3BIWE

Crystal structure of the neuroligin-1/neurexin-1beta synaptic adhesion complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
177
structure length
177
Chain Sequence
HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Neuroligin-1 and the Neuroligin-1/Neurexin-1beta Complex Reveal Specific Protein-Protein and Protein-Ca(2+) Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion/cell adhesion
molecule keywords Neuroligin-1
total genus 36
structure length 177
sequence length 177
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3biwE00
4YZ5A 5JOZA 5HCFA 4DFSA 1SLAA 3I4IA 2GNTA 3UJQA 1S0BA 1AJKA 2PHUA 1HQLA 2ZKNA 3R05A 1MS3A 1GZ9A 1ULCA 2ZA9A 1DQ1A 1QNYA 2RHPA 2WT1A 3FBYA 2DWRA 4FOYA 1W0PA 3GALA 4AVVA 1DQ5A 3WG4A 2DVGA 3ASIA 1APNA 3AFKA 4Y24A 2DU0A 4XJWA 2ZGQA 1DZQA 3WUCA 3B01A 1PZ9A 3WG3A 1DQ2A 4XE9A 3UJOA 2I2SA 3OY8B 1KRIA 2NYYA 2UWAA 3M3CA 2V5YA 3TB0A 2JKBA 1AX2A 4Y1XA 3PVOA 4Y1ZA 2TEPA 1LHUA 4PBPA 2UURA 3WCRA 1S0GA 5T5PA 2Z42A 4Y20A 4PQ9A 5H9SA 1WLDA 2D3SA 2ZGNA 4FOVA 3A4UA 3M3QA 4Q27A 2WSVA 1DIWA 1ULDA 3WCSA 5CNAA 1LOEA 5T5JA 4YG6A 4JRAA 4AGGA 4Z8BA 5BYNA 5GZCA 4XJ8A 3AZYA 1WD4A 2PHXA 1QOSA 2UWCA 3WVJA 5HCBA 1SLCA 1YIFA 3SISA 4Q2FA 3C2UA 3O0WA 1NLSA 2R0FA 3U4XA 2A75A 4GKXA 1LOAA 2CNAA 4CTEA 1TEIA 1UKGA 4XHBA 2PELA 4H55A 2YV8A 1GLHA 1MS8A 4FP3A 4P9WA 2DVFA 4CRQA 1BKZA 1ULGA 4FOQA 3AJYA 4DS0A 1V6MA 2EXHA 4XDQA 3OYWA 1G8WA 3ILRA 3T2TA 2LALA 4YGEA 1O4ZA 4F83A 3IM0A 1SCSA 5DUUA 1N1SA 3WV6A 3M2MA 5JOYA 1EPWA 3N35A 3WNXA 4XBLA 1N1VA 1Q8SA 1QMJA 1S0EA 1F9KA 1H30A 1KDKA 1Q8PA 2C9AA 2GNMA 3MW4A 4UW4A 3ZSMA 3O5SA 3SNMA 3AP7A 4YZ2A 1LHOA 2VXRA 5GLZA 4XIOA 2WJSA 3Q9OA 4P9YA 5L73A 5F9TA 1YO8A 4P14A 4YFWA 1UX6A 4FQ4A 1AVBA 2E6VA 1HDKA 1LU1A 2DUQA 2W08A 1W6PA 4WZFA 2LTNA 1S1AA 4YM1A 4Q8KA 2OW4A 3AZZA 4GXLA 4XJZA 1XQNA 4ATEA 5DUWA 2WT0A 1C57A 4LBLA 4LBKA 1W6NB 3FUQA 2AUYA 4ISQA 1WBFA 4Y1YA 3AXEA 1CQ9A 4XJUA 2ARXA 3M3OA 3B00A 4L8QA 1KJRA 1V6JA 1UMZA 2JD4A 1MS1A 4PBOA 1CESA 5IK7A 3ZYRA 1SCRA 1V6IA 2WQZC 1QKQA 2R16A 4K1YA 4XBQA 1QU0A 4BQ1A 3NV2A 1GNZA 2YROA 3T1MA 1DLLA 1QDCA 1UN1A 3PVNA 3JUUA 3WLUA 1IS5A 1FNYA 3TAYA 3AZVA 4GA9A 1HLCA 3AP4A 3LCPA 4M3CE 1IKPA 3A0KA 3NV3A 1RINA 3AP6A 5T5LA 2EXKA 1JHNA 1YRZA 3L2YA 4K20A 4LBNA 4W65A 5DUXA 5GLVA 2GNDA 3O0XA 3BOPA 4XXPA 1JYIA 5T55A 5KXBA 1FATA 1GBGA 5H9RA 1MS5A 4K1ZA 3WHTA 4YGDA 1SBEA 2AR6A 2WKKA 2A6WA 3H0OA 3ZXEA 2P2KA 4YZ1A 5IK5A 2DURA 4YG0A 3AYCA 2DVAA 2NMOA 3IPVA 5JDBA 2AH2A 2A3WA 3MPPG 2ENRA 3JU9A 3UL2A 2D6PA 3APBA 3R4SA 3RMYA 2D6OX 1AF9A 4LBOA 1LODA 5DG2A 4DRVA 4HL0A 1UZZA 5AVAA 1KITA 5KXCA 2PHWA 2DUPA 3WDTA 4RA0A 1LOFA 5GLUA 1WW4A 1O4YA 3IPVB 1V6OA 2R0HA 2A70A 1N3QA 4GKYA 3OY8A 4R9BA 4AVSA 3ZSLA 1GKBA 2ZBJA 4IQPA 1X50A 5EYXA 4UW5A 5JOXA 3FFZA 2WSUA 2D43A 3V65A 1W6MA 4YW1A 3OBRA 2DV9A 3ENRA 4FQZA 3WOGA 1QOTA 3MW2A 1W6MB 1ZM1A 5T52A 4AWDA 1SACA 4SLIA 5LK5A 3ZYPA 1WLWA 2GMPA 2P3JA 5FRAA 3ILNA 1Q8QA 5GLTA 3ZVXA 4FPGA 3O0VA 1AXKA 4M3CB 2CTVA 2ZMLA 1F5FA 1LHNA 1MR5A 4U2AA 4YGBA 5KXEA 2ES3A 4FPHA 1JXNA 1G9BA 1BYHA 4LBMA 3ZPYA 2E7QA 1QF3A 4I30A 4OZXA 4JC1A 4M00A 4UW6A 2ZGMA 3OYWB 1LECA 4M3CF 3R4UA 1NXD1 4ITCA 1BZWA 4TZDA 1V6NA 1LGBA 3V0BA 2KM2A 2NMNA 2ZABA 1C4RA 1W6OA 4M3CA 3D5OA 4NO4A 5DZEA 3HR9A 4FPCA 1VAMA 1JYCA 2ZGLA 5DXDA 5JOWA 1LOBA 4AGVA 1JBCA 3WUDA 1AZDA 2WNEA 1ULEA 4JCKA 3FLTA 2ZHNA 4BPZA 5KXDA 1RITA 5F5QA 3OPZA 1AJOA 2EF6A 5GZGA 1B09A 2ZHLA 5EXOA 3AXDA 2EIGA 1LEDA 1R1ZA 1W6QA 1FYUA 4XZPA 1DYKA 3AYDA 3M3EA 4Q1RA 2PHTA 2JE9A 1IS3A 1A8DA 2R49A 5EWSA 1V6LA 2P37A 4ISRA 2CL2A 3AZWA 3LSDA 5T54A 3VKOA 3N7LA 3MW3A 3QCWA 4XHXA 1DQ0A 1URXA 3RMXA 3V0AA 2CWSA 3AJZA 3BIWE 4Y1UA 1CR7A 4BMEA 2CWMA 4XOGA 2AENA 3A0NA 3SITA 1Q8OA 2W52A 4ZXKA 1C1FA 1LGCA 1KDMA 2ZHMA 1VIWB 1QNWA 1FNZA 2FMDA 4GALA 2ZGRA 4AYUA 3KM5A 1WW6A 1DFQA 2GN7A 3ZXJA 3ZXFA 1G9AA 3VKNA 3NV1A 1CN1A 5EYYA 3D6EA 5DG1A 1YXWA 5JVVA 1QOOA 5JMCA 2YY1A 1LENA 1FAYA 3POYA 4LBQB 2NN8A 5GJ6A 4XMAA 4R9DA 2A71A 2CYFA 4FPLA 3O12A 4Y20B 3RQ0A 3AYEA 2EXJA 3VKLA 3ZSKA 1CJPA 1IOAA 2A7AA 3INAA 4BM8A 3BTAA 4UW3A 2YXSA 1SFYA 1GSLA 3V64A 1QGLA 5DZGA 3OGGA 2A3XA 1DBNA 2E7TA 3N7KA 2P3KA 4FVVA 1H9PA 4YZ3A 1WCSA 1YI7A 4Y1VA 3WDYA 3WDWA 2H0BA 2A6VA 4BLJA 5GM0A 1JOJA 1GYKA 3LSEA 3OBTA 4YW2A 4Q8LA 1DGLA 5CAZA 1GNHA 2ZMKA 5H9PA 2VW2A 3QLQA 2OUHA 1SLTA 2D44A 4M01A 4LBJA 4XTMA 2VW0A 3NWKA 1MVQA 1MACA 1MS4A 1S0DA 4P9XA 1JUIA 1N1YA 4YG3A 1LCLA 2ZHKA 4FPJA 4XYXA 1ENSA 1BXHA 5DZFA 1LU2A 1C1LA 3POWA 1WBLA 2ZGUA 1PZ8A 2D6LX 1ULFA 1DQ4A 1KJLA 2ZACA 4BMBA 1ENQA 5T50A 4CZSA 4XMIA 2SLIA 5CBLA 2A6XA 4FPFA 2OVUA 2ZGPA 1RIRA 2VUAA 3USUB 3W59A 1GICA 2ZAAA 1YYNA 3HN1A 2V73A 2ZGSA 5E89A 2D7FA 1WD3A 1MS9A 3USUA 1N3OA 3FLRA 1I3HA 3RRDA 1CPMA 4C1XA 2D3RA 4BLIA 1LJ7A 1ZA4A 1SLBA 2E51A 4YFZA 2GMEA 3UK9A 1G86A 2XB6C 2DYCA 4YW3A 1AXYA 4PCRA 4TYSA 2AGSA 2GNBA 1A78A 3RSJA 3SH5A 1UPSA 2UWBA 2AYHA 4YM3A 3VUOA 1GZWB 4MYEA 2ERFA 5HCAA 2W39A 4DRRA 1ENRA 1AXZA 3POSA 2DTYA 1A3KA 1OKQA 3AYAA 3PMEA 1CIWA 4Y22B 1F31A 1W6PB 2E53A 2Q5TA 2W68A 4XIKA 5GZFA 1CVNA 3AX4A 3GNEA 3RG0A 5E8AA 3IMNA 1VLNA 1D2SA 