4HN1A

Crystal structure of h60n/y130f double mutant of chmj, a 3'-monoepimerase from streptomyces bikiniensis in complex with dtdp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
199
Chain Sequence
MHPLSIEGAWSQEPVIHSDHRGRSHEWFRGESFRQAFGHDFPVAQVNVAVSHRGALRGINYTEIPPGQAKYSVCVRGAGLDVVVDVRIGSPTFGRWEIVPMDAERNTAVYLTAGLGRAFLSLTDDATLVFLCSSGYAPAREHSVNPLDPDLGIAWPDDIEPLLSDRDENAPTLATAERLGLLPTYQAWQEQQQAQRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative 3-epimerase in D-allose pathway
publication title Structural and Functional Studies on a 3'-Epimerase Involved in the Biosynthesis of dTDP-6-deoxy-d-allose.
pubmed doi rcsb
source organism Streptomyces bikiniensis
total genus 54
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.27: dTDP-4-dehydro-6-deoxy-D-glucose 3-epimerase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hn1A00
5FLIA 4EROA 1QWRA 5FQ0B 4IEZA 5I0RA 4RD7A 4LLOA 2WFPA 4YARA 4KWKA 1ZRDA 4WVZA 1ZRCA 3H8UA 1L3JA 3PVBB 4XF0A 1DGRA 1QY4A 2H6CA 5I0SA 3RPQA 4EWEA 4F8AA 5E1RA 4UXAA 3WW2A 2IXIA 3CL1A 1RC6A 3BALA 3B02A 5KHGA 3DN7A 3IWZA 2P17A 4ONUA 4Z82A 5LEKA 5KHIA 5I8SA 5T3NA 4LULA 5I8TA 5JCTA 4IEOA 4HSLA 2HKXA 4HVQA 3CJXA 5KHJA 3MDPA 4IEWA 3LA3A 4MZUA 4IEQA 1X8EA 1RUNA 2H6BA 4EWDA 3USSA 4IERA 2Q4SA 2PAEA 4BYYA 3EBRA 3FX3A 5I0UA 3UKVA 4J1WA 5FPZA 1VP6A 2OPKA 5I0TA 5JR7B 3TNPB 4EV0A 4FT8A 1QXRA 2ATFA 2PFWA 4LA3A 3H1MA 3U10A 3H3UA 1X82A 4XETA 4HVRA 4KWLA 4F7ZA 3KCCA 3O14A 3M3IA 3RNSA 4JTOA 2ZKLA 2EA7A 3RYKA 1ZRRA 4XFIA 5EFUA 1XE7A 3E5QA 3NW4A 4ORFA 4MGZE 3I7DA 1H1IA 4BIFA 4QX5A 1ZVFA 1OMIA 2H0VA 2XHKA 3MZHA 3FJSA 4YRDA 5JSOA 1XE8A 3OD0A 1GQGA 2UY8A 1NZCA 3I59A 2UY9A 2Q30A 2UYBA 3CEWA 4MGKE 3HT1A 3H7YA 3ACLA 2IC1A 1ZREA 2PQQA 1ZZ6A 4IETA 4LUKA 4GULA 2D40A 4IEPA 5FQ0A 3BB6A 3ELNA 1X7NA 2PAKA 1CAWB 3LZZA 1O3SA 1CAXB 3H3ZA 2XKPA 3PLQA 5K8SA 4QM9A 2XGXA 1IPKA 3JZVA 1YFUA 4XFFA 1DGWA 2FMYA 2EVXA 2IXHA 5F1RA 2I45A 4K8FA 2F4PA 4AQ6A 2B8MA 4N9IA 4IESA 3SCGA 5AVPA 3HIFA 3OTFA 1I5ZA 1LB2A 2N7GA 5BXXA 1FXZA 1SQ4A 4LA2A 1EP0A 1NE6A 3ES4A 4FAGA 2XLFA 1VR3A 3HQXA 2O1QA 4XFCA 1EYBA 2XL9A 4PJYA 3FE5A 3NSTA 4HBNA 4AQ2A 3E97A 1X8MA 3LOIA 2PHDA 2IXCA 2ET7A 4Q0PA 3DKWA 2BGCA 1QXJA 3IDBB 4UBGA 1PM7A 2Q0AA 5D1IA 1O3QA 1OFNA 2UYAA 4L2NA 2BNMA 3ES1A 3OGJA 3U11A 5KBFA 2QVSB 2PTMA 1OD5A 2OZJA 5J3UA 1ZX5A 5HI0A 1WA4A 2GAUA 1UIKA 2XL7A 4CYDA 4ZU7A 1EPZA 3E5UA 4PIZA 1VJ2A 5FCCA 5I8YA 3G7DA 5JSPA 4JVAA 2FQPA 2CV6A 3E6BA 1UCXA 4JV4A 4QGMA 4ZU4A 3TNQA 1O7FA 4FBFA 2KXLA 4I01A 3GBFA 1RTVA 3NL1A 1CAWA 3H9AA 1CAXA 3RYPA 5LRSA 3QACA 3L2HA 4HSJA 1ZZ9A 2OZ6A 2D93A 3SXWA 1LR5A 1YFXA 2VQAA 1UIJA 2B5HA 3NKTA 3OF1A 3FZ3A 4HLTA 3SMHA 1SFNA 3NVCA 3LA2A 4QMAA 1OI6A 3KGLA 2XLGA 2ET1A 3WW3A 2XLAA 2PA7A 4X6QB 4XFBA 2WC2A 1NXMA 2BNNA 4XF1A 2IXLA 3RZZA 4XFGA 1GQHA 3IDCB 4O9EA 3LAGA 4AVBA 5FLJA 2Z2SB 4Q0VA 2MNGA 2PYTA 3IBMA 1UW8A 3C3VA 4BH9A 1LRHA 1HW5A 1ZRFA 4XEZA 4X6RB 1O3RA 4KWJA 4XF9A 1ZZCA 5J48A 4YYOA 2O8QA 2VECA 4Z07A 3DV8A 1CAVB 4HVOA 2CAVA 4NVPA 3ZDSA 4HN1A 3OCPA 4KL1A 3FHIB 1J3RA 1YHFA 3N4MA 2IXKA 4YNIA 1YUDA 4Q0QA 2OYZA 1ZZ8A 1U12A 2GZWA 1TQ5A 5FLHA 3D82A 4META 3RYRA 5KHKA 1PMIA 3ROUA 3SHRA 2EAAA 1UPIA 1CAUA 1RGSA 1O5LA 4J1XA 4P9GA 5EZWA 1YLLA 3D0SA 3EO6A 4IEYA 4WBBA 4PIYA 3PNAA 4LTAA 4UBHA 2Z69A 4I2OA 3GYDA 1Y9QA 3BCWA 3D0JA 1O5UA 5FDBA 2GU9A 3MPBA 3NJZA 4MV2A 3IIAA 5C8WA 1ZNPA 3KSCA 4I3PA 5KHHA 1EY2A 3CLPA 4OFGA 3CF6E 4EWAA 3E6DA 3S7IA 1J58A 2QDRA 5LRRA 3E5XA 1CX4A 2Y0OA 4PIXA 3WW4A 1NE4A 2QJVA 2V09A 3LWCA 4LUMA 4MUVA 1SEFA 1YFWA 4QGLA 4QM8A 2IXJA 4E2QA 2MHFA 1CAUB 2GC1A 3CO2A 4Q0SA 3M70A 3HT2A 3SCHA 1DZRA 2D5FA 4DINB 4I02A 4MGIE 4HZFA 4MX3A 1J59A 2B9UA 3KMHA 1V70A 1NYWA 2PHLA 1H1MA 4R52A 3E6CC 1YWKA 2D5HA 4XFAA 1CAVA 5CVRA 5BV6A 2BYVE 3DL3A 2BEOA 3WW1A 1RUOA 3SCFA 5E16A 4E2GA 4ZU5A 3EHKA 1G6NA 1ZZBA 1IPJA 4IEUA 2PAMA 2E9QA 4XF3A 5BPXA 2K9ZA 2C0ZA 3MYXA 3UKTA 1J3PA 4TLFA 2XKOA 3S0MA 1YFYA 1WLTA 1DZTA 4KU7A 5FPXA 3ST7A 4QGNA 4I0AA 5CADA 1Q3EA 2OA2A 2QCSB 4A2UA 1CGPA 5CU1A 3LA7A 3R6SA 3U0ZA 4D7TA 4AXOA 2HJIA 2VPVA 1WGPA 1O4TA 3H7JA 4B29A 1FT9A 4QXKA 4HN0A 4XFHA 3FWEA 1ZZ7A 4E2SA 4Q0UA 2Q1ZB 4AVAA 1XRUA 3BU7A 3UKNA 4N9HA 1UD1A 2CGPA 4YSFA 2DCTA 2GC2A 1JUHA 3H1YA 4R8HA 4OLLA 4WZCA 3I54A 4H7LA 2GC0A 2GH2A 2MPFA 3BPZA 5JAXA 2CAUA 1J1LA 3FFQA 3H50A 4IEXA 2ZCWA 4MH0E 4O9GA 1RL3A 4XF4A 4I09A 4BHPA 4I0BA 5I91A 5LEJA 1Q43A 3VHRA 5C6CA 2QNKA 3EQEA 2ETEA 1Y3TA 4HMZA 4Q29A 2BNOA 1I6XA 3KGZA 1J3QA 1O3TA 4FAHA 3RDIA 2GC3A 5J7MA 5I93A 3I59B 4MGYE 4AVCA 4KU8A 3H1WA 1Q5OA 3EJKA 4JTNA 1LKNA 3ETQA 3QOPA 4L11A 3S7EA 5BY5A 4LEJA 2K0GA 5JSRA 5BUVA 4IEVA 4D7SA 1FI2A
chains in the Genus database with same CATH superfamily
