 3MEPA 2VPVA 4QGNA 4JTOA 1W05A 1Q5OA 2P3JA 4GMP0 4Q8LA 4BK5A 1HJFA 2A6YA 4MXWB 1NCQC 4AEDC 4PIXA 4RYDA 3FUQA 2O14A 4ISQA 4MVTA 3AFGA 4LHSA 3PUAA 2VC9A 3HMYA 5ABJC 1SBFA 3VZNA 3E1F1 3W21A 2E51A 2WDBA 4CDUB 3LQCA 3I3MA 1EUUA 1NOVA 1VAKA 5LEKA 3DL3A 1VBD3 1VR3A 1COV3 3T09A 2JG8B 4I02A 1AYM1 3THPA 1S0FA 4LT5A 1VBC1 1VBE2 3USUB 2WFF2 4ZU5A 2VOXA 4PT6A 4XUQA 1W9TA 2HWC1 3LKJA 3CEWA 3H3LA 3U0ZA 3RSJA 1Y43B 3EBRA 5A32A 3KV6A 4CDWC 1PO12 5BV6A 1GV9A 3V0AB 1S0BA 2AC1A 5F37A 4QX1A 4LULA 4QQHA 1WW5A 2PHWA 3T4HB 2UYBA 4ORFA 1Y7BA 4WVVA 1SLLA 2OUJA 1RUE3 2DU1A 1JYTA 1KJLA 4YLZA 5C70A 5FK7A 4Q4Y2 4AGVA 3F2ZA 2K0GA 1RUG1 1A8MA 2D6NA 4OMCA 4M00A 2QQWA 4DIQA 3OD0A 2RS12 2Y6HA 4PBPA 2QQOA 1RUI1 1PMIA 1DGRN 5ERLA 4NRQA 3WLUA 1ENXA 5I0RA 4NHXA 5FTTC 5FXVA 1TMF2 5F7UA 5FOBB 3MI8A 5EIYB 2HWB1 4K1ZA 3ZFGC 3FHIB 3I3DA 5J98B 3NJYA 1YFYA 4QPGB 3WNOA 4A41A 2AENA 4AEKA 2FZ2A 3OPWA 1XNDA 1YNAA 3ACIA 4JKMA 4RFT0 5F3EA 1JTZX 1JYIA 4OHVA 5HV4A 1H6YA 2QFEA 2GAUA 4KQ7A 1UZWA 1CPMA 2FDIA 1KEXA 2ZAHA 4L97A 5F5CA 4XXPA 1I5PA 4WM7C 5EP9A 2BNNA 4XABA 5K8SA 5C4WA 4LBNA 3WP4A 5FIXA 2X05A 3MBWA 1C1FA 2TNFA 3LDRA 3OPZA 1Y9MA 5IT6A 4OYUA 1QXPA 3VBUC 1R091 3ZXEA 3RDIA 3SNMA 3K3OA 3PU8A 1O3QA 1IKPA 2ZEWA 1OC1A 1Y4WA 3O0WA 1JH5A 5HV0A 2HBUA 4OQ9A 3WQ1A 1P8JA 5BNNC 4BQ4A 2VMDA 2MEV2 2CSGA 2VZTA 5FP9A 4C1WA 5LY2A 1W2OA 2JDMA 3TEZA 3M3IA 5FZ6A 2AYHA 2WNUA 1IHMA 3S7EA 3WG1A 1UIKA 3BOPA 3MV01 3PUSA 1X8MA 5J1XA 2ADDA 3LIGA 1XE0A 4DUWA 2DU0A 2HEYF 5LBFA 1Q8VA 4J25A 1G9BA 5CFDA 1Q8QA 2GC1A 5GLUA 5FYVA 3SEPA 5ACA3 3T1LA 4W50A 3ZPOA 2FD8A 5BNPA 2HWD2 5DUVA 1PNFA 2R32A 3V64A 3UNPA 4CUBA 4YGCA 4DY5A 4Z2WA 4JGYA 4RL7A 3R6SA 4EYUA 2CAUA 2VUCA 4NR1A 1LRHA 5HCBA 4LE3A 4XFGA 4QM9A 3WD5A 1CAVB 4R9CA 4LNVA 1BJQA 3FHAA 4G3YC 4WZCA 3K2OA 2D3SA 1UY2A 2GN7A 1NX9A 1ZBE3 3WX5A 2WL1A 1X9PA 4EN9B 1JZ6A 1W6MB 2FMDA 2VQ0A 4LQRA 3VBRA 1KJRA 1RXGA 1NY72 2WWSA 2IC1A 4P00B 4QAWA 3VUOA 1W9SA 1GUIA 3H1WA 3TN92 5L7OC 2VULA 1YC61 5LA1A 1WCUA 1FT9A 1D4M3 3J8F3 2ZGQA 1O3TA 1MQTB 3PHMA 3UV9A 1DHKB 1STMA 4NHYA 4C90A 3HWJA 4N43A 4YW4A 4XDQA 2VUAA 3VDBA 3FFQA 2E7TA 1OSGA 3ZDVA 5CFCC 3OSDA 1UZVA 2GU9A 4META 1LESA 3NAPB 3FLPA 3AP4A 1O91A 1VBE1 2GNTA 2WFF1 1BEV2 1JOPA 1JYWA 1PGL2 3IDBB 3EMRA 1DFQA 2EAKA 3ECQA 4EWDA 2ADEA 1DQ4A 3N7KA 5FFOC 3VBFB 4AQ2A 1BVVA 1PO11 2DCYA 4CP2A 4KBZA 4XW3A 2G9GA 2RVAA 4UW6A 1J59A 1ND2B 2P5BA 1DZTA 3KV4A 5FP7A 5H9RA 3OGJA 2J1VA 3LOIA 2GP5A 3PTRB 3MIEA 5A33A 3RWNA 4TLFA 3WUCA 2PHDA 1ULDA 4XIKA 4BE3A 1JZ8A 1OOPA 1WCDJ 3ZFFC 4Q4Y1 2YU2A 4HVRA 1LEDA 4IV3B 5CNAA 4NIDA 3AKSA 4HETA 4N9HA 1SBEA 4MXWA 1W39A 3IDEA 4GMP1 1S2BA 3RJRA 4I3PA 2RS11 4MV2A 4E8CA 3UGFA 5C3OA 1KD7A 4CUGA 2P17A 2QTWB 4BOWA 3M2MA 3ZX7A 5FO8B 1UZZA 1NQDA 4UFJA 1H2LA 5F5QA 4NPRA 1Q56A 4ASMB 4A7ZA 3FX3A 5DXDA 4L99A 1HX6A 2JDHA 4PIZA 3TYJA 1WBFA 5LBCA 4OQ8A 2WZR3 3KB5A 1BK0A 3OY8A 3VBOA 1ZBA3 2OX0A 2W95A 4FP3A 3V0BB 4AVAA 5FY5A 4BXSV 3B94A 5DMYA 4YFZA 3D6EA 2Q5TA 5FP4A 4Z82A 1LTEA 1W6NB 3DXTA 4Z8BA 3URFA 1SEFA 2RDQA 4LBQB 3DF0A 4PI2A 5BXXA 1I6XA 1GMMA 1AYN2 3H42B 3NJVA 3LF7A 4DS0A 4AR2A 2P4EA 4C91A 5T52A 4UF0B 4GWNA 2WA4A 1V00A 2ZS6B 3PNAA 1WKYA 4LHKA 5A3MA 4K3UA 1W6QB 4XFFA 1S0GA 1BMV1 5KHGA 1GSLA 2PFWA 3N7MA 4Y20B 5FP3A 1NLSA 3BGAA 2MEV1 3FWEA 3PURA 4JGYC 3KS7A 5C9AB 3LFMA 4MGSA 3AYEA 1JU4A 4DRVA 1F15A 3B02A 3R4DB 3ZMOA 3TNPB 3HR9A 4I0AA 5C8CA 1WLTA 3HQUA 1FPN2 4AGGA 3POBA 1GBGA 4PF5A 3ZSJA 1HN1A 2OA2A 5FZBA 3ZYFA 2EICA 3LA7A 2OXBA 4FI9A 4Y1UA 3VN4A 1V6NA 2H6CA 