2CY6A 4FP2A 4WVVA 5IK4A 1JN2P 5JLVA 1GZWA 2GALA 2VY0A 1W6QB 2NP0A 3RS6A 2GMMA 1LOGA 2DVDA 1MS0A 2OUJA 4C1WA 3ZXKA 1J1TA 1HKDA 3WG1A 3ILFA 1W0OA 3FLPA 1OQ1A 3B9CA 1LGNA 3ATGA 1I1EA 5DUVA 1Q8VA 3OJBA 4WVWA 2VU9A 2EAKA 2P3IA 4AVTA 5GALA 3M1HA 3N3HA 1DHKB 4LBQA 3DUIA 4XJAA 1Z0HA 2C5DA 1N3PA 1AX1A 1UZYA 2G4IA 3N36A 1S0CA 1QDOA 3SLIA 3IKWA 1LESA 3T1LA 1UL9A 2D6MA 3VKMA 1LTEA 3I8TA 3NV4A 1S0FA 2DU1A 1LOCA 4FPKA 1LHVA 4Q1PA 4R9CA 5GZDA 1N1TA 1MVEA 1PZ7A 2ZZJA 4PF5A 2ZGTA 1G9DA 4FPEA 3N7JA 1SLIA 1DQ6A 2AREA 3KQRA 1MZ5A 1SBDA 4ATFA 2SBAA 4XILA 3WDXA 2R1DA 2DVBA 4DQAA 1FV2A 2JDZA 4GWNA 3AP9A 5SV8A 1KQRA 2ARBA 3FUOA 2NM1A 1S0JA 1WLCA 2YMZA 3B3QE 4NOTA 3B69A 4BOWA 1SLLA 4ZKTB 5FREA 4XTPA 2P34A 2GDFA 1V6KA 2D6KA 1IS6A 1G7YA 4GWMA 3IN9A 1LHWA 5H9QA 3SH3A 3BODA 2PHRA 3MEPA 1CPNA 2A6ZA 3VV1A 5GZEA 4YW5A 1Z78A 1BJQA 1G9FA 5CA6A 1WUVA 4LBQD 3WHUA 2EXIA 2D3PA 4FPOB 1LEMA 1VAVA 1GANA 2XG3A 4Q26A 2A6YA 2NZ9A 3SH4A 3AK0A 3N7MA 2EALA 1H9WA 5E88A 4YZ4A 4DPNA 5IUQA 3V0BB 3PJQA 2VW1A 2ZGKA 2BQPA 1W6OB 2B7YA 4XBNA 1LULA 1Q56A 1JW6A 2JECA 4XJ9A 1N47A 1CONA 1BQPA 1VALA 2A5ZA 1V00A 1U0AA 3DGTA 4RL7A 4YGCA 5CB7A 3WDUA 3ZSJA 2PHFA 4K21A 2DUOA 4ASMB 2WLQA 3W58A 3VKFC 5IT6A 1IKQA 3WG2A 3PVEA 4YW4A 5IK8A 1IS4A 4D69A 2HYKA 4HANA 2A3YA 1WW5A 1Y7BA 3AZXA 1D0HA 4FOWA 1LOFC 4U36A 4WV8A 1MZ6A 1W6NA 1GZCA 2DTWA 1UAIA 2JE7A 1ONAA 2ZGOA 2YZ4A 4YM0A 2R1BA 1S0IA 4Y26A 4R9AA 1GV9A 3CNAA 1SBFA 1WW7A 4YLZA 1DYPA 1FV3A 5T5OA 3WDVA 4XXAA 4AGRA 4KBBA 3ZXLA 3HMYA 3V0AB 1FX5A 3D4KA 2FHRA 1AX0A 2GN3A 2WT2A 2D6NA 4YM2A 5GLWA 2UU8A 2ZMNA 4FPYA 3WZ1A 1G9CA 4Y22A 1HQWA 2JJ6A 1OFSA 2VH9A 3AP5A
chains in the Genus database with same CATH superfamily
3IDCB 1BVVA 4XAEA 4YZ5A 1S2KA 3JCIA 5FLHA 2H6BA 4COWA 4HKOA 3WEZA 3I4IA 1C5HA 5AC93 5FMBA 3O1RA 2F17A 1VMFA 3FBYA 3I3EA 2DWRA 2VMDA 1GOGA 3B02A 3GALA 3IIAA 3VGIA 2GH8A 2PAMA 3ASIA 3K3NA 2W3JA 3K48A 4EQVA 4ZU4A 4JRLA 2C6SA 2ZGQA 1POV3 1K5MC 3LGRA 5FZ9A 3ITQA 3UKTA 3WUCA 2ZS6B 4BE3A 3P6BA 1K42A 1T6BX 1QQP3 2WO7A 4LE4A 2I2SA 3EBRA 3RWKX 2JKBA 1FOD3 3RZKA 1YFYA 2Q4SA 1WGPA 4QM8A 2TEPA 4PBPA 2UURA 1ZYBA 1XOYA 1OXCA 4IEVA 3CJIC 1AR63 4E4ZA 1O8PA 1WLDA 2ZGNA 3M3QA 1GQGA 2WSVA 3EXUA 3ZYGA 4LT5A 1LOEA 1FPN3 2ARCA 2WC2A 4JRAA 4LO5B 5BYNA 3AZYA 3WF1A 4PLOA 1YIFA 4MO3M 4IETA 3C2UA 2JDAA 4XDPA 5A3NA 1W90A 3U4XA 4QHOA 3VZOA 1OD3A 4IEZA 1PGW2 2VECA 3CQOA 4WZCA 3FJSA 3KV5A 3OUJA 4H55A 4KWJA 2WLPA 2D93A 4Q4X2 4RQPC 5FO8B 1PX3A 2VE1A 1E5SA 1PK6B 2DVFA 2XR4A 4GWIA 4P9WA 3RZZA 4CRQA 5HV0A 1ND3C 1F35A 4DS0A 1UZVA 2EXHA 2VL4A 2XBO2 4RFT0 4XFHA 3TBDA 1XJAA 1S55A 3F95A 3S57A 4F83A 3ILRA 2LALA 1AYN2 3IM0A 5DUUA 3WV6A 4ZZ5A 1ND2C 4AZZA 3N35A 5DQ0A 3WNXA 4Y5TA 1ASJ1 3ZXGA 3JBG3 5FYIA 1F9KA 2C9AA 2GNMA 3HQUA 1SG3A 3NJXA 2CGOA 3AP7A 2HKXA 5GLZA 4QMAA 2X09A 2HWE2 3Q9OA 4Q4W2 5F9TA 1J3QA 4Q4Y3 4B7EA 5LBCA 5C3QA 1UX6A 1COV1 1RUC2 3IMMA 1LU1A 4WZFA 1XXNA 4JX0A 4YM1A 4O61A 4Q8KA 2XWBB 4IE4A 3EQEA 3LAGA 4PLNA 4GXLA 1O4TA 3I2HA 5I0DA 1VBB3 3WNNA 5L9RA 4QU1A 5DUWA 5K4LA 1B35A 1ND3B 4LBLA 1FPN1 1W6NB 3FUQA 4A41A 1WBFA 5A6ZA 3J4UH 5C8CA 2NPIA 4QHBA 3E97A 3E5QA 4L8QA 1UMZA 2B5HA 3ELNA 4PBOA 5FZOB 3VZKA 3THDA 1QJFA 4AE2A 4IV3B 4AFCA 5KR7A 5A32B 1SCRA 1V6IA 2VNRA 1QKQA 4LORA 1TNRA 4PT6A 1AR92 2QZ2A 2ID4A 3I59B 1CAVA 1PGL2 1WMEA 3H50A 3UGFA 2TUNA 2YROA 5FWJA 2XLAA 5A7WB 5K0UA 3GCXA 1QDCA 1UN1A 3GJBA 3PVNA 3VZLA 3WLUA 1IS5A 4CEWA 4GA9A 3AP4A 2WN3A 4M3CE 1IKPA 4B29A 5T5LA 3ZN6A 2EXKA 3L2YA 1TME3 1I6XA 2ZKLA 2HWF1 4P5YA 4CEYB 5GLVA 1OQDA 3BOPA 4COVA 4KH9A 3MIHA 2LM3A 1JYIA 3ACFA 4FTSA 1FATA 4K1ZA 1SBEA 1X9TA 2ORZA 3SCHA 2RS52 2VUCA 2WS93 4G3YC 4GMP1 2JG8C 2VVEA 2NMOA 5FBZA 4AVCA 4D0QA 3I3QA 2W5FA 4LOSA 2BNOA 4ARYA 2ENRA 2QQPA 3VZJA 2X29A 2AEYA 1VBD2 4OLLA 1AF9A 1PO12 1LODA 1VBB2 1IZ3A 5LCWL 4HL0A 4NE9A 1REEA 5KXCA 1SZBA 3USSA 1QJZA 4NRQA 3WDTA 4RA0A 4AEJA 4Z2AA 1LOFA 4MGYE 5GLUA 1WW4A 4DZGA 5IVJA 4GH4A 1V6OA 1VJ2A 2R0HA 2Y26A 3LB9A 5DPNA 1RUJ3 3OY8A 1TZOA 3ZSLA 4YARA 4AEKA 1UWWA 2WO1A 1AYN3 1X50A 3EMRA 1DCSA 4OVEA 1PK6C 3KQ4B 5FY9A 2WSUA 2G19A 4H2AA 1M4WA 1OURA 1W6MA 4N8MA 4YW1A 1JYXA 5A3TA 5ANNA 4ZZ8A 1C3HA 1BMV1 3MW2A 1W0NA 4R52A 2P1BA 2YC0A 1SACA 1ZBE3 4TWTA 4WBBA 4ZY9A 1YFUA 3VBRB 2GMPA 5F32A 3H3ZA 4KWKA 4AEDC 2VUJA 4CU7A 5KXEA 1NXMA 2ZMLA 1MR5A 1UQXA 4U2AA 1G9BA 3O1TA 2ES3A 4AI3A 4LBMA 3RPQA 1OD5A 2JDUA 3E5UA 4P5HA 1WWYA 3POGA 1RUH2 2ZGMA 4M00A 2E63A 4MGQA 2RE9A 3GZUC 4M3CF 4ITCA 4A3ZA 1BZWA 1V6NA 3NAPB 3WQ7A 4JV4A 3UGGA 2JEMA 2KM2A 2NMNA 2R061 2ZABA 3H8XA 1W6OA 2XQXA 5L7OA 4M3CA 4XFBA 1OT5A 3H1MA 5DZEA 1SMVA 4NO4A 2BW8A 1J1LA 1VAMA 3U14A 5JR2A 4AGVA 4BH9A 1UX7A 3QOPA 4SBVA 2EIEA 3PJYA 3SEPA 3MF9A 1ZZCA 3O1SA 1LB2A 1HX6A 1HN1A 1ODNA 2ET1A 2EF6A 1B09A 2DCJA 4BQWA 3AXDA 4LJHA 2EIGA 1LEDA 1ZRIA 4NR1A 5F5CA 1FYUA 1DYKA 1UXZA 3M3EA 2HWC2 5EWSA 1V6LA 1ZBA2 4D6QA 2P37A 5A6YA 5FPUA 5FZ8A 3RZGA 3OGRA 2CL2A 1ST8A 4E8DA 3VKOA 3N7LA 3GYDA 4WM7B 2JDKA 1TME2 2JDMA 3T2QA 2TBVA 4AAXA 4KBZA 1DQ0A 1URXA 4RS5C 4TXWA 4WM8B 3BIWE 4QX3A 1LNSA 4CP9B 3SITA 1Q8OA 3GJAA 1JI6A 4JGZB 3LDKA 2YFUA 4ZXKA 1FXZA 1KDMA 1WA6X 