3BIWE

Crystal structure of the neuroligin-1/neurexin-1beta synaptic adhesion complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
177
structure length
177
Chain Sequence
b'HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neuroligin-1
publication title Structures of Neuroligin-1 and the Neuroligin-1/Neurexin-1beta Complex Reveal Specific Protein-Protein and Protein-Ca(2+) Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell adhesion/cell adhesion
total genus 36
structure length 177
sequence length 177
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3biwE00
2A6ZA 5KXDA 2HYKA 3DUIA 1YRZA 2LTNA 4BM8A 4DFSA 2GNTA 1W6NA 2VW2A 3ASIA 1PZ7A 1W6MB 3B9CA 2D3PA 2ZGUA 2CNAA 4FQZA 5JVVA 2ENRA 4Y20B 3GNEA 1MS5A 1AXKA 3WDYA 1GZWA 4Y1UA 1JOJA 5DUWA 1J1TA 1SBFA 1HQLA 2AR6A 1LECA 2ZGNA 4AYUA 5T50A 5FRAA 1SLLA 2ZKNA 2D3RA 1UPSA 1FYUA 1W0PA 5EWSA 4XZPA 2DTYA 1SBDA 1CR7A 1LGBA 1SLIA 1V6IA 2OVUA 5H9SA 3VKNA 3RSJA 2DURA 1LHVA 2UWAA 4WVVA 2E6VA 2WLQA 4M3CE 2ZMLA 4AGRA 1LJ7A 5GLTA 1QOTA 1S1AA 1G9CA 1X50A 1N1TA 3WHTA 1G9BA 4TZDA 2VU9A 1IS3A 1DQ6A 3INAA 2ZHNA 3O0VA 4XJ8A 2E7TA 1N47A 2OW4A 1FV2A 1C1LA 2A6WA 4BOWA 2UWCA 2DUQA 5IK8A 1SFYA 1GNZA 2EXJA 1UKGA 1KDKA 1MVQA 4XTMA 5IK7A 5EXOA 2VH9A 2DVDA 3OY8B 1QDCA 3MEPA 1ENSA 1SBEA 2FMDA 2GNBA 5GALA 3KQRA 3WUCA 5HCAA 5CBLA 1D2SA 1KJLA 5E88A 3IKWA 1ZA4A 3D5OA 1N1YA 1IOAA 2VW0A 2A3XA 3ZSJA 2YXSA 3AP9A 4BMBA 4XXAA 3AP7A 1QDOA 1B09A 1BQPA 1CPNA 3T2TA 1EPWA 2A6YA 2ARBA 5H9PA 3HN1A 4Y1ZA 1BYHA 2EF6A 4F83A 1GANA 4FOWA 1WUVA 3ZPYA 1U0AA 1S0IA 1AX2A 2Q5TA 3AYCA 2D6MA 2ZGMA 4Q2FA 2VW1A 2ZABA 2P3KA 3AJZA 3AZXA 5T5PA 3WNXA 1G7YA 2ARXA 3M2MA 4Q26A 1LGCA 4FPFA 4Q1RA 1DQ5A 3M1HA 1HLCA 4XJAA 5E8AA 4LBOA 1N1SA 2D6LX 1QNWA 4ISQA 4MYEA 1Q56A 4FPEA 5GM0A 1AXYA 1WW7A 2A3WA 4XHXA 2ZACA 2ZZJA 3V0AA 2VY0A 2WKKA 4Q8KA 3UL2A 4AVTA 4XIOA 1UL9A 5HCBA 3OJBA 3SNMA 2NN8A 5T5OA 2NZ9A 5CB7A 1W6OB 1LOCA 2NP0A 3DGTA 1DBNA 1QNYA 2GNMA 3UJOA 1JYIA 1RINA 1G9FA 2W08A 4YFWA 4P14A 2YZ4A 2A3YA 1JYCA 4YZ1A 1BKZA 1DZQA 1C1FA 4RL7A 5GZFA 3SISA 1N3QA 3MW4A 4KBBA 4R9AA 1W6MA 1IS6A 2WT0A 3IM0A 4XBLA 4Y20A 2ZGRA 1O4YA 2GNDA 5BYNA 2PHUA 3AZZA 