4HN1A

Crystal structure of h60n/y130f double mutant of chmj, a 3'-monoepimerase from streptomyces bikiniensis in complex with dtdp
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
199
structure length
199
Chain Sequence
MHPLSIEGAWSQEPVIHSDHRGRSHEWFRGESFRQAFGHDFPVAQVNVAVSHRGALRGINYTEIPPGQAKYSVCVRGAGLDVVVDVRIGSPTFGRWEIVPMDAERNTAVYLTAGLGRAFLSLTDDATLVFLCSSGYAPAREHSVNPLDPDLGIAWPDDIEPLLSDRDENAPTLATAERLGLLPTYQAWQEQQQAQRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Studies on a 3'-Epimerase Involved in the Biosynthesis of dTDP-6-deoxy-d-allose.
pubmed doi rcsb
source organism Streptomyces bikiniensis
molecule tags Unknown function
molecule keywords Putative 3-epimerase in D-allose pathway
total genus 54
structure length 199
sequence length 199
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.27: dTDP-4-dehydro-6-deoxy-D-glucose 3-epimerase.
pdb deposition date 2012-10-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4hn1A00
2BEOA 3PLQA 4XFGA 4HSJA 4Z07A 3LA7A 1OI6A 2GC2A 1QY4A 2GU9A 5BV6A 4I01A 3E6CC 2H0VA 4E2SA 5I91A 3GBFA 1YFUA 2FQPA 3RDIA 3SXWA 3KGZA 1CAXB 2B5HA 2WFPA 2QVSB 2D40A 4MGIE 1UCXA 3S7IA 3H1YA 3H7YA 5JAXA 4XF3A 4NVPA 1EY2A 1X7NA 3IBMA 4XFBA 4I02A 3RYPA 3QACA 4ZU7A 4EV0A 4R52A 5C6CA 5I8YA 3UKVA 1GQHA 1Y3TA 3L2HA 1NYWA 2D5HA 4QMAA 3OGJA 2K0GA 4WVZA 1RUNA 4Q0SA 5KBFA 1YHFA 2BGCA 2OZ6A 2XLFA 3SHRA 1FI2A 2OA2A 2F4PA 4YYOA 3SCFA 3GYDA 3ES1A 2QJVA 5I8SA 3BCWA 2XGXA 1VJ2A 1XE7A 4XF0A 2HJIA 4Q0PA 4IEYA 1ZZ6A 4L11A 5I93A 5FQ0B 4RD7A 4AXOA 2PTMA 3JZVA 4FBFA 4BYYA 4XF9A 3D0JA 2IXJA 4QX5A 5EFUA 5J48A 5KHGA 1ZNPA 1NXMA 1IPJA 1J1LA 5KHHA 2CAUA 1ZRDA 4MGKE 3RNSA 1X82A 2DCTA 3BALA 1YWKA 1JUHA 3BPZA 2BYVE 3FWEA 2KXLA 3E5UA 5LRRA 5J3UA 3B02A 3EO6A 2B9UA 2PAMA 4L2NA 3M3IA 3N4MA 2Y0OA 4TLFA 1HW5A 3HT1A 3E5XA 1X8EA 3HQXA 5HI0A 4R8HA 2UYAA 3NSTA 2ZKLA 2PYTA 4YSFA 3CLPA 3M70A 3ZDSA 1X8MA 3HIFA 4IEQA 4PIYA 4BH9A 1NE6A 5I8TA 2BNNA 4HVQA 3MDPA 3EJKA 1I6XA 3OTFA 4IESA 4QGNA 1H1MA 2XKOA 4E2GA 4Q0VA 4JTNA 1PMIA 1J58A 2ZCWA 1ZRCA 1UD1A 3S0MA 3CL1A 1YLLA 1UPIA 2CAVA 3H9AA 1ZRFA 4IETA 2PAKA 2XLAA 5AVPA 3LAGA 1RTVA 1LB2A 4XETA 1J3RA 4XFHA 3USSA 3CEWA 3R6SA 4IEXA 3LOIA 4AVAA 2IXLA 5E16A 1OMIA 3KMHA 3MYXA 2HKXA 5E1RA 4ORFA 4HBNA 1OFNA 3VHRA 3G7DA 2B8MA 1ZRRA 3NL1A 4J1XA 5KHKA 2VQAA 4Q29A 3HT2A 4KU8A 5LRSA 3MZHA 4Q0UA 2GC1A 4ZU4A 2XHKA 4FAHA 4HSLA 2CV6A 3TNPB 1TQ5A 4P9GA 2FMYA 4IERA 1Q43A 4DINB 5FLIA 4LEJA 3PNAA 4BIFA 4LULA 2N7GA 4I09A 3RPQA 4PIZA 3WW2A 2K9ZA 3IIAA 3DN7A 3ETQA 3EQEA 3E5QA 4EWEA 1ZZCA 4MGZE 2D93A 4AVCA 2ATFA 3SCHA 3U11A 4LA2A 5JSOA 1LRHA 1O5LA 3IDCB 4PJYA 4JV4A 5BPXA 2O8QA 3H50A 2UYBA 4XFIA 2BNOA 5KHJA 4UBGA 1UW8A 4H7LA 1CAVA 4IEPA 1RC6A 3S7EA 3LZZA 5C8WA 5LEJA 1Q3EA 1VP6A 2E9QA 4EROA 1IPKA 4KWJA 4IEUA 1YUDA 4LLOA 4XFFA 5LEKA 1SQ4A 5CU1A 3H1MA 2Q4SA 2MPFA 2OPKA 1L3JA 3H8UA 5FLHA 2PA7A 4LUKA 3ACLA 3LA2A 4E2QA 1NZCA 1O4TA 2EAAA 4I3PA 1EP0A 4X6RB 4META 1QXRA 2XL7A 3IWZA 3FX3A 2PAEA 3BU7A 4MV2A 3D0SA 4YNIA 3I7DA 1DZRA 5FPZA 3LWCA 2PFWA 1DGWA 4XEZA 4IEZA 3WW4A 1ZZ9A 1DZTA 4HVOA 1O3QA 1YFXA 3NJZA 5BXXA 4AQ6A 2BNMA 2Q1ZB 3MPBA 3OD0A 2V09A 4XFAA 4QM8A 4YARA 2GC0A 1UIKA 4XFCA 5FPXA 2EA7A 1CAXA 4FT8A 3CF6E 4WZCA 4MZUA 2XL9A 4O9EA 2GC3A 1CAUB 1Q5OA 3DV8A 5CADA 4QM9A 1YFWA 4I0AA 4HN0A 4YRDA 2GZWA 5K8SA 4WBBA 4A2UA 1OD5A 1G6NA 3FJSA 2Q0AA 2ETEA 4B29A 4N9HA 1XRUA 2I45A 3NVCA 5FQ0A 3CJXA 1EPZA 2GH2A 2H6BA 3E6DA 4J1WA 3DL3A 1LKNA 1FT9A 3O14A 1Y9QA 3CO2A 2CGPA 4AVBA 3SMHA 3WW3A 5JR7B 3TNQA 1QWRA 3RZZA 2IXIA 3NW4A 1I5ZA 2OYZA 4XF1A 3UKTA 3E6BA 4F8AA 2OZJA 4UXAA 3ES4A 3I59B 1J3QA 2XKPA 4I2OA 3SCGA 2IC1A 3BB6A 4UBHA 1CX4A 3WW1A 2PQQA 2QNKA 2VPVA 4CYDA 1J3PA 1VR3A 3FHIB 4XF4A 2EVXA 5I0SA 4OLLA 2H6CA 4IEVA 4GULA 4Z82A 4KU7A 4IEOA 1ZZBA 1SEFA 2MHFA 4ZU5A 5JSPA 3EHKA 5FLJA 3ELNA 3PVBB 4PIXA 5JSRA 1O5UA 1NE4A 3LA3A 1O3RA 4MX3A 2IXCA 1CAVB 4MUVA 2C0ZA 4QGLA 2VECA 5I0UA 3H3ZA 5D1IA 1U12A 4EWDA 3KCCA 2D5FA 3FZ3A 3U10A 3U0ZA 1UIJA 5FCCA 3D82A 2ET1A 1O7FA 1WA4A 2XLGA 4F7ZA 1O3TA 2Z2SB 2PHLA 3H1WA 3KGLA 4KL1A 3E97A 1SFNA 3UKNA 3KSCA 4HLTA 1PM7A 5CVRA 1WGPA 4MGYE 2IXKA 3IDBB 1GQGA 4OFGA 2QCSB 3FFQA 4O9GA 1RUOA 3RYRA 1EYBA 3NKTA 3OCPA 2UY9A 4K8FA 1ZZ7A 1ZZ8A 4MH0E 1ZVFA 5J7MA 4FAGA 3I59A 2WC2A 3FE5A 4IEWA 5JCTA 3QOPA 4JTOA 1RGSA 3DKWA 4HN1A 4QXKA 4QGMA 1WLTA 1J59A 2PHDA 4D7SA 1FXZA 1V70A 1O3SA 4HMZA 4X6QB 1CAWB 1XE8A 1CAWA 2QDRA 1H1IA 2P17A 1QXJA 3OF1A 5EZWA 4I0BA 2MNGA 3H3UA 2UY8A 4KWKA 1RL3A 2ET7A 3ST7A 1ZREA 4LA3A 5T3NA 5I0TA 3RYKA 3C3VA 4HVRA 1CGPA 3EBRA 4BHPA 4LUMA 2IXHA 3H7JA 4N9IA 5I0RA 4ONUA 4HZFA 1YFYA 5KHIA 5F1RA 1LR5A 3ROUA 2O1QA 2Z69A 4EWAA 5FDBA 1DGRA 4KWLA 4AQ2A 4LTAA 4JVAA 4Q0QA 2GAUA 2Q30A 1ZX5A 5BUVA 5BY5A 4D7TA 1CAUA 3I54A
chains in the Genus database with same CATH superfamily