1VIWB 3WP3A 2AACA 4CEYC 4I0BA 2XLGA 2VZPA 4NAOA 2GN7A 5BNPA 3ZXFA 5JIUA 1G9AA 3VKNA 2QQKA 3NV1A 4R4ZA 5FUPA 1K12A 1VBD3 4RHV3 5D8AB 3THTA 3WW2A 1DU3D 3R0RA 2ETEA 1LENA 3POYA 4LBQB 4OUSA 5GJ6A 5FZGA 5ABJC 2FDFA 1C28A 2A71A 2VZQA 4H7LA 1GU3A 4YYOA 4Y20B 4LITA 5KC6A 3AYEA 3K46A 2EXJA 2BVBA 4QDSA 3VKLA 1JZ8A 4XFCA 2BTVC 3BTAA 1E5RA 1SFYA 3Q8AA 3OGGA 3VBHB 1PGW1 3WDWA 2H0BA 2OKXA 4BLJA 4CCNA 3LSEA 3MUY1 3MV11 2JXAA 5E6HA 1H2NA 5FP9A 1GNHA 2ZMKA 5H9PA 1O7FA 3VBUC 5BNNB 1UMIA 2D44A 3MPBA 4XTMA 3UT0A 1RB8G 4LA2A 1F15A 2J1TA 4A3XA 5AC92 4JAAA 1MS4A 1PO21 4LA3A 2N7GA 4AHXA 1BBT1 1JUIA 1W99A 3ZFFC 4E4SA 1DGRA 2DFCA 2WZ8A 2ZXQA 3M4FA 5EIYB 3W5NA 4FPJA 5JXGA 1ENSA 4XFFA 4CUBA 5KHKA 2HLEA 1C1LA 3MIEA 2VCAA 1NX9A 4PI2A 2HWF3 1KJLA 1DF0A 2DDUA 2PXJA 4KU7A 5J36A 4CZSA 5L36A 4IEWA 5CBLA 2A6XA 5FUNA 4D8MA 4I2OA 1RIRA 3USUB 1R64A 1ZBA3 5CU1A 4E4HA 1GICA 5BNOA 2V73A 2WFF3 4MUVA 5HXMA 5ABJB 1AL21 4AFMA 3C7GA 4AF9A 4NWVA 4META 5KBFA 3VD4A 1V0AA 3NVCA 1UZ0A 5FY0A 5F5AA 3TNPB 4CXXA 1QJU1 4URTA 2E51A 3J9SA 2HWE3 3UK9A 5F1RA 3KVBA 1VMHA 2DYCA 3DKWA 2QVSB 2QQNA 1K5MA 4TYSA 2QDRA 3AKQA 2GNBA 3P3NA 2R072 2UYAA 1A78A 5JZGC 1J3RA 1UU4A 4LHSA 4O65A 3OG2A 2WNUB 5FQ0B 3FHIB 1GZWB 1RUH1 5FAXA 2ERFA 2R6QA 1ENRA 1OUSA 1PVC1 2JDHA 5FYYA 2E9QA 3PMEA 1U5ZA 4Y22B 4B8EA 1IPJA 4FXKB 1W6PB 2Q5TA 1ND2B 5JWPA 4KGGA 3UETA 5E8AA 1VLNA 4N7IA 2QJVA 4XQDA 5JMOA 1ZBE1 2HWF2 2BP6A 2GALA 2K0GA 1D4VB 1W6QB 4PDWA 3RS6A 2QTWB 2HBUA 4GIQA 1HXS1 1X36A 2DVDA 1RTVA 3HT1A 3W5MA 4RQPB 1NZIA 2WWSA 4PJYA 4AI1A 4A6SA 3ILFA 3FLPA 2BEOA 4ASKA 4DUVA 2W95A 3B9CA 1OKOA 3RFRA 4X8PA 4EZHA 1ZBA1 2ZOEB 2VU9A 4KWLA 5GALA 3J7LA 1AL0G 2RDSA 2W1WA 3OF1A 5FZKA 4LBQA 4OI2A 2JWPA 3KGZA 4CEWB 2LW8A 4EZ4A 5C4WA 3VD3A 1NCQB 1A34A 4AI8A 3QBQA 4LKSA 1AX1A 1ZZBA 1QJU3 3CO2A 3SLIA 4G4FA 4CU8A 1ZREA 3T1LA 4BJ0A 1FOD1 3SCGA 2I45A 2JG9B 1UY4A 3JB8A 4FPKA 4LE3A 1H8VA 5GZDA 1QXJA 5JZGB 2J1RA 4IE5A 2UY9A 4HN1A 4JDMA 1JH5A 1RUF3 2VJXA 2IUWA 2QQOA 1SEFA 3N7JA 4COYA 2AREA 1UYXA 1W05A 1GR3A 2WNOA 2JDNA 3ZMOA 1G6NA 2DVBA 1W9YA 4XCBA 4AQSA 1OA4A 4QX7A 4D7SA 4DQAA 5LZ6A 3J8F1 2BDRA 3AP9A 4HXCA 4XW3A 5CFDA 5F5IA 2ARBA 2NM1A 1X8EA 2J22A 1A6CA 3GM8A 3GZTB 2PN5A 5A33A 1NLRA 1STMA 1VBE3 4MHRA 2VULA 3I97A 4XTPA 2P34A 3W21A 4AEDB 5KHGA 4C91A 1O5UA 1W2AX 2HWB1 3C8XA 1G7YA 4P9LA 4AFAA 3GXUA 3OCPA 3T0BA 2A6ZA 5FY5A 3VV1A 1YQCA 3KV4A 3A23A 1VRH3 1NCRB 3JBG1 5KHJA 2D3PA 3BKZA 4FPOB 4L2NA 2XG3A 1XNCA 3NMBA 4JKLA 2A6YA 1GNYA 1PM7A 4D6SA 4GH4C 1HXS2 4YZ4A 5A1AA 3V0BB 4NIHA 3PJQA 2BU9A 2V4AA 3I49A 1AR93 3TOJA 4JHZA 3LZZA 5BNPC 1JW6A 3E6BA 1ND3A 2VZ1A 1JOPA 2OQ6A 3HPNA 3OD0A 3P1IA 4QGLA 4XJ9A 2QQWA 1H8TA 5ACA3 3MV01 3WSOA 4QX0A 2RDQA 3D0JA 1U0AA 5JXHA 4BXSV 3DGTA 1RUF2 4RL7A 5LEKA 1TG7A 3NSTA 3S5QA 4LOTA 4K21A 1JZ3A 4QGMA 1C5IA 1PHMA 1OSGA 3W58A 2VBPA 3H1WA 3LKJA 5A32A 5IT6A 3CMGA 1YFWA 3PVEA 1UU6A 2MEV3 4D69A 2PQSA 2XH6A 5J37A 1QJU2 3AKPA 2DTWA 1UAIA 4CDQB 4DNYA 2YZ4A 3PIJA 4LKDA 2QQMA 3CNAA 1SBFA 4HK8A 5FXWA 4IERA 3ST7A 3VBFA 4AGRA 4XXAA 4AR2A 4AOCA 5C3PA 3A7QA 1CAWB 4YM2A 5HXVA 1G9CA 4FPYA 4JTOA 3WZ1A 1HQWA 1EPZA 2VH9A 1JTZX 4BA6A 4W8JA 1I1EA 4GZ9A 1O3QA 3VBRC 3RNSA 1RC6A 2XBO3 5FXZA 4NPRA 2FMYA 3T08A 1AHSA 2PAKA 4D7YA 1AJKA 5JCTA 3O1VA 4XPVA 1W8WA 2ZA9A 1DQ1A 2RHPA 2WT1A 3FX3A 4CP1A 5FZMA 3LDRA 1W2OA 3WG4A 2DVGA 2IZWA 4QPWA 4Y24A 2DU0A 1L7RA 5FZ1A 1CAXB 1DZQA 3ZFGA 4EYUA 5IAXA 1RUH3 3B01A 1PZ9A 4G9SB 4QQ2A 5F8PA 1J84A 4E27A 1ZRDA 5CFDC 4NIAA 3OY8B 2RMU3 2IFWA 3GBWA 4IEOA 1AX2A 1EAH2 2JENA 2NQYA 2RS12 3LD8A 3CJXA 3PVOA 5I0UA 1CAUA 1H2KA 1RUG3 2IXKA 5DAXA 3WCRA 3NAPC 1S0GA 1D4M1 5CFCC 3DEMA 4Q4X3 4EN8B 1JU3A 2D3SA 3WY6A 4Q27A 4YVWA 1DIWA 5A7OA 1ULDA 2L9LA 3VD5A 5HBAA 5GZCA 2VXJA 4Z8BA 5C7GA 2XJUA 4XJ8A 4Q29A 2MNGA 5CYYA 3I2OA 3ZO0B 1QOSA 5EQUA 4IEYA 3U37A 3WNMA 1XYOA 3VB9A 2XJPA 3O0WA 2WNUC 4OHXA 2XL7A 4GKXA 2CNAA 4OUMA 1FPN2 2VR4A 3TN93 1VBA1 1H6YA 5A3LA 4XUOA 4XUTA 3PMSA 3IDBB 1GLHA 3N9OA 3VBSB 4FP3A 3VZMA 4FAGA 1ULGA 4INDA 4ZXEA 1VRH1 3SKVA 4XDQA 3VL9A 1NG0A 2W1UA 1RHI1 2R063 2WA3A 3OYWA 3T2TA 1O8SA 5HI0A 2RDNA 1OI6A 1SCSA 3M2MA 3UKVA 5JOYA 1JZ2A 4XBLA 3LOIA 3ZOIA 1N1VA 1Q8SA 4CXWA 5LK7B 2QNKA 3OGVA 3BUCA 1Q8PA 4DXTA 3ZSMA 1VE0A 1H2MA 4P9IA 2BRTA 2VXRA 4AQ6A 3LF7A 4QXHA 4DINB 2WJSA 4P9YA 1YO8A 3MIGA 3I2GA 2YPJA 3OPWA 4HPKB 2C1FA 2O1QA 1Z7S2 2JG8B 4K8FA 3PNAA 2OW4A 3I54A 2GP3A 2VOTA 1B35B 1XQNA 4TLFA 4Z2WA 4C90A 3AVRA 5J98B 1ACCA 3ACHA 3D3AA 4LBKA 2B9VA 4ONUA 4OUEA 1UY1A 2AUYA 3IDEA 3VBOA 4QXBA 4B4PA 3QACA 2HWD2 3AVSA 2FCTA 5FMCA 5M0TA 2VAUA 2X8KA 3VBUA 5BNNC 1EUUA 4E2QA 1V6JA 4EWEA 4MHUA 2EIDA 3VBFB 1YIPA 1MS1A 1RUC3 1XNAA 2JD4A 2FCUA 3WW1A 3ZX7A 3RZJA 3TN91 5A7QA 1V70A 1CESA 5IK7A 4CCMA 1OBNA 1W8ZA 2WQZC 1SDWA 5FZ0A 5D8AA 1D2QA 4BQ1A 4QPGA 2VZOA 3AC0A 3ES1A 1YJKA 4JDNA 4IV3C 4LK6A 1F4HA 4HZFA 3POFA 3S30A 4BK4A 1W8TA 3NKTA 5DAVA 4MG2A 1HLCA 4IEQA 3LCPA 3NV3A 1RUG2 5LRRA 1YRZA 4K20A 1M06G 4W65A 2RR11 2GNDA 3O0XA 4XXPA 1W06A 4IUGA 5KXBA 2Y0IA 4NHMA 5H9RA 2BNMA 2GC2A 4N43C 1Y9QA 1WMDA 2A6WA 1NLQA 1V9U2 2W47A 3LQCA 3SXWA 3WW3A 2IXCA 1IG0A 2DURA 4KL1A 4QAWA 