3BIWE

Crystal structure of the neuroligin-1/neurexin-1beta synaptic adhesion complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
177
structure length
177
Chain Sequence
HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Neuroligin-1 and the Neuroligin-1/Neurexin-1beta Complex Reveal Specific Protein-Protein and Protein-Ca(2+) Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion/cell adhesion
molecule keywords Neuroligin-1
total genus 36
structure length 177
sequence length 177
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3biwE00
4KBBA 1S0DA 3BIWE 3AP9A 1GZCA 2EF6A 3AZZA 1GBGA 1FV3A 1LU2A 1SACA 4AVSA 2DVFA 1CN1A 2A3YA 2A75A 1WW7A 2JE7A 2GMPA 2UWAA 3TAYA 1WW4A 1JOJA 4CRQA 1V6MA 2LTNA 3RS6A 2ENRA 4YW4A 1S0IA 4FPHA 5EXOA 4U2AA 1H9WA 4FPEA 2C5DA 4Y1XA 4YZ2A 1BKZA 5JMCA 3IKWA 2DVGA 4LBQA 4Y1UA 5HCBA 5KXBA 5KXCA 4LBMA 2E7TA 1BXHA 1IKPA 2VXRA 2XG3A 3ZXEA 1A3KA 2BQPA 1DQ1A 1SBEA 2YY1A 3A0KA 2NMOA 3POYA 4ISRA 5GZEA 5GZGA 3UL2A 2UURA 2DUOA 1JYCA 3RSJA 3BTAA 5GLWA 2JDZA 3AP5A 1W0OA 3OBTA 4R9CA 3D6EA 4FPCA 3Q9OA 1N1VA 5CAZA 2ZACA 3B01A 2VU9A 4ZKTB 2ZMKA 3M3OA 3NV1A 1GNZA 3T1MA 5T54A 1OKQA 3WHTA 2D6LX 2R1DA 1DLLA 3R05A 4YGBA 1X50A 4GALA 1JUIA 1WLDA 3N7LA 1WBFA 1ULFA 3D4KA 1RITA 1MZ5A 1AJKA 3OY8A 4XOGA 2EXIA 2WLQA 2DVAA 4ZXKA 2A3XA 2I2SA 2PHXA 4Q1PA 1G9DA 3T1LA 1FX5A 4JC1A 4AGGA 5H9RA 1S0GA 3LSEA 3WUDA 4DRVA 1C1LA 2UWBA 2LALA 4Y22B 3ZSMA 1UMZA 5LK5A 1MZ6A 5T5LA 1AXZA 2W08A 1WLCA 2W39A 4FPLA 1UAIA 4XJ8A 1D0HA 3R4SA 2PELA 3VKOA 3FLTA 3SLIA 1ENQA 2YXSA 5IK7A 3USUB 1QOTA 2HYKA 5SV8A 1JYIA 1WD3A 2ZMLA 3PMEA 4Q1RA 1H9PA 2W52A 3IMNA 1HDKA 2ZHKA 5EYXA 4DS0A 1MS3A 2FHRA 1I1EA 1LENA 3N7KA 4K21A 1LESA 3IPVB 2ZAAA 3APBA 2EXJA 3FBYA 4XHBA 4XTPA 4ATEA 3ENRA 2YZ4A 4DPNA 4YZ5A 1LOAA 5CA6A 2GMMA 2NP0A 4YM0A 1DQ2A 4LBQB 2NN8A 4GWMA 3OPZA 2DU0A 3AZWA 4M3CF 4YLZA 2A6WA 5DZEA 3ZSJA 4FPJA 2ZGKA 5KXEA 1SLTA 1MS9A 4DFSA 3V64A 3W58A 4IQPA 4YM1A 1UPSA 2VW2A 3I8TA 1GZWB 3MW4A 2V5YA 1N3PA 3OYWA 4MYEA 1AZDA 2E51A 3V0BA 3NV4A 1AF9A 2CNAA 1GYKA 2A6ZA 1N47A 5FRAA 1V6JA 3O12A 1F5FA 3DUIA 1IOAA 1ONAA 2ZMNA 1W6PA 1SLIA 4FOYA 2R16A 1LJ7A 3POSA 3V65A 4Y20A 1OFSA 1YIFA 2PHWA 4P9XA 4Y24A 3WG2A 2GNDA 2AH2A 1ULEA 3LCPA 4FPKA 1CJPA 4R9BA 1G8WA 4WVWA 4D69A 1GZWA 4Q26A 1UKGA 3N7JA 4XYXA 5JOWA 2WNEA 4DRRA 5IK5A 1SLAA 3SH4A 1BZWA 5GLVA 3ZSKA 5JOXA 1HLCA 4FPFA 3WDWA 3WNXA 2D3RA 1W6MB 1IS5A 1ZM1A 1Z78A 1WW6A 4Y1YA 4LBJA 1GKBA 2UWCA 1SBDA 3AJZA 5FREA 1CVNA 4M00A 2DTWA 3USUA 2D6KA 3VKLA 5T5JA 3SISA 3HMYA 3VKFC 1DHKB 1MACA 3SNMA 1LOCA 5JLVA 1VIWB 3OGGA 1PZ8A 1URXA 3FLRA 4CZSA 2ZGPA 2DUPA 1ULDA 1SFYA 4ITCA 1UN1A 4UW5A 4GKYA 1MVQA 2DYCA 5KXDA 2ZKNA 1JXNA 2WQZC 3AYCA 2DVDA 3INAA 5H9PA 1UX6A 2ZABA 3B9CA 3RMYA 1ZA4A 3AX4A 1QOOA 1WLWA 1DYKA 3ZPYA 2AGSA 3B00A 2CL2A 1DQ4A 1NXD1 1S0FA 2E7QA 1DQ5A 2G4IA 3R4UA 1MS8A 4ISQA 1G9BA 5H9QA 5E8AA 1B09A 1QNWA 4C1WA 1IKQA 1QDCA 1V6OA 4FP3A 3O5SA 1GV9A 4BMBA 1LECA 4NOTA 1J1TA 1WCSA 4PQ9A 5DZGA 2P2KA 3BOPA 1YXWA 1W0PA 4JCKA 1FATA 2AYHA 1GSLA 1G9FA 2EAKA 1KQRA 1LHUA 1ULGA 2WT1A 4FPGA 1WUVA 4M3CE 1FNZA 4YW1A 4OZXA 2YMZA 4FP2A 5IUQA 3ZYPA 5DZFA 3WV6A 5E89A 2E6VA 2B7YA 2ZHMA 1W6OB 3AP7A 2ZGQA 1V6KA 3BODA 5JOYA 4FQZA 3V0AA 5DUXA 1QDOA 3WHUA 1QNYA 2EXKA 4M3CB 4Q2FA 2A6YA 1APNA 1DQ0A 3POWA 4FOQA 2UU8A 1DYPA 1LOFA 2OW4A 1C4RA 1LHWA 3WOGA 5CB7A 4TYSA 1LOGA 2A6XA 4WZFA 3WDUA 4RL7A 1D2SA 1Q8SA 2AENA 2JKBA 2WKKA 4WV8A 3NWKA 4BLIA 5JDBA 1LU1A 3V0BB 5BYNA 1MR5A 3ILFA 1MS4A 1EPWA 1V6LA 2H0BA 2ZHLA 2VW1A 1FV2A 3AJYA 1HQWA 1V00A 1XQNA 2CWMA 2Q5TA 1DFQA 5GLUA 4BM8A 1GICA 2E53A 3NV3A 3QCWA 4GXLA 2WSVA 4P9YA 4UW6A 2GNMA 3N3HA 2D6NA 3UJQA 1YI7A 2ZHNA 3PJQA 4YGCA 1OQ1A 1N1TA 2A3WA 3PVEA 4HL0A 2XB6C 3JU9A 1GZ9A 1JW6A 1LOEA 1LOFC 4C1XA 1W6NA 1LEDA 1KITA 3GNEA 3QLQA 4R9AA 3WG4A 1LHOA 2OUHA 1CIWA 4XMAA 1HKDA 1S0CA 3ZXKA 2ZGLA 4PF5A 5L73A 3O0WA 2DV9A 3WCSA 3VKNA 1DGLA 4Y1VA 3VUOA 1WW5A 1AXKA 1KJLA 1SBFA 4XJ9A 1N1SA 2NM1A 4XDQA 5HCFA 1LOBA 1WBLA 2WJSA 4Q27A 1QMJA 5EYYA 1W6QB 3AP4A 1W6NB 4FPYA 2P3JA 3D5OA 3PVNA 4XBNA 5T52A 3DGTA 5T55A 3W59A 1UZYA 2GMEA 3WDTA 2ZGMA 3O0VA 4YG3A 2D3PA 3RRDA 2RHPA 4AWDA 2PHUA 3KQRA 5HCAA 1F9KA 4YZ3A 3UJOA 3ZSLA 1LULA 1QKQA 1BJQA 2GN3A 2A6VA 1CESA 1PZ9A 2GN7A 4FVVA 1DZQA 2AREA 1VAMA 1MS1A 3NV2A 3VKMA 4XJWA 1Q8OA 1FYUA 1FAYA 1TEIA 1ULCA 2P3KA 3ILRA 4AGRA 1MS0A 1SLLA 2JE9A 1RIRA 1JBCA 1SLCA 5DUWA 2D6OX 1LGBA 3MEPA 4GA9A 5DG2A 4LBLA 1UZZA 3OBRA 1LHVA 1LTEA 2C9AA 2EXHA 2PHRA 1S0JA 1SCSA 4L8QA 2JJ6A 2PHTA 3MW2A 1LGNA 2JECA 2V73A 1AX0A 2R0HA 4YW3A 3ZYRA 3I4IA 4YGEA 4W65A 1MS5A 3C2UA 2ZGSA 4K1YA 5DUVA 5GLZA 2P34A 1I3HA 1A8DA 1AJOA 1SLBA 1O4ZA 1W6OA 2CWSA 1DBNA 2AR6A 4XXPA 2GNTA 2WT2A 1G9CA 2OUJA 4I30A 4Z8BA 1KRIA 1LCLA 4XIKA 1CPMA 4YW2A 1VLNA 1Z0HA 4P14A 4XIOA 3N36A 1GNHA 2ZA9A 3ZXJA 1R1ZA 2ARXA 2EIGA 2NMNA 3U4XA 1JN2P 2VW0A 2ZGTA 3V0AB 5CBLA 3WUCA 3LSDA 2VUAA 2NZ9A 4AGVA 5T5OA 4GWNA 4WVVA 4PBPA 4Y22A 3KM5A 1A78A 3RMXA 3WG3A 3ZXFA 1HQLA 1W6PB 1DQ6A 4AVVA 2SLIA 4DQAA 2R49A 2VY0A 3WLUA 3WDVA 3T2TA 5IT6A 2D44A 5H9SA 4YZ4A 4ASMB 3ZXLA 4BQ1A 1S1AA 2GNBA 3O0XA 