2BEOA 3MIGA 3ZYGA 3DPRA 1H30A 2VQ0A 3NV1A 3OY8A 4Z07A 4YM2A 1ULDA 1UU4A 5FZOA 5CEHA 3LA7A 3MIFA 4P9IA 3ZPOA 5F6LB 1W8OA 1ZBE2 1QY4A 1UU5A 3ILRA 1TMF1 2WT1A 5FUNA 5BV6A 1QJEA 4CZSA 3MFCA 5FV3A 4E2SA 5I91A 1F2NA 5J09A 1YFUA 2B46X 2QQLA 4YM0A 2FQPA 2ZHKA 4GAZA 5FMOS 3U14A 3SXWA 4S2GA 2B5HA 4EE2A 1KS5A 4HKWA 4FOQA 3DF0A 4UFIA 5BNOA 1WBFA 4MGIE 2XONA 4XXAA 5IK5A 4AW7A 1DHKB 5H9QA 5JAXA 4XF3A 1EY2A 4CDQA 1AYM3 2BDRA 1PVXA 2DF7A 4YZ2A 5J96B 4I02A 3WV6A 4GMP1 5JZGB 4LK7A 1RIRA 4FPYA 1LESA 3ZLIA 1SPPA 4ZU7A 4LBMA 2A6XA 5ACA3 3UKVA 1GQHA 5C9AA 4NE9A 1MQTA 5J36A 5DAWA 4CUGA 5IAVA 1RUF2 1HRV1 3UNPA 2K0GA 4WVZA 5IVBA 1D0HA 1RUNA 4QPIA 3AYCA 3W21A 3WNKA 1OHFA 4Q4V2 5IVYA 2B9VA 4N8MA 1JOPA 3NNMA 5F3EA 3SHRA 4C90A 1FI2A 3FBYA 2VZPA 1Q8PA 3SCFA 3SNMA 4CDXC 4D0QA 3ECQA 5BNNC 3G6JB 3Q8FA 4K1YA 1E5IA 1WD4A 1O4YA 2R072 4B1LA 3LDBA 1XE7A 2JECA 1PO12 2HWD2 4Q0PA 3VD5A 2VXJA 4IEYA 1W2NA 5B4XA 2TEPA 5FXZA 4YVSB 1REDA 5I93A 4C0HA 4RD7A 4RR3B 2J42A 2FZ2A 3JZVA 2VU9A 2NMOA 2RDNA 2QZ2A 2Y6GA 1AF9A 3WNOA 4JGZB 5EFUA 1JU4A 2IVJA 4BZ4A 3RZHA 1NXMA 1ULPA 1LHOA 3J4UH 3J8F1 3Q8CA 2LROA 4MGKE 2YBSA 3RNSA 1X82A 2Y64A 3BALA 3VDBA 3VBUB 1JUHA 1OPOA 2AYHA 2X5IC 3ALQA 3FWEA 2KXLA 3I2FA 5A3MA 3VDAA 1W0NA 2O8OA 5AFEA 5L9BA 3PHMA 1Z0HA 4XBQA 4IV1C 1W3VA 4QDQA 2PHWA 2J1AA 4TLFA 3WP3A 2CWMA 4CRQA 3QCWA 4I3GA 2ADDA 5HCBA 3VD7A 5HXMA 2ZAAA 4RN5A 3HQXA 5GLTA 1HJFA 2WR9A 4R8HA 4XUPA 2WS92 2CGNA 2YU1A 4XCBA 2PYTA 3NNLA 4L0PA 4X8NA 5FPLA 3S6PA 4CU6A 2RV9A 3AKSA 1CPNA 4L8QA 5KR7A 5KWRA 2ZX3A 3KB5A 1TME2 1I9RA 5IATA 1X8MA 3HIFA 1T2XA 4IEQA 1E5HA 1QJZA 1V9U2 4YM3A 5JLVA 2FDHA 3AZYA 2NMNA 2VNVA 5DZGA 5JVVA 1LOFC 1GANA 3AZXA 2BNNA 4ES8A 2CNAA 1IKPA 1XNKA 1R091 4HVQA 1YEWA 3MDPA 1ZBA1 1I6XA 3HVDA 2KD7A 2VBDA 4IESA 4LBQD 3N7KA 5FP4A 1H1MA 3ZFEC 4AGRA 4ASMB 1LOCA 3KS7A 3AP5A 4CA9A 2WJSA 4DXZA 2W91A 3VKMA 5JZGC 2R043 2C9AA 1XQNA 1YI9A 3A0KA 5A6ZA 1ZBE1 2EIDA 1UD1A 3VHNA 5CKNA 1YIPA 3JCIA 4DMIA 4A6OA 1JZ7A 1FMD3 4LBKA 3K4DA 1F4HA 2ORXA 3I2JA 2EXIA 2CAVA 3U75A 4CP9A 5JMCA 4QPGC 4FQ4A 3WQ0A 3FBMA 2BOJA 2W1SA 1Q8SA 1S0BA 3LAGA 1SFPA 2RS52 3ZX7A 2JIJA 2HWF1 2JG8B 3J9SA 3U4XA 3TEZA 3UYJA 2J1VA 2PLV3 4JZRA 4AVAA 3O1VA 3ZYIB 1DFQA 4BQYA 1UOBA 3DYMA 1BQPA 3MYXA 3V0AB 1JYTA 2D6LX 2DCKA 2RJLA 4HBNA 4MG2A 2PHFA 1VBC1 2VZSA 3QLQA 3LPGA 3PTRB 1HKDA 1ZRRA 3NL1A 3SEEA 3KLSA 4RQPA 5KHKA 1RITA 5A7QA 2DBNA 2XH6A 3HT2A 1S0GA 2V72A 3WNPA 2YUEA 3SISA 3H8RA 4ZU4A 1YQ5A 3AMHA 2B42B 2XHKA 5FZDA 3TNPB 1TQ5A 3ZFFA 3S30A 2YGLA 3HBKA 3B69A 1NAEA 4XMAA 3K75B 4GWJA 4ARYA 1GP6A 2FMYA 3ZYHA 4H2AA 1Q43A 1A8DA 4A42A 1WW5A 4NHYA 4AQSA 1DYOA 1HLCA 3K51A 3W58A 1JMUB 3PNAA 1JHJA 3WF3A 4BIFA 1OA3A 1W9YA 4H7MA 4DQAA 1VPHA 1DLCA 4XXPA 3ZYRA 4DXRA 1ZA4A 4BISA 1IZ3A 1G9CA 5L19A 3GHMA 3IIAA 1V0AA 1ENQA 2IZWA 3ITQA 4AI0A 1ENXA 2GH8A 3W59A 3DN7A 4D6RA 3D4KA 4FFIA 3E5QA 4EWEA 4YVWA 1CPMA 3AKTA 4QKNA 2D93A 1V9U1 1W6QB 2KA3A 4AVCA 2W92A 1BEV2 4QDSA 4WM7A 5ACA2 5JSOA 1DIWA 3IDCB 2QQMA 1DGLA 1R1A2 2FCUA 4XTPA 2VZ3A 1JUIA 1HB4A 3POGA 2D3SA 2VH9A 3H50A 1JYCA 4L9BA 2UYBA 2R30A 2R49A 1K12A 2ZEXA 4UBGA 3U37A 2Q8CA 1RUG3 2BVVA 5DUVA 2W1WA 4NAOA 3T2TA 2Q8OA 4Y24A 2O14A 1W6MB 1UAIA 2OQ7A 4MXVA 5HV4A 3B3QE 2WAAA 2E9QA 4D3WA 2W0XA 4KWJA 1P8JA 2PHRA 4QPIB 4LOTA 3U4SA 3U07A 3WG2A 4ZS2A 1TMF3 5CU1A 3H1MA 2Q4SA 3DUIA 2VUCA 1LGCA 4QU2A 3SC7X 1ST8A 2MPFA 5KXEA 4KMQA 1L3JA 2EALA 4WM8C 3O1SA 4IE7A 2JIGA 3KZ4C 3WXPA 4CU7A 3H8UA 2RR11 3P6BA 4E2QA 5L9VA 1LCLA 2WAOA 3ZXEA 3B7MA 1FOD3 1IGOA 2EAAA 5FMDA 4CPBD 2XL7A 3FX3A 2PAEA 3D0SA 3MIBA 3I7DA 4AFMA 3SEPA 3WQ1A 4CDXB 3J26N 5EV7A 5FPZA 1CIYA 5FZAA 1WA6X 4AR2A 1DGWA 3VV1A 2DU1A 4F3JA 3J7LA 4UW3A 1KEXA 5AVAA 4AFAA 4BMBA 2CWSA 4XDPA 4K20A 1ZZ9A 1PGL1 2G9FA 1O3QA 1OF3A 4EJRA 4HG6B 4CCNA 2WIIB 3MPBA 5FY7A 1WMXA 4QPGA 1N1TA 5LASA 4YW4A 2XUEA 4UFJA 1XNAA 3UGHA 3LDRA 1COV3 1SFYA 1UIKA 2VTXA 4P9JA 4XFCA 1CAXA 1M06G 3IPVB 3KD4A 4DNYA 3JUUA 4AOCA 3RWNA 5HV0A 4O9EA 1AXKA 1Q5OA 4YVSA 1VB2A 3DV8A 3N9QA 3E1F1 4PDWA 2V4VA 4LBLA 5C3PA 1MS1A 1N1YA 5F2SA 4NPLA 4HN0A 4BXSV 1QNWA 1VBC3 2GZWA 2D6MA 5FO9B 4NHMA 3OPZA 3CZJA 4NMIA 1EV11 1DG6A 1QJX1 1AYN1 2YV8A 4NHKA 4QX2A 4AGVA 1VBE2 1IQAA 1DQ4A 3KWVA 1AL23 3B9IA 5J3UA 3FJSA 4Q4Y2 4N9HA 3ATGA 2K46A 2ZPXA 1IG3A 3MUZ1 4LK6A 1SLCA 5DQ0A 4QPGB 3I3BA 3BIWE 3N35A 2VY0A 4B3NA 3DL3A 2WZEA 4GALA 5FY1A 1ALYA 5F7UA 1FT9A 4QX0A 3I49A 2GNDA 3LGRA 2PN5A 4NRPA 4U36A 3TNQA 3RZZA 1SCSA 2IXIA 3L2YA 4XHBA 2WQ8A 4LT5A 4NIIA 3ZIWA 1YYNA 1UNBA 1JBCA 5EQUA 2WZR1 1PHMA 1B35C 2D7FA 2WRAA 3E6BA 4F8AA 3ZYBA 1FMD2 5LY2A 3ES4A 3C7GA 4I2OA 4OMDA 1ND3C 3AL5A 3NJVA 5CZKA 2J7MA 1JZ6A 3I97A 2ZEZA 1RUE2 1AHSA 1LEDA 4AF9A 4ASKA 2GN7A 1OC1A 3I3EA 1G9DA 3AYDA 1PM4A 1UOJA 1JI6A 1ENRA 4XQWA 5FY5A 3UK9A 2ZGRA 2JKXA 4YLZA 3O1OA 2A3YA 3WLUA 1NCRA 2H6CA 1G9BA 4MVTA 1NQDA 5C71A 4XVHA 2BJSA 3I8TA 1RUH2 1VRH3 3OB8A 4CCJA 1IKQA 1ZZBA 1SEFA 1MZFA 2W1UA 4ISRA 5DUUA 5F6KA 1FPN1 1OH4A 2D98A 2I74A 2VGDA 4XJUA 2NYYA 1AYM1 2D43A 1DZQA 2ZACA 5C4WA 3H3LA 1EAH1 4BU2A 1UZYA 2BTVC 5LATA 1WMDA 2W52A 1S0DA 3HQRA 3VBUC 5CISA 5SV8A 3AZZA 4TXWA 4URTA 1VAVA 1RHI2 4H3WA 3URFA 4LXLA 3WSOA 1SLLA 2W47A 1D4M1 3WX5A 1RMU1 1Y9MA 2X53S 3NO8A 5I0UA 1S55A 5D1IA 1U12A 3OUJA 4B7KA 1PZ9A 4QQLA 5FZFA 3WDUA 2ARBA 4Q4W3 4BCUA 3T2OA 4FPCA 4PI0A 5A7OA 2A73B 3K77A 1BBT2 1HXS1 2VAUA 2W87A 1O3TA 3AP7A 3PJQA 1FNZA 2DCZA 3FMGA 1WW4A 4PLNA 2XBO2 4RHV2 4EQVA 2ZBJA 1Z7S3 5ABJA 1ULGA 2ZZJA 4WZFA 3UKNA 5ABJB 4INDA 3NQHA 4GWIA 2Y60A 3F95A 4LBQB 