5DZEA 1FAYA 5FY5A 2WZPP 5JIAA 2F6BA 2YUEA 3PMEA 2GN7A 4IEZA 5I0RA 2SLIA 4Y3OA 5IJRA 2GALA 4OHYA 1L3JA 3PVBB 1DGRA 4LOSA 3AC0A 2ZAHA 1CJPA 4GJYA 5E1RA 4UXAA 2IXIA 2J1RA 1QXPA 2RM23 1JZ7A 2OPWA 1PZ9A 3B02A 5A32A 3FMGA 3QBQA 1GZCA 2KM2A 3DN7A 3VBUA 4ES9A 1IGOA 2BJSA 2P17A 4ONUA 2I2SA 4HFSA 4V2VA 2BP6A 4Z82A 1VRH2 4BQ3A 5APAA 4E9KA 3VBUC 5DAQA 5T3NA 3NV2A 3N3HA 4LULA 2BOJA 2WNVA 2RS33 4QHOA 3ZN6B 1SFPA 2FDHA 1RVF2 1GZWB 2VVDA 1OLME 1W0OA 2XQXA 4GAZA 1W8OA 2WNVC 5F2SA 3LDRA 4HSLA 2EIEA 4HVQA 3A0NA 4WVVA 4CP2A 2DYCA 3MLKA 5F32A 5K9YA 3CJXA 5KHJA 2ZHNA 4IGPA 4LR4A 5D21A 2CWMA 3LA3A 4MZUA 4INDA 4XJUA 1D0GA 2ZEYA 1DCSA 1OVPA 4PBPA 4EWDA 1F15A 3OBRA 1C4RA 4AFDA 5C4WB 1ZBE2 2PAEA 3NNMA 1ND2A 2XB6C 1C1LA 2VZVA 2XVGA 4JDMA 4K7JA 2HWF2 2R49A 4FFHA 2XPJA 5FXZA 3UKVA 3ZXAC 1MS5A 2WWSA 1JU4A 2B4KA 3FLPA 4LKSA 4SLIA 5LCWL 1ND2C 1X9TA 3RZJA 1QXRA 2EF6A 5IK7A 1VAVA 5IAXA 4P5HA 1X82A 3FLRA 4LXLA 3KCCA 2FDFA 5DZFA 1OBNA 3KT4A 3M3IA 3GZAA 3O14A 3RNSA 1EAH1 3MUZ1 3OPWA 4L0PA 3RYKA 4XFIA 4XURA 3VL8A 3LIGA 1XE7A 1AJOA 2GP3A 4LORA 4L9BA 4CU6A 3BTYA 4MGZE 1RUJ1 1ZVFA 3DXTA 3KT1A 1C8M1 1OA4A 2VMIA 2WS92 3O7OA 5EJ1B 5FMCA 2B45X 4ES8A 4HG6B 4YRDA 4ZKTB 3MZHA 3NWKA 2YGLA 1NT0A 1JOJA 4AI2A 1RMU2 5ACA2 5LA1A 1N1YA 4A7ZA 5DQ0A 1IHMA 2EXJA 2RDRA 1F5FA 3IMNA 1PX4A 2Q30A 1TVGA 4MGKE 1W9YA 4CXXA 2WNEA 3VD9A 3ACLA 1RUC1 1ZREA 3PUSA 2JDUA 4FXGB 3AFGA 5A7PA 3I2GA 3V0BB 4LIVA 1UKGA 2WO7A 4EZ4A 3AP9A 1YRZA 4B4PA 1G9CA 3BB6A 2JECA 4LHLA 2B39A 5C3SA 5FYCA 1W8NA 1CAWB 3J7MA 5BNOA 2HWC1 2QE3A 1CIWA 5T5LA 3H3ZA 4I3GA 2XKPA 2YBPA 3N7LA 1W99A 1HXS3 3PLQA 4L92A 4QM9A 5FY4A 3ZXEA 1TMF3 4AGRA 5CYYA 1A8MA 1ND3A 5BNOC 5DAXA 5CBLA 3N9OA 4AK3A 2WWJA 1CONA 2VM9A 1ND3C 1SCSA 2J1TA 4A44A 2FMDA 5FWJA 5FTTC 4DMIA 4OYUA 4M0HA 2EIDA 2RR13 4XE9A 4N9IA 1KGYA 4PLNA 2E6VA 3INAA 4LKEA 4OI1A 1OLQA 3TEYA 1OA2A 5FYZA 1I5ZA 1AR83 1LB2A 1JTZX 1NKGA 1ZM1A 2D6PA 2LTNA 2N7GA 2JE8A 2OXBA 2WA3A 1AL23 1W8TA 4Q4X2 5DUXA 4LA2A 4TTGA 3I3MA 3ES4A 4AYUA 3MO4A 1WCQA 5T55A 4DS0A 4QXBA 3H42B 5A6QA 1TG7A 1HRI1 1K5JA 2UURA 4XFCA 4AI3A 1EYBA 1DBNA 4XQDA 3IAPA 2G4IA 2RJLA 4NPLA 3FE5A 3OOXA 2VZQA 1W3VA 1GWLA 4HBNA 4IE5A 5CEHA 1X8MA 4XDQA 2PHDA 3BTXA 3RZHA 2IXCA 1LULA 2FDGA 1N3OA 4KGGA 4X8PA 3DKWA 1W03A 4RHV3 2YBKA 2NYYA 4S2FA 3AMPA 1ODMA 2WIIB 3T30A 5CA6A 4TSVA 2W1QA 3DKQA 4Q4W3 2PHUA 2XUMA 4RFRB 4UFHA 3RWNA 3F95A 5KBFA 1WMFA 1YIPA 4Y5SA 1RXGA 1IS6A 5F3IA 5J3UA 1HRV3 1ZX5A 3WG1A 1WA4A 3MF9A 1H8TA 3VN4A 1UIKA 2DVGA 2CSGA 5FZLA 3ZIWA 4PIZA 1VJ2A 5FCCA 5I8YA 3IM0A 4Z8BA 4ZS3A 1H8TC 2PHXA 5CFDA 4LE4A 1IG0A 3O1RA 2JDNA 2WT1A 4P9IA 1RVF1 4JV4A 3AFKA 4QGMA 1OOPA 5I0DA 5CFDC 4Q8LA 1O7FA 3THCA 3IZOA 4LBNA 4CUCA 5JUVA 5K7PA 3U1XA 4CU9A 1OOPC 2CL2A 4FTEA 3JB4C 3ITQA 1MZ5A 4NPMA 1CJDA 1PO12 2OUHA 4BK4A 2NPIA 2KD7A 3HN1A 3AYCA 1UZVA 3USUB 1ZZ9A 4D69A 1YIFA 1SPPB 4AR2A 4LBQD 2D93A 3TN92 1S0CA 3NO8A 4AVSA 3ZPYA 2YZ4A 5ANQA 1FYUA 4JAAA 3NKTA 4QQPA 4D94A 1POV3 4Y1ZA 1S0IA 1SFNA 2JD9A 4U2AA 5DUVA 2CU5A 2RS11 5IT6A 2FDJA 4IV1B 2E7TA 3O5SA 2EXKA 1QOTA 4QPWA 2O14A 2XLAA 1AR63 1BVVA 2HWF3 2VCAA 2WINB 2P6HA 2R063 3T09A 2WC2A 1ASJ2 4QAWA 3WSOA 1WUVA 3CIHA 2Q5TA 4XF1A 3SNMA 3RZZA 2BGPA 1AJKA 4JQRA 4QDQA 2YHJA 1ST8A 4Y1YA 3VZLA 1IKQA 3HD8B 4M3CE 1JOBA 2PYTA 3SLIA 3IBMA 4HANA 1UW8A 2VUCA 2GNDA 4FOWA 1GNZA 1DYOA 4OUSA 3LFMA 3KF3A 1NLSA 3JCIA 2VMGA 5JMOA 3VD5A 4MVTA 4Y4RA 1AYM2 2ENRA 3NJVA 4TWTA 1O3RA 3JXSA 2VW1A 5FYSA 2WS93 3KZ4C 3PUIA 1L7RA 4KWJA 1B09A 1RMU3 1NCRB 3DV8A 5EJ3A 1US3A 3E1F1 3BTZA 4XUQA 5FY1A 3H0OA 1J3RA 1MVEA 1XE0A 1YHFA 2OQ7A 2WBKA 2XR4A 4Y1VA 3UJQA 1ZA4A 4XC9A 3FHAA 2BFUS 1CQ9A 1U12A 2GZWA 1YCIA 3AL6A 3AZVA 2QQNA 4DUVA 3I49A 4YW3A 1GP4A 4XQ4A 4CPBA 4XCBA 3RYRA 1MEC2 5KHKA 4P02B 1PVC3 4YPJA 1AXKA 3K2OA 1QQP2 4MO3M 3ROUA 2E33A 4XDOA 4LNVA 1BBT2 4OHWA 5FREA 1O5LA 2ZGUA 4IE4A 5L9BA 3AYDA 5EZWA 3D0SA 1DGRN 3ZR6A 1S0JA 3RG0A 5C33A 3UT0A 3LIHA 3EO6A 2FCUA 3RI8A 4A6SA 1WCDJ 5DDJ3 1LOAA 5AC93 1JZ6A 3O12A 4JQTA 4YM1A 3PNAA 1JZ3A 3LDKA 1PNFA 2WZ8A 4DRRA 1IS5A 2Z69A 3MBWA 3GYDA 4CEWB 4I2OA 3N9PA 2FDIA 3LSEA 4MXVA 4A4AA 1VPHA 5JOXA 2Z79A 4WVWA 5FDBA 3MPBA 1RHI3 4Q4X3 3MIHA 1OKQA 4CVUA 1VBD2 5FOJB 2CY6A 3UESA 2W1UA 4JDNA 1W8ZA 1RUD2 1U5ZA 2QDNA 4UFIA 1G9BA 3THTA 5C70A 2WUHA 3PVEA 1CWPA 3GCXA 4WZFA 4OMDA 4XUTA 2A7AA 5T52A 5JMCA 1EY2A 3ZSKA 4QHBA 1IQAA 1Q8QA 4FOQA 1QOSA 4XTMA 3RWKX 4N53A 1KFXL 1P8JA 5L73A 1COV1 1CX4A 4PIXA 3MF6A 3PVNA 4AHXA 1NE4A 3DEMA 3LWCA 4LUMA 2B46X 4HPKA 4FPFA 1V9U3 1YFWA 4KH9A 3KCXA 2IXJA 1J84A 2MHFA 4LKFA 3WP5A 4A41A 4AVVA 5A7WA 1DQ6A 1ZRIA 4AAXA 4PQQA 3RJRA 4Q0SA 2Q8OA 1FOD3 4ASLA 3SCHA 2BPA2 3BOWA 1RUH2 4JZRA 2DURA 2NP0A 4R4XA 2BWCA 3WNKA 2NN8A 2WFF2 3PJYA 4MGIE 4FPJA 3VBOB 2P4EA 2ARAA 2XONA 1OUXA 4PI2A 3POEA 1HLCA 2X29A 5JXJA 1XYNA 4C0BA 2VXJA 3U37A 4B1LA 1OF4A 4URTA 4XFAA 3I97A 1CAVA 5CVRA 3O1SA 1OLMA 4NHYA 3DL3A 3TAYA 5C3OA 3AKRA 2WNOA 3SCFA 4XBNA 5FKCA 5JOYA 2QQIA 2YFZA 4OHZA 4Y20B 5FZDA 1G6NA 2DUPA 1ZZBA 2QQKA 3MLJA 3WNNA 5KXEA 5F3GA 4Z2AA 2R041 3TN91 1NG0A 3LGRA 4GZ9A 3JD71 4XF3A 2E32A 1W2AX 1DYPA 2WZR1 4YW4A 3V0AB 1UZWA 1VBE2 1QH7A 2LS6A 2XBO2 2VTXA 3UKTA 1PO13 1Q8VA 1J3PA 3J8F2 2JG9A 2YC4A 4NO4A 4QD2A 1YFYA 1JYTA 1UWWA 4LO8A 3ZPOA 1WLTA 1BEV1 2D3PA 1CZSA 5FK7A 5LBEA 3LPGA 1WBLA 2JG9C 5JPNB 5CADA 4GXLA 3FN9A 4OVEA 2ZGRA 3ZSLA 2OA2A 5FPBA 1G8WA 3NAPA 4Y22B 3RSJA 5J1XA 1OKOA 3NRUA 1CGPA 1NY71 1N3PA 1B35C 3M3EA 3K4DA 1W2UA 3VHOA 4BISA 1WKYA 1PIV1 3TEXA 3NAPC 3B5LB 4I30A 1TME1 2UWBA 1ASJ3 4RQPB 5FY7A 3KHCA 5EXOA 1BK1A 1LGNA 5GZCA 4D6QA 2CDPA 2G9ZA 3GF6A 1WZXA 