1G9AA 1ENSA 1WD4A 1Y7BA 3AZXA 4RA0A 5DXDA 3ZVXA 1CR7A 4YM3A 3FUOA 4YG6A 2YROA 4AVTA 1IS6A 4TZDA 4UW4A 4BPZA 5GZCA 2NYYA 1KJRA 5GZFA 5F9TA 3WZ1A 1LODA 3HR9A 2KM2A 2ZGOA 3GALA 1AX1A 4LBNA 3OY8B 1YO8A 1YRZA 4XJAA 2CYFA 5AVAA 3N7MA 4YG0A 5GJ6A 2VH9A 1DIWA 4PBOA 4R9DA 3RQ0A 5DUUA 3OYWB 3UK9A 2DVBA 1N3OA 2DURA 3M3EA 4BOWA 5IK4A 1Q8VA 4FOWA 3OJBA 1SCRA 2WT0A 3PVOA 1BYHA 4XBLA 4YW5A 2D43A 3ATGA 4YM2A 5T50A 2ARBA 3ASIA 3SITA 1NLSA 4XXAA 1JHNA 4CTEA 1VAVA 2A5ZA 3MPPG 4Q8KA 2A70A 4F83A 1GLHA 2WSUA 1QOSA 3AFKA 2W68A 1VALA 4K1ZA 2Z42A 3IPVA 1Q56A 4XE9A 1N3QA 5GZDA 3FUQA 3FFZA 4NO4A 1G7YA 1IS4A 4YGDA 1AVBA 4LBKA 1AXYA 4XJZA 1QF3A 1G86A 2JD4A 3WDXA 1FNYA 4GKXA 5GLTA 3VV1A 3RG0A 4AYUA 4M01A 4H55A 1KDMA 2PHFA 2GALA 2EALA 4XMIA 2R1BA 3AP6A 5T5PA 1LHNA 2ERFA 3WVJA 1UL9A 1GANA 3M3QA 1IS3A 3ILNA 4LBOA 1CPNA 2D6PA 2GDFA 2SBAA 1BQPA 2DWRA 2D7FA 4Y1ZA 3TB0A 2P37A 3AXDA 4FQ4A 4M3CA 1YYNA 3L2YA 5F5QA 3CNAA 3AZYA 5IK8A 1S0BA 4XZPA 3WG1A 4Q8LA 3B3QE 4XILA 4XJUA 4K20A 1LEMA 1QU0A 3AK0A 2YV8A 5E88A 3IN9A 3IM0A 4XTMA 5GALA 2OVUA 4YZ1A 3AYEA 1Q8QA 2A7AA 3JUUA 1O4YA 4ATFA 1W6QA 2FMDA 1N1YA 4UW3A 3HN1A 4SLIA 4Y26A 5JVVA 1C57A 2ZZJA 1V6NA 4FPOB 4XBQA 2ZGUA 4YFWA 1Q8PA 1QGLA 2P3IA 3A0NA 3AXEA 2DTYA 1LGCA 2TEPA 1W6MA 2D6MA 2ES3A 2DUQA 3N35A 3SH3A 3AYAA 3WDYA 1PZ7A 3M3CA 2AUYA 1AX2A 1H30A 2ZGRA 3M1HA 3AZVA 4BLJA 1C1FA 4BMEA 2ZBJA 1F31A 4U36A 1MVEA 2ZGNA 4FOVA 1KDKA 2A71A 3M2MA 1RINA 4P9WA 1ENRA 3WCRA 2D3SA 3FLPA 2DU1A 2CTVA 5DG1A 4XHXA 5CNAA 5JOZA 4JRAA 4PCRA 3A4UA 3AYDA 4HANA 4YFZA 1V6IA 2CY6A 3SH5A 3H0OA 2R0FA 1U0AA 4Y20B 3B69A 5GM0A 5EWSA 1CONA 4LBQD 1CQ9A 1S0EA 3MW3A
chains in the Genus database with same CATH superfamily
3GCXA 1LNSA 5FQ0A 3AP9A 3VBFC 3AZZA 2QQKA 1LRHA 5FZ6A 4V1PA 5F8PA 1JZ5A 2XJRA 4NWVA 1VMHA 2DCYA 1OLMA 1PNGA 5LBBA 2BGPA 2YU1A 4JQRA 1CN1A 1MPXA 2A3YA 2A75A 2B9VA 2Y8KA 5ERLA 2QQNA 4HSJA 4LUKA 1JOJA 4ZS2A 4PLOA 2RV9A 2RG4A 4YYOA 2FDHA 1R081 4YW4A 1S0IA 4BQYA 5EXOA 3E6CC 1YFYA 2WFPA 3SC7X 5F6LB 1H9WA 3QH7A 5L19A 1RHI2 2CGPA 3NJYA 4LBMA 1W8ZA 2G9FA 1AR92 3UV9A 4ARXA 1A3KA 4Q4W2 4DXTA 2BQPA 4IV1A 2YPJA 2O1QA 3MBWA 4HBNA 3ZPOA 2XUEA 1E57A 1YIPA 1GUIA 2VMCA 4MG2A 2MPFA 4IE5A 1BEV3 2VNRA 1TVGA 1RUF2 5FY0A 2VECA 3VL8A 4BYYA 3F95A 1EPZA 3B01A 2JD9A 2VU9A 1US3A 4ZKTB 3M3OA 2VZVA 3T1MA 2EA7A 2YUEA 5T54A 5L9RA 1VBE1 4HG6B 2R1DA 3WHTA 3WP5A 1DLLA 3H1WA 5KC5A 2MEV1 3VZOA 3K46A 1X50A 3WF1A 1JUIA 1WLDA 3N7LA 1ULFA 3ME2A 2XXZA 3I3DA 2WLQA 2XLFA 4BXSV 2PHXA 4Q1PA 3FN9A 5JSPA 3T1LA 4QPIC 3FMGA 4QMAA 2IXJA 5H9RA 5A7SA 1UWWA 1S0GA 2HWC3 3H3UA 5HCHA 1VJ2A 2ET1A 4Q4X3 3POJA 4GB31 5A80A 1A8MA 1JTZX 2VBPA 1AL21 2WNOA 3MGUA 1UMZA 2PQQA 3C8XA 1JYXA 4PIYA 3HQRA 2W39A 4FPLA 5JR7B 4AQ6A 1R091 4XC9A 5BNQA 1UYYA 2BUKA 3VBUA 1ENQA 2YXSA 1H8TB 3USUB 1E5IA 3O1RA 1QOTA 5ABJB 5CU1A 5SV8A 1JYIA 2F4LA 1H9PA 3Q8CA 2ARAA 2WS92 3RWKX 4DS0A 1I1EA 4RGKA 1NLRA 5SV5A 1LESA 5FMOL 4XTPA 4CPBD 2QQJA 4DPNA 4LHLA 4EWDA 4FAGA 2GMMA 1NZIA 2BBAA 4YM0A 4OHYA 4M3CF 2A6WA 1ZX5A 4Z92B 1C5HA 3VD4A 2BVBA 1X36A 2BRTA 2JG8A 3FJSA 4DXZA 5FK7A 5KXEA 1YQ8A 1SLTA 3OGSA 5FMDA 2VZPA 3U10A 1UPSA 4ZU4A 1UU6A 4XPVA 4HK9A 3V0BA 1AYN3 2E51A 4E2GA 5EJZB 5AFBA 1NG0A 1ZZ8A 3D0JA 4MX3A 5C71A 4MUVA 3O12A 3U75A 1F5FA 5FQ0B 2JIGA 1D4M3 1QJY1 4IE6A 3VLBB 4AFMA 2J1EA 3U0ZA 2RMU1 1LJ7A 3THDA 2ETEA 4QGNA 3BB6A 2OQ7A 3POSA 5DQ0A 4XCAA 4OI0A 3SXWA 1EUTA 3B93A 3J7LA 3LA7A 2ILMA 1G8WA 2UY9A 2XWJB 2VOXA 1GZWA 4KU8A 4D69A 5A3PA 5LW9A 1DGRA 3N7JA 4EQVA 4XABA 2WNEA 1AR72 1SLAA 5K9YA 1CAUB 3SH4A 5GLVA 1FT9A 5JOXA 2I45A 1JZ8A 5FTTC 4AEJA 3H8RA 1ALYA 2W3JA 4JGYB 4Y1YA 2GP5A 2PHLA 3B02A 3GHMA 1CVNA 4IV1C 1SFNA 3VKLA 5T5JA 5L36A 1H6XA 2R042 3HMYA 2TUNA 4GQ7A 4I0AA 3THTA 4IV3A 2Z5WA 1MACA 4UF0B 5HPOA 5JLVA 1REEA 4WVZA 3VZLA 3IIIA 4S2DA 3UKVA 3SCFA 1D4M1 1QJY3 3FLRA 5JUVA 1O3SA 3CHXA 4MXWB 5EFUA 5F2SA 5D2AA 3J4UH 1BBT2 2WFF3 1UN1A 1GQHA 1PM7A 3NL1A 4UW5A 3P3NA 4UYBA 5A33A 1TME1 3AYCA 5LA0A 3INAA 5FXXA 1UX6A 4IEZA 1COV1 2RM21 2VCCA 3B9CA 3ZYIB 3MIBA 1RUI1 3NRUA 5JMOA 3GF6A 1GOFA 2AGSA 4FXGB 3PTYA 4GAZA 1DQ4A 1HIXA 1S0FA 3FWEA 1RUJ3 2E7QA 1DQ5A 2VOKA 3R4UA 1MS8A 5A3OA 1G9BA 1QJX2 1W8TA 3MFAA 3PL0A 1B09A 1IKQA 2O8OA 2EAAA 2WZ8A 3LKJA 4CCCA 4P9JA 3KV6A 4MZUA 2WWSA 4NOTA 3A21A 3UT0A 4PQ9A 4I0BA 5DZGA 3VBRB 3BYWA 4DEQA 2P2KA 2VAUA 3BOPA 4LKFA 3ZKUA 1W0PA 2YFUA 2Z79A 3I2DA 2QKDA 2BU9A 1ULGA 1VBC1 2WT1A 4FPGA 2WL1A 1RUH2 2YMZA 3EXUA 3H3LA 5CFDB 1R093 4IV1B 5JOYA 1CIYA 1W6OB 2BW8A 1UZVA 1V6KA 5IAXA 2ZX4A 1G6NA 2VCAA 1QDOA 1PM4A 3GBGA 2Q1ZB 5HV0A 1DG6A 2EXKA 1RTVA 2V4VA 3B94A 4IL7A 4M3CB 4E2QA 4NROA 1GP5A 2WO1A 4PDWB 4XFGA 3I3MA 4UFIA 5FPLA 3CZUA 2A6YA 2P6CA 2W91A 3MIHA 1PVXA 4FOQA 5B2GB 1LOFA 4IDZA 1C4RA 3FBMA 2BOJA 3LAGA 4HN1A 2RMU2 3G6JB 1QJX1 1D2SA 5I0SA 2JKBA 5JDBA 1XSRA 4AZZA 3V0BB 3ZFEB 4QXCA 4PI0A 1ST8A 5FZOB 4Z2AA 1C8NA 1V6LA 3U37A 3JD73 1ULOA 5KWRA 2VW1A 5CG9A 1BMV1 3IAQA 1IGOA 1WKYA 2Y6KA 2RR12 3CJXA 1HQWA 3GBFA 1UF2C 3WW4A 2Q5TA 2C26A 1WLTA 5DAPA 2E53A 2VZRA 4BM8A 4CP1A 3KT7A 2D6NA 4CDXB 3PJQA 2ZHNA 2RS12 1UXZA 4QQLA 3VZJA 4HL0A 2WO2A 4IGPA 4QX1A 