2RJKA 5M0TA 4R9DA 5CVRA 1WLWA 3AJZA 5DG1A 3Q8EA 2IXKA 1LOEA 2ENRA 3AC0A 1JXNA 4OFGA 5D8AC 4PF5A 1UU6A 3FFQA 3R05A 4HANA 3TBDA 3MEPA 4FPHA 1S0EA 2D6NA 2R061 4FPJA 4RFRB 4FSJA 1NZIA 4MHRA 3T4HB 4CP1A 4Y5Z0 2QKDA 4PLMA 4RSUA 3ZYPA 4GD4A 5IWFA 3I59A 4LORA 2ZGTA 2CGPA 1FV2A 4HETA 1JOJA 1W2TA 1NA1A 3DKWA 2J1RA 3KQRA 2B7YA 4D7SA 3ZXJA 3AKPA 2VZQA 3IMNA 3UJQA 2YG0A 3LEMA 1AX1A 4X6QB 2KM2A 1XE8A 1CAWA 2LTNA 2QDRA 4DS0A 1PO11 4IGQA 4NHXA 2JE9A 4GH4A 4CDUC 4HK8A 1OH3A 2VNOA 3A7QA 2BZDA 2A6YA 4HXCA 4CP2A 3M3OA 3X29B 1V00A 2E31A 2J1UA 1G8WA 1GKBA 2BOIA 1VBB3 2UY8A 3D3AA 4I0WB 4Y4YA 5T5PA 2ES3A 2P5BA 2DCJA 2ET7A 2W68A 1JZ2A 5FYIA 2RS33 1SBFA 1HXS3 3POJA 4BOWA 4KGQA 5FPBA 5LB6A 3THTA 3ZKYA 3A23A 3MUY1 4Q4V3 4Y3OA 3RSJA 2UURA 4NHLA 5JUVA 3H0OA 3ILNA 3AXDA 2TNFA 3OBRA 2RJ2A 3NMBA 1TZOA 4ATFA 2DTWA 2QTWB 2E53A 3DXTA 5LBBA 1YFYA 1U0AA 5KHIA 1BK0A 4MOAA 2VOTA 1L7RA 1A3KA 2ZMLA 3HAGA 4YZ1A 3MO4A 2JD9A 5F5CA 1DGRA 4KWLA 5FK8A 4AQ2A 3WF0A 4E9KA 2V4AA 1KFXL 1QIQA 4QX7A 4AEDB 1K45A 1ZX5A 4LOSA 1W2OA 2QZ3A 2VMHA 3B9CA 4Y1XA 2R1DA 3MW4A 5D2AA 1RMU2 5FP7A 2X05A 5HBAA 4CDUA 4RL7A 1DCSA 4Y20A 2PHXA 5A80A 1OFSA 5FYBA 1OI6A 2Z4FA 3AVSA 1O91A 3ZPYA 4I01A 5AFBA 4SLIA 5K9YA 3THPA 2VCAA 4N43C 3RDIA 4NIGA 2FCTA 1DQ0A 1RUH1 1OUSA 1CAXB 3CHXA 1XYNA 5IVVA 2QQOA 4S2FA 1ND3B 2BFUL 5DAVA 1BEV3 1E5SA 2QVSB 1YQ2A 2Z42A 4P9XA 3SH5A 4DZGA 1KJLA 1SZBA 4YZ5A 4YW2A 1APNA 3T09A 1AR73 4C8DA 1CESA 2QQJA 5FZBA 3H7YA 4UFLA 3RQ0A 2AR6A 4AWDA 4NVPA 2XVKA 1CZVA 5BNPB 1JH5A 3Q8BA 4XFBA 1W9SA 1GZTA 2HWF2 3QACA 3OBZA 5FZ9A 1PNGA 1W9TA 1PK6B 2R062 4R52A 5EJ3A 2HWC2 2ZJCA 2ARAA 2WO3A 4XPVA 1VRH2 3L2HA 5FO8B 2QQNA 3BN6A 4Y5SA 1SACA 2YGMA 3CQOA 3OGJA 4Q8LA 5JPNB 4RR3C 2DVFA 4B4RA 5FTTC 4O7XA 1QU0A 3UJOA 5KBFA 1YHFA 1H8TC 2R042 2XLFA 4MSVA 2YC2A 1PK6C 2HWE1 1OVPA 3K48A 4CCDA 4JCKA 1AJOA 1Y43B 1OQ1A 5F37A 5L36A 3BCWA 2XGXA 2PXJA 3GGLA 3PU8A 3I2IA 2HWB3 5FYYA 4JAAA 1ZBA2 4IQPA 3RRDA 3T08A 3VL8A 3WDXA 4N53B 2EXJA 5FQ0B 4CUAA 4AXOA 2PTMA 2CY6A 1BK1A 1OURA 4YVWC 5C70A 4DUVA 1SBEA 2L9LA 4XF9A 4HL0A 1ASJ3 3AYAA 3JD73 4Q26A 1RHI1 4J25A 2D44A 3KT7A 4QX5A 4XBLA 1W8TA 3LD8A 4AAPA 4E27A 4IE6A 1UMHA 1ZNPA 3O0VA 1RINA 1IPJA 1J1LA 1AL0G 2ZABA 1BVP1 2DCTA 4NRQA 5JOXA 1YWKA 2RM22 2BYVE 3UESA 1COV2 2HWE2 5LRRA 1SLIA 2GP5A 3B02A 5K4LA 4YVWB 3BYWA 4MYEA 2PAMA 2X10A 3M3IA 5G04L 4OHZA 3N4MA 3HR9A 1BZWA 4LMFA 3FFZA 5IAXA 2Y0OA 3B01A 1DGRN 5I0DA 2XJUA 5A1LA 2ERFA 1AR63 1VRH1 4HFSA 3TN91 4OHYA 1X8EA 3IAQA 4B1MA 3NSTA 2ZKLA 1LTEA 3BIEA 1FAYA 4YSFA 3ZSLA 4CVUA 4XQ4A 3PMEA 3ZKUA 4CEYB 2WWJA 4Q2FA 5IFPA 4PIYA 3P5BA 4GB33 3J8F3 4BH9A 1NE6A 1NLQA 3N9OA 4NO4A 4GIQA 2VZOA 3CBNA 2VNGA 1QDOA 3M3QA 4K21A 4UFHA 3HNMA 4XDQA 4YW5A 3PDQA 5GLUA 1ZYBA 3IAPA 5DMYA 1NY71 2DUQA 2MEV2 4P9WA 3VBRA 3M3EA 1PGSA 4E2GA 4RQPB 4JTNA 1GWLA 5C3RA 2WINB 4XW3A 1TNFA 1J58A 1NKGA 1OA2A 5FZ6A 4BMEA 1WD3A 4QKFA 1AYN3 2OXBA 3OEAA 1YLLA 3H9AA 1KDKA 2XB6C 4LE3A 3CU7A 3A22A 5F8PA 1GLHA 5GM0A 1OSGA 3QH6A 3JBG3 1RTVA 1HRV3 3USSA 4XFHA 4LHSA 2ZGMA 1QNYA 1XPWA 3KM5A 4IEXA 4LKEA 5E16A 1RVF1 4F83A 3KMHA 2HKXA 5EWSA 2VUDA 3AX4A 4BIOA 1OFNA 1RUD1 3MLKA 4N7UA 4Y22A 2R0HA 3G7DA 4G9SB 2Y6FA 4W4ZA 4XTMA 4K7JA 1WCKA 4M01A 1LHNA 1SG3A 4PQ9A 3D8CA 5A3PA 5ANQA 2FMDA 1HDKA 4KU8A 5FZHA 3I2KA 3POBA 4OMCA 4AYUA 3MZHA 4Q0UA 1VMHA 4FPFA 2C9KA 3OEBA 4JHZA 3VBRC 4P9GA 5DG2A 3GCXA 2PQSA 5F3IA 3ILFA 1YJLA 4LBNA 2LRPA 4IERA 2LUWA 1JZ4A 3F2ZA 2HEVF 1RVF3 1GNZA 4DINB 4CTEA 3SH3A 4EN8B 4LEJA 1A6CA 1B35B 2QQPA 4CDXA 4LULA 3RPQA 3CIHA 1F5JA 1UY3A 2X8KA 4ET7A 1ODMA 4XE9A 3KCXA 2P3JA 4EZ4A 5BNPC 4FI9A 4LJHA 4YG6A 2NPIA 2WT0A 1RB8G 1W3XA 5E6HA 2YMZA 5A3LA 1CD3G 1N3PA 3OBTA 4QQOA 5H9PA 1H2KA 4Y22B 3ZM8A 4MGSA 3EXUA 2ZKNA 2VMIA 2AENA 3OSDA 4FFFA 3SCHA 4NPMA 1LRHA 1L7LA 3OOXA 4PJYA 2ZGOA 1AR72 1AL22 1PGW1 2RS31 2ZEYA 3BTAA 4TN7A 3B5LB 5CAZA 1COV1 3VKLA 1RJ7A 2XJSA 5FAXA 3B93A 3N9NA 4IEPA 1UZWA 1REEA 5JIUA 3S7EA 3LZZA 2ZA9A 4HK9A 5LEJA 3ABZA 1RUI2 4R9BA 4RFT0 4EROA 2R073 1IPKA 4YM1A 2ZTNA 2WFF1 1IOAA 2DVBA 1YUDA 2WBKA 2HWB2 2WABA 1S2BA 4LLOA 2JDPA 5LEKA 2R6QA 4WM7C 5FZMA 2WYSA 4LHLA 1GOFA 4HONA 4OHWA 4Y26A 1W0OA 3T0AA 1HRI3 1VBD2 2NLRA 4JKKA 2BWCA 5E88A 4JKLA 4UFMA 4LUKA 4XACA 1FYUA 3NRUA 1RYYA 2YFZA 4KH9A 3RVHA 3PUQA 1F8VA 1A8MA 2R0FA 3VLBB 4META 4AEMA 3PVOA 4LE4A 1YXWA 1VBA2 2JXAA 2VE1A 4AGGA 2RR13 4IGPA 2V5DA 3VBSA 4GH4C 3POFA 3WNMA 5KC6A 2W1QA 3HQUA 4Y20B 5J98B 2PFWA 1C8M2 1IS4A 1QQP1 1US3A 2XJVA 1BVVA 3I2GA 3B94A 3WP6A 4CEWA 2HYKA 2HWD3 1W99A 5F5QA 3ZYJB 3I2OA 3GZAA 3WD5A 4UW5A 1YFXA 4AQ6A 4CDQB 3V0AA 1NUKA 2JEMA 4LLFA 2VZ1A 5LWBA 1Q56A 1RUH3 1VB4A 4YW6A 5FXVA 4M4RA 2RM23 4XFAA 4B4QA 3MFAA 4JDOA 1UZ0A 1WCQA 5FPXA 3MW2A 5T5LA 4YFWA 4WZCA 5C8CA 4TTGA 2VC9A 1FV3A 2XL9A 3INAA 4AK3A 1CAUB 4MO3M 5A3NA 1JYNA 4XABA 3AKRA 3J8F2 2BGPA 1SLBA 3TRSB 3JB8A 1AR62 1LU2A 1V6LA 2J22A 4R9CA 2A70A 4FOWA 4M00A 4UW6A 1S0CA 2GP3A 5C7GA 1QHDA 2VW0A 2Q0AA 1PX4A 2ETEA 1XU1A 4B29A 1KJRA 1XRUA 4DRRA 1G9FA 2DFBA 4OVEA 4PBOA 3AP6A 3NVCA 5FQ0A 4GB32 3DCQA 1UY4A 1UF2C 2H6BA 3M3CA 5JIAA 5LA2A 4J1WA 5IK4A 3ZXLA 1QH6A 2VOXA 4ZXEA 4A3XA 4CCCA 5LA1A 1S4CA 2YFUA 2RS11 1V9U3 4P9LA 