2HWD1 1HRV2 1WCKA 1IPKA 3PDQA 3CQOA 1MVEA 4CEWA 4DXTA 1C28A 2R7EB 1REFA 4IV1B 1LJ7A 3UT0A 4Y24A 3HQXA 4EN8B 2I74A 5KHKA 3TEWA 5FMOS 5IFTA 2VZOA 4ASKA 5KXCA 3ZXAC 4AHXA 3JBG3 1XYNA 1LECA 5LA9A 3JB8A 1BCXA 3T2PA 4M3CF 4V2WA 3EO6A 2VW2A 2Y6JA 5F6KA 2ARXA 4ET7A 4N53A 4FFFA 4FTEA 3ZXDA 3GZUC 3NV1A 4DMIA 1CAUB 1IPJA 1NY71 4IEUA 5EFUA 5DAQA 3GXUA 5EJZB 4EN0A 4NAMA 1RUJ1 3TN91 4AOCA 1K3IA 1OPMA 1B35C 5EJ3A 1LOAA 5FYMA 1NAEA 3ZYJB 1ND3B 2WS92 1VB4A 2WO3A 1NZIA 1G86A 3PVNA 3GALA 2XJSA 2R49A 1VRBA 2IXJA 1S2KA 3OB8A 3KQRA 3WW3A 4X6QB 2V73A 1ZRRA 3WNMA 1DZRA 1VBB2 3AKQA 3S6PA 1KGYA 1OKOA 1RUF3 1E5SA 1MEC3 2VCAA 3B00A 3H7JA 4GKXA 1QJEA 2WQ8A 5FMDA 5FXWA 5A7WA 3WF2A 5A3PA 3MPBA 2XLGA 4UFLA 4GJZA 4FTSA 1UL9A 4NROA 4A4AA 2D5HA 2EIGA 2IVIB 3IDAA 1BEV1 3NO8A 1PGL1 1AR92 2C9KA 1GZTA 2D43A 2OZ6A 3NNJA 1BKZA 2WJSA 1I5ZA 3ELNA 4NPLA 4AEJA 2VOTA 2J22A 1C3HA 2D93A 3VDAA 4NRMA 2BNMA 5CA6A 1FV3A 3N35A 5DPNA 5ABJB 3H3UA 2V09A 2FQPA 1XB9A 4FPGA 1EV12 2DUQA 3LA3A 4QU2A 4GXLA 5F8PA 1GR3A 4YW1A 1F5FA 5JAXA 1PX3A 4Q0VA 1QOSA 2QQNA 1UY3A 4DFSA 1VAMA 1AR72 2WWUA 1BYHA 2E6VA 3POJA 3ZYPA 2PQQA 4NWVA 2BOJA 4JC1A 2ET1A 1L3JA 4XTPA 4CDWB 4YSFA 1RINA 3Q8BA 4NIHA 3SH3A 1XSQA 2XGXA 4YW2A 3VL9A 2B5HA 2WO7A 1FAYA 3SC7X 4XEZA 2YBSA 4XC9A 1IQDC 4XQ4A 3PU3A 1U5XA 1FOD3 2B4KA 2ORZA 3NAPA 3WP3A 1K5MC 5DZEA 4ES9A 5IATA 3S0MA 2QE3A 2XVKA 5JOXA 5FKBA 4J1XA 2ZZQA 4AFBA 3WG3A 5ANQA 4E4HA 2RDNA 4IEPA 2BUKA 1CQ9A 4YVSB 2B7YA 1EPWA 4WVMA 2Y26A 3WXPA 5HBAA 1RUD3 1WWYA 4YZ4A 1H8TA 1AYN1 3AXEA 2VGDA 2Z5WA 3MF6A 1H0BA 2K9ZA 1Z7S2 4Q27A 1SQ4A 1UY4A 2DWRA 3FN9A 4UXAA 3UKTA 4AI3A 4D3WA 3MUZ1 2EXJA 4YGEA 1IKQA 1OD3A 3OBRA 3ZFGB 1AXKA 1WD4A 3I54A 1OUSA 3CJXA 3E97A 4FPLA 4BU2A 4BZ4A 5D2AA 3WDWA 3P1IA 2P37A 2CGNA 2BFUS 2XHKA 4JRLA 4QPIA 4QXHA 4OUMA 4XACA 4COZA 3ZDSA 4GD4A 4S2GA 3NJZA 2ZXQA 3MLJA 4AAXA 2QQVA 2WWJA 4WM7B 3ZFEC 1N47A 4FPCA 1HKDA 4ISRA 2VZPA 4FAGA 5JMOA 4IUGA 4WBBA 1YHFA 4CDXB 1FPN1 2RR13 2LW8A 4LHNA 5EPAA 3UETA 3BODA 2PXJA 3JU9A 4HN1A 4YVWA 4Q1RA 1NT0A 1WA4A 4OHWA 3F95A 5C6CA 3W5NA 4IEZA 4AK3A 1IS6A 5FLJA 1HRV1 2W2IA 3POWA 5FXXA 2N7GA 2VCCA 2OZJA 1UMHA 4DXRA 5BNNB 2W92A 2AZ5A 1OF3A 2BW8A 2W68A 3J7HA 4H2AA 4WVWA 1W6NA 2VQUA 2O1QA 2ZCWA 1O7FA 2W52A 3K4AA 3JUUA 2RM23 2VW1A 3KD4A 4X6RB 4DXZA 1VBA3 1PNGA 1C1LA 3IIIA 1AL22 2ZPXA 3OGGA 4FT8A 1HN0A 3HNBM 4IEWA 5FZGA 1PO21 3EQEA 5GZCA 4AI9A 4UF0A 5LASA 1RUC2 2A73B 3WOGA 4CUAA 2ZKLA 3WF0A 1QY4A 4QU1A 1PM7A 4P5YA 4QDRA 5FAXA 3CJIB 4AG4A 5T3NA 4YM1A 5C7GA 2VO5A 2HEVF 1HB3A 1ZZ9A 2WS91 2ZA9A 1JOJA 3AVSA 4S2HA 2P3IA 3AZYA 1K12A 3KV5A 3RYKA 1G9FA 4Q0SA 4PDWC 3ZSEA 4DO0A 1RUH3 2J1UA 2XJUA 3OYWB 1VBB1 4GMP3 5A70A 4XJWA 3T0AA 1J1LA 5FZ8A 2PLV2 3I2FA 1D0HA 3APBA 5DAXA 2DVDA 4FQZA 1RVF3 4GH4C 1H1IA 5A3NA 2DTYA 4WVZA 1PIV3 1TME3 4E8DA 5I0SA 5KHJA 3CMGA 2VVDA 2A71A 1GQGA 1AR91 1BVP1 1JOBA 3CL1A 5C3RA 5IVEA 1O8PA 3JD73 4ZKTB 5J7MA 1L7RA 3FZ3A 3D82A 2RS53 4JRAA 3N7JA 3JCIA 5DAPA 1L7QA 2R16A 3TEYA 2F4LA 5D1IA 4ZS2A 3ZLIA 3CLPA 2X09A 1LHOA 1KXGA 4SBVA 4EN7B 5JWPA 5CFCB 3M7AA 4BQYA 5FUPA 2JDPA 2YC2A 1N1SA 4FOQA 2IXIA 2IXKA 2Y6FA 2A70A 3VBSC 1QQP3 5IUQA 5A6QA 2UURA 2ZZJA 1AR71 2ZGSA 4GWIA 4UW5A 4YG0A 1NZCA 2HWC2 4JDOA 4BQXA 4CCJA 4OI0A 4RHV3 1ND3A 1E5IA 1FI2A 5FZ0A 3W58A 4C0HA 1J84A 4XXAA 1JYCA 3KT1A 3GZEA 3HBZA 2DUPA 3AP5A 4HN0A 2X10A 1DQ6A 4G4FA 3VDDB 3RZGA 3MW3A 4FFHA 2RV9A 3T0BA 4E27A 1OQEA 4CYDA 1PGSA 3ZFFB 5JZGB 2BGPA 1W04A 3SCFA 5A3LA 4Q4X3 2W39A 5LA2A 5FMOL 1RHI2 5EYYA 5FYIA 3C7GA 2R0FA 