3BIWE

Crystal structure of the neuroligin-1/neurexin-1beta synaptic adhesion complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
177
structure length
177
Chain Sequence
HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuroligin-1
publication title Structures of Neuroligin-1 and the Neuroligin-1/Neurexin-1beta Complex Reveal Specific Protein-Protein and Protein-Ca(2+) Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion/cell adhesion
total genus 36
structure length 177
sequence length 177
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3biwE00
2JE7A 5T54A 2ZZJA 2R49A 1KJRA 2A3XA 4W65A 1UZYA 2D3RA 2RHPA 3SISA 1LHNA 2PHTA 2WT2A 2H0BA 4AWDA 4BMBA 1SLIA 1DFQA 3WDVA 2G4IA 2ZABA 5DZGA 4YG0A 2R1DA 2YXSA 2DVFA 3V0BA 3U4XA 4CTEA 1N3PA 1HKDA 3SH4A 2XB6C 5DUUA 5DUWA 4DRRA 2AUYA 1D2SA 2D6LX 3VKOA 1KDKA 4BQ1A 1NXD1 1F9KA 1SLAA 2DV9A 2VW2A 1IKQA 4K21A 5KXCA 2VW1A 3N7JA 3VV1A 1LHWA 1UN1A 3N7KA 1Q8OA 1ZA4A 1DBNA 2DTYA 1LOFC 1WW7A 2OVUA 4CRQA 2TEPA 4YZ3A 1GLHA 1GKBA 3ENRA 3WNXA 2A70A 2ZGKA 4YZ5A 1ENRA 1WW4A 4LBQD 1YO8A 1W6MA 1QGLA 1C4RA 2P34A 3ILFA 3QLQA 4Q26A 5DZEA 3AX4A 2GALA 4NOTA 5T5LA 4BLIA 4M3CE 2EXIA 3AYCA 5E89A 5EXOA 4OZXA 1CVNA 1KJLA 2DVBA 4ISQA 3ZPYA 1JOJA 3WVJA 2GN7A 1AVBA 1V6LA 1TEIA 1KITA 1LOEA 2ZGPA 4YZ2A 4XTPA 4GWMA 1LHOA 2DURA 3I4IA 1IOAA 4FPLA 4XIOA 1W6MB 3UK9A 4PBOA 4P9YA 5F9TA 5EYYA 3A0NA 1RIRA 3QCWA 1Z0HA 3AP4A 4XZPA 4I30A 3IM0A 2WQZC 1GNHA 1MS4A 3SLIA 1VALA 3M3QA 4H55A 4PCRA 2D6PA 3OYWB 3RRDA 4BLJA 2JJ6A 4R9DA 1S0CA 3T1LA 2WSUA 2UWAA 4DRVA 4R9AA 1DQ5A 2ENRA 2KM2A 2Z42A 3WG1A 5BYNA 1UMZA 3MW2A 3USUB 1G9DA 1CONA 4R9BA 1HDKA 2D6MA 5T5OA 1MR5A 1W6NA 2ZBJA 3NV2A 3RQ0A 3WZ1A 5IK7A 3IPVB 2ZGLA 4FPOB 3OY8B 3UL2A 4GA9A 4XYXA 1GYKA 1FX5A 1QDOA 3AYEA 1RITA 2A7AA 2BQPA 5JDBA 3ASIA 2OUJA 4KBBA 4BPZA 4FPEA 2AH2A 4YM1A 3ATGA 4XJZA 3WG3A 3ZXFA 2EAKA 1W6QB 1LESA 1G7YA 1SBDA 2ZGSA 2D43A 3PVNA 4LBQA 2SBAA 1U0AA 4D69A 3D6EA 3ILRA 3O0XA 1S0IA 5L73A 4TZDA 1IS4A 1SACA 1ULFA 1AJKA 2NZ9A 2VU9A 4M3CB 1GZ9A 2DYCA 5GLVA 4FPHA 1WD4A 1IS6A 4LBLA 1DYKA 1LOGA 1AX1A 3AZWA 4SLIA 4YW4A 1YXWA 1QOOA 3ZSKA 3SH5A 4AGGA 1ULEA 4FOYA 4FOWA 4PQ9A 3AP5A 4FQ4A 4UW3A 3N36A 3AJZA 1H9PA 4YW3A 1FYUA 2YMZA 1PZ9A 3HR9A 4WVVA 2VXRA 3POSA 1S0EA 5GZEA 4NO4A 4XJ8A 2R0HA 1DLLA 4Z8BA 3W58A 1KQRA 5HCBA 2DVAA 2GDFA 3NWKA 5IUQA 5CA6A 5GZGA 3V65A 2JECA 3SH3A 3WCSA 3FUQA 1JW6A 1LGBA 1UKGA 3B69A 1V6JA 5H9RA 1FV2A 3GNEA 1PZ7A 3B9CA 5CB7A 1LHUA 4BM8A 1GNZA 2LALA 2YY1A 1SBFA 3WDUA 5KXEA 1D0HA 4DS0A 3R4UA 1IKPA 1GICA 4XIKA 1JYIA 1AF9A 1S0DA 1R1ZA 3ZXEA 2GNBA 1WBLA 1C1FA 3WOGA 2CTVA 2DU0A 4XHBA 2DUPA 4XHXA 5GJ6A 1C57A 2D44A 1LENA 2ZMNA 4Y22B 4YM3A 4YG3A 1WW5A 3M2MA 1GV9A 2PHUA 2ZMLA 1UPSA 3M3CA 5E88A 4AGVA 5JOYA 3O5SA 4XBLA 2A6ZA 4AGRA 1QF3A 2JDZA 4RL7A 5FREA 1BZWA 1RINA 1BKZA 5JOXA 2ZGOA 3AZXA 5DG2A 5KXBA 3JU9A 1F31A 1WCSA 5GALA 2ZHNA 4FOQA 1DGLA 2EIGA 2P3IA 4JCKA 1ULCA 4XILA 4M01A 1G9BA 1SBEA 2AYHA 4Q8KA 1Q56A 1ONAA 1QDCA 2CY6A 1S1AA 2A6XA 4ATEA 2GN3A 2WKKA 3AZZA 3MEPA 5CBLA 2ZACA 3AP9A 4BOWA 1N3QA 3V0BB 3TAYA 1I1EA 1A3KA 3L2YA 2YV8A 1N1VA 1SLLA 1WD3A 3AXDA 3BOPA 1LOAA 4XJAA 2DUOA 4LBNA 4AVVA 1LGCA 2FHRA 2EXKA 2UU8A 4ZXKA 4M3CF 3HN1A 4YFZA 2EALA 4Y1YA 2C5DA 1HLCA 1WLWA 1Q8QA 3RS6A 2A3WA 3Q9OA 2E7TA 3FFZA 1Z78A 1LTEA 1S0FA 4ASMB 5DUXA 2GNMA 2ARBA 2W08A 2P3JA 2OW4A 3OBTA 1GZWA 1H9WA 1G9FA 1N47A 1LECA 1YRZA 2WJSA 1WLCA 3M3OA 3ZYPA 1WUVA 5FRAA 1QNWA 1LCLA 2NN8A 3POYA 3PMEA 4Y20A 5SV8A 3OGGA 1Q8PA 1G86A 3WDYA 1AXZA 1I3HA 4TYSA 3IKWA 3KQRA 5GLZA 1BQPA 1GZWB 1CR7A 3WCRA 3C2UA 3DGTA 1GZCA 4YM0A 1CQ9A 1EPWA 5HCFA 5T5JA 2VW0A 1IS5A 3WDTA 1QOSA 2AR6A 1O4ZA 5IK8A 4FQZA 3A0KA 1JUIA 1SCSA 5DG1A 4U2AA 4YGCA 2D3SA 2DTWA 3A4UA 4Q1PA 4XMAA 1VLNA 5GZFA 2DWRA 1KRIA 3ZSMA 5GLTA 2PHWA 4XXPA 1G9AA 1GBGA 2I2SA 2JKBA 2WT1A 3OBRA 1BJQA 1IS3A 3AZYA 1W6NB 4JRAA 4XBNA 1N1SA 2VH9A 1AX0A 5EWSA 3ZSJA 1S0BA 1GSLA 2WNEA 3AFKA 1W6OA 1HQWA 4FPJA 4YW1A 3WG2A 1MACA 3WG4A 3WLUA 1MS1A 3PVEA 2NYYA 1QOTA 2ZHLA 3FUOA 4XE9A 3WDWA 2ZGQA 5JOZA 1LJ7A 1MS8A 2CYFA 3CNAA 3DUIA 3LSEA 3MW3A 4UW5A 5KXDA 1UZZA 1UL9A 1LEDA 1FV3A 1QKQA 4LBQB 1FAYA 2W68A 3IN9A 2A6WA 3O0WA 1ENQA 3BIWE 1Q8VA 5IT6A 5H9QA 4K20A 4BMEA 2E6VA 3O12A 2ZHKA 4YZ1A 1LEMA 4CZSA 5EYXA 3INAA 2E51A 4XMIA 5DUVA 2V73A 1AXKA 1MVEA 5H9PA 4DPNA 1J1TA 1URXA 1CPMA 2GNDA 2V5YA 3B3QE 2NP0A 4XBQA 3POWA 1DZQA 3MPPG 1AXYA 1V6OA 1N1YA 1YYNA 3AK0A 4GXLA 3ZXKA 3KM5A 4FP2A 2D7FA 4C1XA 1B09A 1W6PA 4Q27A 4PF5A 5DZFA 3V0AA 5JOWA 2FMDA 4Q2FA 2R1BA 2W39A 1SLTA 2D3PA 3LCPA 4LBMA 3AYAA 4UW6A 3TB0A 3WHUA 1CIWA 5AVAA 1ZM1A 4FPCA 3VUOA 4L8QA 2DU1A 4P9WA 1VIWB 4GALA 4AVSA 2A6YA 1JN2P 3VKFC 1JHNA 1W6PB 3M3EA 4FOVA 4F83A 1BXHA 4YGBA 1V6IA 5GZDA 1S0JA 4WVWA 1LGNA 5HCAA 2ZGTA 4DFSA 3ZXLA 4Y1XA 1AJOA 4LBJA 4YZ4A 1SLBA 1MS5A 3FLRA 3ILNA 3FLTA 2ZGRA 1DQ0A 2PHRA 2ZA9A 4HL0A 2D6OX 1FNZA 1WBFA 2EXHA 2E7QA 2ZHMA 3RMXA 2AREA 3H0OA 5CAZA 1LHVA 2A75A 2ZAAA 4WZFA 4XDQA 3PJQA 2ZGMA 2AGSA 3FBYA 4PBPA 1CJPA 4ZKTB 2PHXA 4Y26A 2P2KA 3UJQA 3WV6A 3WDXA 1NLSA 2D6NA 2LTNA 1OKQA 4ISRA 4MYEA 1SLCA 2VUAA 4AVTA 1W0OA 1LOBA 