4HN1A

Crystal structure of h60n/y130f double mutant of chmj, a 3'-monoepimerase from streptomyces bikiniensis in complex with dtdp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
199
Chain Sequence
b'MHPLSIEGAWSQEPVIHSDHRGRSHEWFRGESFRQAFGHDFPVAQVNVAVSHRGALRGINYTEIPPGQAKYSVCVRGAGLDVVVDVRIGSPTFGRWEIVPMDAERNTAVYLTAGLGRAFLSLTDDATLVFLCSSGYAPAREHSVNPLDPDLGIAWPDDIEPLLSDRDENAPTLATAERLGLLPTYQAWQEQQQAQRLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 3-epimerase in D-allose pathway
publication title Structural and Functional Studies on a 3'-Epimerase Involved in the Biosynthesis of dTDP-6-deoxy-d-allose.
pubmed doi rcsb
source organism Streptomyces bikiniensis
molecule tags Unknown function
total genus 54
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.27: dTDP-4-dehydro-6-deoxy-D-glucose 3-epimerase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hn1A00
3SXWA 3NKTA 4IEYA 5KHHA 3NL1A 4MGKE 3H7JA 3CLPA 3U11A 4IETA 3S7IA 3B02A 4LUMA 4AXOA 1O5LA 2QNKA 4QX5A 5FCCA 1RL3A 3H1YA 1I6XA 4MV2A 1J3PA 1X7NA 5JSRA 1CX4A 5I0UA 4RD7A 4MGZE 2ET7A 3HIFA 4YNIA 2B8MA 1LKNA 4IEPA 5JSOA 5KHGA 3MPBA 1YFUA 1I5ZA 2FQPA 2GC3A 1ZZ8A 2IXKA 1CGPA 3U10A 5LRSA 3EBRA 3NJZA 4X6QB 3IBMA 3OF1A 3ZDSA 4WBBA 3H1MA 2IXLA 4JTNA 2EVXA 1J1LA 3E97A 5JAXA 5LEJA 1QY4A 3UKVA 4EWDA 2N7GA 3SMHA 1ZNPA 2VECA 4QMAA 3RDIA 1Q5OA 3ETQA 5FLHA 4F8AA 2WFPA 4IEVA 2PAKA 2V09A 3I7DA 1DGRA 2CAVA 5F1RA 2ZKLA 3KGZA 1NZCA 4MZUA 3KCCA 4I0AA 4QGMA 1L3JA 3FHIB 1DZTA 5FLJA 3WW2A 1NXMA 3N4MA 3WW4A 3H7YA 5BV6A 2UYAA 2D5FA 1UIJA 4XFBA 1Y3TA 4L11A 1J3RA 1OI6A 1Q3EA 3I59B 4HN1A 2IXJA 1UCXA 1YWKA 2OYZA 5J48A 4TLFA 2Q1ZB 3FE5A 4HSJA 1YFWA 1UPIA 3IDCB 3DKWA 4OLLA 2Y0OA 4I2OA 4HZFA 4I09A 5I8SA 3H1WA 5CADA 2HKXA 1FT9A 3FWEA 3M70A 4HVRA 3E5UA 4UBHA 2KXLA 1EP0A 2PYTA 3RYKA 2DCTA 1QWRA 2IC1A 2GH2A 2ETEA 5E16A 3FJSA 4QXKA 3H50A 4UBGA 2XKOA 2OPKA 3CEWA 1ZRDA 2HJIA 3QOPA 4FAGA 2GC2A 3FZ3A 4MGYE 1CAWA 4LA3A 5I8YA 1ZVFA 1ZRFA 2CGPA 4BIFA 2IXCA 3BB6A 3HT1A 1J58A 3CL1A 2MHFA 4FAHA 5FQ0A 5KHJA 4ZU5A 4IEXA 1Y9QA 3H3ZA 4R52A 3NVCA 1H1MA 4PIZA 4QGNA 1O3TA 4NVPA 5CU1A 3H8UA 2E9QA 3LWCA 3LAGA 5FLIA 2PHLA 3S7EA 2FMYA 4MH0E 2PHDA 4LLOA 4YSFA 4IEOA 1ZRRA 5JR7B 3ES1A 2IXIA 1X8MA 2OA2A 3PLQA 5D1IA 4AVAA 1ZREA 3SCHA 2Z69A 3D0SA 5BY5A 4ZU4A 1H1IA 1PM7A 1YHFA 1O5UA 3OD0A 4E2QA 1QXRA 5I8TA 4LULA 2EAAA 1OFNA 4H7LA 2Q0AA 4IEWA 4N9IA 2BNOA 3SCGA 1IPJA 1WGPA 4JTOA 3FX3A 4WZCA 4Z07A 2XLFA 1V70A 1GQHA 4I01A 3HQXA 4MX3A 2GZWA 2H0VA 2OZ6A 1VR3A 4B29A 2PAEA 2XGXA 4XF1A 5KHKA 1RUOA 1UIKA 2XLGA 4Q0UA 4WVZA 1RGSA 1ZX5A 3BCWA 4Q0VA 1WLTA 2O1QA 3GYDA 3WW3A 3ES4A 2VPVA 3NSTA 3U0ZA 4QM9A 4BH9A 2XL9A 4PIXA 5C8WA 5FPZA 1GQGA 4LUKA 3R6SA 5E1RA 2ZCWA 5FPXA 3E5QA 3DN7A 1SQ4A 2QDRA 4Q0PA 3H9AA 3NW4A 4EWEA 3LA3A 1YLLA 1LB2A 3VHRA 1ZRCA 3G7DA 4XFGA 4HN0A 2GC1A 4P9GA 3C3VA 1J3QA 3E6DA 1CAWB 5J7MA 1IPKA 5C6CA 1J59A 2PQQA 1DGWA 2UY9A 1XE8A 1X82A 4HVOA 3IIAA 3HT2A 3O14A 2O8QA 2PFWA 3EQEA 1CAXB 4KWLA 1X8EA 2WC2A 4XFAA 5EFUA 2PTMA 4EWAA 4HSLA 4DINB 5I0SA 3M3IA 3PNAA 4YYOA 4IEQA 2D40A 4IERA 2BEOA 2BNMA 2P17A 4FBFA 4KU8A 3IWZA 4I3PA 1OD5A 1ZZ7A 2CAUA 4KWJA 4F7ZA 3SCFA 1VP6A 4BYYA 4FT8A 4N9HA 4D7TA 3KSCA 4HBNA 4KWKA 3LA7A 4OFGA 2B9UA 5BPXA 3RYRA 4LTAA 1QXJA 1XE7A 4I02A 1RUNA 4AVCA 2XL7A 3GBFA 5EZWA 4ZU7A 3LA2A 2GAUA 2H6BA 4D7SA 3MDPA 3LOIA 5I0TA 3ELNA 3TNQA 1CAVA 4XEZA 4X6RB 5I91A 1LRHA 1VJ2A 3BPZA 4XFIA 4QM8A 4KL1A 4HMZA 3EO6A 2XHKA 4CYDA 1PMIA 5T3NA 3KGLA 4XETA 4XF3A 1CAUA 5JSPA 4IEUA 4ONUA 2UYBA 2MPFA 2PAMA 2QCSB 4XFHA 3RPQA 5JCTA 1U12A 1LR5A 2BNNA 4HVQA 4AQ2A 2F4PA 4EV0A 1WA4A 4O9EA 4IEZA 5I93A 1EY2A 3UKNA 2ATFA 4XFCA 1O3QA 2GU9A 1O4TA 4A2UA 3E6CC 4AQ6A 1YUDA 4YARA 3S0MA 5AVPA 4QGLA 2MNGA 4HLTA 3D82A 3WW1A 2K9ZA 4EROA 2K0GA 1OMIA 1ZZ9A 1YFYA 4Q29A 3EHKA 3KMHA 2OZJA 4Q0SA 1UD1A 3EJKA 1YFXA 3E6BA 4XF9A 3LZZA 4META 1FI2A 3ST7A 3MZHA 2XLAA 1O7FA 2VQAA 1NE4A 2Q30A 3IDBB 4YRDA 4Q0QA 4MUVA 1RTVA 5KHIA 3I54A 2EA7A 4KU7A 1EPZA 1ZZ6A 4LEJA 4XF4A 3DL3A 1FXZA 5BUVA 1TQ5A 4K8FA 4J1WA 3MYXA 1RC6A 2BYVE 4UXAA 5HI0A 4JVAA 1O3SA 2QVSB 3E5XA 2GC0A 2I45A 1NYWA 4I0BA 3ROUA 5FQ0B 1XRUA 4E2SA 3CJXA 2IXHA 3OCPA 5FDBA 3DV8A 2PA7A 1CAVB 4XFFA 2ET1A 1SEFA 1EYBA 4BHPA 2D93A 3SHRA 2UY8A 2H6CA 2D5HA 4Z82A 4GULA 4J1XA 1SFNA 3TNPB 1DZRA 4PJYA 4JV4A 4L2NA 2CV6A 1CAUB 3FFQA 3L2HA 5LEKA 2Q4SA 5CVRA 1UW8A 3OTFA 3USSA 3RZZA 3RYPA 1ZZCA 3BALA 3QACA 4IESA 1ZZBA 3ACLA 5BXXA 5I0RA 2B5HA 2XKPA 1HW5A 4LA2A 2BGCA 3H3UA 1JUHA 5K8SA 4PIYA 2QJVA 4XF0A 4ORFA 3RNSA 4AVBA 2Z2SB 3D0JA 3I59A 4R8HA 1O3RA 2C0ZA 3BU7A 3JZVA 4MGIE 3PVBB 4E2GA 5LRRA 3CF6E 5KBFA 1CAXA 1Q43A 3UKTA 1NE6A 3CO2A 1G6NA 3OGJA 4O9GA 5J3UA
chains in the Genus database with same CATH superfamily
