4HN1A

Crystal structure of h60n/y130f double mutant of chmj, a 3'-monoepimerase from streptomyces bikiniensis in complex with dtdp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
199
Chain Sequence
MHPLSIEGAWSQEPVIHSDHRGRSHEWFRGESFRQAFGHDFPVAQVNVAVSHRGALRGINYTEIPPGQAKYSVCVRGAGLDVVVDVRIGSPTFGRWEIVPMDAERNTAVYLTAGLGRAFLSLTDDATLVFLCSSGYAPAREHSVNPLDPDLGIAWPDDIEPLLSDRDENAPTLATAERLGLLPTYQAWQEQQQAQRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 3-epimerase in D-allose pathway
publication title Structural and Functional Studies on a 3'-Epimerase Involved in the Biosynthesis of dTDP-6-deoxy-d-allose.
pubmed doi rcsb
source organism Streptomyces bikiniensis
molecule tags Unknown function
total genus 54
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.27: dTDP-4-dehydro-6-deoxy-D-glucose 3-epimerase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hn1A00
1LRHA 5JR7B 4LEJA 1ZZ9A 1OMIA 1IPJA 1GQHA 1WLTA 3HQXA 4XF4A 2IXKA 2PQQA 4GULA 4QXKA 2ZKLA 3RYKA 1SQ4A 3ST7A 2IXLA 2WC2A 5LEJA 3SCHA 1ZZ8A 1GQGA 4BH9A 4E2QA 2ZCWA 5BPXA 3ELNA 3DKWA 4PIXA 4Z07A 5HI0A 5AVPA 4I0BA 4YRDA 1RUNA 1UW8A 5KHGA 1O5UA 1WA4A 4L11A 3H9AA 3E5UA 4RD7A 3GYDA 1CX4A 4P9GA 4MV2A 3ETQA 5FDBA 5KHKA 3EO6A 3FZ3A 3SHRA 3ES1A 3FE5A 1NZCA 4QM8A 2N7GA 3S7IA 1ZRFA 5JAXA 2PAEA 2D5FA 3BCWA 4UBHA 1CAUB 1UIKA 4IESA 3E97A 4HMZA 2P17A 2O1QA 1J3QA 4LUKA 4XF9A 3H3UA 1ZNPA 1OFNA 4IEQA 4EROA 3HIFA 2FQPA 4QGNA 4NVPA 3CLPA 1I6XA 5E1RA 3UKNA 1UD1A 4IERA 2D93A 5FCCA 2XLAA 3IBMA 1OI6A 3USSA 3I59B 2WFPA 4FBFA 4EV0A 3BPZA 2D5HA 2PTMA 5FLIA 5EZWA 2CV6A 3FX3A 3ZDSA 3EBRA 4UBGA 4ZU5A 3RYPA 1CAVB 2PFWA 4X6RB 1X8EA 4XEZA 1WGPA 4N9IA 5I93A 2I45A 2K0GA 2VQAA 2Z2SB 1J58A 2MPFA 1DGWA 3OD0A 1YHFA 2VECA 3LA2A 4EWEA 3R6SA 3OGJA 3B02A 1RGSA 3G7DA 3HT1A 3SCFA 1EYBA 3RDIA 3QACA 1EY2A 3IWZA 4E2SA 3U10A 4L2NA 2D40A 2GC0A 2BGCA 2V09A 4JVAA 4AQ2A 1FXZA 3CO2A 2QNKA 3TNPB 3MPBA 4R52A 3RYRA 3BALA 4WZCA 3I7DA 1IPKA 1VR3A 2BNOA 3H7YA 1CAUA 2VPVA 2GH2A 2PAKA 1O5LA 5FQ0B 1J59A 5I0TA 1X82A 4XFHA 2QJVA 3NL1A 4JTOA 3KSCA 5KBFA 4D7SA 4OLLA 4KWKA 1ZZ6A 4LUMA 2B9UA 4XF3A 3U0ZA 4HSJA 1RC6A 2EVXA 5EFUA 3ES4A 2GZWA 4B29A 4BIFA 2ET1A 1X7NA 3JZVA 4IEXA 4X6QB 5FLHA 4AQ6A 2DCTA 2B5HA 5I0UA 1O7FA 3EHKA 3H50A 4I0AA 5KHHA 2BNNA 4AVBA 1SEFA 4K8FA 2CAUA 4KU8A 5I0SA 3WW2A 4XFFA 3TNQA 4N9HA 1O4TA 3PNAA 4MGKE 3HT2A 4YYOA 2HJIA 5C6CA 2O8QA 2BNMA 3D0SA 2EA7A 5JSOA 4WVZA 3MYXA 4META 3LOIA 3OF1A 2Q1ZB 4EWDA 3BB6A 1VP6A 3H1YA 3H1MA 2ATFA 1I5ZA 2UY8A 3DV8A 2PHLA 4HSLA 4IEOA 4AVAA 2IC1A 1LKNA 1CAWB 5CVRA 2IXHA 3I54A 1QXRA 2GC3A 4XFIA 2XLGA 4KL1A 1ZRRA 2BYVE 1ZREA 3ACLA 2OPKA 1Y3TA 4ONUA 4I2OA 4J1XA 2OZ6A 2XKPA 3D0JA 4HVOA 3L2HA 2XL9A 4OFGA 5FLJA 1RTVA 2IXIA 3H8UA 5J48A 1ZZ7A 5K8SA 3NJZA 1VJ2A 1DGRA 3IDCB 4O9GA 3U11A 4QX5A 3RZZA 4XETA 2KXLA 2C0ZA 2B8MA 4O9EA 5I0RA 3KGLA 4HBNA 1FT9A 5BV6A 3VHRA 2H0VA 3EJKA 4Q0QA 3FFQA 4XFGA 1YFUA 1DZTA 2E9QA 1O3QA 4BHPA 3QOPA 3IIAA 4E2GA 3DL3A 1CAXB 3NKTA 1Q43A 3DN7A 3E6DA 3OCPA 2Q4SA 1UPIA 5BY5A 2H6CA 2Q30A 4FT8A 4LTAA 2XGXA 2OZJA 3N4MA 5LRSA 3RNSA 4MGYE 3FWEA 3MDPA 1NYWA 4QGMA 2UYBA 5BUVA 1CAWA 2MHFA 2XHKA 3BU7A 4QM9A 4HLTA 4XFCA 4IEPA 3OTFA 1YUDA 4Q0VA 5C8WA 1Q5OA 1XE8A 2PYTA 4MGZE 2PAMA 1H1MA 1RL3A 1XE7A 3E6CC 4HVRA 2EAAA 2GC2A 1QXJA 5JSRA 3LAGA 4Q29A 4HN0A 1EP0A 1UCXA 3M3IA 1YFWA 4I09A 4XFAA 4ZU7A 4Q0SA 4CYDA 5J7MA 3UKVA 2OYZA 1HW5A 1NXMA 1ZZCA 3PLQA 3I59A 1U12A 4MX3A 1O3TA 1PMIA 1YWKA 4WBBA 2XKOA 1UIJA 3E6BA 4DINB 3GBFA 2OA2A 1X8MA 1L3JA 4QGLA 4XF1A 3WW1A 4I02A 1CAVA 2F4PA 3SXWA 4QMAA 2UY9A 5JCTA 2MNGA 4HN1A 4LA2A 3LA3A 3RPQA 2GC1A 1CAXA 5D1IA 2QCSB 3UKTA 4MGIE 4KU7A 4JV4A 3CEWA 4I01A 2IXJA 4IEUA 4KWLA 5E16A 4KWJA 4IEWA 2ET7A 5LRRA 4H7LA 5JSPA 1Y9QA 1TQ5A 3C3VA 4PIYA 3KMHA 1DZRA 3D82A 3SMHA 5BXXA 1CGPA 1OD5A 2XL7A 5FQ0A 1NE6A 2Y0OA 2FMYA 4AVCA 4LA3A 2UYAA 3CL1A 4IEZA 4A2UA 4XFBA 3H7JA 4BYYA 1YFYA 2Q0AA 4YARA 4I3PA 4MZUA 4MUVA 4EWAA 1LB2A 1QY4A 2GAUA 3NSTA 1J1LA 1LR5A 4HZFA 4ZU4A 3LWCA 4LULA 3S0MA 2PA7A 4PJYA 1YFXA 2CAVA 4AXOA 5I8YA 1ZRCA 3WW3A 3PVBB 3IDBB 4IEYA 3CJXA 1ZVFA 1O3RA 4TLFA 1JUHA 3M70A 4R8HA 1ZZBA 2XLFA 4HVQA 4J1WA 5LEKA 4YNIA 3FHIB 5CU1A 1RUOA 5T3NA 5KHJA 1O3SA 2QDRA 1J3RA 3LZZA 3NVCA 1G6NA 1YLLA 5CADA 2PHDA 2QVSB 5FPXA 4LLOA 4JTNA 5J3UA 4FAGA 4FAHA 1V70A 4Q0PA 2HKXA 1QWRA 4YSFA 3KCCA 1EPZA 4D7TA 5I8SA 4XF0A 1SFNA 3KGZA 1XRUA 1PM7A 1Q3EA 3NW4A 5KHIA 2K9ZA 4IEVA 3E5XA 3E5QA 2IXCA 2ETEA 4F7ZA 1ZRDA 4IETA 4UXAA 2H6BA 3LA7A 3CF6E 1FI2A 2GU9A 3ROUA 1H1IA 1NE4A 3FJSA 5I91A 3H1WA 3SCGA 4PIZA 5FPZA 4ORFA 5F1RA 1ZX5A 4F8AA 3H3ZA 2BEOA 4Q0UA 2Z69A 3EQEA 5I8TA 3O14A 3S7EA 4MH0E 3MZHA 1J3PA 4Z82A 2CGPA 3WW4A
chains in the Genus database with same CATH superfamily