1LOCA 4UW4A 2PELA 1LODA 1ULDA 2P37A 1APNA 4FVVA 2B7YA 1N3OA 1YI7A 2UURA 3RSJA 1ENSA 1Q8SA 1OFSA 2OUHA 5IK4A 4IQPA 1W0PA 4XTMA 1JYCA 2DVDA 1C1LA 1XQNA 3LSDA 1FATA 2ZGNA 4GWNA 2DVGA 3JUUA 1DYPA 3B01A 3OJBA 3N7MA 4ITCA 1G9CA 1DQ4A 3OPZA 1DHKB 1LU2A 4YGDA 1LOFA 1V6KA 4Y20B 4Y1ZA 1QU0A 2GMMA 4YGEA 3OYWA 4FP3A 4LBKA 1JXNA 1MZ6A 4JC1A 1PZ8A 3NV4A 2YZ4A 2AENA 3BODA 2C9AA 3AP7A 5T50A 1YIFA 2EF6A 4YW2A 3SNMA 5H9SA 2SLIA 4WV8A 4DQAA 5DXDA 3BTAA 4RA0A 4LBOA 2WSVA 3USUA 3ZYRA 1X50A 4P9XA 1A78A 4HANA 2VY0A 3UJOA 3HMYA 3IPVA 2D6KA 4GKXA 3OY8A 4K1ZA 4ATFA 4YFWA 1WW6A 3SITA 1LULA 4YG6A 2R16A 4XJWA 5GLWA 3ZSLA 2NMOA 3AP6A 4FPFA 2JE9A 3AYDA 1V6NA 3R4SA 5F5QA 4YM2A 3ZXJA 2ZMKA 1SFYA 2XG3A 4Y1VA 1N1TA 1W6QA 5GLUA 1SCRA 4YLZA 5JVVA 1V6MA 1VAVA 1MZ5A 3W59A 1BYHA 4GKYA 4Y1UA 4YW5A 3RG0A 4XXAA 1O4YA 2E53A 1G8WA 4M3CA 1WLDA 1W6OB 1F5FA 5T55A 2ZKNA 1CESA 5E8AA 1DQ6A 4AYUA 4U36A 1MS0A 5JLVA 1H30A 1HQLA 1CPNA 3I8TA 2EXJA 4R9CA 2W52A 1AX2A 5GM0A 1FNYA 1DQ2A 2A6VA 3PVOA 3N7LA 2JD4A 1V00A 2GMEA 1QNYA 2R0FA 3N3HA 2YROA 2UWBA 1GANA 4M00A 1S0GA 2HYKA 2CWMA 3N35A 1LU1A 1OQ1A 1ULGA 2A5ZA 4K1YA 3NV3A 5GZCA 4FPKA 1Y7BA 3O0VA 3R05A 1A8DA 1DIWA 2ES3A 3T1MA 2CNAA 4Q8LA 2NMNA 1MS9A 3RMYA 1UAIA 3VKLA 2CL2A 4XJ9A 2ZGUA 2WLQA 2ERFA 3AZVA 2NM1A 3B00A 2Q5TA 1CN1A 4P14A 4Y24A 5T5PA 1DQ1A 3WUDA 3V64A 5IK5A 2CWSA 3NV1A 4FPGA 3VKMA 3WHTA 4Q1RA 5JMCA 2A3YA 2A71A 1KDMA 3APBA 3V0AB 1MVQA 3AXEA 5T52A 3GALA 4XJUA 2P3KA 3D4KA 5CNAA 3D5OA 2GMPA 3T2TA 2PHFA 4Y22A 1QMJA 2WT0A 3MW4A 5LK5A 4C1WA 1AZDA 4FPYA 3VKNA 1JBCA 2UWCA 3AJYA 4XOGA 3FLPA 1MS3A 3IMNA 3ZVXA 1UX6A 1VAMA 2GNTA 3WUCA 3M1HA 2ARXA 2DUQA
chains in the Genus database with same CATH superfamily
2JE7A 2PAEA 5DDJ1 2R49A 3KS7A 1XB9A 2GC1A 4HKWA 4Q4X1 5IVYA 1UZYA 3CF6E 1LHNA 3WF1A 1ODMA 2WT2A 3HBZA 2HWF3 3IIAA 1O5LA 1DFQA 3FFQA 3AFGA 4L97A 3PU8A 1U5YA 2G4IA 1OA3A 4HZFA 3VBFC 2R1DA 4CPBA 2YXSA 2Y0IA 4LO8A 4ZZ8A 3U4XA 2RJKA 2XB6C 5DUWA 4DRRA 2IXJA 5FP3A 1DG6A 1NXD1 2VUDA 3HD8B 2DV9A 4CYDA 2D97A 4K21A 2VMHA 2VW1A 4LLOA 4JQTA 1Q8OA 2ZX3A 1EV11 2XOMA 2RS52 5LA9A 3VD3A 1BK1A 2HWC2 4IEWA 2W92A 3ZMOA 1W39A 1VBB3 4LHLA 1JYXA 1VMJA 4QPWA 4XF4A 1ENRA 2PXJA 1XYOA 2XHNA 4LBQD 4SBVA 4P02B 1C4RA 2VC9A 3ILFA 3ORJA 4Q26A 1RGSA 3J8F2 5K4LA 3VBOC 4NOTA 2GALA 3VHPA 1JZ8A 4XABA 4OZOA 4AFDA 4XFFA 5E89A 4AQTA 5FZLA 4CP1A 5IVJA 3ZPYA 2FDIA 3AKRA 3T4VA 2XWJB 3WVJA 2GN7A 2YFUA 5IWFA 1TEIA 1KITA 2GP3A 5AVPA 2XLGA 1MEC1 2WN3A 2XKPA 4A2UA 1JZ2A 2DURA 3DF0A 1IOAA 3I4IA 3KMHA 1W6MB 4QPIA 4V2VA 3VBHB 4QMAA 2WNUC 5F9TA 3ZR5A 2QQWA 5EYYA 1HRI2 2IUWA 5FLIA 4GMP3 2QZ2A 2R7EB 3DEMA 5C5TA 1MQTC 1Z0HA 3HOBA 4EQVA 5L19A 3AP4A 4BK5A 5C8CC 1XNTA 3IM0A 3K75B 4GMP0 1GNHA 1MS4A 2CSGA 4MVTA 3MIHA 3OYWB 2R32A 3ZFFC 5CU1A 4GZ9A 4BLJA 2JJ6A 3EMRA 5IHRA 4XF1A 3T1LA 2WSUA 2R062 4DRVA 4NIIA 2B9UA 2CHHA 5A7OA 2ENRA 3TBDA 3BB6A 3VBOB 4QHZA 2O8QA 3A7QA 4QX7A 5EPAA 2XJSA 2JXAA 3EXUA 5JZGA 2VQ0A 2C4XA 2ADEA 2DFCA 5T5OA 3RQ0A 3U10A 3WZ1A 5IK7A 1X82A 4GA9A 3J7NA 4QKNA 4R52A 3ZFGC 4BE3A 4D94A 1GYKA 1QDOA 3AYEA 4P9IA 5F6KA 1BK0A 1FMD1 3KB5A 4ZXEA 5G05L 1W9YA 1VMFA 4ZONA 4XJZA 4NHYA 5CFDC 3CKHA 3PUSA 1NCRA 1PNFA 2D43A 2O8OA 3PVNA 5FXZA 3WF2A 5BUVA 5C8CB 1VRH1 1XE8A 1VBB2 3MIGA 4TZDA 1GMMA 3O0XA 1W9SA 5FYTA 3PL0A 3WW3A 3ZFFB 5A3OA 1SMVA 5FCCA 4DB5A 2G9GA 4L11A 1NY72 1ZBE3 1WD4A 2XQRA 4P00B 3NAPA 2F6BA 3U78A 3I49A 4I3PA 3OTFA 4SLIA 3VBHA 3B9IA 1ZNPA 1A34A 1UXXX 1YXWA 1QOOA 2X5IB 2YC4A 3SH5A 1J83A 1ULEA 2JEMA 4AEJA 3AP5A 3LDBA 1IZ3A 4JZRA 4YW3A 3I2FA 1JI6A 2YMZA 5L36A 3KD4A 3HR9A 3VBSA 4AEKA 3UESA 4NO4A 4XJ8A 5FY5A 1QQP3 1OD3A 4W8JA 2GDFA 4NIHA 3X29B 5LBEA 1GWKA 4M0NA 5CKNA 3LEKA 2WC2A 1UU6A 2AC1A 3BGAA 3FUQA 5FPBA 4AVCA 3I7DA 3HAGA 3DPRA 3NNMA 1LAJA 1REFA 3GF6A 2X09A 3GNEA 3ES1A 1PZ7A 2QBXA 4META 1LHUA 1W9FA 1GNZA 2LALA 2QQKA 1SBFA 4R4XA 4X6RB 4X8PA 3ZN6A 2AACA 4JKMA 3UGHA 3R4UA 1EUUA 1IKPA 2BGCA 2WDBA 4L92A 1BCXA 2HWD3 3ABZA 4IV3C 4XIKA 4EZHA 4KMQA 1C1FA 5EJ1B 3PDQA 1JZ4A 4XHBA 3VB9A 3WP3A 4YVWA 2E31A 4HK9A 4O61A 2D44A 2BVBA 2QQLA 5DPNA 1H4GA 3HQXA 3Q8CA 1CGPA 3MBWA 1PO13 2ZMLA 2WWSA 1COV3 2V4AA 4AGVA 4CDXC 2DF7A 1DZTA 1OPOA 4AGRA 1QF3A 2JDZA 1AUYA 4RL7A 3MGUA 1CZVA 1UU5A 4IETA 4YYOA 3PTYA 2I74A 2YUEA 4UFLA 4E2QA 5JOXA 5KXBA 2V5DA 1B35A 1F31A 5GALA 4QDQA 4FOQA 2EIGA 2P3IA 2YYOA 1VBC1 3H42B 2BGOA 4M01A 5L7OC 1CIYA 2AYHA 2RM23 4XC9A 4Q8KA 1BBT2 3B93A 4ARYA 4B3NA 4BXSV 4QKFA 1KFXL 4EV0A 1PGW2 5CBLA 4IV3B 3AP9A 2EVXA 4HVRA 2Y0OA 4R4ZA 5FUNA 5LBFA 4BOWA 4CDQC 4CDWB 1BHGA 1RHI1 2VNGA 1A3KA 2VCAA 4AI0A 2XMLA 5C71A 1QQP2 3ST7A 2XJQA 2RR11 2X53S 2BEOA 2DUOA 2FHRA 4NRQA 2YC2A 3FX3A 2WINB 1V0AA 3U1XA 4YFZA 2VOTA 1I5PA 1MPXA 2KXLA 5J3UA 2E7TA 1LTEA 1S0FA 1YEWA 3NJYA 1ZBA1 1AR82 4BJ0A 2W08A 3MZHA 1OA2A 2HBUA 3H7JA 1GZWA 2JG8B 3U14A 1LECA 2WJSA 5LBCA 2JKXA 3ZYPA 5LB6A 1WUVA 2HWD2 1FOD1 3D82A 3JBG3 3POYA 1ZYBA 3PMSA 1C28A 1K42A 5A70A 4Y20A 4XF0A 1G86A 4UYBA 5CG9A 2P6CA 3GCXA 3KF5A 1YCIA 2Y6HA 5EZWA 1J3PA 2QE3A 4QPGA 3DGTA 2IWGB 2WNVA 1PO12 2ZTNA 3AVRA 2B39A 1GZCA 2MEV1 1CQ9A 5HCFA 2VW0A 2HKXA 3OUHA 4QQPA 2J1SA 3WDTA 