1ZBE3 1XSQA 2WNVC 3KCCA 1GZ9A 4OVEA 3T2OA 3FZ3A 1JOBA 1JW6A 3NMBA 1LOEA 4CXYA 2C24A 3M4FA 3GNEA 4LE3A 4R9AA 5FZKA 3WG4A 1LHOA 4BZ4A 1UY2A 4JZRA 3HD8B 2VNGA 1FI2A 4ZZ5A 1HKDA 1RYYA 2BNNA 4PQQA 2FBEA 3ZXKA 3CIHA 4EROA 4HKLA 4P02B 1AYM2 3NNJA 1QIQA 4XAEA 5F1RA 3NJXA 3ZFFB 1H4HA 1AXKA 5HCFA 5FPUA 3RYRA 1WBLA 1UPIA 4IV3B 4GWIA 1QMJA 4UF0A 3AP4A 1W6NB 2WR9A 3H7YA 4XBNA 3DGTA 5JSOA 1UO9A 2VGDA 3RZJA 2B45X 2YB7A 2LW8A 5ACA3 3MHZA 2PHUA 3KQRA 2BWAA 1F9KA 3RJRA 3UJOA 1QXPA 1QJU1 4FFIA 4HN0A 2XBO3 2GN3A 2X09A 4XFHA 4E8CA 1PZ9A 1OD3A 5LK7B 4LK6A 3POBA 4TN7A 2AREA 1MZFA 1K5MB 5CYYA 1RL3A 1VAMA 1VBA3 1VRH3 2VOVA 2ORXA 3THPA 2QDNA 1RXFA 3LA3A 3ITQA 1OPOA 2VZOA 1RIRA 1JBCA 1SLCA 2WAOA 5G05L 4BB3A 2D6OX 2I07B 2YC4A 4KH9A 3TEWA 1NX9A 1STMA 1NCRA 2ZXQA 4AAXA 1UQXA 2JJ6A 2YBKA 4YVWB 3E1F1 1S2EA 1JYVA 2P3YA 3S5AA 3ZYRA 1W3XA 3I4IA 4LPLA 1FXZA 3HBKA 1XC6A 1F5JA 3GM8A 2ZGSA 1H1MA 3FHAA 4K1YA 4XDOA 5F6KA 2P34A 1W6OA 2EIEA 1I9RA 1XB9A 2CWSA 2XL7A 4G9SB 4CEYC 3ORJA 1R1A2 3POFA 4UOJA 5GKAC 4I30A 5FY1A 5D8AB 4XIKA 3HVDA 1CPMA 2VOTA 1R083 3N36A 4QKDA 2QQLA 4DMIA 3SQOA 2ARXA 2VM9A 2ZGTA 1EY2A 3V0AB 4KQ7A 4CEYA 2VUAA 3NJVA 5DABA 3O14A 4PBPA 1OQEA 3KM5A 1PVC3 1W2NA 4LLOA 5EPAA 1W6PB 2QQUA 4AVVA 3HPNA 4LO6B 5JIAA 3RZMA 1U5XA 1YFWA 3VBUB 2W1SA 3OGRA 4ZZ8A 4JDOA 4QX5A 5IVVA 3OEBA 1JYTA 5I91A 4RYDA 5FYBA 3ZXLA 4ASMB 2GNBA 4BQ1A 5C3PA 3WQ7A 3O0XA 3I49A 5FY7A 1WD4A 5A1FA 1K12A 2XJTA 3Q8AA 3AKTA 3N9LA 2B5HA 2VZ3A 3ZVXA 4BQWA 3I59A 3FUOA 3T2QA 1X7NA 4YG6A 4A7KA 3VHOA 4B7KA 2B8MA 1WMEA 3I2GA 4BPZA 2HWB3 2QCSB 2VCMA 4UFJA 5DDJ3 1QXJA 3WNOA 3EYPA 2HEYF 4G3YC 2ZGOA 5A7PA 3GALA 3S6PA 1AX1A 4LBNA 1KEXA 1UY0A 2CYFA 1MEC2 2XWBB 3N7MA 5GJ6A 3ZYJB 1PHMA 5BNOB 4BDVB 1DIWA 2LUWA 2N7GA 4XFAA 4XUPA 5K4LA 3S57A 2PLV1 3LE0A 1OI6A 3RQ0A 1I5PA 2FDGA 3WX5A 1B35A 3M3IA 4JKMA 1JU4A 1NA1C 4BISA 3ZO0B 1N3OA 4BOWA 5FMCA 1Q8VA 1HRV3 1EV13 1TMF2 3OJBA 2FDIA 1S2BA 2VVEA 1RMU3 3PVOA 1BYHA 2IVIB 5CKMA 3WF3A 4I09A 5T50A 2JDMA 4E4HA 3SITA 3MZHA 3I54A 3OOXA 4AEDB 1XU2A 2W46A 1PO23 3MPPG 3HBZA 1JODA 4EWAA 5A7WB 1RUE3 3PHMA 1VBE3 3IDAA 1KD7A 1VALA 4E27A 4K1ZA 4B3NA 4DEVA 1V70A 2Z42A 4QKBA 3LD8A 3ALQA 4XVHA 4RS5B 3VBSC 1HJFA 5GZDA 3AKSA 5HBAA 2RDNA 4YGDA 2B39A 3JB8A 4J25A 1FNYA 3UYJA 4M01A 3OUIA 1KDMA 2PHFA 3BPZA 1VBA2 4NPLA 5I0RA 3TOJA 3ETPA 4CCLA 2ERFA 4BQXA 4AXOA 2XBO2 1CPNA 3CL1A 4PLNA 3ZXAC 4I3PA 2SBAA 1XNAA 4Z2WA 1HB3A 1QQP2 1ZBE1 1RUNA 4FQ4A 5BNOC 4SBVA 4RR3C 4BE3A 3L2YA 3R0RA 4MVTA 3AZYA 5FUNA 5IK8A 4XFFA 2G1MA 5HXVA 3CJIC 1OURA 2JDPA 4O9GA 4QB2A 1QJZA 3WG1A 4Q8LA 1UXXX 3B3QE 5FY5A 4XJUA 5A7QA 5A33B 1LAJA 2WFF1 3B9IA 4COUA 2YV8A 5L7OB 3IN9A 3GYDA 5GALA 4YZ1A 1MQTB 5FWJA 3JUUA 4ATFA 1SEFA 5KHHA 3UETA 1AYM1 2Y6JA 5AC93 2ARCA 3EBRA 2FMDA 4UW3A 1ZYBA 3VDDB 1OKOA 2VZUA 4META 5FYHA 4EWEA 1W04A 1CAXA 1K3IA 2BWCA 4Q0PA 4XBQA 4E9KA 1XNCA 3AXEA 1VMJA 1J3QA 4LIUA 1QEXA 1UY1A 3MIDA 5LZ6A 2D6MA 3N35A 5FOBB 5J36A 1W9FA 3SH3A 1ZRRA 4QPWA 1PZ7A 4P5YA 5DAQA 2AUYA 4NAOA 4O7XA 3H8XA 1H30A 1OF3A 3JQXA 2Q8EA 2IXHA 4BLJA 1C1FA 1F31A 3W20A 1AR62 2HJIA 1S55A 5FCCA 2QQPA 2RR13 2D3SA 2WWUA 3WCRA 3QH6A 1WZXA 4A6SA 2CTVA 3I59B 4URTA 5LY1A 3BGAA 1UKRA 3H8UA 4PCRA 3SEPA 2CDPA 3K48A 4P9IA 4I2OA 1HW5A 4YFZA 2CY6A 3ZR6A 1DGRN 2RMU3 3OBZA 4O61A 5HV4A 3B69A 3I3QA 5J1XA 1VRBA 1CONA 4NUBA 5A3MA 1ENXA 1RJ7A 1S0DA 4JAAA 2QNKA 4R52A 2EF6A 1O6UA 1B35B 1O5UA 4RQPA 3KCYA 4UFKA 1FMD2 5BNPC 2CAVA 1SACA 1HXS2 2FQPA 2JE7A 3DXTA 3HEIA 1WW7A 5FYMA 4AEKA 1WA4A 2GC1A 3TAYA 3IBMA 1WW4A 5FOJB 4CRQA 1M06G 3MLJA 1EAH3 5CFCA 1S2KA 3K3OA 2W92A 5F37A 1BBT1 3L2HA 1OLRA 5IVCA 3NKTA 1PO21 1ASJ1 4UAPA 5A7WA 1BKZA 1BCXA 5HCBA 1DGWA 1EP0A 3HJRA 4YVSC 2VXRA 3LPGA 3VB9A 3AKPA 3NJZA 1H2LA 4NIHA 1VB2A 2ADEA 3NAPC 2YY1A 2WA3A 2NMOA 4N53A 4ISRA 5HXMA 4CDWB 3UL2A 4DXRA 1W39A 4LHKA 3DPRB 3UGFA 3ZIWA 5GLWA 4LA2A 4LK7A 3U07A 1ZRFA 2HH9A 4R9CA 3D6EA 5CAZA 1C8M3 1ZA7A 3LZZA 4WM8A 1AR81 4CCMA 3NV1A 1GNZA 1UIKA 2ZZQA 1RUG1 4FXKB 4D7SA 3O1PA 3CQOA 2WFF2 1BBT3 4Z07A 4IEOA 4CUBA 1Z7S3 4P9GA 2W1QA 4AGRA 3E5QA 4AVAA 5J3UA 1GZTA 1QHDA 3MYXA 5FZCA 2BV4A 4QQHA 1JYNA 4ZXKA 1G9DA 4OLLA 3ACIA 1ACCA 2JG9A 2YDEA 1UOFA 2MNGA 4JC1A 4DIQA 2VBDA 3LSEA 3WSOA 3WF0A 2CU5A 1AL0G 2QQIA 2E31A 2D98A 3OD4A 4A42A 4B4RA 5A3UA 5FP8A 1PMHX 2LALA 3J8F1 4Y22B 1MZ6A 1AXZA 2RDRA 2W08A 1W90A 5FYYA 3W9AA 5FZ7A 5JZGC 2V72A 4LHNA 1UAIA 4AVCA 1Q5OA 2QZ2A 3FLTA 4A7ZA 2K9ZA 1H2MA 1BEV1 1F15A 4YVSA 5FZHA 4Q1RA 3FHQA 2W52A 4QPYA 4A45A 4CDUB 4CP0A 2JENA 2NLRA 2ZX2A 4MGQA 2FHRA 2HBTA 3I97A 3NAPB 4B4PA 5B4NA 3N7KA 4XF4A 4K21A 1FMD3 2EXJA 3VBHC 1W9SA 3ENRA 4D7YA 2FCTA 4HVOA 3K4DA 4CUCA 3UESA 4WBBA 1D0GA 2JXAA 1GQGA 4GWMA 4YLZA 1W8UA 1RUOA 4X6RB 3THCA 2VQUA 5DZEA 1D4M2 4CCDA 3WXPA 1SFPA 1XJAA 1C5IA 3TNQA 1UYXA 4BQ4A 4A6OA 5FZBA 4Q0VA 5D8AA 5A32A 4IEXA 2WZR3 1WCQA 4HKOA 3MW4A 4EYUA 1EUUA 1N3PA 1XXNA 3LEKA 3LEGA 3LEMA 3OYWA 4MYEA 1NAEA 5FY4A 4BWOA 5K0UC 1VBA1 1AR63 3KWVA 2PFWA 2BGOA 3CJIA 3IZOA 1OA4A 2A6ZA 3PUSA 4I3GA 1V6JA 4CPBA 2HWD2 4LOSA 4LO8A 3TEZA 5FUPA 1YQ5A 3TEYA 1SLIA 4HVRA 3G7DA 4RQPB 1VBB1 2R6QA 4W4ZA 5C70A 4I02A 4Y24A 