1YIFA 3M3EA 4ITCA 3B69A 5JOWA 3ATGA 4AWDA 1FAYA 1V6KA 1IKQA 4FOVA 5CA6A 2E51A 2ZHLA 2D3SA 4AGVA 3W58A 3OPZA 1CVNA 5IK4A 4Z8BA 2R1DA 3O5SA 4Y24A 4GALA 3V0AB 1MS8A 2CWMA 1WD4A 2C5DA 3TAYA 4YGEA 4XIKA 3AFKA 1F31A 4GXLA 3WDVA 4NO4A 1WCSA 4UW3A 1Q8VA 3AP6A 4M3CF 5F5QA 4IQPA 1UZYA 2UWBA 2A5ZA 2SBAA 4GWNA 2D44A 5GLZA 2JDZA 5GZEA 4Y1VA 1PZ9A 3AP5A 1ZM1A 4FPCA 3N7LA 2P3IA 4FPOB 3ILNA 3VKMA 1I1EA 1C4RA 1DGLA 4PBOA 2P2KA 1TEIA 3ZSLA 1NXD1 1FX5A 2D6OX 1RIRA 3ENRA 4FP2A 4YLZA 4OZXA 3OY8A 1SLCA 4K1YA 5CAZA 2WNEA 4YG3A 4DPNA 4YM2A 3UK9A 5L73A 1H9WA 4FPHA 4XJWA 5H9RA 3W59A 1Q8SA 3ZYRA 5IK5A 5JOXA 5GLVA 1WW6A 2NM1A 4FVVA 4JCKA 4BMEA 1DYKA 1FNZA 1A78A 1C57A 2DYCA 3BIWE 2JECA 1G9AA 3N7MA 3PVNA 4PCRA 2DVFA 1KITA 4TYSA 2R49A 5KXEA 1LHOA 1OQ1A 1HQWA 3MPPG 1MACA 5JLVA 3CNAA 1IS5A 1S0CA 5DUXA 3ILRA 3B3QE 4YM3A 4P9XA 2W39A 1A3KA 1UMZA 2JD4A 2D6NA 2PHXA 4BPZA 3WHUA 3AXEA 5GZGA 3N35A 3D6EA 4FPJA 1ULEA 1AF9A 1YYNA 5F9TA 2OUJA 1QOSA 1JW6A 2WT2A 3AJYA 3AYEA 4M01A 1UN1A 1N1VA 3WZ1A 4AVSA 5KXCA 4YW5A 4YFZA 1Q8QA 2ZAAA 2AYHA 4XMIA 3RQ0A 1UAIA 4M3CB 2A75A 3WDTA 1WBLA 4ISRA 1W6OA 5GLUA 1V00A 5T55A 2ERFA 3AZYA 4YZ5A 2ZGOA 1WD3A 1CQ9A 1ENQA 2A70A 4HL0A 2RHPA 3FFZA 4C1XA 1JN2P 3MW3A 3NV3A 5DXDA 2DVAA 1AZDA 3I8TA 2V5YA 3ZXJA 3FLPA 3B00A 1LODA 1ENRA 4XXPA 1APNA 2DU0A 3BOPA 2JKBA 4YGBA 5SV8A 4LBQB 4DQAA 1AVBA 1IKPA 1YI7A 2PHTA 2A6XA 3ZYPA 1VLNA 4AVVA 1MS9A 1WLDA 5EYYA 2CL2A 4XMAA 4Q27A 3A4UA 4UW6A 1A8DA 1BJQA 2NMOA 2VUAA 3QLQA 4UW4A 3T1LA 1GLHA 1QKQA 2R0FA 4CRQA 4YZ3A 5T52A 3WDWA 2OUHA 1YXWA 1LESA 1ONAA 1LOBA 3APBA 2EIGA 5DG2A 3B01A 2GDFA 2DV9A 3ILFA 1CJPA 1VIWB 1Y7BA 2D6PA 4FQ4A 4LBQD 5JOYA 3N3HA 3VKFC 1G8WA 1HDKA 4GKXA 3OBRA 5JMCA 3VUOA 3WUDA 4W65A 1GKBA 1LU1A 5T5JA 1LOAA 1JHNA 1N3OA 4U36A 5FREA 2P3JA 1S0JA 4GKYA 1GYKA 4GA9A 4WZFA 1QGLA 1DHKB 2H0BA 2I2SA 1WW5A 4PQ9A 4CZSA 1DQ0A 2NYYA 1LGNA 4LBMA 1KJRA 3PMEA 3WDXA 3WCSA 1LEMA 1MS1A 3JUUA 2AUYA 4YG0A 4LBKA 3ZXKA 3N7KA 1LEDA 3H0OA 1CPMA 4ASMB 2GN3A 1LCLA 1LULA 2D43A 2GMPA 2YV8A 1MS0A 1W6PB 2WT1A 5GJ6A 1SACA 1MS3A 1V6OA 2DVBA 1CONA 5DUVA 5GZDA 3SH3A 4XE9A 4Q8LA 4K20A 1SCSA 2DU1A 4JRAA 4XDQA 3AK0A 5H9QA 3T1MA 4SLIA 4FP3A 4YGDA 