3OY8A 3I2FA 2WSVA 4LEJA 1C8M3 1EPWA 4YGBA 2JDPA 4CEWB 1G9DA 5FZIA 4AI1A 1W6QB 3HMYA 1GQHA 2RDNA 3UYJA 4GULA 3VBSC 1UZVA 4XVHA 4XTPA 5L19A 4IV3A 5A7QA 2WC2A 3WV6A 2VCCA 3SCHA 1ZZ8A 5FPUA 4AF9A 2JKXA 4K3UA 3ZR6A 3AVSA 5IVYA 3CJIA 3JD73 1UX6A 1DYOA 1A8MA 1DQ0A 2W91A 4Q4V2 4YZ5A 4FTEA 2JDHA 4V1PA 3P1IA 5AC91 2X53S 1TMF1 3GZTB 4LQRA 2YC4A 4L92A 1C57A 3P5BA 1UW8A 4BM8A 1K5MA 1O5UA 5KHGA 2IVIB 3ETPA 4AEMA 1V6OA 1HRV3 2ZX0A 1OURA 1W2OA 1FX5A 4QB6A 2FCVA 2WA4A 2WO1A 1QXPA 2DVDA 2IVJA 3NAPC 3GYDA 5L7OB 4XUTA 2JDNA 4P9GA 1QIQA 4MV2A 5LATA 2QQKA 2YROA 2Y6JA 3K46A 4LLFA 5JZGC 5KHKA 3ES1A 3VDDC 4KG8A 4LBKA 1JOPA 3NJVA 3B00A 5A3TA 1S1AA 1XPWA 3S7IA 3WP4A 5JAXA 3RWNA 4MG2A 2PAEA 1LOAA 3KHBA 2EIDA 2W3JA 1FOD1 3PUIA 2ZGRA 4XQDA 3AL6A 3T1MA 5CKNA 4IESA 3ZXEA 5FUPA 4DXRA 3MI8A 1R092 1Z7S1 1D4VB 4HMZA 1NOVA 4W4ZA 2DUOA 3RGBA 2P4EA 2VULA 3H3UA 1W2AX 2WZ8A 1ULEA 2D6NA 3EXUA 1NUKA 2VH9A 4FOVA 1EAH2 1LHWA 3NNFA 1JZ8A 2FQPA 4Q4Y3 2RM22 4QGNA 5FKBA 1V6NA 4OHZA 3ZVXA 5A7OA 3VUOA 2W46A 5DAWA 4XPVA 5FCCA 3IMMA 2C9KA 3UGHA 4CEWA 5J09A 1W6QA 3I59B 4XMIA 4FBFA 2R32A 3WDTA 3BPZA 4EV0A 3O1MA 1RJ7A 3ACFA 5A33A 2VJXA 2CV6A 4XURA 1US3A 2X5IA 3FX3A 3ECQA 2LM3A 4FTBA 4AFCA 4M3CA 1XSQA 2VGDA 2ZHKA 3N9NA 2JG8B 1EV12 1NAEA 4YVWC 1X8EA 4RQPA 5DPNA 1RUG3 4LKEA 2I45A 2K0GA 1FMD2 1UZWA 1J58A 1LHVA 1DGWA 1QJX1 1YHFA 5C70A 1OKOA 1ZA7A 3H3LA 1DQ2A 3GHNA 2JDUA 5FXZA 1ENSA 2EAKA 3ZFGA 2ZKNA 2LTNA 3QACA 4AHYA 1VBC2 3GNEA 4AOCA 2K2SA 4I3GA 4XYXA 1GICA 5CEHA 4E2SA 3ILNA 4Y20A 5DZEA 3B7MA 3JB4C 2D97A 3O1UA 1JU4A 4DRVA 3LQCA 2AZ5A 2V09A 4HG6B 4LBLA 2PLV3 3BTAA 1LESA 4YW5A 3ASIA 3POJA 4CCOA 4QKFA 4YGDA 5GLVA 4Y3OA 1OQDA 1ST8A 3OPWA 1QGLA 4AR2A 4DXTA 4R9CA 2VPVA 3MEPA 2WYFA 2QQLA 1HXS2 2HWC1 1X82A 4LHKA 3L2YA 1OF3A 1AJKA 2JENA 4XFHA 3NL1A 3S5AA 3W20A 3KSCA 5KBFA 1H8TB 2OQ6A 3PJYA 4DXSA 1ND2B 1O6UA 2VOTA 5ACA3 4JHZA 3K77A 5EHDA 3ZLIA 1RUH1 2VO5A 1SLTA 4BIOA 2AGSA 5EFUA 3U4SA 1AR81 3AKRA 2FZ1A 3I2OA 1B35A 1W28A 2OX0A 1X7NA 5FLHA 3N9LA 5A7WA 2BGOA 2XJTA 4AQ6A 4LKDA 3HJRA 5FZ3A 4A6SA 2AACA 3I8TA 2VUJA 4P9IA 1AL22 2AYHA 4P14A 4A7ZA 3A21A 2ZHMA 2NPIA 3FBYA 3J9SA 1OPOA 2JB8A 2WUHA 4AFBA 1W39A 3PHMA 1S0EA 3C7FA 3JQXA 2D6PA 1O4TA 4FQZA 3AKQA 2QQMA 2VY0A 5FZ1A 3VBHC 3BTXA 2O8QA 3VBOA 2BNMA 2KD7A 2YC2A 4UOJA 1TVGA 1UY2A 3D0SA 2EA7A 2F17A 3RZKA 1ND3C 1OF4A 3UK9A 3WQ1A 1UYXA 2XVKA 3MYXA 5IVEA 3OF1A 2G9FA 1AR72 1ENRA 1RUF2 3ZXGA 4Z2AA 1W2NA 1SDDB 4TZDA 3AZXA 3H1MA 5FMOS 5IAXA 3DV8A 4FXGB 4QKBA 4OHXA 4OVEA 2IC1A 2VUAA 1LKNA 2CU5A 1ASJ3 3ZN5A 5IHRA 1XC6A 2IXHA 2VCBA 4XFIA 3ACHA 1VBA1 2XLGA 5CFDA 4A3XA 1GOGA 1BEV3 2W1QA 4I2OA 4LO7A 5GKAC 5I0DA 1V9U3 1W6NB 4HVOA 1LOFA 4R4XA 1VBB2 1UF2C 3DPRA 1JN2P 2BQPA 2QZ3A 1QHDA 1WMFA 4UFHA 2IXIA 4E4SA 4H7MA 5J48A 1POV0 1H8TA 1JHJA 1ALYA 1S0CA 3HBKA 3NJZA 4Q8KA 5KR7A 1AR91 1VAMA 3VBUC 1IPSA 4QX5A 1C3HA 4YZ4A 5FREA 2WFF2 3MIBA 4MLOA 4NIIA 2I07B 1HB4A 2C0ZA 4K9SA 2RJ2A 3O5SA 5LY2A 3TRSB 4EN6B 1XU2A 1YNAA 1IGOA 2W1SA 3PMEA 2RS31 2QFEA 2YV8A 2XJPA 4FPJA 4HBNA 4KGQA 1AX0A 1MACA 4NIAA 3RZJA 5T5PA 1W8ZA 1QJU3 2PXJA 1O59A 1XNAA 3ZKYA 1V6JA 2DF7A 1I3HA 1LGBA 3NO8A 3VHRA 4EYUA 5K0UB 1QQP2 4Q0QA 3FFQA 4L8QA 3WQ7A 2VAUA 2JIJA 2WAAA 4CU6A 4EN7B 5LZ6A 4NROA 5IVFA 4DNYA 2ZEZA 4BHPA 1L7RA 3JCIA 2Q1FA 1AR61 4NAMA 3J26N 1MEC1 2XG3A 4TTGA 4Y26A 2IFWA 3AKSA 4FOYA 3RMXA 1JZ5A 3WSOA 3E6DA 1NT0A 2VR4A 3AP4A 3I2GA 5FXXA 4BXSV 2FBEA 2QQNA 2VMGA 1AX1A 3OEBA 3ZYIB 3MF6A 5CFCC 1YQ6A 2H6CA 4GALA 1VRH1 2E26A 1S0IA 4YW1A 3LDBA 3RFRA 2OZJA 1US2A 3H42B 2LUWA 2XUMA 3RNSA 2LROA 4MGYE 5FR3A 1NYWA 4QGMA 5GLTA 5JOXA 5BUVA 2FCTA 2W5FA 2FDGA 2MHFA 1C5IA 1STMA 4UW5A 1MQTC 3BU7A 5A3UA 2ZABA 3N9MA 2ZGOA 4QM9A 3AP7A 4XFCA 3W58A 4AEKA 4NPRA 5EQUA 4WM8A 3POEA 3OSDA 3OTFA 1CZVA 1YUDA 3TN92 2RJLA 4DQAA 3MW2A 3NNLA 4NRPA 3VZLA 4CCNA 1ZBA1 3ZXDA 2HYXA 2RS51 3WDVA 3AMPA 3A4UA 1HB1A 2PYTA 2Y8KA 1WW7A 4HETA 4C91A 5JOWA 3WY6A 4NIGA 2VW1A 3DECA 1FPN3 2IFRA 2PAMA 1HJGA 3AZWA 4IXLA 1H1MA 4DIQA 1OUXA 2EXHA 1XE7A 3GHMA 4JQRA 3E6CC 4HVRA 1RUE2 3CZUA 5KC6A 3ZFFC 1NCQC 1QXJA 4GB31 4GH4B 5FZBA 3LAGA 1WZXA 5JSRA 4CP9A 4YLZA 5CISA 1PMHX 1EP0A 3M3IA 3M3EA 4LBNA 2H0BA 4Q0SA 4CYDA 3KT7A 4OHWA 3UKVA 1DQ5A 4CEYA 4YG3A 1W8HA 2WKKA 4AHXA 3ORJA 1U12A 4LBMA 2G9ZA 1JTZX 3UGGA 1O3TA 2XKOA 1UIJA 3PUQA 4K20A 3E6BA 4GWMA 2OA2A 2ILMA 1MS1A 4YFWA 5C3QA 1N3QA 5L9RA 3SEPA 5GZEA 3SXWA 1RVF3 4CDWA 4QMAA 4LK7A 4UFLA 3TAYA 3MICA 2MNGA 5JCTA 1DIWA 5JXHA 2BVVA 1QJY3 5H9SA 2QQIA 1BHGA 2BUKA 2R041 2O8OA 2A6XA 2QCSB 2RMU2 2A6WA 2WNOA 1QNWA 1URXA 4LMFA 4P9JA 1O8SA 1SZBA 4YFZA 3UGFA 1SFYA 2WSUA 1WD3A 4I01A 1UQXA 1OLMA 3NV3A 4KWLA 3ZFEC 5E16A 3RZLA 2WLQA 3I3DA 4HKOA 4KWJA 3H8OA 5JSPA 2BDRA 5E89A 1PGL2 1NZIA 2BFUS 1Y9QA 1RXFA 3C3VA 3K75B 1XQNA 3FN9A 4BMEA 2V72A 3KS7A 3RWKX 2XOMA 1YQ5A 1UY0A 3LEIA 1DZRA 2RDSA 3D82A 4NMIA 5E6HA 5BXXA 4QQOA 1LJ7A 3UESA 1JZ3A 5EWSA 3ZPYA 3IMNA 1VIWB 1HX6A 1W90A 1OD5A 3AP9A 4CXYA 2VZ3A 3OPTA 3AXDA 4COUA 1NE6A 5JXJA 3KF5A 4HKLA 2OUJA 2VVDA 2DU0A 3TEYA 3IDEA 2FMYA 3KVAA 4UWDA 1T6GC 1DCSA 2JECA 1S0BA 4LA3A 2QQJA 1RMU1 1SPPB 2P3KA 4A2UA 4BQ2A 1XNKA 2DU1A 2ZA9A 1YFYA 1MPXA 2A5ZA 3AZZA 1OA2A 1EUUA 1H2KA 1CJPA 2W68A 1OOPC 4ZONA 1C5HA 1XNCA 4BLIA 5IK8A 5IYYA 2EIBA 1GBGA 4LULA 5FIXA 3S0MA 2WWUA 3LF7A 5AC93 1RHI2 3KM5A 1TMF3 2DCJA 3MV01 4OZXA 3POYA 4GAZA 4FSJA 2DVGA 4CCKA 5ABJB 1PO11 2CAVA 3HOBA 4R9BA 5FMDA 4E8CA 4F3JA 3WW3A 1CZTA 4XUPA 4LHSA 2LALA 3SKJE 3K2OA 5KXBA 4FPKA 1J1TA 2ZS6B 4JDMA 1JUHA 3MLLA 4URTA 3M70A 5FMCA 5CA6A 3ZSEA 3RZGA 1GQPA 4AK3A 1POV1 3WG3A 1ZZBA 