4P14A 1CR7A 3SMHA 2DVGA 2HYXA 3T2QA 3WW3A 3BODA 3HPNA 1OKQA 4M3CA 1PIV3 4UYBA 1OT5A 2RHPA 4CCOA 4DOUA 1A34A 3ZVXA 1HRV2 1XSQA 1R092 4XF1A 3WDYA 5FJKA 4Q4X3 2OZJA 4BB3A 3WNLA 1AYN2 3I59B 1NT0A 1JW6A 1KRIA 1QEXA 4QT6A 2XWBB 1LOAA 3CMGA 2D3RA 4YZ3A 5CFDC 1AR93 3PUAA 4ZS3A 2BU9A 1LHUA 5JXGA 2PQQA 2CU5A 1OOPB 2VPVA 2OW4A 4AVTA 4BXFA 1J3PA 5CA6A 1RUC1 3TEWA 1CQ9A 1F15A 3BOPA 4LNVA 3FHIB 4XF4A 3TYJA 4DB5A 2SLIA 5IYYA 4V2VA 4WVMB 5JDBA 4Q1PA 4OLLA 4Y33A 2I2SA 1MS8A 5HPOA 4GULA 4Z82A 4IEOA 3RGBA 4GJZA 3LPFA 4JX0A 5C3SA 4HT1T 2V5YA 3R4SA 3IN9A 3K46A 4ZU5A 1FX5A 1WMFA 2JDMA 5AC91 5JXHA 1WW7A 2JB4A 3MF9A 1URXA 4A7ZA 5FLJA 3SH4A 2JDZA 4E4DX 4AHXA 4FP3A 2E6VA 1QMJA 4X8PA 2QQVA 2WDBA 5JSRA 4HPKB 1O5UA 2G9ZA 1NE4A 4AVSA 2VZRA 3BPSA 5FR3A 1O3RA 3VZMA 2C0ZA 2X5IA 3C7FA 2AUYA 3LIHA 4O65A 3WDWA 3AFKA 2Z5WA 1ND2C 5C8CC 1WBLA 2CL2A 4EWDA 5FYZA 1TVGA 3FZ3A 3U10A 4AEDA 1UIJA 3D82A 2GMEA 2FDJA 1AUYA 2HWE3 3R4UA 2YXSA 4L97A 2DU0A 3LB9A 4FVVA 1ULEA 2Z2SB 1U5ZA 2GNTA 3E97A 4LHNA 3IKWA 1LOFA 1BHGA 1ULOA 2EXKA 4GA9A 3HNBM 5FP9A 2JE8A 4XILA 1X9TA 4OZOA 2GMMA 5IVCA 4YFZA 5FZKA 3PIGA 3ZFGB 1GQGA 3AP9A 5JI9A 1X36A 4QXCA 2DWRA 2ZHMA 1RUOA 3RYRA 3NKTA 2WO1A 3OCPA 3R4DB 1W8UA 2RM21 3HN3A 5FYSA 4K8FA 5C9AB 1DF0A 5TSWA 2A6ZA 1ZZ8A 1AXZA 4XURA 4AI3A 2GSYA 3ZDVA 1UYYA 4RQPC 4OI0A 4NRMA 1UPSA 1GFF2 1PVC3 2WC2A 5ACA1 1BEV1 2VCMA 4IEWA 3QOPA 5JCTA 3THCA 5K0UC 3I3MA 4HN1A 5CG9A 5GZGA 1VBA1 1JS9A 1OKOA 1LODA 3K2OA 4TWTA 2PHDA 1KD7A 3MV11 4QX3A 1J59A 5IJRA 4I30A 3DEMA 4IXLA 3LEKA 1FXZA 3TN93 1VLNA 1CAWB 3V65A 3BOWA 3MBWA 2FD8A 4CEYC 2JG9C 4AHWA 5FZ7A 2UWBA 2RS12 5FMCA 1D4VB 1AYM2 4KBBA 4OI1A 4LKFA 2SBAA 1RUJ3 4K40A 3VKNA 1W6OA 1YQCA 2JJ6A 1TMF2 2GMPA 3V56A 2FZ1A 4R9AA 1MS4A 2R041 3PUSA 5GLVA 3WHUA 4E4ZA 1AVBA 3AFGA 4QKDA 2ZGUA 5BYNA 2DBIA 1XSRA 5HCAA 3RZGA 4RS5C 2A75A 1DYKA 1OLQA 2HLEA 1RUF3 1C3HA 4LA3A 2Y33A 2ZHNA 1YQ6A 4TYSA 3KF3A 2RMU3 4QKBA 5EP9A 1PIV1 1UQXA 5I0TA 3A21A 4HVRA 1AR71 5LBCA 3LCPA 1IS3A 5EYXA 2HH9A 4OYUA 3H7JA 4LR4A 2YC4A 1Z78A 4UT5A 3HBZA 3N7MA 1VBC2 4HZFA 2DV9A 5E8AA 4RS5B 3ORJA 2WL1A 1QF3A 2D6PA 2Q1MA 4OZXA 1WCUA 1W8HA 4EWAA 1FPN3 3ZN4A 4LTAA 1V6JA 5LY1A 3M8LA 4JVAA 4AI2A 5CFCB 3LEGA 1BMV1 1W6NA 2K2SA 1GZ9A 1OOPC 2GALA 2Q30A 3MIHA 1SLTA 5BY5A 4D7TA 3PLQA 3JQXA 4XFGA 4HSJA 1HN1A 1PK6A 2W3JA 4GXLA 3ZOIA 1R64A 3FN9A 5IW0A 1QQP2 1C8M1 4LO5B 4YGCA 1F9KA 1HB1A 2GC2A 1R081 2GU9A 1D2SA 2XR4A 4MADA 4A7KA 4P00B 2VZTA 2H0VA 1UYZA 3CKHA 2ZAHA 4JKMA 4YZ4A 2AZ5A 3GBFA 1DYPA 1R093 5C4WB 2UU8A 4Q8KA 1EV12 1E5RA 1QJX2 4XUTA 3WF4A 2XPJA 5FPUA 5E89A 4M3CB 3AYEA 1B09A 2WFPA 1ND3A 1H2NA 1UOFA 2D40A 3QH7A 2XQXA 4AFDA 2VJXA 3S7IA 2YHJA 3ZN6B 5FY0A 5JXJA 1HX6A 3THDA 4D6QA 1H8TB 2VXRA 1X7NA 1W6PB 4Q1RA 3VDDC 4W8JA 2Q8DA 1LNSA 2A3WA 3RYPA 2F6BA 2XJTA 3MIDA 5FIXA 2BFUS 3TEXA 5DDJ1 3UT0A 3ZR5A 4EV0A 1NQJA 2VUJA 3NJXA 3APBA 1JYIA 3S5QA 4CDUB 1Y3TA 2CTVA 1NYWA 3DECA 1WLCA 3NAPB 5H9RA 2XHNA 1XJAA 4QMAA 5DAQA 3MIEA 4CUBA 4COZA 1CONA 2A3XA 2QQUA 4PF1A 4Q0SA 4BQ4A 4CP0A 2BGCA 3V0BA 1XYPA 3ZFGC 3POWA 4PCRA 2OZ6A 5FZGA 5C3OA 4WVWA 4JHTA 5C8CB 2ZGQA 3N3HA 2OA2A 2F4PA 4YYOA 2I07B 2P1BA 2P4EA 3ES1A 3PUIA 2QJVA 4BDVB 4NIAA 2NQYA 4QX8A 1JZ8A 4FTSA 5A3WA 4XF0A 3OBAA 2HJIA 1W8WA 1VBA3 3RS6A 1H2MA 1ZZ6A 1GWMA 4YG0A 5FYVA 4L11A 1HJGA 3RI8A 4CEYA 5LZ6A 1N3OA 2QE3A 3B00A 5DUWA 2NZ9A 1OXCA 2Z79A 4FBFA 4DIQA 2ZMKA 4BYYA 3WNXA 4WVVA 5LA9A 5FYHA 3D0JA 4QU1A 4D8MA 2ZXQA 3SITA 5J48A 5KHGA 3DYPA 5F39A 3N9LA 2HWD1 2CAUA 4LO4B 3ACFA 1DQ1A 3VDDA 4GZ9A 4XUNA 3GALA 2VMCA 3BPZA 1NX9A 3WP5A 5F3GA 3E5UA 5D8AA 3IPVA 5EJ1B 2B9UA 5BNOB 5A3OA 1DDLA 3JBG1 1STMA 1H9WA 1VE0A 3ZXKA 4IDZA 5A6XA 1QJY1 2W94A 5T5OA 1HW5A 4Q4W2 1RUF1 5EYYA 1C1LA 2VW1A 3HT1A 3E5XA 2X29A 3RI9A 1RUC2 1W2UA 3A4UA 4MXWA 4JDNA 4RA0A 4DY5A 3C8XA 4N43B 4TSVA 5IUQA 5A7PA 3WQBA 3WUDA 2UYAA 4BA6A 5HI0A 2ZGKA 3CLPA 4OUMA 1JODA 3OY8B 4E8CA 2AGSA 1CWPA 4P9YA 3VKFC 4XZUG 2W2IA 3ACHA 4ZXKA 3TAYA 1PVC2 2JDNA 3J7HA 4HOOA 3ZN5A 4D6SA 3EJKA 3W5NA 1W39A 3LFIA 3OTFA 5LBEA 1LHVA 4BQWA 4CPBA 4RYDA 4ES9A 4QDRA 4LBQA 3RG0A 4CSWA 1PMJX 5K7PA 5A6QA 1OQEA 2P3YA 2XQRA 5FPAA 1GQPA 1MQTC 4M3CE 2ZCWA 3BTZA 3EB7A 4HPKA 5BNQA 2CDOA 1R082 3WDTA 2WFF2 3VBHA 3S0MA 1ZRCA 5F32A 3WT3A 1FOD1 4DUXA 1PO23 1G9AA 1CIWA 1HV1A 1DU3D 4IETA 2PAKA 2XLAA 3KT4A 5CNAA 5C4WC 3ZYFA 2WNUB 3ZFEA 2AEYA 2OS2A 3NNJA 1HRI1 4IV3C 1NCQA 3CJIA 5C5TA 4XETA 1QDCA 3MW3A 1XOYA 3CEWA 1UMZA 3R6SA 4EZHA 3NKGA 5CYYA 1C5IA 3LOIA 1T6BX 5FBJA 1OMIA 3C2UA 5FREA 4PHZA 1MEC2 2AEZA 3IIIA 2WQ4A 5IK7A 4N53C 4ORFA 2WT2A 2UWCA 1N1SA 1QXPA 1YIFA 3WVJA 4A45A 2PHUA 1TE1B 4A6SA 4J1XA 4BQ1A 2BRTA 3NJYA 3J7NA 4KQ7A 3UV9A 2VQAA 2X09A 2YZ4A 4KI5M 1LENA 4KGGA 4IV3B 4CXXA 5LRSA 1PZ7A 4E8DA 3CNAA 1NLRA 1QJU3 3MPPG 4XUQA 2VD7A 5B2GB 4Z2AA 4QXBA 5ERLA 2VL4A 1YO8A 4FAHA 4HSLA 2CV6A 3RZMA 1H6XA 4YPJA 2BBVA 1WKYA 4C1XA 3VB9A 3WZ1A 1X50A 3FUOA 1E57A 1FNYA 1GNHA 1YI7A 1TEIA 1C4RA 3AZWA 1EV13 1QJX3 2WNOA 3J7MA 3PTYA 1QGLA 1H0BA 1POQA 3NNGA 1GOGA 5FLIA 4CDWA 1JYXA 2N7GA 4I09A 5CFCC 2BV4A 5A7WA 3NV3A 4RGKA 3KQ4B 3AXEA 1W0PA 3WW2A 2PHTA 1RMU3 2ZHLA 4QPWA 3VDDB 3T0DA 5FFOC 2WWUA 4LPLA 4PLOA 1Y9GA 2P3IA 