3ZXLA 1MR5A 4I30A 2XB6C 1V6LA 3WG2A 2YY1A 2W52A 1D0HA 4BLJA 1QMJA 1WW4A 1VALA 4YW4A 3VV1A 2CYFA 3VKOA 4WV8A 5T5LA 3IN9A 1DFQA 2WQZC 3O0XA 3RMXA 5JOZA 1KRIA 1CIWA 2EXHA 5E89A 4XOGA 4BLIA 5IT6A 3U4XA 3FUOA 1GBGA 3QCWA 5LK5A 1UX6A 2WSVA 3FLRA 1GNHA 2ZMNA 2W68A 3GALA 2ZGTA 3HMYA 4XJZA 3O12A 1UZZA 2V73A 3V0BB 1GZ9A 2CY6A 3M3QA 1MS4A 4M3CA 1WBFA 1O4ZA 2ZHMA 3IPVB 4XYXA 4L8QA 4DRVA 3RG0A 4ATEA 4H55A 3OYWB 3USUB 3ZXEA 1FATA 1LOFC 4YGCA 4CTEA 4ZXKA 4XJ9A 2PHWA 4YM0A 3POSA 4PBPA 2E53A 3BODA 1G86A 1HKDA 3RMYA 1VAVA 2UURA 4Y1YA 1LHNA 3AZVA 1GZCA 1LHWA 3D4KA 2KM2A 3I4IA 4LBQA 3PJQA 3NWKA 4FPKA 1ULFA 1ULCA 2WJSA 4C1WA 1PZ8A 4HANA 3OBTA 3SH5A 4R9DA 1H9PA 2AGSA 1W0OA 4DS0A 1WLWA 3R4SA 1GSLA 4FOYA 2AENA 2ZHKA 1NLSA 4AGGA 3AYAA 3O0WA 3WVJA 2GMEA 1DIWA 1GV9A 1SLTA 2ZGKA 3ZSMA 4UW5A 3FUQA 1FNYA 1H30A 1OKQA 1W6QB 1Z0HA 2A7AA 3N7JA 4Y22B 1LU2A 2PHFA 1G9DA 4P9YA 2R0HA 1S0DA 4WVWA 4RA0A 3WOGA 1I3HA 5GLWA 5GZCA 2P34A 1W6NB 3IMNA 3JU9A 2CTVA 4P9WA 2ZA9A 1DYPA 2A6VA 4LBLA 3ZSKA 1KDMA 3A0KA 2TEPA 3N36A 4NOTA 1GZWB 2VXRA 1MZ5A 2FHRA 2D7FA 3KM5A 3LSEA 1V6NA 2EXKA 1SLAA 3BTAA 2D6KA 4PF5A 3NV1A 5CNAA 3MW2A 3RS6A 3V65A 5JDBA 2CWSA 2DTWA 1FV3A 3FBYA 4LBNA 4R9CA 4YG6A 5T54A 2ES3A 3WDUA 2R1BA 3SLIA 4XTPA 4Y26A 4LBJA 4U2AA 4YW3A 1LOFA 4Y1XA 2DUOA 2ZGLA 1QOOA 3HR9A 1LTEA 2JE7A 4XBNA 2ZBJA 4XJUA 3M3CA 1QU0A 3AX4A 5DUUA 4BQ1A 1W6PA 2E7QA 2DVGA 3WG4A 1AX0A 1LOGA 3WG1A 5EYXA 1VAMA 2WSUA 4XBQA 2LALA 1S0EA 1LHUA 1S0FA 1OFSA 3POYA 3AYDA 2DWRA 1V6JA 3SITA 1KQRA 1V6MA 1LOEA 2UU8A 4R9BA 4ATFA 4M00A 4D69A 2P37A 3ZXFA 5KXBA 4FPYA 4YW1A 3SH4A 4YZ2A 4Q1PA 1LENA 4K1ZA 1Q8OA 1WLCA 1S0GA 1GICA 3NV2A 2C9AA 4GWMA 5DZGA 3WV6A 2R16A 4FPGA 1AXZA 1ULGA 3TB0A 2EAKA 1BZWA 3V0BA 2NMNA 2AREA 5HCFA 2EALA 3V64A 1CESA 1MZ6A 1AX1A 1SCRA 1ULDA 1S0BA 1F9KA 5AVAA 5IUQA 3IPVA 3WG3A 1JUIA 3M3OA 3AZWA 4YW2A 1DQ1A 3LSDA 2AH2A 3NV4A 5DZFA 3OYWA 3USUA 3FLTA 2JE9A 3WCRA 2XG3A 2GN7A 4ZKTB 4YM1A 1CN1A 4XHBA 3VKLA 1N3PA 2GMMA 3OGGA 5DZEA 1JBCA 3Q9OA 3UJQA 1MVEA 2GALA 2ZGQA 3R4UA 3A0NA 3POWA 1XQNA 1R1ZA 2PHRA 3R05A 2JJ6A 5DG1A 3PVEA 1Z78A 1F5FA 4YZ4A 2DUPA 1YO8A 1DLLA 2EXIA 2PELA 4JC1A 1URXA 2SLIA 4FPLA 4K21A 2A71A 1JXNA 2BQPA 2G4IA 2Z42A 3RRDA 1IS4A 1AJOA 3PVOA 3AXDA 1BXHA 1DQ2A 4XILA 2ZGPA 3C2UA 3AP4A 1DQ4A 1SLBA 2ZGSA 3ZVXA 4FOQA 2YROA 1AJKA 3LCPA 4DRRA 1RITA 1QF3A 1W6QA 3L2YA 2YMZA 4Y22A 2B7YA 1Q8PA 3WLUA 2ZMKA