3SXWA 3OPZA 3NL1A 1X33A 3VBUC 2VNOA 4IETA 1FX5A 3B02A 2WZR2 4LUMA 5C7GA 2QNKA 4FPEA 3TOJA 1VBB2 2VCMA 1GANA 1UOFA 1PVC1 2DF7A 3HQUA 4NRPA 3ZVXA 4TN7A 1QJFA 1RUH2 1O4ZA 4GKYA 5IW0A 3SH3A 5CISA 3IZOA 2OKXA 1W03A 4LR4A 1JUIA 1OLMA 2XVGA 5M0TA 1FYUA 2EXHA 3JB4C 1JYWA 2XB6C 3WEZA 3IPVB 1BK0A 2OT7A 4RD7A 1TEIA 4AFDA 1B35A 4XBNA 5E6HA 5F3CA 3JCIA 1CZTA 1V6KA 5FZAA 4YG6A 2EXKA 4IEPA 1LKNA 4XDPA 3N35A 2O8OA 3MPBA 3NAPA 2RMU3 4GB32 4IE0A 2YY1A 3TEXA 4CCLA 5JIUA 1I5ZA 1ULOA 2VMFA 1VBA1 1TNRA 1OA2A 3KVBA 4GIQA 2JG8C 4PBPA 1UZVA 5A1FA 2D6OX 2GC3A 5AVAA 3T0BA 2JDAA 1US3A 1ZZ8A 4HANA 1RUD3 4MOAA 4P08A 4WM8A 1CGPA 2VNVA 3H0OA 5BNOA 2HWD2 5HCBA 3WF0A 3IBMA 1ULPA 5C3RA 2A6ZA 4WBBA 4BMEA 3IMMA 5CKQA 2HEYF 4GWMA 2EVXA 3AFGA 2QQOA 5FZFA 2P37A 1N3PA 2JX9A 3ME2A 2LROA 4SBVA 3BTXA 1C57A 2XBO3 1QY4A 1H6XA 2B7YA 3WQBA 3JB8A 3RZMA 3LPGA 3SMHA 2TNFA 4D6SA 4PDWC 4LK7A 1HB3A 3JUUA 3WXPA 1BCXA 5FLHA 4F8AA 1SCSA 1W05A 2DTYA 2YC0A 3C8XA 5LY1A 3JD71 1MEC3 3OD4A 3ZFFB 3I7DA 2WZEA 3ZMOA 2CAVA 3J8F3 4YM2A 4RR3C 5F1RA 4XDQA 1LU2A 1NZCA 1RUH3 4I0AA 1L3JA 3FHIB 3R0RA 4UFJA 3AM2A 1DZTA 1FNZA 2XR4A 1FATA 2Z5WA 4LBJA 4QXBA 4UFMA 3AYEA 2B42B 3LGRA 2D44A 1OA4A 1V0AA 1NXMA 4XJWA 4QHZA 3WW2A 2H0BA 2OW4A 2CWMA 3N4MA 4NHLA 3M7AA 5EWSA 3T3YA 5C8CA 2VBDA 3GGLA 5BV6A 2ENRA 1QDOA 4P9JA 1FMD1 1J3RA 4L11A 2VW2A 2HLEA 3I59B 2NYYA 2WBKA 4H7MA 4PI0A 4GB33 1FPN3 1RMU2 2TEPA 3OYWB 4HN1A 4JC1A 4A42A 3VBRC 4D3WA 4FP2A 4A44A 4AAPA 4AVVA 3VD5A 2JIGA 3FE5A 4HSJA 5FP8A 4CEYA 1JZ8A 4XIOA 5EYXA 3RJRA 3ASIA 1UPIA 4R4XA 1S55A 3B5LB 2ZA9A 3IDCB 4HPKB 4OLLA 2HWD3 1DZQA 1UU4A 1WW4A 4DZGA 3RG0A 4CCNA 3H1WA 4NIAA 4ES9A 3NMBA 2ES3A 2GN3A 5SV8A 4HVRA 4Y22B 4CDQA 4URAA 2DCTA 3O1TA 1QWRA 1OQEA 3CU7A 1HXS1 4M3CE 1W8OA 3K4AA 4CCOA 4J25A 4PF1A 1XJAA 1UX7A 4DMIA 3EMRA 2VG9A 3UGHA 4NPLA 3USUA 4BIOA 1OF4A 2GC2A 1XU1A 4FAGA 2W1SA 2NLRA 1HB2A 4OUMA 1F4HA 2WNEA 4LA3A 1XSQA 3JU9A 4OCTA 2W3JA 5I8YA 1JODA 4JRLA 2RE9A 1VBC2 3IB3A 2HWC1 2A6VA 2ID4A 1KDMA 3HMYA 1AL0G 3HT1A 4QQ2A 2WS92 3L2YA 1AR73 2DVAA 4XUTA 4FAHA 5DDJ1 5LBCA 2XPJA 3ZXJA 4ZU5A 3GBGA 5FBJA 4G4FA 4CP0A 4Y1YA 1X9PA 4YM0A 4AW7A 1JZ2A 4A6SA 1O8SA 3NVCA 3Q8FA 1BEV1 1H1MA 4NOTA 4RS5A 5CA6A 4PIZA 3MIEA 3BODA 5FYTA 5TSWA 1GZWA 3AB0A 2QUOA 1DYKA 1WZXA 3KHCA 3H8UA 5FREA 3RZGA 3VDAA 1RMU3 5FYBA 1F9KA 1CD3G 4E4DX 1HJGA 3DPRC 1MPXA 3ACHA 2PHLA 3S7EA 4MH0E 4XZUG 4B4PA 3KS7A 4NIHA 2Y6LA 4IEOA 1PX4A 4E4HA 1ZRRA 4CXWA 5JR7B 2VZSA 2IXIA 2OA2A 2QQVA 3DYMA 3K77A 4FFGA 3WG1A 3VD9A 4XXAA 1UXXX 3D0SA 3AKTA 3OUHA 5FZCA 1CPNA 4ZXKA 5FMDA 2HWB3 2R073 4DEQA 3N9LA 1PM7A 4MGTA 2MEV1 1Z7S3 2PMWB 1RUE1 1TNFA 2JDYA 2YBSA 4YLZA 4GXLA 3DECA 2G9ZA 4H7LA 3WZ1A 2EIEA 5FY0A 4OYUA 2HWB1 2RM21 5HCHA 4WZCA 4Z07A 3FX3A 5J09A 2DFCA 1Z7S1 4LO6B 5FPLA 2XLFA 4DO0A 1QIQA 5T5OA 3D8CA 1D4M1 4IV3B 2GNTA 2DVDA 2VTXJ 4GMP3 2GNDA 3MV11 3HQXA 4MX3A 5C9AA 2JICA 1VBE1 1OQ1A 4Q4X2 4LORA 3OG2A 5FK7A 1TME3 4KG0A 1YEWA 3NRUA 1J1TA 3CIHA 4XF1A 4GMP1 4BQ3A 5KHKA 4CDUB 1R082 2VMCA 4CXXA 2QQPA 1W6OA 2BWCA 1TME1 5A3OA 3W59A 4JGZA 1RGSA 3AL6A 1LOAA 1REDA 1HN1A 2ZEYA 1SDDB 2VM9A 3ES4A 4W50A 2VPVA 4QAWA 4DRRA 3U0ZA 3BN6A 1LOBA 2HH9A 2P4EA 3OPTA 2OQ7A 1J84A 1UZ0A 4PIXA 1OC1A 4I3GA 3MIHA 2XQXA 2VOXA 3D6EA 1ZA7A 5FZ9A 1JYVA 1AYM1 3N7LA 3POYA 2ZCWA 5DUUA 5FUIA 1HLCA 2TBVA 3DN7A 2ZMLA 1SQ4A 2QDRA 3M3OA 3N9OA 3UV9A 5KWRA 3H9AA 3ZYGA 3B94A 2W94A 1CIYA 1I5PA 2ZGRA 3LA3A 1YRZA 4QX8A 4IE7A 3B3QE 3AYCA 3HVDA 3WSOA 3AMHA 3G7DA 1AX0A 3MW2A 3PVEA 4QPYA 4XFGA 2BOIA 3ZPYA 1AXZA 4MO3M 1CAWB 4DPNA 4FTSA 3E1F1 2R0HA 1M4WA 4RHV3 5FYYA 3IPVA 3B93A 4RQPB 1C1LA 4NPMA 2PQQA 1WCDJ 2Y60A 3VKMA 1GWKA 2Y34A 1DGWA 2UY9A 4PLNA 4XAEA 2GP3A 3ZR6A 4HVOA 2JXAA 1AJOA 2UWAA 4Y20B 4AF9A 4RHV1 2PFWA 3EQEA 1VMHA 4TLGA 4Z8BA 3KB5A 4FPHA 1OF3A 5FAXA 5A32A 4IW3A 4AGGA 2ZHMA 4XJAA 5JI9A 2JD9A 3VD4A 1H30A 1VRH2 1X8EA 4XFAA 3W58A 2PTMA 3RMYA 4QX1A 5LBBA 3CBNA 4Z1VA 5I0SA 5C4WB 1UQXA 3VBUB 2CYFA 2YMZA 5FKBA 1RVF2 1SDWA 2BNMA 1NA1A 3R05A 4LBKA 5FZ1A 1JYNA 2QTWB 2WO2A 4KU8A 2LUWA 2BJSA 4QPIC 3LDBA 3WLUA 1AVBA 4BE3A 5F5IA 4F7ZA 4HBNA 1HRV2 4CVUA 4P9WA 2B9UA 5EJ1B 3B9CA 4CU7A 2VMGA 4QB6A 4YW6A 1DBNA 1LU1A 1QXJA 4LTAA 2NN8A 4KBBA 1WCKA 1M06G 1XE7A 5IVBA 3B00A 4BDVB 1T6BX 2XL7A 5A7OA 5EJZB 5EP9A 3KV6A 3LF7A 4OHXA 2ARCA 5FWEA 5CFDB 4ZU7A 3LA2A 2GAUA 2VOWA 5D21A 2JKBA 4Q4Y2 3VHPA 3WQ1A 4NIGA 1OLQA 3TB0A 4OI0A 1VAVA 3B69A 4QKDA 2ZXQA 4DB5A 3HBKA 2O0OA 5F5QA 1UOGA 4COZA 5K4LA 2R041 2RS11 4K6BA 2WRAA 2XMLA 4AQSA 5F9TA 1CVNA 4I0WB 1C8M1 4DS0A 4X6RB 1RXGA 2BBVA 1ENXA 1VBD3 4QXHA 3V64A 1VJ2A 4XFIA 3O1VA 2X5IA 3ZFGA 1NAEA 4KL1A 5T5PA 1V6OA 1VRH3 4HMZA 1RUG3 3VV1A 4QPGA 4CYDA 3H8RA 3OBZA 3VBOB 4HPKA 4BOWA 1CZSA 3OY8B 3MEPA 5CYYA 4CDWC 1NY72 4XDOA 2D97A 3O0XA 1FAYA 4ONUA 5GLTA 2UYBA 5JXHA 1RUG1 3AVRA 2X09A 3M4FA 1N47A 4FPLA 1RVF3 1W3XA 1PO23 1POV3 2HYKA 2XWBB 5GKAC 5LBEA 4ET7A 1YCIA 4WVMB 1SLIA 5BYNA 3IIIA 4HVQA 4P5YA 3WP4A 4ZS2A 4LKFA 3GNEA 2P34A 4YVWB 1L7QA 4EV0A 5JOWA 2WA4A 1JH5A 1Y4WA 2VQUA 4O9EA 4IEZA 5I93A 1K12A 1QU0A 4HG6B 1OKQA 4XFCA 3A0KA 4YZ4A 1PM4A 5D2AA 2FDJA 1RUJ3 1V6JA 3FLRA 1QJX2 3MI8A 4A2UA 3U4SA 3E6CC 1A8MA 2RS33 1KS5A 1ND2A 3SISA 4BMBA 3AKRA 2E7AA 3DCQA 3WW1A 4EROA 4LHSA 2V4AA 2K0GA 1RUJ1 2R062 4Q4V1 1JOBA 3VBRB 3OB8A 3HAGA 2WFF2 4LBQB 4Q29A 3POJA 4PHZA 4RGGA 1COV1 4Q0SA 5FPUA 1GLHA 1BVP1 4CCJA 4PF5A 3K4ZA 2XXZA 1BBT2 4XF9A 3WF3A 4UW4A 3MW4A 5FZ7A 1ZM1A 2XONA 4META 2D6PA 3PUHA 1NQDA 3ZDVA 3O1SA 3WDYA 2VQAA 1N1YA 1NE4A 5FXWA 4PQQA 3TYJA 1D7PM 1SFPA 3IAQA 1Q8OA 3UGFA 3WOGA 3X29B 4DY5A 