2WS91 4HVQA 5LEKA 5FZOB 4GWNA 4HL0A 3NKGA 5CU1A 1RUOA 1S2BA 2D3SA 5GJ6A 4N43C 5JLVA 2QDRA 2Y34A 2A3WA 2YFUA 3BVCA 1GZWA 3DUIA 4QX3A 2DCKA 2BBAA 4LLOA 1FOD3 4GA9A 4FCAA 5JIAA 3IN9A 3P6BA 1O4ZA 4QDRA 4Y24A 1V70A 2VZPA 1U5ZA 2TUNA 4Q0PA 5FY5A 5LA2A 5BNOA 3KCCA 2VVFA 1O8PA 1SFNA 3BUCA 4NJ4A 3ZYPA 1W99A 1XRUA 3EMRA 4Y1ZA 3ZYJB 1BCXA 1UY4A 1V00A 4PQ9A 5D8AB 4IEVA 3U07A 3E5QA 4W6XA 5C4WB 4N53C 5A6ZA 2CSGA 5J36A 1A8DA 4IUGA 4XOGA 5FP3A 2ETEA 2YUEA 1NX9A 1RUI2 1YJLA 1CR7A 3IAPA 4GZ9A 1Q8VA 4AG4A 1ULGA 2GN3A 4GJYA 3KT4A 4CDUC 5C9AC 4ET7A 5FYVA 2EXKA 3E1F1 2GU9A 3JUUA 2ZXQA 2R30A 4U36A 3FJSA 4QPGC 4QQLA 2VBBA 3H1WA 3ME2A 4E8DA 5I91A 5JZGB 1R64A 3JBG2 3SCGA 3ZMOA 3CBNA 4FPCA 1YCIA 2ZGQA 2VZTA 3FUOA 4Q4X2 4RR3B 5FP4A 1OA3A 4AHWA 5J96B 4E4HA 3H3ZA 5FO8B 4ZZ8A 4IV3C 3APBA 1GNHA 1OC1A 1JBCA 4L9BA 4LKFA 4QX0A 3VHNA 4IL7A 5I8TA 1H6XA 1QJX3 4R9DA 2R1BA 2JXAA 3MIEA 3O14A 5F32A 5FP9A 3CJIC 5G05L 1WMXA 4A42A 4MH0E 4AYUA 5ABJA 3I3MA 3MZHA 1BBT2 2Q1MA 1DYPA 1KQRA 3HWJA 1JODA 4YZ2A 4DS0A 1YRZA 1K5MC 3AVRA 4H2AA 4IGQA 2XDVA 4JAAA 4NWWA 2E7TA 4XF4A 3VZMA 1GYKA 1WLTA 1DP0A 2IXKA 1SBEA 1PO22 4QXKA 2ZKLA 4M00A 5DAQA 1TG7A 2ERFA 5FZOA 3IDAA 2DCYA 1UYZA 5EJZB 3PVNA 1LGNA 2XJQA 1GOFA 4MYEA 5BNNC 5F9TA 3DKWA 1AYM2 1QJU1 4L97A 4PIXA 3OUJA 1JS9A 3HQRA 5HI0A 2W0XA 4YRDA 1OQEA 5GZFA 1UU4A 1KD7A 3POBA 5FYYA 1KGYA 2C6SA 4FFFA 1WA4A 2WDBA 1IQDC 1ODMA 2HWC3 2QQOA 4ATFA 3E5UA 1WCDJ 4W65A 2E51A 3VD7A 4CE8A 1AYN2 4OULA 3BIWE 1RUH3 3MPPG 1PGW1 3URFA 3ETQA 4A45A 2R6QA 1AR83 1W8WA 4G9SB 1GSLA 4TYSA 1WLDA 3SKVA 4DZGA 5BNPB 5FDBA 2GALA 2W52A 3EO6A 3FZ3A 3SHRA 1NLSA 3M1HA 4NN0A 3FE5A 2YB7A 2Y26A 2RE9A 1DGWX 2VMDA 3IM0A 1XBFA 4JRAA 5FPLA 1UOBA 3RI9A 3N7MA 5H9QA 2XJSA 1ENXA 3ACIA 2GP3A 5LB6A 1UYPA 1OPMA 3BCWA 4H14A 1QDOA 4JDNA 4UBHA 5FY7A 1UIKA 3CZJA 3HNBM 2PHFA 2YBSA 2ZGMA 4PBPA 4B1MA 1CONA 2P17A 4XF9A 1J3QA 3R05A 5A3OA 4MHRA 4RL7A 3ZMNA 4CCLA 3BN6A 3ACGA 3Q8BA 2X5IC 2WZR1 1GZTA 1K3IA 1Z78A 2QQUA 5FYHA 4RQPC 3NWKA 4NVPA 1FPN1 4DEQA 5E1RA 3IB3A 4R9AA 1UD1A 4IERA 4QB1A 2DWRA 5GLUA 4AL9A 1COV1 2E53A 2XLAA 2JEMA 2WZEA 3AMNA 4UYBA 5C8CA 3ZFGC 5HCBA 4XJ9A 1RUJ2 2PTMA 5FLIA 2HWB2 2CDPA 4FFIA 5FZKA 4PHZA 1LTEA 3MIHA 2RR11 4JCKA 3EBRA 2B46X 1PNFA 3A22A 3EYPA 4UBGA 5FMBA 3RYPA 1M06G 5FUNA 3WX5A 1VBA3 5FYZA 4PLNA 1JYNA 2E33A 5IT6A 1Y4WA 3TEXA 5A1AA 1I1EA 4XEZA 1WGPA 4N9IA 4FPFA 3ZSJA 4AEDA 1WBLA 1ZBE1 4YVSC 4URAA 1H2MA 4DO0A 3OBZA 5T5LA 1REDA 4Z1VA 4J25A 3W9AA 1NXD1 2WNUA 3F95A 3B02A 1RGSA 3DYOA 3HT1A 4INDA 2BJSA 2CWSA 1VBE2 4BQWA 5KXEA 4Y5SA 3N35A 1AR93 2YPDA 3WZ1A 1CIYA 1T6BX 2C26A 1R082 4J6GA 5CNAA 1VMHA 3U10A 3GZAA 1SBFA 2Y0IA 3AYDA 2GC0A 4QHBA 3VBFA 1LODA 4A44A 2FDKA 2FDIA 4Y22A 5FXWA 4CDQB 1UAIA 3CO2A 4BQ3A 1G9BA 1WW6A 2RS33 1UO9A 3HR9A 2YFZA 1B35C 2ZOEB 4R52A 2ARBA 3BALA 4WZCA 3I7DA 4QPIA 1IPKA 2BNOA 2ZX4A 2O0OA 2XHNA 2WO2A 4CVUA 2WA3A 5JPMB 2MEV2 2I74A 4GMP0 4IV1C 3RMYA 3VBRB 5A3WA 2B42B 1WLWA 1F35A 3POFA 3C2UA 4JTOA 3HBZA 5D2AA 4XF3A 1RUC2 1JYWA 1AR63 3B94A 4HSJA 4XABA 2AREA 2ZX3A 1MEC3 1RC6A 1R1A2 3PU3A 4Q4V1 2QKDA 4EZHA 4B29A 4BQ1A 4BIFA 3JZVA 5FYMA 3BTYA 1VB4A 5T54A 2BOJA 3LSDA 4FPLA 3VBOC 1ULDA 2HWD2 5F5AA 5I0UA 3IAQA 1VRH3 2R072 4YWAA 3EHKA 1SCRA 3VKMA 4B4RA 1QJY2 4AGRA 2R062 4I0AA 4RS5A 3MW3A 3T0AA 2BNNA 2V5YA 4LE3A 4A7KA 4LBQB 5LBEA 3WW2A 4XFFA 3VL8A 1H6YA 1LOCA 4DPNA 1XJAA 2NP0A 1FATA 1N1TA 5ISLA 3PL0A 3PNAA 3INAA 3HT2A 4XDOA 3LOBA 3U14A 5DDJ2 3D8CA 1AF9A 2Q8DA 5HV0A 1ZBA3 2HJIA 4AI8A 1S4CA 1F4HA 2RS53 2X10A 3T4HB 5CFDC 1TME2 5DAXA 4QPWA 3Q8EA 1HN1A 3KLSA 3UETA 1REEA 2BVBA 3POGA 5JSOA 2ZPXA 4Z92B 1NKGA 2O14A 1LOFC 3BB6A 2YXSA 3L9JT 3M3CA 1R091 2PHWA 1UXZA 2OXBA 2PHXA 3DPRC 3LIHA 3WUDA 3B9IA 2DVAA 1UWWA 1FV2A 2VOXA 4GB33 5DZFA 2ATFA 2UY8A 2ORZA 3AKPA 3AP5A 4AGVA 1H8TC 1DFQA 1JOJA 3WVJA 1EAH1 3WD5A 4WZFA 1JH5A 3J7NA 2AC1A 3DYPA 1ZREA 4KL1A 3OD4A 3ACLA 2OPKA 1Y3TA 2OS2A 5JXGA 2FDFA 4DXZA 4J1XA 2OZ6A 1PZ9A 2Z42A 4DUWA 5J1XA 3D0JA 4PCRA 3WXPA 4B3NA 4PDWA 5FO7B 2XL9A 3VBRA 1V0AA 4XAAA 5GLZA 1Q8OA 1X36A 1RTVA 3QH7A 4XBNA 2XJRA 5C3OA 1XU1A 1YIPA 5AC92 2WO3A 1W05A 2R043 1TNRA 4JZRA 1EV11 4K7JA 4OUEA 5H9RA 1W0OA 3RZZA 3WLUA 1XB9A 2GNTA 4CCDA 3CKHA 1FMD1 3KWVA 3PIGA 3TB0A 5C3SA 3AZVA 3BYWA 3KF3A 4DUVA 1UOJA 2ORXA 4EN9B 4CP0A 2J1UA 1K5JA 1XSRA 1JUIA 4E4ZA 3QD6A 4MXWB 4LBQA 5BV6A 1VBC1 2V73A 1VE0A 3EJKA 1GLHA 1I5PA 2DVBA 4AQTA 1PK6B 4ITCA 2BRTA 1DZTA 5HCFA 1UN1A 2JG9B 3J8F2 5GM0A 4ZXKA 3VGIA 4EE2A 4COWA 1IOAA 2XBO2 5LBCA 3IIAA 2VU9A 4E2GA 1FOD2 2UU8A 1CAXB 5B4XA 4CDXB 5FYCA 1MR5A 1Q43A 3DN7A 4WM8C 1D2SA 5JVVA 2W1WA 3NQHA 4ZS2A 1QMJA 1Z7S2 5FZ6A 1UPIA 5L7OA 1QOTA 3ZIWA 1WLCA 2Q30A 1CIWA 2VMCA 4JGYB 4LK6A 4LTAA 1RMU3 3CU7A 2G4IA 2WNVB 4RFRB 3WG4A 4IGOA 3FWEA 4Z2WA 1IZ3A 2XHKA 1IS6A 1KFXL 3RSJA 3WCSA 4KI5M 2EXIA 4HLTA 4BK5A 4YG6A 4IEPA 1RB8G 2A75A 1RUD2 4NE9A 1C28A 3VBSB 1BXHA 4Q0VA 3AJZA 4CEYC 2GH8A 4YGCA 4OYUA 1MS8A 1APNA 1NCRB 2VE1A 4FVVA 2J1VA 5IW0A 3KHCA 1PO13 4GXLA 4H55A 3DGTA 3O0XA 2FDHA 3WG1A 4NO4A 4R4ZA 1HB3A 4ASKA 2ADEA 5FZ4A 2YYOA 3USUB 5HXMA 2GC2A 5F3CA 4CDWC 3KV4A 1GZCA 4LKSA 1POV3 4Q29A 2VW2A 2WS93 4B4PA 1HRI2 1UCXA 