chains in the Genus database with same CATH superfamily
3OD0A 2FCUA 3QOPA 1CJDA 1YRZA 2LTNA 4J25A 4BM8A 1RUF1 5D21A 3ZFGC 3DPRA 5APAA 5F37A 1VR3A 4YNIA 4QQLA 3PLQA 1SEFA 3T0AA 1L3JA 5TSWA 3U11A 2VL4A 2GSYA 1XC6A 3BUCA 2JKXA 1CAWB 3ES1A 4ASKA 1LECA 2MPFA 4NAOA 2ZKNA 5DAPA 4QX7A 3VZNA 3ZSEA 1PNFA 1ZBA3 3P1IA 3PHMA 4CCJA 1UPSA 4QHBA 4XQWA 5F2WA 3NNFA 4CDXB 4CUBA 2VZOA 3VBRB 2JIJA 1CR7A 1LGBA 1SLIA 3FHIB 4Q4Y2 2UWAA 2B5HA 3ZXGA 3A23A 4R4XA 1RUH3 3PUIA 4LXLA 5GLTA 3HNBM 5FWJA 1X50A 5LB6A 2XBO2 5C33A 3C7OA 1E5IA 4Q4X2 5C8CA 1G9BA 3VBUB 5KHIA 3ZN6A 3AKTA 5JXJA 1N47A 3VHOA 3GHNA 3CIHA 2RM22 3K51A 4LKEA 2OQ7A 4V2VA 2CDPA 5FP7A 1AYM1 1PGSA 3DXUA 2YC4A 4WVZA 2FDIA 3NRUA 1YIPA 4O65A 2HEYF 1MVQA 5IK7A 2VH9A 1NUKA 5CKMA 5KHHA 2RS33 3WUCA 2G1MA 4AFDA 5J37A 4RFT0 5E88A 3NKGA 1Y4WA 3PMSA 4COZA 5KBFA 4W4ZA 2NLRA 3QBQA 4QXBA 1X9PA 1AL21 2WZPP 3T08A 4BMBA 3SKVA 5ANNA 1XYPA 1F8VA 2ARBA 1NQJA 1OMIA 4Y1ZA 4OZOA 2OS2A 3VDBA 1S0IA 3S5AA 2RE9A 3E1F1 1W8UA 1H8TC 3IIAA 4N7IA 3GZUC 1YLLA 3ZXDA 3AJZA 3AKRA 5T5PA 2AEZA 4NPMA 1LB2A 4NHKA 1D4M3 2ARXA 3M2MA 4Q26A 5A6QA 2FDHA 1OLME 1PM4A 4Q1RA 1R092 1DQ5A 3M1HA 1FOD2 3KZ4C 4AQSA 5IVJA 2C9KA 4PIYA 5E8AA 1QNWA 3NNLA 4ISQA 1YI9A 4MYEA 1JOPA 4IEOA 3D8CA 5KWRA 1RUF2 2A3WA 2XHKA 2YGMA 3IDAA 5DN2A 1WMFA 5FZ6A 4ZZ8A 1W2UA 2ZZJA 3HNYM 4GB32 3V0AA 4MG2A 3T2OA 1AHSA 1VRH1 1UX7A 2A1XA 3OJBA 3SNMA 4LUKA 2W47A 1RUD2 2ZX3A 4UOJA 5T5OA 4E4DX 1W6OB 2G9GA 3DGTA 1JYIA 4AFCA 4CEYB 1KFXL 1MZFA 1POV1 4P14A 1AR83 4QPGA 5ERLA 2YZ4A 2A3YA 3L2HA 1ALYA 3ZFFB 4YZ1A 4EN7B 3ES4A 5FUNA 1BKZA 4EYUA 1C1FA 5GZFA 2HBTA 3SISA 4D6SA 1W05A 1OH4A 2VVDA 5FLJA 4BQ2A 3I2IA 2X5IB 3IM0A 2ZGRA 4NMIA 5BYNA 1WCUA 5FY9A 1DGWX 5IYYA 1YIFA 2ILMA 2VBDA 1CAWA 5FYZA 4AK3A 2R063 4EWAA 3DECA 1NYWA 1ZZBA 4QWNA 4YARA 4Y5SA 2ZHLA 5J36A 1GNYA 3UT0A 4AGVA 3JD71 1CVNA 2R1DA 4Y24A 4CDXA 4GALA 2JICA 2CWMA 2VTXA 2WYFA 3K4AA 4FO9A 3VBRA 2ET7A 1ZZCA 4G9SB 1WD4A 4Q4X3 1QEXA 3TAYA 