1NKGA 5EIYB 3KM5A 4JQTA 5FZKA 3N7MA 3DL3A 4QPWA 3ZFEA 1LEMA 4M4PA 4CP2A 1S2BA 1JS9A 2IFRA 2VZTA 2WWJA 4NR1A 1RC6A 2KM2A 2YU1A 1RUF1 2HBTA 2C5DA 5J36A 2W1UA 3A22A 3ILNA 1WKYA 2YBPA 1VRBA 5BNPB 1HX6A 4COWA 5F2SA 4A45A 2I45A 4AQTA 3INAA 2KR2A 4ZHNA 1HRI2 4LMFA 4NHXA 5FUNA 4JRAA 1AL23 1A3KA 1E5IA 1EV13 5FZ4A 1Q56A 4YG3A 3CJXA 3WT3A 3MIFA 4XPVA 2ZGQA 1UMZA 1QJX3 3GBWA 3ITQA 1W90A 2I74A 4JAAA 5KXEA 3OCPA 2ZJCA 2JEMA 1PNFA 3KZ4C 1N1VA 4GMP0 2WNUC 1W6MA 1CAVB 4XFFA 4HKLA 1TMF1 2R063 1OOPB 3GZAA 4N53A 3WP3A 4XURA 1F15A 1NX9A 3AX4A 4FFFA 4AHWA 2HWE1 2D5HA 5A33B 3OGVA 4FSJA 2FDIA 2CTVA 2EF6A 1SPPB 4XXPA 1LOGA 2UURA 3AYAA 5JOXA 2JB8A 5BNNA 1UYPA 2YXSA 2CV6A 4NHKA 3L2HA 3RZHA 1K5MA 2E6VA 3IN9A 4BU2A 1UU6A 5CVRA 1UW8A 5DAPA 2JIJA 4YW3A 3VL8A 1BZWA 5FWJA 5FV3A 3AC0A 2VQ0A 5APAA 4F83A 4LJHA 3ZFFC 3ZIWA 3T2OA 3BALA 4Q8LA 4YWAA 4AG4A 3J7HA 3P1IA 2WQ8A 5KC6A 3KV5A 2W9XA 3I97A 3ACLA 2AC1A 4QQLA 5I0RA 2B5HA 5AC92 4K40A 3RMXA 4LA2A 4A3ZA 5JDBA 3Q8AA 4LHLA 5IWFA 5K8SA 4NMIA 5HV0A 2VC9A 4XF0A 5KXBA 1PZ9A 2Z2SB 3D0JA 4AVTA 1GWLA 4R8HA 3ACFA 2FDGA 1AR61 1JTZX 3MV01 1MQTA 2VAUA 4DFSA 4XOGA 4E2GA 4ZKTB 4AEDB 3CF6E 5FDBA 5JMCA 5F37A 1AJKA 3HNBM 1AYN2 3UGGA 3UKTA 3S57A 1GMMA 5D8AC 5J3UA 2NZ9A 4MGKE 3VBUA 3NO8A 1CQ9A 3H7JA 5FYVA 3S7IA 5EHDA 1O5LA 1RHI2 3AP9A 1NXD1 4LPLA 1DQ2A 4L8QA 4QX5A 3HD8B 1AXKA 1DGRN 3PUIA 2WO7A 1H9WA 5GZGA 2PLV3 4H2AA 1I6XA 1ODMA 2RS51 1I3HA 3G6JB 4MV2A 1AUYA 4RYDA 1J3PA 1X7NA 5FZMA 2ZAAA 5JSRA 3S5QA 4IV1C 2CNAA 3RS6A 2ET7A 4UW5A 1QQP3 4UF0B 1MVQA 3R4UA 5EV7A 4W4ZA 5T5LA 3P3NA 4LBQD 4LO7A 4EQVA 3N9QA 3AK0A 1ENRA 5JSOA 5KHGA 1YFUA 4YG0A 4XJZA 1KS4A 2SLIA 4C0HA 2FQPA 5GLVA 4XVHA 2JG8A 1PIV3 3NWKA 3M8LA 3R4SA 5AC93 3I3EA 1QEXA 1W6NB 1XXNA 3LE0A 1OLME 3IDAA 1VB2A 4UI9L 5C3OA 1DLLA 3THDA 3EBRA 3O5SA 5LA9A 3NJZA 4X6QB 3W21A 2ADEA 5FZHA 3IAPA 2ZEZA 4A7ZA 1LECA 1W9SA 3H1MA 1C28A 5A7PA 1ULEA 2W52A 5JIAA 1J1LA 3RJ2X 5JAXA 5LEJA 3ACGA 4GWNA 2VH9A 4QPIB 4EWDA 4EN9B 1XOYA 2JDKA 1JHJA 4PDWA 1Q8PA 4W6YA 4XBLA 3ETQA 4XQWA 5LB6A 2IVJA 4XABA 2CU5A 3U37A 3WF2A 2BQPA 1AR83 2WFPA 3WP5A 4NHYA 4XTMA 4E9KA 2VE1A 2PAKA 4LO8A 1MS8A 1DQ1A 4RR3A 5F39A 4CUGA 1UOJA 1W8TA 3ILFA 1GNZA 1POV0 2ZKLA 4LHKA 3VLBB 1R1A2 1RJ7A 4UT5A 1AR81 4G9SB 4FPFA 1UNBA 1S2EA 4IV3C 4UFKA 5JI7A 2YU2A 5IFPA 1BXHA 4SLIA 3MF6A 4CDXC 1GV9A 2Y26A 2XJVA 3WW4A 4IQPA 1S0CA 5CBLA 1AF9A 2ILMA 3LSEA 2NMNA 1SLBA 1V00A 3PDQA 4CDUC 2BRTA 1W06A 2OQ6A 2GNBA 4Y4YA 3WG3A 5F6KA 3H8XA 3PJYA 2P1BA 1H8TB 1UCXA 3OBAA 3KCYA 5GLWA 2OYZA 3VBRA 4YZ2A 3K48A 1UXZA 4TLFA 4AFCA 5J48A 2VTXA 4TYSA 3T2TA 1XSRA 4CP1A 1LHOA 4A4AA 2ZGKA 4LXLA 1U5YA 1AR92 5JUVA 4I2OA 2EIGA 4NIIA 4O65A 3IKWA 2F4LA 2R30A 5GALA 1GYKA 5CADA 2HKXA 1FT9A 1MS4A 3FWEA 3AJZA 4LIUA 4UBHA 4Y4RA 4XUOA 1ULGA 1UU5A 5E16A 5F32A 3FJSA 2HWF3 1AXYA 3U75A 1PVC2 1Y9MA 2G19A 2BP6A 2RVAA 3H50A 4KMQA 4QXKA 1W2UA 4UBGA 4Y1ZA 5K9YA 2YPJA 4EN0A 5DQ0A 1DF0A 3VZNA 5JZGB 3FZ3A 4MGYE 4EZ4A 4XCBA 2CDPA 5C70A 1ZRFA 2VOKA 1V9U2 4RQPC 1GOHA 5KXCA 3ZOIA 2Q8OA 4K9SA 4AEKA 1GOGA 2IXCA 3MIBA 4AEMA 1W99A 3CL1A 2MHFA 1VBA2 2GDFA 2Q8EA 4ATEA 1JZ7A 3ACIA 4Y24A 1Y9QA 4R52A 4RA0A 4RN5A 2DVFA 5EQUA 1X50A 2DUOA 1S2KA 2IUWA 3GJBA 3JBG1 2W87A 5FY4A 1G9FA 4NVPA 2C26A 5C4WC 1AZDA 1DLCA 4GWIA 4BXSV 3DPRA 5FLIA 1FOD3 1KD7A 5A3PA 4WV8A 4YSFA 1W6QB 3A7QA 1ZREA 1X8MA 5D1IA 4AVAA 1AR93 2FMDA 4LBOA 2Z69A 5AFEA 4LT5A 1DHKB 3POEA 2X53S 5FY8A 5ISLA 4B7EA 1PGW2 5L9RA 2B9VA 5CEHA 3VKLA 2PELA 3I2KA 1OBNA 4GJYA 3MUY1 2VNRA 1SBEA 1QXRA 4LULA 2EAAA 1OFNA 2OIIA 2VCCA 1ULCA 3JD72 4RFRB 3PTRB 2QQNA 2Q0AA 2HEVF 3VBSB 5A7QA 2ZX3A 2BZDA 5CFDC 1DU3D 4AVSA 1GQHA 1OKOA 2WDBA 2WZ8A 5C71A 3VB9A 3T2PA 1LOCA 2IWGB 1V9U3 2RMU1 1H4GA 1S4CA 3AYDA 2WNUB 4NRMA 2OZ6A 3AZVA 3BOWA 3EXUA 4HOOA 3T30A 2D3SA 3ZYHA 1W8NA 4L9BA 2WWUA 1W2OA 2XLGA 1RUD1 5EYYA 3GZTB 2O1QA 2JD4A 2C6SA 5LY2A 4AI8A 1YJKA 5DABA 4C1XA 1W0OA 2D6LX 3VBOC 4S2HA 2ZEXA 3SITA 5B4NA 1LHVA 2E33A 3BTZA 1NG0A 2XBO1 2UU8A 4URTA 4LUKA 3M1HA 5L7OC 3SH5A 3CMGA 1AHSA 2R6QA 2WZR3 2Y6JA 1JBCA 5FPXA 1VBB3 1R64A 5FOBB 1HXS2 1NQJA 4PCRA 3NW4A 4Q0PA 5JVVA 4YVWC 4E8DA 4CP9B 3VUOA 4XMIA 1LB2A 1RYYA 3MFAA 5FMOL 5A6XA 1L7RA 3SEPA 1MEC1 4IGOA 3KT1A 5DMYA 4FQZA 3J8F1 4N8MA 3MICA 2R32A 4P9GA 1WA6X 1RUH1 3J7MA 1J3QA 1UZZA 3NKGA 1IPKA 2WYFA 3SLIA 2HWC2 1QF3A 5C6CA 1MS1A 1GUIA 4NN0A 3AZYA 2RDNA 4UF0A 4CZSA 4D8MA 2BU9A 3BTYA 5DDJ2 4YPJA 1XE8A 1X82A 2DVGA 5LK7B 5JPNB 2WO3A 4DUXA 2VCBA 4QX7A 3MHZA 4Q27A 2W1QA 1CAXB 4GB31 1FPN1 4KWLA 4YM3A 1SCRA 1G7YA 1WW7A 1QJZA 5IT6A 2Q5TA 2RDRA 1HB4A 5T52A 4ASKA 1DP0A 1BVVA 3HNYM 3LQCA 4DINB 3BIEA 5D8AB 1KDKA 3LPFA 3M3CA 4S2GA 1E5HA 5DAQA 4OUEA 2Q8CA 1KFUL 3DXUA 1OUXA 3NJVA 3ZYJB 5I0DA 2O14A 4IEQA 2Y64A 2HWD1 5FXZA 2NQYA 2GALA 4FBFA 4BQ1A 1RXFA 4QPIA 5HBAA 2VZ3A 1MR5A 2CAUA 2V5YA 3FMGA 4KWJA 1IZ3A 5FZLA 3SCFA 1WCSA 4FT8A 4N9HA 3T4VA 4KWKA 3LA7A 2JDMA 3AP7A 4UOJA 4OFGA 3ZXKA 1KRIA 1QHDA 3PU3A 4IV1B 5BPXA 4WVWA 1BLZA 1YQ2A 3RSJA 5BNPC 4Q1RA 4H14A 1RUNA 2QDNA 1V6IA 3MW3A 1QJU2 4BB3A 3FBMA 2KD7A 3ZYBA 1YO8A 1D4M2 5BNNC 1QJY2 4YGDA 4B1LA 5FYSA 4KBZA 5A1LA 4AE2A 1W2TA 1AR71 1REFA 2XVKA 4ARYA 2J1UA 2WSVA 3SNMA 