4CCOA 2W9XA 4CU6A 1A8DA 2CY6A 5GLWA 2F17A 3E5QA 1LU2A 1S0DA 4J1WA 4LHLA 4M0NA 4CCDA 2JD9A 3FLRA 3PIGA 2ZEYA 4O7XA 4YNIA 1PX4A 2PAMA 1MZFA 1NCRC 4A3ZA 3UJQA 4XMIA 3A21A 4XUPA 3WDUA 3KHCA 1T6BX 2QBXA 1US3A 4QQOA 5LCWL 1Z7S1 3BTXA 3WCRA 4AI1A 3MPPG 4HL0A 4XAEA 5GLVA 4K8FA 3MIFA 2QKDA 4O65A 4W6YA 3RS6A 2JD4A 4S2FA 3IWZA 4XFCA 5FUNA 4COYA 2YPDA 2IFRA 2ZAAA 2ZKNA 1O4TA 5D8AC 2RJ2A 4FSJA 3AMNA 3INAA 3MDPA 2VAUA 1AR61 1GNZA 1YFWA 1FATA 2Q1ZB 4E4SA 3B3QE 3I2DA 5CVRA 2ARBA 2R30A 3ZXGA 4V2VA 1CPNA 2VNGA 2RDSA 2WUHA 3B93A 4H55A 5LBBA 1JBCA 3VKOA 4URAA 3DECA 1SFPA 2IWGB 4PQQA 3AMPA 3AMQA 1EYBA 1NUKA 2P1BA 1EAH3 3MLKA 5BYNA 1BBT2 2P2KA 3VZOA 3WG4A 1DDLA 4LE4A 3ZKYA 3D8CA 1D2SA 4YW3A 4YVSA 1DQ2A 2VM9A 1UMIA 1LOCA 4LTAA 2UY9A 1F31A 1UNBA 3VD3A 2Q0AA 4EWEA 5JI9A 2VMCA 4JQRA 4LITA 4BK4A 1RJ7A 1AL21 2Q30A 3J7NA 1HRI3 4HLTA 1UX6A 3I3BA 3OG2A 4BJ0A 3LE0A 4K40A 4CXYA 1RUC1 4MH0E 4BM8A 1O4ZA 1YXWA 4Y33A 4C0BA 3GGLA 2EAAA 1NE6A 2RMU3 4AXOA 2A6ZA 4OLLA 2W0XA 3IM0A 1VBD2 4D7YA 1COV2 1AX0A 3EYPA 1W2NA 4XYXA 2PHFA 4AHYA 3KVBA 2GALA 2NP0A 4JGZB 1GICA 3SCGA 4XCBA 2BYVE 2A3WA 3FLTA 1JYXA 5FYTA 2B39A 2SLIA 3K51A 2GNMA 4CDXA 1UKRA 4FPFA 4CU8A 2FDGA 3M70A 2PLV1 5F2WA 1HW5A 1NLQA 5FZ4A 2NMNA 5KC5A 3POSA 3DYMA 4FP2A 3UESA 3NNGA 5T55A 1QF3A 2XJVA 4C1XA 4AFAA 1Q8PA 2ZHLA 3BVCA 1RUE2 4BXFA 1B35B 1Q8OA 3AB0A 2KR2A 1OLQA 3GZTB 2V72A 4K20A 3U37A 1FYUA 2QDNA 3VD7A 1GQPA 5A3TA 3GBGA 1R1A3 1O6UA 1CESA 1YI9A 3A4UA 2CGOA 4HXCA 4QHBA 1ZRIA 2WABA 4RSUA 3TB0A 3VHOA 2A6WA 3ZN5A 3RZKA 2IFWA 2ZACA 4N8MA 1LOFC 3H50A 1OLME 4ATFA 2CL2A 4ZY9A 2VMEA 1NE4A 1SG3A 4JKLA 5H9QA 3ZPYA 3SH5A 3CJIA 3BKZA 2LROA 3CBNA 1TNRA 2ARAA 1BLZA 1X33A 5AC93 1RUNA 2BWAA 4M4RA 4ARXA 4LBKA 3ETQA 4FO9A 3LDKA 4Y1XA 3VB9A 4OULA 1ZRDA 4IEQA 5B4XA 1NA1A 1SZBA 5I8SA 4AQSA 1QXRA 3OYWA 3KVAA 5FZ1A 4YYOA 1XOYA 2X5IA 1CAWB 2ZGPA 1CX4A 1RMU3 4QX3A 2VZQA 4Y4RA 3WHUA 4D69A 1EPZA 2GSYA 3J26N 2WN3A 3LEKA 3V56A 5FZ7A 5K0UC 1ZREA 4LOSA 2JG9C 4CCCA 3N36A 3VBHC 1RHI1 2XKOA 3UL2A 3ASIA 1A34A 4AEMA 3PUIA 3ZN6B 1YQ6A 4Y5SA 4A45A 2JIJA 3A22A 1S2EA 3WNPA 4IGOA 4XF0A 5FDBA 3X29B 3WCSA 4WM8A 1HXS3 2ZOEB 3B69A 1O8SA 2CWSA 3ZO0B 2Y6KA 4XBLA 3DGTA 3T0DA 1DQ5A 1LHWA 2SBAA 2VQAA 4MUVA 5L9RA 1K5MB 1QHDA 2JIGA 4LO5B 5E88A 5CU1A 1F35A 2XB6C 5ACA2 1KS4A 1Q43A 2D97A 2CHHA 3KF3A 4KI5M 3PIJA 4QQPA 4BIOA 3WY6A 3H8XA 2XOMA 3VDDA 4UFMA 4YW6A 1OXCA 1UW8A 4K6BA 1PVC1 5FWJA 3KZ4C 5FYUA 2VMIA 1US2A 4PBOA 3UGHA 5FPXA 2D5FA 2HWE1 5JZGA 4Q4V3 4K8RB 2QCSB 1OA2A 1ZBE2 4KMQA 4TLGA 1BBT1 1EY2A 2C1FA 3DKWA 4Q0QA 5L36A 5CG9A 1BMV2 2WZEA 3RZHA 3K75B 1HJGA 4IE6A 2EVXA 2RS33 2Y60A 4LPLA 2QUOA 3ZFEB 4AYUA 4CPBA 1OLRA 1OVPA 4JDNA 4UT5A 5IW0A 1D4M2 1LNSA 3J8F2 4IESA 2BPA2 2VZUA 5BUVA 1RL3A 4CU9A 2BZDA 5FYBA 4RD7A 4W4ZA 4QX0A 3BIEA 5JVVA 3UK9A 4EQVA 4YM3A 3AZWA 5J48A 3M4FA 1VBD1 1COV1 3WW2A 4NWWA 3RI8A 1YIFA 4Y26A 4RS5A 5FMBA 2BVVA 2OVUA 2C4XA 1UZYA 4CCLA 5AC91 2GZWA 1YCIA 1VB2A 3WNNA 5JI7A 2A6VA 4CDQA 5DQ0A 4ZHNA 4RR3A 1APNA 4JHTA 1UPSA 3K4DA 4XOGA 2PMWB 1ZRFA 5K9YA 1REDA 1SHWB 3IDCB 3J4UH 2ZMNA 3O1RA 1GKBA 2OPKA 3WR0A 1Z0HA 5HCAA 1RUJ2 2GH2A 1RUE1 4DY3A 3ZN4A 3M3OA 5BNOA 1J83A 2VU9A 4AVBA 4MOAA 5CBLA 1LGNA 2BDRA 5I0TA 5LZ6A 3NKGA 3P6BA 4M3CE 4UWDA 2PYTA 3GZAA 3OUHA 4PDWB 1WCSA 1CGPA 4GIQA 1QJX3 1W99A 4FOVA 4ZXKA 2VZSA 2O8OA 1IS5A 1WMDA 1QJY3 3BPZA 2GNBA 2WSVA 1CIYA 4AVVA 4DEVA 4GH4B 4CEYB 1PK6B 1TEIA 5FZLA 5BNQA 2VE1A 3ZYBA 4A6SA 2UWCA 2CV6A 2DBIA 2OS2A 5JIUA 1UYXA 2G9FA 4Z92B 1PHMA 4CSWA 1GOFA 