2PHWA 3WG2A 2PMWB 1DYOA 1ULEA 3RWNA 1KGYA 4PT6A 1MQTA 4DZGA 4B7EA 4OZOA 3IMMA 4WVWA 4BA6A 4CU8A 3WF2A 4Q26A 3KLSA 5JOWA 1FOD1 5FMOS 4CCEA 3ZSKA 4FPFA 1MEC1 1US2A 4CCNA 2D3RA 1IS5A 3WD5A 2UWCA 4XQWA 4OI2A 1SBDA 3GJAA 1RUJ1 5FREA 3RZLA 1X33A 4M00A 1OH3A 3AB0A 3BUCA 2DTWA 3USUA 2D6KA 4Q4X2 3SKVA 5C9AA 4XUQA 3JBG1 1ND3C 4L0PA 1E5SA 1W9WA 1W2OA 1IPJA 2OIIA 3K75B 1X9TA 3R6SA 2ZCWA 3LGRA 3NSTA 2ZGPA 3UGHA 2RJLA 1VBD3 5I0TA 4HXCA 2YYOA 4AK3A 1MVQA 4AOCA 4DY5A 3O1SA 2WQZC 5A3TA 3EJKA 3O1UA 4FFGA 4NHKA 2YHJA 1XYPA 1QOOA 2E9QA 3PIGA 1V9U3 3B00A 3I2IA 4QDQA 3S7IA 3LDBA 1BEV2 3JB4C 5FP3A 5FYTA 5LY2A 5I8TA 2FZ2A 4FBFA 4DNYA 5FZ8A 2VZ1A 1GV9A 3O5SA 1WCSA 4Y4YA 5FBJA 4XAAA 1FMD1 1OA2A 2J22A 1NQDA 2AYHA 4Q4X1 5C8CC 1KQRA 1LHUA 4COYA 4H14A 5DMYA 5I93A 1WUVA 4P5HA 1FNZA 1RMU2 1XPWA 5F7UA 4QB1A 5IUQA 1TMF3 4NPRA 3WV6A 5FUIA 2DCZA 4MGIE 5E89A 5E6HA 1BK1A 4URAA 2V4AA 5DUXA 5CIRA 2D97A 2QBXA 3BKZA 2I74A 3WNNA 2VMFA 4DOUA 2K0GA 5JI9A 2DBNA 2FDJA 2Y64A 5BPXA 1APNA 3JQWA 4Y33A 3POWA 5JZGA 3GZTB 4XACA 1LHWA 3ES1A 5FZGA 5G04L 1QJU2 3N9MA 2JWPA 1YCIA 4IEYA 4WZFA 1D4VB 1Y9GA 4RL7A 4EN6B 4GH4A 3MI8A 2WKKA 1W8NA 4Y5Z0 4AI1A 4QPIB 3ILFA 1MS4A 1EPWA 5FPZA 2H0BA 2JG9C 2ZHLA 1ZZ6A 4JGZB 5T3NA 4A4AA 4FTEA 1Y9QA 2Y26A 4WM7B 1RVF2 4AHYA 4JHTA 1RUG2 4QHBA 1XQNA 2R062 1DFQA 3TBDA 4XETA 1GICA 4P9YA 2WLPA 2Z4FA 3HNBM 3QCWA 4IEWA 4M0NA 4R4ZA 4N43A 4UW6A 3D0SA 3N3HA 4HPKB 1N1TA 1TZOA 2TNFA 4QHOA 2XB6C 3VBRC 3C7OA 3JU9A 5CZKA 1ZZCA 1BLZA 2RDSA 1A34A 2VL4A 1ND3A 2XPJA 4BXFA 1JZ2A 3WP3A 2RJKA 1CIWA 4CE8A 4XMAA 1ASJ3 1S0CA 1XNBA 3KMHA 1Y9MA 3NAPA 5DDJ1 2QVSB 5L73A 1UYPA 2E26A 2FZ1A 3O0WA 4QQ2A 3H7JA 1DGLA 1UNBA 1XNKA 4XJ9A 3AM2A 4CEWB 3ZFGB 3ZN6A 3MF9A 1W05A 5ISLA 4FPYA 5T52A 4XUNA 2XBO1 1UU4A 5FP7A 1CAVA 2G9GA 1D2QA 2GMEA 1TE1B 5A6QA 3OPTA 3PDQA 2BP6A 4YZ3A 2ZPXA 1NKGA 1GQPA 1CESA 3J8F3 4FVVA 2QUOA 4MV2A 2HWE3 3N4MA 2DBIA 3VKMA 3O1TA 4XF1A 2KR2A 2OQ6A 4IE7A 2P3KA 3H50A 1BK0A 3QOPA 1UZWA 5FZOA 2JE9A 3AFGA 4QD2A 4TLFA 5EZWA 5CEHA 3FL7A 2WIIB 3MEPA 3Q8BA 5DG2A 3IWZA 2GH8A 2VQTA 3WW3A 5ACA2 4N7UA 5JXJA 1UZZA 3DPRA 1GWMA 2ID4A 5A1LA 2VG9A 1LTEA 2PHRA 3ZDSA 2DCTA 5J09A 1E5RA 3MW2A 5APAA 1LGNA 2JECA 4K8RB 2V73A 1GWKA 1PK6A 3HNYM 1AX0A 4DUVA 4O9EA 4YW3A 2BPA2 2Y6GA 1L7LA 4K3UA 1IPKA 1YEWA 3BN6A 4W65A 5FYSA 5FXZA 5CKNA 5DUVA 1EV11 1AJOA 3LIGA 1VBB2 1AYM3 2XKOA 1RUG3 5AC91 4XXPA 2GNTA 2WT2A 3NKGA 3OGJA 4IEQA 4LO5B 3NVCA 1AR61 3OBAA 4L99A 4AQTA 1LCLA 3BTYA 3PUHA 3VBSA 1F4AA 3PIJA 1VLNA 1Z0HA 1XU1A 3CO2A 3LWCA 1CZTA 1PX3A 4H7LA 4IV3C 5ANNA 4D6RA 5A70A 3DYMA 4YVWA 2R32A 3ZXJA 1X8EA 3PMSA 2FDFA 4AI9A 2VW0A 3E97A 3ZIXA 5CBLA 2WBKA 2NZ9A 4AGVA 2NPIA 3GDBA 4Y22A 5TSWA 2RS13 1OVSA 1A78A 4MHUA 2ZX3A 3A22A 1HQLA 3WG3A 4CU9A 1ZREA 2RS51 4QWNA 5LASA 4DQAA 2R49A 2VY0A 5C5TA 5KHIA 1W3VA 2WYSA 2O8QA 3WLUA 1O91A 1ZVFA 1J1LA 5ACA1 4TTGA 2ADDA 1O4TA 1O3RA 5HI0A 5BNPA 1QH6A 3JD72 1ENSA 1G9AA 3VBOC 5DXDA 3IB3A 5LATA 4KBZA 2HYXA 4GZ9A 1JOPA 4NIGA 4UBHA 2W2IA 1F4HA 4E4ZA 1CAUA 2JEMA 4TZDA 5DN2A 3DF0A 4QX3A 5FO9B 2NYYA 5GZFA 3LB9A 4GH4C 1JHJA 2IVJA 2YBSA 4HETA 1YO8A 1YRZA 3BU0A 4YG0A 2HWD1 2P5BA 5FZAA 1Y4WA 4R9DA 3ACFA 3HAGA 4BK4A 4YW2A 5DUUA 1W99A 3OYWB 1YQ6A 3EHKA 2V09A 4NMIA 3WNLA 1JUHA 4AW7A 2WZPP 3IIAA 5F39A 5IK4A 3SHRA 4CXXA 1U5ZA 3I7DA 3AMPA 3HN3A 2D5FA 4YW5A 3ZYGA 4P08A 2ARBA 3PJYA 3CZJA 5IJRA 1CX1A 2A5ZA 1O5LA 4Q8KA 2VQAA 2WSUA 2KXLA 4F83A 3DKQA 1YLLA 4RHV1 4YARA 2Y33A 4OHXA 4EN8B 3SKJE 3MIGA 1H8TC 1QJX3 2GSYA 3IPVA 4PIXA 1RUJ2 3ZLIA 1Q56A 2RDQA 4WM7A 4XE9A 2K46A 5FBZA 3ZOIA 1J59A 1IS4A 4LA3A 1AVBA 4CA9A 4LBKA 2WN2A 3I3BA 1G86A 3WDXA 3MF6A 4GKXA 3VBRA 3KSCA 1RUI2 4H55A 2GALA 1LHNA 3FX3A 3WVJA 3ON7A 3B7MA 5EJ1B 5IYYA 3VDBA 1J3RA 5C9AB 1IS3A 1A6CA 2GDFA 1OQDA 4UFMA 5FAXA 1BQPA 4BH9A 2VNVA 3JBG3 2AZ5A 2P37A 4COWA 5K8SA 3T0DA 2YG0A 4GWJA 1VBC3 4ES9A 1BVP1 4W6YA 4JKKA 2C4XA 1S0BA 1CD3G 4PDWA 1HXS1 3LDKA 5FJKA 2LRPA 4K20A 1LEMA 1QU0A 4PHZA 3ZYHA 2HWD3 3SCHA 4L2NA 2WN3A 3RNSA 4A3XA 3V56A 3ACGA 1YNAA 3AYEA 1CJDA 3ACLA 4A44A 1O4YA 1W8FA 3BTXA 1AR73 4UFHA 1O7FA 2O0OA 4AI3A 5C3SA 5FPBA 2WZR2 4COVA 5F3CA 1ZRDA 3MICA 3HN1A 3EO6A 2ZZJA 1ZBA2 4FPOB 4N90A 4YFWA 1QGLA 4S2FA 1TG7A 2E33A 2DTYA 3FC0A 1W6MA 3NNLA 2XOMA 2ES3A 2DUQA 3DECA 3ZN5A 2YU2A 4EZHA 3KV5A 3AYAA 3WDYA 3M3CA 5JXIA 1JZ3A 1CZVA 1AX2A 2ZGRA 2WS91 3AZVA 5KBFA 3LOBA 4LORA 2ZBJA 4IEPA 1ZBA3 4U36A 4LLFA 1JH5A 1KDKA 3BPSA 5FZ1A 2E7AA 4AHZA 4IGQA 4UFLA 1NCRC 1AYN2 2UYAA 1LKNA 1HRI2 1OC1A 2F17A 4NN0A 3POGA 4Q0UA 2L9LA 5C3OA 5JOZA 4JRAA 4AI8A 1SDDB 3A4UA 3AYDA 4HANA 4J1XA 1HQNA 3K4AA 1ZRCA 4CCOA 1U0AA 4Y20B 5JI7A 4WVMA 3RVHA 4XBLA 4XXAA 1QJEA 4NHYA 3VZNA 3JXSA 4KBBA 3ZFFA 3HIFA 4KU7A 1BHGA 1GZCA 2GC3A 1VBC2 5C6CA 1GBGA 2XGXA 5LB6A 5FYUA 3JBG2 4XFCA 1J58A 4JKLA 4AVSA 5L7OC 1UOJA 2DVFA 2UWAA 2VZTA 1W06A 3VBOA 3ZR5A 3VHRA 2WABA 1XYOA 4C90A 2ENRA 2VC9A 1WWYA 4FPHA 2ZOEB 2XUMA 2YGMA 4KG0A 5LA9A 4YZ2A 4FPEA 4MXVA 4BQ3A 5C3RA 5JMCA 3HWJA 1C8M2 1DF0A 2B4KA 2DVGA 4LBQA 5KXBA 1NE4A 4NPMA 4QAWA 1IKPA 2XG3A 5BY5A 4RN5A 1HRI1 2HWC2 1UMIA 1PVC1 3A0KA 3AVRA 1FOD3 1JU3A 3POYA 1GP6A 