3CKHA 2BGPA 2AEZA 3TNQA 4AHZA 4FOVA 2YB7A 2FHRA 2YZ4A 1OOPC 3MPPG 4A7KA 2WQZC 1HIXA 4BQ5A 5I91A 2P2KA 1LRHA 3BPZA 2DCYA 2CDOA 3ZXAC 4LKEA 1W6PB 2PHFA 1UY4A 2AZ5A 1RMU1 3JQXA 2ZHLA 3EO6A 3O12A 1K42A 2WT0A 2XHKA 2YYOA 3KGLA 4HKWA 1WMDA 2PHUA 1DYPA 1RITA 5E88A 2YC4A 1CAUA 4CDWA 4IEUA 1R092 2V5DA 3NNJA 4QX2A 3ZSKA 2PAMA 2QCSB 4JHTA 3VDDC 2AR6A 3MIDA 4YFZA 1LR5A 2BNNA 2VNGA 1W2NA 2R071 4AL9A 3TEZA 4DOUA 2F4PA 3OUJA 5A7SA 1WA4A 4FXKB 5LCWL 4MXWB 5CFCC 2DTWA 3J4UH 2GSYA 2L9LA 4XBQA 4DEVA 4CDXB 3UKNA 2ATFA 1GP5A 1O3QA 4INDA 1O4TA 4ZZ8A 1LGBA 4Y3OA 1VBC3 4Q4W2 4DUWA 3SQOA 4AQ6A 4YARA 5J1XA 3V0BB 4HK9A 1N1SA 1UN1A 3FHAA 2EIDA 1XC6A 5FPVA 2E63A 2WS93 1WW5A 2ZGLA 1EPWA 4CRQA 1H6YA 5CIRA 1QJY3 1YFYA 1SLLA 2ZPXA 3NQHA 4FOWA 2OZJA 2NPIA 4YZ3A 2J1SA 1YYNA 5E89A 1UD1A 5GZEA 3RI8A 3TRSB 4AEDC 4BQWA 4HKOA 2HBUA 3E6BA 4FFIA 5A6ZA 5ABJB 2P6CA 2DBIA 3TN92 1KEXA 2XJQA 4YVSC 2J7MA 1DGLA 1GBGA 1FI2A 1OA3A 3ST7A 3CZUA 1O7FA 3BVCA 1LULA 1U5XA 2Q30A 3IDBB 3J7NA 3N36A 1NCQB 4Q0QA 4IGQA 5FBZA 1VIWB 4XCAA 1ZBE2 5H9RA 3BKZA 1JYTA 1GZCA 1BQPA 3RFRA 5DG2A 1Q8VA 3N3HA 3O0VA 2BERA 3KV4A 4AEJA 4KU7A 1W8UA 1ND3B 5A7NA 4AFBA 4XC9A 4XF4A 4CUBA 1S0GA 4NO4A 4LOTA 2G1MA 2ZS6B 3ZXEA 1GWMA 1OXCA 4Y5Z0 5BUVA 1RUC2 4J1WA 1JW6A 3LEGA 5T50A 3Q8CA 1G9BA 2BFUL 3WX5A 3F95A 2B39A 4AFAA 5L19A 4UXAA 3DKQA 4Z2AA 2A73B 1O3SA 3E5XA 5IHRA 1OFSA 2D3RA 3ZXGA 1GNYA 5FQ0B 1XRUA 4TZDA 2YG0A 4PBOA 2ADDA 2BV4A 4E2SA 4Q4X3 4QX3A 3VBHB 4ZONA 1LTEA 5GJ6A 4Q4W3 4QHOA 5JLVA 3OGGA 4B4QA 1W04A 2RS12 3C7EA 4LHNA 3DV8A 1D2QA 1GOFA 1KGYA 1R083 2PA7A 2WNUA 1GU3A 2YFUA 4NAMA 2ET1A 2BVVA 1SEFA 2WO1A 3GDBA 3QBQA 3SHRA 3GCWA 3VKOA 2XH6A 2X29A 1R081 2VXJA 5FYCA 2ZGOA 4Z82A 3S5AA 4NWVA 1NCRC 2JENA 2ZAHA 3CJIB 3TN93 1G86A 3I2HA 3MO4A 4P9IA 1DZRA 5FJHA 3TNPB 2UWBA 5ACA2 3U78A 2JE9A 1IS4A 3P5BA 4V2VA 3OBRA 2QQLA 4B4RA 5FZOB 5LEKA 2Q4SA 5FP9A 3APBA 5FYZA 4XUPA 3WNPA 4JDOA 5CAZA 1SFYA 3ZFFA 4N43B 2VO5A 5FYHA 3RYPA 2W5FA 4EN6B 1RUC3 1UY3A 1GQPA 3DXTA 2WLPA 4IESA 2A5ZA 1RIRA 2GN7A 1RJ8A 1RUI2 1UMIA 4CUAA 3TEYA 3WQ7A 3DGTA 1LHWA 2J1VA 2WJSA 5BXXA 5FP3A 3VDCA 3V0AB 1X36A 2XKPA 2Y6KA 3AP6A 1XNKA 3OUIA 3O1MA 1ASJ2 1TG7A 4Q26A 1HV1A 2C4XA 1LAJA 3T4HB 1CZVA 1QNWA 3NV2A 2EXJA 4Q4V2 3RNSA 3I59A 1O3RA 1P8JA 3KT7A 3OYWA 2VY0A 1H8TC 5F7UA 2YHJA 3I8TA 1SZBA 2QE3A 1A78A 4H55A 1CONA 4MGIE 4BK5A 4HL0A 2EIBA 2W39A 1VBD1 1CAXA 4DIQA 1W39A 5IK5A 4CCMA 5FY9A 2OS2A 3POGA 3AJYA 1NE6A 5F2WA 3L9JT 1G6NA 2Q8DA 4EJRA 3KF5A 1VRH1 5DAXA 3VBFB 5L7OB 3PU8A 2LS6A 2ZGNA 5D8AA 3RZKA 3NKTA 3VDBA 1CPMA 5KHHA 4Y22A 5LWBA 5FZ3A 3CLPA 1PGL2 1N3QA 2VVEA 3FC0A 1OQDA 4AXOA 3AZWA 1UAIA 5CB7A 3KQRA 1RVF1 1PO21 1POV1 4WM7B 5ACA3 5FCCA 2C24A 1HRV3 1PK6B 3PMEA 2JB4A 3H1YA 5JZGC 1RUF2 5F5CA 2FD8A 3NNMA 2W91A 1HJFA 2VUDA 3AMMA 3DEMA 4NRQA 1CX4A 1SG3A 2XOMA 5I0UA 4IV1A 4X8PA 2E53A 3ATGA 3HIFA 4YGBA 3VZOA 2CY6A 2B4KA 2RS31 3M2MA 4HT1T 4Q4Y3 1RUI3 4IE6A 2VW0A 1G9AA 4CXYA 2BPA2 1MZEA 1GNHA 1C3HA 4P5HA 4UFLA 4JX0A 1UWWA 5FK8A 4YW2A 1ASJ3 4Y5TA 4M0HA 4NWWA 5JWPA 1US2A 2IXKA 3FUOA 3I3BA 4K3UA 5T5JA 1TMF2 2F6BA 3K2OA 3V56A 4CEWB 5KC5A 1CESA 2G9FA 3U10A 5LRSA 1UY0A 4GALA 5LA1A 3SC7X 5C3SA 1QMJA 1NLSA 3ZYIB 2IXLA 4JTNA 4DQAA 5JPMB 2AREA 1C1FA 5HV4A 3E97A 2WZPP 3WDWA 1IS3A 2VZQA 3AMQA 3AXEA 4O61A 3JQWA 1XU2A 4YW7A 1SLCA 1PZ8A 4JDNA 1ZNPA 1O4YA 5K0UB 1Q5OA 2R49A 4KH9A 1WW6A 4QDRA 2XJUA 2R7EB 4XJ9A 3VBSC 4Y5SA 3I2DA 1DIWA 3N9MA 2ZHKA 3C7GA 4QGMA 2RG4A 3HNMA 4IV3A 3A21A 4J6GA 4MXWA 1PO12 1CJPA 1C5IA 4MGQA 1W8HA 4Y1VA 4CDXA 5FLJA 2FDFA 4AHXA 1W0NA 2XUEA 3EB7A 5EJ3A 3BI3A 1RB8G 1BMV2 1AL21 2XVLA 1EV11 1PMHX 1UIJA 5T54A 3ZSEA 4D7YA 4YM1A 1QJX1 1Y3TA 2ZTNA 3AMPA 1OI6A 1ZA4A 2WFF3 1Q3EA 1BHGA 2YDEA 3POWA 3PUQA 4XILA 4CDUA 1H0BA 1REEA 3QLQA 1ONAA 2IXJA 2BOJA 4BXFA 1JU4A 1BBT3 1O8PA 2J42A 2PHWA 2R061 3ALQA 1I1EA 5FZ8A 5FZ0A 4QQPA 1UX6A 2ZZJA 2XQRA 5CG8A 4MG2A 1YFWA 1D4VB 1XYPA 2FZ1A 5A7WB 5DAVA 2Y0OA 4R9AA 3ZSMA 4I09A 3BGAA 1GR3A 4OVEA 4PT6A 3WNLA 3QH6A 4GH4B 3VDDB 3I2GA 2ZEWA 2QQUA 1JI6A 1SMVA 4EE2A 3E5UA 3RYKA 1EP0A 1JU3A 2DYCA 3PIGA 3BYWA 1XYNA 5F3IA 2QZ2A 2IC1A 1WUVA 3LEMA 3VN4A 4AI3A 4EN7B 4RGKA 1WD3A 5CFCB 1DQ4A 2XKOA 3D4KA 1GP6A 3Q9OA 4ISQA 4CPBA 2HJIA 1J83A 3QOPA 1ZRDA 2ZOEB 2TUNA 5A1AA 5DUXA 1CAWA 5T55A 2YV8A 3MIGA 4P9LA 4COUA 1ZVFA 2CGPA 1HRI3 4RQPA 2I07B 4Q2FA 1B35B 3ZX7A 5FXXA 1QOSA 3ILRA 2D6MA 3BB6A 1J58A 2BUKA 1IQAA 3I2FA 4LLFA 4Y20A 3D3AA 1PO13 4N90A 1HDKA 4E4SA 5FQ0A 2WABA 5KHJA 3NAPB 4IEXA 4P00B 2E7TA 1A8DA 3H3ZA 3UJQA 2CWSA 1SHWB 3MUZ1 3GZEA 4AI2A 3POIA 2LALA 3ZN5A 4QGNA 4FPYA 1YQ6A 2EXIA 4YVSB 4A6OA 1IOAA 1O3TA 4ITCA 3UESA 1W0PA 2SBAA 4WM8B 5CKMA 5C4WA 5CU1A 3C7FA 5LA2A 3LWCA 3RWKX 3PURA 2VU9A 3QH7A 4O7XA 4OUSA 4UW6A 5FYIA 3O1OA 2IFWA 2FMYA 2AGSA 4IE4A 1OUSA 4RGAA 1JXNA 3UNPA 3GF6A 4MVTA 4CA9A 5B4XA 2Y6FA 3VD7A 3EYPA 1PZ7A 1YI9A 3PLQA 4Y1XA 4YW1A 4M4RA 3ZMNA 1MS5A 1EAH2 1TE1B 1H1IA 2J1AA 2ZGPA 2WYSA 5DG1A 1FNYA 2WINB 2QQIA 2VQTA 4CSWA 1XNTA 5FZOA 1YHFA 1Z0HA 1UKGA 1ZBA2 3OD0A 4E2QA 2PLV1 1NLQA 3VKFC 3ZKYA 2LW8A 4N9IA 4XHBA 2BNOA 4H3WA 1WLWA 5A80A 3SCGA 1IPJA 1WGPA 2GMEA 4JTOA 5CFDA 1IHMA 3HEIA 1EUTA 1V70A 