1H30A 3JQXA 1FV2A 3GJBA 4P5HA 2WZR2 1ZBA2 4GB33 5IHRA 4IQPA 4JGZA 2MNGA 1WBLA 1RIRA 3R4UA 5GZGA 1YRZA 5C33A 3KT7A 4HSLA 3PL0A 2OIIA 4FPJA 4KL1A 4XZPA 3RFRA 3K46A 4IEYA 3ZYGA 2FHRA 2JXAA 2AACA 3VD9A 4RQPB 3AM2A 1DCSA 1XE8A 4H7LA 1J58A 3HPNA 5APAA 4LLOA 2QZ2A 1XYPA 3N9PA 1H4HA 1ZYBA 2XHNA 3LA2A 3I49A 3VBSB 3ZXJA 5FK8A 5FZMA 1IPSA 4JZRA 2XPJA 2A3YA 2BGCA 2QQLA 4Z2AA 1O59A 4FPKA 2DTWA 5DDJ3 1QGLA 4K21A 5FZKA 4Q29A 3RQ0A 2QQPA 4KH9A 1DYKA 1Q3EA 4OZOA 5A7QA 2YMZA 2PQSA 3SKJE 3UGGA 1NYWA 4IERA 4BYYA 4NUBA 4QT6A 2NPIA 5BPXA 3I3QA 3ZM8A 4DNYA 4CDUA 1AF9A 2D44A 3MUY1 4EN6B 4BISA 5C4WC 3FFZA 4GZ9A 4AL9A 1ZZBA 4AI0A 1GP6A 2JDKA 3KMHA 3AJZA 1HLCA 2BV4A 3JB4C 4KWKA 1ASJ3 3O1VA 2FBEA 2JG8A 4NAOA 5I8YA 1JUHA 2BBAA 1GP4A 3USUA 3JZVA 2YGMA 2Y8KA 1NKGA 2WO1A 1MS4A 5FYZA 4TXWA 3RMXA 5ACA1 1DLLA 5CKNA 1A3KA 5KBFA 4L11A 1V9U3 1UY0A 3QCWA 4RA0A 1H9PA 1IS3A 1IS4A 5DUXA 4OFGA 4B7KA 4D7TA 3V0AA 2WNUC 1YQ8A 4X8PA 2VZ3A 3WQ0A 1NCRB 2P6CA 3O1OA 3E6CC 5FZDA 3UKVA 2KXLA 3EB7A 1PZ9A 1HIXA 2WRAA 2WLQA 4LK6A 5CFDC 2VTXJ 3A0KA 4JDMA 4XJ8A 4AAPA 2ET7A 2ZEZA 3OEBA 3JBG2 3O1MA 3LOBA 2D6MA 1ZBE1 3ILNA 4Y22B 3WQ7A 5BNPC 1DLCA 2W1UA 1UYPA 4KWJA 4BIFA 4COVA 3C7OA 1GWLA 3ZN6A 5D8AB 4I3GA 2ES3A 3AZVA 3LSEA 4CP1A 4OI4A 3HVDA 4RS5C 5JIAA 4M3CB 2BRTA 1WD3A 2ZHKA 4LJHA 4P02B 1AXYA 3DN7A 3FHQA 4M0HA 5E6HA 1UAIA 1YQ5A 3NRUA 5JOZA 4HK9A 1D4M1 2EXIA 2BERA 2FCVA 3J8F1 4K1YA 4YGBA 5FPAA 3ZVXA 2W1WA 4MXVA 4Q26A 4QPGA 4EROA 3LWCA 1RUF2 3VBRC 1MEC2 1X50A 4KWUA 3T30A 1GU3A 2WAOA 4ZPIA 4I01A 3C7HA 4P9LA 5HXMA 1DQ0A 1FXZA 1LCLA 4BPZA 5BNOC 3Q8FA 4BLJA 1UOJA 3OUIA 4NIGA 3ALQA 1PZ8A 3WNXA 2PHLA 4LLFA 5CAZA 1AVBA 2RE9A 1DP0A 4HG6B 4D7SA 3S30A 2GP3A 4FPYA 4N43C 3BALA 4XETA 2A7AA 2VJXA 1PO22 2YV8A 1ULOA 5TSWA 4NPMA 1AZDA 2G4IA 2RJLA 4FFGA 4QX5A 1H8VA 5LK7B 1ODNA 1ZNPA 5FZIA 3QD6A 5IVYA 1JMUB 4GKYA 3AZZA 4HMZA 3PUQA 3AYAA 2R1BA 4AVTA 4CVUA 1QJZA 4E4ZA 2I2SA 3LIHA 4LA2A 4H7MA 2KD7A 5LRRA 1QIQA 1CZVA 4LBMA 1CN1A 2JE7A 3U75A 2JE8A 3GNEA 4LKSA 1UXZA 4D94A 2E32A 4MGZE 1WUVA 2R063 3NNMA 3U10A 3EJKA 5FPBA 5IVJA 2WNVB 3T08A 4XMAA 5IJRA 5AFEA 5ANNA 1UCXA 2RG4A 2VR4A 5KXEA 2ZGKA 3PJYA 4HANA 2EALA 1OOPC 1FMD3 3DPRB 4QKDA 3T2QA 5IVVA 2DDUA 1LHNA 1SLTA 1U12A 5DUUA 3WF4A 1REEA 3P5BA 2HYKA 2XMLA 3I2HA 1NCQB 1J3QA 1O5LA 1GWKA 4AEDB 3B7MA 2WZR1 4IGPA 5AVPA 5BY5A 1ZBA1 2E33A 2DCJA 2QJVA 1JS9A 3AX4A 3ROUA 3DEMA 3B01A 3VKMA 1PM4A 4LKEA 1CAVA 3I4IA 4QB2A 5EQUA 3MIDA 4U36A 3LEIA 3ZSLA 1UU4A 4KG8A 2JB4A 2FCUA 1RUD2 3OOXA 2Q8DA 1W6MA 5FP8A 3BOWA 5KWRA 5H9PA 2EIDA 4FAHA 3VBOC 3N9NA 5DG1A 1LR5A 1MS3A 1RC6A 3K77A 1OH3A 4IEOA 1C5IA 3O12A 2VW0A 3I59B 4AVCA 3HEIA 4H3WA 3HT1A 1GNYA 1UY1A 1HV0A 4SLIA 1W8ZA 2ARCA 3U11A 1C8M3 1MZ6A 1W6OB 2UWAA 5CB7A 2Y33A 5JLVA 1UU5A 1MQTA 1A78A 2D40A 3IIAA 5FZEA 3T1MA 1WA6X 4BQ3A 1POQA 4PLOA 1JZ4A 1ZA4A 1Z78A 4GWMA 4QX7A 2V5DA 4HBNA 5E8AA 1YYNA 4FCAA 4NHMA 1AJOA 4YPJA 4CEYA 1PK6A 1RGSA 4PHZA 5GM0A 3IB3A 2DCZA 2RR12 4HPKB 4LUMA 5FZFA 5IK7A 1J1TA 2UYAA 2H0VA 3VBHB 4BB3A 3DV8A 1C57A 3AKPA 1XSRA 3WNLA 1OA3A 4R9BA 1R083 2E7AA 2VNVA 3AYDA 1QJFA 4JCKA 5FZ3A 2YYOA 3VBFA 2VZRA 4A42A 2VXJA 2YROA 3RG0A 2Q1FA 1NQJA 4CCKA 2YZ4A 2CYFA 5L9VA 4A7YA 3ORJA 2VNOA 4EJRA 1SPPB 1ENQA 1ND2A 5C8CC 5A7PA 4UFHA 2QQJA 1G7YA 2AH2A 4F3JA 5HI0A 2R073 4RQPA 3U4XA 2JKXA 2RM22 4R9DA 1CAXB 3ACFA 1VBA2 1XRUA 4MHUA 4Y5TA 2A5ZA 3JBG1 5B4NA 2R043 3I2OA 4IV3A 4QM8A 5FY1A 3S7IA 2HWF3 3VD4A 4DRRA 1PVXA 1YQ2A 5FWEA 1KRIA 1MS9A 1AR83 5KR7A 1R1ZA 1X8EA 4XQDA 4CEWC 3VHRA 