1TMF3 4YGEA 4BQWA 4XIKA 1GP6A 3VBOC 3K3NA 4CVUA 3MZHA 1UY3A 5C9AC 4NO4A 4UW3A 1H2LA 1Q8VA 3AP6A 4OUMA 4EN8B 1JS9A 5B2GB 2SBAA 3VBUA 5A3UA 1F4AA 4Y1VA 1JI6A 1XB9A 3N7LA 2HWF1 2J7MA 3ILNA 4FPOB 3WT3A 4KWLA 2JDMA 4LPLA 3NVCA 1HXS1 3ZSLA 1NXD1 3SCHA 5LA1A 4LO6B 4RQPB 2X53S 1HJGA 4FXKB 4BQ5A 4BH9A 1J3RA 4QB1A 1BBT1 3OPTA 4O9EA 4MH0E 4C90A 5CG8A 2XPJA 1XNBA 2HWD3 2YC2A 5T50A 1U5YA 4DUVA 4FPHA 3PUHA 1PHMA 1X8EA 3W59A 4I0WB 4EV0A 1K5MC 5GLVA 2NM1A 5DPNA 4JCKA 4BMEA 1FNZA 4NHXA 1RUJ3 4WVMA 3BIWE 3E97A 2LW8A 1ZRFA 1XNDA 5KHJA 3HBZA 2WNUB 4EN0A 2W1SA 1HRI1 3K46A 2B9UA 4PCRA 1WMDA 1W2AX 2VBBA 1VRH2 3IBMA 3MPPG 1BEV3 3O1TA 5JWPA 3FE5A 2XH6A 1IS5A 3ILRA 3B3QE 5FO9B 3I7DA 1EY2A 4Y33A 2PHXA 4PIZA 1OFNA 3N35A 4LE4A 4OUSA 3LEMA 1W8OA 1GWKA 1YYNA 5FY4A 5F9TA 4AVSA 1KS4A 3BB6A 3ZXAC 4EN9B 5I93A 1YQ2A 2KD7A 1IG3A 5FK8A 2YDEA 2ZAAA 2WO3A 5KHKA 3RQ0A 1TME1 2A75A 2V72A 2YBKA 2HH9A 3IDEA 4COWA 5BNPC 1W6OA 3VHPA 1F35A 1E5SA 1HB3A 3RZMA 3ZM8A 4GH4C 1ENQA 2A70A 4CEYA 2EIEA 3FFZA 5L7OC 3LEIA 3JD72 1J3PA 2BDRA 4PDWC 2V5YA 2X29A 2B39A 1BHGA 1UD1A 1ENRA 3KF5A 4M0HA 2X5IA 1APNA 2JKBA 4LBQB 4HXCA 3ZYFA 3HT1A 3TWIA 4AVVA 3HVDA 1WLDA 3DCQA 1E57A 1YFYA 2CL2A 3J26N 3P6BA 3ZYGA 2HWF2 3A4UA 1BJQA 2HWC3 1DF0A 4NRPA 1XRUA 2HWB3 1GLHA 4QDRA 1HXS2 2R0FA 4NUBA 4CRQA 1AYN1 4DIQA 2OUHA 2HEWF 1YXWA 4QD2A 2QQIA 1A6CA 1ONAA 1XE0A 1LOBA 1BBT2 3APBA 2EICA 4KG0A 4UXAA 3BIEA 2EIGA 5FPZA 2JDUA 1XJAA 2DV9A 2VOWA 3A7QA 1VIWB 2YHJA 2OQ6A 4LBQD 5JIAA 4BQ4A 1HDKA 5JMCA 1QIQA 4OHWA 3WUDA 4YPJA 1NX9A 4KG8A 3VBFA 3VD9A 4KU8A 4LULA 1JHNA 2VCBA 4U36A 4UFHA 5JXHA 2P3JA 3R6SA 4GKYA 3RPQA 3BCWA 5FXWA 3E5QA 3ME2A 2Z2SB 4RQPA 4CA9A 4CZSA 1HRI2 1LGNA 2F6BA 4CDQC 1FI2A 1VE0A 1KJRA 4YG0A 4EE2A 3N7KA 3PUQA 4XFBA 3HQUA 4E2SA 2WFF3 4KGGA 2YV8A 3VBFB 1UPIA 3E5UA 3N9QA 3PIJA 1W6PB 4LIVA 1C8M1 3Q8EA 4IW3A 5CIRA 1MS3A 1QXPA 2DVBA 5A7WB 1CONA 5DUVA 4RSUA 1OVPA 5GZDA 3J7MA 2HWE2 5CKNA 5ISLA 2QZ2A 3FJSA 4K20A 2VJXA 4WZCA 4FI9A 3U78A 4XCBA 3VBHA 1J58A 4AEMA 4QDQA 4HVQA 4XDQA 3AK0A 2WNUA 5FYUA 2WDBA 1GR3A 3H42B 4FP3A 4YGDA 4H3WA 4A3XA 2WO1A 5DQ0A 1UF2C 4CUGA 1R1A1 2OA2A 1TME2 3H1WA 3WG2A 1T2XA 5JR7B 3BGAA 4I2OA 