5GZEA 4AEDA 5L9VA 2IFWA 1CAXB 2UURA 4LXLA 1HB1A 2HWE1 4ES8A 1JYCA 5A7NA 3BTAA 3RSJA 5BV6A 4JQTA 1HN0A 1BMV2 4XF0A 1NCRB 4LKSA 4FFFA 4FPCA 3TN91 4RR3A 3Q9OA 5CKQA 1TME3 2Z2SB 4M0HA 4YSFA 2R7EB 5IWFA 3I3EA 3PLQA 4OQ9A 3RFRA 1OKQA 3AC0A 4BK5A 3JD71 2H0VA 2C1FA 4UWDA 1EAH2 4N53B 3W5MA 1TNFA 1NYWA 1RUC2 4E8DA 4GALA 4QX0A 4NE9A 4YGEA 1WBFA 2BVVA 2BYVE 1RITA 1U12A 1AJKA 3P6BA 4WM8C 3PU8A 2EXIA 4ZY9A 2DVAA 4NHXA 1AUYA 1UCXA 2I2SA 4DXSA 2B42B 4AGGA 4Q4V1 2WA4A 2XJQA 3O7OA 4Q4W3 4DRVA 3LA2A 4Z82A 4C0HA 3VDCA 1RHI3 4ZS3A 4FAHA 4D0QA 3O1OA 5FIXA 2W87A 2Y60A 3RI8A 3U78A 3I2HA 1D0HA 3R4SA 4R4XA 2PELA 4AVBA 4CVUA 2J1VA 1VRH1 5IK7A 4N9IA 2HYKA 3PMEA 3IMNA 2ZHKA 2VD7A 5EYXA 1MS3A 2Q4SA 4AI2A 1LENA 4CCJA 3IPVB 3APBA 4XHBA 4CDWC 3RZKA 4ATEA 3T3YA 2BZDA 4L97A 4YZ5A 3CU7A 1F2NA 3W21A 3NO8A 4DINB 2NN8A 3QACA 3OPZA 3AZWA 4Q4Y3 2IZWA 3PVBB 1H8VA 4YW7A 2D93A 4YW6A 2ZGKA 5FZLA 2OKXA 2LROA 2JE8A 1POV1 1SQ4A 4HT1T 5JAXA 2MHFA 3W58A 4JTNA 4IQPA 4YM1A 1PGL1 2RM23 3I8TA 5F5CA 1GZWB 4ET7A 2V5YA 1UW8A 3ROUA 3NV4A 1AF9A 1NZCA 1W8HA 1VBB3 4WVMB 4WM8B 1X82A 4JVAA 1GYKA 2VQ0A 1N47A 5FRAA 3VD7A 3DXUA 4QX8A 1ONAA 3PUIA 3H1YA 3LFMA 4FI9A 1DGWX 3H9AA 1COV3 2R16A 4FOYA 4S2HA 1NY72 3V65A 1K5MC 3KF5A 4N9HA 1OFSA 1YIFA 1UX7A 4XFBA 5J96B 2GNDA 2AH2A 5A32B 5EJ3A 3EQEA 5KHKA 1WCKA 1IQAA 4LKDA 1GR3A 4Y4RA 4KWLA 4XYXA 4BIFA 5KC6A 2XQRA 4DRRA 5IK5A 4ZHNA 2J1SA 3KHBA 3T4VA 1BZWA 4MXWA 3RZGA 4HKWA 1HLCA 1K45A 2IUWA 3I2OA 3OPWA 3WNXA 3OG2A 1W6MB 3I2JA 4R8HA 5EV7A 2QQMA 1OPMA 1GKBA 1RJ8A 3MUY1 1DZRA 3AJZA 3KT1A 1PIV3 4X6QB 3ZSEA 3T0BA 5FO7B 5FZ0A 5FYIA 2G9ZA 4W50A 3VKFC 2AC1A 4ZU5A 1X8MA 4KWJA 4Y3OA 1VBE2 1FPN3 2FCVA 4KWUA 4K6BA 1VIWB 3TN93 1PZ8A 3UKTA 4CZSA 5JPMB 1PO22 2QDRA 4X8PA 4OHWA 2DUPA 2HLEA 5DAWA 2ZEXA 3PU3A 3NNFA 3WNMA 2JDKA 1IZ3A 4LNVA 1DDLA 3RDIA 4ZXEA 2DVDA 1JS9A 1EV12 1RVF1 2VE1A 2X8KA 3ZKYA 3LDRA 4NVPA 1JZ4A 3D82A 5A1AA 1ASJ2 1DYKA 3KT4A 4RQPC 4OCTA 2P6HA 3OUHA 3IAPA 2G4IA 3VN4A 2W95A 5E8AA 5H9QA 4BU2A 1QNWA 1MEC3 5FO8B 1QDCA 2W5FA 4GIQA 3VDDA 4IEUA 1PMJX 1POV0 4HZFA 1V6OA 4BMBA 1FPN1 2R30A 4YWAA 2QE3A 1GFF2 4RD7A 1YWKA 2HWB2 5JR2A 2X5IB 4JCKA 5LEJA 2EAKA 1RMU1 1Z7S1 4AQSA 1T6BX 2R063 3C7GA 4M3CE 5FLIA 4OZXA 1PIV1 2HEVF 3ZYPA 4CSWA 5IVBA 1RVF3 4QGMA 3N9PA 2LM3A 2B7YA 1P8JA 2ZHMA 3AVSA 4FT8A 4FQZA 1QXRA 5LWBA 4HFSA 2ZKLA 2OT7A 5FJHA 4AFDA 3E5XA 4NRMA 2VZSA 5FV3A 5LRSA 2Y38A 2XKPA 5J98B 4NRQA 1CAWB 2QZ3A 5C5UA 1PVC2 5FXWA 2UU8A 1DYPA 2OW4A 5B4XA 4HSLA 3FE5A 4K7JA 2OS2A 4XEZA 3WOGA 5CB7A 4TYSA 1LOGA 2A6XA 3TNPB 3D3AA 1Q8SA 4WV8A 2PHDA 4BLIA 2IC1A 4MGTA 2ATFA 3RZZA 5BYNA 3C7FA 4KL1A 2WNUA 4C8DA 3OCPA 1NOVA 2BOIA 3AJYA 2W9XA 4CP9B 3AMMA 1R64A 1R1A3 1V00A 4LIVA 4QXHA 1UU5A 4HVQA 3KVAA 2VMDA 2CWMA 3GBWA 2EVXA 5GLUA 3A7QA 3NV3A 2H6BA 2XHNA 2WDBA 4P9LA 2GNMA 4QPGA 5LBEA 4LITA 5FFOC 4QB6A 2P17A 3ABZA 3UJQA 1PO11 1OQ1A 1AR71 3PVEA 4RGAA 3KHCA 2Q8DA 5ABJC 1REFA 4LEJA 4LMFA 4K9SA 3UKNA 1LEDA 3QLQA 3JCIA 2HWF2 2VZQA 1KS5A 3TEXA 5KHGA 1V9U2 2OUHA 3J9SA 4TSVA 1HN1A 3VBHB 1UY3A 4QM8A 3C7HA 2WUHA 1OFNA 3K2OA 4QU2A 5LBCA 1PX4A 3U1XA 2CHHA 2ZGLA 4PF5A 2Q0AA 4OYUA 5ANQA 1VRH2 5DAXA 1VR3A 2W0XA 4NAMA 3VKNA 3VUOA 1VBD2 2XLGA 1SBFA 3H1MA 3P5BA 1N1SA 2NM1A 4OMDA 4XDQA 1ODMA 5FLJA 4OI1A 5FZEA 2JB8A 1JZ7A 2WJSA 2WYFA 5J48A 2ZEYA 5K0UB 1L3JA 1NA1A 4HONA 4YRDA 5FYCA 4XW3A 4QQPA 4Q4W1 1PGSA 2ZGMA 3O0VA 3C7EA 4YG3A 2RHPA 1V0AA 3RJ2X 4AWDA 2QJVA 2RS52 1LULA 1H4GA 2UY8A 3M8LA 2JG9B 2VMEA 2A6VA 1AL23 4I0WB 4AG4A 5C8CA 4C91A 2WO7A 1JZ6A 1MS1A 3WW1A 3M7AA 3NV2A 1Q3EA 3POEA 1Q8OA 1FYUA 2QTWB 5I8SA 5BNNA 1FAYA 1ULCA 5FPAA 4JRLA 3ECQA 2Y6HA 2ZX0A 3M70A 1MS0A 4QPIA 1UOGA 5DUWA 5FK8A 1LGBA 3CMGA 1O3TA 2BEOA 5KR7A 4LBLA 2EIDA 2D5HA 2VO5A 1LHVA 3OBRA 2CAUA 4LTAA 4UXAA 2JG8C 2C9AA 1JI6A 2EXHA 1S0JA 1SCSA 3PNAA 4L8QA 3OEAA 5FP9A 1PMIA 5AFEA 1E5HA 3K4ZA 5GLZA 2QQVA 3VZMA 1I3HA 1O4ZA 2BGCA 3NW4A 1DBNA 1DCSA 2B9UA 2E63A 1REDA 2OUJA 4K40A 3WQ1A 4BIOA 4Z8BA 4ORFA 1ZNPA 2ZAHA 4M4RA 3LFIA 2ZTNA 1ZZ7A 2NMNA 1XE8A 5JSRA 1JN2P 1IHMA 4W6XA 1ODNA 3WUCA 3LSDA 4RHV2 2F6BA 3UGGA 1PGW1 1SPPA 2VUDA 4GWNA 1GP4A 4WVVA 3URFA 3ZN6B 1HRV1 2GU9A 4CEWA 1W2UA 2DDUA 3CKHA 2GAUA 1DQ6A 1HX6A 1PO12 2J1RA 2SLIA 3P1IA 2VUCA 2XJUA 2PLV3 5CISA 3MV11 3OF1A 3T2TA 2D44A 5H9SA 4FFHA 4YZ4A 5IT6A 1RGSA 1GOGA 1R092 4QT6A 2X53S 3AZXA 4RA0A 3S5QA 4L9BA 4AQ2A 4E2SA 1CR7A 1V9U1 2C0ZA 1RUH3 2J1UA 3SMHA 2OPWA 4V2VA 1OH4A 4YM3A 2WZR1 3GZEA 3NNGA 1PO13 4MO3M 5F2WA 4NIAA 1IS6A 1OD5A 3VGIA 2FCUA 4AVTA 1WGPA 4MHRA 1CGPA 1O59A 1ZBA1 1KJRA 3LOIA 3PUAA 3WZ1A 2UYBA 4GULA 2V5DA 3WP6A 1VBD1 3HR9A 5CFDC 2PAMA 4N43B 4RHV3 5C3QA 1W03A 3OY8B 5AVAA 3GGLA 5BXXA 3TWIA 3DV8A 2VH9A 3VD3A 1AHSA 2A1XA 2RS32 2JDUA 3GXUA 4XDPA 4YNIA 1Z7S2 2DVBA 3KB5A 1KFUL 3BVCA 3IT8A 4XF9A 1HB2A 3M3EA 3VD9A 3BU7A 2JB4A 5F5AA 1U5YA 1SCRA 5EP9A 3MLLA 4CDQB 2YC2A 2WAAA 2WZEA 5E16A 1I5ZA 3ATGA 4XURA 5JCTA 2MEV2 3MIFA 5C7GA 5J37A 1RUH1 2VVFA 1NLSA 5FZ9A 1JHNA 3ZFEC 4OMCA 1WCUA 4A2UA 4CTEA 3CDZB 5IVEA 1GNYA 1QJY2 1VMFA 2VXJA 1GLHA 2R071 1QOSA 3GZAA 1RUC1 4GD4A 4AF9A 4EN7B 3POIA 4AI0A 2JDHA 2PXJA 5FP4A 2R043 