4LQRA 4QPIB 4W4ZA 3T3YA 1MS0A 1BKZA 1BQPA 4DNYA 3NNLA 1LOFA 3ZFGA 1W04A 1RJ7A 1ZZ7A 3AKPA 3N7JA 5FOBB 4JCKA 5ABJB 5FR3A 4MGQA 1UU5A 4N9HA 2JB4A 2W95A 5C71A 1LOFC 2VTXJ 5FKBA 3ZFGC 3K46A 1AYM3 4R9AA 1QJY2 4CRQA 3RZMA 1LOGA 4QKNA 5FO7B 5IW0A 2A3XA 4WM8A 3M3OA 2GC2A 1JUHA 3H1YA 1Z78A 1OF3A 2OX0A 4NIGA 2ZOEB 1OQDA 4H7LA 2HEWF 2PLV2 5KXDA 1UOFA 3J7LA 1UZ0A 1W6PB 4WM8C 4AEDB 1WLDA 2GH2A 3BPZA 3VZJA 3V64A 2ZMNA 1J1LA 1RUF3 4MH0E 4O9GA 3TB0A 1YJKA 3VKOA 3A0KA 5CFCB 3VDDA 3GZUC 4PCRA 2ZA9A 1OURA 4XJAA 2WZEA 3ZO0B 4CDWB 4YZ2A 2W9XA 5LBCA 2IFRA 4K40A 3T08A 4DRVA 3VDDC 2ZX2A 1SLCA 1MZFA 3VHRA 3W5NA 2Y6FA 2VVEA 4HMZA 4Q29A 2R071 5FZBA 3W20A 3ZN6A 2HWE1 4QPGA 1CX1A 1I6XA 2J7MA 1R1A2 5KWRA 1BBT3 1CD3G 1GSLA 2D98A 1W6OB 4LBMA 3ETPA 4XACA 1CESA 3RDIA 5IK8A 4QPGC 2C5DA 2GC3A 2VTFA 1XYPA 1L7QA 4MGYE 5H9QA 2OS2A 4KU8A 3H1WA 3EJKA 5LY1A 1VBD1 3BKZA 3ETQA 3RRDA 3V65A 4XHXA 1XNBA 1Y9GA 1JYCA 2XUEA 3OGGA 2WWUA 5A3UA 4CCLA 1NA1B 3D5OA 2XJRA 1NQDA 2DCYA 2Y8KA 3KV9A 1DGLA 2WQ8A 4LBQB 3U14A 4E8DA 4EROA 1UMHA 5FQ0B 5C4WC 3WG2A 4RD7A 4LLOA 3UYJA 5FZ1A 1ZRDA 4WVZA 4D6SA 2WL1A 4DXZA 3T2PA 2OKXA 3WOGA 3WDYA 1E5RA 2ZACA 2WKKA 1POV0 2CTVA 1C8NA 4QX2A 3CNAA 1LESA 1Y43B 4PDWB 5KR7A 5FK8A 1RC6A 2VGDA 5KHGA 1APNA 2EAKA 4RS5B 3WDUA 2J1SA 4DZGA 5LEKA 4QQ2A 4CEYA 4GJZA 1LGBA 1SLBA 5I8SA 2ZGMA 4W6YA 2DCZA 4UW3A 3OPZA 5F3CA 2DU0A 5IVVA 5I8TA 2WFF1 5FP3A 4CEYC 1VAMA 3PHMA 2VZ1A 3RMYA 5CAZA 5HPOA 1WD3A 1DIWA 4RR3B 3SKJE 2HWB1 2YY1A 4BQYA 2VCMA 5JCTA 3GDBA 5IVJA 1Z7S1 1Y7BA 4GQ7A 2ID4A 2JDYA 2VMEA 4XUOA 2MEV2 5H9RA 1RUH3 3WNXA 3MDPA 4AAPA 4XBLA 3EYPA 2DVDA 4LJHA 1S2KA 4IEQA 2VG9A 1V6NA 3V0BA 2YU2A 5GKAC 3AK0A 4PLOA 1GV9A 2AREA 1S2BA 4DUWA 1W6QB 4B8EA 4NWWA 2W68A 3ON7A 4COZA 5FYIA 3WQ7A 4G4FA 1YQ8A 5EYYA 5IATA 4J1WA 5FPZA 1VP6A 2OPKA 4XMAA 5I0TA 3A22A 1N1VA 4FCAA 2R30A 1EAH2 1W28A 2QQVA 3M7AA 1M4WA 4LA3A 2TEPA 1VMFA 4J25A 3H1MA 1RUJ2 4XETA 4UOJA 4KWLA 2W87A 3Q8EA 5E6HA 4F7ZA 5IWFA 3VBHA 4RGKA 2IWGB 2EA7A 2W1SA 2CNAA 1ZRRA 1C8M2 2ZEZA 3POWA 3E5QA 5EFUA 3NW4A 5EP9A 5FXXA 2IUWA 3DUIA 3WVJA 1VBA3 4NWVA 4BE3A 1OMIA 3OYWA 4XJZA 2FZ2A 3VBHC 1VBE3 2H0VA 1EPWA 3AMNA 1PO21 1EV13 1R091 3A23A 2XHKA 3AM2A 3FJSA 3PU8A 5FV3A 1G86A 3D6EA 2E63A 3OD0A 1RUC2 2CWSA 3WZ1A 2FDKA 4QX8A 2VC9A 1NZCA 4M3CA 4OULA 4AFMA 1DG6A 2D6OX 5A1AA 2QQMA 2B42B 2IC1A 3RQ0A 2RDQA 1JHJA 1ZZ6A 4IETA 4FOYA 2HWC2 4GULA 1QJX1 1RXFA 1XC6A 3RMXA 2JG8A 5F6LB 3WHTA 5LWBA 4Q4Y3 4WM7A 3QD6A 4YVSB 3BPSA 1O3SA 2P3IA 2JG8C 1CAXB 3GBWA 1YEWA 5K8SA 2QZ3A 4WM7C 4ZXEA 4A45A 4EQVA 2Y60A 1TNFA 1DQ1A 3JZVA 3ZMNA 1DGWA 1V6JA 3IIIA 3DCQA 4QXCA 3S57A 2WR9A 3VBRA 1OLRA 3DGTA 3KLSA 4XXAA 1C3HA 2RMU3 4FI9A 3VZOA 3LF7A 3W59A 2IXHA 2R1DA 2ZGNA 5A3TA 5LBFA 2F4PA 2VBDA 3VBRC 3SCGA 3OGVA 4GA9A 3HIFA 2HWD3 3ZYIB 2VCCA 1GYKA 3LPFA 5M0TA 2XG3A 2AENA 3WY6A 4CUAA 1SQ4A 1HRI2 2ZTNA 3HNYM 4UT5A 1EP0A 2J42A 3PMSA 4GKYA 1R1A1 1FPN1 1NOVA 1OH4A 1LECA 1SDDB 3C7GA 1VR3A 3HQXA 2O1QA 3X29B 3VUOA 3F2ZA 4AHWA 1HB3A 4UFJA 2XL9A 5GALA 4UW6A 3AP4A 4LHSA 2BDRA 4AQ2A 2DFBA 4KBZA 3HNBM 3MGUA 1GNYA 3CDZB 3TYJA 3KM5A 4Q0PA 1T6BX 3I3BA 4YGBA 3VB9A 5K0UB 1W9SA 1IPSA 3PUQA 4YW6A 1JXNA 1JBCA 3I2JA 3ZFEB 1PM7A 3M1HA 2Q0AA 3IB3A 2VZTA 4BIOA 2WABA 2WNUA 2W46A 2W3JA 3T0AA 3VDBA 3ES1A 3OGJA 3U11A 2QVSB 1HB2A 5FZFA 4CU7A 1F31A 3I2FA 2YROA 2WNUC 1UX6A 2JENA 4CP1A 5HI0A 3R4SA 2GAUA 1QJU2 4IW3A 5FZAA 3MIGA 4AVTA 1EPZA 5HXVA 2G19A 3E5UA 4LBKA 3WDTA 3ZYBA 4GB32 5DN2A 3JBG3 4Y5TA 3G7DA 3IPVA 4PBOA 3VKMA 1OD3A 2P3JA 3KQRA 2RS31 3GHNA 5A7OA 2FQPA 5KC5A 1SBEA 1LHOA 1FMD3 1UCXA 4ISQA 4ZU4A 1FNYA 3B94A 5IHRA 2MEV1 1F4AA 4FBFA 4YG0A 3GBFA 3NL1A 3DF0A 1SHWB 4YZ4A 2RJKA 1VBC3 3QACA 4H7MA 2DCKA 4QQHA 1QMJA 4AEMA 4HSJA 4IE6A 4R4ZA 3K48A 2YPDA 5FZOB 2XJTA 2RS12 3ZR5A 1TEIA 1NCRC 4NUBA 3FC0A 1EUUA 1JU3A 1YFXA 4FPYA 1UIJA 1ULEA 3KVAA 3GZTB 3WQ0A 1XNTA 3QLQA 2X5IB 3S5QA 4HLTA 2XJPA 3SMHA 5F8PA 5C9AB 2W92A 4AI1A 3LA2A 4LK7A 2D44A 4QMAA 1OI6A 4GIQA 2XOMA 2XLGA 3JU9A 3O0XA 5EV7A 4JGZA 5EPAA 1OA3A 1E5SA 2BNNA 3T2OA 5EYXA 4COVA 5A3LA 1DLCA 3KHBA 3AVRA 1GQHA 3IDCB 4QDRA 2GNTA 1OUSA 3O1MA 4JGZC 4YGCA 3AXEA 3WINE 4NMIA 3H8XA 1LAJA 5FLJA 1RUJ3 1AYN3 4MHUA 4ASMB 4Q0VA 2OQ6A 1Q8SA 5D2AA 2BOIA 4EE2A 3DPRA 3KWVA 2GMEA 2ZGKA 4BH9A 2UWCA 4BQXA 1LRHA 4N8MA 3WNLA 2B7YA 5A7QA 3RS6A 4B1MA 3S5AA 1CPMA 1O8PA 3DPRC 3T2TA 5A6ZA 1VBB1 2ZZJA 5LK7B 2QBXA 4XF9A 1WMXA 4NIAA 3POSA 1BVP1 4GMP3 1QIQA 1GBGA 1AUYA 3OCPA 5FIXA 2W1WA 3AJZA 5FMOS 4BU2A 1E57A 4AI0A 4Q0QA 5IAVA 2JICA 1HXS1 2OYZA 4CP9B 3J7NA 5FLHA 3VZMA 1HQNA 2HWC3 1UL9A 2YU1A 4N90A 4FPOB 3D82A 1OQEA 4IV3B 1GFF2 4C91A 2XVLA 1CN1A 4GALA 4KG0A 2Y0IA 2A71A 1PMIA 2G9FA 3HPNA 1UPIA 4XW3A 5DG1A 2RR11 4P9GA 4RGAA 2BZDA 1YLLA 4FPLA 1C1FA 3O1PA 4GH4A 1JZ8A 3O0VA 1SFYA 1UXZA 2FCTA 1AL21 4IEYA 1UY1A 2WAOA 5A80A 2Y38A 2ORXA 4GH4C 2WDBA 3FUQA 4PIYA 1RUG1 2WA4A 2WJSA 1OQ1A 4XXPA 1N1TA 2VMDA 3BCWA 1YQ2A 3KF5A 5CNAA 4BQWA 3FBYA 1OSGA 2GU9A 1HRI3 1R083 4MV2A 1D0HA 4Y26A 5BNPA 3MIBA 3VD7A 3IIAA 5C8WA 2HBTA 1H9WA 3POFA 4Y20A 3W58A 1G7YA 4IUGA 4KI5M 4XMIA 3MI8A 4HXCA 3KD4A 5BNPC 3AMMA 3KSCA 1COV2 4E27A 3ZYHA 1QJEA 3KVBA 2ZS6B 5B4NA 