3ETQA 3EQEA 4JQRA 4XDOA 1D2QA 3MF6A 1ZZCA 4DY3A 2HEYF 4GMP3 3USUA 1SDDB 2VR4A 1CZTA 2OVUA 1O8PA 2VZVA 4FCAA 4YW1A 4OQ9A 2FHRA 3POIA 5ANNA 4JV4A 4PI2A 2A5ZA 3OPWA 5BPXA 2O8QA 1KXGA 2Y6KA 4XFIA 1PMHX 4Y1VA 2DUOA 2ZZQA 5F2WA 1GV9A 1PGL2 1NXD1 2JWPA 5A3TA 2WO7A 4YGBA 4A44A 5JZGA 2FBEA 1QJY2 1WCDJ 3VBHC 3LF7A 4UFKA 4YWAA 2Q8EA 1CZSA 4UWDA 1C57A 1H9PA 4XFFA 3OPTA 4W6WA 4XCAA 1YQ8A 1RXFA 1SQ4A 4S2HA 4XJAA 1LOGA 4GH4B 2WZPP 2HWF3 1PZ8A 2ZGLA 3GJBA 1ACCA 1XYOA 1QOSA 2Y6HA 1X33A 3OGGA 5FYMA 5A3UA 3CDZB 1JTZX 5FLHA 2PA7A 5JOWA 1AR82 3MLJA 3VBSB 3JB4C 2DVDA 4Q27A 4M3CF 3K3OA 1W6PA 2A6WA 4I3PA 1XB9A 4C0BA 3M4FA 5BNNA 2R7EB 2E63A 4YNIA 2ZMNA 5F5IA 3ACGA 4MV2A 1DZRA 3RZLA 4MGTA 5DZEA 3LWCA 4FXKB 4ZONA 5FZ1A 5FKCA 4BQ2A 4FPKA 2RMU2 4ZZ5A 3FHQA 4XEZA 2WLPA 3DPRB 1D4M3 4IEZA 4BQ3A 3PVEA 1CX1A 3WW4A 2D3PA 5AC92 4HVOA 2YPJA 3NJZA 5KXBA 3MLLA 4LBOA 2BNMA 2EXHA 5GZDA 5C5UA 3H8OA 2NP0A 1BKZA 5FZ4A 4AL9A 4QWNA 3OD0A 4Q4V1 2WSVA 4CU9A 4IE0A 2Y34A 2OKXA 4Y5TA 3AVRA 4QM8A 4YARA 2GC0A 3T4VA 4OQ8A 5IVJA 5FZEA 3VUOA 4FT8A 1UKGA 1F31A 5KXDA 4O61A 3P3PA 3MGUA 5CKMA 3WR0A 3R0RA 4XJWA 1DLLA 1VBB1 2YB7A 5CADA 4AHYA 3K4AA 1LEMA 1W6NB 1HV0A 4I0AA 1RUC3 5K8SA 3O1UA 3P3NA 4WBBA 1GBGA 5IFTA 3JQWA 2VQTA 4Y1UA 1VMFA 2XJQA 4AVVA 5ABJC 4QB2A 5F5AA 1J83A 4Y4RA 1XBFA 1WWYA 2JDHA 1UZVA 2I45A 1G86A 4DEVA 2VQUA 3CJXA 4GKYA 3WDVA 1S1AA 3KV4A 1QJU1 2GH2A 3E6DA 4LIUA 1UO9A 4RHV3 1HB3A 3ZXAC 4AHZA 5A1AA 5JR2A 1W05A 1LKNA 3O1PA 2GNBA 1TME3 3HWJA 1C1FA 2OUJA 1Y9QA 3POEA 4AFBA 1X9PA 3KHCA 4RGAA 1D0GA 1AXYA 2EF6A 5FRAA 5GJ6A 4AVBA 4XJ8A 2C5DA 5JR7B 1QWRA 5IK8A 3N7LA 2R063 5GLZA 4BLJA 3GXUA 2WYFA 4GB31 2OYZA 3IDAA 1YCIA 5K0UB 1HQLA 2Y6LA 4NWWA 2WA3A 3UKTA 1OUXA 5BNNB 3O12A 1A78A 5GZEA 4AI9A 4LITA 4B8EA 4S2DA 3W9AA 1YNAA 4AAXA 3I3QA 1MEC3 5DPNA 1VALA 4KWUA 3BGAA 2WN2A 2FDIA 3AMMA 1SPPB 2ORZA 2IC1A 3BB6A 3BVCA 3I3DA 1HQNA 1UY1A 3ENRA 3ME2A 4UBHA 1CX4A 1NCRB 2O0OA 2QNKA 2VZUA 3WW1A 3POYA 4COWA 2WN3A 5A32A 3VD4A 3W20A 1PO13 2XOMA 2IUWA 3TN92 1AR91 3D5OA 1UX7A 4EYUA 1W2AX 4W65A 5I0SA 2YYOA 2V73A 5L7OB 2JB8A 1MZ6A 3AKQA 3C7HA 4P5YA 4QHOA 1F35A 4K9SA 2MHFA 2VO5A 1V6OA 3DPRC 3AMQA 5GLWA 2IFWA 2P3KA 3AMNA 3N9PA 2KR2A 4M0NA 3ELNA 3ETPA 1BBT1 1HXS2 3GBGA 1QJU2 3PVBB 3O1TA 1VAMA 4PIXA 4MX3A 4FTBA 4MUVA 1CAVB 2W08A 5JPMB 2J1SA 1SCRA 2ZGPA 1DBNA 3ASIA 3DXUA 2VECA 5T54A 1VBE1 3PU3A 4NOTA 3VBOB 3H3ZA 3VBRB 1KS4A 1BCXA 1IHMA 4BQXA 2D5FA 4Z92B 4LHKA 4IV1B 4TZDA 2DVAA 4OI4A 3OD4A 3KVAA 1O7FA 3ZXDA 2WS91 2XLGA 4F7ZA 4UF0A 2PHLA 2C6SA 4KL1A 5C9AC 4OUEA 1SFNA 4CDWC 3T1MA 2CSGA 1FPN2 3DGTA 1DQ2A 4FFGA 3PIJA 4Q4W1 5JMOA 5FUPA 1PM7A 3GDBA 1WGPA 4MGYE 2QBXA 4RGGA 1XNDA 1VMJA 3HNYM 1W6OB 3KT1A 3ZO0B 1GOHA 5FPVA 5EHDA 2E51A 2ID4A 2QCSB 5L73A 4O9GA 1ONAA 1EYBA 3USUB 4PDWB 3ZSKA 2UY9A 1ASJ1 2Y26A 3JD71 4EN0A 1UZZA 4M0HA 2XUMA 4MH0E 1VRBA 1ZVFA 2WZ8A 5J7MA 1XC6A 5IT6A 4YGEA 5FO7B 5T5JA 3LIGA 1GWKA 4JTOA 4XYXA 1IQDC 1R1A3 3OUHA 4QXKA 4D7YA 4QGMA 1WLTA 1JZ3A 4NIDA 3I2DA 3U78A 1OOPA 4K8RB 2XVLA 1V70A 1O3SA 2ZX1A 2OQ6A 4HMZA 3T3YA 4FPLA 2RR12 2AREA 1H1IA 2P17A 3OG2A 1UY2A 1R083 2BWAA 2R1BA 5DN2A 2R071 1C8M3 2JDUA 2TBVA 4UW4A 1UN1A 1WMEA 5EZWA 3ZR6A 1AR83 3KV5A 4D94A 3S5AA 1O6UA 1MZEA 2OIIA 3VBHB 1W28A 2CHHA 4URAA 1UX6A 1K5MA 2VVEA 5FXXA 1HIXA 1RL3A 2HWC3 4CCMA 1OLMA 1QJFA 1QKQA 4JGYB 3LDKA 4Q4Y1 3BI3A 1PX3A 4WM8B 3FUQA 3GZTB 2VTFA 1RHI3 3DYOA 5CG8A 2HBUA 5T3NA 5HXVA 3UGFA 3RYKA 3VD9A 3POSA 1CGPA 2BBAA 3EBRA 2TUNA 1R1A1 4A7YA 4BHPA 4LUMA 5JXIA 2P34A 4DFSA 2ADEA 4NR1A 3ZIXA 3FL7A 4P02B 4E4HA 3LKJA 4C91A 1UKRA 2XBO1 1MS3A 4MGQA 1W06A 3GM8A 3ROUA 4AI8A 2YPDA 1LGNA 2VW2A 3PURA 1RVF2 4YW3A 2O1QA 3RWKX 5FDBA 5BNPA 3PMSA 1RUD3 4CXWA 2YROA 2QUOA 4Q0QA 1O8SA 2EIBA 4CE8A 4N43A 2GAUA 4LO8A 2E26A 1UMIA 1LGBA 2B45X 1OD3A 1CAUA 1FATA 3FLRA 3QD6A 4QB6A 4Z1VA 1K3IA 5J37A 2XVGA 3H8XA 1LOBA 2AACA 4COVA 3ACIA 3ZSMA 2RMU1 2ZOEB 3V64A 4A4AA 5D8AB 2ARXA 3E6CC 1IPSA 4FOVA 1ULFA 5FOBB 2VVFA 5D21A 5GALA 3KGZA 4BPZA 2PMWB 3ZMOA 2MEV1 1NY72 5KXCA 1M4WA 3BU0A 2G19A 1BYHA 4EN7B 4CEWB 5A33B 3KHBA 1AR81 1W8FA 2J1EA 4FPEA 4AEDC 5HCHA 1RUG1 1U5YA 2OPWA 3HN1A 2DYCA 1UCXA 3WOGA 3WCRA 1AR92 1F4AA 3UGGA 5IHRA 1LJ7A 4ARXA 1RUI3 3H1YA 1RUE1 4MXWB 1XU2A 3JU9A 3IBMA 4GJYA 3RZKA 1HQWA 1AX0A 5CBLA 3A0NA 4G4FA 1QJY3 1HRI2 1VBD3 2BW8A 5C6CA 5LCWL 5I8YA 2JG9B 3VZNA 2BGOA 4XUOA 2PLV1 3BTYA 3O1MA 2D5HA 1GICA 4QQ2A 3KV9A 5DZFA 2ZX4A 4NIHA 1SBDA 3OJBA 3ZSEA 1VIWB 3UETA 3ZSJA 2D6OX 1FOD2 2G1MA 4OHVA 3T30A 1GP4A 3HMYA 4NAMA 3N9MA 3GJAA 4N90A 4K1ZA 3VBOC 4ZHNA 2DUPA 3K3NA 2C1FA 4CDQC 2JG8A 3EMRA 3RFRA 4DXTA 3GYDA 2WFF3 2WNUC 2YY1A 2Q5TA 5I8SA 3VDCA 1OLME 5FKBA 1VJ2A 5HCFA 1RUE3 5C3QA 5FBZA 3O0XA 1PO22 4XMIA 5DUXA 4QX1A 1EPWA 5FY4A 4Z2WA 2FDGA 5FJHA 1NCRC 2VVDA 3ZN6A 3IMMA 1DP0A 1PVC1 2A1XA 4COYA 1H8VA 4LIVA 1VBD1 4PBPA 4YW7A 2QDNA 1W9WA 4D69A 5DXDA 1W04A 1D4M2 1KITA 1UOGA 4FXGB 3VBOA 4AZZA 4EN6B 4K3UA 4C1WA 1BLZA 3VHOA 2IXJA 5L7OC 1MS5A 1OVSA 2VG9A 1UXZA 3HJRA 3N7JA 3VZOA 5KHHA 4IL7A 3WG1A 3V0BB 1ZRDA 4BE3A 5A1FA 5ISLA 1EAH2 4M4PA 1HB2A 1NA1B 2YBKA 1JN2P 1W90A 4MLOA 3BKZA 3EO6A 2VCCA 3KVBA 1AL21 4L2NA 1N1VA 2D6KA 5A33A 3GHNA 