4EN0A 1GP4A 1QOSA 4Y4YA 3SKVA 5IK8A 5DG1A 4YGCA 2YG0A 5FXVA 2D3SA 3MFCA 4Q1PA 4G4FA 4XMAA 3QOPA 5B4NA 3GZEA 4N9IA 1KGYA 1EAH3 1EY2A 3GXUA 2G1MA 4XXPA 1JYVA 2OZJA 1OF4A 3HNYM 3I59A 4A3XA 4CP9A 2CGOA 3AZYA 1L3JA 1HJGA 4JRAA 4MOAA 4AOCA 1V9U3 2I45A 2XVGA 3NVCA 4HMZA 1OFNA 4NRMA 3CO2A 5GKAC 3AFKA 3FZ3A 4AI3A 4RYDA 1HQWA 2W87A 1JZ5A 4AEDC 1MS1A 4L99A 2IXKA 4XE9A 2KR2A 3WDWA 5CISA 3LPGA 3LSEA 2F4LA 3MW3A 4FFHA 4RHV3 5HV0A 1W2NA 4LBQB 1OA4A 1O5UA 2W68A 1XNDA 5FWJA 4GH4B 1VMHA 3O0WA 3KGLA 2PLV1 1ENQA 1Q8VA 4QB6A 5H9QA 1RUJ1 4D7TA 1YFYA 1PMIA 3AVSA 2Y33A 5B4XA 1LEMA 2BBAA 4KGGA 4XUTA 3ZXDA 1UOJA 2WO7A 4QQOA 3JBG2 3DN7A 2PN5A 4E2GA 3HNMA 1K3IA 4LNVA 5FXWA 1SPPA 3ACGA 4AF9A 2VULA 4EN9B 1AL21 3NQHA 2MPFA 2FZ2A 1GQPA 1DZQA 1K5MC 2QQJA 1STMA 5FZOA 5FPUA 1GP5A 1V6OA 1N1YA 3FHIB 4Z92B 3WQ1A 4XZUG 5SV5A 2FQPA 4FP2A 4Y5Z0 2CGPA 4C1XA 4CUGA 1NA1C 1B09A 1UIKA 1W6PA 4Q27A 3J7MA 2FMDA 4Q2FA 4QXHA 2R1BA 2W39A 3EO6A 4JGZA 1UY4A 4LBMA 1CJDA 2B8MA 5FZ3A 3TB0A 4QQLA 1CIWA 2VZTA 3E5XA 4L8QA 4P9WA 5A1AA 1VIWB 5C6CA 1YJLA 3PHMA 3HVDA 4Q0QA 1EAH2 1JN2P 4Q4V1 1XNKA 3THDA 3GGLA 4J6GA 3C7GA 5GZDA 4UXAA 5DDJ3 4QAWA 2WO2A 4HLTA 4W50A 4MHRA 4Q4X3 1HW5A 1VBA1 4ONUA 4CCOA 4DFSA 3KCYA 1V9U2 3ZXLA 2ETEA 3BN6A 1SLBA 3T08A 1K5MB 1GOHA 4XCBA 3FLTA 2UY9A 5C70A 2ZGRA 3JD71 4OHXA 1RUNA 5FP9A 4RHV2 3KLSA 1NA1B 3WW1A 2D6OX 1UWWA 4ASKA 3POFA 2J7MA 4PLMA 1U5XA 2LW8A 5JAXA 2ZJCA 3B94A 4RFT0 2ZS6B 1RUI3 5C4WC 2VZ1A 5FYMA 4H3WA 5CAZA 1RUOA 1LHVA 1YQCA 1DYOA 1DGRA 2A75A 3LGRA 4UFMA 4WZFA 2HWF1 4QPIC 4XQ4A 1W8UA 2AGSA 4PBPA 3I97A 2HYXA 3LB9A 1W05A 2XR4A 3BUCA 3HQUA 1QH7A 1W8FA 4PI0A 2XLAA 4PDWC 4AVTA 5C5UA 4BIOA 2A1XA 4PIXA 1ULDA 2C26A 1R082 5FZBA 3S0MA 4CEYC 3NW4A 5A80A 2OXBA 4GQ7A 3PUIA 2HEVF 4MXVA 2V72A 1L7QA 2B7YA 1YI7A 2UURA 4OUSA 4A4AA 1ENSA 4LA3A 4QM8A 5KR7A 1O3TA 3J26N 5IK4A 2C24A 3M3IA 3VBFA 1TG7A 2XJUA 3SHRA 1JYCA 4XURA 1RUD1 4OHYA 3VLBB 1XQNA 1PO22 3GYDA 3WY6A 1BLZA 2ZGNA 2JIGA 4YRDA 1DYPA 5DDJ2 3B01A 4OI0A 3OJBA 3ZXGA 4RQPC 3N9OA 1G9CA 4Q4X2 4XPVA 3I2KA 4XW3A 4PDWB 4LE4A 3W5MA 5KBFA 3OYWA 4EZ4A 1W04A 2BZDA 2RV9A 1PZ8A 2E9QA 4PJYA 2LM3A 2YZ4A 2VG9A 1RC6A 5T50A 4YW2A 2EF6A 5IJRA 2VZPA 4ZS2A 3VBOA 5DXDA 3BTAA 4RA0A 4S2FA 3WNNA 3WNKA 3MIBA 3ZYRA 1X50A 3CLPA 4E4ZA 4FO9A 4I02A 3VBHC 4UI9L 2WZ8A 3AMPA 4K1ZA 4GKXA 2ADDA 1WW6A 1EV12 5GLWA 2ZX2A 3EQEA 3USSA 2WNUA 1VRH3 1XNBA 1I5ZA 4OULA 4WBBA 5F5QA 5LY2A 2CV6A 2ZMKA 5LA2A 4AQSA 1N1TA 4JKLA 5FYHA 2N7GA 5GLUA 2VR4A 1MQTA 1V6MA 1VAVA 3KT4A 2P4EA 5C8CA 4Q4Y1 1BYHA 1RJ7A 4XXAA 1VRBA 3DPRC 1G8WA 2Y60A 1OPMA 3ZFFA 1X9PA 5A7QA 4CCCA 2ZKNA 3CEWA 1WCDJ 2HWE1 4QXCA 5JLVA 5D1IA 3KV6A 5FZ6A 2WLPA 3Q8EA 1PHMA 1V00A 3ZFGA 2R0FA 1D2QA 1ZBE1 3AKSA 2YROA 2UWBA 4M00A 2R073 5FY1A 5F5CA 2CWMA 3N35A 5J7MA 1LU1A 1OQ1A 4FTBA 4NAOA 5JR7B 3SQOA 1NLQA 5A33B 4IUGA 2VTXA 3MPBA 1DIWA 3NL1A 2WWJA 2Y34A 1XNCA 4TLGA 5FY0A 3F95A 1BVVA 2CL2A 3BU7A 3K51A 3AM2A 2WLQA 5FYIA 2Q5TA 2NQYA 4I0AA 4CXXA 1NE4A 5T5PA 1DQ1A 4KWLA 5BNOB 5IK5A 2TUNA 5FPXA 2CWSA 4QD2A 4FPGA 2RMU1 2ILMA 3ZLIA 1FMD2 5B2GB 2A3YA 2ATFA 4P9GA 1Z7S3 2VZRA 4HSJA 5C9AC 1PMJX 3JXSA 1S2EA 1S4CA 5FZHA 3ZFEC 2GMPA 5A6XA 4F3JA 3BOWA 3H1YA 3H3LA 2UY8A 1VRH2 5DN2A 5LK5A 1PMHX 4C1WA 1J3RA 1JUHA 1JBCA 1TMF1 1ODNA 2UWCA 3FLPA 4LKFA 5F39A 2ID4A 3BYWA 4I01A 5F5IA 3T3YA 4E27A 1UKRA 1VAMA 5FYVA 5J48A 3M1HA 1IPKA 4XFBA 3D0JA 2MHFA 3NJZA 1OBNA 2Q1FA 1BMV1 1US2A 3QACA 4K6BA 1ZRIA 3FC0A 4FAGA 4W65A 4NIAA 4XACA 1COV1 1W8OA 3LZZA 3SISA 4OI2A 1AR91 1OC1A 2H0BA 4KWJA 4BMBA 1JZ7A 1SLIA 1ND3B 2ZOEB 4LT5A 3WINE 4HOOA 3THTA 4QXBA 2BNOA 2VXJA 4I0BA 4IV3A 3IT8A 4TSVA 5DZGA 5ANNA 5C9AB 1RVF1 4B7KA 1XOYA 2BWAA 3ZFEB 2RM21 1N3PA 5FAXA 3GM8A 4CTEA 3LOIA 5D8AB 1O59A 3RZJA 5DUUA 4ZU4A 2AUYA 1D2SA 3GZTB 4IV1C 4D6QA 3IDCB 5A7SA 5JR2A 3RZHA 1ZBA3 5FKCA 1IKQA 2OIIA 2WRAA 5KXCA 3AMNA 4CDXA 2TBVA 4DUWA 3N7KA 1ZA4A 2DTYA 3IZOA 1LOFC 4NAMA 1NOVA 2VBBA 1W8HA 3SEEA 2TEPA 3WF3A 3ENRA 1FOD3 1UCXA 5ISLA 1DP0A 2ZGKA 1WW4A 3ON7A 4C8DA 4QX3A 3BCWA 5FR3A 2P34A 5DZEA 5D2AA 4WVMA 4LE3A 4DY3A 5T5LA 4BLIA 3POGA 1JYTA 3AYCA 4KWKA 4JGYC 4OZXA 5EXOA 4OI1A 1KJLA 5A3PA 4NIDA 1JOJA 1V6LA 1YI9A 4CDQA 5FPZA 1O7FA 4XIOA 1VBD3 1WGPA 3K3OA 4IV1B 1JU3A 1VB2A 4N7UA 1VBC2 3LWCA 2OPWA 2J1EA 2X29A 2BOIA 3JCIA 4XZPA 2XVKA 2O14A 3BPZA 4DUXA 4H55A 4PCRA 2W94A 1PM7A 5LZ6A 4QWNA 2J1RA 4R9DA 1UZ0A 1S0CA 1RHI2 3K4AA 5FYSA 4BH9A 4DUVA 1IHMA 1DQ5A 4BQYA 5BYNA 5C3OA 1UNBA 4BQ3A 3MW2A 2RR12 3FJSA 4R9BA 2ZBJA 2WFF1 1H8TC 3R6SA 2I07B 4CCLA 1WA4A 2XGXA 3M4FA 4L9BA 4EYUA 1YFWA 1FX5A 2ZXQA 2BJSA 5I8TA 1ZBA2 3LFMA 4KBBA 2CDOA 4LTAA 4AAXA 1QH6A 4FPEA 4LR4A 4BPZA 2PLV3 2D5FA 3ATGA 3WG3A 3ZXFA 3O1RA 3AB0A 1Q43A 1J84A 1SBDA 2ZGSA 3RI8A 4LBQA 4LOTA 2SBAA 1FOD2 4A3ZA 4COYA 3CJXA 3H7YA 1RL3A 1S0IA 2VE1A 4IEVA 5L73A 4LIVA 1SACA 4M3CB 1AJKA 2NZ9A 4MV2A 4AVAA 3WXPA 1REDA 4ZZ5A 1AL23 3VDBA 1IS6A 4QX5A 4UT5A 1LOGA 1R1A1 4FFGA 4WZCA 3AZWA 1RMU1 4LQRA 1RUE1 3CIHA 5JUVA 1KS4A 2MEV2 4HG6B 3UETA 4FOWA 4AGGA 4UW3A 3HQRA 2YBSA 3AJZA 1ZZBA 2WA3A 4K9SA 1FYUA 1LR5A 2GP5A 1PZ9A 3OEBA 4S2GA 4WVVA 4EN6B 5BV6A 2VMFA 5GZEA 