4S2FA 2Q8OA 5FO9B 2DVAA 3IPVA 2ZX4A 4OHZA 2VQTA 2MEV1 3TWIA 2VBDA 3MPPG 3SHRA 1RUJ1 4JGZC 1UNBA 2D6PA 5JZGA 3KCYA 1W8HA 2QFEA 3APBA 3R4SA 5SV5A 2D6OX 1BEV3 3POEA 4LBOA 4W6YA 3WXPA 5JAXA 1X8MA 1WMXA 2TNFA 5DDJ1 1YFXA 2F4LA 4DRVA 4IGOA 3I3DA 5AVAA 2Z79A 2XVKA 1DLCA 1NE4A 2GH2A 5FZBA 2A70A 3RI9A 2PAEA 2ILMA 3IAQA 2G1MA 3LOBA 4LHNA 5FZAA 5CADA 2ZBJA 5EYXA 4NWWA 3FFZA 5I8SA 4EV0A 4NAMA 5KHHA 3V65A 3ENRA 2R043 5CKNA 2Q8DA 1CGPA 2VTXJ 4TTGA 4GH4B 4AWDA 1Z7S3 4SLIA 5LK5A 3CHXA 3WP6A 2B39A 2P3JA 3BPSA 1Q8QA 3ILNA 5GLTA 4CDUB 4EJRA 3AM2A 1F5FA 1LHNA 4IGQA 3ZPYA 1QQP1 1HJFA 1QF3A 3T30A 3GHNA 4JHTA 4RN5A 4UW6A 4JC1A 1CIYA 4ZS3A 4EN7B 3T0AA 1X33A 1XC6A 1NXD1 1SHWB 3ACLA 3R4UA 2WO3A 3NQHA 1UU5A 4MXWA 1CZTA 4QPIB 4XUNA 3VDDB 3V0BA 2W2IA 3VBRA 5J1XA 3HNBM 4QDRA 4QQPA 3Q8CA 2X05A 2ZTNA 1CWPA 1RUG1 3D5OA 5JOWA 4L92A 2OPWA 1JYCA 1EV11 1OVSA 5DAQA 5DXDA 5ACA2 1JBCA 2W0XA 4DUXA 3CDZB 1OQEA 1ULEA 3PURA 1VBC1 2ZHNA 2BYVE 3FLTA 4JCKA 3SC7X 4BPZA 5J96B 4B4QA 5F5QA 1RUD2 1REDA 2ZHLA 3HNMA 4RGKA 1FMD2 1R1ZA 1VAKA 1W6QA 1IPSA 2VGDA 2Y0OA 3H42B 4N90A 5L7OB 3U75A 2YFZA 3CKHA 3BN6A 3BI3A 3BYWA 5FOJB 4YVSA 2EVXA 4NHXA 2V5DA 5IFPA 3AZWA 1NE6A 1MZFA 1W8NA 1AYM1 3MW3A 5FZLA 4XHXA 3NNFA 1EY2A 4D94A 2HJIA 3V0AA 3H7JA 4Y1UA 4E2SA 2CWMA 2WDBA 2YGMA 4XOGA 3A0NA 2W52A 3Q8FA 1Y3TA 4OI0A 2ZHMA 4EN9B 5FP4A 4NPMA 3VL8A 3OBZA 2BFUS 4RSUA 4V1PA 1PO22 3NJVA 3O1OA 3NNMA 2Q1FA 1W2TA 1HQNA 2YC4A 2ZPXA 3M7AA 2BBVA 3NO8A 5C9AB 4XURA 1RUE2 1X9PA 5EYYA 1KFXL 3D6EA 3K75B 2RS11 3ZR6A 4GB31 1E5IA 1OF4A 2ZAHA 5IVYA 2JB4A 3B5LB 4JGZA 2YY1A 5A70A 2W94A 3KGLA 1F2NA 1FAYA 2YBPA 4FCAA 2NN8A 3S7EA 4R9DA 1HN0A 2CYFA 4F3JA 4XCAA 3FFQA 4EROA 4IGPA 4Y4RA 1FMD3 3E5XA 3ZDSA 3G7DA 3DYPA 1POQA 3MGUA 3ZFGB 3M70A 5FO7B 2WZR1 3DN7A 3I3MA 1DBNA 2E7TA 3N7KA 4YZ3A 1H9PA 4ES9A 5ACA1 3OEAA 2A6VA 4P9JA 3LPGA 3ZIWA 5GM0A 4YW2A 1GYKA 1KXGA 2XONA 4K6BA 2C9KA 1OFNA 4UF0B 1VPHA 5IVBA 4AFDA 1JYWA 2ADDA 2BBAA 3QLQA 1AYM3 3RI8A 1V9U1 3KCCA 4BQ3A 2VW0A 1MACA 4P9XA 4XUQA 1AR72 2XDVA 1N1YA 2MEV2 1R091 4FFGA 3SEEA 5A6XA 3ABZA 4OHYA 4MGSA 4LQRA 4XYXA 4JTNA 3RVHA 3N9QA 2XOMA 3PUQA 5ERLA 1GP6A 5BNNA 2Q30A 2RR13 1PMIA 1ULFA 1DQ4A 2HEWF 2WYSA 2ZACA 4BMBA 1ENQA 1VMJA 5T50A 5CG8A 1Z7S1 5A7NA 4MOAA 2ZGPA 1E5HA 4XF0A 4MXWB 3I2IA 2ZAAA 1WKYA 2WZPP 4CSWA 3HN1A 2JDYA 2ZGSA 5JXJA 5IW0A 2HH9A 3LA2A 2I74A 4QD2A 1LAJA 5EJZB 4RGGA 1N3OA 1JU4A 4MLOA 1ZA4A 1RMU2 1TNFA 2WQ4A 2RJKA 2GMEA 1OPMA 4YFZA 1G86A 1LKNA 5FP8A 1SPPA 1AXYA 5DDJ3 1UD1A 2BGOA 2VMEA 4PCRA 5C8CB 3O1PA 1C8M1 3ZYHA 4OI4A 5IVEA 2WAAA 5JXIA 1OLRA 3RSJA 1DGWX 3TN92 4K9SA 2OIIA 2AYHA 2BUKA 2K2SA 2UWBA 4YRDA 2YBKA 3PDQA 1A8MA 3F2ZA 3CU7A 4IV3A 5HCAA 2W39A 5I0TA 1ASJ2 4DRRA 4CEWC 2YUEA 3POSA 2DTYA 2FDKA 1A3KA 2W1QA 4I3GA 4M0HA 5CKMA 4I09A 4LHKA 1CIWA 1DZRA 1FI2A 4LKEA 5FY1A 1GP4A 4YVWC 5K0UB 4XIKA 4HFSA 1CVNA 3BALA 4BHPA 3RG0A 1D2SA 1IQDC 4O9GA 4AAPA 4LUMA 1GZWA 2VY0A 1OMIA 3JD73 2GMMA 4DIQA 4C1WA 4CDQC 2OUJA 2RJ2A 4L9BA 4BZ4A 2PFWA 3AKSA 1WMFA 1OQ1A 3ATGA 5A7PA 5K8SA 1AR71 1XNTA 3FZ3A 4WVWA 5D1IA 1VB4A 2EAKA 3N4MA 4FI9A 1RUJ2 3VBOC 4A7KA 4IE6A 3DUIA 4XJAA 4JGYC 4COUA 2QE3A 5FZFA 2C5DA 2ZX0A 5LBEA 3OBAA 2IFRA 2G4IA 5JSOA 1OPOA 4GB33 1JZ5A 2YU2A 3OOXA 1UL9A 4CCCA 3LEGA 1LTEA 4HSJA 4R4XA 2J1AA 5A1FA 1HRV3 4Q1PA 5FY7A 1MVEA 4HG6B 4Y33A 3KHBA 2D97A 2O0OA 2YDEA 3BTYA 4E2GA 4QKBA 1HRI3 4FPEA 4KG8A 4RD7A 1OLME 4D7TA 3KQRA 1XYPA 4FXGB 5FFOC 4XILA 1NA1A 5CFDB 3WDXA 2R1DA 1WA4A 2LRPA 3LE0A 3SQOA 1WCQA 2E7AA 1F4AA 4IV1B 3ZN5A 2GSYA 3KCXA 3BTZA 4KU8A 3FUOA 5JSRA 2BVVA 2YMZA 2OS2A 3B3QE 4X8NA 2B46X 1YWKA 4NOTA 2C26A 5FPAA 2XXZA 3PHMA 5EJ1B 3R6SA 3ACIA 4QPYA 3ZN4A 5CFCA 5FYCA 1OLMA 3IN9A 2PHRA 4QB1A 4IW3A 1Z78A 2GAUA 3ALQA 3HWJA 3FE5A 5CVRA 5F3IA 4LBQD 4JVAA 4N43A 3W20A 1KGYA 3Q8BA 2CGNA 4NHKA 4Q26A 2KXLA 4Z1VA 3MFAA 3C7FA 2NZ9A 4LHLA 4HETA 5EJ3A 3SH4A 2JG8A 5E88A 5C71A 5IUQA 3HOBA 3RZHA 2WRAA 1FMD1 2MPFA 2QCSB 2FCVA 1QEXA 1YUDA 1JZ7A 3ME2A 3H1YA 5DAWA 1NAEA 4CP2A 1NOVA 1PK6A 2FDGA 1H8TB 5K9YA 2YU1A 3OEBA 4Q4W3 2QQUA 3HQXA 1QJEA 1TQ5A 2RG4A 3H3UA 3J8F2 2A5ZA 1X82A 5G05L 4NHYA 3TEXA 4H3WA 1U5IA 5FK8A 1O6UA 4Y5SA 3POJA 3ZSJA 2PHFA 4URAA 4WM8A 1RUI1 1YCIA 5I91A 3QH6A 1BLZA 2WLQA 4N9IA 4TLGA 1DGWA 1IKQA 5CKQA 2YBSA 4BQYA 3ECQA 1I5PA 5IK8A 2IXJA 3LPFA 1IS4A 3C7EA 4IV1C 3WQ1A 3LEMA 4CDQA 4A44A 3KT4A 4CYDA 1D0HA 3OUIA 4FOWA 4ARXA 3WF2A 1QXPA 1OOPB 2JE7A 3ZFFA 4YM0A 4R9AA 1TMF3 4NPLA 4UWDA 1GV9A 1SQ4A 2XUEA 2WNVC 1DYPA 4HLTA 5T5OA 4UFHA 3V0AB 2Y60A 2WFF1 2W91A 5A7WA 2RVAA 2XLFA 1OOPC 1AX0A 1W9WA 2FHRA 4FO9A 5DN2A 5GLWA 2UU8A 1AL23 2JJ6A 1POV1 2R32A 1WCUA 4OULA 3URFA 5FPXA 5F6KA 1L3JA 1XE0A 2CAUA 5HCFA 4GAZA 3VZNA 4CCOA 1RUOA 4ZU7A 2GNTA 1W9TA 3GDBA 2BZDA 2VZTA 4Y4YA 4Q0SA 4AQTA 1COV2 1S0BA 2PHUA 3DPRA 1JYVA 1DP0A 1HQLA 2ZKNA 3CZUA 1PO11 1Y9MA 3R05A 1GZ9A 1O91A 5LEJA 1QNYA 4MX3A 2CHHA 4DO0A 1XE7A 5I8YA 3ZIXA 1W0PA 3MIDA 2BGPA 4HOOA 1DQ5A 4JKKA 3PU3A 2JX9A 1ZZ8A 4S2GA 3AFKA 4ZU5A 5LA0A 4QQLA 2W46A 4KG0A 3P5BA 1I9RA 3HD8B 2XKPA 5EP9A 2W9XA 1FT9A 1L7LA 4L99A 4XFAA 4P00B 3WG3A 2DCZA 4XE9A 3UJOA 4CEYA 2UWAA 3M3CA 