1AR62 3KLSA 4R52A 1EV13 5FYCA 1ULPA 3L2HA 4QX2A 4B3NA 1G8WA 2XJTA 3Q8EA 1JUIA 3POYA 2WQ4A 4MADA 2Q8EA 3S57A 1BHGA 2L9LA 2X8KA 5JOYA 3EXUA 2IZWA 1RUH2 1JU3A 2OW4A 4N53C 2WZ8A 3VBUB 5IYYA 1X82A 1RUF1 1V6MA 3WSOA 1MEC1 4QB6A 3V0BA 4AF9A 1DQ1A 3UYJA 2DVGA 1OHFA 1XJAA 4NHKA 4BMBA 4OHXA 1D7PM 1RVF2 4M4PA 1OQ1A 4Q2FA 1OA4A 1UXXX 1PIV2 4XVHA 3K4ZA 5FYSA 3TOJA 5C3PA 1OFSA 4LBQA 4XIOA 2Z69A 2C6SA 4QHZA 3JD72 5I91A 5LA0A 2RS52 1SMVA 1GZ9A 1OKQA 3HD8B 4EZHA 3LFIA 3ILFA 4N7UA 1YLLA 3NV2A 4N90A 4KU7A 3T2OA 4KG0A 3NNFA 5A3UA 1YFXA 1IQAA 2A6XA 4Y22A 1POV3 5FY9A 2XBO3 4YRDA 4YM2A 5KHIA 4NVPA 1W6QA 4FPHA 4Y20A 1VRH3 4XJUA 2DVFA 3EHKA 2PHXA 1QQP2 3U07A 3VLBB 3WP6A 5C9AA 1Q8SA 3AP6A 4M3CA 5LEJA 3B5LB 3THDA 5T5PA 2JEMA 1D0GA 4RHV2 1V6JA 1W8FA 3O0VA 5GZDA 2FDHA 3WP5A 3C8XA 3CF6E 2EXHA 1CVNA 5C3QA 1YO8A 3MYXA 4WV8A 3AXDA 2A3XA 2W1SA 1HV1A 2WSUA 4R9AA 1H2MA 4YGDA 4JV4A 2IXLA 3BPSA 3DKQA 5EYXA 2B9UA 1WGPA 2A75A 3SCHA 3O1PA 3UJOA 2W91A 3ON7A 1UYYA 4UFIA 1FX5A 3RMYA 1JZ3A 3OGSA 1HQLA 4Q4W3 1ODMA 4Q5OA 4XF1A 5FMCA 2Q1MA 1FOD1 5A80A 5L7OB 3O1TA 4AW7A 1H1AA 3KGZA 4Q4X2 1JZ5A 4MGIE 1IOAA 4LBOA 4Y1YA 4IV1A 4AHZA 3ZXLA 5F1RA 1UYZA 2BOIA 1EP0A 1UOGA 4MYEA 3WDVA 2JDUA 3ACGA 5FBZA 5A1AA 1W6PB 1ZX5A 4FOYA 4A2UA 3MO4A 3S5AA 4ATEA 2Y64A 4L92A 2VMHA 4ONUA 1RUD1 1GP5A 1IG3A 4DPNA 4XPVA 1VJ2A 3NAPC 4W8JA 3LGRA 3T2TA 3ACHA 1CAUA 4RFRB 2CDPA 2VH9A 5FZHA 3WT3A 5A1LA 1QJU3 5IAVA 5KC6A 2WKKA 1GZWB 1X9TA 4GWJA 4AGRA 4ZS3A 4LO7A 4I0BA 4EWAA 3AFKA 3POFA 5T5JA 4UW3A 2V5YA 3MF9A 2EF6A 2WNVA 1H8TC 1W3XA 4XFHA 1JYNA 2ETEA 5A6ZA 3O7OA 1AUYA 3Q9OA 2E63A 4AVSA 3M3EA 1CONA 1BQPA 3IT8A 5I93A 1LB2A 3HT2A 2RR11 1MS8A 1N1VA 4FPEA 1YI7A 2ZGRA 1K5JA 1MACA 1X7NA 5SV8A 1NCQA 4CXWA 4QPIC 2ILMA 4AEDA 4LBLA 4OVEA 5FZOB 1EAH2 2OKXA 5DG2A 3RYPA 3W9AA 3M3QA 1KFXL 1XQNA 5EHDA 1KDMA 3ZYHA 5GLZA 2CAVA 1HQWA 3M3CA 4R4XA 1SLBA 2JDNA 4N9IA 1E5RA 5FQ0B 5ABJA 2X29A 2ZJCA 1PMJX 1GFF2 2GC3A 5C4WB 4X8NA 1AJKA 3MW4A 4JAAA 3D0JA 2AEZA 2RM21 4YVWC 1VBA1 3DXUA 5FPUA 4AI2A 4B4PA 1XNCA 2DV9A 1W8OA 2D3RA 1HRI2 1MZ5A 5JXHA 1EUTA 3ZYIB 1H1MA 2P3YA 1XXNA 2VD7A 1W0PA 1RTVA 3I59A 3DUIA 4XF4A 4KBBA 4I30A 4LIVA 4CDWA 1W6OA 3NWKA 1UWWA 3POIA 2AGSA 1XPWA 2Y38A 3PLQA 5EV7A 1OFNA 2WNUB 3AYCA 5IWFA 4MG2A 1YIPA 3B9IA 4NIIA 1OT5A 1ZZ7A 3RI9A 4GQ7A 2JDYA 2WLPA 1PVC2 1AYM3 2CU5A 3DYOA 4QX8A 4XILA 3W59A 4D8MA 4HVOA 5I0DA 1VBC3 3AZXA 3OF1A 1ZA7A 2NN8A 4IDZA 1F5JA 1ENSA 3L9JT 4QDSA 5CFDB 2PAKA 2HWC3 2C26A 1RUH1 2CWMA 2HWE2 2W5FA 3ME2A 3NW4A 3PVBB 1E57A 1KDKA 2Z2SB 3LZZA 4HPKA 5A3OA 4NHLA 2B9VA 1U5ZA 5FPVA 2P34A 4JX0A 2OYZA 4D6RA 2GC2A 3M8LA 3QH7A 1RVF1 2W08A 2EA7A 5JR2A 2WT1A 4JGYB 2QZ3A 1GANA 1PIV1 1MZEA 1TME1 3NV3A 4N7IA 4BWOA 2GDFA 1OPOA 2Z79A 2FDFA 5IAXA 2ERFA 4KU8A 3JD71 2DBNA 2RS51 4P9GA 1RUG3 2FDKA 2ZHNA 4L2NA 3V65A 1WLDA 1N3QA 1UIJA 5FZCA 3ZFGA 1R1A2 2HEWF 3HJRA 2K46A 2Y6GA 2XVGA 2Q8OA 4E2QA 2J1AA 3VBRB 4FPOB 1GNHA 2JDAA 1RUI3 5CKQA 3S5QA 1ULCA 3QBQA 5FY0A 3KGLA 4PCRA 1QDOA 4A6OA 2YGLA 3HBKA 1QQP1 1XYOA 5CKMA 4CZSA 1LENA 3NMBA 4WM7A 4P14A 4HOOA 1G9CA 4HZFA 3MICA 1HQNA 2HWB3 2QQMA 3IMMA 4IL7A 4HKLA 1POV0 1AX2A 2W1QA 4RHV1 5AC92 3WINE 3ST7A 4N43B 3E5UA 1H2KA 3C7FA 3KHBA 4FOWA 4LOTA 2YBPA 4QKFA 5FYYA 1QH6A 2VECA 4B8EA 3VBUA 3LAGA 3MIHA 3TWIA 2GMEA 2WT0A 5F5IA 1DGWA 3T4VA 3ZKUA 1URXA 1RMU2 2GH8A 1DGRA 2G9ZA 4DUXA 2E26A 4QD2A 5BNNA 1O3RA 1W9FA 1ND3C 4Q4X1 5F9TA 2FZ1A 1W3VA 1KQRA 1CZSA 4CA9A 5C5TA 5C3SA 1HB4A 2J1EA 5DUWA 1N3PA 2YY1A 1R093 3HOBA 5EZWA 2DFBA 1YFUA 