3AZYA 1YFWA 2D6OX 2HWF2 3ZXFA 5LW9A 2JDMA 2NM1A 3NAPB 3H8RA 5J7MA 5DZGA 3GALA 4YM0A 2OYZA 1HW5A 2RS12 3PLQA 5F2SA 3I59A 4LO4B 5K7PA 1PMIA 1YWKA 5FOBB 2WABA 1VMJA 3J7HA 1RUF1 3MIFA 4PQQA 4Y4RA 1PVC2 3I49A 4MXWA 3MIDA 4JKLA 3VDDB 3M3OA 5GZCA 1X8MA 4XF1A 5JPNB 4I02A 3CIHA 2JG8A 3WNXA 3NV4A 3HAGA 2F4PA 2JG9A 2UY9A 5CKQA 2P6CA 3I3BA 4LA2A 5FY4A 3OEAA 3VDBA 3LB9A 3NRUA 4GMP1 2D3PA 1D4M2 3RPQA 4QKNA 4AHZA 4OI0A 3JB8A 3IT8A 1CAXA 1DGRN 2C9AA 2DUPA 1N1SA 3UKTA 3POWA 2BGPA 3NJXA 1S0GA 2QQWA 1GV9A 2BW8A 3T2TA 4KU7A 4TWTA 4KG0A 2IXJA 3GF6A 4KMQA 5T50A 1UOGA 4MVTA 1VBB1 2EXJA 4JGYA 1IKPA 5FBZA 5CG8A 2WIIB 1MS9A 5CAZA 3SITA 2DBIA 5A3MA 4CU8A 1KRIA 2VVEA 4DUXA 4YM3A 4PBOA 3ZKUA 1TEIA 4JRLA 4PIYA 1UU5A 2XMLA 2X29A 4XHBA 2VOKA 3KMHA 2QZ2A 3SMHA 4MSVA 4COZA 1WW4A 1HQWA 5FP8A 1U5IA 1H1AA 2R7EB 2ZMLA 3VKOA 4P9XA 3VBSA 1W06A 1VLNA 1PIV2 3FLRA 2SLIA 2AENA 1NCRA 2Y33A 3LIGA 1UU6A 3A7QA 4MO3M 4P9YA 4K1ZA 3ITQA 5FY1A 1RJ8A 2DTYA 2JE8A 2JKBA 4YVWB 1QQP1 1ND2A 3OBAA 2ZX1A 4C0HA 2E31A 1W6MB 4QQ2A 2UYAA 3CL1A 3O12A 4IEZA 4M0NA 5FYSA 5IFPA 3USUA 4JHTA 5AFBA 2XPJA 2PELA 4ARXA 1A78A 4YARA 5JUVA 4NRQA 2W2IA 3C7EA 4MUVA 3J4UH 4EWAA 3BKZA 1LB2A 3WP6A 5LY1A 2GAUA 3OGVA 3B5LB 4OQ8A 2Y6KA 3O1SA 5JZGA 5JI9A 1XOYA 4AZZA 1YI9A 4W6WA 1F2NA 1ULPA 2ZBJA 4UT5A 4A41A 1WWYA 1D0HA 3ZDVA 5KXCA 1UKRA 5I8YA 4FPOB 1Q56A 4WM7C 3BI3A 1ZRCA 4V2VA 2HWE2 3T3YA 1F9KA 2X09A 3IDBB 4QHOA 5FP7A 2UWCA 3TOJA 3WHUA 3DF0A 4R8HA 5BNOC 4DB5A 2PQSA 3TN91 3IIIA 4C1XA 2XLFA 1VPHA 3HN3A 3IPVB 4DY5A 1WKYA 2OT7A 1SMVA 2IWGB 4YW4A 3C8XA 1AR92 5FJKA 3LZZA 1JHNA 1NA1B 1YLLA 1O4YA 2QVSB 4JTNA 2J1SA 3SQOA 4DFSA 1RUE1 5A32B 2ARCA 2WRAA 2XWJB 4N90A 1QWRA 5FK8A 3I2HA 4MXVA 1G9AA 3ZSKA 2GMEA 5L73A 3PU8A 4D7TA 1W6NA 2TBVA 2DUQA 2NMOA 2SBAA 2WZR3 5GLWA 1PM7A 4BJ0A 1Q3EA 4AI3A 4QQHA 3H0OA 2ZGSA 2ZACA 2ZGPA 2P6HA 3HNMA 1GR3A 2BTVC 4M01A 1LEDA 4YVWA 4LBQD 4A7YA 1AXZA 1GMMA 3VBHB 4BE3A 4E9KA 4RHV3 3VKNA 5ABJC 1COV3 1W6MA 2ES3A 4IETA 3CHXA 3NMBA 4UXAA 2H6BA 2R0HA 4O65A 3WQBA 3CF6E 1POQA 4LORA 1AHSA 3V0BB 2NMNA 1OH3A 1NE4A 1ND3B 2Y60A 4RGGA 2W47A 5C3RA 2RR13 4LO8A 3MHZA 4FO9A 4P9LA 1C8M2 4Q1RA 3O1OA 5FXVA 4PIZA 5FMOL 2RMU1 2NYYA 1ZX5A 4QAWA 4GKXA 2WAOA 1ODNA 1NLRA 4F8AA 3I3EA 1JXNA 3AJYA 5K0UA 4IQPA 4ZHNA 2WQ8A 4FI9A 1ZBE3 1KDMA 3AX4A 4BLJA 1SLBA 3HPNA 2RHPA 2VG9A 3AMHA 4OUMA 4QT6A 2WT2A 3ABZA 1AL0G 1J3PA 1JU3A 3J7LA 2JDKA 3WNMA 3JD72 4C0BA 1H2NA 2L9LA 4K8RB 5JR7B 3B93A 2AEZA 1E5HA 4B7EA 1ZZ9A 3R4DB 1C1FA 4TLGA 2F6BA 1IPJA 3T2QA 3HQXA 5FO9B 1HRV2 4JKKA 4IE5A 5ANQA 1RITA 1SQ4A 5FZ9A 2IXLA 4E27A 5DABA 1SACA 5LEJA 3D5OA 3GZEA 1L7LA 2CWMA 2P1BA 4E2QA 1HN0A 3VBUB 4BK4A 1NA1A 4IDZA 4BQ5A 4Z07A 1JOBA 4FXKB 5AVPA 5SV5A 3GM8A 3MO4A 1BJQA 4UI9L 1E5SA 2D43A 1AJOA 1RUNA 5FY8A 2NZ9A 2ZGTA 1DLLA 3I2IA 4N7IA 5A32A 2D7FA 4COVA 5EJ3A 3H9AA 3AL5A 4QX7A 5FTTC 1Z0HA 2YMZA 3OGSA 2BOIA 1J83A 4B7KA 2JDYA 3AYEA 4WVMB 4D94A 4XJWA 4Q4V3 3ZM8A 3T08A 1MS4A 4QXHA 4FPGA 4AWDA 5E88A 1RHI1 5FWJA 4X8PA 1KITA 3THPA 1BZWA 1F15A 1ULCA 3K4AA 3R4UA 1W9YA 3VBHA 1JZ7A 1AVBA 1TNFA 4Y5Z0 4AI0A 5J37A 4GH4A 2ADDA 4Q4Y2 2RG4A 3SH3A 2FDJA 4P5YA 1W6PB 2P37A 1ND3A 2ZEYA 3VD4A 3KVBA 1CD3G 3WQ0A 4GJZA 5C8CC 5CFCB 3E97A 3WINE 2O1QA 4Z8BA 3THCA 2YU2A 4PF5A 5GZGA 5C71A 2UWAA 4GQ7A 2WL1A 4LPLA 1W0NA 4FP3A 1OFNA 4IEQA 4LBJA 3UT0A 5D21A 4EROA 1ENQA 1IQAA 5J98B 1MQTB 4D8MA 4FTSA 1CPNA 2QQVA 1I6XA 2UWBA 4AEDC 2D6LX 5L9VA 4ZS3A 1RUG2 1UX7A 1UZ0A 1R093 1F8VA 1S0JA 4CSWA 3IBMA 3HEIA 2YBPA 5BNQA 2WNUC 3U4XA 1W3XA 2D5HA 5TSWA 4YZ1A 4XACA 3MGUA 4UFMA 1EAH3 1XE0A 4MADA 2R49A 4CXXA 1FAYA 2RM23 2V4AA 1HQNA 1Q8QA 1CAVB 5LK5A 4B8EA 4X6RB 3N7JA 1NCQB 3DXUA 3R4SA 2VBDA 1RUI1 5F6KA 1QH6A 2VQAA 2Z2SB 3LFMA 5A3LA 2ZTNA 2MPFA 3DYMA 3BOWA 3OD0A 2VECA 3LA2A 3LEKA 2PLV2 4OMCA 4Q4W1 5FFOC 3F2ZA 1W6OB 4JGZC 4HFSA 4QPIC 1H4GA 4P08A 4ISQA 3BODA 2VNGA 1EYBA 3FUQA 3FL7A 3JBG1 1IHMA 2Q8OA 4Q4X1 2WQZC 1EV13 1ULFA 1S0FA 3ENRA 5EJ1B 1FMD3 3N3HA 1BK0A 1W03A 2BGCA 1YIFA 4NHXA 1FXZA 3TNPB 2QNKA 5ACA2 1SPPA 1XNTA 4HK8A 3MPBA 1BBT1 3VZNA 3G6JB 1F5FA 3PTRB 3AMMA 5A3NA 1LOEA 3H7YA 1VBC3 4OHVA 2D44A 1C1LA 3ZFEB 2YHJA 4RS5C 1O5LA 5FQ0B 1PO21 5I0TA 3S6PA 2BFUL 1PM4A 1MZFA 2ZGKA 4D6SA 1X50A 1VRBA 2QJVA 2ZGNA 3D6EA 5IVVA 3MW4A 3KCYA 4D7SA 4OLLA 4KWKA 4D0QA 3U0ZA 2B9UA 1FNYA 2YBKA 1RXGA 1W9SA 2P3JA 4IE0A 3V65A 3WDXA 1IKQA 2WBKA 1PHMA 2XQXA 1HB2A 3ES4A 2GZWA 5APAA 2DYCA 5F5QA 2ET1A 2YDEA 3LPGA 4IEXA 4W50A 5FZAA 3Q9OA 4P00B 1NG0A 2A3YA 1SFPA 2DCTA 4MGTA 1JI6A 1ACCA 4YPJA 3VKFC 5IFTA 3H50A 4FPEA 2F4LA 4AVBA 2ZZJA 5FPVA 4AE2A 1Q8SA 2CAUA 4YW6A 2TEPA 1AYN1 5A7SA 3WUCA 5I0SA 1PGSA 4OHYA 3TNQA 4N7UA 4TN7A 4N9HA 3AKTA 1DQ4A 4ES8A 4AVSA 1A34A 4DMIA 3DEMA 2VXRA 3OB8A 5CZKA 3OBRA 4LHLA 4MGKE 3AM2A 4YG0A 3T0BA 5EP9A 4YYOA 1GP4A 1UXXX 2RDQA 5A80A 2LW8A 5FK7A 1ASJ2 3KV6A 4AFAA 3U1XA 1AL23 4W6YA 2ZAHA 1UMZA 2DFBA 2A6VA 1OOPB 3C7OA 2WT0A 4ZKTB 4WVZA 3UJOA 4META 1BEV2 3LOIA 3S30A 5FY9A 2QUOA 3P3PA 1AZDA 2Q1ZB 1UOFA 2VZOA 2PHRA 4PDWC 2KA3A 4AGGA 1V9U2 4G4FA 1VP6A 2WN2A 4S2FA 1NQDA 1SCSA 3H1YA 3WF0A 5D8AA 3FLTA 1NY71 1BQPA 5C4WA 2NLRA 1I5ZA 1DBNA 3KQRA 4HSLA 5CB7A 3X29B 4AVAA 1BMV1 