4ASLA 4Q4Y3 3WG3A 5L7OA 4AI1A 1I5PA 3D6EA 4CCKA 3VKOA 4GQ7A 3LOBA 2JDAA 4U2AA 1XNCA 2Y38A 5K0UA 1V6KA 1MEC1 5FP8A 4DEQA 5IVFA 4B4PA 2WWSA 3WP4A 5G05L 4CDWB 2P6CA 1Z7S2 4COUA 5FY8A 4JGZA 4L92A 1W6MA 3M70A 5LA0A 2A7AA 5C33A 5FXWA 3ZDSA 2RS51 3MV01 2IFRA 4IGOA 3ON7A 5CKQA 3RJRA 2A71A 3U1XA 4W6XA 1DQ5A 4QD2A 1CN1A 5I8TA 4L99A 4AG4A 2WZR2 5T55A 3GBWA 2FDFA 2IVIB 2RDQA 4UAPA 3VBUA 2VMDA 2VM9A 3VBFC 1VBE3 5DAPA 5EXOA 4IV3A 5LK5A 2GN3A 3RMXA 3ZFFC 4QGNA 4DPNA 2XKOA 1JZ5A 1K42A 3TOJA 4Q0VA 1PMIA 1UL9A 2VUAA 2YC0A 3RMYA 4FPGA 4A3ZA 4CXYA 3N36A 3OUIA 1C28A 5A70A 3TWIA 1W8ZA 3AM2A 5F9TA 4RR3A 3ZXFA 3IB3A 3IZOA 3Q9OA 2QQIA 3CL1A 3WEZA 5KC5A 1UPIA 5DDJ3 2ZGNA 3OGRA 5GKAC 4LQRA 2C4XA 1T6GC 4WM8A 1ZRFA 2OX0A 3GCWA 1W8NA 4KG8A 1WW6A 4JGYA 2EAKA 2WNUA 2JICA 5AVPA 2R32A 3ZFEB 4H55A 1XE0A 1K5MB 1MVEA 1J3RA 4ATEA 1LB2A 5EJZB 5FZ8A 1RUJ2 1RUJ1 3M2MA 3C7EA 2RDRA 2IXLA 2WA4A 2ZX2A 4R4XA 4BQ5A 2XG3A 1VBB2 4QQHA 1DQ6A 4OI2A 3VBSC 1V6MA 4ZKTB 1RUD2 3MHZA 2AH2A 1ODNA 5E1RA 1J84A 3PUHA 3KF5A 3VHRA 2B8MA 1ND2B 1GUIA 2VOKA 3WNNA 3T2PA 3TB0A 4OULA 4DRVA 5FZLA 4Q29A 4MHUA 2BPA2 1QQP3 2W9XA 2GC1A 5FZIA 3H42B 3P1IA 2BVBA 3S57A 1NLSA 2D97A 1BBT3 4PT6A 3IM0A 1U5IA 2VNRA 5FZOB 2WLQA 2EICA 1AZDA 2DCYA 3HOBA 1JOBA 2AC1A 2W39A 3OYWB 1D7PM 1OLRA 4P5HA 3WQ7A 5AC93 1GYKA 1BXHA 5BNOC 1K5JA 3L9JT 3O5SA 2VBPA 4JC1A 5B4NA 4HKLA 5FMOL 4PIZA 2E32A 2XJRA 2VMFA 3SQOA 5DAXA 1BMV2 2K9ZA 4FFHA 2W5FA 4OUSA 1MZ5A 3DKQA 2E7TA 4ITCA 1ND2A 3HD8B 4FTEA 1C5HA 1KDMA 2W95A 3FLTA 3SKVA 4FOYA 4MGZE 4QQPA 4IW3A 2ZEWA 2ATFA 3U11A 4LA2A 4CEWC 1GP5A 1O5LA 3FC0A 3ZFGA 2XBO3 2ZGSA 1YJKA 3OGVA 1XXNA 2ARCA 2VMEA 1ZM1A 2BNOA 2R16A 4KBZA 2BP6A 5KHJA 1UW8A 1NG0A 2RVAA 4H7LA 5EPAA 3T1LA 1JYVA 1CAVA 1EUTA 3NV4A 3PVNA 2CGOA 5FWJA 2VBBA 1RC6A 3FHAA 4LBJA 4N7IA 4CU8A 1W9FA 3NNFA 5C8WA 1Q3EA 1WZXA 2LS6A 1VP6A 2RS13 2ZS6B 5FYUA 5J1XA 4IEUA 2GNMA 2VMGA 4YVSC 5A7WB 3WINE 2EIGA 3WF2A 2YDEA 3KCYA 1IS6A 5JI7A 4DXSA 3RJ2X 4BJ0A 4NUBA 4OHXA 2OPKA 1C8NA 2QQKA 3PL0A 4W6YA 1XNTA 1TNRA 1Y7BA 5CFDA 3ACLA 3LA2A 1GNYA 4Q4X2 4Q4X1 4XJ9A 1NCQC 3CJIC 4TLGA 2ILMA 1NZCA 1PO21 2XJPA 2G9GA 1O4TA 3AK0A 3WG4A 2DURA 4AEJA 1EP0A 2J1TA 2WO2A 1KGYA 2VOVA 2JG8C 4V1PA 4X6RB 1QXRA 2F17A 3IWZA 3BU7A 1LECA 1EAH3 1UYXA 5FK7A 3EYPA 4A41A 1TME1 1GZCA 1O59A 2WNVB 1QOOA 1RUI1 3LSDA 4CUCA 1DGWX 2Y0IA 4XC9A 4XQDA 2FDKA 1WCSA 1LHWA 2E33A 2E7QA 3WUCA 1DZTA 1S2EA 5BXXA 1SHWB 1LULA 3Q8AA 3MICA 2Q1ZB 2Q1FA 3AB0A 3ZMNA 1BJQA 1GSLA 2RS32 1PGW2 4NPRA 2V09A 1SLAA 4Q5OA 1KFUL 4JRAA 2DFCA 1SMVA 2UWAA 4NJ4A 5T50A 1RJ8A 1ZA7A 3K4ZA 2EA7A 2WNVC 3WF1A 3BUCA 5LW9A 4QPYA 3CF6E 2HWC1 4JDMA 4LKSA 5LBFA 5FWEA 4MZUA 4ZY9A 4PQQA 2GC3A 4N53A 2C26A 1TG7A 1V6IA 3AJYA 4QM9A 1G7YA 4QXHA 3SKJE 4KNCA 1YFWA 2WNEA 3GZEA 2WZR3 4YRDA 4WV8A 4DO0A 1W6QA 4A2UA 1MQTB 2BUKA 1FMD1 2WS93 1OD5A 2QFEA 1G6NA 1ZBE3 4QAWA 1Q8OA 4XJZA 2RDSA 5SV5A 1OF4A 4AEKA 1MACA 4QB1A 3GNEA 2XMLA 4Y1YA 5A32B 1RUG2 1OBNA 1CJPA 1GR3A 1EPZA 1Q8VA 2C24A 4NROA 1ZRIA 1MPXA 1POV1 3WHTA 1HN0A 4AQTA 5JOYA 2LM3A 1PNFA 3OGSA 5JWPA 4PDWC 3O7OA 2CYFA 4GMP0 4GKXA 3O14A 3NAPC 5FMBA 2A6VA 3CO2A 3BTXA 1LU1A 3VHPA 3CZUA 1K5MC 1GMMA 2B39A 2RG4A 4QPIC 3NW4A 3LQCA 4XIOA 5A7SA 1I5ZA 5FYTA 5A6YA 3AZVA 4SBVA 2NN8A 3IDEA 3ZFFB 1WUVA 1GU3A 3W5MA 3VBFB 4IUGA 1GZWB 4XBNA 1F5FA 4P08A 4WM7B 5FP3A 4E4SA 4NWVA 2JG9A 2ZX0A 4UXAA 3I2HA 4B7EA 1J3QA 3KV6A 5DDJ2 4AE2A 2XKPA 1OPMA 3SCGA 3T0BA 4BM8A 2IWGB 2JE7A 2P37A 3OYWA 5CB7A 4FP2A 4XHXA 2RS53 1CVNA 1WLDA 4CYDA 2XXZA 1VR3A 3LSEA 1CJDA 2YBPA 3UL2A 2EVXA 3LE0A 1R1ZA 2E7AA 4JGZC 1UY0A 5GZCA 5JOZA 2W46A 4FO9A 3AP4A 4IEVA 4K6BA 4BK5A 3JBG2 4KU7A 1US2A 4DUWA 2CDPA 4GWMA 2Y8KA 4XZPA 3QBQA 4LO7A 5JSPA 4JGYC 3VZJA 4BWOA 2VCBA 2WQZC 4W50A 3EHKA 1NA1C 2BERA 2XDVA 1GZWA 2WUHA 3VBFA 5FOJB 3GF6A 1ENSA 1IG0A 1L7QA 3LA3A 4LO6B 4ISQA 4Z8BA 2BQPA 2LW8A 1OA4A 2IXCA 2P2KA 2HBTA 4QGLA 1IS5A 1AJKA 3VD3A 1ULCA 2DTYA 1POV3 3C7OA 2VULA 3VZKA 3KCCA 1ZBA3 4QHBA 4J6GA 3SLIA 5F3CA 5IVEA 3U0ZA 2H0BA 1SDWA 2GDFA 5FCCA 1AR61 3GZUC 4YGDA 2ET1A 4UI9L 1Z7S1 5T52A 3WCSA 1WA4A 3IT8A 1JYWA 4YG3A 3HEIA 1ASJ2 3JD72 3H1WA 3KGLA 5FZ0A 3ZXGA 3LEIA 2Y6JA 2OT7A 4IE5A 3KSCA 1JU3A 1W03A 1QH7A 3I4IA 4HLTA 1JHNA 3VN4A 1MS9A 2JDYA 5FZCA 4CP9B 1LAJA 1H8TA 1UYPA 4BK4A 3IDBB 1EUUA 1UXXX 2LALA 5L9RA 1PIV2 1OQDA 4FPOB 1POV0 2PELA 4JQTA 1V6NA 1S0FA 2JX9A 2NM1A 3NAPA 1ZZ7A 2WNVA 1I3HA 2FCVA 2X5IB 4XOGA 3M7AA 3LFMA 5APAA 1XNBA 4FAGA 1MVQA 3WY6A 5A7NA 3FE5A 1S2KA 3PJYA 1RGSA 4HKOA 1NOVA 4CCEA 1S0IA 2HEWF 2JENA 5FUIA 5EIYB 4RHV1 4XAAA 1H4GA 2VOWA 3FLPA 2WKKA 3MI8A 1B35A 2XWJB 1N3QA 5CFDB 1RXGA 2WSUA 2VTXJ 4LKDA 1YC61 1U5XA 2QQWA 4Y1ZA 2YU2A 1VAKA 4NN0A 4FQZA 1QXJA 4XAEA 1O4ZA 3OF1A 2JD4A 1Q8QA 4WVMA 3VZLA 4ZZ8A 4I0BA 5CFCA 2MNGA 1MR5A 3H3UA 1H2LA 3AL6A 2HWB1 5DABA 4AFCA 2MEV3 3O1RA 4V2WA 2P6HA 2JKBA 1S0JA 4KWKA 4G3YC 1YRZA 3JXSA 2DDUA 5GZFA 1NCQB 3CJIB 4H14A 2G4IA 4XIKA 3ST7A 3TEYA 4EN9B 4R4ZA 4UOJA 4BLIA 2RE9A 1ZREA 2PLV2 4JRLA 1H1AA 5FZ3A 1AX2A 5CIRA 2EIEA 2OUHA 3C3VA 2F4LA 5FY9A 2B4KA 5LK7B 1I1EA 1H4HA 4GWNA 4OCTA 2IXHA 4N9IA 5I0RA 1Y4WA 1J1TA 4ONUA 1UWWA 4QHZA 4CCLA 1REFA 5F1RA 1MS0A 4RS5A 4KG0A 1LR5A 4UF0B 3VGIA 2Z69A 3AMPA 3NV2A 3O0WA 1QOTA 1N47A 1KQRA 5FYCA 3VL9A 3RZJA 4IV1A 3M1HA 5H9SA 4IE4A 3NWKA 5BUVA 1H6YA 4ZPIA 3I54A 2JDKA