2WR9A 1A6CA 4CCMA 2NZ9A 4E2SA 2BFUL 5D21A 4PLNA 3D3AA 1ULEA 3ACLA 1HXS2 1OOPB 4PIYA 2FCTA 5IFPA 1U5YA 2AR6A 4Y5Z0 3SEEA 4B4QA 2LRPA 3BIWE 1WLCA 4A44A 5M0TA 3BU0A 3TEXA 3H8RA 3D5OA 2ZMKA 4IEXA 1T6GC 2WC2A 1YUDA 4OHZA 3K48A 3BCWA 1Y3TA 5E16A 5DABA 2VCBA 2E53A 4IE5A 2B42B 4O61A 3H9AA 4A3XA 1DZQA 4DOUA 5I8TA 1DBNA 3LEMA 2DFCA 1SACA 1ST8A 2JKBA 1VLNA 1N3OA 1UD1A 3M1HA 3OY8B 2H0BA 3VBOB 2JWPA 4W6XA 1W03A 4AFCA 2PAEA 5G05L 3K3NA 3P3PA 4W65A 4J6GA 2VTXA 1VALA 3PUHA 2B45X 3GCWA 4HSJA 4Q4V2 5L7OA 1LHVA 1EAH1 2AREA 3O1UA 2YPJA 1Y9QA 1Y9GA 2PA7A 3VKFC 3ZIXA 4URTA 4AI8A 1D4VB 1W6PA 2HKXA 3O14A 2ID4A 2J1SA 5CFCA 2RS32 3AKRA 3MFAA 5IK4A 4DB5A 3VHPA 3SKVA 2R0HA 2OQ6A 4QQLA 1HRI1 2UU8A 3RZLA 2VQTA 2XL7A 2RJKA 4MGYE 4HT1T 2XR4A 3OCPA 4PF1A 1GZWA 1LOEA 5A3WA 4YVSC 4LEJA 2RMU1 4FFIA 4UYBA 4YW5A 4QB1A 5LB6A 1GZCA 1MPXA 1TNFA 1SLAA 3RYRA 4ES8A 2W94A 5A1FA 5C8CB 2AEYA 3CZUA 5GJ6A 2WT2A 2C9AA 1VBE3 3HQRA 4ITCA 2WFF3 4LORA 3WHTA 3SHRA 5LY1A 2XXZA 2ZBJA 5SV5A 1DYPA 3ZFFA 4Q8KA 2XONA 4LMFA 4XJAA 4P9IA 2Z42A 4QMAA 5LRSA 3MW2A 5H9SA 2GNDA 4EE2A 1PO13 3OUJA 1LULA 3WW4A 2DVAA 2IXCA 3ZR6A 1W8UA 1S55A 3HIFA 2I07B 1SCRA 3KM5A 5FZOA 4CEWB 1VPHA 3GF6A 1UN1A 2XJRA 5FQ0A 4BMEA 4FVVA 4O9EA 3U4SA 1OQDA 4LKFA 1CX1A 4Q4Y3 4CDXC 2WA3A 2XVLA 3VGIA 3R4SA 4OUEA 3KSCA 2JENA 1VMHA 1UMZA 5JSOA 5FOJB 1QOTA 4QXKA 1R1A1 4N53B 1QJX2 5CADA 1RYYA 1XU2A 4XDOA 3NSTA 1WMEA 2BU9A 2RS13 4HKWA 4DEQA 2YXSA 1QJY2 4NIAA 1QMJA 2DCTA 5CISA 4XFBA 4LK7A 1XC6A 1L7LA 3NL1A 5LW9A 2BVBA 2PHRA 1DIWA 2BTVC 1MR5A 2VMFA 2QQUA 1TMF3 3B9CA 2ORXA 2VUJA 2Z4FA 4ASLA 3O1SA 3I2GA 3OD4A 4A7KA 2Y0IA 3VKLA 1JHJA 2OPWA 5DAWA 5LK5A 3N9LA 4GB32 2RDRA 5A7WB 3CHXA 4D0QA 4S2DA 3O5SA 4LXLA 2BQPA 4MZUA 2WNOA 4CE8A 3POGA 3R05A 1YEWA 3ZYRA 1YJKA 2XL9A 2W3JA 1RMU1 5T5OA 1AL0G 3CJIC 4L0PA 1W28A 4PLMA 2XJPA 3N7LA 4ZONA 3VHNA 2IUWA 2I45A 2GC0A 3MFCA 2ZX3A 1NA1C 5DDJ2 4BH9A 1W8TA 2C24A 3IPVB 3N9OA 1QNWA 2UWBA 2VY0A 1AX1A 1D2QA 2X5IC 3SLIA 3WDYA 2GN3A 3GBWA 1CJPA 1E5HA 1HXS1 2YBKA 5GALA 4DZGA 4Q0UA 4XURA 2MEV3 1ZZCA 3GHNA 2AUYA 4CP9B 4TSVA 4COWA 5IK5A 2VUDA 4LR4A 2G1MA 4QWNA 2XLAA 1ASJ2 1W90A 2IVJA 5FV3A 3USSA 1BK1A 4OCTA 4E2GA 3I7DA 5HCFA 4MGTA 1JI6A 1VMJA 3OTFA 4I0WB 1WW6A 4BQ1A 4XFIA 1N1YA 2ZGLA 1JN2P 2DUOA 4WM8C 5FZAA 1V9U2 2X53S 1ALYA 1IZ3A 3IZOA 2HWD3 4Q0PA 2WN2A 4DQAA 4TTGA 4EV0A 5CG8A 1OI6A 1WMXA 1S0IA 4B1MA 1W06A 5F2SA 2XH6A 2CNAA 2VZ1A 4JKKA 3IN9A 1LGBA 1B35A 2XG3A 4XBNA 5A7NA 2WQZC 4Q4V1 4QPWA 1LGCA 3WG2A 5FY4A 4ZXEA 4WVMB 2GMPA 1LEMA 1WW7A 1S0EA 5F6LB 3OEAA 2VVEA 5JR7B 3GM8A 4CCEA 1BXHA 1XNAA 2W87A 3LD8A 3VDDC 4ZZ8A 1LAJA 5G04L 1H8TB 3THCA 4M01A 5EJ1B 4UBHA 1J3RA 2J42A 1H4GA 5K4LA 2WAAA 1O3SA 2RS31 2VBBA 3FMGA 3ZSKA 1RUJ3 3TN93 4CP0A 4UI9L
chains in the Genus database with same CATH topology
4XHBA 5JZGC 4NOTA 2D3PA 3WZ1A 1XNBA 4NN0A 4OI1A 4BA6A 3I8TA 4MX3A 4QPIB 1U5IA 3AMMA 5J96B 4FTBA 3C2UA 1ZRCA 3H0OA 3IKWA 2PELA 3QOPA 2XKPA 5FCCA 4E9KA 4YM0A 4AE2A 1TMF1 1CAWA 1QDCA 2BWCA 3OJBA 5FLHA 2MHFA 1BEV3 2VOKA 1UF2C 2JDZA 4YVWB 1QNYA 3WW1A 2D6KA 3ES1A 3NKTA 3VZLA 1RJ8A 4YZ3A 3SISA 4YZ1A 3UKNA 2OUHA 3ILRA 1SBDA 5I0UA 1KS5A 3ZSMA 2NMOA 5GZEA 4YG6A 2ZGOA 1H2NA 1DGLA 2ZTNA 1SLIA 3QH6A 3QACA 4LO8A 3AK0A 2VMGA 3FJSA 2TEPA 1N1TA 1S0CA 4CRQA 4CDQC 1G9AA 3WVJA 2QVSB 3AP9A 4RR3C 2R062 1K5MA 1QJX1 5GLTA 2ZX4A 1QJY1 3NV4A 1DG6A 1SDWA 2NM1A 1FMD2 5DZFA 3VZMA 4BLIA 3E5XA 5L73A 1JHNA 3E6DA 5FREA 3SXWA 3TAYA 2JJ6A 1YJLA 3C3VA 4RGGA 3SITA 3GHMA 5J36A 4Y4YA 1JXNA 3O0XA 4GB31 