2ZPXA 2PTMA 2FDFA 3ECQA 3VZNA 2IXLA 4B8EA 1DLLA 4KG0A 3UYJA 1YJKA 2Q1ZB 2VTFA 1I6XA 3HN3A 5HCBA 1R091 2DVAA 3W58A 5IUQA 2Q8OA 4B4PA 4CDUB 5CA6A 3BIEA 1X8MA 4Q4V3 3V65A 2C9KA 1JYWA 2JECA 3SH3A 5CYYA 3SMHA 4JX0A 1JW6A 1LGBA 1UKGA 2J1VA 3UGFA 3ZSEA 5JXGA 1US3A 3OGSA 5I0TA 1VBA3 4CP0A 2VD7A 4BM8A 1UD1A 5CADA 1A8MA 3FMGA 1C5HA 5KXEA 2JDPA 4XFAA 3ZIWA 5K8SA 4AEMA 4RN5A 3P3PA 3JD73 1JYIA 1AF9A 1R1ZA 2DBNA 3POIA 4IE4A 3GZUC 4ZHNA 3CL1A 3WOGA 4URAA 3EHKA 3DV8A 2W9XA 2CTVA 2DU0A 2R30A 1J58A 1K5MA 2DUPA 1UZVA 4XHXA 4B1LA 1W2OA 5F3EA 4ES9A 1LENA 1UXZA 1AR71 2ZMNA 3C3VA 4C0HA 3UV9A 2PLV2 4NE9A 4QGNA 1NA1A 1RUJ2 1UPSA 3M3CA 4MGQA 5IVFA 5EV7A 3O5SA 2Y38A 4XBLA 5JOYA 4BQ2A 2V4VA 4UBHA 4X8NA 4IEOA 1QJZA 1YC61 3O1OA 3MYXA 2VOVA 2ZGOA 4RSUA 5FWEA 3JU9A 3W5NA 1DCSA 4JCKA 3T30A 1G9BA 1AL22 1LNSA 3VL8A 4BWOA 1H1IA 3H8XA 4LOSA 4IEPA 2PHLA 3BI3A 1RTVA 1O6UA 1HJFA 2EAAA 3NJXA 1RUI1 5A7NA 2WKKA 4ATEA 2ZACA 2W1SA 1C8M1 4CCMA 5KC5A 3V0BB 2GH2A 1ST8A 3MV01 4LKSA 3RPQA 4DY5A 1LOAA 1OOPB 1RUD3 4LBNA 5F37A 1LGCA 3E6CC 2EXKA 4ZXKA 5FFOC 4Q4V2 1S55A 2LRPA 2C5DA 4AQ6A 4BCUA 3Q9OA 1W06A 3FFZA 1Z78A 4ASMB 4FSJA 3SCFA 4PI2A 1VBA2 5DUXA 5C4WA 3EYPA 2FDHA 1POV1 5K0UC 1WCUA 3RYRA 1HRV1 4M0HA 2QQMA 3GJBA 1YRZA 2WZEA 3JD72 5FZFA 4A42A 3TEYA 3PMEA 4PDWA 2VQUA 3OGGA 2K0GA 3WDYA 1AXZA 3N9NA 3IB3A 1YQ5A 1C3HA 3PURA 2VBDA 2VOKA 3ZX7A 4CEYA 5HPOA 1HV1A 1BQPA 1CR7A 4QX8A 4AXOA 1RYYA 4XF3A 4N43C 4YNIA 3W20A 2HWF2 5A1LA 5FO8B 5A32B 2GC2A 2QQVA 4QQHA 1LKNA 1NT0A 1DF0A 1RXFA 1O4ZA 4FQZA 1EYBA 1NZIA 1SCSA 2X5IC 3UKVA 2W91A 2ZEYA 3MV11 3A4UA 5GZFA 4AFAA 3C7OA 4Q4Y3 2BU9A 4BQWA 5GLTA 1GOFA 1G9AA 4RQPA 2E63A 5FZGA 2H6BA 3IWZA 2JKBA 2WT1A 5I93A 5FQ0A 1S2KA 4JRLA 1IS3A 4CUAA 2BBVA 2WN2A 3D3AA 2HWE3 4NMIA 1N1SA 4JVAA 2VH9A 5EWSA 5I8SA 1S0BA 2WNEA 4FPJA 3WG4A 3ELNA 3ZXAC 4HK8A 1RUD2 1EP0A 1QOTA 2ZHLA 3C7HA 3CDZB 4UOJA 4D8MA 5BPXA 1MS8A 2CYFA 3DUIA 4N43B 1VP6A 5FZCA 4UW5A 2VUJA 1UZZA 2H0VA 3CJIB 1LEDA 2Y6GA 2D5HA 4UWDA 1FV3A 2P1BA 4BQ4A 5BNNB 1FAYA 4DINB 2VCCA 5BNQA 4LA2A 3IN9A 2A6WA 2PAKA 3N9MA 3OOXA 5FY9A 4MGYE 1Y9QA 1VB4A 4BMEA 2WR9A 1NZCA 3DKWA 2K46A 4HVOA 5EYXA 3INAA 4YZ1A 1CAWB 5A33A 5DUVA 4HPKB 4ZU5A 1AXKA 1MVEA 5H9PA 4B1MA 4DPNA 4MGTA 1WMXA 2ZX0A 2XJTA 5FV3A 3RNSA 1JODA 2R071 1H0BA 4XBQA 2RMU3 3NKGA 1PK6C 3MPPG 1IPSA 1OVPA 4GXLA 3AK0A 4HKLA 5BNOA 3NNGA 5FY7A 3VHOA 2D7FA 2VECA 4E2SA 2EIDA 2P6HA 2VCBA 1RUC1 4HETA 4OCTA 1SLTA 2D3PA 3LCPA 4UW6A 3AYAA 1TMF3 4P9JA 1ZZ9A 5EJ3A 3TNQA 4B7EA 4CDWC 4FPCA 4AVSA 4A44A 4KNCA 4Q4Y2 2Z5WA 5LK7B 3TEWA 1JHNA 5AC91 1O8SA 2Z69A 4FOVA 4F83A 3LAGA 1YHFA 1Z7S1 3GHMA 4UFKA 3GJAA 1LGNA 5KWRA 2HWE2 1W2TA 4NPMA 4A6OA 5FPAA 1AR93 1AJOA 1ZA7A 4YZ4A 2GSYA 4NHXA 4LO5B 3ILNA 1PK6B 3ZN4A 4QX1A 1P8JA 4XUNA 4HVQA 4UF0B 2WUHA 1RVF3 1NCQC 3QH6A 4FI9A 4JTOA 5IW0A 3M8LA 1OUSA 1ZBE2 5F32A 3SKJE 2JG8C 2JDUA 2ZA9A 1G6NA 3ACFA 3E5UA 3UKNA 1ZRCA 2XH6A 4DXZA 5C9AA 1FNZA 1WBFA 2EXHA 3C7FA 4XFCA 3RYKA 2ZHMA 5FZ0A 3RMXA 3H0OA 3WP5A 3ZFEA 1HX6A 5FJKA 1AR61 3RJ2X 5IATA 2PQSA 4XDQA 2QQPA 3PJQA 1L7RA 3MIFA 4ZKTB 4Y26A 2P2KA 3LA2A 3WDXA 5C3QA 4RR3B 1NLSA 2LTNA 4E9KA 5E6HA 1ZZ6A 4TLFA 1CAUB 5FO7B 1SLCA 2RMU2 2VUAA 3PIJA 1J59A 1LOCA 1W03A 4PIYA 5FDBA 5FUIA 3MDPA 2ARCA 1T2XA 1BVP1 1H6XA 1CZSA 1NCQB 4FVVA 1HB2A 4NHMA 5F2SA 2VQTA 2H6CA 4Q4W1 3S7IA 3TRSB 2XQXA 1J1LA 3ZIXA 1TMF2 1W8ZA 4XFGA 1OURA 4CVUA 3VD7A 4MSVA 4GJYA 4EWDA 1FATA 1QJX1 2ET1A 2ORZA 4E8CA 3VD4A 4QU1A 4OMDA 2PAMA 4IV1A 1E5IA 3HNBM 1BMV2 5JSPA 1XE0A 3N7MA 3WF0A 4ITCA 4V1PA 1COV2 1M06G 2Q0AA 3OPZA 1LU2A 1AR92 1LOFA 4P5YA 4CUBA 1VBD1 3OUIA 4KQ7A 4AI2A 1CAVA 1SZBA 2J1AA 1OHFA 2VQAA 4FP3A 4GH4C 1RVF2 2G9FA 1OD5A 5DAWA 2ZEWA 2WFF3 1NKGA 2RM22 2C9AA 1EPZA 1YIFA 1PVXA 3O1UA 3VUOA 1H1AA 3DYMA 1MZEA 5IVVA 4P9XA 4LKEA 1A78A 4HANA 4JGYA 4E4DX 2VY0A 1H2KA 4G3YC 2QDNA 3KT1A 1Y9GA 2VMCA 4YG6A 2XBO1 1HXS1 4GJZA 2NMOA 3AP6A 1PVC1 4FPFA 4LULA 3AYDA 5HI0A 3FL7A 1UO9A 5CFCB 3ROUA 5IAXA 3O1PA 2OQ6A 1SCRA 3KT7A 2XL7A 3NRUA 2BV4A 4AFBA 1VR3A 1JU4A 5DAXA 5CEHA 4OUMA 1HIXA 1R1A3 1XSRA 3IIIA 3K4ZA 1O4YA 3MIEA 1REEA 4M3CA 2AEYA 1RMU3 1UF2C 1RUE3 2W5FA 1F5FA 5T55A 4BK4A 4COUA 4IEQA 4E4SA 3F2ZA 1CESA 4P08A 2VVEA 1H30A 1CPNA 4KBZA 5HXVA 2W52A 5FO9B 2OPKA 1DDLA 3C7EA 1XC6A 1GU3A 2HJIA 1H8TA 1R093 3HEIA 3THPA 3N3HA 2QUOA 4AHYA 3HJRA 2QVSB 3I3QA 5JPMB 1U5IA 3TN91 3RJRA 2A5ZA 2B45X 1FPN1 5FYZA 3SEPA 3H3UA 5AFBA 2JDMA 5L7OA 3KWVA 3O0VA 4YVSC 1PIV1 4NROA 5FZ1A 3T0BA 1SQ4A 2CNAA 4LUMA 5C33A 3CQOA 1X7NA 3RMYA 3VKLA 5I0RA 3H8RA 3T0AA 2ZGUA 2NM1A 4OVEA 3THCA 3FWEA 2WFF2 3IMMA 4P14A 4Y24A 4Y33A 1JYNA 2VNOA 5FZIA 2OKXA 2VZSA 5A7WB 3WHTA 5JMCA 3KGZA 2A71A 1AR73 1O91A 2W0XA 2EICA 1PGL2 3U37A 3AXEA 5T52A 2DCTA 3T2QA 4XJUA 4AHZA 4KWUA 5LRSA 4FXKB 3Q8BA 3G7DA 2RE9A 3I54A 1RJ8A 2PHFA 4D7SA 1QMJA 1GP6A 3MW4A 3T0DA 2RVAA 5JSRA 3KV4A 4NHLA 4QKDA 1L7LA 4FPYA 2WO3A 1F15A 4QB1A 4YVSB 1KD7A 1RUG3 4IE0A 3VDDB 3ZVXA 1UX6A 4BYYA 3QBQA 2ARXA 1R1A2 2YGLA 4JDNA 5FLHA 1RMU2 1RUE2 2VNRA 1C8NA 1UYZA 3KCXA 1GUIA 3LKJA 2D3RA 5CKQA 1C8M3 2RHPA 4MGKE 1VBE1 3MUZ1 5DAVA 1WMFA 4Q5OA 4AWDA 5F3IA 4O65A 3WDVA 