1WCQA 2OUHA 5FYIA 2WNEA 2EIGA 5CVRA 3I54A 1QXRA 3M7AA 1ZRRA 2HH9A 1MS3A 1AR73 1RUF3 1VBD1 1WCUA 4ONUA 3ZYHA 5F5CA 1QJZA 3Q8CA 1OH4A 4CEWC 1KXGA 1ONAA 2V5DA 2XKPA 1OKQA 3VHPA 2VNVA 2ZEWA 3WNKA 5HCAA 1OA4A 5EYXA 5FZEA 4RR3A 3K4ZA 1RUJ1 4N43B 5FLJA 3H8UA 4Q8LA 1QJU2 3OJBA 1G9FA 4HONA 3VZJA 5K8SA 1VJ2A 2PHTA 4GMP3 3IDCB 4CCEA 4O9GA 4Y1UA 3U11A 1H8VA 4XJ8A 1LULA 3Q8AA 1REFA 2B8MA 3M2MA 2J1EA 3MBWA 2DDUA 5DUUA 2FCUA 1D7PM 3N9PA 1VBB3 4RHV1 5I0RA 1AXKA 1BKZA 2E7AA 3OGRA 3SNMA 1W0PA 5L7OC 1XXNA 3GJBA 3ZXJA 2CGNA 2VBPA 4N53B 4E4DX 4AEJA 1MZ6A 2BZDA 3VD5A 2H0VA 1R081 4XFGA 2W87A 5LA1A 2WFF3 4XE9A 2YU1A 5DAVA 2A3XA 2E32A 2VMFA 4CDUB 1L7QA 5C9AB 5ERLA 4ES9A 1O3QA 3OY8B 4QPYA 3S57A 1F31A 2VUCA 3HQUA 2A1XA 4QPGB 5LBBA 2Q5TA 5JOYA 2Q4SA 5BY5A 1QQP3 4IV3B 5L36A 1O91A 4M4PA 2MEV1 4FT8A 1MVEA 3T09A 2XVLA 4QX1A 1WD4A 2YY1A 3N4MA 3CJIB 5BNPA 5LRSA 1AXYA 1V6LA 4LR4A 1FPN2 4BDVB 2GSYA 4P5HA 4Y1YA 3NNMA 4FP2A 5LK7B 1R1A1 2CNAA 4YM1A 1LHNA 1K5MB 1GWLA 5CKMA 5C5TA 1PZ7A 3N9QA 3RI8A 2HWD1 1YYNA 4N8MA 1A6CA 2QBXA 3FFZA 4A3ZA 2Y6FA 5A6QA 5AFEA 5DN2A 5F5IA 2R061 5GALA 1SHWB 5C5UA 5BNNB 4AAXA 4Q2FA 4ATEA 4MGZE 2EALA 3MLKA 5DUVA 2Y6HA 3PURA 4PT6A 2VCMA 1ZBE2 2JG8C 3WR0A 1OVSA 2EAAA 5FAXA 2P34A 2A6YA 1YXWA 3TN93 1G9CA 4HN0A 1RVF2 2ZAAA 3LSEA 4FPYA 3RJRA 4I09A 4CRQA 1PNGA 4ZU7A 1TME1 1NXMA 4KBBA 4LNVA 4AFDA 4MX3A 1ZRIA 3K3OA 3KV5A 4WBBA 1W8NA 2FHRA 2YGMA 3A0NA 5LWBA 1IS5A 2KM2A 4DOUA 1XYNA 1M4WA 1SG3A 4DINB 3GBFA 4LHNA 1WMEA 1RUE3 4XDQA 3WW1A 2VZVA 4K40A 4YW3A 4LOSA 4B4QA 3QH6A 3OPZA 4BCUA 1UNBA 1UYYA 4MGSA 4UW4A 4HN1A 1V6MA 1GWMA 2JX9A 2P3IA 4Q27A 2FD8A 3LA3A 4QPGA 1TZOA 2GC1A 2DCZA 5F8PA 1E57A 1MS0A 5D1IA 4BXFA 3T1LA 4XMAA 1BVP1 2Z4FA 5F6LB 3WHTA 3MLJA 1HDKA 4MGIE 5A33B 3CEWA 4NIHA 2P2KA 4IEUA 2A71A 2X5IB 1DZQA 1NCRC 1PMJX 2LRPA 4QB2A 5JMCA 2OQ7A 1LU1A 4IEWA 2ET7A 4M3CB 5LRRA 5LCWL 2W92A 4H7LA 2OW4A 3VDAA 4BMBA 4BA6A 1ND2C 2AR6A 3ATGA 4RQPB 4OZOA 1VAVA 3A23A 4CDQA 3ZYRA 1HJFA 4WVWA 2RM21 4FPHA 1QJFA 1VAKA 4HOOA 4O7XA 3ZSLA 2RMU3 2VD7A 3DKQA 4TSVA 1CGPA 3UJQA 1UKGA 5DAPA 3VHOA 3ZFGB 4C90A 5FPAA 1F5JA 3HN1A 5KWRA 4ZY9A 2CYFA 2XL7A 3WEZA 4LXLA 4KH9A 2Y38A 3BPSA 1WBFA 3AFGA 4BU2A 1DG6A 5BNNA 3VD9A 4Y20B 1HIXA 4WV8A 3T4VA 2HEWF 2C24A 1TE1B 4AVCA 1RIRA 3ZO0B 1DYKA 1TMF2 3IKWA 4BQ4A 4YVSB 1S2KA 5CYYA 2CL2A 1IG0A 3J8F1 2X05A 1W8UA 2FZ2A 2BERA 1HLCA 2XBO1 2Q0AA 4RFT0 4XDPA 5FZ0A 2ZJCA 4I3PA 4MZUA 1OXCA 2JB4A 4S2DA 1CJDA 3FHAA 1QY4A 1GU3A 4LIVA 4XJUA 4CUCA 5IATA 1QKQA 3KT1A 3MUZ1 3HD8B 3TYJA 1LR5A 2GNDA 5M0TA 1CWPA 3LWCA 2K46A 4XCAA 1KJLA 3HVDA 5DQ0A 5IK7A 1MZ5A 1OT5A 3LGRA 4PJYA 1YFXA 3ZSMA 1LECA 5C3PA 1C8NA 1W8FA 3OBTA 2P5BA 1B35B 4Y1XA 1LOBA 1YJKA 3O1PA 1QOSA 4IEYA 4GKYA 3AK0A 4UFJA 1DQ1A 4QDQA 3CJXA 5A7WB 1ZVFA 1DF0A 4IE6A 1RINA 4IV1B 2RDRA 1HQLA 1PZ8A 4QDSA 1RUD1 1Y43B 1RHI3 4AI2A 3M3QA 4LBOA 2Q8CA 3FHIB 1N1VA 5A3PA 1HXS1 5T3NA 1O3SA 4D69A 4PF1A 3NVCA 1G6NA 2GP5A 3KQ4B 2HBTA 5F39A 4EN8B 1OLQA 2ZHLA 1JYTA 1EUTA 5IWFA 4FAGA 3AC0A 2JD4A 2A73B 3SISA 3VBOB 1T2XA 2DBNA 2HKXA 1GNYA 3V56A 1HRI1 2JE7A 4NPLA 3OGGA 4YSFA 2HWF1 3RQ0A 5JR2A 2R0FA 5FYUA 3VZOA 5I8SA 1H0BA 4XIOA 3KB5A 2RS11 1AL21 2B9VA 3OUIA 2LS6A 1YO8A 2FMDA 2K9ZA 5HV4A 3E5XA 4ARYA 5FY0A 2DV9A 5K0UC 1PVC1 2IXCA 2XR4A 1OUSA 2A70A 1CVNA 4M3CE 2KR2A 4QU1A 4F7ZA 1QJX2 2J22A 2JDZA 4LO6B 4C8DA 3WNPA 4YVSA 5CFDB 2QDNA 3LA7A 2WO7A 5SV8A 3ROUA 3BIEA 3AYAA 4UFKA 4UFIA 1N3OA 1D4M1 1LOGA 1YI7A 2B7YA 4GWJA 3PUHA 1JMUB 1CN1A 5F1RA 4XXAA 3DPRB 3GGLA 1AR71 4XAEA 2Z69A 3EQEA 1G7YA 1RUI3 2A7AA 4OCTA 1Q8PA 4XBQA 3PUAA 4YZ3A 5A7NA 3SC7X 3SH4A 5K9YA 3GJAA 4Q4W3 1HKDA 5FZHA 1PK6A 4RSUA 1NA1C 2V4VA 4Z82A 4HK9A 4WVVA 1LRHA 5EYYA 1F4AA 4UF0B 3JBG3 5ANNA 1OMIA 2XQRA 4CDXA 2VTFA 4Q4X3 2PN5A 2OIIA 3OG2A 4IV1A 2PQQA 4U2AA 3LDKA 2HWC2 4S2GA 1U5XA 4YM2A 2CHHA 5AVAA 3RYKA 3ST7A 1PIV1 1LHOA 4XUNA 4S2HA 1GQGA 4JKMA 4BH9A 5F37A 2YZ4A 5K4LA 2ZCWA 1RUH2 1BBT3 2ZHNA 3ELNA 5BPXA 2WNVA 4A4AA 4DY3A 1XYOA 1AR82 2AEYA 4BZ4A 4I0WB 5DMYA 1GP6A 4I0BA 1YEWA 1X33A 1N3PA 3OUHA 1YQ8A 3KCXA 2VOVA 2WFF1 4GH4C 2BWAA 2XXZA 4OI2A 5B4NA 1JYXA 4IE7A 4L11A 1VALA 3C7HA 1PO23 4HXCA 3B01A 4HANA 4CU7A 2ENRA 4HT1T 4MHUA 4RD7A 3U37A 1DGLA 1CX4A 2D3RA 2ZZQA 3M8LA 4W8JA 1AYM3 1UZZA 1H4HA 3I3QA 3LCPA 5EV7A 5KXDA 4FFGA 3TEWA 4FOQA 1XYPA 3AMQA 4EZ4A 3PVEA 4JC1A 2CY6A 1NZCA 5CG9A 4QM8A 2N7GA 3RG0A 4RGAA 1KS5A 1LEMA 2XJUA 4NHKA 4GD4A 5T55A 1ZRFA 2E63A 2IZWA 2WWSA 1UMIA 2HWE1 4WM8B 2E6VA 1WW5A 2D5FA 1AYN3 5DG1A 1CAUB 3JU9A 3NAPA 1UMHA 5C33A 3UV9A 2A6ZA 3NV2A 4BWOA 5A70A 1N47A 2HBUA 3LKJA 4LUKA 2XUEA 4OI4A 3BU0A 4FFHA 2XH6A 4SLIA 2JIGA 2ZEXA 1YQCA 5EXOA 3VDDA 4LITA 1ZNPA 1X9PA 4OI1A 1NLQA 4H3WA 3GCWA 3HIFA 4XCBA 3K4DA 1KFUL 5FWEA 3U75A 1VBA2 3CLPA 4NHMA 5IK5A 4CP9B 2G1MA 2J1TA 1PVXA 3T2OA 2XONA 1PX3A 3UKNA 3RZMA 2D93A 1WCKA 4QWNA 4UF0A 4YGEA 5EPAA 1SLAA 2C4XA 4KWUA 4CEYB 4XUQA 1OI6A 2VL4A 3USSA 2D98A 4CUBA 2WFPA 1KEXA 2DFCA 4NWVA 3VB9A 5KC5A 1GZ9A 5EZWA 1LU2A 3IZOA 2VMHA 5L9BA 3ZDSA 3RJ2X 4ZU5A 1LGCA 3ZR5A 4CCMA 2BU9A 2PFWA 4HPKB 5HXVA 2JDAA 1GOHA 4QX2A 4CDWB 2C5DA 5CIRA 1VBD3 1MZEA 3MIGA 3D3AA 2ID4A 2GMPA 5FZLA 4B1LA 5I93A 