2ZX2A 2ATFA 3ZIWA 1VP6A 4FQ4A 1SCSA 1CD3G 3L2YA 2DCKA 2WIIB 1QKQA 1AYN3 2C0ZA 1RUOA 1ZM1A 3ZFEA 4JGZC 4P9WA 3PTYA 3WUDA 3AJYA 3H8UA 4B7EA 5DDJ1 1PGW2 4XJZA 3RJ2X 5AFBA 1C8M2 4GALA 2BEOA 4XE9A 1UKGA 3MGUA 5E89A 4F8AA 4MGKE 1B09A 1FOD2 4O9GA 1ASJ1 2TBVA 1JW6A 3VZJA 1FPN3 2DVBA 1SFNA 4IETA 2UY8A 5JSPA 3ZMNA 1R082 3MZHA 3OBTA 3CNAA 2WFPA 4AQTA 1V9U1 4CDUC 1X36A 3IBMA 1S0JA 4BHPA 3VZKA 1HRV3 2QDRA 4XF9A 2IXHA 2Q4SA 2PTMA 2DF7A 2JG8C 4AFMA 5FRAA 3RZZA 2R072 5B2GB 4L9BA 1M06G 2TUNA 2JX9A 2LALA 4B29A 2VOVA 4MLOA 2R042 4KNCA 2ZGMA 2HWF2 3A0NA 1PO23 3D4KA 1G6NA 2DURA 3LSDA 4PDWA 3NVCA 1ZZ8A 1XE7A 1AR82 3J9SA 3BB6A 4Y1VA 3IPVA 5KHHA 3TRSB 4P9YA 5J3UA 4GH4A 3ENRA 2FMYA 1QOOA 4B4RA 1LOGA 5FO7B 2WS93 5K0UB 2F4PA 2JG9B 2LM3A 1ULGA 3FBMA 5JOWA 4GULA 4YG3A 1VBB3 1V6LA 4LUKA 3GBFA 3ZXKA 3FE5A 4R4ZA 3FBYA 1DF0A 1V70A 3ZXFA 1H9WA 4Z1VA 3RPQA 1AR93 2VOWA 1F2NA 3FC0A 2F6BA 4QPGC 3VBSA 4FXGB 4Y1ZA 5J37A 1GQHA 4YARA 2NLRA 4LO4B 1F9KA 3ATGA 4XJ9A 3VL8A 2D6OX 2XBO2 1QU0A 3AMHA 3SMHA 1VRH2 3TNQA 1AR73 2YDEA 2R061 5JMCA 3MIBA 4W6WA 3MLLA 1ZVFA 2YUEA 1FMD1 1QWRA 2LTNA 1TME2 4Q4W2 2PHUA 4TZDA 1NCRA 5T50A 4G9SB 2HJIA 2WNEA 1AXZA 2PHTA 1NXD1 2D6PA 2ZHMA 2RHPA 4R8HA 1U0AA 2MPFA 1UU6A 4YZ2A 2D98A 5E1RA 5EWSA 1KITA 1I9RA 2XWJB 1OD5A 5D8AA 3RNSA 4TWTA 4L8QA 1C8NA 3HAGA 1Z7S3 3CO2A 4XF3A 4OZXA 5J09A 1QJU2 4KGQA 4P9XA 4YZ5A 1PGW1 4XBQA 5FLIA 2ZMLA 1C8M1 2NYYA 5GZFA 2ZABA 3PMEA 2R6QA 2VNRA 2JE9A 4AQ6A 3H3ZA 4TYSA 1AR63 2JECA 4FXKB 4K9SA 4HK8A 1TE1B 5K7PA 4QQ2A 1OMIA 2D7FA 5A32B 1LHUA 4AFDA 1SFYA 2KM2A 2O0OA 3N3HA 4I09A 4ZU7A 5IK8A 1MQTC 1NA1B 1R081 1W2UA 1I1EA 3HN1A 4E4DX 4UBGA 2X5IB 5JDBA 4YFWA 4JTNA 4H14A 3H7YA 1ENRA 1QXJA 4CEYC 1PK6C 5KXDA 4I2OA 4HKOA 4LO6B 1I3HA 2ZGUA 4NO4A 2R071 1CIWA 1LU1A 4Q1PA 3GYDA 1AHSA 3BTAA 2ZX1A 3VBFC 5L19A 2R041 1AL23 4RGAA 4FBFA 3WDTA 1NG0A 4XQWA 2GMMA 2HWF1 4MSVA 2DYCA 5FPZA 1AR81 4WM8B 1ONAA 1RUC3 1ND2C 4PQ9A 4F7ZA 4K7JA 3N4MA 4RQPC 1EV11 5FO9B 2XLFA 5DZGA 1RITA 3VV1A 3DPRA 2ZGTA 3P3NA 4AWDA 2C5DA 1AYM2 1XNKA 1C5HA 5T54A 3SH4A 1VBC2 1WW4A 4IV3C 2Y0OA 1MS5A 1HDKA 4BCUA 1V6OA 3LCPA 1M4WA 2PLV3 4HVQA 4V1PA 2NQYA 1YWKA 5JPMB 1MS0A 2B8MA 3AP7A 3LB9A 3WV6A 4QGMA 2ENRA 2K2SA 3CU7A 3THTA 2BNOA 1LOFA 3VKNA 4JVAA 1VAVA 3KT4A 5JPNB 3RRDA 2XWBB 4COUA 1RUG2 3WDXA 5KXBA 2CGPA 4KWLA 4ZU4A 1SLCA 5GKAC 2RMU2 1POV1 4OUSA 2XBO1 2QNKA 1RUI2 1V6IA 2WINB 3KCCA 4KGGA 1KFUL 3G7DA 5HXVA 2WZPP 4F83A 5JIUA 1G9DA 1NXMA 1VRH1 2YC0A 3TBDA 1V6KA 4LBQD 2XUMA 1WLWA 3KCYA 1O5UA 1FNZA 4XTMA 5CIRA 4QPYA 5JCTA 5EXOA 4HFSA 2HWB2 1VIWB 2XJQA 3AKTA 5K0UA 1LKNA 2JG9A 2H6BA 3H1MA 3VBHA 5BNPB 3PMSA 1WMFA 2JICA 2P3KA 2ZX0A 1F8VA 4GA9A 1DU3D 1LODA 4XFAA 4Q4W1 4RS5B 5C9AC 1NLRA 4IXLA 2VVFA 4XHXA 2YHJA 1MS1A 3PVEA 4Z07A 3R0RA 4CDQB 4U2AA 1QH7A 1RHI3 3BU7A 4RR3B 1CAXA 1CJDA 2B46X 2PN5A 1R092 4AHWA 1W0OA 3PJQA 1TQ5A 1BZWA 1S1AA 4P9JA 1O4YA 1GLHA 1PZ7A 3PVOA 5BNOB 1MVQA 1GYKA 4UW4A 3D0SA 4WZFA 4IV1C 4LBJA 3KCXA 1QJU1 1ULFA 5T5LA 2O8QA 4INDA 4OI2A 5C8WA 1UPIA 4QGLA 3G6JB 2EXKA 4PJYA 3QLQA 5AVAA 3MIGA 4DINB 2VXRA 4CTEA 4IEVA 3E6BA 2E7QA 4OHYA 1IGOA 2LUWA 3JQWA 2D6LX 1LOBA 2VG9A 1PVC3 5JSRA 1ZZ6A 3ES4A 2ZGNA 2KA3A 2BBVA 2HWE3 1RB8G 2CTVA 2WNVC 1FNYA 1J3PA 3H1YA 1CR7A 3IMNA 1BBT3 4LA3A 5A33B 3DPRC 3FUOA 2R1DA 1XU1A 1C4RA 2E9QA 1DGWX 3MEPA 2VPVA 4QGNA 4JTOA 1Q5OA 2P3JA 4GMP0 4Q8LA 2A6YA 4MXWB 1NCQC 4AEDC 4PIXA 3FUQA 4ISQA 4MVTA 3AFGA 3HMYA 5ABJC 1SBFA 3VZNA 2E51A 4CDUB 1NOVA 1VAKA 5LEKA 3DL3A 1VBD3 1VR3A 1COV3 2JG8B 