3KHCA 2QKDA 2F17A 3VBRB 3OGJA 4N53B 1X36A 3OPWA 1R092 4PHZA 1D0GA 1ZZ7A 4Y3OA 5FOBB 3V0BA 4HN1A 4ZY9A 5J36A 3SH4A 5HCHA 3VKOA 1QXRA 2D6LX 2FCTA 2VW2A 3H9AA 5E1RA 3T09A 4XAAA 1LHWA 1POV3 4LO4B 3VZMA 4D3WA 1HRV3 1WKYA 2GZWA 4IDZA 5LA1A 3VL9A 3POEA 1POQA 2VMIA 1W28A 1POV0 1W8TA 4YZ3A 3WNXA 2A70A 3HT1A 1WMEA 4H7MA 4YWAA 1SDWA 5JIUA 1OI6A 3ZYIB 1W6MA 3HBKA 4KI5M 4RFRB 3QLQA 1JZ3A 3AX4A 1AR72 2B4KA 2XJPA 4M3CE 1CVNA 5FLJA 4YZ2A 1AVBA 1LOEA 1QJY1 4XTPA 1LHOA 3UK9A 1RUF1 2Y6LA 1ASJ3 3W9AA 3ZKYA 4PBOA 2HEWF 1NUKA 5FZEA 4LKDA 3A0NA 3VZJA 2DDUA 2GU9A 2JDHA 5A32A 1Y4WA 4DIQA 4E4HA 5K0UB 4I30A 5LEKA 2WQZC 5L9BA 2WQ4A 1OLRA 1VALA 1IPJA 2DCZA 4BIFA 1RUI2 2FZ1A 3RRDA 5K0UA 1C8M2 5FP8A 2C0ZA 5FZ4A 3LPFA 2KM2A 3WG1A 2Z42A 4IERA 3ZOIA 3KVAA 3USUB 3IAPA 1CONA 3OEAA 2WYSA 1MR5A 2TNFA 3NV2A 1MZFA 3UGGA 2B42B 4FPOB 3ETQA 4XYXA 3AC0A 3DCQA 4LHNA 1RITA 2A7AA 5DABA 2K9ZA 3ASIA 4INDA 3VBUC 5BNOC 4N43A 4YM1A 3MI8A 2OZ6A 2RS31 5JZGB 1HRV2 1W6QB 1XJAA 2EAKA 2P5BA 3CJIA 4K40A 1G7YA 4NUBA 4WM7C 3ZYFA 5LASA 4KG8A 4UBGA 2VCMA 4AZZA 1U0AA 2X5IA 2WS91 5E16A 4D69A 3R4DB 5K9YA 1IS4A 3Q8FA 1ULFA 4WM8B 4QPYA 3J7LA 5GLVA 1GZ9A 2DYCA 4DXTA 4FTSA 1JZ6A 3OGRA 3WF4A 1DYKA 3VD9A 1F4HA 3AKTA 1NCRB 3WNOA 1AX1A 3U0ZA 1TME3 1UQXA 4YW4A 1RB8G 4AAPA 4Q29A 3ZSKA 2FDKA 3O7OA 2V09A 2HEYF 4FQ4A 4CXWA 1ZZ8A 1H9PA 2W1UA 1ALYA 2VOWA 4HN0A 2VXRA 1RUC3 3POSA 2WABA 4QB2A 2Q8CA 3I2JA 3NAPB 4CU6A 3V56A 2WYFA 3RI9A 3T4HB 3TYJA 3VBUB 4Z8BA 4PLOA 4QT6A 5LWBA 3NWKA 4NIGA 4NRPA 1ND3C 4WM7B 3CHXA 4D6RA 5AC93 5C8WA 5GZGA 5HV4A 5LBBA 5JXHA 3B69A 4A7ZA 3KV9A 3LE0A 2ORXA 5H9RA 1FV2A 1KXGA 2ET7A 2BRTA 5D8AC 5CB7A 5KHHA 2W95A 2YY1A 5IFTA 1NX9A 4Z1VA 3AL6A 1GICA 4KU8A 1S0DA 4QDSA 3OF1A 4LPLA 2GNBA 3BU0A 4FTEA 2HWB3 1PK6A 3DYPA 4LJHA 3ZO0B 1JHJA 4A7KA 1WW5A 3M2MA 2OT7A 2LS6A 4MGSA 4CA9A 3GBFA 5C3RA 2HLEA 5DAQA 3C8XA 1AR63 4P9LA 5F7UA 3SCHA 3FHAA 3KHBA 5FREA 1BZWA 1BKZA 1TQ5A 3AZXA 4YVWB 4K8RB 4CDWA 4LIUA 1WCSA 1W8NA 1LB2A 4MHUA 1DGLA 4K8FA 2JX9A 2YC0A 4XDOA 3WP4A 1ULCA 4KL1A 2R072 1SBEA 5BY5A 2VZVA 1Q56A 5FYBA 5A3WA 1QDCA 2J42A 2DFBA 2CY6A 4W6YA 3K4DA 5FMOL 4F8AA 2A6XA 3MEPA 4COWA 4UFIA 1CAUA 4HXCA 1ZRFA 1B35B 4LK6A 2JG9C 4RGAA 4RS5C 4IGOA 4L2NA 4Q4W3 1YWKA 1RUC2 3MO4A 5FZMA 1N1VA 1SLLA 3TEXA 4JKKA 1WD3A 1NCQA 3BOPA 4MXWB 4XJAA 4AFCA 4AVVA 1AYM1 2UU8A 4ET7A 2JG8A 5TSWA 3LOBA 1QJX3 4BQXA 5AC92 3HN1A 2ZEZA 2EALA 4Y1YA 5FMCA 1Z7S2 2A3WA 1WWYA 5ERLA 1VE0A 5KHJA 2VUCA 2VTXJ 3S7EA 3MUY1 4FFFA 3M3OA 1H9WA 1N47A 2RG4A 2G19A 2XJVA 4OHWA 1WLCA 3QD6A 4COVA 3GBWA 4IGQA 2NN8A 5FMBA 2RJLA 2WNOA 4JTNA 5FZDA 4HONA 5SV8A 2JG9B 1H4HA 1UOBA 2E7AA 3A22A 1H2NA 1I3HA 4RS5B 4AI1A 5A3UA 5C3SA 4E8DA 1GZWB 2QQNA 3C2UA 3JB4C 4HKOA 4LO6B 4Z82A 3WW2A 1AR62 4AL9A 1EPWA 2PA7A 4YSFA 2XBO3 1HXS3 1XSQA 3HIFA 1PVC3 2RDRA 3NMBA 2AEZA 4ZPIA 4U2AA 3EB7A 1VLNA 2DWRA 2WNVB 4Z07A 5FJHA 4I09A 4AVBA 3S57A 1KRIA 2WZR3 3ITQA 3I3MA 5F6LB 3MF6A 3PJYA 4H2AA 2PHWA 1WLTA 3AMHA 1ND2B 5ACA3 3NJVA 3OBRA 1BJQA 4JHTA 4C90A 4CDUC 3OB8A 1W6NB 4HBNA 4Q4W2 1UMHA 1HB1A 1ACCA 3LDKA 3ZSJA 1GSLA 1W0NA 2YDEA 4GH4A 3WG2A 5JSOA 4N9HA 3UT0A 1MACA 3WLUA 3PVEA 3FUOA 3P1IA 4ES8A 5JOZA 1V70A 4OQ8A 1QJX2 2KD7A 4O9EA 1HV0A 5LRRA 5KXDA 1RUH1 4GB31 3TN93 1UMIA 2E33A 2F4PA 5IAVA 1FPN3 2XKOA 3POJA 4OFGA 5EHDA 3S5AA 4LK7A 3RZGA 2C6SA 1PIV3 4CCDA 4GIQA 4K20A 3OPTA 1VBD2 2ZHKA 4CZSA 3VHNA 1VPHA 4BDVB 3ZKUA 1T6GC 4XMIA 4YARA 3LFIA 2XJRA 3ZPOA 1URXA 1CPMA 4W6XA 1O8PA 3B3QE 4MADA 3BPSA 3POWA 2JE8A 3OG2A 2BUKA 4BHPA 2X8KA 1OT5A 1PGSA 1UY2A 2D40A 1YYNA 5JIAA 3ZXKA 3KM5A 1SHWB 3K2OA 4MGZE 1NE6A 5JI7A 2XBO2 1HXS2 1YQ2A 2BTVC 3I3BA 4FFIA 1PVC2 5A7WA 1OUXA 4CXYA 3WP6A 3RZMA 3HWJA 2ZCWA 4XDPA 2HWC3 5FZOB 4H14A 3U11A 1BEV1 5I8YA 4GALA 2JWPA 1TE1B 2WZR2 2DBIA 2A6YA 2EA7A 3S30A 4MH0E 4CE8A 2VL4A 1W6PB 1A6CA 4EE2A 4YGBA 3UNPA 1V6IA 4BXFA 5FBJA 1OOPC 3O1TA 4DNYA 4YVSA 1XU2A 3TEZA 2ZGTA 5LA0A 2VO5A 1X33A 1VBE3 4Y1XA 4COZA 3L9JT 1HQNA 1MS5A 3FLRA 4WVZA 3RDIA 2YBPA 5FKBA 1GNYA 1IG3A 1DQ0A 2YPJA 1H6YA 2Q1MA 1RUG1 1UOGA 2PHRA 3K46A 4CEWC 1IGOA 4HL0A 2QZ3A 3TN92 3LEMA 1IQDC 5BNPB 3VBRA 1FPN2 4N53A 1YUDA 1KFUL 1Q3EA 1PIV2 3P3NA 2AREA 2FMYA 1DGWA 4AI8A 2JDKA 1XBFA 5F3CA 5FXXA 3BKZA 2R063 1CWPA 1YLLA 1CJPA 3UJQA 3WV6A 2BW8A 3WNLA 1UY0A 1OLMA 2LUWA 4L0PA 4DZGA 2D6NA 1OKQA 1D4M1 3E6DA 4MYEA 5M0TA 3HT2A 5EJZB 2CGNA 4UW4A 1LODA 3H3ZA 3J9SA 2ZKLA 2IXHA 2P37A 3JZVA 5L9VA 4OYUA 4RD7A 1X9TA 2W3JA 4FXGB 4OI4A 4W6WA 4NPLA 4CEWB 5KHGA 1QJY3 4KH9A 2O0OA 1RUF3 4IE7A 1GQGA 1Q8SA 1UOFA 3H8OA 1W0PA 2BNNA 4XTMA 2QJVA 2J22A 4IGPA 2BPA2 2Y64A 2WA4A 2IXCA 4NWWA 1NXMA 4QQ2A 5FZ7A 2DVGA 4OQ9A 1O4TA 2Y26A 3JUUA 1QJEA 3J7HA 2VZ3A 1DQ4A 2Z4FA 4XCAA 3VBFB 2JB8A 1UY1A 1VBE2 1HN0A 3CJIC 1E5RA 4C0BA 1V6KA 3LEIA 1ASJ1 4Y1ZA 4ZU7A 5BNNC 4YGEA 1QJU1 5KHKA 1Y3TA 2XUMA 4LBKA 1MZ6A 3NSTA 4UFHA 3AP7A 4DMIA 1SG3A 2VBPA 5JI9A 1GWMA 4WV8A 1H8VA 5A3LA 4LBOA 2WSVA 3USUA 1XPWA 1JMUB 3WD5A 4A6SA 2GH8A 3UJOA 2HBTA 3HMYA 5LEJA 1UX7A 2D6KA 2RS33 2JENA 3SITA 3PTRB 5JWPA 2R16A 2P3YA 4EROA 2VVDA 3ZSLA 2D93A 3ACHA 4B4QA 2ARAA 4P5HA 4QXKA 2JE9A 5DAPA 1V6NA 3R4SA 