chains in the Genus database with same CATH topology
2BEOA 3MIGA 3ZYGA 3DPRA 1H30A 2VQ0A 3NV1A 3OY8A 4Z07A 4YM2A 1ULDA 1UU4A 3LA7A 3MIFA 4P9IA 5F6LB 1ZBE2 1QY4A 1UU5A 3ILRA 1TMF1 2WT1A 5BV6A 4CZSA 3MFCA 4E2SA 5I91A 1F2NA 5J09A 1YFUA 2B46X 4YM0A 5FMOS 2FQPA 2ZHKA 3SXWA 4S2GA 2B5HA 1KS5A 4HKWA 4FOQA 3DF0A 5BNOA 1WBFA 4MGIE 4XXAA 5IK5A 4AW7A 1DHKB 5H9QA 5JAXA 4XF3A 1EY2A 4CDQA 1AYM3 2DF7A 1PVXA 4YZ2A 5J96B 4I02A 3WV6A 4GMP1 5JZGB 1RIRA 4FPYA 1LESA 4ZU7A 4LBMA 2A6XA 5ACA3 3UKVA 1GQHA 5C9AA 1MQTA 5J36A 1RUF2 1HRV1 2K0GA 4WVZA 1D0HA 1RUNA 4QPIA 3AYCA 1OHFA 4Q4V2 4C90A 3SHRA 1FI2A 3FBYA 3SNMA 1Q8PA 3SCFA 4CDXC 5BNNC 3ECQA 3G6JB 4K1YA 1WD4A 1O4YA 2R072 1XE7A 2JECA 1PO12 2HWD2 4Q0PA 4IEYA 2TEPA 4YVSB 1REDA 5I93A 4C0HA 4RD7A 4RR3B 3JZVA 2VU9A 2NMOA 2QZ2A 1AF9A 4JGZB 5EFUA 4BZ4A 1NXMA 1LHOA 3J4UH 3J8F1 4MGKE 3RNSA 1X82A 3BALA 3VBUB 1JUHA 1OPOA 2AYHA 2X5IC 3ALQA 3FWEA 2KXLA 5A3MA 5AFEA 2O8OA 3PHMA 1Z0HA 4XBQA 4IV1C 2PHWA 4TLFA 3WP3A 2CWMA 4CRQA 3QCWA 4I3GA 5HCBA 2ZAAA 3HQXA 5GLTA 4R8HA 2WS92 2CGNA 3S6PA 2PYTA 2FZ2A 4X8NA 4L8QA 3AKSA 1CPNA 5KWRA 2ZX3A 3KB5A 1TME2 1I9RA 1X8MA 3HIFA 4IEQA 1QJZA 1V9U2 4YM3A 5JLVA 3AZYA 2NMNA 5DZGA 5JVVA 1LOFC 1GANA 3AZXA 2BNNA 4ES8A 2CNAA 1IKPA 1XNKA 1R091 4HVQA 3MDPA 1ZBA1 1I6XA 4IESA 4LBQD 3N7KA 1H1MA 3ZFEC 4AGRA 4ASMB 1LOCA 3KS7A 3AP5A 4DXZA 2WJSA 5JZGC 3VKMA 2R043 2C9AA 1XQNA 1YI9A 3A0KA 1ZBE1 1UD1A 3VHNA 1YIPA 3JCIA 4DMIA 1FMD3 4LBKA 2EXIA 2CAVA 5JMCA 4QPGC 4FQ4A 3WQ0A 3FBMA 1Q8SA 1S0BA 3LAGA 2RS52 3ZX7A 3U4XA 2HWF1 2JG8B 3J9SA 2PLV3 4AVAA 3ZYIB 1DFQA 3V0AB 1BQPA 3MYXA 2D6LX 2DCKA 2RJLA 4HBNA 2PHFA 1VBC1 3QLQA 1HKDA 1ZRRA 3NL1A 3KLSA 4RQPA 5KHKA 1RITA 2XH6A 3HT2A 1S0GA 2YUEA 3SISA 4ZU4A 3AMHA 2B42B 2XHKA 3TNPB 1TQ5A 3ZFFA 3S30A 2YGLA 3B69A 4XMAA 2FMYA 1Q43A 1A8DA 1WW5A 4AQSA 3W58A 1HLCA 3K51A 3PNAA 4BIFA 1OA3A 4H7MA 4DQAA 4XXPA 3ZYRA 1ZA4A 1IZ3A 1G9CA 5L19A 3GHMA 3IIAA 1ENQA 2IZWA 4AI0A 1ENXA 2GH8A 3W59A 3DN7A 3D4KA 3E5QA 4EWEA 4YVWA 1CPMA 3AKTA 2D93A 1V9U1 1W6QB 2KA3A 4AVCA 4WM7A 1BEV2 5ACA2 5JSOA 1DIWA 3IDCB 1DGLA 1R1A2 4XTPA 1JUIA 2VH9A 2D3SA 3H50A 1JYCA 4L9BA 2UYBA 2R30A 2R49A 4UBGA 3T2TA 1RUG3 2BVVA 5DUVA 2Q8OA 4Y24A 1W6MB 1UAIA 4MXVA 3B3QE 2E9QA 4D3WA 2W0XA 4KWJA 2PHRA 4QPIB 3U07A 3WG2A 1TMF3 5CU1A 3H1MA 2Q4SA 3DUIA 4QU2A 1LGCA 2MPFA 5KXEA 1L3JA 2EALA 4WM8C 3WXPA 3KZ4C 3H8UA 2RR11 4E2QA 1LCLA 3ZXEA 3B7MA 1FOD3 1IGOA 2EAAA 2XL7A 3FX3A 2PAEA 3D0SA 3MIBA 3I7DA 4AFMA 3WQ1A 4CDXB 3J26N 5EV7A 5FPZA 1DGWA 3VV1A 2DU1A 4F3JA 4UW3A 5AVAA 4AFAA 4BMBA 2CWSA 4K20A 1ZZ9A 1PGL1 2G9FA 1O3QA 4EJRA 2WIIB 3MPBA 4QPGA 1N1TA 4YW4A 1COV3 1SFYA 1UIKA 4P9JA 4XFCA 1CAXA 1M06G 3IPVB 3KD4A 4DNYA 3JUUA 3RWNA 4O9EA 1AXKA 1Q5OA 4YVSA 1VB2A 3DV8A 4PDWA 4LBLA 1MS1A 1N1YA 5FO9B 4HN0A 1QNWA 1VBC3 2GZWA 2D6MA 4NHMA 3OPZA 1EV11 1DG6A 1QJX1 1AYN1 2YV8A 4NHKA 4AGVA 1VBE2 1IQAA 1DQ4A 1AL23 3B9IA 3FJSA 4Q4Y2 4N9HA 3ATGA 2ZPXA 1SLCA 4QPGB 3BIWE 3N35A 2VY0A 4B3NA 3DL3A 4GALA 1ALYA 1FT9A 2GNDA 3LGRA 2PN5A 4U36A 3TNQA 3RZZA 1SCSA 2IXIA 3L2YA 4XHBA 4LT5A 3ZIWA 1YYNA 1JBCA 2WZR1 1PHMA 1B35C 2D7FA 3E6BA 4F8AA 1FMD2 3ES4A 4I2OA 1ND3C 1RUE2 1AHSA 1LEDA 4AF9A 2GN7A 1G9DA 3AYDA 4XQWA 1ENRA 3UK9A 2ZGRA 4YLZA 2A3YA 3WLUA 1NCRA 2H6CA 1G9BA 4MVTA 1NQDA 3I8TA 1RUH2 1VRH3 1IKQA 1ZZBA 1SEFA 1MZFA 4ISRA 5DUUA 5F6KA 1FPN1 2D98A 2I74A 4XJUA 2VGDA 2NYYA 1AYM1 2D43A 1DZQA 2ZACA 5C4WA 1EAH1 1UZYA 2BTVC 1WMDA 2W52A 1S0DA 3VBUC 5SV8A 3AZZA 4URTA 1VAVA 1RHI2 4H3WA 3URFA 1SLLA 1D4M1 3WX5A 1RMU1 2X53S 3NO8A 5I0UA 1S55A 5D1IA 1U12A 4B7KA 1PZ9A 4QQLA 3WDUA 4BCUA 2ARBA 4Q4W3 4FPCA 2A73B 1BBT2 1HXS1 1O3TA 3AP7A 3PJQA 1FNZA 2DCZA 3FMGA 1WW4A 4PLNA 2XBO2 4RHV2 2ZBJA 1Z7S3 5ABJA 1ULGA 2ZZJA 4WZFA 3UKNA 5ABJB 4INDA 4LBQB 2RJKA 4R9DA 5CVRA 1WLWA 3AJZA 5DG1A 1LOEA 2ENRA 2IXKA 1JXNA 4OFGA 5D8AC 4PF5A 1UU6A 3FFQA 3R05A 4HANA 3TBDA 3MEPA 4FPHA 1S0EA 2D6NA 2R061 4FPJA 4FSJA 4CP1A 4Y5Z0 2QKDA 4PLMA 4RSUA 3ZYPA 3I59A 2ZGTA 1FV2A 4HETA 1JOJA 1NA1A 3DKWA 3KQRA 2B7YA 4D7SA 3ZXJA 3AKPA 3IMNA 3UJQA 1AX1A 4X6QB 2KM2A 1XE8A 1CAWA 2LTNA 2QDRA 4DS0A 1PO11 2JE9A 4GH4A 4CDUC 4HK8A 2VNOA 4CP2A 2A6YA 3M3OA 3X29B 1V00A 1G8WA 1GKBA 1VBB3 2UY8A 4I0WB 4Y4YA 5T5PA 2ES3A 2DCJA 2ET7A 2W68A 2RS33 1SBFA 1HXS3 4BOWA 4KGQA 3THTA 4Q4V3 3RSJA 2UURA 4NHLA 3H0OA 3ILNA 3AXDA 2TNFA 3OBRA 4ATFA 2DTWA 2E53A 1YFYA 1U0AA 5KHIA 1A3KA 2ZMLA 3HAGA 4YZ1A 1DGRA 4KWLA 4AQ2A 4E9KA 1KFXL 4AEDB 1ZX5A 2VMHA 2QZ3A 3B9CA 5A32B 4Y1XA 2R1DA 3MW4A 5HBAA 1RMU2 4CDUA 4RL7A 4Y20A 2PHXA 1OFSA 1OI6A 1O91A 3ZPYA 4I01A 5AFBA 4SLIA 5K9YA 3THPA 4N43C 3RDIA 1DQ0A 1RUH1 1CAXB 1XYNA 4S2FA 1ND3B 2BFUL 1BEV3 2QVSB 2Z42A 4P9XA 3SH5A 4DZGA 1KJLA 4YZ5A 4YW2A 1APNA 1AR73 1CESA 3H7YA 3RQ0A 2AR6A 4AWDA 4NVPA 2XVKA 5BNPB 1JH5A 4XFBA 2HWF2 3QACA 1PNGA 4R52A 1PK6B 2R062 5EJ3A 2HWC2 2ZJCA 4XPVA 1VRH2 3L2HA 5FO8B 1SACA 2YGMA 3OGJA 4Q8LA 5JPNB 4RR3C 2DVFA 4B4RA 5FTTC 5KBFA 1QU0A 3UJOA 1YHFA 1H8TC 2R042 2XLFA 4MSVA 1PK6C 2HWE1 3K48A 4JCKA 1AJOA 1Y43B 1OQ1A 5L36A 3BCWA 2XGXA 2HWB3 4JAAA 