1AYM1 3THPA 1S0FA 4LT5A 1VBC1 1VBE2 3USUB 2WFF2 4ZU5A 2VOXA 2HWC1 3LKJA 3CEWA 3U0ZA 1Y43B 3EBRA 5A32A 4CDWC 1PO12 5BV6A 1GV9A 3V0AB 1S0BA 4LULA 4QQHA 1WW5A 2PHWA 2UYBA 4ORFA 1Y7BA 4WVVA 1SLLA 2OUJA 1RUE3 2DU1A 1KJLA 4YLZA 4AGVA 4Q4Y2 2K0GA 1RUG1 1A8MA 2D6NA 4M00A 3OD0A 2RS12 4PBPA 1RUI1 1PMIA 1DGRN 3WLUA 1ENXA 5I0RA 5FTTC 1TMF2 5FOBB 3MI8A 2HWB1 4K1ZA 3ZFGC 3FHIB 4AEKA 5J98B 1YFYA 4QPGB 2AENA 2FZ2A 1XNDA 1YNAA 4RFT0 1JTZX 1JYIA 4OHVA 2QFEA 2GAUA 4KQ7A 1CPMA 2ZAHA 4L97A 4XXPA 4WM7C 2BNNA 5K8SA 5C4WA 4LBNA 3WP4A 5IT6A 1C1FA 2TNFA 3OPZA 1QXPA 3VBUC 1R091 3ZXEA 3RDIA 3SNMA 1O3QA 1IKPA 3O0WA 1JH5A 3WQ1A 5BNNC 2MEV2 4C1WA 3M3IA 2AYHA 2WNUA 1IHMA 3S7EA 3WG1A 1UIKA 3BOPA 1X8MA 2DU0A 2HEYF 1Q8VA 1G9BA 5CFDA 1Q8QA 2GC1A 5GLUA 5ACA3 3T1LA 5BNPA 2HWD2 5DUVA 1PNFA 2R32A 3V64A 4YGCA 4DY5A 4Z2WA 4JGYA 4RL7A 3R6SA 2CAUA 4NR1A 5HCBA 1LRHA 4LE3A 4XFGA 4QM9A 3WD5A 1CAVB 4R9CA 4LNVA 1BJQA 4G3YC 4WZCA 2D3SA 2GN7A 3WX5A 1ZBE3 2WL1A 4EN9B 1W6MB 2FMDA 2VQ0A 3VBRA 1KJRA 2WWSA 1NY72 3VUOA 2IC1A 3TN92 3H1WA 5L7OC 2VULA 1FT9A 1D4M3 3J8F3 2ZGQA 1O3TA 1MQTB 3PHMA 3UV9A 1DHKB 4C90A 3HWJA 4N43A 4YW4A 4XDQA 2VUAA 3FFQA 2E7TA 1OSGA 5CFCC 2GU9A 4META 1LESA 3NAPB 3FLPA 3AP4A 1O91A 1VBE1 2GNTA 2WFF1 1BEV2 1PGL2 3IDBB 3ECQA 1DFQA 2EAKA 4EWDA 3N7KA 1DQ4A 5FFOC 3VBFB 4AQ2A 1BVVA 1PO11 2DCYA 4CP2A 4XW3A 2G9GA 4UW6A 1J59A 1ND2B 1DZTA 5H9RA 3OGJA 3LOIA 3RWNA 5A33A 3MIEA 3WUCA 4TLFA 2PHDA 1ULDA 4XIKA 4BE3A 1OOPA 1WCDJ 3ZFFC 4Q4Y1 4HVRA 1LEDA 4IV3B 5CNAA 3AKSA 4HETA 4N9HA 1SBEA 4MXWA 1W39A 3IDEA 1S2BA 3RJRA 4I3PA 2RS11 4MV2A 1KD7A 2P17A 4BOWA 3M2MA 3ZX7A 5FO8B 1UZZA 1NQDA 1H2LA 5F5QA 4NPRA 1Q56A 4ASMB 4A7ZA 3FX3A 5DXDA 4L99A 1HX6A 3TYJA 4PIZA 1WBFA 2WZR3 3KB5A 3OY8A 3VBOA 1ZBA3 4FP3A 3V0BB 4AVAA 3B94A 4YFZA 3D6EA 2Q5TA 4Z82A 1LTEA 1W6NB 4Z8BA 3URFA 1SEFA 4LBQB 3DF0A 5BXXA 1I6XA 1AYN2 4DS0A 4C91A 5T52A 4GWNA 2WA4A 1V00A 2ZS6B 3PNAA 4LHKA 5A3MA 4K3UA 1W6QB 4XFFA 1S0GA 1BMV1 5KHGA 1GSLA 2PFWA 3N7MA 4Y20B 1NLSA 3FWEA 2MEV1 4JGYC 3KS7A 5C9AB 3AYEA 4DRVA 3B02A 3R4DB 3ZMOA 3TNPB 3HR9A 4I0AA 5C8CA 1WLTA 1FPN2 4AGGA 1GBGA 4PF5A 3ZSJA 2OA2A 3LA7A 4Y1UA 3VN4A 1V6NA 2H6CA 2HWD1 1HRV2 1WCKA 1IPKA 1MVEA 4CEWA 1C28A 1REFA 4IV1B 1LJ7A 4EN8B 4Y24A 3HQXA 5KHKA 2I74A 5FMOS 5KXCA 3ZXAC 4AHXA 3JBG3 1XYNA 1LECA 3JB8A 1BCXA 4M3CF 3EO6A 2VW2A 5F6KA 2ARXA 4N53A 4FTEA 3ZXDA 3GZUC 3NV1A 4DMIA 1CAUB 1IPJA 1NY71 4IEUA 5EFUA 4EN0A 1RUJ1 3TN91 1OPMA 1B35C 5EJ3A 1LOAA 3ZYJB 1ND3B 2WS92 1VB4A 3PVNA 1G86A 3GALA 2XJSA 2R49A 2IXJA 1S2KA 3KQRA 3WW3A 4X6QB 2V73A 1ZRRA 1DZRA 1VBB2 3AKQA 3S6PA 1RUF3 1MEC3 4GKXA 3B00A 3H7JA 3MPBA 2XLGA 4FTSA 1UL9A 2D5HA 2EIGA 1BEV1 3NO8A 1PGL1 1AR92 2D43A 2OZ6A 1BKZA 2WJSA 1I5ZA 3ELNA 4AEJA 1C3HA 2D93A 5CA6A 2BNMA 1FV3A 3N35A 5ABJB 3H3UA 2V09A 2FQPA 4FPGA 1EV12 2DUQA 3LA3A 4QU2A 4GXLA 4YW1A 1GR3A 1F5FA 5JAXA 4Q0VA 1QOSA 4DFSA 1VAMA 1AR72 1BYHA 2E6VA 3ZYPA 2PQQA 4NWVA 4JC1A 2ET1A 1L3JA 4XTPA 4CDWB 4YSFA 1RINA 3SH3A 2XGXA 4YW2A 3VL9A 2B5HA 1FAYA 4XEZA 4XQ4A 1U5XA 1FOD3 3NAPA 3WP3A 1K5MC 5DZEA 4ES9A 3S0MA 2QE3A 2XVKA 5JOXA 4J1XA 2ZZQA 4AFBA 3WG3A 4IEPA 2BUKA 1CQ9A 4YVSB 2B7YA 1EPWA 4WVMA 2Y26A 3WXPA 5HBAA 1RUD3 4YZ4A 1H8TA 1AYN1 3AXEA 2VGDA 2Z5WA 3MF6A 1H0BA 2K9ZA 1Z7S2 4Q27A 1SQ4A 4UXAA 2DWRA 3UKTA 4AI3A 4D3WA 2EXJA 4YGEA 1IKQA 3OBRA 3ZFGB 1AXKA 1WD4A 3I54A 3CJXA 3E97A 4FPLA 4BZ4A 3WDWA 2P37A 2CGNA 2BFUS 2XHKA 4JRLA 4QPIA 4OUMA 4COZA 3ZDSA 4S2GA 3NJZA 3MLJA 3LOBA 4WM7B 3ZFEC 1N47A 4FPCA 1HKDA 4ISRA 4FAGA 4WBBA 1YHFA