2RHPA 5FOJB 1QQP1 2AENA 1F2NA 1WMFA 3NJYA 4P02B 4I01A 1BKZA 4YGCA 3FFZA 2A71A 2P5BA 4QB1A 2H0VA 5C8CB 4K20A 1VR3A 2RR12 2PAEA 2XGXA 4W6XA 1ENSA 1PIV1 4FPOB 4K8RB 4B29A 3NNFA 4DXRA 5AC91 2W92A 3AKPA 1UIKA 1MVEA 5L36A 4OHYA 2E31A 1ZRIA 3CZJA 4WVZA 1KXGA 1S0JA 1QDCA 3GJAA 2VOTA 3BCWA 1WLTA 1NCRB 4Q1PA 4CEYB 1AYN3 2P3JA 3GM8A 5IYYA 3NSTA 1GFF2 3UT0A 4FTBA 3VBOA 1EUUA 4QM9A 1YI7A 2IZWA 5H9QA 1LEDA 1YC61 2Y6GA 1E57A 3OY8A 1DFQA 1YQCA 5FPZA 1F5FA 1MZ6A 1OLRA 1DQ5A 5A3MA 2NM1A 5B2GB 5EPAA 5L7OA 1AYN1 3ZKUA 3ECQA 4FPKA 3R6SA 5E1RA 3O1UA 3E5QA 5FO9B 4WVMA 4CDQB 1RHI3 3D5OA 5FZEA 1DQ6A 5CZKA 4XJ8A 5FP4A 4YVWA 5C5TA 5AFBA 2QBXA 1EAH3 4XUQA 1RHI1 3USUB 1XPWA 2GC1A 1ZBA3 4XJUA 4FCAA 4KGGA 5J7MA 2VZPA 3O7OA 2V4VA 3AKSA 1J59A 1H9PA 1MS3A 1UZWA 2OPWA 2WT2A 2VZVA 5KR7A 5IUQA 3ZYFA 3AKQA 3CDZB 1ODNA 3IIAA 4LBQA 3O14A 2O8QA 3WF1A 2W08A 3P6BA 1C5HA 4S2FA 2A6XA 3GZUC 3THTA 5ABJC 4RS5B 2WC2A 1DYOA 3ZXLA 1JOJA 5IVCA 2I2SA 4FO9A 4HSLA 3WV6A 3PIJA 1O91A 3I3QA 5FKCA 1NCQC 4QDQA 2DWRA 4KQ7A 2BW8A 4Y33A 2BEOA 1LESA 1NT0A 4R9BA 4HK8A 2P17A 1ND3C 1W8WA 3KCXA 3I3DA 4LIVA 4I3PA 1ZZ7A 3AP4A 2HWF1 5FMOS 3TAYA 1UPSA 4A7YA 4BYYA 3O1PA 4XYXA 4D7TA 2QZ3A 3OOXA 1G8WA 1CX1A 3AXDA 5BNPA 4E4ZA 2JE7A 1GZ9A 3VKNA 1GSLA 3VD3A 2AYHA 1R1A3 4AVCA 1WBLA 5LBFA 5C5UA 2YC2A 3C7HA 1Z78A 5EZWA 5FY5A 2IVIB 3VZJA 2H6BA 2FBEA 2RDSA 4L97A 2HYXA 3VBHC 2VR4A 3MDPA 2RMU2 1UL9A 5C9AB 5C3PA 2VUAA 1QKQA 5BNQA 1CAVA 4XEZA 3VL9A 3BTAA 1OOPA 2CSGA 3ZYPA 4ASMB 2VUCA 2B45X 4WVVA 2VBPA 2CGOA 1OURA 1W6OB 1JN2P 2A3YA 4OMCA 5A33A 4JGZB 5J96B 3TEWA 4QM8A 2WR9A 5F3EA 3CJIC 2JE8A 3WDVA 1SPPA 3S6PA 4G3YC 2UWCA 1PMIA 5EXOA 1FOD1 5T3NA 1K5JA 2XBO2 3LIGA 4XF3A 4XETA 3VHNA 4C90A 3IT8A 1A6CA 1AR91 4LKSA 4XAAA 1LCLA 2DBNA 3VDDA 1K3IA 2AH2A 4DXSA 1U12A 1PVC3 4TTGA 4N43C 2QKDA 4OQ8A 1DCSA 1URXA 3VZLA 2Z79A 3WDUA 2R1DA 4AQ2A 5A3NA 3MLJA 1HV0A 2WIIB 1MEC2 3ON7A 5LASA 5CFCA 3J8F2 5JXIA 1EY2A 2QFEA 3N9NA 4TXWA 2A70A 4XTPA 5E8AA 2GU9A 1FMD2 3NV4A 3S0MA 5AVPA 3VGIA 4ARXA 1DQ0A 4LBLA 4QGLA 2D6KA 4QQHA 2MNGA 4HLTA 3D82A 4XQ4A 2K9ZA 1XBFA 3WDXA 1VBA3 1OMIA 1V9U1 4GAZA 1JMUB 4FVVA 5A70A 2BVBA 5LATA 1ST8A 4M3CB 3EHKA 4TWTA 5CNAA 1FPN2 5A32B 4AEDA 3OGRA 5IK4A 2A1XA 3VZKA 2R1BA 4R4ZA 1W3VA 2LM3A 4BQXA 3ZIXA 3HOBA 4YVSA 3I2IA 2K2SA 1D2SA 4JDMA 5FY7A 5HXVA 3VBFC 4CU6A 5G05L 1S0BA 3MZHA 4OHWA 4YRDA 1F31A 3WD5A 4Q8KA 4AZZA 3LD8A 1RTVA 5KHIA 3I54A 2PN5A 2EA7A 1NA1B 2WZR1 1ZZ6A 5JXGA 4LEJA 4WM7C 3P3PA 1VBB1 2WQ4A 5FZ6A 4NAOA 1TQ5A 4HFSA 1PK6C 3KWVA 4KNCA 2D7FA 3JD73 3LEIA 2Y33A 4A3XA 2FCVA 4DRVA 2BYVE 4BQYA 4CCKA 2BWAA 5HI0A 1PGW1 5JXJA 5JMOA 4OMDA 5L73A 1PVXA 4LO5B 4Z2WA 1G9CA 1ZYBA 1WCQA 2GMPA 4N53B 3THPA 1QH6A 1XNCA 2D98A 4I0BA 4LK6A 4D6QA 4DY3A 3UL2A 2BGOA 2X8KA 4W8JA 4BZ4A 2CL2A 2VL4A 4LQRA 1BEV2 1VPHA 5J37A 1PX3A 3LFIA 3ZPOA 1AR72 2DDUA 4GZ9A 5IVYA 1FMD3 5FO8B 1W6NA 3O0WA 1ENQA 1VB4A 2P3YA 3LB9A 4MGSA 3WQ0A 4S2DA 4AHYA 1QJEA 2RJ2A 1W9FA 3KD4A 3KQ4B 5DZEA 3ZLIA 3K4DA 1W9TA 4CEWC 2VJXA 4A41A 1W8ZA 2XDVA 4JGYC 2OUHA 2D93A 2RDQA 2UY8A 5A3LA 3WNXA 2H6CA 2A6YA 2X5IB 3THCA 3T08A 3ZFGB 2FDHA 3OGSA 1NCRA 4GULA 2ZMNA 4J1XA 4U36A 1WBFA 1O59A 4QPGB 1MZFA 1SACA 4PJYA 1UYYA 3HJRA 3J9SA 3J7LA 4L2NA 2MEV2 3ZN6B 1RUE2 2WAAA 1YNAA 4QKFA 3SKVA 5K0UC 1HXS3 2BFUS 2ZBJA 1G9DA 5HXMA 2HWB2 2JG9C 2RM22 5H9PA 1XNAA 2R072 3RZZA 2A3WA 3ORJA 4B3NA 1Z7S2 3OEBA 1VAMA 1HQLA 1ZZCA 4F3JA 4IL7A 3HQRA 3PVNA 4XQDA 5IVEA 4EZHA 2KA3A 4L99A 3AZZA 4MHUA 3OSDA 1VBE2 4RL7A 1PHMA 1ZZBA 4LO4B 1WLDA 4GKXA 4JQRA 4UAPA 1HN0A 5DUVA 5CKNA 2HWC3 5L9BA 1YQ8A 2WUHA 3H3LA 3ETPA 4R9DA 5J98B 1ND2B 2BGCA 3GHNA 3WNMA 5JR2A 3H3UA 1JUHA 5DDJ3 4KWUA 5ANNA 4PIYA 2QJVA 1TME2 4ORFA 3AZXA 5G04L 4C1WA 2JECA 1UKRA 1XNBA 1LNSA 2ARAA 3WP6A 3BU0A 3M3QA 1BEV3 1H8TA 3A0NA 2VXRA 4HETA 2DUPA 2P6HA 2QQKA 3JZVA 5DZFA 2JDHA 4YW5A 3PVBB 1LOFC 3LDKA 4CCEA 1C8NA 4M00A 5KBFA 4LE4A 2DU0A 2NMOA 1Q43A 1E5SA 5HCAA 2VZOA 3CO2A 1AYM2 1OPOA 4GH4C 4LKDA 4EYUA 5FR3A 4NE9A 4IEYA 3W9AA 2C9KA 3U11A 4HONA 2ZACA 3FLPA 2DCJA 1DGWX 2PQSA 3I2JA 4P14A 4UW3A 4LBMA 5FZIA 1DDLA 4CU8A 2MEV3 3ZFEB 1RL3A 1RUE3 4X8NA 1GICA 5JZGA 3POFA 2WWSA 2FCTA 2RM23 2DCKA 1S1AA 1U0AA 2AEYA 1MS9A 2A6WA 1YIPA 1KQRA 1QJU3 2XJTA 1ULDA 3IM0A 3KHBA 4MGZE 4COVA 1B35C 1D4M3 2J22A 1WWYA 4CE8A 5FJKA 1VBC1 4RHV2 4YNIA 4M01A 1XNDA 2WNVB 4NIDA 1NUKA 5FPBA 1A34A 1VBE3 2B8MA 1IPSA 1QJU1 3NAPC 2WS91 1SLTA 5FUPA 1LHUA 4AI0A 4CUCA 4EN8B 5A3TA 1QJY1 2GP5A 3O1RA 1FV2A 5GLZA 3I4IA 4WM8C 5FMCA 3WINE 3BIWE 4FFHA 1W6MB 5BNOC 3OF1A 3PMSA 2WNOA 1R1ZA 1TZOA 2AACA 3JXSA 2VULA 3A4UA 4K1YA 1KJLA 2F17A 2PHXA 4LOSA 4NHMA 4UYBA 4BM8A 2ZGTA 2DCZA 3C7OA 1W6QA 3OPWA 2VVFA 4XZPA 1F35A 5L9VA 1K45A 3UKVA 3B01A 3ZYRA 1R093 2N7GA 1CWPA 1AYM3 5HCFA 1NZIA 3WF4A 2G4IA 2OUJA 5BNNB 2WN3A 3N7KA 2VECA 3NNGA 4QMAA 3RDIA 2RJKA 1K5MB 4QU1A 4DXZA 3HWJA 1R091 1YQ5A 5CG9A 3CHXA 3C2UA 4IEVA 1BYHA 3UJOA 3CNAA 4AAXA 5FZDA 2V09A 3QD6A 1DGRA 3VBSA 3UETA 3KGZA 2VW1A 4MZUA 3KCCA 1JHNA 5HPOA 5KXDA 4QHBA 3LKJA 2R042 3H7YA 5JOZA 5C8CC 2UYAA 2D5FA 1C8M2 2YPDA 4Q4X1 4UWDA 4XFBA 3KV9A 4NJ4A 2NP0A 4Q4W1 3PUAA 3I3MA 2XHNA 4OI2A 3I2OA 1W28A 1QOOA 2XUMA 5IK8A 