2XWBB 4FO9A 4EWAA 3Q8CA 2RV9A 4CDUB 1AX0A 3H8RA 1J58A 3V0AA 1MPXA 2QDRA 2ZX1A 1GOGA 4Q2FA 5LRRA 4Z92B 3AMQA 4HL0A 2A6YA 4Q4W1 4EN8B 1KDMA 2QJVA 2V09A 2XDVA 3B9CA 4MG2A 2DUQA 1SEFA 3ACHA 1F9KA 1BYHA 5GLTA 2VUAA 3ILRA 1LHWA 2QKDA 1LU1A 4L99A 1HRV1 2Z42A 1MACA 2GC1A 3O1VA 3CO2A 4P00B 2LM3A 3HVDA 1QJU1 3M70A 4LO4B 4Y22A 1DZRA 2F4LA 2VZ3A 4DINB 3DYPA 4GB31 2EXHA 1LEDA 3I3DA 3VBFB 2BWAA 4MX3A 4NE9A 2R0HA 5FP8A 3VLBB 1VRH3 5A1LA 4D3WA 3HOBA 2Z4FA 3KMHA 1V70A 1NYWA 2ARXA 2HEYF 2PHLA 2H0BA 4GWIA 1H1MA 2VAUA 2JKBA 2DFCA 4GWMA 2YG0A 5F5IA 3TRSB 4A3XA 1YWKA 3E6CC 4PT6A 1SLTA 2Y6JA 1LOEA 1RVF3 4QB1A 4DEQA 4RQPC 5FYYA 4QPIA 3BI3A 2AZ5A 2RS51 1RUOA 2R042 4B3NA 3LEKA 1UF2C 3UNPA 1S4CA 1SZBA 3AZYA 3U07A 3W9AA 4XBQA 3JD72 3MUY1 2WZR2 5ANNA 4ZU5A 5ABJA 4QPIC 1ZA7A 1UY3A 4OZOA 4DIQA 1D2SA 2E9QA 4XUPA 4CXYA 4QX3A 1ZBE3 3CBNA 1BEV2 4XCAA 3VHNA 5ABJC 1OXCA 2K9ZA 3T4VA 5AFEA 1UU4A 5C3QA 2D7FA 1POV1 2C0ZA 1E5IA 1C28A 1PNGA 1SACA 1REEA 1V6MA 3MYXA 2WSVA 1WW5A 3OBAA 2XQRA 2DVFA 4TLFA 4UFLA 4O61A 1NCQB 2V4AA 1W6PA 1W0NA 2L9LA 4UFKA 4QGNA 3LEGA 4QKBA 5JZGA 1VB2A 1AX1A 1AR61 1NY72 5K4LA 4COUA 4CPBD 2R061 5J36A 2O0OA 4P5YA 3WP4A 5EJZB 1PIV2 1H8VA 4XTPA 1LU2A 4M00A 1TME2 1XNCA 5JZGC 4Y1UA 4A2UA 5A32B 3VBUB 2VO5A 3U0ZA 2W47A 4D7TA 3R4DB 2XJVA 3WDXA 1SG3A 4BXFA 4CDWC 4AXOA 5G04L 3L9JT 4MHRA 1BCXA 2HJIA 5FZHA 5CG8A 2X8KA 3IKWA 4CCEA 1W6OA 1I3HA 3MICA 1WGPA 3AXDA 4JC1A 1S0EA 4Y24A 2WNVB 1ULGA 5ACA3 4A42A 3U75A 4QXKA 3PU3A 4BLJA 2A3WA 1ZBA2 4HN0A 3ZN4A 2JDAA 1OH3A 4E2SA 4LMFA 4YW5A 4FFIA 4AVAA 4SBVA 5LZ6A 2DV9A 2VMHA 3UKNA 4LBLA 2IVIB 1X36A 1MQTA 1UD1A 1SBFA 4YSFA 2DF7A 4B7EA 2GP5A 3ZXKA 3K77A 3LQCA 3BIWE 1ND2B 2DTWA 2R0FA 3MV11 3UL2A 1MQTC 3HBKA 4WZCA 2VXRA 4YZ1A 4V1PA 1FATA 1QJZA 4BMEA 4G9SB 2VQ0A 4FQZA 5DG2A 5FZ4A 5A3OA 4PDWA 2Q8EA 1UQXA 1PVC1 2GNBA 4IEXA 1VALA 3MEPA 4RGGA 2LRPA 3OUJA 4PDWC 2NQYA 2R072 1H0BA 3U4SA 2ES3A 2HWE2 4Y4YA 5A33A 3OGSA 4H2AA 4IE7A 2YBSA 2JDMA 3W21A 5C6CA 2PHFA 1JMUB 4GKXA 4K1YA 2D6KA 1K5MB 5AC91 3PUAA 4JRLA 2RJ2A 2BVBA 1J3QA 1DQ2A 2ZGOA 3N9QA 1O3TA 3IT8A 3TWIA 3QCWA 4FAHA 1GR3A 1O4YA 1S0FA 1DYKA 1GP5A 3JUUA 4DOUA 1A34A 4LHNA 2A70A 1MVQA 4DEVA 5F5QA 4MYEA 4BPZA 1LKNA 5D8AB 2BW8A 3QOPA 1D4M1 4L11A 5FFOC 3SEEA 3AL5A 3JQWA 5JI7A 3ENRA 3ZXJA 5JOWA 2E26A 4ZZ8A 1WW7A 1A8DA 5DAVA 3WR0A 3SC7X 1AR71 3HEIA 3M3CA 1OPOA 5FLIA 3IDAA 1QWRA 1OPMA 2ADEA 1XU1A 1NQJA 4YVWA 2WFPA 4P08A 5BNOB 4KWKA 1SLLA 3NNGA 3D8CA 4XF0A 1KRIA 1ENXA 4K8RB 2H6CA 4EWEA 4OQ8A 2JDPA 3D3AA 4K1ZA 4YVWC 4F8AA 1CVNA 1ND3B 3WW2A 4XJ8A 2PHTA 1CIYA 1V9U1 3CL1A 2V73A 1FX5A 1UAIA 1Z0HA 3HMYA 4Z1VA 4N43A 1JYIA 5T5OA 3BTAA 3OSDA 2HWB2 1FOD1 2WN2A 1Z7S2 2JDHA 2XWJB 1O6UA 1WCSA 4N43C 4CCMA 5L7OB 2BU9A 3ZYFA 4NIHA 2YFUA 4K20A 4ARXA 5HCBA 1LHUA 2KA3A 4IEOA 2D6LX 2HKXA 2Q1MA 4YG6A 2KR2A 5L36A 3T1LA 2HBUA 1YQ5A 2ADDA 1ULOA 4IEWA 4YW2A 5LATA 2Q8CA 3A7QA 1PMHX 1X8EA 2ZABA 1RUNA 1BMV1 2H6BA 4P14A 1RUI2 5F3EA 3USSA 3I2DA 1UOGA 1UYZA 4MGSA 3KB5A 4GMP0 1HN0A 5I0UA 3FX3A 2DVBA 3TNPB 2R6QA 3WHUA 4EV0A 3DXUA 4FT8A 3LFIA 1K45A 2PN5A 3TN93 2EXIA 4WV8A 4FPHA 3T0DA 3JD73 1B35A 3H3UA 2WZR3 4BLIA 4HVRA 2ZKLA 1PO22 3B93A 1R092 5H9PA 2OIIA 3WUDA 5FZMA 3WV6A 2WYFA 4OI0A 2JE7A 1D7PM 4WVMB 3BGAA 3I7DA 4TN7A 1BEV3 4BIFA 5B4XA 5B2GB 2A1XA 5GLWA 1FV3A 1JYNA 1LNSA 1U5YA 1HB4A 2ZJCA 3WLUA 2QQUA 3PDQA 4LO7A 5JSOA 1H8TB 2Y34A 4DFSA 5JWPA 1R64A 3IMMA 3I59A 5CIRA 2TBVA 3MV01 4NOTA 1GKBA 1UMZA 2NMNA 2UY9A 3P3NA 4CA9A 1QJX2 4KMQA 2UYBA 3CEWA 5FZ3A 3HT1A 1AXZA 5CFDB 3N9LA 1TME3 1BLZA 1GNHA 1K3IA 2PQQA 5FY9A 1ZBA1 1OOPB 4LUKA 1LCLA 1HV0A 1I1EA 2YC0A 4LT5A 3WT3A 3NV1A 3ELNA 3EMRA 3J4UH 4GWNA 4YGDA 4ARYA 1J83A 3I3EA 5K0UA 3CHXA 2GMPA 3ZFEA 3S30A 1LGCA 1YO8A 4PQ9A 1YFUA 3WQBA 3R05A 2WT0A 4XFFA 4QB6A 5K0UC 1HN1A 2FMYA 5F5CA 3ZFEC 1HDKA 5HCHA 2EVXA 4CP0A 3OBZA 1K42A 4YFWA 2JD4A 3B3QE 5BNNB 5FXWA 5LB6A 2I45A 3I2HA 1LHNA 4NIIA 3WF1A 1RUF1 5IVCA 4K8FA 4B4RA 3OGRA 1MEC3 3VBSB 2XHNA 4AQ6A 4FPKA 2B8MA 2K46A 1UKRA 1US2A 4BZ4A 1QQP3 1GZWA 2YYOA 1FPN2 4MADA 3RZKA 2A6ZA 5GLUA 3RGBA 1FV2A 2DBIA 4BJ0A 2BBAA 1NE6A 1GP6A 2A5ZA 2VZOA 2XLFA 1W8UA 2ZX4A 1I5PA 1W9TA 4BB3A 2R073 5LA9A 4FFFA 5C4WA 4RA0A 2K2SA 4PJYA 1UZYA 1W2TA 1U0AA 4B4QA 2IZWA 2JDZA 1UNBA 4JKLA 4CDXB 2P3KA 1H2MA 1GLHA 1KXGA 1VBD3 1W06A 4QQOA 1JZ2A 2ZEWA 1XB9A 3B69A 4DUXA 1RUD3 1QXJA 4LKDA 3ILFA 4UBGA 3Q9OA 1BZWA 4YM0A 1PM4A 3N9NA 4FPEA 2SBAA 4OI4A 4CUBA 1O3QA 1NXD1 2W39A 3AKQA 5C9AA 4IE0A 1GQPA 4L2NA 2E53A 3HQRA 3VD4A 2R7EB 3OD4A 1JODA 2XMLA 4P9WA 1G9AA 1OD5A 5C9AC 2OZJA 2BQPA 4CXWA 1ENQA 2ZX3A 3AP7A 2FBEA 5JXIA 2BBVA 4XDPA 1RITA 2RS32 3LKJA 2JIJA 4ZU7A 4MOAA 4DY5A 3GJAA 4UF0B 3RZGA 1KJLA 3ZFFB 5JSPA 2VZSA 1S0DA 2CV6A 4UI9L 2ZHMA 1C5IA 3ZIXA 1BHGA 3TNQA 4BK5A 2WFF3 2BV4A 2VOWA 3ABZA 3MIFA 2XJQA 3ZX7A 3WUCA 4Y33A 3FLTA 2AEZA 3AP6A 4I01A 5LK5A 1CAWA 5GZFA 5FJKA 4ZPIA 4JDOA 4S2HA 3O1TA 5BNNA 2ZGPA 4PF5A 5LRSA 1ALYA 5T5JA 1AR91 1PHMA 1D2QA 1RUI1 3T4HB 5C8CB 4H55A 1K12A 2C9AA 1XXNA 4CCCA 3HAGA 2OZ6A 3HN3A 5BNNC 4CCNA 1LR5A 2VQAA 1QKQA 4AEKA 3RJ2X 1WMEA 3ILNA 3UV9A 4R9DA 4TZDA 1RYYA 4YZ3A 1RUE1 3ZDVA 3KGLA 4AGGA 3J26N 2ET1A 3WW3A 