2WS93 1J3QA 2RJ2A 4YM2A 5FK7A 1SFYA 2LROA 2XG3A 3KVBA 4AHXA 5A6ZA 1W6QA 4CP2A 4JGZC 4XFIA 5ANQA 5JVVA 3RFRA 1XRUA 4NJ4A 2WL1A 1MZ5A 1JTZX 1C5IA 3WNMA 1W2AX 3W59A 4GKYA 2FDJA 3RG0A 3H8UA 2AZ5A 4CCJA 2WNUB 1CZTA 1W6OB 1HN1A 1WLDA 2BDRA 2ZEXA 4KGQA 4NWVA 4WM8A 1CX1A 1QJY2 4B29A 5E8AA 2R041 5JMOA 1RUF2 4U36A 1MQTB 1HQLA 2YGMA 3I8TA 2EXJA 1ENXA 2VOXA 5DMYA 5EQUA 3PUHA 1DQ2A 3PVOA 5FUPA 3VZKA 1OSGA 4JAAA 2J1UA 1E5HA 2GMEA 5FMOS 5IT6A 2QNKA 5J37A 2HYKA 4AW7A 1S2BA 2W46A 4CPBD 4EN8B 1ULGA 4K1YA 1TME1 3NV3A 3MIDA 5GZCA 3VBUA 1BBT3 1Y7BA 3PLQA 2OS2A 2IFWA 1Y43B 1A8DA 2ES3A 2Q30A 4PT6A 3VDCA 4JGZB 4WM7A 1YQ8A 5IFPA 4Q8LA 2NMNA 3O1VA 3FBMA 1O3QA 1MS9A 1H1MA 2ZX1A 3ZFGB 4QDRA 3U4SA 3VZOA 1OLME 2DCJA 1CN1A 3B7MA 3HPNA 4EJRA 3GZAA 4UAPA 3WUDA 3V64A 3O1MA 5CFDB 4LO7A 3NV1A 3VKMA 3I3EA 4CU8A 2BVVA 4TN7A 3BVCA 4M4PA 4AE2A 5I91A 3FN9A 3V0AB 1MVQA 4RR3C 3I2OA 3GALA 1OVSA 2RS32 3K77A 3D4KA 5CNAA 3D5OA 1E5SA 3WW4A 2XXZA 1AR83 1SFPA 3WEZA 2BP6A 3H1MA 2WS92 3K48A 4N8MA 1AZDA 1SFNA 2QFEA 3SCGA 3VKNA 1GZTA 2BFUL 1XXNA 2OQ7A 5FZAA 3A21A 2BWCA 1ND3A 1U12A 2HWB1 4TXWA 3WUCA 3U07A 1OLQA 4JDMA 5T54A 3LA7A 2WAAA 5FTTC 2ZZJA 3VD5A 1UYPA 1DGRN 1XNAA 1VJ2A 1KJRA 2A3XA 4LORA 4NR1A 5D8AA 4CCKA 3VHRA 1I9RA 2PHTA 5T3NA 3SXWA 2OA2A 1YIPA 2B5HA 2ZABA 3E5QA 2FD8A 3OD0A 2CAVA 3OD4A 3CMGA 4YG0A 1AYM3 2RDNA 2DVFA 4GULA 4XEZA 1HKDA 1LRHA 2Z79A 5IVEA 3IDBB 5K7PA 1X8EA 4D7YA 4MXWA 1KDKA 4BQ1A 4MLOA 1F9KA 1SLAA 1ZX5A 1OH3A 3N7JA 3VV1A 4I3GA 3DL3A 1UN1A 1DBNA 5J98B 1YFUA 1WW7A 2OVUA 4XVHA 5A6YA 4BA6A 1QEXA 4CRQA 3URFA 1GLHA 1GKBA 3D8CA 3ME2A 4YZ5A 1AL0G 1YO8A 1QGLA 5JXIA 4QHOA 4DXSA 3G6JB 4CDXB 5KHIA 2BGPA 2VPVA 3B5LB 5CFCC 5F2WA 3OUJA 5J96B 2EXIA 2VAUA 4O7XA 2GC0A 3MLLA 2DVBA 4ISQA 2IVIB 2WBKA 2JG9A 2ZGPA 4RS5A 1PX4A 2VVFA 1OQDA 4GWMA 4DEQA 4FPLA 5ABJC 5JPNB 1NLRA 4P9YA 3S6PA 3M7AA 4GAZA 4WVMB 4DEVA 4OHZA 1OH4A 1RIRA 3QCWA 2XVLA 4Y5SA 5HXMA 4YW6A 4CDQB 1T6BX 1PNGA 4QX0A 1GFF2 2E32A 2NLRA 3I2IA 3Q8AA 3M3QA 4K7JA 4MUVA 3SLIA 2D6PA 5HBAA 4F7ZA 3LF7A 2RS11 2UWAA 1QXJA 1FI2A 1KS5A 4R9AA 1ND2A 2BYVE 2WQ8A 3ALQA 1UMZA 1AYN1 1G9DA 1AYM2 1HDKA 2D6MA 3BALA 1W6NA 3ZDSA 4AQ2A 4CUCA 3IPVB 2Z2SB 2ZGLA 1NG0A 3OY8B 2WZR1 3UL2A 1ZRDA 5CKMA 1RUH3 3JB8A 4GB33 5F8PA 3TOJA 5ABJB 3QH7A 2BQPA 1ZRRA 4AK3A 5ACA1 2OUJA 5JDBA 2Y6FA 2AH2A 1W2UA 2RDQA 2VGDA 3P6BA 1LESA 1HB4A 1QHDA 2VMEA 4IXLA 4H7LA 2HH9A 4A45A 5DQ0A 1EUTA 2YU1A 3D6EA 3ILRA 3KCCA 5FIXA 2VU9A 2VZQA 3AMQA 5F5AA 3N4MA 4FPHA 3PIGA 3DXUA 5FZKA 3WNPA 1IQAA 1JH5A 4LBLA 5FY4A 3PUAA 3IDEA 1GOGA 3E1F1 3MHZA 4N7IA 4CDUA 4C91A 3VDDC 2VMDA 2WWUA 1IG0A 4FOYA 4PQ9A 3N36A 1D4VB 2VZUA 2J1TA 5IVBA 4CU7A 2FDGA 1S0EA 1OMIA 3H1WA 1CAXB 5A6QA 4HT1T 2R0HA 3ACLA 2JDAA 5FYCA 4AI9A 4CSWA 2KA3A 1BEV3 1KQRA 2UYAA 5F1RA 5C7GA 4AR2A 3KZ4C 3VBRC 3WCSA 4FT8A 4N53C 5A7PA 3E6BA 3I2HA 1R083 1V6JA 1O3SA 2K2SA 4AEDB 3OCPA 2ZZQA 3B9CA 3EJKA 1F8VA 2P17A 4QU2A 1W3XA 3WDUA 1D0HA 2RS51 4DS0A 3WT3A 1QJFA 5LATA 2HWC1 5EP9A 4M4RA 5FPVA 2EIEA 3MLKA 3ZXEA 2Y6KA 1WBLA 4MG2A 2FCVA 1RUH2 2XONA 4GB32 3IDAA 1HB3A 1W3VA 4GD4A 1PO23 5GJ6A 3VN4A 1C57A 2BOJA 2WIIB 3J8F1 4Y22B 4YM3A 4IW3A 4YG3A 3NNJA 1GV9A 3N9LA 2PHUA 5E88A 5BNPA 2A6ZA 5CVRA 4MGIE 4LEJA 1RINA 4B4RA 5DG2A 2DCYA 4Y5TA 2JDNA 2R6QA 2JICA 2ZHNA 1HRI1 4AHWA 3PVBB 5D21A 1WA6X 4XILA 1D4M3 5EIYB 4YPJA 2WAOA 4CU9A 1AHSA 1ONAA 3WX5A 4AFMA 1W9WA 1OOPA 1S1AA 1OF3A 2GN3A 2UYBA 3AZZA 4OUEA 3O1SA 1N3QA 2FBEA 2ZX4A 1EV13 3H50A 3L2YA 2R061 2YV8A 3MFAA 4MO3M 3TAYA 4AG4A 1I1EA 5J09A 1XYPA 3AKQA 1XYNA 3WQ0A 3WR0A 2PYTA 3AXDA 4CEWA 1BEV2 1F5JA 1K12A 4LXLA 4XFHA 1UYXA 2WFPA 4M3CF 5LCWL 1W8WA 1WCQA 1DU3D 1HLCA 1WLWA 1M4WA 1Q8QA 3RS6A 4LITA 4XUPA 2GNMA 2ARBA 3KSCA 2JD9A 3VGIA 1PM4A 1TVGA 2OX0A 2P3JA 1MEC3 3OBZA 4QHBA 1NQJA 2OW4A 3OBTA 4X6QB 3RWKX 1G9FA 3R0RA 1QJU3 3VDAA 2XDVA 3BTYA 1Q5OA 3BTXA 5FRAA 1QNWA 1LCLA 1VBB1 3KF3A 1RUG2 5L9RA 4LHSA 2EIBA 4J1WA 2XUEA 2YU2A 5JZGC 1YNAA 1GR3A 4Q0VA 1Q8PA 5FZ8A 3W21A 5C4WB 1UY3A 3CBNA 1NY71 3IKWA 1UW8A 3KQRA 4TYSA 4DOUA 2XPJA 4QPIB 5GLZA 3JQWA 1CD3G 1F4AA 3WCRA 3O14A 1UIJA 4PIZA 4WM8C 4EN7B 1DGWX 4YM0A 5T5JA 4CCNA 4EWEA 2IC1A 4JDOA 1IS5A 1NCRC 2Y8KA 3PNAA 1KEXA 4IL7A 3T2PA 4V2WA 4W4ZA 2AR6A 4I2OA 4BISA 2JIJA 3A0KA 1JUIA 2W1WA 4Z2WA 1H2MA 4CEYB 4GMP1 4FBFA 4A7YA 1D4M2 2DTWA 3RZLA 2RDSA 4IEYA 4RGGA 2YB7A 3ZMNA 2GAUA 5FZ9A 3M70A 1NAEA 1WCKA 4XF9A 3ZSMA 3NAPC 1SDDB 1GBGA 2CU5A 2Y6JA 1FMD3 2I2SA 5C3PA 3I2DA 4XQDA 2R043 5JCTA 1E57A 3LIGA 1OQEA 2BFUS 3GDBA 4XBNA 4PLNA 5BNNA 3EBRA 1AX0A 2YPDA 4YW1A 4Q0UA 1W6OA 3JQXA 1K5JA 3VBSC 3ETPA 2NYYA 1ZREA 4RQPB 2ZGQA 4YW7A 1LJ7A 3CNAA 4NVPA 4LLFA 5FQ0B 2VM9A 1CAWA 5BXXA 1UL9A 5AFEA 4HPKA 5FBZA 2BERA 1QKQA 4J1XA 1UPIA 2CDPA 3ZYBA 5FPLA 4IEUA 4D6SA 3BIWE 3PU3A 3CZUA 3L2HA 1MEC2 1ASJ2 4JQRA 3WSOA 5I0DA 2E6VA 2JB4A 3O12A 4OMCA 1QJU2 2YHJA 2E51A 5CG8A 1Y9MA 2GC3A 2V73A 1QWRA 2NPIA 2WO1A 1J1TA 1SEFA 2Q4SA 1K45A 2GNDA 2V5YA 3FE5A 3KQ4B 4IE5A 1JOBA 2A73B 3D0SA 1GQHA 4HFSA 2NP0A 4MX3A 2L9LA 4YVWC 1AXYA 3A23A 1BBT1 3VBSB 1PGL1 2X05A 1PGW1 1VAKA 3E97A 4QGLA 5CFDA 4NN0A 3CZJA 1R64A 4RGKA 3I3DA 4PF5A 1FT9A 