2V5YA 3TB0A 2ZEYA 4FFHA 2OZ6A 1W8UA 1BMV2 5C5UA 2Z42A 4NHLA 1CAXA 4PQ9A 5H9SA 3U10A 4BIOA 5IATA 3I3BA 5IFTA 4FOVA 3EO6A 1ALYA 2P5BA 5AVPA 5CNAA 2P17A 1UOJA 5FYMA 3ZPOA 3MFCA 2PHXA 2UWCA 3GGLA 5CFCB 3KZ4C 5HCBA 1SLCA 4PDWC 4Q2FA 1IPKA 1NCQC 2R0FA 5A3UA 4PQQA 1HB4A 1XPWA 1JMUB 1TEIA 2ZEZA 5F3EA 4AG4A 1UKGA 4W4ZA 1PIV3 1Q3EA 2KR2A 2OA2A 2R062 2YV8A 4Z82A 2QZ3A 4DMIA 4BCUA 2YG0A 1BKZA 4QQHA 3KB5A 2VCBA 2XL9A 3WNLA 4B4RA 2RS33 1G8WA 5B4NA 4NUBA 4OCTA 1O4ZA 2WWUA 2XVLA 3KHCA 1O3TA 1N1SA 2WFF2 5JIAA 1EPWA 2P3YA 3BGAA 5A1LA 1EAH1 5JI7A 3JQWA 3MW4A 4C0HA 2Z69A 4UW4A 4OHVA 4YZ2A 2BERA 1OC1A 1LHOA 2HWC1 2FDIA 4IEPA 4XIOA 4UBGA 4OHWA 1GQHA 1TMF2 4P14A 3OPTA 4Y5Z0 1IQAA 2AZ5A 4CE8A 4FQ4A 2E6VA 2DUQA 1KEXA 1W6PA 1XRUA 1YHFA 4LEJA 3MIBA 2LTNA 3OUHA 1RUNA 5AFEA 3AZZA 5JR7B 4Q0UA 4AQ2A 4XJZA 4DXSA 5A6QA 5LRSA 4Q4V2 4ATEA 3VBOB 2VMCA 2WT0A 3VHNA 1ASJ3 4HK9A 1C57A 1ZZ7A 2FBEA 2Y6JA 5FXXA 4ISQA 4QB2A 4Y1YA 1T2XA 1DZTA 2VVFA 4AHZA 2ARXA 3M3OA 3T2OA 4Q4Y1 2FDJA 3L2HA 1KJRA 4EWAA 4XVHA 2WN2A 1COV3 4ES8A 2VC9A 3DF0A 4K8RB 4CP9A 2R071 4NIIA 5C9AA 3ZYRA 3MICA 2R16A 3H7YA 3DPRC 4P9GA 4K1YA 4NIGA 5C33A 3B9IA 4XBQA 4D3WA 3GZAA 2WFPA 3NV2A 2LROA 4CUGA 1GNZA 3CEWA 3T1MA 3DYOA 1UIKA 1DLLA 3N9MA 1DGRN 3AMHA 1FNYA 3N9LA 3FMGA 4K3UA 2O14A 4UOJA 5BV6A 3GZEA 3BPZA 1AR62 3A0KA 3VN4A 4AI0A 1BEV2 4Q0PA 5DUXA 1ZBE2 4A2UA 5FPLA 1W39A 3T09A 1GBGA 2BWCA 1PVC3 3LEKA 1W9FA 3PTRB 2AR6A 5TSWA 3WHTA 3KS7A 5I0SA 3H0OA 2BV4A 3C7OA 1HB1A 4LO4B 4YG0A 5FDBA 4A7YA 5JDBA 2FDHA 1AYN1 3M3IA 3NW4A 4E4DX 4NN0A 3PU8A 5ISLA 3E6CC 2Y6KA 5CEHA 1V9U3 3RMYA 1REFA 4PIZA 3ZYBA 5DG2A 4Q4V3 1S4CA 3DV8A 5LA2A 2O8QA 3ZKUA 3LIHA 1K5JA 2CAVA 4JGYA 4JQRA 1KITA 1TMF1 2PHWA 4C0BA 3ZDVA 4XF9A 4HBNA 2Z5WA 3WF4A 1O4YA 1FOD2 2IXIA 3D0SA 3IB3A 3IPVB 3HT2A 4QKDA 2ZZQA 5IAVA 3TEYA 5FYVA 1N3QA 1VBC2 4GKYA 3RZMA 1F8VA 4R9BA 4K40A 1RUD1 2F6BA 2VCMA 3LFIA 4UW5A 4W50A 5JOXA 2XHKA 4O7XA 3OBRA 3O1UA 1BHGA 5FP7A 1O3RA 3WOGA 1YQ5A 2B8MA 2PTMA 2XPJA 1MEC3 3Q8EA 2AC1A 1D7PM 1UZWA 1VRBA 4FT8A 5T52A 4BK5A 2UYBA 1W2UA 2JG9C 4QT6A 1WLWA 1W9SA 3AMNA 4ZS2A 5FRAA 2OXBA 3ZVXA 5BNOB 4FPGA 3O0VA 1AXKA 2FZ1A 3DYMA 1PM4A 5BXXA 1BYHA 3CLPA 4UFIA 2E7QA 2VVDA 3VDDA 4GJYA 2P6HA 4LLOA 4I30A 4OZXA 2V09A 4Z07A 3MZHA 2RS31 2VMIA 5FV3A 4DUWA 1LECA 5C4WC 3TEZA 2C24A 1XB9A 1IGOA 2XQRA 1PVXA 3KV9A 4I0AA 4V2WA 4NIDA 1EP0A 4Q4X1 5F3CA 2Y8KA 1LRHA 4FPCA 4XC9A 1MQTA 3WQBA 3KVAA 3KF3A 1JZ6A 1H4HA 1LOBA 1JYTA 1QJX3 3WUDA 4QXKA 5AC91 4AHWA 2GU9A 5KXDA 3O1MA 1ZRCA 1BK1A 5FZOA 5GZGA 3MLJA 3OGJA 5EXOA 4QPIA 1UKRA 4PIXA 1EUTA 5C9AC 3A21A 1BK0A 4XZPA 4NMIA 4OFGA 4XDOA 3VHPA 2RM21 4UFJA 4A42A 3I59A 2JE9A 1IS3A 1A8DA 4QB6A 3RWNA 2VZUA 1RUD3 2A73B 3I2JA 2J1EA 1PX4A 3LIGA 3W9AA 4UFMA 4PDWB 3AMPA 1RYYA 1VBD1 3QCWA 3RMXA 2WNUA 2OX0A 2XJRA 3AJZA 3RYPA 3ZFFB 4BMEA 1MEC1 5BNQA 2R073 2WR9A 1UOGA 2RS13 4XQWA 5ANQA 1TVGA 2G9FA 1C1FA 1GUIA 1UIJA 4RR3B 1RVF2 5C6CA 2QQIA 2RS53 3J26N 2WNVB 4IDZA 2PLV1 2GC3A 2V72A 1K3IA 3NNJA 1CZSA 3KM5A 1J58A 2PHDA 1MZEA 5LY1A 3TYJA 5DG1A 1YXWA 5EHDA 1X7NA 5JVVA 1R083 2PHLA 4P02B 3IIIA 5JMCA 3HVDA 4J1XA 1NY71 1W8OA 1KD7A 5C3RA 2JB8A 3MBWA 3MF6A 3VDCA 1CAUB 2BOJA 2ET7A 2J1VA 3IAPA 5BPXA 1PGL1 4DXRA 2OT7A 4IV1A 3INAA 1IOAA 3NJYA 2ZJCA 4IEXA 4UW3A 1CJDA 2YXSA 4NRMA 4XF1A 5G04L 1GSLA 5FTTC 1D0GA 3V64A 1XSQA 2QDNA 5DZGA 5LBBA 2HBTA 4FVVA 2P3KA 3I2KA 4QU2A 3ZXAC 3TNQA 3T3YA 1W8FA 5CAZA 3OBTA 1DGLA 4N53C 4QWNA 4UFLA 3KSCA 4CUCA 1RL3A 4XETA 3H8OA 3MO4A 2XBO1 1PNGA 3AKRA 5LBFA 3VD7A 4FTBA 1MVQA 4GWJA 1S0DA 3RYRA 4YG3A 3WNKA 1P8JA 4UBHA 4M4PA 1KS4A 1GMMA 2ZHKA 4F8AA 1PMJX 1BXHA 2RM22 3GBFA 1LU2A 1VBB1 3ZR5A 2HWE1 4NJ4A 1QJX2 1PZ8A 3JZVA 4H7MA 2PYTA 2C4XA 5FK7A 4BDVB 2SLIA 3U11A 3FL7A 3MDPA 4CVUA 1ZVFA 2RMU1 4LLFA 4XFGA 2VUAA 2HWD3 2VD7A 2ATFA 1BBT3 2NLRA 3POBA 4RHV2 4ZONA 1OF3A 2Q0AA 4PLMA 5E89A 5KC5A 4LXLA 1MS9A 1SDDB 3HQRA 1IG3A 3FLRA 1I3HA 5FZ6A 4HSLA 4C1XA 2D3RA 4CDWA 1LJ7A 1YLLA 5L9VA 1SLBA 4WVMB 4IE7A 3NAPA 4AVBA 4Z92B 2XB6C 4YW3A 1R1A1 2QQLA 3WINE 1U5YA 2AGSA 2X53S 1VRH2 4PIYA 2XWJB 3LFMA 4LIVA 5FIXA 4QPGC 1CX1A 1UPSA 5FYBA 1NY72 2VUDA 1UXXX 4UXAA 5EZWA 4YM3A 3VUOA 2VNVA 2Y38A 1VBA3 1XBFA 4MYEA 3V56A 3UGHA 4QPGB 1S2EA 2W1SA 1F31A 4HVRA 4KNCA 3O14A 5GZFA 5A7SA 1UCXA 5FZCA 1XNKA 2CSGA 3IMNA 2XJQA 4ASLA 4BIFA 4X6QB 1RJ8A 3MUZ1 1JN2P 3ZYIB 1XE8A 4OQ9A 4BQ2A 5BY5A 4CDXA 5K7PA 3B94A 3NJZA 1I5ZA 3VHOA 2ZEXA 2F4PA 4LK7A 3WG1A 1H0BA 1VR3A 1W0OA 3ZYJB 4CPBA 5FYTA 2VG9A 1PMHX 2HWD1 2WABA 1MPXA 5CISA 2P3IA 4IL7A 5FUIA 3N3HA 1DHKB 2WWJA 1GFF2 1Z0HA 2H6CA 2OPKA 3B93A 1N3PA 5CG9A 2PMWB 1CAWA 2XMLA 2ARAA 4QGNA 3JD72 4LR4A 3WNPA 4CCEA 1QJX1 1S0CA 1R081 4Q5OA 2DCKA 3MIFA 4ZPIA 1LESA 1R1A3 1RVF1 4DY3A 3I8TA 4R9CA 3NV4A 1S0FA 2DU1A 4N53A 1PGSA 5FR3A 3CF6E 2G9ZA 2PLV2 1PZ7A 1VBE1 2XHNA 2BOIA 1O5LA 2JIJA 2ZZJA 3CJIB 5C8CC 1GWMA 2ZGTA 5FY4A 4MV2A 5T3NA 1G9DA 2V4VA 4DB5A 3FN9A 1SLIA 1RXFA 1NA1B 4P08A 1H6XA 3KV6A 1JYNA 1O59A 1MZ5A 1VBA2 1SBDA 2IXLA 2SBAA 3IT8A 4HT1T 5FYUA 4ATFA 1AUYA 1NYWA 3RZLA 3GBGA 3D8CA 3ZKYA 1FV2A 4N9HA 3ROUA 2JDZA 4ET7A 3FC0A 3OTFA 5SV8A 1KQRA 2BWAA 