4N53B 4EZHA 5EQUA 1PZ8A 4AE2A 2XBO3 4X6QB 4XFBA 3KV6A 4NJ4A 3J8F3 5JPMB 2CYFA 1AVBA 1VBA1 4XFGA 4HPKB 5KXBA 1UN1A 2NMOA 3LAGA 3AMHA 4AVBA 1EV11 4W6WA 3GJBA 3VKNA 2Z2SB 5A7WB 4CCDA 1SDWA 2MNGA 2VD7A 2HYKA 1VBB2 3LEIA 2VOKA 1NUKA 2ZGQA 3GXUA 3RZLA 3PVOA 3AP5A 2Y33A 4W6XA 4X6RB 2V4VA 2JXAA 1A78A 4YLZA 4BQ5A 3KV4A 5IVEA 3LDBA 4MSVA 1S0GA 5CKMA 3ZOIA 5JLVA 4F3JA 1ZZCA 1H30A 3B01A 5C7GA 2VZRA 4YYOA 1ACCA 2HEVF 2O8QA 2VECA 1MS9A 1CAVB 4HVOA 4Z07A 5FBJA 1HXS2 2CAVA 4Q4Y1 3WDWA 3ZDSA 4KL1A 3FHIB 1AZDA 1QJX3 5FWEA 5FY0A 3SH3A 4M4PA 2RG4A 5AVAA 1JZ5A 2QQOA 2ARCA 4YNIA 1ZZ8A 5FAXA 5IFTA 1NLRA 3SQOA 2X53S 2W91A 5FPAA 1T6GC 1QJY3 2D3RA 2HH9A 4K9SA 5IK4A 3P1IA 4BOWA 1PMJX 3C2UA 1W6NB 1HJGA 2RR12 2WAAA 5GZGA 3AKSA 1TNRA 1W8HA 3N7MA 3N9MA 3IN9A 2LALA 1GOHA 1Y4WA 1AR82 3SHRA 2PLV3 2JG9B 2D43A 1AL22 1KDKA 1RGSA 4J1XA 1OC1A 1UMIA 3EXUA 2IVJA 1RUG2 2VQUA 4MGTA 5DZGA 4H14A 3KCYA 1BK0A 2C4XA 1TE1B 3VDCA 1QH6A 4WBBA 1PGL1 2BERA 5HCFA 3NAPB 2ILMA 4OI2A 4XJWA 2CGNA 4MXWB 3M2MA 3U4XA 5T54A 1GANA 3GZEA 4A6OA 3AJYA 4YW7A 1Y9QA 2ORZA 3POGA 3D0JA 1O5UA 2A6VA 4KNCA 3MHZA 4QXHA 1R1A3 3AVSA 2QZ2A 4Q4V1 4CZSA 3A21A 3NJZA 3USUA 1SPPA 1C57A 3M4FA 3OBTA 4YWAA 3THPA 1HQLA 2WQ4A 1DQ0A 1GUIA 1JS9A 2Y6LA 3GCWA 4FTBA 3VD3A 1MS1A 2Y6HA 2VW2A 3Q8BA 4OUEA 3FBMA 2OT7A 3ZFGB 4RL7A 4Y5Z0 1W9WA 2QQJA 4Q4W2 1BJQA 3CLPA 4IV1A 4OFGA 3CF6E 1CZVA 3S7IA 4W50A 2RM21 3L2YA 2Y0OA 4M0NA 4URAA 1HRV2 3ALQA 3NNJA 1V6OA 4IV1C 2FZ1A 4MUVA 1NCQA 1ULCA 4WM8B 1OT5A 1ULFA 2WQZC 4CSWA 2J1AA 3AZZA 5F7UA 2DCJA 4JHTA 4NHKA 1LJ7A 1CAUB 1IS4A 1NCQC 4FPCA 5FPLA 2LW8A 3HT2A 1QHDA 2D5FA 1XU2A 3NKGA 5FJHA 5EIYB 3DYOA 4QKDA 5HV0A 3VDDB 3JBG1 4HZFA 1BXHA 2VL4A 5CG9A 2C9KA 3VKLA 2VMCA 1W0PA 2RS52 1QU0A 2WO2A 2ZX0A 1FMD1 4XAEA 2TUNA 4CU8A 1AF9A 2D5HA 1NCRA 4UYBA 2BRTA 2BUKA 4QPGB 4A7YA 4AQSA 2BYVE 4F83A 5C5TA 1XOYA 2BEOA 3WW1A 3OEAA 1W3XA 3IAQA 4D7YA 5A1FA 1DU3D 5E16A 2MEV3 2IFWA 5FZ9A 4AFCA 3M3QA 4UW4A 3MPPG 1VBC1 3EHKA 4IL7A 4E4SA 1L7LA 1NX9A 2VVFA 4NHLA 1IPJA 2WSUA 3O1UA 2VOTA 3T0BA 4BDVB 4FXKB 5A7SA 4AOCA 1JH5A 4HKLA 4ET7A 4NIDA 4DQAA 1GOFA 1CPNA 4BQ1A 4LBJA 3ZYJB 1AR62 2BFUL 1I9RA 2R062 4XUNA 1OVSA 3S0MA 2DBNA 4GD4A 5GLZA 1DZTA 1EAH3 4KU7A 2DU1A 1OFSA 1WLWA 4GWJA 4NPRA 5LASA 3ST7A 5FPXA 2WYSA 3UETA 1HB1A 3J7HA 1REDA 4Q5OA 4NRQA 3SEPA 4MLOA 4LITA 1C8M3 2QCSB 1RB8G 2RE9A 5FMDA 5CU1A 5DABA 1W6MB 4N7IA 4CEWA 1AYN1 3R6SA 1DQ5A 2FD8A 4CEYB 3VV1A 3AYAA 4FPGA 1LOCA 2ZKNA 1K5MA 3I2IA 3K3OA 4Q8KA 4CEWC 1W8FA 2P34A 2Y6GA 5ERLA 1F5JA 3H7JA 1RUC3 2W52A 1YJLA 3WDVA 1K5MC 5FUIA 3IDEA 5E88A 1UYYA 3HQUA 1PVXA 2DDUA 4FP2A 4P9JA 4XFHA 5D8AA 3BIEA 3JB8A 4GMP1 2CHHA 1VBB3 4JKKA 4Q0UA 1XRUA 4XAAA 3BU7A 4COWA 5A70A 1SMVA 1TMF1 2BTVC 4V2WA 3WF0A 1HKDA 2A6XA 5D8AC 2ZBJA 2DCTA 3LOBA 1IG3A 4OQ9A 2NM1A 3MIEA 4BXSV 2Y6KA 3BVCA 1LEMA 1PVC2 3I54A 3VZNA 2A6WA 4BQ2A 4QWNA 2GC0A 1YQ6A 3MW3A 3KV5A 5H9SA 4AFBA 4JKMA 1TZOA 1H4HA 3HR9A 5JAXA 1YYNA 2PMWB 3FFQA 3H50A 1PGSA 4CCOA 1AR81 5IVBA 1RL3A 4XF4A 3T2QA 3OY8B 4E4ZA 1ULPA 1H2KA 4LOTA 5DDJ2 2C26A 4I09A 4NAMA 4IGOA 5J98B 3VBOA 4BHPA 3VBHB 5AC92 4U36A 5I91A 1MR5A 1UU6A 2VU9A 2X05A 5LEJA 2D3SA 2VCBA 1JW6A 4QDSA 5L7OA 2QNKA 3VBOC 2ETEA 4R9CA 3OYWB 2EALA 1Y3TA 2D6MA 3P6BA 2BNOA 1VMHA 1STMA 3M8LA 2OUJA 3WCSA 2YXSA 1JOPA 2YMZA 1RHI2 5L7OC 2ZZQA 1LTEA 2WRAA 1D4M2 3EB7A 1F4HA 2PQSA 2DTYA 4OUMA 1RUG3 1J1TA 4JRAA 4KWUA 5I93A 5J7MA 1W9FA 1AR72 3GGLA 1SLIA 4M3CB 4Q27A 1XJAA 5FYUA 5GZDA 4AVCA 3LB9A 5IK5A 1JN2P 2CGOA 1R081 2EIBA 2P5BA 3N7KA 4HETA 3AZXA 4LEJA 2K0GA 4RHV1 4ATFA 4DXRA 5JSRA 2RDSA 4ZY9A 5FZ8A 1GICA 4D7SA 2EIGA 1HX6A 3QH7A 1FI2A 1YXWA 2JG8B 4R9BA 1ODNA 1QOOA 1Y9MA 3P5BA 4WM7B 3SITA 1AX2A 4BCUA 1IS3A 4CUGA 5F37A 1V9U2 4XHBA 2VH9A 4YARA 3B00A 2VUJA 1ZRCA 1V00A 2OW4A 3H8UA 3AYEA 1QY4A 3CZUA 3POBA 3V56A 2YV8A 5I0SA 3RPQA 2W0XA 1DDLA 3GM8A 4EN7B 2JKXA 4W8JA 5LW9A 1F35A 1FOD2 4C1WA 3BALA 1LOBA 1DZQA 2E7AA 2R32A 1R1ZA 1XYOA 2J1EA 4WVMA 2QFEA 3VBRB 3IWZA 1W05A 2JEMA 3H8OA 5KHIA 1WLCA 2F17A 1S0BA 4RQPA 3ZMOA 3THDA 4TYSA 1O4ZA 1WA6X 2AUYA 4BQ4A 4CCJA 5T50A 2X09A 4CTEA 1FNZA 4YGEA 1QJU3 5DAPA 3WEZA 1VRH1 4UW5A 3HNMA 2YDEA 4GB33 4AHYA 2BVVA 2C24A 1DHKB 5JVVA 4QX0A 2WO1A 5L9RA 1BMV2 2V72A 1N3QA 5HXMA 1LHVA 4JGYB 4CDQB 2Y64A 3N35A 4A3ZA 3CJIB 1POQA 2ZGTA 3DYMA 5JI9A 1RIRA 3ACIA 4IGQA 3LEMA 5CZKA 5FBZA 5GJ6A 1PK6B 3PIGA 1S1AA 5FUPA 4HK9A 4IERA 2Q4SA 2RS53 4E8CA 4B7KA 4BYYA 3EBRA 2X10A 4NRPA 2ZHKA 1YI7A 5JR7B 3C7EA 4AEDA 1VB4A 1ZBE1 1KJRA 3POYA 1F8VA 4AEJA 2ATFA 2PFWA 2HWF1 2J1UA 2RS13 2R1BA 3U10A 5CFCA 4AEDC 2YGMA 4XYXA 5F39A 1ZYBA 3AX4A 4JTOA 4RYDA 4CDWA 2WNUB 3MW2A 3OUHA 4QU1A 2ZGSA 1WD4A 2P3YA 4QX1A 5JR2A 5CFCC 4ORFA 3VBSA 1H1IA 4QX5A 2FHRA 3ZKUA 2VNRA 1WW6A 3MIDA 4ZZ5A 3VBSC 5CB7A 2ZHLA 4S2GA 3AKTA 4S2DA 3ATGA 4O65A 1XE8A 4TLGA 1UO9A 1GQGA 5F6KA 1KS5A 2UY8A 5A6YA 3CZJA 1HQWA 2WS91 2D6NA 1UYXA 3IPVB 3TEWA 3AB0A 5DPNA 3K4ZA 1IOAA 1ENSA 3H7YA 2EICA 1RMU1 3T1MA 4HONA 5ACA1 1WCUA 4IQPA 2XVKA 1UY0A 2B9VA 1NA1A 3FUOA 1W2OA 2VBBA 4HK8A 4UWDA 1H4GA 2D40A 2JWPA 4IEPA 4LBQA 3ZYPA 5A6XA 1IZ3A 2VNVA 4QHZA 5FQ0A 4PHZA 3RFRA 3ECQA 4CDXA 1Q8PA 1NA1C 1X7NA 2PAKA 