2BPA2 1KS4A 4CPBA 1SLCA 2VZQA 4JQTA 4EWEA 2VXJA 5HPOA 5A6XA 1OBNA 1QNYA 1UY1A 2RS32 5FJHA 3R6SA 1RUJ3 3OGJA 2HWB3 3G7DA 4ZZ5A 3FLPA 3QLQA 3SCFA 3W21A 2JD9A 1C8M1 1W3VA 1EY2A 3RDIA 4ASMB 4RGKA 3IWZA 1VMFA 1QEXA 3VZKA 3LEGA 4NHLA 4NPMA 4PLOA 4L2NA 3THTA 1GWKA 3K51A 3A0KA 3W5MA 2WT1A 2D40A 2JJ6A 1BLZA 2W95A 4XW3A 4JVAA 2VM9A 4AQ2A 3MUY1 4UW3A 3WT3A 2ZX2A 3Q8FA 2W08A 1AR62 1MEC2 3JD71 4NAOA 3CMGA 3RYRA 4XJZA 3VV1A 1FNZA 1VBE3 1VR3A 4KBZA 4LIUA 1CAUA 3FMGA 4KQ7A 2J42A 1R083 2GH2A 1VRH2 2PAKA 3LD8A 4CCJA 1CESA 1J59A 5T5OA 3PVOA 1HRV1 4NUBA 4LJHA 1H30A 3N36A 4Y1VA 1SLLA 1UZYA 5FZMA 3AP6A 4HKWA 4OQ9A 1R1ZA 1ZZ6A 2ZGLA 4LUMA 4JX0A 2Q8EA 1H9WA 4D7YA 1PGL1 2YGLA 1OQ1A 2EVXA 3NNJA 1DU3D 3T0DA 4KNCA 3V64A 4X6QB 1QDCA 2CTVA 3I2JA 2BV4A 3WF4A 1OVPA 2B5HA 2MEV3 3SEEA 1O7FA 1ZBA2 4RA0A 2RS52 5KHHA 5A7PA 2GN7A 1H9PA 1SEFA 2QTWB 3MV11 4XXPA 4K8FA 3IPVA 5F2WA 4KU8A 1SLIA 1RUC3 4QU2A 2OVUA 4IGPA 1E5RA 2Y64A 3P3NA 5D8AC 1R1A3 2JWPA 4QX8A 5C4WC 4XQWA 4HPKA 3D4KA 4M3CF 1DLCA 4GB32 1CPMA 2UURA 2XJVA 4G3YC 4AVTA 5G04L 5JOZA 1FV3A 2X8KA 2HWD3 2R073 5FKCA 4XILA 5C6CA 4IE4A 3WNNA 2R063 5JMOA 4Q4Y1 1Y9GA 2JE9A 2VTXA 4NRMA 1U0AA 5BYNA 2Z79A 5HBAA 1OHFA 4MGQA 5FZCA 1DDLA 4D6QA 1QH7A 4QXBA 2BWCA 4TXWA 1PX4A 2YC0A 3ZYBA 4QXCA 4EWDA 3BTZA 1MS5A 3WF3A 4RR3C 2JICA 3LPFA 1GUIA 4F83A 2VZRA 4OMDA 5JI7A 2WZPP 3ZYFA 3ZXAC 3POIA 2PHLA 5LA9A 4IEOA 1GZWB 5DDJ3 3OOXA 4WM7B 5JWPA 1J84A 3GBWA 4X8NA 1CAWB 4K1YA 1JYCA 1TME3 4EQVA 2GC3A 5IK4A 1AUYA 3WG2A 2R042 2BYVE 1U5YA 5BNOB 1ZA4A 2EF6A 3DCQA 3GBGA 3V0BA 4XIKA 1RUG1 4XJAA 3O1VA 5IVCA 3ALQA 3QBQA 3RRDA 2YPJA 3L2HA 3R0RA 3V0AB 3ZIXA 2QE3A 4RN5A 2WN3A 4OFGA 2IUWA 4QD2A 3CNAA 3NJYA 1OLME 3S5QA 1ZZ7A 1G86A 3AFKA 2W9XA 2DURA 1DGRA 1JZ2A 4AI9A 5T5JA 2RV9A 3I97A 4BQYA 5FZ7A 3VDCA 3FC0A 3M4FA 4GWIA 3THDA 2B39A 3B69A 1W9WA 4XETA 4D6RA 2R16A 2KXLA 3B3QE 2I2SA 2DVFA 5F3EA 3PTYA 3LE0A 4O9EA 2PLV1 5IVJA 2W39A 2HEVF 1S0DA 3GXUA 3WF2A 3KGLA 5DUWA 4FQ4A 5F3IA 1JYVA 2WYSA 1S55A 2B45X 1FT9A 3VD3A 4RYDA 4JDOA 4BQXA 1KJRA 4BPZA 1GKBA 2NQYA 2YG0A 1CQ9A 1Y9MA 3I2DA 4M0HA 3VBUA 3ON7A 5BNPC 1RMU2 1IS4A 4NIDA 3VBFC 1YFUA 3ZPOA 3ZFFB 2RJKA 3FBMA 5FZGA 1V6KA 2VNOA 1UPSA 2E9QA 1ULOA 2VQ0A 1WA6X 3WDUA 5ACA1 1UY3A 3QOPA 1W8TA 3T30A 3DL3A 3BOPA 3CQOA 4XUOA 3NKTA 3ZN4A 1ZM1A 2CGOA 4AVVA 4D3WA 1JYIA 1W2UA 1YQ2A 4XZPA 3OCPA 2WINB 3O1RA 3N9OA 4PLMA 4CA9A 4FOWA 2QQPA 4BISA 4LO5B 4CP1A 3ZN6B 2XGXA 4WVMA 1OLRA 4ZXEA 3J8F3 3O1TA 5F3GA 4AQSA 5HCHA 1PO12 1XNBA 3MDPA 2XBO3 2G19A 2UYBA 4WM7A 5IAVA 2VNRA 2WQ4A 4C1WA 1CAWA 3VL9A 4M4RA 1JW6A 4V2WA 3LFIA 4EN0A 1SDWA 1S2EA 1Z7S3 3WF1A 5A1FA 2PHUA 2VZ1A 1W6PA 2W1UA 3VKLA 3UNPA 2WS92 2EICA 4CUGA 3ILRA 3RS6A 5C8WA 1Q5OA 3B9CA 5DUXA 5CFCA 2VQUA 1XE8A 2WLPA 2W94A 3BGAA 4DEVA 3V0AA 1H2LA 2VC9A 2WR9A 3W59A 3VBFB 1QJEA 2R1DA 1RL3A 1KDKA 1LCLA 3CDZB 1D0GA 1N1YA 3TEZA 1AYM1 1K42A 2VMEA 2P3YA 1MQTA 2D6KA 4Q4W2 3PJQA 3ZYGA 5CBLA 3HNYM 1BYHA 1RUD3 3MFCA 4DRRA 1K45A 2TNFA 4K6BA 2HLEA 4QKDA 1ASJ1 4XFAA 5JIUA 4COYA 4CPBD 1HXS3 1I9RA 4Q5OA 1ZZCA 1K12A 4EJRA 3J7MA 1FYUA 4LOTA 1W2TA 1BEV1 4UW6A 3AB0A 3WCRA 5E8AA 1V9U1 3ZXLA 2ARXA 3T2PA 5F7UA 1L3JA 4QGLA 3WDWA 3WP5A 4L0PA 4YW7A 1CAVA 1HRI3 1NCQA 3ZFFA 3TBDA 2HWF3 4CDQC 2Y6LA 1JZ6A 4XBLA 1LNSA 3WNLA 1BVVA 2RS13 1WCSA 3MFAA 5C8CB 1CX1A 1W6OA 3JXSA 2VMIA 2ZMNA 2Z5WA 1PVC3 3KD4A 4XZUG 3EB7A 4JV4A 4CTEA 5GZDA 3VBRC 1IS3A 2VZUA 4P9WA 3ZN6A 1CZSA 3O0VA 5FOJB 3N7KA 3ILFA 1DHKB 5IUQA 1SBDA 1TQ5A 4AEDB 1D4M3 1HV1A 3O0WA 4XQ4A 1BK1A 1C4RA 5FRAA 2XWBB 3K48A 4ASLA 1V6IA 2NN8A 2GDFA 5FYBA 4KGGA 2WNUB 3ZX7A 2VW0A 1GNZA 3JQWA 4GIQA 3ZFEA 3DXTA 2ARAA 5C7GA 5FQ0A 3PMSA 1YC61 3KZ4C 2Y0OA 2OPWA 2HWB1 4Q1PA 5T52A 4SBVA 5FYTA 4NHYA 4Q26A 2OKXA 1Y7BA 4Y22B 2Y6GA 5FUIA 5B2GB 4UAPA 2C1FA 3LDRA 4XFBA 5IVBA 3H7JA 4BYYA 5JDBA 4NR1A 4A6OA 4JGZB 4QPIB 1GP5A 1OD3A 4AAPA 1GFF2 4Y5TA 2PMWB 1PIV3 2RVAA 4L99A 2HYKA 5FV3A 5FZFA 2GMMA 1A3KA 1WUVA 3I4IA 3NSTA 3KV9A 1OSGA 1PGW2 1J1LA 1IG3A 4HZFA 4ZU4A 1VBE1 1NY72 1W9FA 4I30A 3OYWB 4CZSA 1BMV2 4CCCA 2WWJA 3FHQA 3C7GA 5FZ8A 2PA7A 2HEYF 1QF3A 2VQTA 3GZUC 3SLIA 4QQPA 1NQJA 2AUYA 2VCAA 4AXOA 4YW2A 3NNGA 1AX2A 3PVBB 1VBD2 2WJSA 5LA0A 2BBVA 1O3RA 3AYCA 4ISRA 4TLFA 1ZYBA 4Y33A 5IJRA 2GNBA 3VN4A 4CUAA 1XNDA 4NOTA 4RS5B 2GNMA 2J1AA 2EIEA 3PIJA 1OOPA 4P02B 3WOGA 1WMDA 1MVQA 3K3NA 4J1WA 2D6MA 4YNIA 4PI2A 3ZOIA 4BB3A 3W5NA 1JZ4A 5FPBA 3GCXA 3POSA 2WZR2 5H9PA 5KHJA 3GDBA 1J3RA 3I2KA 4XTMA 3LEMA 5FBJA 3SH5A 3PDQA 1B09A 2HWE3 4BOWA 5CADA 1W04A 1RUC1 2PHDA 5FPXA 5J3UA 3H8XA 4FAHA 5FZDA 2AH2A 1G8WA 4RHV2 2BP6A 4XC9A 1COV2 1W8OA 3U78A 5A6YA 1RVF1 5LASA 1OFSA 1W9TA 5DG2A 2R071 1EPZA 3TWIA 2J7MA 4XF0A 3KGZA 4QHZA 1QJY1 3MF9A 1RYYA 2RR12 1LHUA 4LT5A 2VUDA 2VTXJ 3NV1A 2ZMKA 5DXDA 3NW4A 2VZSA 5KHIA 3RZHA 2XVGA 4N43A 4XHXA 1VB2A 3RVHA 2XB6C 4AFMA 4AW7A 5JXIA 2CDOA 1X9TA 1LAJA 4MOAA 1ZRDA 1D2QA 1PK6C 4IW3A 5EIYB 2DTWA 2JG9C 5LBFA 1LENA 4OUSA 1FI2A 2VOWA 5DDJ1 1GANA 3WDYA 4CP2A 1H1IA 4JGZA 4CDXC 4O61A 3WP3A 4PDWB 5FPZA 3WNOA 4LE4A 4ORFA 3VLBB 2E7QA 1E5IA 4CXWA 3N7LA 3O7OA 5A1LA 2BEOA 4Q0UA 4CU9A 3OYWA 3PUSA 4JGYC 4N53A 3UL2A 1P8JA 4Y4YA 4CDUA 4PI0A 4K21A 3S7EA 2J1RA 1HV0A 1QU0A 2WNVC 3AXEA 2B4KA 1UL9A 2G9GA 1DQ6A 3QCWA 4ZPIA 3ZXKA 2CGPA 2ZGUA 5C9AA 3WW4A 1QOOA