2FDKA 1YWKA 3BUCA 2YUEA 5K7PA 1F5JA 4M3CA 1MQTB 1ULFA 2G9GA 2Q1ZB 4FPJA 1VBD2 3RQ0A 4AGVA 4CEYC 4FOQA 2VMHA 3ZDSA 1WMEA 1F8VA 1OVPA 2VUJA 2WN2A 2ZX2A 5GM0A 2WA3A 3DKWA 4GD4A 1RUG2 3ZM8A 4HZFA 4GJZA 1TVGA 3I49A 1ZBE3 3TN91 4W6WA 5I8SA 1OHFA 1I9RA 2J1TA 2ZX4A 3BPSA 3GALA 2ZKNA 3M70A 4CDQC 2KXLA 2PYTA 2VZRA 3IMNA 5FY1A 1LENA 2OX0A 1JZ3A 2GH2A 2ETEA 4KI5M 3W5MA 1PO22 3S30A 1ZBE1 3U07A 4CP9A 4ZXEA 5FIXA 4XHXA 2V73A 4QB2A 2OPKA 1STMA 1IGOA 3CEWA 4FPCA 2VBBA 4HXCA 4ZZ5A 1LODA 3LCPA 3PUSA 2XG3A 3MFCA 1RUC1 4AGRA 4BJ0A 2R16A 3K75B 4BLIA 5FPAA 4B8EA 2DUQA 4ES8A 1YIFA 1IS6A 3BOPA 4IUGA 4M0NA 1RUJ2 3LOBA 1MZ5A 2RS32 4BIFA 5SV5A 1COV2 1VMFA 4AI9A 3B9IA 2VCAA 2E7QA 2B46X 2R043 2RS13 2YGMA 2JG8B 4RS5C 1C8M3 2GMMA 1LHNA 1H2NA 5FFOC 4M3CF 3PVOA 5IFTA 2OXBA 3FBYA 1HB1A 5LZ6A 4NPRA 5DUWA 3AP5A 1IG3A 2E9QA 4W65A 4OHZA 3WUCA 3LAGA 4QKNA 1ALYA 2DVBA 2JJ6A 2PHDA 5C33A 4JKLA 4DNYA 4LLOA 4N7UA 3K51A 3ES1A 3FN9A 3HPNA 3SCHA 1S0IA 3ZR5A 5BY5A 4ZU4A 1QOTA 5DZGA 4PDWB 3PJQA 1MACA 1H8VA 3ZN6A 5ACA1 2CGNA 1O5UA 1OT5A 1HRV1 5I8TA 3DUIA 1JYIA 3MBWA 5FP7A 4COYA 4IEWA 2JDUA 1XYOA 4MLOA 2E26A 4RR3B 3UYJA 5LK5A 4BISA 3LEKA 1VE0A 2W68A 3HR9A 4JKMA 4OI1A 3WG2A 1HKDA 4V1PA 4DXTA 3RRDA 4Q4Y1 3U4XA 2XJSA 1AL22 1RUI1 2GZWA 2JKXA 1EV12 5C9AC 2PHRA 2EALA 2ZHNA 4Q4V3 1WMXA 4FTEA 1OVSA 5GLUA 1CN1A 4JGYB 1RUOA 2HWE2 1ASJ1 1COV3 3MLLA 1SBDA 5FRAA 2D3PA 4MSVA 4Q0UA 2J1EA 4JGZC 3ZSLA 4D6RA 1ZX5A 1VLNA 1W6PA 4Q0VA 3T09A 3GYDA 3WW3A 2P3KA 4Y26A 4PQ9A 4BH9A 2XL9A 4CCCA 5C8WA 2HEWF 1SBFA 2VOVA 5FO7B 3T1LA 4K21A 4K1ZA 1UYZA 1GQGA 5DXDA 4ZS3A 5A3WA 5IATA 1NY71 4D69A 2JG9B 2VGDA 5IVVA 3MGUA 1WLCA 4Z92B 3NJXA 5ERLA 4B7KA 1NLRA 4UFIA 1CIWA 3RZJA 2YROA 3K3OA 3NV1A 4JZRA 4EWEA 1PGL1 5C3QA 1YLLA 1RUF3 4QD2A 1C4RA 4R9CA 2LRPA 3VHRA 4CPBD 5A6YA 1ZRCA 2K46A 4IXLA 2PHTA 5FYUA 4GWJA 1WCUA 4HN0A 1IKQA 5DN2A 3M3EA 3C3VA 1F4AA 3E6DA 3V0BA 2Y0IA 3MF9A 2VD7A 1AR62 4N7IA 4Y1UA 5F8PA 3HBZA 3OBTA 1L7LA 1Y43B 2WNVA 1Y7BA 3SKJE 1XB9A 3HT2A 1H2MA 2X10A 1HQNA 2Q1FA 1U5IA 2WFF1 5ABJA 4LITA 1XE0A 1TMF3 2RJLA 2ZX1A 2GH8A 5EFUA 4QU2A 4EWAA 1BBT1 2BBAA 1UMHA 1S0EA 2HWE3 1W8FA 1KFXL 3M3IA 2A7AA 3PNAA 3POBA 4GQ7A 4V2WA 3WHTA 4AR2A 1NCQA 2JDZA 2BDRA 3ENRA 4P9XA 4QQOA 4YYOA 3DPRB 5IJRA 2D40A 2ZGMA 4IERA 4LNVA 1E5RA 2J1RA 1NA1C 4QWNA 1ND3A 5FZGA 3RWNA 1OPMA 2RS52 3IWZA 2XWJB 5FMBA 1OD5A 3F2ZA 4IE5A 1UO9A 1VP6A 3WVJA 1OH4A 1POQA 1V6LA 2D6NA 3KSCA 4OZXA 2PLV2 3WNKA 3WHUA 4MXVA 4BK4A 2EICA 2ZABA 4FOYA 2ARXA 4OULA 3RYRA 3WUDA 4YZ1A 4I02A 3GBFA 2BTVC 2QQJA 2ORXA 1N1TA 1QQP2 1GKBA 2E51A 1HRI1 4FP3A 2ORZA 2WT1A 4P9YA 3VBHA 3HN1A 4D7SA 1YXWA 4CTEA 5FXVA 1QGLA 2ZGSA 4PI2A 3KT4A 3T1MA 1B09A 2Q1MA 2R0FA 3ELNA 1PO11 3LOIA 3OEAA 5GZDA 5I0TA 3WR0A 3RGBA 4BWOA 1JZ5A 3FLTA 1PIV2 1AR63 3ABZA 3PL0A 3RZLA 4JHZA 3U1XA 5BNOB 1BMV1 4BQ4A 4ZY9A 4AK3A 4D94A 4UFHA 5IVJA 1JZ4A 2X5IC 5FTTC 3ZFGC 4AOCA 1OD3A 2LTNA 1DG6A 3GHMA 3WNOA 4BLJA 2YFZA 1IQDC 3CJIA 4C8DA 1X9TA 2W46A 5GZFA 2YGLA 4XMAA 1UY2A 4QPGC 3LFMA 2FZ2A 1JYCA 4JKKA 5JSPA 3OJBA 4I30A 2WLQA 4FPGA 2MPFA 4XFHA 2OVUA 2VMEA 3KVAA 3RPQA 1AX2A 4LE3A 5A6QA 3WY6A 5JCTA 1IS5A 3H42B 4YGEA 4JCKA 2W0XA 5IK7A 4N43A 3T0DA 4GA9A 1N3OA 5ANQA 1T2XA 2VTFA 1AR82 2ZGUA 2RS53 5F3GA 5LW9A 3WG4A 1APNA 3KF3A 3VZMA 1MS0A 3DYPA 1S0DA 2W47A 3LSDA 1Q8SA 4FI9A 4XIKA 4U2AA 3V0AA 1ACCA 3LIHA 3WCSA 4ATFA 4BA6A 1YUDA 2JDNA 1ND2C 2JWPA 3T0AA 3VHOA 2XJRA 5JOYA 1UOBA 5H9SA 3ZXDA 1D0GA 3FUQA 4FQ4A 1NOVA 4FXGB 1ZZ9A 5A3UA 3U14A 2D43A 5FYMA 3H8OA 3KMHA 4KGQA 4YFWA 2Z42A 4RFT0 3QCWA 1SLAA 3EJKA 1YFXA 4OQ9A 4QKBA 4OZOA 3SH4A 3TBDA 2C1FA 1Q8QA 3LZZA 3K46A 5F5AA 1UY1A 4E27A 3MLKA 3VBFA 3PTYA 4CCDA 2VVDA 3NV3A 2ARBA 2XLAA 2EAKA 3N7JA 3R4DB 1YJLA 3WNNA 1UZYA 2DURA 2VMIA 3K3NA 4MUVA 4XW3A 1JYXA 1FV3A 4BPZA 2P3IA 3KLSA 2PXJA 5F6LB 4KG8A 4AFMA 1EPZA 3WCRA 4WM7A 3AL5A 2DFBA 2RV9A 4K7JA 1FXZA 4L92A 2HWF2 3W20A 4WZFA 3ZFEC 1PK6A 2XJPA 4K8FA 1H2LA 1U5ZA 4MHRA 4DUVA 3MYXA 4L0PA 3T2QA 5LA0A 2QQMA 1EAH1 4OHVA 3IDEA 1IG0A 2W1WA 3DYOA 2W95A 1VALA 5DAWA 1W2AX 4JVAA 1UYXA 4ASLA 2FCUA 2QVSB 2WAOA 2VZUA 4AYUA 1ZBA1 2GC0A 2Z4FA 1NYWA 4AWDA 1D0HA 4MYEA 2WNVC 3ROUA 3Q8EA 2ZMKA 1W9WA 4PLOA 1S0FA 3URFA 2YBKA 3N9PA 1PGSA 2A75A 2Y8KA 1WD4A 4C0BA 3TWIA 1V6NA 3JBG2 2WSUA 2VZ1A 2X05A 2IXHA 2RR13 3ZO0B 4BCUA 1KITA 2ERFA 1GZWB 4OI4A 3A23A 4YZ5A 2V72A 4CEWA 4C91A 5IAVA 2WL1A 3LDRA 3ZXFA 1VAKA 1OH3A 1EYBA 4JGYA 4N53C 4QT6A 4BHPA 1O6UA 1AX1A 2RR11 1RINA 2E32A 2JDPA 1LGNA 1QH7A 4ISRA 4CU9A 5FZBA 3AMNA 4D0QA 1SFNA 1FOD2 4LBNA 4QX0A 3SEEA 3UK9A 3AVSA 2Y6HA 3NNLA 1LOEA 4JV4A 2WKKA 1GP4A 3CQOA 1QXPA 4IDZA 1CJDA 3POSA 4XACA 1T6GC 3AFKA 1CAUB 3FFQA 4XUNA 4YW4A 5K0UA 3RVHA 4CDWB 1K5MC 3DF0A 2ZX0A 3OTFA 4PLMA 3USSA 2JG9A 5IAXA 2CHHA 3ZN4A 3FHQA 2DV9A 4BQ2A 4IGPA 3GCXA 3QACA 1UF2C 3B7MA 1LGCA 1JZ6A 4RSUA 1LJ7A 1PMJX 3J26N 1BK1A 1R1A1 1VMJA 4MADA 1H2KA 4Q5OA 4QDSA 4B1MA 4NROA 4NUBA 1BJQA 1OSGA 3FL7A 2C9AA 2VMDA 4TSVA 1QNYA 3Q8BA 1HW5A 2ZZQA 1JOPA 1RUD2 4AVBA 1IKPA 3ZSJA 2A3XA 1V6MA 3RI9A 1PNGA 1H1AA 2C0ZA 3HN3A 5DPNA 3BU7A 1MQTC 1H4HA 2GNMA 4AI1A 1Y9GA 3JBG3 1KJRA 1LOFA 3W5NA 1XQNA 2QQWA 5LRRA 3V65A 5IVFA 1GZTA 4XE9A 4ZPIA 1HQWA 2W2IA 1W9YA 3GXUA 5A7WA 1CR7A 4QXCA 3WDTA 2Y38A 5GZCA 3OGJA 4E8CA 2DU1A 3PHMA 4O9GA 4GH4A 2AUYA