1VBD1 1PO22 5FMOL 3VKOA 3WW4A 1ST8A 5LBFA 5JMOA 5FO8B 3S57A 3O0XA 1JZ5A 2OKXA 5IT6A 3U4XA 2WN3A 2Y64A 4LK7A 2JWPA 1W8NA 3J8F3 2ZKLA 3FLRA 2H6BA 3KT1A 3O14A 2ZMNA 1OXCA 1TVGA 4KWKA 4DXZA 2ZGTA 3HMYA 5FDBA 5JUVA 4YVWB 4EJRA 4CPBA 1GZ9A 2Y8KA 1W8FA 2CY6A 5FY8A 1VBA3 1O4ZA 3EBRA 2ZHMA 5CKQA 4IXLA 4ZHNA 1WWYA 4XYXA 5D8AB 5HXVA 4ZU7A 4KL1A 4PLNA 4CCMA 4ATEA 2E33A 5CFCC 3W5MA 1UY4A 1O5UA 1AR63 4MGYE 3GJAA 3IAQA 4YGCA 1OF3A 4QM9A 3HNMA 4QAWA 1AYN2 3NJZA 1K5JA 4QKBA 3SCGA 5A3PA 5F7UA 4OVEA 1C5IA 1D4VB 4YWAA 5IVEA 1HKDA 5FP8A 1L7LA 2UURA 5BY5A 3I4IA 1GZCA 2VZVA 3D4KA 4LBQA 4BZ4A 1EV13 1WGPA 4FPKA 1ULFA 4XFCA 2WJSA 2XR4A 2YYOA 5AC92 3G6JB 4HANA 3SH5A 4CU8A 4R9DA 1H9PA 2ZS6B 1OKOA 5F5CA 4AHWA 4IGOA 3KVBA 4FOYA 2Z4FA 2K0GA 3AYAA 3I2HA 1W39A 1X33A 2IXHA 4Q4W1 4QKDA 3WVJA 3ZIWA 4E2GA 1SLTA 2B42B 2ZGKA 4KH9A 3ZSMA 4IEZA 5FJHA 4UW5A 5J3UA 2PLV1 1FNYA 1IPKA 1AR71 1UIKA 1W6QB 1X82A 3JB4C 4NRQA 3KT4A 4OI1A 1LU2A 3T2PA 4FTSA 2QE3A 1CD3G 3WINE 2VG9A 3WOGA 3KGZA 1I3HA 5GZCA 3BKZA 1H4GA 5A3MA 1W6NB 3IMNA 3IAPA 2WZEA 4P9WA 3JBG2 1CX4A 3MF9A 1DGRA 1FMD1 5EJ3A 4XAAA 5FIXA 2OYZA 1OURA 4HZFA 2RS53 4NOTA 1GZWB 2EVXA 2JDPA 1ZRRA 3MIFA 1PVC1 2D7FA 5LY2A 3WX5A 4S2GA 2EXKA 4IEUA 3NV1A 1ACCA 1RHI3 4R9CA 3FBYA 2QQPA 1G6NA 4IV3B 5FZKA 3LIGA 1IPJA 1YJKA 2HYXA 5BPXA 3SLIA 4LBJA 4C0BA 1PO13 3OCPA 2BTVC 4GJYA 2RMU1 1VBD2 4QGLA 2WNVC 3NJXA 3PTYA 2YGLA 4PLMA 2JE7A 1W3XA 2IC1A 1V9U1 2WZ8A 3AX4A 4KWUA 2VOVA 3KCYA 4XFIA 5DUUA 1W6PA 5DAWA 3RYPA 1CX1A 2PTMA 1B35B 1LOGA 3WG1A 5A7WA 5EYXA 5HBAA 3OEBA 4MO3M 1UOBA 2WSUA 3J7HA 4AI2A 1GOHA 1V70A 2J1VA 3TNPB 4UFLA 3S6PA 3ZFEB 1JUHA 2I74A 1S0EA 3BVCA 2WR9A 2VD7A 1OFSA 3LGRA 5FKCA 2QQMA 1V6JA 4G3YC 1KQRA 1UYPA 1PX4A 3VZLA 3VL8A 4R9BA 3GGLA 2RJKA 2QDRA 1Y9QA 2BOIA 4K1ZA 3WXPA 4JVAA 3ZO0B 2JDHA 1GICA 2RS11 1YWKA 3T4VA 1RUE1 5FZ8A 2OZ6A 4GWMA 4L92A 4AEKA 1SG3A 2R16A 4HVOA 5CZKA 4FPGA 2VMGA 5A7OA 2ARCA 1U5ZA 4YVWA 2Q8EA 2PMWB 2ZEWA 2NMNA 5I0RA 2Y6LA 1S0BA 1EYBA 1ULDA 4QQHA 1JUIA 3AMHA 3AZWA 5D8AA 1DQ1A 4HPKB 2PHDA 1YUDA 4COUA 4IE0A 3FLTA 4H14A 1RYYA 3H50A 3POEA 3VBSB 5EJ1B 5CFDA 4CYDA 4OQ8A 3VB9A 4Q4W2 1CN1A 4UT5A 3WDXA 1LAJA 1O3SA 2PLV2 4NIHA 