3WNMA 3C7OA 4AGVA 1Q56A 3LZZA 4XZUG 5FPVA 5FUNA 5AFBA 1RJ8A 3ZYGA 1MS3A 4LO6B 1QNYA 3R0RA 2XGXA 4CDXC 1IPKA 1EUTA 5F9TA 3HWJA 4EN0A 2ZEXA 1LODA 1RUF2 2DUOA 4RS5A 4FVVA 2QQPA 3OUIA 5FYBA 1Q8OA 1W2NA 1UY2A 4DB5A 1VLNA 3MFCA 5F1RA 4NROA 2YB7A 5CKNA 4RS5C 4PLMA 1G9DA 1WW4A 1IQDC 5DXDA 4IESA 5FO9B 1GWMA 4FP3A 3OTFA 2W94A 5DDJ1 5AVPA 4EYUA 4RR3A 1CZTA 4JGZB 4ISRA 1XNDA 1PZ7A 3ZXFA 3PUHA 2GH8A 3J9SA 1V6LA 1FXZA 5BXXA 4UF0A 4AI9A 3NJYA 4G3YC 3UJOA 2GDFA 4D0QA 3ZFFA 4NHXA 5J96B 1PGW2 1XQNA 4RR3C 3BOPA 4LO5B 4FAGA 2JX9A 1XSRA 1RHI1 1W90A 4Q4X1 1NZIA 2VBPA 2JE9A 3ZFFC 1XBFA 2Y26A 1AHSA 3OPTA 5SV8A 4LBOA 3RI9A 2DWRA 3DPRB 5JOZA 3OJBA 1W6QA 4XOGA 4LK6A 3HBZA 5A3PA 3NSTA 2QQWA 3E97A 4OCTA 3LOIA 5C8CA 5FY8A 4A7KA 1O8SA 5T5PA 4COYA 2ET7A 5JXGA 4XQWA 1D4M3 3POIA 1AL0G 2BGCA 3KS7A 1U5IA 4KBBA 3IDBB 3C7FA 5DAWA 2PHWA 3ZXDA 1AR73 5C8CC 5D1IA 4J6GA 4CCKA 1OFNA 1G9FA 1SBDA 2UYAA 3SKVA 1COV3 1UY4A 4JHZA 4NR1A 3WCRA 2BNMA 4AHZA 2AGSA 2VUDA 1H2NA 4Y1XA 4AL9A 2I07B 2QQLA 2PTMA 2E31A 3B9IA 3WNOA 5F5AA 1N47A 3C7HA 1O91A 1MS8A 4X8NA 1C5HA 4M4RA 4P9YA 4LHKA 1NAEA 2BGOA 2GNMA 4K3UA 4N53C 3GALA 4OHXA 2XL7A 4CYDA 2E7QA 3C8XA 1DLLA 2JIGA 3POJA 4QX7A 2JJ6A 4RFT0 3WXPA 1DQ4A 4JVAA 3S6PA 5BYNA 4GH4B 3ZKYA 3E6BA 4OMCA 1VRBA 5L19A 5BNQA 4HT1T 3PL0A 2V5YA 4QPYA 5FRAA 2Q1FA 3BU0A 1M06G 3CKHA 1ENRA 4HKWA 1VAKA 2XJUA 4JX0A 4YM2A 1AR92 4BM8A 2KXLA 2O8OA 3NMBA 1RTVA 5IUQA 2P37A 4BWOA 2NZ9A 2XH6A 4YVSA 3BODA 3OEBA 3H9AA 1CAXA 1UOBA 3RYPA 3I8TA 3L2HA 1XNKA 4NN0A 5JDBA 1SLAA 2J22A 2R043 3MLLA 3K4AA 3OB8A 4KQ7A 2VQTA 4YVSC 3U78A 3WP6A 5BNPB 1UYPA 2AACA 3SXWA 1URXA 1RUE2 1PO11 2C1FA 1UOJA 3WF3A 4D8MA 2B5HA 3B7MA 2QTWB 4NRMA 3ZXGA 5JIUA 3OF1A 3FZ3A 1F2NA 3WNPA 1H6XA 3NVCA 4BMBA 5J09A 4W65A 3VKFC 1KS4A 5C5UA 1KQRA 2WLPA 1VBA2 1W6NA 4OZXA 5TSWA 1UPSA 4KGQA 5CKQA 2PA7A 1VE0A 3G6JB 4QQLA 1EV12 5FYMA 1KEXA 1NXMA 1T2XA 3A4UA 2IXLA 4XILA 2PHRA 3NQHA 1HV1A 3UK9A 4LLFA 2ZAAA 5E89A 5A3WA 4Q1PA 4O9EA 3DECA 5LA2A 1YQCA 5FPUA 3ZSJA 1ASJ1 1PIV3 2AEYA 2C6SA 4PI0A 2QUOA 3C3VA 1QDOA 2WN3A 1U5XA 2VZUA 4MXWA 4L8QA 1HW5A 1REFA 4ITCA 1GU3A 4YW1A 4AI8A 3TEZA 4XEZA 1ZRFA 5KXCA 1WWYA 5FZ7A 4DY3A 1GMMA 3GBGA 4Q4Y2 1QJFA 2W5FA 4K21A 5L9VA 4P9LA 5JXHA 5FMBA 5HCAA 3ASIA 1UZZA 2VNOA 4XABA 5J48A 3APBA 5J37A 1QDCA 3VL9A 1AYM1 4NHMA 2I74A 1DP0A 4EJRA 4NVPA 1ZBA3 1GZ9A 2P1BA 2W2IA 4HN1A 1X9PA 1V6IA 3GHMA 1QNWA 4OHVA 3N4MA 2IXKA 2Z5WA 5FYTA 3NJXA 3Q8FA 4FOVA 1YUDA 4HKOA 1JHNA 3RVHA 3K51A 1TQ5A 3PTYA 2RMU2 3H3LA 2PELA 4DPNA 1KD7A 2J1VA 3NNFA 4META 4YM3A 5IFPA 4E4HA 4H3WA 3Q8AA 4AFAA 1WBFA 3AZWA 2HWD2 3I4IA 2EAAA 1CAUA 1MEC1 1PGL2 1A6CA 3LSDA 1H2LA 3WP3A 3K75B 4ATEA 5JZGB 2UWAA 1QQP1 4ZS2A 2VR4A 2AH2A 1BBT1 4M3CF 3ZSMA 4AF9A 4DXTA 4ZHNA 3WG3A 2HWE3 2GN3A 1PGW1 5FZGA 3PJQA 4Q4V2 5DUUA 4LTAA 4FTSA 4Q26A 4UBHA 5C3RA 2VE1A 3CMGA 3LCPA 4C90A 4XVHA 1QF3A 5FZ6A 1AXYA 4HOOA 2FCVA 5FO8B 2XXZA 5IVFA 2ZXQA 5FZOA 2WT2A 4IDZA 2AC1A 1LENA 4IXLA 1CR7A 3MW4A 3WQ1A 2VJXA 1ZNPA 2Q8DA 4EN6B 4C0HA 2X5IA 1O59A 4TXWA 5FP7A 1VMJA 2RM22 3ZN5A 3ZVXA 4I3PA 5KHHA 5GM0A 1H9PA 1RUD1 1SCRA 3FHQA 4PF1A 5HBAA 2GSYA 4N7UA 4D6RA 2WLQA 2DVAA 2X5IC 3ACGA 3E6DA 2VULA 1MQTB 1JUIA 2G1MA 3E5XA 2VOVA 4YZ5A 2P2KA 3BN6A 3WW4A 2ZMKA 4KG8A 4QGLA 3O0WA 4QM8A 5G05L 4E2QA 2VOXA 1XSQA 5SV5A 3PIJA 3SH4A 5FZIA 3JBG2 2ARBA 3PTRB 1JZ4A 1HIXA 2RHPA 5A3MA 1DFQA 4P9XA 4DO0A 1FMD2 1W6MA 4I02A 2GMMA 2A73B 5EHDA 1IKPA 1W39A 2HWB3 2ZPXA 2B9UA 4UFMA 1J59A 5A33B 2XJSA 1RUH1 1E5HA 1Z7S3 5DUWA 4Q1RA 1S55A 3R4UA 2W08A 5FXVA 3CQOA 4R52A 5A7NA 3WX5A 4CE8A 3ORJA 3ZLIA 1VBC2 3LE0A 5BV6A 5ISLA 4FFGA 1S2EA 4AQTA 2UU8A 3FL7A 4UAPA 3KQ4B 5EWSA 1YI9A 4E2GA 5F2WA 4CP9A 1RINA 3SH5A 2AYHA 2D97A 2VZPA 3VGIA 4IEUA 5FZEA 4FSJA 2A3YA 2PAMA 4IV3A 2VY0A 4YG3A 1AR93 1RUI3 5LBBA 2TNFA 4XPVA 2ZMLA 1YC61 5BPXA 5FMOL 1QEXA 3WD5A 3I3QA 5DMYA 1UXXX 4IV3C 3WF4A 1GZTA 1JYVA 2XKOA 1KITA 3O1OA 4XZPA 2ZGLA 1PX3A 4YVWB 5FP9A 4YFZA 3JQXA 4XIOA 2LROA 3HJRA 1VBE1 1X50A 2ERFA 3ZXLA 2XBO1 1RUE3 4I0AA 4EN9B 3J8F1 3ME2A 1AYN2 3N36A 3OY8A 1Q3EA 4I0WB 1PO23 1R093 1XNAA 3UGHA 2AR6A 4N43B 3UGGA 3LA7A 4AZZA 1DF0A 1WCKA 1D4VB 3I2KA 3UGFA 4AWDA 5GZEA 1JYXA 2VPVA 4C1XA 1HJFA 1NLQA 4QT6A 1O4TA 4B29A 3TOJA 1FT9A 1MZEA 5FZKA 5CISA 1TMF2 4QB2A 5IVYA 1ULDA 4O7XA 4ASKA 5A3NA 5LA0A 3VDAA 2JB8A 3FWEA 2PXJA 4XIKA 2Q1ZB 4FQ4A 3ACFA 5LY2A 1DGWX 4CDUA 4RSUA 4Z2WA 2CGPA 1KFUL 4NAOA 1MS4A 3K3NA 2YC2A 3GNEA 4ZXKA 4AW7A 2YPJA 4CDUC 3OG2A 3NV3A 3WG4A 2RMU1 2WO3A 4R8HA 4OLLA 5FZCA 2RDNA 1WMDA 1A3KA 1QJY1 4BA6A 1GWKA 1UX7A 3P3PA 2MPFA 4LPLA 2HWD1 2CAUA 4C8DA 2VW0A 1XPWA 2VNGA 4LE3A 4LIUA 3VZKA 2ZCWA 4RN5A 2P6CA 1B35B 1MZ6A 4ZONA 1YNAA 2PLV1 3VBFA 1OHFA 1JI6A 1N1SA 4I0BA 5FYHA 4E4DX 1H6YA 3BUCA 2OVUA 4XJ9A 5FP4A 5IYYA 2HYXA 1Q43A 3VBFC 1ONAA 3BYWA 3EQEA 3URFA 3ZSEA 1VIWB 3I2OA 2R16A 5GLVA 2JDKA 3MFAA 3W5MA 2LUWA 2RVAA 3KGZA 5FZ0A 5KC6A 1FPN3 3LD8A 3SISA 1JYWA 1R082 1W8WA 4AG4A 3NV4A 3KT7A 5FYVA 4RHV2 2HLEA 4L97A 4JGYA 1H1AA 4QKFA 3WF2A 3TBDA 3I59B 4CDQA 5HV4A 1V0AA 3CJIA 4DXSA 1V6KA 1Q5OA 1X33A 2V5DA 4JTNA 3CU7A 1QGLA 1PK6A 2A75A 3VHPA 3S7EA 3ZM8A 5BY5A 2G9GA 4JGYC 2NLRA 3ZYRA 4Q4V3 4M01A 4CDQC 2CDOA 5BUVA 3CJIC 2E51A 3PURA 2VMFA 4QU2A 4IEVA 5E8AA 5C3PA 4K6BA 3D4KA 1PK6C 3QH6A 3FFZA