5DZFA 5JOWA 3V0AA 5FY8A 2XL9A 2Q8EA 4PF1A 4R8HA 3LEGA 3WHUA 1QQP1 5I0UA 4XUOA 3DPRB 1B35C 1ZM1A 4GWJA 5AVAA 2W1QA 3NNLA 2DU1A 3MICA 4K3UA 1CX4A 3LDRA 3VKFC 1W9TA 3M3EA 4UF0A 1BXHA 1ZZCA 3ZN6B 2PQQA 3RYPA 1XU1A 4URTA 1S0JA 4WVWA 2R042 4G9SB 1AR81 5APAA 5HCAA 3VZLA 4DO0A 1NQDA 4A41A 1TNFA 4LBJA 2XWBB 4XETA 3PUQA 1NYWA 4Q0SA 1ZVFA 3IBMA 3B02A 1UZWA 3WQ7A 1DLCA 2HWD1 3GCWA 3MLJA 4GWIA 1U5ZA 1VBC3 3U75A 1FXZA 3N9QA 5A3MA 3NO8A 3OSDA 1TME2 3SC7X 4J25A 5F3GA 4RR3A 1H2LA 5FYUA 2CAUA 2E7QA 3KV5A 3RZKA 1PO11 2ZAAA 3ZDVA 5LY1A 1RHI3 4JHZA 2ZGMA 3FBYA 1W90A 3DXTA 2PHXA 1OKOA 3UKTA 3POBA 2RR13 3RGBA 1W99A 2B46X 4UFJA 4TTGA 3MF9A 4ISRA 5G04L 3J4UH 1LOBA 1W0OA 2PELA 3I2GA 3ZR6A 4XQWA 2PMWB 4FCAA 3ZYGA 4BQ5A 3WQBA 5FYYA 4QPGC 1UU4A 2WNVC 2W2IA 1DZRA 2QQIA 1APNA 3AMMA 1N3OA 3DYOA 4TWTA 3RSJA 1QIQA 2Q8DA 4QM9A 1ND2C 1OFSA 2OUHA 4LMFA 4IQPA 1TNRA 2DVDA 4NHKA 1C1LA 2HWB2 1GWLA 2D98A 2QCSB 3LSDA 3GHNA 3BTZA 4XUQA 5A3NA 4GWNA 3N9PA 3ZN5A 4LUKA 4Q0PA 1PX3A 3CU7A 3S5QA 3OGVA 4ORFA 3ZYJB 4QX2A 1RXGA 2IXIA 1DHKB 3ZM8A 2MEV3 4YGDA 1JS9A 2RS13 4PQQA 4Y20B 5A1FA 1QU0A 2GMMA 1XE7A 4DXRA 1OXCA 4QKBA 1AYN3 3AKPA 1JXNA 2YBKA 3ACIA 4JC1A 4QPGB 3NV4A 3JBG1 2OYZA 2AENA 2QQUA 2W47A 3BODA 4BZ4A 5FK8A 3SNMA 5H9SA 2SLIA 2ZAHA 3OBAA 4IE6A 3LIHA 4DQAA 5CFCA 4OHVA 5FP4A 2XLFA 1D7PM 4XAEA 1ULOA 1CAVB 3IPVA 5CIRA 5IYYA 4ATFA 3OY8A 4YFWA 5ABJA 1LULA 4XJWA 1QY4A 5FP7A 4S2DA 4N90A 1QXPA 2VJXA 4KU7A 3ZXJA 4Z2AA 4Y1VA 4CCEA 4S2HA 2C1FA 4JGYB 5JXJA 4YLZA 3I59B 4CP9B 4NPRA 4QGMA 4ZS3A 4D0QA 4Y1UA 1EAH1 4YW5A 2QQOA 3LQCA 2PFWA 1TZOA 2E53A 2DCKA 1YFXA 3TNPB 2IVJA 2PHDA 4IEXA 2YFZA 3AL5A 3ES4A 2WZPP 2VMGA 1DQ6A 4AYUA 5J1XA 4MZUA 1RUJ3 1V9U1 1MS0A 3GBGA 4R9CA 2E26A 1UYYA 4EWAA 4BU2A 1AX2A 4I0WB 4IESA 5GM0A 3DECA 1FNYA 4BB3A 5IVCA 2A6VA 3N7LA 5A3TA 2JD4A 1F35A 4O9GA 1QNYA 4RHV1 1GANA 1S0GA 3LA3A 1CAXA 2MNGA 4OLLA 4FPKA 3RZZA 1O3RA 5FMDA 1WMDA 2VZOA 2IZWA 3LD8A 3R05A 1ULPA 2RS12 3T1MA 3FHQA 5BNPC 5LW9A 1SPPB 2QTWB 1H8TB 2IFRA 4HSLA 1UAIA 2RS53 1AYN2 3DKQA 4XJ9A 2G9ZA 4LHKA 2ERFA 3AZVA 4AEDA 3B00A 1F2NA 1YQ6A 1WZXA 5L7OB 2BNMA 3P5BA 2FCUA 2B9VA 4Q1RA 3J8F3 3APBA 1KDMA 2X10A 5ACA2 5FOJB 2QDRA 5CZKA 1R081 2JDYA 2O1QA 4Y4RA 2VNVA 3TWIA 3VDDA 2P3KA 5KC6A 4ARXA 3T2TA 4ASLA 3IAQA 4Y22A 2WT0A 5I0SA 3RVHA 3RWNA 3AJYA 4XOGA 1HRI3 5EFUA 3T2OA 4JV4A 1MS3A 3IMNA 3K3NA 1JOPA 3NNFA 3ZYHA 3NKTA 2GNTA 4FAHA 4IEZA 1PO21 2XHKA 2DUQA
chains in the Genus database with same CATH topology
2JE7A 2PAEA 5DDJ1 2R49A 3KS7A 2GC1A 4HKWA 4Q4X1 1UZYA 3CF6E 1LHNA 2WT2A 3HBZA 2HWF3 3IIAA 1O5LA 1DFQA 3FFQA 3AFGA 4L97A 1U5YA 2G4IA 1OA3A 4HZFA 3VBFC 2R1DA 2YXSA 2Y0IA 4LO8A 3U4XA 2RJKA 2XB6C 5DUWA 4DRRA 2IXJA 1DG6A 1NXD1 3HD8B 2DV9A 4CYDA 2D97A 4K21A 2VMHA 2VW1A 4LLOA 1Q8OA 2ZX3A 1EV11 2RS52 1BK1A 2HWC2 4IEWA 3ZMOA 1W39A 1VBB3 4LHLA 4XF4A 1ENRA 1XYOA 4LBQD 4SBVA 1C4RA 3ILFA 4Q26A 1RGSA 3J8F2 3VBOC 4NOTA 2GALA 3VHPA 4AFDA 4XFFA 5E89A 4AQTA 4CP1A 3ZPYA 3AKRA 2XWJB 3WVJA 2GN7A 4A2UA 1TEIA 1KITA 5AVPA 2XLGA 1MEC1 2XKPA 2DURA 3DF0A 1IOAA 3I4IA 3KMHA 1W6MB 4QPIA 4QMAA 2WNUC 5F9TA 5EYYA 1HRI2 5FLIA 4GMP3 2QZ2A 1MQTC 1Z0HA 5L19A 3AP4A 5C8CC 3IM0A 4GMP0 4MVTA 1GNHA 1MS4A 3MIHA 3OYWB 2R32A 3ZFFC 5CU1A 4BLJA 2JJ6A 4XF1A 3T1LA 2WSUA 2R062 4DRVA 2B9UA 3TBDA 2ENRA 3VBOB 3BB6A 2O8QA 2XJSA 2JXAA 3EXUA 5JZGA 2VQ0A 5T5OA 3U10A 2DFCA 3WZ1A 3RQ0A 5IK7A 1X82A 4GA9A 3ZFGC 4BE3A 4R52A 5K0UB 4D94A 1GYKA 1QDOA 3AYEA 4P9IA 5F6KA 1FMD1 3KB5A 4XJZA 5CFDC 1NCRA 1PNFA 2D43A 2O8OA 3PVNA 5BUVA 5C8CB 1VRH1 1XE8A 1VBB2 3MIGA 4TZDA 3O0XA 3WW3A 3ZFFB 1SMVA 5FCCA 4DB5A 2G9GA 4L11A 1NY72 1ZBE3 1WD4A 3NAPA 2F6BA 4I3PA 3OTFA 4SLIA 3VBHA 3B9IA 1ZNPA 1YXWA 2X5IB 1QOOA 3SH5A 1ULEA 2JEMA 4AEJA 3AP5A 1IZ3A 4YW3A 2YMZA 5L36A 3KD4A 3HR9A 3VBSA 4AEKA 4NO4A 4XJ8A 1QQP3 2GDFA 3X29B 4M0NA 2WC2A 1UU6A 3FUQA 4AVCA 3I7DA 3HAGA 3DPRA 1REFA 3GF6A 3GNEA 3ES1A 1PZ7A 4META 1LHUA 1GNZA 2LALA 4R4XA 1SBFA 4X6RB 4X8PA 3ZN6A 3R4UA 1IKPA 2BGCA 4L92A 1BCXA 2HWD3 4IV3C 4XIKA 1C1FA 4XHBA 3WP3A 4YVWA 4HK9A 2D44A 2BVBA 1H4GA 3HQXA 1CGPA 1PO13 2ZMLA 2WWSA 1COV3 4AGVA 4CDXC 2DF7A 1DZTA 1OPOA 4AGRA 1QF3A 2JDZA 1AUYA 4RL7A 3MGUA 1UU5A 4IETA 4YYOA 3PTYA 2I74A 2YUEA 4E2QA 5JOXA 5KXBA 1B35A 1F31A 5GALA 4FOQA 2EIGA 2P3IA 2YYOA 1VBC1 4M01A 2AYHA 2RM23 4Q8KA 1BBT2 3B93A 4B3NA 4EV0A 1KFXL 1PGW2 5CBLA 4IV3B 3AP9A 2EVXA 4HVRA 2Y0OA 4R4ZA 4CDWB 4CDQC 4BOWA 1RHI1 2VNGA 1A3KA 4AI0A 1QQP2 3ST7A 2XJQA 2X53S 2RR11 2BEOA 2DUOA 2FHRA 3FX3A 2WINB 4YFZA 2KXLA 5J3UA 2E7TA 1LTEA 1S0FA 1ZBA1 1AR82 2W08A 3MZHA 1OA2A 3H7JA 1GZWA 2JG8B 1LECA 2WJSA 3ZYPA 1WUVA 2HWD2 1FOD1 3D82A 3JBG3 3POYA 1ZYBA 3PMSA 1C28A 4Y20A 4XF0A 1G86A 5CG9A 1YCIA 5EZWA 1J3PA 2QE3A 4QPGA 3DGTA 2IWGB 2WNVA 1PO12 2ZTNA 2B39A 1GZCA 2MEV1 1CQ9A 5HCFA 2VW0A 2HKXA 4QQPA 3WDTA 4EN0A 1QOSA 4Y4YA 5IK8A 5DG1A 4YGCA 2D3SA 3MFCA 4Q1PA 4G4FA 4XMAA 3QOPA 4N9IA 1EAH3 1EY2A 4XXPA 2OZJA 4A3XA 3I59A 2CGOA 3AZYA 1L3JA 4JRAA 1V9U3 2I45A 2XVGA 3NVCA 4HMZA 1OFNA 3CO2A 5GKAC 3AFKA 3FZ3A 4AI3A 1HQWA 4AEDC 1MS1A 4L99A 2IXKA 4XE9A 3WDWA 3LSEA 3MW3A 4RHV3 4LBQB 1OA4A 1O5UA 2W68A 