1AR72 1AR93 2VNGA 3H3LA 1ZZ8A 2W46A 3KF3A 3NNGA 3PVEA 1LKNA 4MVTA 4JC1A 2XHNA 2F4LA 1JXNA 4BWOA 5DDJ3 1IS4A 3EHKA 1YEWA 2D93A 3AXDA 3HBKA 5EIYB 2OPKA 4LKDA 2F4PA 2W2IA 1OD3A 3MFAA 4XILA 1NT0A 3AP4A 1SLBA 2ZGSA 1PVC2 3THCA 4FOQA 5F3IA 4A44A 1RITA 1ND2C 1QF3A 1W6QA 3FBMA 4CE8A 1VRBA 3I3MA 4LTAA 4Z1VA 3U10A 2VPVA 4N7UA 1RJ8A 3DUIA 4LK6A 2C6SA 5FYHA 2Y34A 4G4FA 2GNTA 1W6NA 2RMU2 1QJU3 1PZ7A 4QB2A 3B9CA 2Y33A 4FQZA 2ENRA 2P1BA 4Y20B 5FFOC 1GFF2 4B3NA 3WDYA 4LHKA 4YW6A 4DY5A 4CEWB 1GZWA 3PL0A 1UZVA 4Y1UA 5DUWA 1SFPA 1ZBE3 2P6HA 3VHNA 1J1TA 3ZFFC 2ZGNA 1HQLA 3M7AA 4AYUA 5FYTA 3PIGA 4E8CA 2ZPXA 3K4DA 3DN7A 1SLLA 4LLOA 4N8MA 2D3RA 4IV3A 4N90A 4QXHA 5JOYA 3BYWA 3FZ3A 1UOFA 2JG9C 4AZZA 3EQEA 1Q3EA 2DTYA 4XZPA 1V6IA 1QJX1 1AYM3 2QZ3A 4HN0A 3VKNA 3RZJA 3VD5A 3ZDVA 3A22A 3IB3A 4WM7C 3AMPA 2W9XA 2ZMLA 2RS12 2WFPA 1B35A 3RZHA 4BQ3A 1RUE2 3WHTA 4TZDA 2JB4A 3OEAA 3J7NA 3INAA 2JB8A 2ZHNA 3O0VA 3ON7A 4MXWB 4Q4V1 3L9JT 3ZDSA 3ZFEA 4LHSA 1FV2A 1CZTA 3ACLA 1C1LA 2A6WA 1NXMA 4Y4RA 2BBAA 2DUQA 2JDYA 2EXJA 4XACA 3O1SA 1KDKA 2VQ0A 4XTMA 4FAGA 4E4ZA 3E6BA 1J59A 1VBE3 1PM7A 1BK0A 2RVAA 3OY8B 1CAVB 3HQXA 5IW0A 5C4WA 1ZVFA 1ZA7A 5HCAA 1D2SA 3U37A 3ZLIA 1KJLA 2YFUA 1WA6X 4WBBA 5SV5A 1ZA4A 3AFGA 4S2FA 4TXWA 5IAXA 1N1YA 3B02A 2VW0A 2A3XA 3DV8A 5I8SA 1MEC2 3AP9A 4CCKA 3ZYIB 1WCQA 4BU2A 3T2TA 1QDOA 1BQPA 1CPNA 4LOSA 3C8XA 2FQPA 2A6YA 5FLHA 2E32A 2EF6A 4QX2A 4BISA 3LF7A 1WUVA 4GQ7A 4HPKA 3UNPA 1UO9A 1UU6A 3VZOA 2NPIA 2VC9A 4E4HA 1AX2A 4K6BA 4UAPA 5FZDA 2BOJA 4RR3C 3VBSA 4Q2FA 3RJRA 1NCQB 2VW1A 2ZABA 3AZXA 5BNQA 2VULA 5EZWA 1GWLA 1RB8G 3LB9A 1YHFA 1CWPA 4XJAA 4OMCA 1N1SA 2D6LX 4HETA 2BERA 3LZZA 1Q56A 4FPEA 2ZAHA 1AXYA 2P6CA 2G9ZA 2O8QA 5K9YA 1VJ2A 3TNQA 4BXFA 1IPSA 5FMDA 3RJ2X 2VNVA 3WQBA 3PNAA 4A7ZA 4P08A 1UL9A 3T30A 5KHGA 2NN8A 4IETA 2NZ9A 3VDDC 4DNYA 3AVSA 3DL3A 2NP0A 2PN5A 2GNMA 1YFUA 4YFWA 3WW3A 3Q8AA 1GP4A 5JR2A 3J9SA 3OGRA 5L9VA 5FPUA 2VQTA 2XQXA 3HOBA 1QJX2 1RTVA 2R6QA 2IXKA 3MW4A 1COV3 4KBBA 4R9AA 1NZCA 5BNOB 3MICA 4XBLA 4IE4A 4Y20A 2XUMA 1O4YA 5DAVA 2PHUA 3AZZA 2B45X 4QHZA 4CEWA 4XETA 3S0MA 3B69A 3KS7A 4MHRA 4W6YA 4MGTA 4Q4V2 3B93A 1V6KA 5F39A 1IKQA 5AFBA 