chains in the Genus database with same CATH topology
5DZEA 1FAYA 2WZPP 5JIAA 2F6BA 2YUEA 3PMEA 2GN7A 4IEZA 5I0RA 2SLIA 2GALA 4OHYA 1L3JA 3PVBB 1DGRA 2ZAHA 1CJPA 5E1RA 4UXAA 2IXIA 1QXPA 2RM23 1PZ9A 3B02A 5A32A 3FMGA 3QBQA 1GZCA 2KM2A 3DN7A 3VBUA 4ES9A 1IGOA 2P17A 4ONUA 4Z82A 2I2SA 4HFSA 1VRH2 4E9KA 3VBUC 5T3NA 3NV2A 3N3HA 4LULA 2WNVA 2RS33 3ZN6B 1RVF2 1GZWB 2VVDA 1W0OA 2WNVC 4HSLA 4HVQA 3A0NA 4WVVA 4CP2A 2DYCA 3MLKA 5K9YA 3CJXA 5KHJA 2ZHNA 4LR4A 2CWMA 3LA3A 4MZUA 4INDA 4XJUA 1D0GA 4EWDA 4PBPA 3OBRA 1C4RA 4AFDA 5C4WB 1ZBE2 2PAEA 1ND2A 2XB6C 1C1LA 4JDMA 2XVGA 4K7JA 2HWF2 2R49A 3UKVA 3ZXAC 1MS5A 2WWSA 3FLPA 4SLIA 1ND2C 1QXRA 2EF6A 5IK7A 1VAVA 4P5HA 1X82A 3FLRA 3KCCA 5DZFA 3O14A 3KT4A 3M3IA 3GZAA 3RNSA 3VL8A 1EAH1 3RYKA 4XFIA 1XE7A 1AJOA 4L9BA 4MGZE 1RUJ1 1ZVFA 3KT1A 1C8M1 1OA4A 2VMIA 2WS92 3O7OA 4ZKTB 3MZHA 2B45X 4ES8A 4YRDA 3NWKA 2YGLA 1JOJA 4AI2A 1RMU2 5ACA2 1N1YA 4A7ZA 1IHMA 2EXJA 1F5FA 3IMNA 2Q30A 4MGKE 2WNEA 3ACLA 1RUC1 1ZREA 4FXGB 3AFGA 3V0BB 1UKGA 3AP9A 1YRZA 4B4PA 1G9CA 3BB6A 2JECA 4LHLA 2B39A 1CAWB 5BNOA 2HWC1 2QE3A 1CIWA 5T5LA 3H3ZA 4I3GA 2XKPA 3N7LA 4L92A 3PLQA 1HXS3 4QM9A 4YW5A 3ZXEA 5BNNB 4AGRA 1TMF3 1A8MA 1ND3A 5BNOC 5CBLA 4AK3A 1CONA 1ND3C 1SCSA 2FMDA 5FTTC 4DMIA 4M0HA 2RR13 4XE9A 4N9IA 4OI1A 4PLNA 2E6VA 3INAA 1OLQA 1OA2A 1I5ZA 1AR83 1LB2A 1JTZX 2D6PA 1ZM1A 2LTNA 2N7GA 2XJRA 2WA3A 5DUXA 1AL23 4Q4X2 4LA2A 3ES4A 4AYUA 5T55A 4DS0A 1HRI1 4XFCA 2UURA 4AI3A 1EYBA 1DBNA 4XQDA 2G4IA 2RJLA 3FE5A 4HBNA 1X8MA 4XDQA 2PHDA 2IXCA 1LULA 1N3OA 4KGGA 4X8PA 3DKWA 4RHV3 2NYYA 4S2FA 3AMPA 2WIIB 5CA6A 4TSVA 4Q4W3 2PHUA 2XUMA 3RWNA 5KBFA 1WMFA 1YIPA 1IS6A 5J3UA 1HRV3 1ZX5A 3WG1A 1WA4A 3MF9A 1H8TA 3VN4A 1UIKA 2DVGA 3ZIWA 4PIZA 1VJ2A 5FCCA 5I8YA 3IM0A 4Z8BA 1H8TC 2PHXA 5CFDA 4LE4A 2WT1A 4P9IA 1RVF1 4JV4A 3AFKA 4QGMA 1OOPA 5CFDC 4Q8LA 1O7FA 4LBNA 5K7PA 4FTEA 1OOPC 2CL2A 3JB4C 1MZ5A 1CJDA 1PO12 2OUHA 2NPIA 3HN1A 3AYCA 3USUB 1ZZ9A 4D69A 1YIFA 4LBQD 2D93A 3TN92 1S0CA 3NO8A 4AVSA 3ZPYA 2YZ4A 1FYUA 4JAAA 3NKTA 4QQPA 4D94A 1POV3 4Y1ZA 1S0IA 1SFNA 4U2AA 5DUVA 2RS11 5IT6A 4IV1B 2E7TA 3O5SA 2EXKA 1QOTA 4DY5A 2XLAA 1AR63 1BVVA 2HWF3 2WINB 2R063 2WC2A 1ASJ2 1WUVA 4XF1A 2Q5TA 3SNMA 3RZZA 1AJKA 4JQRA 2YHJA 4Y1YA 3VZLA 1IKQA 3HD8B 4M3CE 2PYTA 3SLIA 3IBMA 4HANA 1UW8A 2GNDA 4FOWA 1GNZA 4OUSA 1NLSA 3JCIA 2VMGA 4MVTA 1AYM2 2ENRA 4TWTA 1O3RA 2VW1A 2WS93 3KZ4C 4KWJA 1B09A 1RMU3 1NCRB 3DV8A 5EJ3A 3H0OA 1J3RA 1MVEA 1YHFA 3UJQA 4Y1VA 1ZA4A 2BFUS 1CQ9A 1U12A 2GZWA 1YCIA 3AZVA 4YW3A 4XQ4A 3RYRA 1MEC2 5KHKA 1PVC3 1AXKA 1QQP2 3ROUA 4LNVA 1BBT2 4OHWA 5FREA 1O5LA 2ZGUA 3AYDA 5EZWA 3D0SA 1DGRN 1S0JA 3RG0A 5C33A 3EO6A 3RI8A 1WCDJ 5DDJ3 1LOAA 5AC93 3O12A 4YM1A 3PNAA 1PNFA 4DRRA 1IS5A 2Z69A 4CEWB 3GYDA 4I2OA 3LSEA 4MXVA 5JOXA 2Z79A 4WVWA 5FDBA 3MPBA 1RHI3 4Q4X3 3MIHA 1OKQA 1VBD2 5FOJB 2CY6A 4JDNA 1RUD2 1U5ZA 2QDNA 1G9BA 3THTA 3PVEA 4WZFA 5JMCA 2A7AA 5T52A 1EY2A 3ZSKA 4QHBA 1IQAA 1Q8QA 4FOQA 1QOSA 4XTMA 4N53A 1KFXL 5L73A 1COV1 1CX4A 4PIXA 3MF6A 3PVNA 4AHXA 1NE4A 3LWCA 4LUMA 2B46X 4HPKA 4FPFA 1V9U3 1YFWA 4KH9A 3KCXA 2IXJA 2MHFA 3WP5A 4AVVA 1DQ6A 3RJRA 4Q0SA 2Q8OA 1FOD3 4ASLA 3SCHA 2BPA2 3BOWA 1RUH2 2DURA 2NP0A 4R4XA 2BWCA 2NN8A 2WFF2 3PJYA 4MGIE 4FPJA 3VBOB 1HLCA 2X29A 1XYNA 4C0BA 4URTA 4XFAA 5CVRA 1CAVA 3DL3A 3TAYA 3AKRA 3SCFA 4XBNA 5JOYA 4OHZA 4Y20B 1G6NA 2DUPA 1ZZBA 3MLJA 5KXEA 2R041 3TN91 1NG0A 3LGRA 3JD71 4XF3A 2WZR1 1DYPA 4YW4A 3V0AB 1VBE2 1QH7A 2XBO2 3UKTA 1PO13 1Q8VA 1J3PA 3J8F2 2JG9A 4NO4A 4QD2A 1YFYA 4LO8A 1WLTA 1BEV1 2D3PA 1WBLA 2JG9C 5JPNB 5CADA 4GXLA 4OVEA 2ZGRA 3ZSLA 2OA2A 1G8WA 3NAPA 4Y22B 3RSJA 1CGPA 1NY71 1N3PA 1B35C 3M3EA 1W2UA 3VHOA 1PIV1 3NAPC 3B5LB 4I30A 1TME1 2UWBA 1ASJ3 4RQPB 5EXOA 1BK1A 1LGNA 5GZCA 3GF6A 4QPIB 1MS0A 1BKZA 1BQPA 4DNYA 1LOFA 3ZFGA 1RJ7A 1ZZ7A 3AKPA 3N7JA 5FOBB 4JCKA 5ABJB 1UU5A 4N9HA 1LOFC 3ZFGC 4CRQA 1AYM3 4R9AA 1QJY2 1LOGA 5FO7B 2A3XA 4WM8A 3M3OA 2GC2A 1JUHA 3H1YA 1Z78A 2ZOEB 1OQDA 4H7LA 2HEWF 2PLV2 5KXDA 4WM8C 4AEDB 1W6PB 1WLDA 2GH2A 3BPZA 3VZJA 3V64A 2ZMNA 1J1LA 1RUF3 4MH0E 4O9GA 3TB0A 1YJKA 3VKOA 3A0KA 5CFCB 3VDDA 3GZUC 4PCRA 2ZA9A 4XJAA 3ZO0B 4CDWB 4YZ2A 2IFRA 4K40A 4DRVA 3VDDC 2ZX2A 1SLCA 1MZFA 3VHRA 2VVEA 4HMZA 4Q29A 2R071 3ZN6A 2HWE1 4QPGA 1I6XA 1R1A2 5KWRA 1BBT3 1CD3G 1GSLA 1W6OB 2D98A 4LBMA 1CESA 3RDIA 5IK8A 4QPGC 2C5DA 2GC3A 1XYPA 4MGYE 5H9QA 4KU8A 3H1WA 3EJKA 1VBD1 3ETQA 3RRDA 3V65A 4XHXA 1XNBA 1JYCA 3OGGA 1NA1B 3D5OA 1NQDA 2DCYA 1DGLA 4LBQB 4EROA 5FQ0B 5C4WC 3WG2A 4RD7A 4LLOA 1ZRDA 4WVZA 4DXZA 2WL1A 3WOGA 3WDYA 2ZACA 2WKKA 1POV0 2CTVA 1C8NA 3CNAA 1LESA 1Y43B 4PDWB 1RC6A 2VGDA 5KHGA 1APNA 2EAKA 4RS5B 3WDUA 4DZGA 5LEKA 4QQ2A 4CEYA 1LGBA 1SLBA 5I8SA 2ZGMA 4W6YA 2DCZA 4UW3A 3OPZA 2DU0A 5I8TA 2WFF1 4CEYC 1VAMA 3PHMA 5CAZA 3RMYA 1WD3A 1DIWA 4RR3B 2HWB1 2YY1A 5JCTA 1Z7S1 1Y7BA 4GQ7A 2MEV2 5H9RA 1RUH3 3WNXA 3MDPA 4XBLA 2DVDA 1S2KA 4IEQA 2VG9A 1V6NA 3V0BA 5GKAC 3AK0A 4PLOA 1GV9A 2AREA 1S2BA 1W6QB 4B8EA 4NWWA 2W68A 4COZA 3WQ7A 4G4FA 5EYYA 4J1WA 5FPZA 1VP6A 2OPKA 4XMAA 5I0TA 