4XUPA 1W3VA 1S0JA 2WYFA 5FOBB 1SLLA 3HJRA 4LULA 5FREA 5B2GB 3ZM8A 4I3PA 2Q8CA 1GOFA 5BNOC 1IS6A 1UMHA 4GWMA 1QY4A 1LHWA 4CPBD 4C8DA 3BODA 1CPNA 2VMFA 1US3A 4LIUA 4YW5A 1BJQA 4N43B 2Y34A 4OI1A 1WUVA 3WHUA 1EAH3 1XU1A 1OA3A 2EXIA 3AKTA 1LEMA 1VAVA 1GANA 2D40A 3A22A 3FHQA 4HKWA 4B7KA 3N9PA 3AK0A 1Y4WA 4JZRA 5FLIA 4GJZA 1XSRA 4A45A 4ZHNA 2ZGKA 2BQPA 4BISA 1LULA 3G6JB 1Q56A 4HPKA 4RGAA 3CZJA 4HMZA 1GOHA 3K3OA 5JPMB 5FPBA 1JOBA 2JECA 2ADEA 1N47A 1CONA 1BQPA 1VALA 1TME1 2E26A 4LO8A 2YHJA 1UY3A 1ND2A 2WZEA 2RMU2 4CA9A 3NNGA 5HCHA 3OB8A 4QM9A 1R093 2C0ZA 1OVPA 2DUOA 3IBMA 4RHV1 4ASMB 4NRPA 2VZRA 4LO7A 1AR81 4HANA 1HB2A 2Y6HA 2A3YA 1KFUL 1CZVA 3AZXA 4HKLA 5IJRA 3VD9A 1BVP1 5C8WA 1MZ6A 1GZCA 4YW6A 3ZFEB 3N9NA 1ONAA 2R1BA 4FFFA 1W2NA 2WIIB 1W04A 3LDBA 2Y6FA 2BFUL 4OMDA 4Y26A 4CDXB 5BUVA 3UNPA 4A4AA 4O9EA 3WDVA 1WW7A 4YLZA 3HIFA 2B9UA 3O7OA 5JI9A 5C4WB 3ZXLA 3D4KA 2X5IC 4IESA 4M4RA 4IEUA 2GN3A 3VDDC 2CV6A 2D6NA 2J1SA 2WT2A 4MH0E 5LB6A 2PA7A 5L9BA 4CCKA 4A6OA 3S7IA 1QJY1 3H8RA 1UF2C 3CIHA 5CIRA 3AP5A 1UYPA 4WM7A 4FFIA 3DPRB 5JOZA 2JG9A 4DFSA 2ZX2A 1SLAA 1VBC3 1VP6A 3UJQA 1WZXA 4YVSC 3DECA 1LR5A 1MS3A 1ULCA 4D6RA 3RGBA 1D4M3 4FOYA 5CZKA 2I07B 1OUXA 4AVVA 1J3PA 1SFNA 3WP4A 2ZX3A 2K9ZA 3WT3A 2RJLA 1APNA 3UV9A 2UY8A 5FKBA 1NA1C 1YI9A 2R7EB 3OSDA 4XJWA 3IWZA 5FMOS 5BNPB 4XABA 2RDRA 4E9KA 1SFPA 2CDPA 2P4EA 3ZLIA 1DQ2A 3BIEA 4PHZA 4MGZE 1KRIA 5LY2A 2NYYA 2DFBA 3FBMA 4QX5A 3PVBB 4Y1XA 5F2SA 2A1XA 2KA3A 2QQVA 4LNVA 1DYOA 1LHUA 4Y1ZA 5I8TA 4RS5A 4QPIC 5T5PA 3JD71 2IVJA 4Y20A 4LKFA 1NKGA 1PIV1 3A4UA 4XACA 2CU5A 3WCSA 4AGGA 4PI0A 5T5JA 4YG6A 3H8UA 4YWAA 4NVPA 1UY2A 1RMU3 1WD4A 2VNOA 5E16A 1ZNPA 3WVJA 3DL3A 3VBHA 1YJLA 3BU7A 2J1UA 1JODA 3SISA 2Y6GA 1EYBA 1NLSA 2WZR2 1Y9GA 2A75A 1LOAA 4CTEA 4B1MA 1OLQA 2OQ7A 4AXOA 4XHBA 3U4SA 5IVCA 2PELA 4S2DA 3KT7A 4K7JA 3SMHA 3DXUA 1MS8A 3EYPA 4MGIE 4Q4Y2 2WO2A 5EPAA 5F6LB 2HWC3 4FOQA 3PUSA 5FMDA 3AJYA 1JHJA 1NUKA 3L9JT 1V6MA 4EN6B 5J48A 4E8CA 2GP5A 4FBFA 3HAGA 2FD8A 2HEVF 4YGEA 1R092 2WBKA 4J25A 1QMJA 2VPVA 1S0EA 3BCWA 1H30A 1H4GA 1KDKA 3VLBB 5I0RA 4Y3OA 1PVC2 2XVGA 3O5SA 4I02A 4KQ7A 3SNMA 3T4HB 5L73A 2O8OA 4XEZA 2IC1A 4XAAA 1YQ2A 4YFWA 4UYBA 4L97A 4CDWB 4WVZA 1AVBA 3JBG2 1HDKA 4JQTA 2W08A 4FAHA 3U0ZA 2RM23 5A3OA 1S1AA 1C8NA 5EV7A 3WP5A 3QH7A 1HB3A 1PNFA 1KS5A 4JDOA 2YGLA 5D2AA 2P6CA 2X5IA 3AXEA 1RMU1 1K5MB 1CQ9A 4XJUA 4OMCA 3OGSA 3B00A 4DEQA 2B45X 2VOKA 3U07A 3HNYM 2WL1A 2JIGA 5FWEA 5KWRA 5FZ3A 5FQ0A 3ZN6B 2E32A 1D4M2 4XF3A 4CCDA 5DMYA 1QU0A 1RGSA 1RUE3 4BU2A 1HJGA 4J1WA 3JXSA 4LPLA 4YVSB 2E33A 3AB0A 4UFKA 1WLTA 2R30A 2Y6LA 5FZDA 2BGCA 1PO23 3J8F3 1VB2A 2EAAA 2QBXA 3AZVA 3JUUA 4IE0A 1QJY3 5FYZA 3TAYA 5KHIA 1UYYA 1RINA 3AP6A 1JHNA 3VDBA 4XF4A 2VM9A 5A3MA 4LBNA 3AL5A 4S2HA 5F2WA 1HIXA 5FPZA 2DBIA 3S6PA 2J7MA 3EHKA 5T55A 3WD5A 1MS5A 4Q4V1 5FPVA 1QH7A 4YGDA 1ZRRA 2WKKA 1QIQA 1ZX5A 4AHYA 3ZXEA 4YZ1A 5IK5A 2P2KA 4MSVA 2D5FA 4CDWC 4CDXC 3HBKA 1ENXA 4M0NA 5F39A 3AYCA 4YVWB 2VZSA 1TE1B 2AH2A 5JSPA 1AR83 2A3WA 3JU9A 3UL2A 4RS5B 4WM8C 5LWBA 1AYM2 2YB7A 2BPA2 3RDIA 3FWEA 4BWOA 3AMQA 3K4AA 4UF0A 4AEMA 2B4KA 5A3WA 5LW9A 1JS9A 1F5JA 1UZZA 2EIBA 1H8TC 3P3PA 4QKNA 3SKJE 2DUPA 2QUOA 2EA7A 2PQQA 4QX1A 3CBNA 4JKMA 3VBSA 5J7MA 2RV9A 2XGXA 2ZX1A 4AVSA 1QWRA 5HV4A 1GKBA 4IQPA 4QX2A 3VBFC 2ZEWA 5IVFA 1W3XA 1RUE1 2D43A 4BYYA 1DDLA 5C70A 1J83A 4LMFA 4OQ8A 2DV9A 1GQPA 1PO13 4FQZA 1GP5A 3SCFA 1QOTA 1XNDA 5FZ4A 2JD9A 3THPA 4QDQA 3X29B 1W6MB 1ZM1A 4AW7A 5EFUA 4B1LA 3K4ZA 4BB3A 2CGPA 4BXFA 2DF7A 3D82A 3ZYPA 1Y43B 4LTAA 1EV13 3ZSEA 5A33B 4M3CB 2WQ8A 4YGBA 2CTVA 2WUHA 1K45A 3PIGA 3EB7A 1NQDA 1HRI1 4FPHA 1JXNA 4HONA 1MEC2 5C5TA 2BNNA 1H2LA 3GCWA 1HV1A 1HXS3 1OH4A 3J7MA 4UAPA 1US2A 1ZZ9A 3OYWB 2BJSA 2FQPA 4TZDA 1LGBA 1HV0A 3AL6A 2YYOA 2HYXA 1C4RA 2D98A 3DKQA 1W28A 1XYNA 5AFBA 3HR9A 2Q1MA 2ZGLA 1GZTA 3ORJA 4AFBA 1AZDA 2WNEA 5D21A 1OOPA 1RHI2 4R8HA 1RITA 3ZYFA 4HVQA 1DG6A 3OPZA 1AJOA 2VQ0A 1UW8A 4I01A 2X10A 5F37A 3AYDA 3RYKA 2W92A 1NCRC 3LA7A 2J42A 2PHTA 2XJTA 4Q1RA 3ON7A 2R49A 1MQTB 4PF1A 4MXVA 1GWLA 4MZUA 4ISRA 2XUMA 4A7ZA 3LSDA 5T54A 1Q5OA 1ZZ6A 2Y64A 5E1RA 5F7UA 5FXVA 1YEWA 3U1XA 2CWSA 2VZVA 3E6DA 4B3NA 3S5AA 1CR7A 1J59A 3H3LA 2D5HA 3NL1A 1RXGA 2AENA 2IVIB 4QHZA 5FCCA 4AI2A 2R042 1H1AA 1LGCA 3FHAA 4X6RB 1POV0 4QKFA 5FLJA 3TEWA 1QNWA 1JZ4A 4I0WB 4L11A 1FNZA 3T2PA 2FMDA 3WX5A 4GALA 2G9GA 2ZGRA 3IZOA 1IHMA 4AYUA 1WW6A 1DFQA 1YC61 4NROA 4N53B 3ZXJA 1UY0A 1CN1A 1RVF3 1C8M2 3CJIA 1RUI3 5FMOL 1UPIA 2HWB3 2B42B 1QOOA 1CAVB 5C3OA 4RR3A 3GHMA 2VMGA 2WA4A 2YPDA 4XMAA 2WNVA 4FPLA 2IWGB 3O12A 3WNOA 3NRUA 3RQ0A 3VBHC 4W6WA 5IYYA 3ZSKA 3THCA 4EWDA 1CJPA 2A7AA 1U5XA 1ZA7A 4BM8A 1QQP2 2IXHA 2XJSA 2HEYF 1QGLA 1RHI3 2VTXA 4MVTA 2A3XA 5C3SA 3M8LA 1WCSA 2DCYA 4F7ZA 1YI7A 4GD4A 1UOFA 4Y1VA 5FZIA 5APAA 5GKAC 3WDYA 1JOJA 4QX8A 3WF0A 4Q8LA 5LATA 4IXLA 4YPJA 2LS6A 4COZA 2VW2A 4XZUG 1OHFA 2OUHA 1SLTA 4YNIA 4CUAA 4M01A 3RJ2X 2QKDA 4LBJA 3NWKA 5FJKA 4V2VA 1LCLA 3ZXDA 2GC1A 5DZFA 5A3PA 5IVVA 3H9AA 4TSVA 5L19A 1H1IA 3POWA 1WBLA 2ZGUA 3MLKA 4N7UA 2JICA 2D6LX 2JKXA 5FKCA 3MLLA 3HBZA 4H14A 