1ZBA2 4IQPA 3RRDA 3WDXA 3VL8A 4N53B 2EXJA 5FQ0B 4AXOA 2PTMA 2CY6A 1BK1A 4YVWC 1SBEA 4XF9A 4HL0A 1ASJ3 3AYAA 3JD73 4Q26A 1RHI1 2D44A 3KT7A 4QX5A 4XBLA 4E27A 1ZNPA 3O0VA 1RINA 1IPJA 1J1LA 1AL0G 2ZABA 1BVP1 2DCTA 5JOXA 1YWKA 2RM22 2BYVE 1COV2 2HWE2 5LRRA 1SLIA 5J3UA 3B02A 4YVWB 4MYEA 2PAMA 3M3IA 4OHZA 3N4MA 3HR9A 1BZWA 3FFZA 2Y0OA 3B01A 1DGRN 2XJUA 2ERFA 1AR63 1VRH1 4HFSA 3TN91 4OHYA 1X8EA 3NSTA 2ZKLA 1LTEA 1FAYA 4YSFA 3ZSLA 4XQ4A 3PMEA 4CEYB 4Q2FA 4PIYA 4GB33 3J8F3 4BH9A 1NE6A 4NO4A 4GIQA 3M3QA 2VNGA 1QDOA 4K21A 4XDQA 4YW5A 5GLUA 1ZYBA 1NY71 2DUQA 2MEV2 4P9WA 3VBRA 3M3EA 1PGSA 4E2GA 4RQPB 4JTNA 2WINB 4XW3A 1TNFA 1J58A 1OA2A 4BMEA 1WD3A 1AYN3 1YLLA 3H9AA 1KDKA 2XB6C 4LE3A 3CU7A 1GLHA 5GM0A 1OSGA 3QH6A 3JBG3 1RTVA 1HRV3 3USSA 4XFHA 2ZGMA 1QNYA 3KM5A 4IEXA 5E16A 1RVF1 4F83A 3KMHA 2HKXA 5EWSA 3AX4A 4BIOA 1OFNA 1RUD1 3MLKA 4N7UA 4Y22A 2R0HA 3G7DA 4G9SB 4XTMA 4K7JA 1WCKA 4M01A 1LHNA 4PQ9A 3D8CA 2FMDA 1HDKA 4KU8A 3MZHA 4Q0UA 4FPFA 3VBRC 4P9GA 5DG2A 3ILFA 1YJLA 4LBNA 4IERA 2LUWA 2HEVF 1RVF3 1GNZA 4DINB 4CTEA 3SH3A 4EN8B 4LEJA 1A6CA 1B35B 2QQPA 4CDXA 4LULA 3RPQA 1F5JA 2X8KA 4XE9A 3KCXA 2P3JA 5BNPC 4YG6A 2NPIA 2WT0A 1RB8G 2YMZA 5A3LA 1CD3G 1N3PA 3OBTA 4QQOA 5H9PA 1H2KA 4Y22B 3EXUA 2ZKNA 2VMIA 2AENA 3SCHA 1LRHA 4PJYA 2ZGOA 1AR72 1AL22 1PGW1 2RS31 3BTAA 3B5LB 5CAZA 1COV1 3VKLA 1RJ7A 2XJSA 5FAXA 3B93A 4IEPA 5JIUA 1REEA 3S7EA 3LZZA 2ZA9A 4HK9A 5LEJA 4R9BA 1RUI2 4RFT0 4EROA 2R073 1IPKA 4YM1A 2ZTNA 2WFF1 1IOAA 2DVBA 1YUDA 4LLOA 2HWB2 1S2BA 5LEKA 2R6QA 4WM7C 4OHWA 4LHLA 4Y26A 1W0OA 1HRI3 1VBD2 2NLRA 2BWCA 5E88A 4LUKA 1FYUA 4KH9A 1F8VA 1A8MA 2R0FA 3VLBB 4META 4AEMA 3PVOA 4LE4A 1YXWA 1VBA2 2JXAA 4AGGA 2RR13 3VBSA 4GH4C 5KC6A 4Y20B 5J98B 4CEYA 2PFWA 2XJVA 1C8M2 1IS4A 1QQP1 1BVVA 3B94A 3WP6A 4CEWA 2HYKA 2HWD3 5F5QA 3ZYJB 3GZAA 3WD5A 4UW5A 1YFXA 4AQ6A 4CDQB 3V0AA 2JEMA 4LLFA 1Q56A 1RUH3 1VB4A 4XFAA 2RM23 4B4QA 3MFAA 4JDOA 5FPXA 3MW2A 5T5LA 4YFWA 4WZCA 5C8CA 1FV3A 2XL9A 3INAA 4AK3A 1CAUB 3AKRA 3J8F2 1SLBA 3TRSB 3JB8A 1AR62 1LU2A 1V6LA 4R9CA 2A70A 4FOWA 4M00A 4UW6A 1S0CA 1QHDA 2VW0A 2Q0AA 2ETEA 1XU1A 4B29A 1KJRA 1XRUA 4DRRA 1G9FA 2DFBA 4OVEA 4PBOA 3AP6A 3NVCA 5FQ0A 4GB32 5JIAA 1UF2C 2H6BA 3M3CA 4J1WA 5IK4A 3ZXLA 1QH6A 2VOXA 4A3XA 2RS11 1V9U3 4P9LA 4P14A 1CR7A 3SMHA 2DVGA 3WW3A 4AYUA 3BODA 4M3CA 1OKQA 1PIV3 4DOUA 2RHPA 3ZVXA 1HRV2 1R092 4XF1A 3WDYA 4Q4X3 2OZJA 1AYN2 3I59B 1JW6A 1KRIA 4QT6A 2XWBB 1LOAA 2D3RA 4YZ3A 5CFDC 1AR93 1LHUA 2PQQA 1OOPB 2VPVA 2OW4A 4AVTA 1J3PA 5CA6A 1RUC1 1CQ9A 3BOPA 4LNVA 3FHIB 4XF4A 3TYJA 4DB5A 2SLIA 4WVMB 5JDBA 4Q1PA 4OLLA 2I2SA 1MS8A 4GULA 4Z82A 4IEOA 4HT1T 2V5YA 3R4SA 3IN9A 4ZU5A 1FX5A 1WMFA 5AC91 1WW7A 3MF9A 4A7ZA 1URXA 5FLJA 3SH4A 2JDZA 4E4DX 4AHXA 4FP3A 2E6VA 1QMJA 4X8PA 5JSRA 4HPKB 1O5UA 4AVSA 1NE4A 1O3RA 3VZMA 2C0ZA 2X5IA 2AUYA 3WDWA 3AFKA 2Z5WA 1ND2C 5C8CC 1WBLA 2CL2A 4EWDA 4AEDA 3FZ3A 3U10A 1UIJA 3D82A 2GMEA 2HWE3 1AUYA 3R4UA 2YXSA 4L97A 2DU0A 3LB9A 4FVVA 1ULEA 2Z2SB 1U5ZA 2GNTA 3E97A 4LHNA 3IKWA 1LOFA 2EXKA 4GA9A 4XILA 2GMMA 4YFZA 3ZFGB 1GQGA 3AP9A 5JI9A 1X36A 2DWRA 2ZHMA 1RUOA 3RYRA 3NKTA 3OCPA 3R4DB 2RM21 4K8FA 5C9AB 1DF0A 5TSWA 2A6ZA 1ZZ8A 1AXZA 4AI3A 2GSYA 4RQPC 4OI0A 1UPSA 1GFF2 1PVC3 2WC2A 5ACA1 1BEV1 4IEWA 5JCTA 3QOPA 5K0UC 5CG9A 4HN1A 5GZGA 1VBA1 1LODA 1J59A 4TWTA 2PHDA 1KD7A 4I30A 4IXLA 1FXZA 3TN93 1VLNA 1CAWB 3V65A 3BOWA 4CEYC 2JG9C 4AHWA 2UWBA 2RS12 1D4VB 1AYM2 4KBBA 4OI1A 2SBAA 1RUJ3 4K40A 3VKNA 1W6OA 2JJ6A 1TMF2 2GMPA 3V56A 2FZ1A 4R9AA 1MS4A 2R041 5GLVA 3WHUA 4E4ZA 1AVBA 3AFGA 2ZGUA 5BYNA 5HCAA 4RS5C 2A75A 1DYKA 1OLQA 1RUF3 1C3HA 4LA3A 2ZHNA 4TYSA 2RMU3 1PIV1 5I0TA 4HVRA 1AR71 3LCPA 1IS3A 5EYXA 3H7JA 4LR4A 1Z78A 3HBZA 3N7MA 1VBC2 4HZFA 2DV9A 5E8AA 4RS5B 2WL1A 1QF3A 2D6PA 2Q1MA 4OZXA 4EWAA 1FPN3 3ZN4A 4LTAA 1V6JA 3M8LA 4JVAA 4AI2A 5CFCB 1BMV1 1W6NA 2K2SA 1GZ9A 1OOPC 2GALA 2Q30A 3MIHA 1SLTA 5BY5A 4D7TA 3PLQA 3JQXA 4XFGA 4HSJA 1PK6A 4GXLA 1QQP2 1C8M1 4LO5B 4YGCA 1F9KA 2GC2A 1R081 2GU9A 1D2SA 4A7KA 2H0VA 4YZ4A 2ZAHA 2AZ5A 3GBFA 1DYPA 1R093 5C4WB 2UU8A 4Q8KA 1EV12 1QJX2 2XPJA 5E89A 4M3CB 3AYEA 1B09A 2WFPA 1ND3A 1H2NA 2D40A 3QH7A 4AFDA 3S7IA 2YHJA 3ZN6B 1HX6A 1H8TB 2VXRA 1X7NA 1W6PB 4Q1RA 3VDDC 3RYPA 2A3WA 2F6BA 2XJTA 3MIDA 2BFUS 5DDJ1 4EV0A 1NQJA 2VUJA 3APBA 1JYIA 4CDUB 1Y3TA 2CTVA 1NYWA 3NAPB 1WLCA 5H9RA 4QMAA 3MIEA 4COZA 1CONA 2A3XA 4CP0A 4Q0SA 3V0BA 2BGCA 1XYPA 3ZFGC 3POWA 4PCRA 2OZ6A 4WVWA 5C8CB 2ZGQA 3N3HA 2OA2A 2F4PA 4YYOA 2I07B 3ES1A 2QJVA 2NQYA 4FTSA 4XF0A 2HJIA 1VBA3 3RS6A 1H2MA 1ZZ6A 4YG0A 3RI8A 4L11A 1N3OA 2QE3A 3B00A 5DUWA 2NZ9A 2Z79A 4FBFA 2ZMKA 4BYYA 3WNXA 4WVVA 3D0JA 3SITA 5J48A 5KHGA 2HWD1 2CAUA 4LO4B 1DQ1A 3VDDA 3GALA 3BPZA 3WP5A 3E5UA 5D8AA 3IPVA 2B9UA 5BNOB 1DDLA 3JBG1 1H9WA 3ZXKA 1QJY1 5T5OA 1HW5A 4Q4W2 1RUF1 5EYYA 1C1LA 2VW1A 3HT1A 3E5XA 2X29A 3RI9A 1RUC2 1W2UA 3A4UA 4MXWA 4JDNA 4RA0A 4DY5A 4N43B 4TSVA 5IUQA 4BA6A 5HI0A 3WUDA 2UYAA 2ZGKA 3CLPA 4OUMA 3OY8B 2AGSA 4P9YA 3VKFC 4ZXKA 3TAYA 1PVC2 3ZN5A 3EJKA 1W39A 3OTFA 1LHVA 4ES9A 4LBQA 3RG0A 5K7PA 1OQEA 1MQTC 2ZCWA 4HPKA 5BNQA 1ZRCA 1R082 3WDTA 2WFF2 3VBHA 3S0MA 3WT3A 1FOD1 1PO23 1G9AA 1CIWA 1HV1A