2GP3A 1LR5A 4A41A 1F8VA 3WP4A 4CDUC 4CP9A 3FFZA 1G7YA 3I2KA 4UT5A 4XJZA 2Y0OA 2O14A 2YPDA 3OD0A 4KWKA 3RG0A 4EE2A 4LR4A 2VPVA 5F3EA 4XMIA 4AHXA 3C3VA 3AP6A 5T5PA 1GOHA 1UL9A 2RS31 3M3QA 1AL22 3TYJA 5LCWL 4LBOA 2XVLA 2X10A 3WR0A 5K7PA 4N43C 1HXS3 2IFRA 3I2FA 4TLGA 5IFPA 4NIIA 2VVDA 3AXDA 4W8JA 3CF6E 5CG8A 2CGNA 2OXBA 1Y3TA 1D7PM 4D94A 3KF3A 2TBVA 2JKXA 3WQ0A 3CNAA 4XZPA 4DUWA 2DCJA 4IE0A 4CEWC 3J7HA 4GMP3 2XHKA 4XILA 3F2ZA 1UOBA 2J7MA 3AK0A 4IETA 4D6SA 2AEYA 3KQ4B 1XE0A 4CDQC 3ZN4A 2WNUC 3IM0A 5A3NA 1OUSA 2OVUA 4EZ4A 1Q8QA 2Y34A 3ZYFA 1RUD1 4PF1A 2QQOA 1ULPA 1XNDA 2W47A 1WMDA 4TXWA 4ZU7A 4PLMA 5IHRA 3ES4A 4SLIA 2HWF3 4Y26A 1C57A 4JGZA 5JVVA 4CCKA 2OZJA 2DCKA 4BQ2A 5EIYB 1M4WA 3W5NA 2P3IA 1OOPC 4OQ8A 1LGCA 1GU3A 5FZFA 4CXWA 2GC2A 2YBPA 3DL3A 4BHPA 5M0TA 1VB4A 1NY71 5L7OA 3M1HA 4HPKA 4H3WA 1IG3A 4JGYC 4AFCA 5FPXA 2PQSA 3E6BA 1MVEA 4FOVA 4QU1A 3Q8EA 2JICA 1POQA 2A71A 5JWPA 4XUOA 3M2MA 4P9WA 1ENRA 4IW3A 5AC92 2YC0A 2WRAA 1ND3B 4XHXA 5CFCB 2PTMA 2VTFA 2Q8OA 4HOOA 1HV1A 2VR4A 3SH5A 1HV0A 2R0FA 5GM0A 4LBQD 4NJ4A 4CP2A 2WINB 2Y0IA 5C33A 4Q4V2 3BIWE 1AR83 4DUXA 5D8AC 4AFBA 3BALA 4IE4A 3ZFGA 1FV3A 3H8OA 3VDAA 1LU2A 3ZDVA 1YI9A 4PIZA 2R072 1QQP3 2WNUB 5F3IA 3ST7A 3VL9A 2GMPA 4B4QA 1YQCA 4KGQA 3VHNA 1YUDA 4L92A 1V6MA 3RPQA 3WNPA 1W8OA 4JGYA 2LTNA 3FFQA 2ZX1A 2VJXA 3RS6A 1PGL2 2E32A 4N7IA 4V2WA 1UIJA 1DZTA 4U2AA 4Y1XA 2C5DA 2D40A 3GZUC 1OOPB 3VBUC 3IKWA 4GB33 4JHZA 4Y1UA 5KXCA 2E7TA 1BXHA 3MV01 3RYKA 1QH7A 3ZXEA 4JDNA 3WQBA 4B8EA 1DQ1A 1ND2B 1SBEA 2IXCA 3HNMA 5CADA 3VBOB 3K3NA 4JTOA 5GZGA 2FMYA 2XJVA 2DUOA 1RUE2 4M4PA 2JDZA 3AP5A 1W0OA 1AR93 3OBTA 3AKQA 3KCXA 4DY3A 1N1VA 1DU3D 1GWLA 2ZACA 5CFCC 2ZMKA 4QX7A 5LRRA 5LA2A 3FHIB 2W94A 4QXBA 3CLPA 2Q1MA 4WZCA 2D6LX 1HRV2 1NXMA 5IW0A 4AAPA 3E6DA 3MLKA 1OMIA 3R05A 4YGBA 3OY8A 3KD4A 3D4KA 4XOGA 1NA1B 1MZ5A 1YQ2A 1OXCA 2HEWF 2A3XA 4GJZA 1FX5A 3CEWA 4MGKE 2Z69A 4MGYE 4Q0QA 4QHZA 5A3WA 3ZM8A 2BNOA 4FO9A 3WUDA 4INDA 4WM7C 1C1LA 2IXLA 2UWBA 4XZUG 5DDJ2 4MLOA 3SEEA 4KNCA 4AEDC 2GZWA 4GB32 3ZSMA 3BI3A 2JDAA 5LK5A 5T5LA 4OHZA 1WLCA 4XJ8A 4HLTA 3HT2A 2WQ8A 3E5UA 1OSGA 3VKOA 3SLIA 4NHLA 2PN5A 2WNVB 1WD3A 1OUXA 2ZMLA 4RS5C 4MADA 2F4PA 1HDKA 2WO3A 4ASLA 1ND2C 5I0DA 2R073 3S7EA 4J1WA 2ZAAA 1W2TA 3FBYA 1XOYA 4OUEA 2YZ4A 4F3JA 1LOAA 3HT1A 5CA6A 2NP0A 2VMHA 1AR82 5IFTA 4Q4V3 1DQ2A 4LBQB 4QX2A 2DU0A 3JZVA 3ZSJA 1O8SA 1EYBA 3AL6A 2IXIA 4FPJA 3S30A 3ZFFC 4GMP0 4DO0A 1W9YA 2G19A 1MS9A 3DN7A 3ZFGC 4DFSA 3H3ZA 3RYPA 1UZ0A 1R082 1K5JA 1WCDJ 2JX9A 2VW2A 2XR4A 3KS7A 4OFGA 3WF4A 4FTSA 2KD7A 4Q29A 3ZMNA 3NQHA 1AZDA 2W1WA 2BBVA 1O3QA 1CWPA 2CNAA 5FYZA 1WMFA 1RHI1 1QJFA 2ET7A 3LEIA 4I01A 3DEMA 3MPBA 3DUIA 1IOAA 1NCQA 3KVBA 1J84A 1SPPB 2ZMNA 5FZIA 3IDCB 1W6PA 1IPSA 2VOWA 5J7MA 4Q4Y2 1CX4A 1W28A 4LHSA 5KHJA 4Y20A 2BTVC 4P9XA 5D21A 4CUAA 1C28A 3T0AA 2LS6A 3LCPA 4FPKA 5C8WA 3BIEA 1CJPA 2HWB1 2R061 4R9BA 2XJPA 4FCAA 3OUJA 4LT5A 1UKGA 4ARYA 4E4SA 3U11A 1KFXL 3BOWA 3MO4A 1K42A 4B1LA 1AYN1 1OOPA 3VHPA 1J3PA 3IDEA 2BDRA 5E1RA 3WDWA 1RUD2 4YVWC 1ZM1A 1S4CA 1Z78A 1WW6A 3WINE 4LBJA 4KI5M 1WMXA 3AKRA 4RGGA 3SISA 2RVAA 3B5LB 2CGOA 2EICA 3N9NA 1POV3 1DHKB 4PDWC 5FYVA 4AL9A 3SNMA 4FSJA 1LOCA 2RJ2A 4NIDA 5FZDA 3PTRB 3T4HB 2BJSA 3OGGA 5JPNB 1URXA 1L7RA 1K5MA 1L7QA 1RUC3 5DAVA 5F3GA 3U14A 1ULDA 1SFYA 1TQ5A 2BFUS 4ITCA 4OUSA 4W6WA 4GKYA 4XCBA 3VBFA 2IXKA 4JX0A 2DYCA 2KA3A 1YFXA 4COZA 5KXDA 2HWC1 1JXNA 2ZKNA 1B35C 5H9PA 2ZABA 3EMRA 3PURA 3RMYA 5A6YA 1TME2 1ZA4A 3AX4A 1WLWA 3AMHA 5AVPA 3ZPYA 3TRSB 4NRPA 3LQCA 1NXD1 2CL2A 1WA6X 4ISQA 5CFDA 1R1A1 2DFBA 4C1WA 1NT0A 1FOD2 4FP3A 4RSUA 4CDXC 1ZBE2 3J7NA 1LECA 1J1TA 3RI9A 2P4EA 3H42B 4QDSA 3N9QA 2J1TA 1YXWA 4MSVA 4K8FA 5EQUA 1FATA 1W0NA 1IQDC 1G9FA 1GSLA 2MEV3 3N9OA 2Y6LA 4IGOA 4YW1A 1UMHA 4FP2A 3UNPA 3KZ4C 4GH4B 4IESA 4KG8A 1JMUB 2IWGB 2Y6FA 3QBQA 4IERA 4UI9L 5DZFA 4E4DX 2E6VA 1SHWB 3AP7A 1LB2A 5FPVA 3BODA 2ZGQA 2Q8CA 1ND2A 3ZFEA 2XLAA 3V0AA 2RS33 3EB7A 3WHUA 3WNKA 1QNYA 1VPHA 5IAVA 4Q2FA 5FKCA 1KS4A 1DQ0A 3LPFA 2VTXA 2PAEA 2ZJCA 4L11A 4FTBA 2BNMA 4CU6A 3KV9A 1VE0A 4CDXA 5JIUA 4N8MA 3WDUA 3ZX7A 1NQJA 5FDBA 2AENA 3T2PA 4AEMA 3S0MA 3NWKA 1LU1A 2AACA 1MR5A 4D8MA 2WWJA 2VNOA 1HRI3 3LIHA 2K2SA 1PK6C 1FV2A 2JDYA 4EN0A 2DF7A 4Q0SA 5FY9A 1NCQB 4B1MA 2PYTA 1C8M1 3OTFA 4ZONA 2PLV2 3RGBA 5FZMA 1H6YA 4GXLA 2WSVA 5JZGB 1QY4A 1QWRA 1YI7A 2YGLA 1YJKA 4YGCA 1RB8G 1DLCA 2A3WA 4XUTA 5EHDA 4RFRB 2HWF1 1LOFC 1OHFA 4C1XA 1W6NA 1CAVB 1KITA 2XONA 2VCBA 4Y5TA 5C9AC 1I6XA 2CSGA 3X29B 4ASKA 1W8WA 5A6XA 1XRUA 2VUJA 2XL9A 3ZMOA 4JDMA 4Q5OA 5LA1A 2DV9A 4RR3B 5FZ3A 3WCSA 4CEYB 4GJYA 4Y1VA 1WW5A 1KJLA 3HQUA 3K77A 2AEZA 4O65A 1LOBA 1T2XA 4QXKA 2ORZA 3GJBA 4Q27A 5EYYA 4XF3A 1W6QB 3ETQA 3MUZ1 2P3JA 2ZEWA 3D5OA 3PVNA 3LF7A 1XBFA 5T55A 1UZYA 4RS5A 4NWWA 4UBGA 1MQTC 1OLME 3W59A 4KGGA 3J26N 1YJLA 3RRDA 3WDTA 4LULA 2D3PA 5HCAA 3ZSLA 1QKQA 5FLHA 2XJSA 1BJQA 2XH6A 5FMBA 1H0BA 3VDDC 1QQP1 5IVFA 3WY6A 1OA3A 1UD1A 1PK6B 2GN7A 4ZPIA 1DZQA 3O1VA 1NCQC 3MDPA 2XQXA 1EAH1 4H7MA 3WW2A 3ELNA 1RUI3 4XJWA 2ZEZA 1RUE1 1OF4A 2WC2A 4AR2A 2OYZA 1TEIA 3AL5A 3ILRA 1T6GC 