1N1VA 4FCAA 2R30A 1EAH2 3M7AA 1M4WA 4LA3A 2TEPA 3H1MA 1RUJ2 4XETA 4KWLA 4F7ZA 3VBHA 2IWGB 2EA7A 3POWA 2CNAA 1ZRRA 1C8M2 5EFUA 3E5QA 3NW4A 3DUIA 3WVJA 1VBA3 4NWVA 4BE3A 1OMIA 3OYWA 4XJZA 2FZ2A 3VBHC 1VBE3 2H0VA 1EPWA 3AMNA 1PO21 1EV13 1R091 3AM2A 2XHKA 3FJSA 1G86A 3D6EA 2E63A 3OD0A 1RUC2 2CWSA 3WZ1A 1NZCA 4M3CA 4OULA 4AFMA 1DG6A 2D6OX 2B42B 2IC1A 3RQ0A 1ZZ6A 4IETA 4FOYA 2HWC2 4GULA 1QJX1 3RMXA 2JG8A 5F6LB 3WHTA 4Q4Y3 4WM7A 3QD6A 4YVSB 1O3SA 2P3IA 2JG8C 1CAXB 3GBWA 5K8SA 2QZ3A 4WM7C 1TNFA 1DQ1A 3JZVA 3ZMNA 1DGWA 1V6JA 3VBRA 1OLRA 3DGTA 3KLSA 4XXAA 1C3HA 2RMU3 3VZOA 3W59A 2IXHA 2R1DA 2ZGNA 2F4PA 3VBRC 3SCGA 3ZYIB 4GA9A 3HIFA 2HWD3 1GYKA 2XG3A 2AENA 3WY6A 1SQ4A 1HRI2 2ZTNA 1EP0A 4GKYA 3PMSA 1R1A1 1FPN1 1NOVA 1LECA 3X29B 1VR3A 3HQXA 2O1QA 3VUOA 4AHWA 2XL9A 5GALA 4UW6A 3AP4A 4AQ2A 2DFBA 3MGUA 3TYJA 3KM5A 4Q0PA 4YGBA 5K0UB 1JXNA 1JBCA 3ZFEB 1PM7A 3M1HA 2Q0AA 4BIOA 2WNUA 3ES1A 3OGJA 3U11A 2QVSB 1F31A 2YROA 2WNUC 1UX6A 2JENA 4CP1A 5HI0A 3R4SA 2GAUA 1QJU2 3MIGA 1EPZA 5HXVA 3E5UA 4LBKA 3WDTA 4GB32 3JBG3 3G7DA 3IPVA 4PBOA 3VKMA 2P3JA 3KQRA 2RS31 3GHNA 5KC5A 2FQPA 1SBEA 1LHOA 1FMD3 1UCXA 4ISQA 4ZU4A 1FNYA 3B94A 2MEV1 4FBFA 4YG0A 3GBFA 3NL1A 3DF0A 4YZ4A 2RJKA 1VBC3 3QACA 4H7MA 2DCKA 4QQHA 1QMJA 4AEMA 4HSJA 4R4ZA 3K48A 2XJTA 2RS12 1TEIA 1NCRC 3FC0A 4FPYA 1YFXA 1UIJA 1ULEA 3GZTB 3WQ0A 3QLQA 2X5IB 4HLTA 2XJPA 3SMHA 5C9AB 4AI1A 3LA2A 2D44A 4QMAA 1OI6A 4GIQA 2XLGA 3JU9A 3O0XA 5EV7A 4JGZA 1OA3A 2BNNA 5A3LA 5EYXA 4COVA 1GQHA 3IDCB 2GNTA 4JGZC 3WINE 3AXEA 5FLJA 1RUJ3 1AYN3 4ASMB 4Q0VA 1Q8SA 3DPRA 2GMEA 2ZGKA 4BH9A 2UWCA 1LRHA 2B7YA 3RS6A 1CPMA 3T2TA 3DPRC 5LK7B 1VBB1 2ZZJA 4XF9A 3POSA 1BVP1 4GMP3 1GBGA 1AUYA 3OCPA 3AJZA 5FMOS 1E57A 4AI0A 4Q0QA 2JICA 1HXS1 2OYZA 5FLHA 3VZMA 1HQNA 2HWC3 1UL9A 4N90A 4FPOB 3D82A 1OQEA 4IV3B 1GFF2 4C91A 2XVLA 1CN1A 4GALA 4KG0A 2Y0IA 2A71A 1PMIA 2G9FA 1UPIA 4XW3A 5DG1A 2RR11 4P9GA 4RGAA 1YLLA 4FPLA 1C1FA 4GH4A 3O0VA 1SFYA 1AL21 4IEYA 2Y38A 4GH4C 4PIYA 3FUQA 1RUG1 2WA4A 2WJSA 1OQ1A 4XXPA 1N1TA 3BCWA 5CNAA 3FBYA 1OSGA 2GU9A 1HRI3 1R083 4MV2A 1D0HA 4Y26A 5BNPA 3MIBA 3IIAA 5C8WA 1H9WA 4Y20A 3W58A 1G7YA 4XMIA 3MI8A 3KD4A 5BNPC 3AMMA 3KSCA 1COV2 4E27A 2ZS6B 2XWBB 4FO9A 4EWAA 4CDUB 1AX0A 1J58A 3V0AA 2ZX1A 2QDRA 4Q2FA 5LRRA 4Z92B 3AMQA 4HL0A 2A6YA 4Q4W1 4EN8B 1KDMA 2QJVA 2V09A 3B9CA 2DUQA 1SEFA 1F9KA 1BYHA 5GLTA 2VUAA 3ILRA 1LHWA 2QKDA 1LU1A 4L99A 1HRV1 2Z42A 1MACA 2GC1A 3CO2A 2LM3A 4LO4B 1QJU1 3M70A 4Y22A 1DZRA 4DINB 4GB31 2EXHA 1LEDA 3VBFB 2BWAA 4MX3A 2R0HA 3VLBB 1VRH3 4D3WA 3KMHA 1V70A 1NYWA 2ARXA 2HEYF 2PHLA 2H0BA 4YGCA 1H1MA 5HCFA 2JKBA 2DFCA 4GWMA 4A3XA 3TRSB 4AVTA 3E6CC 1YWKA 1SLTA 1LOEA 1RVF3 4RQPC 4QPIA 1RUOA 2AZ5A 2RS51 2R042 4B3NA 1UF2C 3AZYA 3U07A 3W9AA 4XBQA 3JD72 2WZR2 4ZU5A 5ABJA 4QPIC 1D2SA 2E9QA 5ABJC 1ZBE3 1BEV2 3VHNA 5AFEA 2K9ZA 1UU4A 2D7FA 1POV1 2C0ZA 1C28A 1PNGA 1SACA 1REEA 1V6MA 3MYXA 2WSVA 1WW5A 2DVFA 4TLFA 1NCQB 1W6PA 4QGNA 5JZGA 1VB2A 1AX1A 1AR61 1NY72 4COUA 5J36A 2R061 2O0OA 3WP4A 1PIV2 1H8VA 4XTPA 1LU2A 4M00A 1TME2 1XNCA 5JZGC 4Y1UA 4A2UA 5A32B 3VBUB 3U0ZA 4D7TA 3R4DB 2XJVA 3WDXA 4CDWC 4AXOA 3L9JT 1BCXA 2HJIA 5CG8A 2X8KA 3IKWA 1W6OA 1I3HA 3MICA 1WGPA 3AXDA 4JC1A 1S0EA 4Y24A 2WNVB 1ULGA 5ACA3 4QXKA 4BLJA 2A3WA 1ZBA2 4HN0A 3ZN4A 4E2SA 4AVAA 4SBVA 2DV9A 2VMHA 3UKNA 4LBLA 1X36A 1MQTA 1UD1A 1SBFA 4YSFA 2DF7A 4B7EA 3ZXKA 3BIWE 1ND2B 2DTWA 2R0FA 3UL2A 1MQTC 4WZCA 2VXRA 4YZ1A 4V1PA 1FATA 1QJZA 4BMEA 4G9SB 2VQ0A 4FQZA 5DG2A 4PDWA 2GNBA 1PVC1 4IEXA 1VALA 3MEPA 4RGGA 4PDWC 2NQYA 2R072 1H0BA 2ES3A 2HWE2 4Y4YA 5A33A 5C6CA 2PHFA 4K1YA 4GKXA 2D6KA 1K5MB 5AC91 4JRLA 2BVBA 1J3QA 1DQ2A 2ZGOA 1O3TA 3IT8A 3TWIA 3QCWA 4FAHA 1GR3A 1O4YA 1S0FA 1DYKA 3JUUA 4DOUA 4LHNA 2A70A 1MVQA 5F5QA 4MYEA 4BPZA 1LKNA 5D8AB 2BW8A 3QOPA 1D4M1 4L11A 5FFOC 3ZXJA 3JQWA 5JI7A 3ENRA 5JOWA 1WW7A 1A8DA 3WR0A 1AR71 3M3CA 1OPOA 5FLIA 1QWRA 1OPMA 1XU1A 1NQJA 4YVWA 2WFPA 5BNOB 4KWKA 1SLLA 3D8CA 4XF0A 1KRIA 1ENXA 2H6CA 4EWEA 4K1ZA 4YVWC 4F8AA 1CVNA 1ND3B 3WW2A 4XJ8A 2PHTA 1V9U1 3CL1A 2V73A 1FX5A 1UAIA 1Z0HA 3HMYA 4Z1VA 4N43A 1JYIA 5T5OA 3BTAA 2HWB2 1FOD1 1Z7S2 2XWJB 4N43C 1WCSA 5L7OB 4K20A 5HCBA 1LHUA 2KA3A 4IEOA 2D6LX 2HKXA 2Q1MA 4YG6A 5L36A 3T1LA 4IEWA 4YW2A 2ZABA 1X8EA 1RUNA 1BMV1 2H6BA 4P14A 1RUI2 3USSA 3I2DA 3KB5A 4GMP0 5I0UA 3FX3A 2DVBA 3TNPB 2R6QA 3WHUA 4EV0A 4FT8A 2PN5A 3TN93 2EXIA 4WV8A 4FPHA 3JD73 1B35A 3H3UA 2WZR3 4BLIA 4HVRA 2ZKLA 1PO22 3B93A 1R092 5H9PA 2OIIA 3WUDA 4OI0A 3WV6A 2JE7A 4WVMB 3I7DA 1BEV3 4BIFA 5B2GB 5GLWA 1FV3A 1U5YA 2ZJCA 3WLUA 4LO7A 5JSOA 1H8TB 4DFSA 5JWPA 3I59A 5CIRA 2TBVA 4NOTA 1GKBA 1UMZA 2NMNA 2UY9A 3P3NA 1QJX2 2UYBA 3CEWA 3HT1A 1AXZA 5CFDB 1TME3 1GNHA 2PQQA 1ZBA1 1OOPB 4LUKA 1LCLA 1HV0A 1I1EA 2YC0A 4LT5A 3WT3A 3NV1A 3ELNA 3J4UH 4GWNA 4YGDA 5K0UA 2GMPA 3ZFEA 3S30A 1LGCA 1YO8A 4PQ9A 1YFUA 3R05A 2WT0A 4XFFA 5K0UC 2FMYA 3ZFEC 1HDKA 2EVXA 4CP0A 4YFWA 2JD4A 3B3QE 2I45A 1LHNA 1RUF1 4K8FA 4B4RA 3VBSB 1MEC3 4AQ6A 4FPKA 2B8MA 1UKRA 4BZ4A 1QQP3 1GZWA 2YYOA 1FPN2 2A6ZA 5GLUA 1FV2A 1NE6A 2A5ZA 2XLFA 2ZX4A 2R073 5C4WA 4RA0A 2K2SA 4PJYA 1UZYA 1U0AA 4B4QA 2IZWA 2JDZA 4CDXB 2P3KA