chains in the Genus database with same CATH topology
3SXWA 3OPZA 3NL1A 1X33A 3VBUC 2VNOA 4IETA 1FX5A 3B02A 2WZR2 4LUMA 2QNKA 4FPEA 3TOJA 1VBB2 1GANA 2DF7A 1PVC1 3ZVXA 1RUH2 1O4ZA 4GKYA 3SH3A 4LR4A 1JUIA 2XVGA 1FYUA 2EXHA 3JB4C 2XB6C 3IPVB 4RD7A 1TEIA 4AFDA 1B35A 4XBNA 3JCIA 1V6KA 4YG6A 2EXKA 4IEPA 1LKNA 3N35A 2O8OA 3MPBA 3NAPA 2RMU3 4GB32 5JIUA 2YY1A 1I5ZA 4GIQA 1VBA1 1TNRA 1OA2A 4PBPA 2JG8C 2D6OX 2GC3A 5AVAA 4HANA 1ZZ8A 1RUD3 4WM8A 1CGPA 3H0OA 5BNOA 2HWD2 5HCBA 3IBMA 2A6ZA 4WBBA 4BMEA 2HEYF 4GWMA 2EVXA 3AFGA 2P37A 1N3PA 2JX9A 3ME2A 4SBVA 1C57A 2XBO3 1QY4A 2B7YA 3JB8A 3SMHA 2TNFA 4PDWC 3JUUA 3WXPA 1BCXA 5FLHA 4F8AA 1SCSA 2DTYA 2YC0A 3JD71 1MEC3 3OD4A 3ZFFB 3I7DA 3ZMOA 2CAVA 3J8F3 4YM2A 4RR3C 5F1RA 4XDQA 1LU2A 1NZCA 1RUH3 4I0AA 1L3JA 3FHIB 3R0RA 3AM2A 1DZTA 1FNZA 2Z5WA 1FATA 4LBJA 4XJWA 3AYEA 2B42B 3LGRA 2D44A 1OA4A 3WW2A 1NXMA 3N4MA 2H0BA 2OW4A 2CWMA 4NHLA 3M7AA 5EWSA 5C8CA 5BV6A 2ENRA 1QDOA 4P9JA 1FMD1 1J3RA 4L11A 2VW2A 3I59B 2NYYA 4H7MA 4GB33 1FPN3 1RMU2 2TEPA 3OYWB 4HN1A 4JC1A 3VBRC 4D3WA 4FP2A 4AVVA 4CEYA 3FE5A 4HSJA 4XIOA 5EYXA 3RJRA 3ASIA 1UPIA 4R4XA 1S55A 3B5LB 2ZA9A 3IDCB 4HPKB 4OLLA 2HWD3 1DZQA 1UU4A 1WW4A 4DZGA 3RG0A 4ES9A 3H1WA 2ES3A 2GN3A 5SV8A 4HVRA 4Y22B 4CDQA 2DCTA 1QWRA 1OQEA 3CU7A 1HXS1 4M3CE 4DMIA 2VG9A 3USUA 4BIOA 4FAGA 2GC2A 1XU1A 2NLRA 4OUMA 2WNEA 4LA3A 3JU9A 5I8YA 4JRLA 2RE9A 1VBC2 2HWC1 2A6VA 1KDMA 3HMYA 1AL0G 3HT1A 4QQ2A 2WS92 3L2YA 1AR73 2DVAA 2XPJA 4FAHA 5DDJ1 3ZXJA 4ZU5A 3GBGA 4CP0A 4G4FA 4Y1YA 4YM0A 4AW7A 3NVCA 4NOTA 1BEV1 1H1MA 4RS5A 5CA6A 4PIZA 3MIEA 3BODA 5TSWA 1GZWA 3AB0A 2QUOA 1DYKA 3H8UA 5FREA 1RMU3 1F9KA 1CD3G 4E4DX 3DPRC 2PHLA 3S7EA 4MH0E 4B4PA 3KS7A 4IEOA 1ZRRA 5JR7B 2IXIA 2OA2A 3WG1A 4XXAA 3D0SA 3AKTA 1CPNA 4ZXKA 2HWB3 2R073 1PM7A 2MEV1 1Z7S3 1RUE1 1TNFA 4YLZA 4GXLA 3WZ1A 4H7LA 2HWB1 2RM21 4WZCA 4Z07A 3FX3A 5J09A 2DFCA 1Z7S1 4LO6B 2XLFA 5T5OA 3D8CA 1D4M1 4IV3B 2GNTA 2DVDA 4GMP3 2GNDA 3HQXA 4MX3A 5C9AA 2JICA 1VBE1 1OQ1A 4Q4X2 1TME3 4KG0A 1J1TA 4XF1A 4GMP1 5KHKA 4CDUB 1R082 2QQPA 1W6OA 2BWCA 1TME1 3W59A 4JGZA 1RGSA 1LOAA 1REDA 3ES4A 2VPVA 4DRRA 3U0ZA 1LOBA 4PIXA 4I3GA 3MIHA 2VOXA 3D6EA 1AYM1 3N7LA 3POYA 2ZCWA 5DUUA 1HLCA 2TBVA 3DN7A 2ZMLA 1SQ4A 2QDRA 3M3OA 3UV9A 5KWRA 3H9AA 3ZYGA 3B94A 2ZGRA 3LA3A 1YRZA 3B3QE 3AYCA 3AMHA 3G7DA 1AX0A 3MW2A 3PVEA 4QPYA 4XFGA 3ZPYA 1AXZA 4FTSA 1CAWB 4DPNA 2R0HA 1M4WA 4RHV3 3IPVA 3B93A 4RQPB 1C1LA 2PQQA 1WCDJ 4PLNA 1DGWA 2UY9A 4HVOA 2JXAA 1AJOA 2UWAA 4Y20B 4AF9A 4RHV1 2PFWA 3EQEA 4Z8BA 5A32A 3KB5A 4FPHA 5FAXA 4AGGA 2ZHMA 4XJAA 5JI9A 1H30A 1VRH2 1X8EA 4XFAA 3W58A 2PTMA 3RMYA 4Z1VA 5I0SA 5C4WB 3VBUB 2CYFA 2YMZA 1RVF2 1SDWA 2BNMA 1NA1A 3R05A 4LBKA 4KU8A 2LUWA 4QPIC 3WLUA 1AVBA 4BE3A 4F7ZA 4HBNA 1HRV2 4P9WA 2B9UA 3B9CA 2VMGA 1DBNA 1LU1A 1QXJA 4LTAA 2NN8A 4KBBA 1WCKA 1M06G 1XE7A 3B00A 2XL7A 4OHXA 5CFDB 4ZU7A 3LA2A 2GAUA 2VOWA 2JKBA 4Q4Y2 3VHPA 3WQ1A 1OLQA 3TB0A 4OI0A 1VAVA 3B69A 4DB5A 2O0OA 5F5QA 4COZA 2R041 2RS11 4K6BA 4AQSA 5F9TA 1CVNA 4I0WB 1C8M1 4DS0A 4X6RB 2BBVA 1ENXA 1VBD3 3V64A 1VJ2A 4XFIA 2X5IA 3ZFGA 4KL1A 5T5PA 1V6OA 1VRH3 4HMZA 1RUG3 3VV1A 4QPGA 4CYDA 3VBOB 4HPKA 4BOWA 3OY8B 4CDWC 3MEPA 1NY72 2D97A 3O0XA 1FAYA 4ONUA 5GLTA 2UYBA 1RUG1 3M4FA 4FPLA 1N47A 1RVF3 5GKAC 1PO23 1POV3 2HYKA 2XWBB 1YCIA 4WVMB 1SLIA 5BYNA 4HVQA 3WP4A 3GNEA 2P34A 4YVWB 4EV0A 5JOWA 2WA4A 1JH5A 4O9EA 4IEZA 5I93A 1QU0A 1OKQA 4XFCA 3A0KA 4YZ4A 4A2UA 1RUJ3 1V6JA 3FLRA 1QJX2 3MI8A 3E6CC 1A8MA 2RS33 1KS5A 1ND2A 3SISA 4BMBA 3AKRA 2E7AA 3WW1A 4EROA 2K0GA 1RUJ1 2R062 4Q4V1 3VBRB 3HAGA 2WFF2 4LBQB 4Q29A 4RGGA 1COV1 4Q0SA 1GLHA 1BVP1 4PF5A 1BBT2 4XF9A 4UW4A 3MW4A 1ZM1A 4META 2D6PA 1NQDA 3WDYA 2VQAA 1N1YA 1NE4A 3TYJA 3WOGA 1Q8OA 3X29B 4DY5A 3KM5A 3N7MA 3DL3A 3ZFEA 1LEMA 4CP2A 1S2BA 2IFRA 4NR1A 1RC6A 2KM2A 1RUF1 2C5DA 5J36A 3ILNA 5BNPB 1HX6A 4COWA 2I45A 3INAA 1HRI2 4JRAA 1AL23 1A3KA 1EV13 1Q56A 4YG3A 3CJXA 3WT3A 3MIFA 4XPVA 2ZGQA 1UMZA 1QJX3 3GBWA 5KXEA 2I74A 4JAAA 3OCPA 2ZJCA 2JEMA 1PNFA 3KZ4C 1N1VA 4GMP0 2WNUC 1W6MA 1CAVB 4XFFA 4HKLA 1TMF1 2R063 1OOPB 3GZAA 4N53A 3WP3A 3AX4A 4AHWA 2HWE1 2D5HA 5A33B 4FSJA 2CTVA 2EF6A 4XXPA 1LOGA 2UURA 3AYAA 5JOXA 5BNNA 2YXSA 2CV6A 4NHKA 3L2HA 1K5MA 2E6VA 3IN9A 1UU6A 5CVRA 1UW8A 4YW3A 3VL8A 1BZWA 2VQ0A 4F83A 3ZFFC 3ZIWA 3BALA 4Q8LA 4AG4A 5KC6A 3ACLA 4QQLA 5I0RA 2B5HA 5AC92 4K40A 3RMXA 4LA2A 5JDBA 4LHLA 5K8SA 4XF0A 5KXBA 1PZ9A 2Z2SB 3D0JA 4AVTA 4R8HA 1AR61 1JTZX 1MQTA 4DFSA 4XOGA 4E2GA 4ZKTB 4AEDB 3CF6E 5JMCA 1AJKA 3UKTA 1AYN2 5D8AC 5J3UA 2NZ9A 4MGKE 3VBUA 3NO8A 1CQ9A 3H7JA 3S7IA 1O5LA 1RHI2 3AP9A 1NXD1 1DQ2A 4L8QA 4QX5A 3HD8B 1AXKA 1DGRN 1H9WA 5GZGA 2PLV3 1I6XA 2RS51 1I3HA 3G6JB 4MV2A 1AUYA 1J3PA 1X7NA 2ZAAA 5JSRA 4IV1C 2CNAA 3RS6A 2ET7A 4UW5A 1QQP3 1MVQA 3R4UA 5EV7A 5T5LA 3P3NA 4LBQD 4LO7A 3AK0A 1ENRA 5JSOA 5KHGA 1YFUA 4YG0A 4XJZA 1KS4A 2SLIA 4C0HA 2FQPA 5GLVA 2JG8A 1PIV3 3NWKA 3M8LA 3R4SA 5AC93 1W6NB 1XXNA 1VB2A 1DLLA 3EBRA 3O5SA 3NJZA 4X6QB 4A7ZA 1LECA 3H1MA 1C28A 1ULEA 2W52A 5JIAA 1J1LA 3RJ2X 5JAXA 