5K0UA 2XVKA 4EN9B 1SLLA 3BTZA 2R041 3DYOA 2RS53 4RFT0 5C4WA 3MFCA 4GA9A 3D8CA 5ABJA 1ZZBA 5BNOA 5A3LA 3PUQA 2XDVA 5JXGA 4Q4Y1 1HJGA 1SZBA 2H6CA 2J42A 2PHTA 4H2AA 4LOTA 3OB8A 3T30A 1H1AA 4IUGA 1OT5A 2R0HA 4Y5SA 4LE4A 4MOAA 4QGLA 5BNNB 1AR91 2CDOA 1MS5A 3C2UA 3KV4A 3AMNA 1SLBA 1A8DA 4LKEA 2QFEA 1H2KA 2ZS6B 4QDRA 4PI2A 1KRIA 2AR6A 1G9CA 5L9BA 4B29A 3AMQA 4CU7A 1OBNA 1O8PA 1ZRIA 3DCQA 1MZEA 2CV6A 4P14A 4NHMA 2JDNA 4XIOA 5BNPB 4QM9A 4NR1A 1GNHA 4YPJA 2RS11 2ZA9A 2GH2A 1R1ZA 2EIGA 3OSDA 4GMP1 3U4XA 2GC0A 2BFUL 3USSA 1PGW2 2PAKA 1YFUA 4LQRA 5D1IA 4Z1VA 5T5OA 4BCUA 4X8NA 3CBNA 2YFZA 3WEZA 3HOBA 3RMXA 3T09A 1RUF1 3ZXFA 3R4DB 3DYPA 4MH0E 1Y43B 4YVSB 3WDVA 2WS93 1VAKA 1CZSA 2WNVA 5IVYA 1F35A 3VBSB 1OLQA 1S1AA 2VTXJ 1Y7BA 2X5IC 2OA2A 4A3ZA 2BERA 5C8CB 1BVVA 1UYZA 2YROA 5I8YA 4UW4A 5GZCA 5F9TA 4BJ0A 4XQ4A 5F5IA 1LODA 1TNRA 2KM2A 1IG0A 2VULA 4QPGB 4XJAA 5BNNC 2FD8A 5LEKA 1H1IA 5FY8A 4PBOA 3T08A 2B46X 4F7ZA 4N53C 3MIEA 5I0UA 3Q8FA 4QKNA 2Q30A 2XVGA 1SG3A 2XMLA 1H2NA 3CJIB 1VP6A 3KGZA 5F32A 2WQ4A 3UK9A 2DURA 3ZXGA 1XYNA 2OZ6A 3SCGA 3VBHA 4FOWA 3U4SA 5IATA 2WT0A 3ZXDA 2D43A 4YM2A 4CUGA 3ASIA 2NQYA 5FXVA 2P1BA 1VAVA 4OHVA 4CDWA 1RUF3 3ACHA 2A70A 4JGZC 3V64A 5CVRA 3AFKA 2W68A 1SMVA 4HK8A 1NE6A 3A23A 2A73B 1C3HA 4G4FA 4HMZA 2QQWA 4S2GA 1JYWA 1N3QA 4CDQA 3FUQA 4J6GA 4NO4A 4EV0A 5FR3A 3RZHA 4AE2A 5FWEA 1AXYA 1QF3A 3J7MA 2JD4A 5GLTA 3VV1A 4AYUA 1RUD3 3GCWA 2X5IA 2EALA 1KXGA 1RXGA 2VBBA 2HWE2 2R1BA 5BUVA 5C4WB 1GANA 3J8F2 4MGZE 4D6QA 3P3PA 3ILNA 3K51A 2D6PA 2OPKA 3L9JT 4TWTA 3TN92 4QPGC 1FPN2 2DWRA 2D7FA 4Y1ZA 3TB0A 4OULA 2X29A 3IDBB 4M3CA 1YYNA 4XQDA 3DKWA 5LBFA 2PA7A 4KMQA 5F5QA 1W2AX 1YC61 4IXLA 2C6SA 4P00B 3VBFB 5IVJA 4QQOA 1PIV2 1CAWA 1OVPA 2DFCA 4ONUA 4F8AA 4QKFA 1SDWA 2J1AA 4AFAA 1HB4A 5E88A 3NNMA 4XTMA 3QD6A 4CDUA 2A7AA 1NLQA 2HKXA 3BCWA 1W9TA 1W6QA 5DPNA 5JXHA 2RE9A 1N1YA 3HQXA 2Q1FA 1H8TA 3WT3A 4DB5A 1V6NA 2ZGUA 1Q8PA 4C0BA 4D7TA 3A0NA 1DP0A 3VD5A 2VMGA 2TEPA 4CYDA 1YHFA 2HBUA 2JIJA 1XE7A 4A7YA 4LJHA 4EJRA 1COV2 4LO4B 2RR11 2C9KA 1J83A 4OUMA 4PJYA 2EIBA 5A6ZA 3O1MA 4D3WA 5A7OA 3ZYBA 4IEVA 4BMEA 1PNFA 3DPRC 3OGVA 2ZGNA 4MGSA 1NUKA 4JV4A 1GMMA 1RINA 1TMF1 2JG8B 2OX0A 3FLPA 1U5IA 5C4WC 3KGLA 2FDKA 2DU1A 5DG1A 1XNTA 4AHWA 2RM22 2VMIA 1Q43A 5CNAA 1X9PA 1RC6A 4XFIA 1ZZ9A 3GHNA 2X05A 4LO7A 3VZKA 4BQ5A 1V6IA 2W1UA 3H0OA 1QJU3 1UY4A 4OI4A 4LUMA 5FKBA 5EWSA 5FZ4A 1CQ9A 1S0EA 3MW3A
chains in the Genus database with same CATH topology
5FQ0A 3AP9A 3VBFC 3AZZA 1LRHA 4V1PA 2XJRA 4NWVA 2DCYA 1PNGA 4JQRA 1CN1A 2A3YA 2A75A 4HSJA 4LUKA 1JOJA 4PLOA 4YYOA 1R081 4YW4A 1S0IA 5EXOA 3E6CC 1YFYA 2WFPA 5F6LB 1H9WA 3QH7A 5L19A 1RHI2 2CGPA 4LBMA 2G9FA 1AR92 3UV9A 1A3KA 4Q4W2 2BQPA 4IV1A 2YPJA 2O1QA 4HBNA 1E57A 1YIPA 2MPFA 1BEV3 2VNRA 1RUF2 2VECA 3VL8A 4BYYA 1EPZA 3B01A 2VU9A 4ZKTB 3M3OA 3T1MA 2EA7A 2YUEA 5T54A 1VBE1 3WHTA 2R1DA 3WP5A 1DLLA 3H1WA 5KC5A 2MEV1 3VZOA 1X50A 1JUIA 1WLDA 3N7LA 1ULFA 3ME2A 2WLQA 2XLFA 2PHXA 4Q1PA 5JSPA 3T1LA 4QPIC 3FMGA 4QMAA 2IXJA 5H9RA 1S0GA 2HWC3 3H3UA 1VJ2A 2ET1A 4Q4X3 4GB31 1A8MA 1JTZX 1AL21 3MGUA 1UMZA 2PQQA 4PIYA 2W39A 4FPLA 5JR7B 4AQ6A 1R091 5BNQA 2BUKA 3VBUA 1ENQA 2YXSA 1H8TB 3USUB 1QOTA 5ABJB 5CU1A 5SV8A 1JYIA 1H9PA 2WS92 4DS0A 1I1EA 5SV5A 1NLRA 1LESA 5FMOL 4XTPA 4DPNA 4LHLA 4EWDA 4FAGA 2GMMA 4OHYA 4YM0A 4M3CF 2A6WA 1ZX5A 4Z92B 1C5HA 2BVBA 1X36A 4DXZA 2JG8A 3FJSA 5KXEA 1SLTA 3U10A 1UPSA 4ZU4A 1UU6A 4XPVA 4HK9A 3V0BA 1AYN3 2E51A 4E2GA 5AFBA 1NG0A 1ZZ8A 3D0JA 4MX3A 4MUVA 3O12A 1F5FA 5FQ0B 1D4M3 1QJY1 3VLBB 4AFMA 3U0ZA 2RMU1 1LJ7A 2ETEA 4QGNA 3BB6A 3POSA 4OI0A 3SXWA 3B93A 3LA7A 2ILMA 1G8WA 2UY9A 2XWJB 2VOXA 1GZWA 4KU8A 4D69A 1DGRA 3N7JA 2WNEA 1AR72 1SLAA 5K9YA 1CAUB 3SH4A 5GLVA 1FT9A 5JOXA 2I45A 5FTTC 4AEJA 1ALYA 4JGYB 4Y1YA 2PHLA 3B02A 3GHMA 1CVNA 4IV1C 1SFNA 3VKLA 5T5JA 5L36A 2R042 3HMYA 2TUNA 4GQ7A 4I0AA 3THTA 4IV3A 2Z5WA 1MACA 5JLVA 1REEA 4WVZA 3VZLA 4S2DA 3UKVA 3SCFA 1D4M1 1QJY3 3FLRA 1O3SA 4MXWB 5EFUA 3J4UH 1BBT2 2WFF3 1UN1A 1GQHA 1PM7A 3NL1A 4UW5A 3P3NA 5A33A 1TME1 3AYCA 3INAA 1UX6A 4IEZA 1COV1 2RM21 3B9CA 3ZYIB 3MIBA 1RUI1 3GF6A 2AGSA 4FXGB 3PTYA 1DQ4A 1HIXA 1S0FA 3FWEA 1RUJ3 2E7QA 1DQ5A 2VOKA 3R4UA 1MS8A 1G9BA 1QJX2 3MFAA 1B09A 1IKQA 2O8OA 2EAAA 3LKJA 4P9JA 4MZUA 2WWSA 4NOTA 4PQ9A 4I0BA 5DZGA 3VBRB 2P2KA 3BOPA 1W0PA 2Z79A 3I2DA 2QKDA 1ULGA 1VBC1 2WT1A 4FPGA 2WL1A 1RUH2 2YMZA 3EXUA 5CFDB 1R093 4IV1B 5JOYA 1W6OB 2BW8A 1V6KA 2ZX4A 1G6NA 1QDOA 3GBGA 2Q1ZB 1DG6A 2EXKA 1RTVA 3B94A 4IL7A 4M3CB 4E2QA 4PDWB 4XFGA 2A6YA 3MIHA 1PVXA 4FOQA 5B2GB 1LOFA 1C4RA 3FBMA 3LAGA 4HN1A 2RMU2 3G6JB 1QJX1 1D2SA 5I0SA 2JKBA 5JDBA 3V0BB 3ZFEB 1C8NA 1V6LA 3JD73 5KWRA 5CG9A 2VW1A 1BMV1 1IGOA 2RR12 3CJXA 1HQWA 3GBFA 1UF2C 3WW4A 2Q5TA 1WLTA 4BM8A 2E53A 4CP1A 3KT7A 2D6NA 4CDXB 3PJQA 2ZHNA 2RS12 4QQLA 3VZJA 4HL0A 1ZBE3 2WNVC 3KCCA 1GZ9A 4OVEA 3FZ3A 1JW6A 1LOEA 3M4FA 3GNEA 4LE3A 4R9AA 3WG4A 4BZ4A 1LHOA 3HD8B 2VNGA 1FI2A 1HKDA 2BNNA 2FBEA 3ZXKA 4EROA 4HKLA 1AYM2 5F1RA 3ZFFB 1H4HA 1AXKA 5HCFA 3RYRA 1WBLA 1UPIA 4IV3B 1QMJA 3AP4A 1W6NB 3H7YA 4XBNA 3DGTA 5JSOA 2VGDA 2B45X 5ACA3 