4XMIA 4KWUA 2VQAA 4FPFA 4GQ7A 4WM7C 1OH3A 2OVUA 3B7MA 5D8AC 4DEVA 2JDPA 4CDUA 3W59A 1RUI2 1YYNA 3MYXA 1L7QA 3KD4A 2WS92 2D7FA 1WD3A 2VO5A 2VOVA 2ZCWA 3C7HA 4WVMA 3USUA 2Y33A 2LUWA 4DOUA 3RRDA 3UKNA 1CPMA 4AI9A 4BLIA 3IDAA 4KMQA 4CXYA 3UYJA 1XU2A 3PUIA 3UESA 2VMHA 4J6GA 3BTXA 2Q1ZB 3VHRA 1JUHA 4AK3A 2Q8EA 3SH5A 4TN7A 1HRI2 1U12A 4DY5A 4FSJA 5DABA 5HPOA 4RYDA 1YNAA 5F3GA 2MHFA 2ORXA 1BBT2 3K51A 3K77A 4HN0A 2K46A 3GF6A 3WW4A 5IHRA 2CDOA 4MADA 1AXZA 4Q0QA 3BB6A 3PUHA 5FBJA 1OKQA 3AYAA 4DXZA 4ORFA 4YW7A 2VTFA 5JUVA 1ULOA 2E53A 2W68A 2X5IB 5FZEA 3VDAA 1T6GC 3AX4A 3GNEA 1C8M3 3C3VA 1ODMA 2EICA 1WCKA 4WVVA 1GWKA 2CY6A 4FP2A 2RR12 5IK4A 3POIA 5FYHA 5JLVA 4KGQA 2NP0A 2H0VA 2XKOA 3ES4A 4QXCA 3LA3A 1NCQA 1LOGA 1MS0A 3ZFEC 3ZXKA 1J1TA 3I2FA 3VBSC 4YSFA 1HKDA 4GMP0 3T4VA 1AL22 2DCTA 3T0DA 1XNBA 3VBUB 3EJKA 1LGNA 2FZ2A 3TRSB 1QXRA 4RQPA 4UI9L 1Q8VA 3J7HA 3K2OA 3OJBA 5DUVA 3ZMNA 1B35C 4KI5M 4AVTA 4BQ5A 4MGTA 1NT0A 3KWVA 3M1HA 1BCXA 1R1A2 3DCQA 2HWB2 4RFRB 3R4DB 5DDJ2 2QQJA 5I93A 1UZYA 2DBNA 5J3UA 3N36A 1W03A 3ETPA 1QDOA 2R041 5FZHA 2VQUA 3IKWA 5LA9A 5L7OC 2JE8A 2D6MA 4JGYB 3MI8A 3VKMA 1MQTC 1LOCA 2KD7A 1LHVA 3BOWA 4EN0A 3S0MA 1N1TA 2VNGA 3AFGA 3BU0A 1AR73 3ETQA 5FYSA 4PF5A 1ZRFA 4HVOA 4QQOA 1RJ7A 1DQ6A 1S2BA 2VOXA 3HN3A 4AEDA 1Q43A 3ACGA 3ZFGC 4XQ4A 4UT5A 3PL0A 3QD6A 4GWNA 3PTYA 1E57A 2WINB 2RS51 1HRV1 1RUF1 1UOBA 1YQ6A 2VCCA 5FY8A 3RJRA 1WLCA 2PLV3 5K0UC 2VZ3A 3B69A 4CU9A 4BOWA 4ZKTB 1NQJA 1CD3G 1OA2A 3E1F1 2GDFA 3NNLA 1V6KA 2D6KA 4CP0A 4CDUC 4Q0VA 1AR82 2AEZA 5H9QA 3SH3A 3BVCA 3MEPA 1H1MA 5DAPA 3PUAA 5GZEA 2GC0A 4Q4W1 1G9FA 5CA6A 1R082 3OD4A 4LUKA 5LA1A 4GULA 1EV12 1QHDA 4BQ4A 1RUC1 3NKGA 3HEIA 5B4XA 3J7NA 4L0PA 1VBE2 3N7MA 1NCRA 1H9WA 2EALA 1ULPA 1NZCA 4DPNA 1UO9A 4CCLA 2VW1A 4OZOA 5J09A 3DXTA 5LASA 2VOWA 1W6OB 3LEIA 4XFIA 1QJY2 2B7YA 4XBNA 1O3SA 3AMMA 3KLSA 1WCDJ 5FP3A 2WAOA 2Z4FA 2GZWA 2XJVA 4FTEA 1QH6A 4CCJA 1CX4A 3PLQA 3JB4C 1V00A 3KF5A 3KMHA 1SPPB 2OZJA 4AL9A 4YGCA 5CB7A 3MHZA 3WDUA 3KT1A 5ABJA 5FZ7A 1AR91 3I2DA 3I7DA 3LWCA 2WS91 4GMP3 5FJHA 2RS32 3U78A 3VKFC 3WG2A 4YW4A 5IWFA 5A80A 4CU6A 3WR0A 2HYKA 3K4DA 3ZFEA 1WW5A 1Y7BA 2Z2SB 4W6XA 1AR61 1LOFC 4U36A 4WV8A 1W6NA 4AVAA 5JPNB 2ZGOA 1S0IA 2YC2A 4RR3C 3CL1A 1BEV1 2VBBA 4OYUA 4GB32 2OYZA 2E31A 4MGKE 2WZR3 1FV3A 1YQ8A 4LO6B 3JQXA 4EE2A 4KBBA 3HMYA 1FX5A 1PIV2 2W87A 3WQ0A 2ZMNA 1UYZA 4BQXA 4Y22A 1HW5A 1HRV2 1OFSA 3WF3A
chains in the Genus database with same CATH topology
3IDCB 1BVVA 4YZ5A 1S2KA 3JCIA 5FLHA 2H6BA 4COWA 4HKOA 3I4IA 1C5HA 5AC93 3FBYA 2DWRA 3B02A 3GALA 3IIAA 3VGIA 2GH8A 2PAMA 3ASIA 3K48A 4ZU4A 4JRLA 4C0BA 2ZGQA 1POV3 1K5MC 3LGRA 3WUCA 4BE3A 3UKTA 2ZS6B 1QQP3 4LE4A 2I2SA 3EBRA 2JKBA 1FOD3 1YFYA 2Q4SA 1WGPA 4QM8A 2TEPA 4PBPA 2UURA 1ZYBA 4IEVA 3CJIC 1AR63 4E4ZA 1WLDA 2ZGNA 3M3QA 1GQGA 2WSVA 3EXUA 3ZYGA 4LT5A 1LOEA 1FPN3 5BYNA 2WC2A 4JRAA 4LO5B 3AZYA 4PLOA 1YIFA 4IETA 3C2UA 3U4XA 3VZOA 4IEZA 1PGW2 2VECA 4WZCA 3FJSA 4KWJA 4H55A 2WLPA 2D93A 4Q4X2 4RQPC 5FO8B 4P9WA 2DVFA 1PK6B 4CRQA 3RZZA 1ND3C 4DS0A 2EXHA 2XBO2 4XFHA 4RFT0 3TBDA 1S55A 4F83A 3ILRA 2LALA 1AYN2 3IM0A 5DUUA 3WV6A 1ND2C 3N35A 3WNXA 1ASJ1 3ZXGA 3JBG3 1F9KA 2C9AA 2GNMA 2CGOA 3AP7A 2HKXA 5GLZA 4QMAA 2HWE2 3Q9OA 4Q4W2 5F9TA 1J3QA 4Q4Y3 4B7EA 1UX6A 1COV1 1RUC2 1LU1A 4WZFA 1XXNA 4YM1A 4Q8KA 2XWBB 3EQEA 3LAGA 4PLNA 4GXLA 1O4TA 1VBB3 5DUWA 1B35A 1ND3B 4LBLA 1FPN1 1W6NB 3FUQA 1WBFA 3J4UH 5C8CA 2NPIA 4QHBA 3E97A 3E5QA 4L8QA 1UMZA 2B5HA 3ELNA 4PBOA 3VZKA 4AE2A 4IV3B 4AFCA 5A32B 1SCRA 1V6IA 2VNRA 1QKQA 1TNRA 1AR92 2QZ2A 3I59B 1CAVA 1PGL2 1WMEA 3H50A 2TUNA 2YROA 2XLAA 5K0UA 1QDCA 1UN1A 3VZLA 3PVNA 3WLUA 1IS5A 4CEWA 4GA9A 3AP4A 4M3CE 1IKPA 4B29A 5T5LA 3ZN6A 2EXKA 3L2YA 1TME3 1I6XA 2ZKLA 2HWF1 4CEYB 5GLVA 1OQDA 3BOPA 4COVA 4KH9A 3MIHA 2LM3A 1JYIA 4FTSA 1FATA 4K1ZA 1SBEA 3SCHA 2RS52 2WS93 4G3YC 4GMP1 2JG8C 2VVEA 2NMOA 5FBZA 4AVCA 2BNOA 2ENRA 2QQPA 3VZJA 2X29A 1VBD2 4OLLA 1AF9A 1PO12 1LODA 1VBB2 1IZ3A 4HL0A 5KXCA 1REEA 3USSA 1QJZA 3WDTA 4AEJA 4RA0A 1LOFA 4MGYE 5GLUA 1WW4A 4DZGA 4GH4A 1V6OA 1VJ2A 2R0HA 2Y26A 3LB9A 1RUJ3 3OY8A 3ZSLA 4YARA 4AEKA 1AYN3 1X50A 4OVEA 1PK6C 2WSUA 1M4WA 1W6MA 4YW1A 1C3HA 1BMV1 3MW2A 4R52A 4TWTA 2YC0A 1SACA 1ZBE3 4WBBA 1YFUA 3VBRB 2GMPA 4AEDC 3H3ZA 4KWKA 2VUJA 5KXEA 1NXMA 2ZMLA 1MR5A 4U2AA 1G9BA 2ES3A 4AI3A 4LBMA 3RPQA 1OD5A 3E5UA 4P5HA 4M00A 1RUH2 2ZGMA 2E63A 2RE9A 3GZUC 4M3CF 4ITCA 1BZWA 1V6NA 3NAPB 3WQ7A 4JV4A 2JEMA 2KM2A 2NMNA 2R061 2ZABA 1W6OA 5L7OA 4M3CA 4XFBA 3H1MA 5DZEA 1SMVA 4NO4A 2BW8A 1J1LA 1VAMA 4AGVA 4BH9A 3QOPA 4SBVA 3PJYA 3MF9A 1ZZCA 1LB2A 1HX6A 2ET1A 2EF6A 1B09A 2DCJA 3AXDA 2EIGA 1LEDA 4NR1A 1FYUA 1DYKA 3M3EA 2HWC2 5EWSA 1V6LA 1ZBA2 2P37A 2CL2A 3VKOA 3N7LA 3GYDA 4WM7B 1TME2 2TBVA 1DQ0A 1URXA 4RS5C 4WM8B 3BIWE 3SITA 1Q8OA 4JGZB 4ZXKA 1FXZA 1KDMA 1VIWB 3WP3A 4CEYC 4I0BA 2XLGA 2GN7A 5BNPA 3ZXFA 5JIUA 1G9AA 3VKNA 3NV1A 4R4ZA 1VBD3 4RHV3 5D8AB 3THTA 3WW2A 1DU3D 3R0RA 2ETEA 1LENA 3POYA 4LBQB 4OUSA 5GJ6A 5ABJC 1C28A 2A71A 4H7LA 4YYOA 4Y20B 5KC6A 3AYEA 2EXJA 2BVBA 3VKLA 4XFCA 2BTVC 3BTAA 1SFYA 3OGGA 3VBHB 1PGW1 3WDWA 