1XNDA 4GH4B 3O0WA 3KGLA 2PLV1 1ENQA 1Q8VA 5H9QA 1RUJ1 4D7TA 1YFYA 1PMIA 1LEMA 4KGGA 3ZXDA 4QQOA 3JBG2 3DN7A 2PN5A 4E2GA 4LNVA 4AF9A 2VULA 4EN9B 1AL21 2MPFA 2FZ2A 1DZQA 1K5MC 1V6OA 1N1YA 3FHIB 4Z92B 3WQ1A 5SV5A 2FQPA 4FP2A 4Y5Z0 2CGPA 4C1XA 1NA1C 1B09A 1UIKA 1W6PA 4Q27A 2FMDA 4Q2FA 2R1BA 2W39A 3EO6A 3TB0A 4LBMA 1CJDA 2B8MA 4QQLA 1CIWA 3E5XA 4L8QA 4P9WA 1VIWB 5C6CA 1YJLA 3PHMA 4Q0QA 1EAH2 1JN2P 4Q4V1 1XNKA 4J6GA 5GZDA 4UXAA 5DDJ3 4HLTA 4Q4X3 1HW5A 1VBA1 4ONUA 4DFSA 3KCYA 1V9U2 3ZXLA 2ETEA 1SLBA 1K5MB 3FLTA 2UY9A 2ZGRA 3JD71 4OHXA 1RUNA 4RHV2 3KLSA 1NA1B 3WW1A 2D6OX 4PLMA 1U5XA 5JAXA 2ZJCA 3B94A 4RFT0 2ZS6B 1RUI3 5C4WC 5CAZA 1RUOA 4H3WA 1LHVA 2A75A 4WZFA 1DGRA 3LGRA 2HWF1 4QPIC 4XQ4A 2AGSA 4PBPA 3LB9A 1QH7A 2XLAA 4PDWC 4AVTA 4BIOA 4PIXA 1ULDA 3S0MA 1R082 4CEYC 3NW4A 4GQ7A 4MXVA 2HEVF 2B7YA 1YI7A 2UURA 4OUSA 1ENSA 4LA3A 4QM8A 1O3TA 3J26N 5IK4A 3M3IA 3VBFA 2XJUA 3SHRA 1JYCA 1RUD1 4OHYA 3VLBB 1XQNA 1PO22 3GYDA 3WY6A 2ZGNA 4YRDA 1DYPA 5DDJ2 3B01A 3OJBA 3ZXGA 4RQPC 1G9CA 4Q4X2 4XPVA 4XW3A 4PDWB 4LE4A 5KBFA 3OYWA 1PZ8A 2E9QA 4PJYA 2LM3A 2YZ4A 2VG9A 1RC6A 5T50A 4YW2A 2EF6A 3VBOA 5DXDA 3BTAA 4RA0A 4S2FA 3ZYRA 3MIBA 1X50A 3CLPA 4E4ZA 4FO9A 4I02A 3VBHC 3AMPA 4K1ZA 4GKXA 1WW6A 1EV12 5GLWA 2ZX2A 3EQEA 3USSA 2WNUA 1VRH3 1XNBA 1I5ZA 4OULA 4WBBA 5F5QA 2CV6A 2ZMKA 4AQSA 1N1TA 5GLUA 2N7GA 1MQTA 1V6MA 1VAVA 3KT4A 5C8CA 4Q4Y1 1BYHA 1RJ7A 4XXAA 3DPRC 1G8WA 1OPMA 3ZFFA 2ZKNA 3CEWA 1WCDJ 2HWE1 5JLVA 5D1IA 2WLPA 1PHMA 1V00A 3ZFGA 2R0FA 1D2QA 1ZBE1 3AKSA 2YROA 2UWBA 4M00A 2R073 2CWMA 3N35A 5J7MA 1LU1A 1OQ1A 4FTBA 5JR7B 5A33B 3MPBA 1DIWA 3NL1A 1XNCA 1BVVA 2CL2A 3BU7A 3K51A 3AM2A 2WLQA 2Q5TA 2NQYA 4I0AA 1NE4A 5T5PA 1DQ1A 4KWLA 5BNOB 5IK5A 2TUNA 5FPXA 2CWSA 4QD2A 4FPGA 2RMU1 2ILMA 1FMD2 5B2GB 2A3YA 2ATFA 4P9GA 1Z7S3 4HSJA 5C9AC 3ZFEC 2GMPA 4F3JA 3BOWA 3H1YA 2UY8A 1VRH2 5LK5A 4C1WA 1J3RA 1JUHA 1JBCA 1TMF1 2UWCA 3FLPA 4I01A 4E27A 1UKRA 1VAMA 5J48A 3M1HA 1IPKA 4XFBA 3D0JA 2MHFA 3NJZA 1BMV1 3QACA 4K6BA 3FC0A 4FAGA 4W65A 1COV1 3LZZA 3SISA 4OI2A 1AR91 2H0BA 4KWJA 4BMBA 4LT5A 1SLIA 1ND3B 2ZOEB 3WINE 3THTA 2BNOA 4I0BA 4IV3A 5DZGA 3IT8A 4TSVA 5C9AB 1RVF1 4B7KA 2BWAA 3ZFEB 2RM21 1N3PA 5FAXA 4CTEA 3LOIA 5D8AB 5DUUA 4ZU4A 2AUYA 1D2SA 3GZTB 4IV1C 3IDCB 1ZBA3 1IKQA 2OIIA 5KXCA 3AMNA 4CDXA 2TBVA 3N7KA 1ZA4A 2DTYA 1LOFC 1NOVA 2TEPA 3ENRA 1FOD3 1UCXA 2ZGKA 1WW4A 3BCWA 2P34A 5DZEA 4WVMA 4LE3A 4DY3A 5T5LA 4BLIA 3AYCA 4KWKA 4JGYC 4OZXA 5EXOA 4OI1A 1KJLA 1JOJA 1V6LA 1YI9A 4CDQA 5FPZA 1O7FA 4XIOA 1VBD3 1WGPA 4IV1B 1VB2A 4N7UA 1VBC2 3LWCA 2X29A 3JCIA 4XZPA 2XVKA 3BPZA 4H55A 4PCRA 1PM7A 4R9DA 1S0CA 1RHI2 4BH9A 1IHMA 1DQ5A 5BYNA 3MW2A 2RR12 3FJSA 4R9BA 2ZBJA 2WFF1 1H8TC 3R6SA 2I07B 1WA4A 2XGXA 3M4FA 4L9BA 1YFWA 1FX5A 5I8TA 1ZBA2 4KBBA 1PGL1 4LTAA 5L7OC 3U0ZA 1QH6A 4FPEA 4LR4A 4BPZA 2PLV3 2D5FA 3ATGA 3WG3A 3ZXFA 3AB0A 1Q43A 1SBDA 2ZGSA 3RI8A 4LBQA 2SBAA 1FOD2 4COYA 3CJXA 3H7YA 1RL3A 1S0IA 4IEVA 5L73A 4AVAA 1SACA 4M3CB 1AJKA 2NZ9A 4MV2A 3WXPA 1REDA 1AL23 1IS6A 4QX5A 1LOGA 1R1A1 4WZCA 3AZWA 1RMU1 1RUE1 1KS4A 2MEV2 4AGGA 4FOWA 4UW3A 3AJZA 1ZZBA 2WA3A 4K9SA 1FYUA 1LR5A 4S2GA 1PZ9A 4EN6B 4WVVA 5BV6A 5GZEA 2ZPXA 2PTMA 3ECQA 3VZNA 2IXLA 4B8EA 1DLLA 4KG0A 1YJKA 2Q1ZB 3W58A 1I6XA 5HCBA 1R091 2DVAA 4B4PA 5IUQA 2Q8OA 4CDUB 5CA6A 1X8MA 4Q4V3 3V65A 2JECA 3SH3A 3SMHA 1JW6A 1LGBA 1UKGA 3ZSEA 5I0TA 1VBA3 4CP0A 4BM8A 1UD1A 5CADA 1A8MA 3FMGA 1C5HA 5KXEA 4XFAA 3ZIWA 5K8SA 4AEMA 3P3PA 3JD73 1JYIA 1AF9A 1R1ZA 3GZUC 3CL1A 3WOGA 3EHKA 3DV8A 2CTVA 2DU0A 2R30A 1J58A 1K5MA 2DUPA 4XHXA 4ES9A 1LENA 2ZMNA 1AR71 3C3VA 4C0HA 3UV9A 2PLV2 4QGNA 1NA1A 1RUJ2 1UPSA 3M3CA 5JOYA 5EV7A 3O5SA 2Y38A 4XBLA 4UBHA 4X8NA 4IEOA 1QJZA 3MYXA 2VOVA 2ZGOA 4RSUA 3JU9A 4JCKA 1G9BA 1AL22 3VL8A 4BWOA 1H1IA 4IEPA 2PHLA 1RTVA 4ATEA 2EAAA 1RUI1 2WKKA 2ZACA 1C8M1 5KC5A 3V0BB 2GH2A 3RPQA 4DY5A 1LOAA 1OOPB 1RUD3 4LBNA 3E6CC 1LGCA 2EXKA 4ZXKA 5FFOC 4Q4V2 1S55A 2C5DA 4AQ6A 4BCUA 3Q9OA 3FFZA 4ASMB 1Z78A 4FSJA 3SCFA 1VBA2 5DUXA 5C4WA 1POV1 5K0UC 3RYRA 1HRV1 4M0HA 1YRZA 3JD72 3PMEA 4PDWA 3OGGA 2K0GA 3WDYA 1AXZA 1C3HA 2VOKA 4CEYA 3ZX7A 1HV1A 1BQPA 1CR7A 4AXOA 4XF3A 4N43C 4YNIA 2HWF2 5FO8B 5A32B 2GC2A 4QQHA 1LKNA 1DF0A 1O4ZA 4FQZA 1EYBA 1SCSA 2X5IC 3UKVA 3A4UA 5GZFA 4AFAA 4Q4Y3 5GLTA 1G9AA 4RQPA 2E63A 2H6BA 3IWZA 2JKBA 2WT1A 5I93A 5FQ0A 1S2KA 4JRLA 1IS3A 2BBVA 2HWE3 1N1SA 4JVAA 2VH9A 5EWSA 5I8SA 1S0BA 2WNEA 4FPJA 3WG4A 3ELNA 3ZXAC 4HK8A 1RUD2 1EP0A 1QOTA 2ZHLA 5BPXA 1MS8A 2CYFA 3DUIA 4N43B 1VP6A 4UW5A 2VUJA 1UZZA 2H0VA 3CJIB 1LEDA 2D5HA 1FV3A 5BNNB 1FAYA 4DINB 5BNQA 4LA2A 3IN9A 2A6WA 2PAKA 4MGYE 1Y9QA 1VB4A 4BMEA 1NZCA 3DKWA 4HVOA 4YZ1A 5EYXA 3INAA 1CAWB 5A33A 5DUVA 4HPKB 4ZU5A 1AXKA 1MVEA 5H9PA 4DPNA 2ZX0A 2XJTA 3RNSA 2R071 1H0BA 4XBQA 2RMU3 3NKGA 1PK6C 3MPPG 4GXLA 3AK0A 4HKLA 5BNOA 3VHOA 2D7FA 2VECA 4E2SA 1RUC1 4HETA 1SLTA 2D3PA 3LCPA 4UW6A 3AYAA 1TMF3 4P9JA 1ZZ9A 5EJ3A 3TNQA 4B7EA 4CDWC 4FPCA 4AVSA 4KNCA 4Q4Y2 2Z5WA 5LK7B 1JHNA 5AC91 2Z69A 4FOVA 4F83A 3LAGA 1YHFA 1Z7S1 3GHMA 5KWRA 1LGNA 2HWE2 1AR93 1AJOA 4YZ4A 2GSYA 4LO5B 3ILNA 1PK6B 3ZN4A 4HVQA 4JTOA 1RVF3