5LEJA 4GWNA 4QPIB 2VH9A 4EWDA 4PDWA 1Q8PA 4W6YA 4XBLA 3ETQA 4XQWA 2BQPA 1AR83 2WFPA 3WP5A 4E9KA 4XTMA 2PAKA 4LO8A 1MS8A 1DQ1A 4RR3A 3ILFA 3VLBB 1GNZA 1POV0 2ZKLA 4LHKA 1R1A2 1RJ7A 1AR81 4G9SB 4FPFA 4IV3C 5JI7A 1BXHA 4SLIA 3MF6A 4CDXC 1GV9A 2Y26A 2XJVA 3WW4A 4IQPA 1S0CA 5CBLA 1AF9A 2ILMA 3LSEA 2NMNA 1SLBA 1V00A 4CDUC 4Y4YA 2GNBA 3WG3A 5F6KA 3PJYA 1H8TB 1UCXA 5GLWA 3KCYA 3VBRA 2OYZA 4YZ2A 3K48A 4TLFA 4AFCA 5J48A 4TYSA 3T2TA 4CP1A 1LHOA 2ZGKA 1U5YA 1AR92 4I2OA 2EIGA 3IKWA 2R30A 5GALA 5CADA 1GYKA 2HKXA 1FT9A 1MS4A 3FWEA 3AJZA 4UBHA 1ULGA 1UU5A 5E16A 3FJSA 2HWF3 1AXYA 1PVC2 3VKMA 4Y1ZA 4QXKA 3H50A 4UBGA 1W2UA 5K9YA 2YPJA 4EN0A 1DF0A 3VZNA 5JZGB 3FZ3A 4MGYE 1ZRFA 2VOKA 1V9U2 4RQPC 5KXCA 2Q8OA 4K9SA 4AEKA 2IXCA 3MIBA 4AEMA 3CL1A 2MHFA 1VBA2 2GDFA 4ATEA 4Y24A 1Y9QA 4R52A 4RA0A 2DVFA 1X50A 2DUOA 1S2KA 3JBG1 1G9FA 4NVPA 5C4WC 1AZDA 3DPRA 5FLIA 1FOD3 1KD7A 4WV8A 4YSFA 1W6QB 1ZREA 1X8MA 5D1IA 4AVAA 1AR93 2FMDA 4LBOA 2Z69A 5AFEA 4LT5A 1DHKB 2X53S 4B7EA 1PGW2 3VKLA 2PELA 2VNRA 1SBEA 1QXRA 4LULA 2EAAA 1OFNA 2OIIA 3JD72 1ULCA 2Q0AA 2HEVF 3VBSB 5CFDC 2ZX3A 1DU3D 4AVSA 1GQHA 1LOCA 2IWGB 1V9U3 2RMU1 1H4GA 3AYDA 2WNUB 2OZ6A 3AZVA 3BOWA 3EXUA 2D3SA 4L9BA 2XLGA 1RUD1 5EYYA 3GZTB 2O1QA 2JD4A 4AI8A 1YJKA 4C1XA 1W0OA 2D6LX 3VBOC 4S2HA 3SITA 1LHVA 1NG0A 2XBO1 2UU8A 4URTA 4LUKA 3M1HA 5L7OC 3SH5A 1AHSA 2R6QA 2WZR3 1JBCA 5FPXA 1VBB3 5FOBB 1HXS2 1NQJA 4PCRA 3NW4A 4Q0PA 5JVVA 4YVWC 3VUOA 4XMIA 1LB2A 3MFAA 5FMOL 1MEC1 3KT1A 4FQZA 3J8F1 3MICA 2R32A 4P9GA 1RUH1 1J3QA 1UZZA 3NKGA 1IPKA 3SLIA 2HWC2 1QF3A 5C6CA 1MS1A 4NN0A 3AZYA 4CZSA 5DDJ2 1XE8A 1X82A 2DVGA 5LK7B 5JPNB 4Q27A 1CAXB 4GB31 1FPN1 4KWLA 4YM3A 1SCRA 1G7YA 1WW7A 1QJZA 5IT6A 2Q5TA 5T52A 1BVVA 4DINB 5D8AB 1KDKA 3M3CA 4S2GA 1KFUL 3ZYJB 4IEQA 2HWD1 2NQYA 2GALA 4FBFA 4BQ1A 4QPIA 5HBAA 1MR5A 2CAUA 2V5YA 3FMGA 4KWJA 1IZ3A 3SCFA 1WCSA 4FT8A 4N9HA 4KWKA 3LA7A 3ZXKA 3AP7A 4OFGA 1KRIA 1QHDA 4IV1B 5BPXA 4WVWA 3RSJA 5BNPC 4Q1RA 4H14A 1RUNA 2QDNA 1V6IA 3MW3A 1QJU2 3FBMA 1YO8A 1D4M2 1QJY2 4YGDA 4AE2A 1AR71 1REFA 2XVKA 2WSVA 3SNMA 3TNQA 4AHZA 4FOVA 2FHRA 2YZ4A 1OOPC 3MPPG 4A7KA 2WQZC 1HIXA 5I91A 2P2KA 1LRHA 3BPZA 2DCYA 3ZXAC 1W6PB 2PHFA 3JQXA 2AZ5A 1RMU1 2ZHLA 3EO6A 3O12A 2WT0A 2XHKA 2YYOA 3KGLA 4HKWA 1WMDA 2PHUA 1DYPA 1RITA 5E88A 4CDWA 1CAUA 4IEUA 1R092 3ZSKA 2PAMA 2QCSB 3VDDC 2AR6A 3MIDA 4YFZA 1LR5A 2BNNA 2VNGA 2R071 4DOUA 2F4PA 1WA4A 4FXKB 4MXWB 5CFCC 2DTWA 3J4UH 2GSYA 4XBQA 4CDXB 3UKNA 2ATFA 1O3QA 4INDA 1O4TA 1LGBA 1VBC3 4Q4W2 4AQ6A 4YARA 3V0BB 4HK9A 1N1SA 1UN1A 2E63A 2WS93 1WW5A 2ZGLA 1EPWA 4CRQA 5CIRA 1QJY3 1YFYA 1SLLA 2ZPXA 4FOWA 2OZJA 2NPIA 4YZ3A 5E89A 1YYNA 5GZEA 1UD1A 3RI8A 3TRSB 4AEDC 4HKOA 3E6BA 5ABJB 3TN92 2XJQA 4YVSC 1DGLA 1GBGA 1FI2A 1OA3A 3ST7A 1O7FA 3IDBB 2Q30A 1LULA 1U5XA 3N36A 4Q0QA 1NCQB 5FBZA 1VIWB 5H9RA 1ZBE2 1GZCA 1BQPA 5DG2A 1Q8VA 3N3HA 3O0VA 4AEJA 4KU7A 4AFBA 1ND3B 4XF4A 1S0GA 4NO4A 3ZXEA 2ZS6B 5BUVA 4Y5Z0 1RUC2 4J1WA 1JW6A 5T50A 1G9BA 2BFUL 3WX5A 2B39A 4AFAA 5L19A 4UXAA 1O3SA 2A73B 3E5XA 1OFSA 2D3RA 3ZXGA 5FQ0B 1XRUA 4TZDA 4PBOA 4E2SA 4Q4X3 3VBHB 1LTEA 5GJ6A 4Q4W3 5JLVA 3OGGA 4B4QA 2RS12 4LHNA 3DV8A 1D2QA 1R083 2PA7A 2WNUA 4EN9B 2ET1A 2BVVA 1SEFA 3QBQA 3SHRA 3VKOA 2XH6A 2X29A 1R081 2ZGOA 4Z82A 4NWVA 1NCRC 2JENA 2ZAHA 3CJIB 3TN93 1G86A 3TNPB 4P9IA 1DZRA 2UWBA 5ACA2 2JE9A 1IS4A 3OBRA 4B4RA 5LEKA 2Q4SA 3APBA 4JDOA 5CAZA 1SFYA 3ZFFA 4N43B 3RYPA 4EN6B 1RUC3 2WLPA 4IESA 2A5ZA 1RIRA 1RJ8A 1RUI2 2GN7A 3WQ7A 3DGTA 1LHWA 5BXXA 2WJSA 3V0AB 1X36A 2XKPA 3AP6A 1XNKA 1ASJ2 4Q26A 1HV1A 1QNWA 3NV2A 2EXJA 4Q4V2 3RNSA 3I59A 1O3RA 3KT7A 3OYWA 2VY0A 1H8TC 2YHJA 3I8TA 2QE3A 1A78A 4H55A 1CONA 4MGIE 4HL0A 2W39A 1VBD1 1CAXA 1W39A 5IK5A 3AJYA 1NE6A 3L9JT 1G6NA 4EJRA 1VRH1 3VBFB 5L7OB 2ZGNA 5D8AA 3NKTA 1CPMA 5KHHA 4Y22A 3CLPA 1PGL2 1N3QA 2VVEA 3FC0A 1OQDA 4AXOA 3AZWA 1UAIA 5CB7A 3KQRA 1RVF1 1PO21 1POV1 4WM7B 5ACA3 5FCCA 1HRV3 1PK6B 3PMEA 3H1YA 5JZGC 1RUF2 3AMMA 1CX4A 5I0UA 4IV1A 4X8PA 2E53A 3ATGA 3HIFA 4YGBA 3VZOA 2CY6A 2RS31 3M2MA 4HT1T 4Q4Y3 1RUI3 2VW0A 1G9AA 2BPA2 1MZEA 1GNHA 1C3HA 4P5HA 4YW2A 5JWPA 1ASJ3 4M0HA 4NWWA 2IXKA 3FUOA 4K3UA 5T5JA 3V56A 1TMF2 2F6BA 5KC5A 4CEWB 1CESA 2G9FA 3U10A 5LRSA 4GALA 1QMJA 1NLSA 3ZYIB 2IXLA 4JTNA 4DQAA 5JPMB 2AREA 1C1FA 3E97A 2WZPP 3WDWA 1IS3A 3AMQA 3AXEA 3JQWA 1XU2A 1SLCA 1PZ8A 4JDNA 1ZNPA 1O4YA 5K0UB 1Q5OA 2R49A 4KH9A 1WW6A 2XJUA 4XJ9A 3VBSC 3I2DA 1DIWA 2ZHKA 4QGMA 4IV3A 4MXWA 4J6GA 1PO12 1CJPA 1C5IA 4Y1VA 4CDXA 5FLJA 4AHXA 5EJ3A 1RB8G 1BMV2 1AL21 2XVLA 1EV11 1UIJA 5T54A 3ZSEA 4D7YA 4YM1A 1QJX1 1Y3TA 2ZTNA 3AMPA 1OI6A 1ZA4A 2WFF3 1Q3EA 2YDEA 3POWA 4XILA 4CDUA 1H0BA 1REEA 3QLQA 1ONAA 2IXJA 1BBT3 2R061 3ALQA 2PHWA 1I1EA 4QQPA 1UX6A 2ZZJA 5CG8A 1YFWA 1D4VB 1XYPA 2FZ1A 2Y0OA 4R9AA 3ZSMA 4I09A 1GR3A 4OVEA 3QH6A 4GH4B 3VDDB 1SMVA 3E5UA 3RYKA 1EP0A 2DYCA 3VN4A 1XYNA 4EN7B 2QZ2A 2IC1A 1WUVA 4AI3A 1WD3A 5CFCB 1DQ4A 2XKOA 3D4KA 3Q9OA 4ISQA 1ZRDA 2HJIA 3QOPA 2ZOEB 2TUNA 5DUXA 1CAWA 5T55A 2YV8A 3MIGA 4P9LA 4COUA 1ZVFA 2CGPA 1HRI3 4RQPA 2I07B 4Q2FA 1B35B 3ZX7A 1QOSA 3ILRA 2D6MA 3BB6A 1J58A 2BUKA 1IQAA 4E4SA 4LLFA 4Y20A 1PO13 4N90A 1HDKA 5FQ0A