2H0BA 4BLJA 3LSEA 2JXAA 1H2NA 1GNHA 2ZMKA 5H9PA 1O7FA 3VBUC 5BNNB 2D44A 1RB8G 3MPBA 4XTMA 4LA2A 4A3XA 5AC92 4JAAA 1MS4A 1PO21 4LA3A 2N7GA 4AHXA 1BBT1 1JUIA 3ZFFC 4E4SA 1DGRA 2DFCA 3M4FA 4FPJA 1ENSA 4XFFA 5KHKA 1C1LA 3MIEA 2HWF3 1KJLA 1DF0A 5J36A 4KU7A 4CZSA 5L36A 4IEWA 5CBLA 2A6XA 4I2OA 1RIRA 3USUB 5BNOA 1ZBA3 5CU1A 1GICA 2V73A 2WFF3 4MUVA 5ABJB 1AL21 4AFMA 4AF9A 5KBFA 4NWVA 4META 3NVCA 3TNPB 1QJU1 4URTA 2E51A 3J9SA 2HWE3 3UK9A 5F1RA 2DYCA 3DKWA 2QVSB 1K5MA 4TYSA 3AKQA 2QDRA 2GNBA 3P3NA 2R072 2UYAA 1A78A 5JZGC 1J3RA 1UU4A 2WNUB 5FQ0B 3FHIB 1GZWB 1RUH1 5FAXA 2ERFA 2R6QA 1ENRA 1PVC1 2E9QA 3PMEA 1U5ZA 4Y22B 4B8EA 1IPJA 4FXKB 1W6PB 2Q5TA 1ND2B 5JWPA 4KGGA 5E8AA 1VLNA 4N7IA 2QJVA 4XQDA 1ZBE1 2HWF2 2GALA 2K0GA 1D4VB 1W6QB 4PDWA 3RS6A 4GIQA 1HXS1 1X36A 2DVDA 1RTVA 3HT1A 4RQPB 2WWSA 4PJYA 3ILFA 3FLPA 2BEOA 3B9CA 4X8PA 1ZBA1 2ZOEB 2VU9A 4KWLA 5GALA 1AL0G 3OF1A 4LBQA 4OI2A 3KGZA 4CEWB 5C4WA 1NCQB 4AI8A 3QBQA 1AX1A 1ZZBA 1QJU3 3CO2A 3SLIA 4G4FA 1ZREA 3T1LA 1FOD1 3SCGA 2I45A 2JG9B 3JB8A 4FPKA 4LE3A 5GZDA 1H8VA 1QXJA 5JZGB 4JDMA 2UY9A 4HN1A 1JH5A 1RUF3 1SEFA 3N7JA 4COYA 2AREA 1GR3A 3ZMOA 1G6NA 2DVBA 4AQSA 4D7SA 1OA4A 4DQAA 3J8F1 3AP9A 4XW3A 5CFDA 2ARBA 2NM1A 1X8EA 1A6CA 3GZTB 2PN5A 5A33A 1NLRA 1VBE3 2VULA 4XTPA 2P34A 4AEDB 5KHGA 4C91A 1O5UA 2HWB1 1G7YA 4P9LA 4AFAA 3OCPA 3VV1A 2A6ZA 1VRH3 1NCRB 3JBG1 5KHJA 2D3PA 4FPOB 4L2NA 2XG3A 1XNCA 2A6YA 1PM7A 4GH4C 1HXS2 4YZ4A 3V0BB 3PJQA 1AR93 3TOJA 3LZZA 5BNPC 1JW6A 3E6BA 1ND3A 3OD0A 4QGLA 4XJ9A 1H8TA 5ACA3 3D0JA 1U0AA 5LEKA 3DGTA 1RUF2 4RL7A 3NSTA 4K21A 4QGMA 1C5IA 1PHMA 1OSGA 3W58A 3H1WA 3LKJA 5A32A 5IT6A 3PVEA 1YFWA 1UU6A 2MEV3 4D69A 5J37A 2XH6A 1QJU2 3AKPA 2DTWA 1UAIA 4CDQB 4DNYA 2YZ4A 3CNAA 1SBFA 4HK8A 3VBFA 4IERA 3ST7A 4AGRA 4XXAA 1CAWB 4YM2A 5HXVA 1G9CA 4FPYA 4JTOA 3WZ1A 1HQWA 1EPZA 2VH9A 1JTZX 4BA6A 1O3QA 3VBRC 3RNSA 1RC6A 2XBO3 4NPRA 2FMYA 1AHSA 2PAKA 4D7YA 1AJKA 5JCTA 4XPVA 2ZA9A 1DQ1A 2RHPA 2WT1A 3FX3A 4CP1A 3WG4A 2DVGA 2IZWA 4Y24A 2DU0A 1CAXB 1DZQA 3ZFGA 1RUH3 3B01A 1PZ9A 4G9SB 4QQ2A 1ZRDA 4E27A 5CFDC 3OY8B 2RMU3 2IFWA 3GBWA 4IEOA 1AX2A 1EAH2 2JENA 2NQYA 2RS12 3PVOA 3CJXA 5I0UA 1CAUA 1H2KA 1RUG3 2IXKA 3WCRA 3NAPC 1S0GA 1D4M1 5CFCC 4Q4X3 4EN8B 2D3SA 3WY6A 4Q27A 4YVWA 1DIWA 5HBAA 1ULDA 5GZCA 4Z8BA 2XJUA 4XJ8A 4Q29A 2MNGA 3ZO0B 1QOSA 4IEYA 1XYOA 2XJPA 3O0WA 2WNUC 4OHXA 2XL7A 4GKXA 2CNAA 4OUMA 1FPN2 3TN93 1VBA1 5A3LA 3PMSA 3IDBB 1GLHA 3VBSB 4FP3A 3VZMA 4FAGA 1ULGA 4INDA 1VRH1 4XDQA 3VL9A 1NG0A 1RHI1 2R063 2WA3A 3OYWA 3T2TA 5HI0A 1OI6A 1SCSA 3M2MA 3UKVA 5JOYA 4XBLA 3LOIA 5LK7B 1N1VA 1Q8SA 2QNKA 1Q8PA 3ZSMA 4P9IA 1H2MA 2VXRA 4AQ6A 4DINB 2WJSA 4P9YA 1YO8A 3MIGA 4HPKB 2YPJA 2C1FA 2O1QA 1Z7S2 2JG8B 4K8FA 3PNAA 2OW4A 3I54A 1B35B 1XQNA 4TLFA 4Z2WA 4C90A 5J98B 4LBKA 4ONUA 2AUYA 3IDEA 3VBOA 4B4PA 3QACA 2HWD2 2X8KA 3VBUA 5BNNC 4E2QA 1V6JA 4EWEA 3VBFB 1YIPA 1MS1A 1RUC3 2JD4A 3WW1A 3ZX7A 3TN91 1V70A 1CESA 5IK7A 2WQZC 1SDWA 5D8AA 1D2QA 4BQ1A 4QPGA 3ES1A 1YJKA 4JDNA 4IV3C 4HZFA 3S30A 3NKTA 1HLCA 4IEQA 3LCPA 3NV3A 1RUG2 5LRRA 1YRZA 4K20A 1M06G 4W65A 2RR11 2GNDA 3O0XA 4XXPA 5KXBA 2Y0IA 4NHMA 5H9RA 2BNMA 2GC2A 4N43C 1Y9QA 1WMDA 2A6WA 3SXWA 1V9U2 3WW3A 2IXCA 2DURA 4KL1A 4S2FA 2Q8OA 5FO9B 2DVAA 3IPVA 2ZX4A 4OHZA 2MEV1 3TWIA 3MPPG 3SHRA 1RUJ1 4JGZC 2D6PA 5JZGA 3KCYA 2QFEA 3APBA 3R4SA 5SV5A 2D6OX 1BEV3 5JAXA 4LBOA 4W6YA 3WXPA 1X8MA 2TNFA 5DDJ1 1YFXA 4DRVA 5AVAA 2Z79A 2XVKA 1NE4A 2GH2A 2A70A 3RI9A 2PAEA 2ILMA 3LOBA 4LHNA 5CADA 2ZBJA 5EYXA 4NWWA 3FFZA 5I8SA 4EV0A 5KHHA 3V65A 3ENRA 2R043 1CGPA 4GH4B 4AWDA 1Z7S3 4SLIA 5LK5A 3WP6A 2B39A 2P3JA 3ILNA 1Q8QA 5GLTA 4CDUB 4EJRA 3AM2A 1F5FA 1LHNA 3ZPYA 1QQP1 1QF3A 4EN7B 3GHNA 4UW6A 4JC1A 1X33A 3R4UA 1NXD1 3ACLA 4MXWA 3VDDB 1UU5A 4QPIB 3V0BA 3VBRA 4QQPA 2ZTNA 1RUG1 3D5OA 5JOWA 4L92A 1JYCA 1EV11 5DXDA 5ACA2 1JBCA 2W0XA 4JCKA 1OQEA 1ULEA 4BPZA 1VBC1 2ZHNA 2BYVE 3FLTA 5J96B 4B4QA 5F5QA 1RUD2 1REDA 2ZHLA 1FMD2 1R1ZA 1VAKA 1W6QA 2VGDA 2Y0OA 4N90A 5L7OB 5FOJB 4YVSA 2EVXA 3AZWA 1NE6A 1MZFA 1AYM1 3MW3A 4XHXA 3V0AA 1EY2A 4D94A 2HJIA 3H7JA 4Y1UA 4E2SA 2CWMA 2YGMA 4XOGA 3A0NA 2W52A 1Y3TA 4OI0A 2ZHMA 3VL8A 4V1PA 2BFUS 4RSUA 1PO22 3M7AA 1HQNA 2BBVA 2ZPXA 3NO8A 5C9AB 1RUE2 5EYYA 1KFXL 3D6EA 2RS11 4GB31 2ZAHA 3B5LB 4JGZA 2YY1A 3KGLA 1F2NA 1FAYA 4FCAA 2NN8A 3S7EA 4R9DA 2CYFA 4F3JA 3FFQA 4EROA 1FMD3 3E5XA 3ZDSA 3G7DA 3MGUA 3ZFGB 3M70A 5FO7B 2WZR1 3DN7A 1DBNA 2E7TA 3N7KA 4YZ3A 1H9PA 4ES9A 2A6VA 4P9JA 3ZIWA 5GM0A 4YW2A 1GYKA 1KXGA 4K6BA 1OFNA 4AFDA 3RI8A 3QLQA 1AYM3 1V9U1 3KCCA 2VW0A 1MACA 4P9XA 1AR72 1N1YA 2MEV2 1R091 4OHYA 4XYXA 4JTNA 5BNNA 2Q30A 2RR13 1PMIA 1ULFA 1DQ4A 2HEWF 2ZACA 4BMBA 1ENQA 5T50A 5CG8A 1Z7S1 2ZGPA 4XF0A 4MXWB 2WZPP 2ZAAA 3HN1A 2ZGSA 3LA2A 2I74A 4QD2A 4RGGA 1N3OA 4MLOA 1ZA4A 1RMU2 1TNFA 2WQ4A 2RJKA 2GMEA 1OPMA 4YFZA 1G86A 1LKNA 1AXYA 5DDJ3 1UD1A 4PCRA 5C8CB 1C8M1 4OI4A 1OLRA 3RSJA 1DGWX 3TN92 4K9SA 2OIIA 2AYHA 2BUKA 2K2SA 2UWBA 4YRDA 1A8MA 3CU7A 4IV3A 5HCAA 2W39A 5I0TA 1ASJ2 4DRRA 4CEWC 2YUEA 3POSA 2DTYA 1A3KA 4I3GA 4M0HA 4I09A 4LHKA 1CIWA 1DZRA 1FI2A 4YVWC 5K0UB 4XIKA 4HFSA 1CVNA