chains in the Genus database with same CATH topology
3OY8A 2WSVA 4LEJA 1C8M3 1EPWA 4YGBA 4CEWB 4AI1A 1W6QB 3HMYA 1GQHA 4GULA 3VBSC 4XTPA 5L19A 4IV3A 3WV6A 2WC2A 3SCHA 1ZZ8A 4AF9A 4K3UA 3CJIA 3JD73 1UX6A 1A8MA 1DQ0A 4Q4V2 4YZ5A 4FTEA 4V1PA 5AC91 2X53S 1TMF1 3GZTB 4L92A 1C57A 4BM8A 1UW8A 5KHGA 1K5MA 1O5UA 4AEMA 1V6OA 1HRV3 2ZX0A 1FX5A 3NAPC 2WA4A 1QXPA 2DVDA 5L7OB 3GYDA 4P9GA 4MV2A 2YROA 4LLFA 5JZGC 5KHKA 3ES1A 3VDDC 4KG8A 4LBKA 3B00A 1S1AA 3S7IA 3WP4A 5JAXA 3RWNA 2PAEA 1LOAA 1FOD1 3T1MA 2ZGRA 4XQDA 4IESA 3ZXEA 3MI8A 1R092 1Z7S1 1D4VB 4HMZA 1NOVA 2DUOA 2VULA 3H3UA 1ULEA 2D6NA 3EXUA 2VH9A 4FOVA 1EAH2 1LHWA 2FQPA 4Q4Y3 2RM22 4QGNA 1V6NA 4OHZA 3ZVXA 3VUOA 4XPVA 5FCCA 4CEWA 5J09A 1W6QA 3I59B 4XMIA 4FBFA 2R32A 3WDTA 3BPZA 4EV0A 1RJ7A 5A33A 2CV6A 2X5IA 3FX3A 3ECQA 2LM3A 4FTBA 4AFCA 4M3CA 2VGDA 2ZHKA 2JG8B 1EV12 4YVWC 1X8EA 4RQPA 1RUG3 2K0GA 2I45A 1FMD2 1LHVA 1J58A 1DGWA 1QJX1 1YHFA 1DQ2A 3GHNA 1ENSA 2EAKA 3ZFGA 2ZKNA 2LTNA 3QACA 1VBC2 3GNEA 2K2SA 4I3GA 4XYXA 1GICA 4E2SA 3ILNA 4Y20A 5DZEA 3B7MA 3JB4C 2D97A 4DRVA 2AZ5A 2V09A 4LBLA 2PLV3 3BTAA 1LESA 4YW5A 3ASIA 4YGDA 5GLVA 1OQDA 1QGLA 4R9CA 2VPVA 3MEPA 1HXS2 2HWC1 1X82A 4LHKA 3L2YA 2JENA 1AJKA 4XFHA 3NL1A 3KSCA 5KBFA 1H8TB 3PJYA 1ND2B 5ACA3 1RUH1 4BIOA 1SLTA 2AGSA 5EFUA 1AR81 3AKRA 2FZ1A 1B35A 1X7NA 5FLHA 2XJTA 4AQ6A 3I8TA 2VUJA 4P9IA 1AL22 2AYHA 4P14A 4A7ZA 2ZHMA 2NPIA 3FBYA 3J9SA 1OPOA 4AFBA 1W39A 3PHMA 1S0EA 3JQXA 2D6PA 1O4TA 4FQZA 3AKQA 2VY0A 3VBHC 2O8QA 3VBOA 2BNMA 3D0SA 2EA7A 1ND3C 3UK9A 3WQ1A 3MYXA 2XVKA 3OF1A 2G9FA 1AR72 1ENRA 1RUF2 3ZXGA 3AZXA 3H1MA 5FMOS 3DV8A 4FXGB 4OHXA 4OVEA 2IC1A 2VUAA 1LKNA 1ASJ3 3ZN5A 2IXHA 4XFIA 5CFDA 1VBA1 2XLGA 4A3XA 1BEV3 4I2OA 4LO7A 5GKAC 1V9U3 1W6NB 4HVOA 1LOFA 4R4XA 1VBB2 1UF2C 3DPRA 1JN2P 2BQPA 2QZ3A 1QHDA 1WMFA 2IXIA 4E4SA 4H7MA 5J48A 1POV0 1H8TA 1ALYA 1S0CA 3NJZA 4Q8KA 1AR91 1VAMA 3VBUC 4QX5A 1C3HA 4YZ4A 5FREA 2WFF2 3MIBA 4MLOA 2I07B 2C0ZA 4K9SA 3O5SA 3TRSB 4EN6B 1XU2A 1YNAA 1IGOA 3PMEA 2RS31 2QFEA 2YV8A 2XJPA 4FPJA 4HBNA 4KGQA 1AX0A 1MACA 5T5PA 1QJU3 1V6JA 2DF7A 1I3HA 1LGBA 3NO8A 3VHRA 5K0UB 1QQP2 4Q0QA 3FFQA 4L8QA 3WQ7A 4EN7B 4DNYA 4BHPA 3JCIA 1AR61 3J26N 1MEC1 2XG3A 4Y26A 2IFWA 3AKSA 4FOYA 3RMXA 3E6DA 3AP4A 2FBEA 2VMGA 3ZYIB 1AX1A 3MF6A 5CFCC 2H6CA 4GALA 1VRH1 1S0IA 4YW1A 2OZJA 2LUWA 2XUMA 3RNSA 4MGYE 1NYWA 4QGMA 5GLTA 5JOXA 5BUVA 2MHFA 1C5IA 4UW5A 1MQTC 3BU7A 2ZABA 2ZGOA 4QM9A 3AP7A 4XFCA 3W58A 4AEKA 4NPRA 4WM8A 3OTFA 3TN92 1YUDA 4DQAA 2RJLA 3MW2A 3VZLA 1ZBA1 3ZXDA 2RS51 3WDVA 3AMPA 3A4UA 4HETA 2PYTA 5JOWA 1WW7A 4C91A 3WY6A 2VW1A 1FPN3 2IFRA 2PAMA 3AZWA 4IXLA 1H1MA 2EXHA 1XE7A 3GHMA 4JQRA 3E6CC 4HVRA 1RUE2 5KC6A 3ZFFC 1NCQC 1QXJA 4GB31 4GH4B 5JSRA 3LAGA 4YLZA 1EP0A 3M3IA 3M3EA 4LBNA 2H0BA 4Q0SA 4CYDA 3KT7A 4OHWA 3UKVA 1DQ5A 4CEYA 4YG3A 2WKKA 4AHXA 1U12A 4LBMA 1JTZX 1O3TA 2XKOA 1UIJA 4K20A 3E6BA 4GWMA 2OA2A 2ILMA 1MS1A 4YFWA 1N3QA 5GZEA 3SXWA 1RVF3 4CDWA 4QMAA 3TAYA 3MICA 2MNGA 5JCTA 1DIWA 2BVVA 1QJY3 5H9SA 2BUKA 2R041 2O8OA 2A6XA 2QCSB 2RMU2 2A6WA 1QNWA 1URXA 4P9JA 4YFZA 1SFYA 2WSUA 1WD3A 4I01A 3ZFEC 4KWLA 3NV3A 5E16A 2WLQA 4HKOA 4KWJA 5JSPA 5E89A 1PGL2 2BFUS 1Y9QA 3C3VA 1XQNA 4BMEA 3KS7A 1DZRA 3D82A 5BXXA 4QQOA 1LJ7A 5EWSA 3ZPYA 3IMNA 1VIWB 1HX6A 1OD5A 3AP9A 4COUA 3AXDA 1NE6A 4HKLA 2OUJA 2VVDA 2DU0A 3IDEA 2FMYA 1T6GC 2JECA 1S0BA 4LA3A 1RMU1 2P3KA 4A2UA 1XNKA 2DU1A 2ZA9A 1YFYA 2A5ZA 3AZZA 1OA2A 1H2KA 1CJPA 2W68A 1OOPC 1C5HA 1XNCA 4BLIA 5IK8A 1GBGA 4LULA 3S0MA 5AC93 1RHI2 3KM5A 1TMF3 2DCJA 4OZXA 3POYA 4FSJA 2DVGA 5ABJB 1PO11 2CAVA 4R9BA 4F3JA 3WW3A 2LALA 5KXBA 4FPKA 1J1TA 2ZS6B 4JDMA 1JUHA 3MLLA 4URTA 3M70A 5CA6A 3ZSEA 4AK3A 1POV1 3WG3A 1ZZBA 2WS91 4HVQA 5LEKA 4GWNA 4HL0A 3NKGA 5CU1A 1RUOA 1S2BA 2D3SA 5GJ6A 4N43C 5JLVA 2QDRA 2A3WA 3DUIA 1GZWA 2DCKA 4LLOA 1FOD3 4GA9A 4FCAA 5JIAA 3IN9A 1O4ZA 4Y24A 1V70A 1U5ZA 2TUNA 4Q0PA 5BNOA 3KCCA 2VVFA 1SFNA 3ZYPA 4Y1ZA 1XRUA 3ZYJB 1BCXA 1V00A 4PQ9A 5D8AB 4IEVA 3U07A 3E5QA 4W6XA 5C4WB 4N53C 5J36A 1A8DA 4XOGA 2ETEA 2YUEA 1RUI2 1YJLA 1CR7A 1Q8VA 4AG4A 1ULGA 2GN3A 3KT4A 4CDUC 5C9AC 2EXKA 2GU9A 3JUUA 2R30A 4U36A 3FJSA 4QPGC 4QQLA 3ME2A 3H1WA 5I91A 3JBG2 3SCGA 3ZMOA 4FPCA 1YCIA 2ZGQA 4Q4X2 3FUOA 4RR3B 4AHWA 1OA3A 5J96B 3H3ZA 5FO8B 4IV3C 3APBA 1GNHA 4L9BA 1JBCA 3VHNA 4IL7A 5I8TA 1QJX3 4R9DA 2R1BA 2JXAA 3MIEA 3O14A 3CJIC 4AYUA 4MH0E 3MZHA 5ABJA 1BBT2 2Q1MA 1DYPA 1KQRA 3HWJA 4YZ2A 4DS0A 1YRZA 1K5MC 4JAAA 4NWWA 2E7TA 4XF4A 3VZMA 1GYKA 1WLTA 2IXKA 1SBEA 1PO22 4QXKA 2ZKLA 4M00A 2ERFA 2DCYA 3PVNA 1LGNA 2XJQA 4MYEA 5BNNC 5F9TA 3DKWA 1AYM2 1QJU1 4L97A 4PIXA 5HI0A 2W0XA 4YRDA 1OQEA 5GZFA 1UU4A 1KD7A 1WA4A 4ATFA 2HWC3 3E5UA 1WCDJ 4W65A 2E51A 1AYN2 4OULA 3BIWE 1RUH3 3MPPG 1PGW1 3URFA 3ETQA 2R6QA 1AR83 4G9SB 1GSLA 4TYSA 1WLDA 5BNPB 4DZGA 5FDBA 2GALA 2W52A 3EO6A 3FZ3A 3SHRA 1NLSA 3M1HA 4NN0A 3FE5A 3VBFB 2Y26A 2RE9A 1DGWX 3IM0A 4JRAA 3RI9A 3N7MA 5H9QA 2XJSA 1ENXA 3BCWA 1OPMA 4H14A 4JDNA 1QDOA 4UBHA 1UIKA 2PHFA 2ZGMA 4PBPA 1CONA 2P17A 4XF9A 1J3QA 3R05A 4RL7A 3ZMNA 