2PHUA 3KQRA 2BWAA 1F9KA 3RJRA 3UJOA 1QXPA 1QJU1 4HN0A 2XBO3 2GN3A 4XFHA 1PZ9A 5LK7B 2AREA 1MZFA 1K5MB 1RL3A 1VAMA 1VBA3 1VRH3 2VOVA 3THPA 2QDNA 3LA3A 1OPOA 1RIRA 1JBCA 1SLCA 2D6OX 2I07B 4KH9A 1NCRA 2JJ6A 4YVWB 3ZYRA 3I4IA 1FXZA 1F5JA 4K1YA 2ZGSA 1H1MA 5F6KA 4COVA 2P34A 1W6OA 1I9RA 2XL7A 4G9SB 2CWSA 4CEYC 1R1A2 5GKAC 4I30A 5D8AB 4XIKA 1CPMA 1R083 3N36A 4DMIA 2ARXA 2ZGTA 1EY2A 3V0AB 4KQ7A 4CEYA 2VUAA 3O14A 4PBPA 1OQEA 3KM5A 1PVC3 4LLOA 1W6PB 4AVVA 4LO6B 5JIAA 1U5XA 1YFWA 3VBUB 4JDOA 4QX5A 5I91A 4ASMB 3ZXLA 4BQ1A 2GNBA 3WQ7A 3O0XA 1WD4A 2XJTA 3AKTA 3ZVXA 2B5HA 3I59A 3FUOA 1X7NA 4YG6A 4A7KA 3VHOA 4B7KA 2B8MA 1WMEA 4BPZA 2HWB3 2QCSB 5DDJ3 1QXJA 2HEYF 4G3YC 2ZGOA 3GALA 3S6PA 1AX1A 4LBNA 2CYFA 1MEC2 2XWBB 3N7MA 5GJ6A 3ZYJB 1PHMA 5BNOB 1DIWA 2LUWA 2N7GA 4XFAA 2PLV1 1OI6A 3RQ0A 3WX5A 1B35A 3M3IA 1NA1C 3ZO0B 1N3OA 4BOWA 1Q8VA 1HRV3 1EV13 1TMF2 3OJBA 1S2BA 2VVEA 1RMU3 3PVOA 1BYHA 4I09A 5T50A 3SITA 3MZHA 3I54A 4AEDB 1XU2A 1PO23 3MPPG 3HBZA 4EWAA 1RUE3 3PHMA 1VBE3 1KD7A 1VALA 4E27A 4K1ZA 4B3NA 1V70A 2Z42A 3ALQA 4RS5B 3VBSC 5GZDA 3AKSA 5HBAA 4YGDA 2B39A 3JB8A 1FNYA 4M01A 1KDMA 2PHFA 3BPZA 1VBA2 5I0RA 3TOJA 2ERFA 4AXOA 2XBO2 3CL1A 1CPNA 4PLNA 3ZXAC 4I3PA 2SBAA 4Z2WA 1QQP2 1ZBE1 1RUNA 4FQ4A 5BNOC 4SBVA 4RR3C 4BE3A 3L2YA 3R0RA 4MVTA 3AZYA 5IK8A 4XFFA 5HXVA 3CJIC 4O9GA 3WG1A 1QJZA 5A33B 4Q8LA 3B3QE 4XJUA 2WFF1 3B9IA 4COUA 2YV8A 5L7OB 3IN9A 3GYDA 5GALA 4YZ1A 1MQTB 3JUUA 4ATFA 1SEFA 5KHHA 1AYM1 5AC93 3EBRA 2FMDA 4UW3A 1ZYBA 3VDDB 4META 4EWEA 1CAXA 2BWCA 4Q0PA 4XBQA 4E9KA 1XNCA 3AXEA 1J3QA 3MIDA 2D6MA 3N35A 5FOBB 5J36A 3SH3A 1ZRRA 1PZ7A 2AUYA 1H30A 3JQXA 2IXHA 4BLJA 1C1FA 1F31A 1AR62 2HJIA 1S55A 5FCCA 2QQPA 2RR13 2D3SA 3WCRA 3QH6A 2CTVA 3I59B 4URTA 1UKRA 3H8UA 4PCRA 3K48A 4P9IA 4I2OA 1HW5A 4YFZA 2CY6A 1DGRN 2RMU3 3B69A 1CONA 5A3MA 1ENXA 1RJ7A 1S0DA 4JAAA 2QNKA 4R52A 2EF6A 1B35B 1O5UA 4RQPA 3KCYA 1FMD2 5BNPC 2CAVA 1SACA 1HXS2 2FQPA 2JE7A 1WW7A 1WA4A 2GC1A 3TAYA 3IBMA 1WW4A 5FOJB 4CRQA 1M06G 3MLJA 1EAH3 5CFCA 1S2KA 1BBT1 3L2HA 1OLRA 3NKTA 1PO21 1ASJ1 1BKZA 1BCXA 5HCBA 1DGWA 1EP0A 4YVSC 2VXRA 3AKPA 3NJZA 1H2LA 1VB2A 3NAPC 2YY1A 2WA3A 2NMOA 4N53A 4ISRA 4CDWB 3UL2A 1W39A 4LHKA 3DPRB 3ZIWA 5GLWA 4LA2A 3U07A 1ZRFA 4R9CA 3D6EA 5CAZA 1C8M3 3LZZA 4WM8A 1AR81 3NV1A 1GNZA 1UIKA 2ZZQA 1RUG1 4FXKB 4D7SA 2WFF2 1BBT3 4Z07A 4IEOA 1Z7S3 4P9GA 4AGRA 3E5QA 4AVAA 5J3UA 1QHDA 3MYXA 4QQHA 4ZXKA 1G9DA 4OLLA 2JG9A 2YDEA 2MNGA 4JC1A 3LSEA 1AL0G 2D98A 3OD4A 4B4RA 2LALA 4Y22B 3J8F1 1MZ6A 1AXZA 2W08A 3W9AA 5JZGC 4LHNA 1UAIA 4AVCA 1Q5OA 2QZ2A 3FLTA 2K9ZA 1H2MA 1BEV1 4YVSA 4Q1RA 4QPYA 2W52A 4CDUB 4CP0A 2JENA 2NLRA 2ZX2A 2FHRA 3NAPB 4B4PA 3N7KA 4XF4A 4K21A 1FMD3 2EXJA 3VBHC 3ENRA 4D7YA 4HVOA 4WBBA 1D0GA 2JXAA 1GQGA 4GWMA 4YLZA 1RUOA 4X6RB 5DZEA 1D4M2 3WXPA 1C5IA 3TNQA 4Q0VA 5D8AA 5A32A 4IEXA 2WZR3 4HKOA 3MW4A 1XXNA 1N3PA 3OYWA 4MYEA 4BWOA 5K0UC 1VBA1 1AR63 2PFWA 3CJIA 1OA4A 2A6ZA 4I3GA 1V6JA 2HWD2 4LO8A 1SLIA 4HVRA 3G7DA 4RQPB 1VBB1 2R6QA 4I02A 4Y24A 2PHWA 3WG2A 1ULEA 3RWNA 1MQTA 4DZGA 4B7EA 4WVWA 4Q26A 3KLSA 5JOWA 1FOD1 5FMOS 3ZSKA 4FPFA 1MEC1 2D3RA 1IS5A 3WD5A 2UWCA 4XQWA 4OI2A 1SBDA 1RUJ1 5FREA 1X33A 4M00A 3AB0A 2DTWA 3USUA 2D6KA 4Q4X2 5C9AA 3JBG1 1ND3C 2OIIA 1IPJA 3R6SA 2ZCWA 3LGRA 3NSTA 2ZGPA 2RJLA 1VBD3 5I0TA 4AK3A 2YYOA 1MVQA 4DY5A 2WQZC 3EJKA 4NHKA 2YHJA 1XYPA 1QOOA 2E9QA 1V9U3 3B00A 3S7IA 1BEV2 3JB4C 5I8TA 2FZ2A 4FBFA 4DNYA 3O5SA 1GV9A 1WCSA 4Y4YA 1FMD1 1OA2A 1NQDA 2AYHA 4Q4X1 5C8CC 1KQRA 1LHUA 4COYA 4H14A 5I93A 1WUVA 4P5HA 1FNZA 1RMU2 5IUQA 1TMF3 4NPRA 3WV6A 2DCZA 4MGIE 5E89A 1BK1A 5DUXA 5CIRA 2D97A 2I74A 2K0GA 5JI9A 5BPXA 1APNA 3JQWA 3POWA 5JZGA 3GZTB 1LHWA 3ES1A 1QJU2 4IEYA 1YCIA 4WZFA 1D4VB 4EN6B 4RL7A 4GH4A 3MI8A 2WKKA 4Y5Z0 4AI1A 4QPIB 3ILFA 1MS4A 1EPWA 5FPZA 2H0BA 2JG9C 2ZHLA 1ZZ6A 4JGZB 5T3NA 4FTEA 1Y9QA 2Y26A 4WM7B 1RVF2 4AHYA 1RUG2 4QHBA 1XQNA 2R062 1DFQA 3TBDA 4XETA 1GICA 4P9YA 2WLPA 3QCWA 4IEWA 4UW6A 4R4ZA 4M0NA 4N43A 3D0SA 3N3HA 4HPKB 1N1TA 2TNFA 3VBRC 2XB6C 3JU9A 1ZZCA 1ND3A 2XPJA 3WP3A 2RJKA 1CIWA 4XMAA 1ASJ3 1S0CA 1XNBA 3KMHA 3NAPA 5DDJ1 2QVSB 5L73A 4QQ2A 2FZ1A 3O0WA 3H7JA 1DGLA 1XNKA 4XJ9A 3AM2A 4CEWB 3ZFGB 3ZN6A 3MF9A 4FPYA 5T52A 2XBO1 1UU4A 1CAVA 2G9GA 1D2QA 2GMEA 1TE1B 4YZ3A 2ZPXA 1CESA 3J8F3 4FVVA 2QUOA 4MV2A 2HWE3 3N4MA 3VKMA 4XF1A 2P3KA 3H50A 3QOPA 2JE9A 3AFGA 4QD2A 4TLFA 5EZWA 2WIIB 3MEPA 5DG2A 3IWZA 2GH8A 3WW3A 5ACA2 4N7UA 1UZZA 3DPRA 2VG9A 1LTEA 2PHRA 3ZDSA 2DCTA 5J09A 3MW2A 1LGNA 2JECA 2V73A 1PK6A 1AX0A 4O9EA 4YW3A 2BPA2 4K3UA 1IPKA 4W65A 5DUVA 1EV11 1AJOA 1VBB2 1AYM3 2XKOA 1RUG3 5AC91 4XXPA 2GNTA 2WT2A 3NKGA 3OGJA 4IEQA 4LO5B 3NVCA 1AR61 4L99A 4AQTA 1LCLA 3VBSA 4YW2A 4IV3C 1VLNA 1Z0HA 1XU1A 3CO2A 3LWCA 4H7LA 4BA6A 4F8AA 4YVWA 2R32A 3ZXJA 1X8EA 3PMSA 2VW0A 3E97A 3ZIXA 5CBLA 4AGVA 2NZ9A 2NPIA 4Y22A 5TSWA 2RS13 1A78A 3WG3A 2ZX3A 1HQLA 1ZREA 2RS51 4DQAA 2R49A 2VY0A 5KHIA 3WLUA 5ACA1 2O8QA 1O91A 1ZVFA 1J1LA 1O4TA 1O3RA 5HI0A 5BNPA 1QH6A 3JD72 1ENSA 1G9AA 3VBOC 5DXDA 4UBHA 4E4ZA 1CAUA 2JEMA 4TZDA 3DF0A 5FO9B 2NYYA 5GZFA 3LB9A 4GH4C 4HETA 1YO8A 1YRZA 4YG0A