2X5IC 2WZR1 1Z78A 4RQPC 3NWKA 4NVPA 1FPN1 5E1RA 4R9AA 1UD1A 4IERA 2DWRA 5GLUA 1COV1 2E53A 2XLAA 2JEMA 3AMNA 5C8CA 3ZFGC 5HCBA 4XJ9A 1RUJ2 2PTMA 5FLIA 2HWB2 1LTEA 3MIHA 2RR11 4JCKA 3EBRA 2B46X 1PNFA 4UBGA 1M06G 3RYPA 3WX5A 1VBA3 4PLNA 5IT6A 1I1EA 4XEZA 1WGPA 4N9IA 4FPFA 3ZSJA 4AEDA 1WBLA 1ZBE1 4YVSC 1H2MA 5T5LA 1REDA 4Z1VA 3W9AA 1NXD1 2WNUA 3B02A 1RGSA 3HT1A 4INDA 2CWSA 1VBE2 5KXEA 3N35A 1AR93 3WZ1A 1R082 4J6GA 5CNAA 3U10A 3GZAA 1SBFA 2Y0IA 3AYDA 2GC0A 4QHBA 3VBFA 1LODA 4Y22A 4CDQB 1UAIA 3CO2A 1G9BA 1WW6A 2RS33 3HR9A 1B35C 2ZOEB 4R52A 2ARBA 3BALA 4WZCA 3I7DA 4QPIA 1IPKA 2BNOA 2ZX4A 2O0OA 2WA3A 5JPMB 2MEV2 2I74A 4GMP0 4IV1C 3RMYA 3VBRB 2B42B 1WLWA 3C2UA 4JTOA 3HBZA 4XF3A 1RUC2 1AR63 3B94A 4HSJA 2AREA 2ZX3A 1MEC3 1RC6A 1R1A2 4Q4V1 2QKDA 4B29A 4BQ1A 4BIFA 3JZVA 1VB4A 5T54A 3LSDA 4FPLA 3VBOC 1ULDA 2HWD2 5I0UA 3VKMA 1VRH3 2R072 3EHKA 1SCRA 4B4RA 1QJY2 4AGRA 2R062 4I0AA 4RS5A 3MW3A 2BNNA 2V5YA 4LE3A 4A7KA 4LBQB 3WW2A 4XFFA 3VL8A 4DPNA 1LOCA 2NP0A 1FATA 1N1TA 3PNAA 3INAA 3HT2A 3LOBA 5DDJ2 3D8CA 1AF9A 1ZBA3 2HJIA 4AI8A 5CFDC 2RS53 1TME2 3KLSA 1REEA 2BVBA 5JSOA 2ZPXA 4Z92B 1LOFC 3BB6A 2YXSA 3L9JT 3M3CA 1R091 2PHWA 3WUDA 1G9DA 2PHXA 3DPRC 3B9IA 2DVAA 2VOXA 1FV2A 4GB33 5DZFA 2ATFA 2UY8A 3AP5A 3AKPA 4AGVA 1H8TC 1DFQA 1JOJA 3WVJA 1EAH1 3WD5A 4WZFA 1JH5A 1ZREA 4KL1A 3OD4A 3ACLA 2OPKA 1Y3TA 4DXZA 4J1XA 2OZ6A 1PZ9A 2Z42A 3D0JA 4PCRA 3WXPA 4B3NA 4PDWA 5FO7B 2XL9A 3VBRA 5GLZA 1Q8OA 1X36A 1RTVA 3QH7A 4XBNA 2XJRA 1XU1A 1YIPA 5AC92 4K7JA 2R043 1TNRA 1EV11 5H9RA 3RZZA 1W0OA 3WLUA 2GNTA 1FMD1 3TB0A 3AZVA 4EN9B 4CP0A 1JUIA 4E4ZA 3QD6A 4MXWB 4LBQA 5BV6A 1VBC1 2V73A 3EJKA 1GLHA 2DVBA 4AQTA 1PK6B 4ITCA 1DZTA 5HCFA 1UN1A 2JG9B 3J8F2 5GM0A 4ZXKA 3VGIA 4COWA 1IOAA 2XBO2 3IIAA 2VU9A 4E2GA 1FOD2 2UU8A 1CAXB 4CDXB 1MR5A 1Q43A 3DN7A 4WM8C 1D2SA 5JVVA 1QMJA 1Z7S2 1UPIA 5L7OA 1QOTA 3ZIWA 1WLCA 2Q30A 1CIWA 4JGYB 4LTAA 1RMU3 3CU7A 2G4IA 2WNVB 3WG4A 3FWEA 4Z2WA 1IZ3A 2XHKA 1IS6A 1KFXL 3RSJA 3WCSA 2EXIA 4HLTA 4YG6A 4IEPA 1RB8G 2A75A 1RUD2 3VBSB 1C28A 1BXHA 4Q0VA 3AJZA 4CEYC 2GH8A 4YGCA 1MS8A 1APNA 1NCRB 4FVVA 1PO13 4GXLA 4H55A 3DGTA 3O0XA 3WG1A 4NO4A 4R4ZA 2YYOA 3USUB 2GC2A 4CDWC 1GZCA 1POV3 4Q29A 2VW2A 2WS93 4B4PA 1HRI2 1UCXA 3AZYA 1YFWA 2D6OX 2HWF2 3ZXFA 2NM1A 3NAPB 5J7MA 5DZGA 3GALA 4YM0A 2OYZA 1HW5A 2RS12 3PLQA 3I59A 4LO4B 5K7PA 1PMIA 1YWKA 5FOBB 5JZGB 1RUF1 3MIFA 1PVC2 4MXWA 3MIDA 3VDDB 3M3OA 5GZCA 1X8MA 4XF1A 5JPNB 4I02A 2JG8A 3WNXA 3NV4A 3HAGA 2F4PA 2JG9A 2UY9A 4LA2A 3LB9A 4GMP1 2D3PA 1D4M2 3RPQA 4AHZA 4OI0A 3JB8A 3IT8A 1CAXA 1DGRN 2C9AA 2DUPA 1N1SA 3UKTA 3POWA 1S0GA 3T2TA 1GV9A 2BW8A 4KU7A 4TWTA 4KG0A 2IXJA 3GF6A 5T50A 5FBZA 4MVTA 1VBB1 2EXJA 4JGYA 1IKPA 5CG8A 2WIIB 1MS9A 5CAZA 3SITA 5A3MA 1KRIA 2VVEA 4YM3A 4PBOA 1TEIA 4JRLA 4PIYA 1UU5A 2X29A 4XHBA 2VOKA 3KMHA 2QZ2A 3SMHA 4MSVA 4COZA 1WW4A 1HQWA 1U5IA 1H1AA 2ZMLA 3VKOA 4P9XA 3VBSA 1VLNA 1PIV2 3FLRA 2SLIA 2AENA 1NCRA 1UU6A 4P9YA 4K1ZA 1RJ8A 2DTYA 2JKBA 4YVWB 1QQP1 1ND2A 2ZX1A 4C0HA 1W6MB 4QQ2A 2UYAA 3CL1A 3O12A 4IEZA 4M0NA 3USUA 5AFBA 2XPJA 2PELA 1A78A 4YARA 4MUVA 4EWAA 3J4UH 1LB2A 3WP6A 2GAUA 3B5LB 5JZGA 5JI9A 1YI9A 4W6WA 1F2NA 2ZBJA 5KXCA 1D0HA 1UKRA 5I8YA 4FPOB 1Q56A 4WM7C 1ZRCA 2HWE2 1F9KA 3IDBB 2UWCA 3TOJA 3WHUA 3DF0A 4R8HA 5BNOC 4DB5A 3TN91 4C1XA 2XLFA 3IPVB 4DY5A 1SMVA 2IWGB 4YW4A 1AR92 3LZZA 1JHNA 1NA1B 1YLLA 1O4YA 2QVSB 4JTNA 4DFSA 1RUE1 5A32B 2XWJB 4N90A 1QWRA 4MXVA 1G9AA 3ZSKA 2GMEA 5L73A 4D7TA 1W6NA 2TBVA 2DUQA 2NMOA 2SBAA 2WZR3 5GLWA 1PM7A 1Q3EA 4AI3A 4QQHA 3H0OA 2ZGSA 2ZACA 2ZGPA 1GR3A 2BTVC 4M01A 1LEDA 4YVWA 4LBQD 4A7YA 1AXZA 3VBHB 4BE3A 4E9KA 4RHV3 3VKNA 5ABJC 1COV3 1W6MA 2ES3A 4IETA 4UXAA 2H6BA 2R0HA 3CF6E 1AHSA 3V0BB 2NMNA 1NE4A 1ND3B 4RGGA 2RR13 4LO8A 4FO9A 4Q1RA 4P9LA 1C8M2 4PIZA 5FMOL 2RMU1 2NYYA 1ZX5A 4GKXA 1NLRA 4F8AA 1JXNA 3AJYA 5K0UA 4IQPA 1ZBE3 1KDMA 3AX4A 4BLJA 1SLBA 4OUMA 2RHPA 2VG9A 3AMHA 4QT6A 2WT2A 1AL0G 1J3PA 4C0BA 3JD72 1H2NA 4B7EA 5JR7B 3B93A 1ZZ9A 3R4DB 1C1FA 2F6BA 1IPJA 3HQXA 5FO9B 1HRV2 1RITA 1SQ4A 4E27A 2IXLA 5LEJA 1SACA 3D5OA 2CWMA 4E2QA 3VBUB 1NA1A 4Z07A 4FXKB 5AVPA 5SV5A 1BJQA 2D43A 1AJOA 1RUNA 2NZ9A 2ZGTA 1DLLA 4N7IA 5A32A 2D7FA 4COVA 5EJ3A 3H9AA 5FTTC 1Z0HA 2YMZA 4B7KA 3AYEA 4WVMB 4D94A 4XJWA 4Q4V3 1MS4A 4FPGA 4AWDA 5E88A 1RHI1 4X8PA 1KITA 3THPA 1BZWA 1ULCA 3R4UA 3VBHA 1AVBA 1TNFA 4Y5Z0 4AI0A 5J37A 4GH4A 4Q4Y2 3SH3A 1W6PB 2P37A 1ND3A 3WQ0A 1CD3G 5C8CC 5CFCB 3E97A 3WINE 2O1QA 4Z8BA 4PF5A 2UWAA 4GQ7A 2WL1A 4FP3A 1OFNA 4IEQA 4LBJA 4EROA 1ENQA 1IQAA 5J98B 1MQTB 1CPNA 4AEDC 1I6XA 2UWBA 2D6LX 1RUG2 1R093 1F8VA 1S0JA 5BNQA 3IBMA 3U4XA 2WNUC 2D5HA 5TSWA 4YZ1A 3MGUA 1EAH3 2R49A 1FAYA 2RM23 1HQNA 1Q8QA 1CAVB 5LK5A 4B8EA 4X6RB 3N7JA 1NCQB 3R4SA 1RUI1 5F6KA 1QH6A 2VQAA 2Z2SB 5A3LA 2ZTNA 2MPFA 3BOWA 3OD0A 2VECA 3LA2A 4Q4W1 2PLV2 5FFOC 1W6OB 4JGZC 4HFSA 4QPIC 1H4GA 4ISQA 3BODA 2VNGA 1EYBA 3FUQA 3JBG1 1IHMA 2Q8OA 4Q4X1 2WQZC 1EV13 1ULFA 1S0FA 3ENRA 1FMD3 3N3HA 2BGCA 1YIFA 1FXZA 3TNPB 2QNKA 5ACA2 4HK8A 3MPBA 1BBT1 3VZNA 3G6JB 1F5FA 3AMMA 1LOEA 3H7YA 1VBC3 4OHVA 2D44A 1C1LA 3ZFEB 2YHJA 4RS5C 1O5LA 5FQ0B 1PO21 5I0TA 3S6PA 2BFUL 4TZDA