2XLFA 5CA6A 2QQVA 3CLPA 2E51A 5A3WA 2QNKA 2D3SA 5IK4A 4Z8BA 4AR2A 2LS6A 1W9WA 3V0AB 1ZRIA 2FD8A 1EPZA 4O9GA 4OI0A 1MQTC 2IXCA 3K77A 2K2SA 4INDA 2OPWA 3RWKX 1F31A 3MUZ1 4P9IA 3WDVA 5HPOA 5A1FA 1BVP1 1KD7A 1UZYA 5CYYA 2R073 2WLPA 3T2QA 4MXWA 3CZJA 5GZEA 4DXTA 3O1RA 1PZ9A 3AP5A 3UKNA 3JB8A 4RS5C 3UV9A 3VKMA 4CXWA 1JYWA 1Y3TA 1I1EA 1C4RA 1XNAA 5FXVA 3WNKA 5K0UB 4FAHA 2VMCA 1TEIA 4N53B 4GB31 2RDRA 2XDVA 4CU7A 2XOMA 4DINB 5A1LA 1RIRA 4FP2A 4YLZA 4OZXA 4CDUA 2ZX0A 3OY8A 2WS91 4COVA 1SLCA 1CAVA 4X6RB 2CAUA 1RUD1 3KVAA 4OYUA 4AE2A 2XJUA 3T09A 5LBEA 2BEOA 2VOTA 1EAH1 2RR13 3CQOA 3EMRA 4OI4A 4XJWA 2MEV1 4LKFA 3ABZA 1Q8SA 5IK5A 3Q8FA 4AHYA 3RZLA 2MNGA 4CU9A 1WW6A 3GBWA 4FVVA 2XMLA 1EUUA 1M4WA 1YQ8A 2DCTA 1UXZA 4TYSA 1I6XA 4EZHA 5K4LA 1Z7S1 1NCRC 1NCQA 4XDPA 1RUC2 3CNAA 1NY71 1ULPA 3ZYBA 4YM3A 3JQWA 2Q0AA 1A3KA 5FZIA 2QFEA 4BPZA 1POQA 3AXEA 3WHUA 3H7JA 3CZUA 1AF9A 4ZY9A 3FX3A 2OUJA 4LHLA 1JW6A 1OOPB 2WT2A 1SPPB 3AJYA 4V1PA 5ABJC 5KXCA 1H2KA 1OH3A 2WAAA 3H8XA 5FZ9A 5IJRA 5C3SA 2E7AA 1C8NA 2AYHA 3H3ZA 5FP9A 5F6LB 4M3CB 4X8PA 4UI9L 3WDTA 5JSRA 4ISRA 5GLUA 2ZGOA 1WD3A 1KXGA 2XONA 4HL0A 4IESA 4WVMB 5A32B 4C1XA 4MGKE 4J1XA 3NV3A 4D7TA 1RUG3 5LWBA 5DABA 4EN6B 3G7DA 3UETA 4NIGA 3OBAA 2Q30A 5LATA 2C0ZA 2FDFA 5BNOA 4E2QA 3X29B 3BOPA 4AW7A 4XUNA 2AACA 4DQAA 4LJHA 1RUI3 1AVBA 1YFWA 5LA2A 2PHTA 1CAUB 2A6XA 2YUEA 1I5PA 3CU7A 5FTTC 1MS9A 4NJ4A 1S2BA 4QX1A 2FDKA 4XMAA 4AL9A 2P3YA 4NWWA 1A8DA 1ODNA 2VGDA 4UW4A 4BQYA 5FUIA 1ND3C 4YVSB 3WSOA 1XNKA 5BUVA 2R32A 4A7YA 2WS92 3ZKUA 3VBHC 4EZ4A 1NA1C 2WINB 4EWEA 3B01A 2D5FA 3TN92 2J1RA 4WM8B 4E8DA 1XNCA 1Y7BA 2D6PA 1EAH2 2WABA 4FQ4A 4XFAA 3N3HA 3VKFC 2Y6GA 2MEV2 4LLFA 1RVF3 1CZSA 4P5HA 4AI8A 1SHWB 4HSLA 2XJVA 1LU1A 3LDRA 5T5JA 5FPAA 1N3OA 5FREA 5A3OA 1QJY2 5K0UA 1S0JA 1OPOA 1GYKA 4N53A 4LR4A 4WZFA 3DF0A 5JSOA 1QGLA 1DHKB 1R081 1UZWA 2H0BA 2I2SA 5IVCA 1DQ0A 4QHOA 3AL5A 1ASJ3 1IQAA 2BFUL 2BGOA 1LEMA 1DG6A 1MS1A 1Z7S2 2VUJA 1QQP2 2AUYA 3JUUA 3KCXA 4LBKA 3ZXKA 1NY72 3FC0A 4GJZA 3H0OA 1CPMA 2QQUA 2GN3A 2D43A 2BPA2 1JHJA 1XYNA 1U5IA 1MS0A 1PIV3 2PAKA 2WT1A 2W1UA 1WMXA 3PU8A 4IV3C 3SH3A 5KXBA 3MIEA 2WRAA 2JX9A 4BIOA 1UW8A 4JRAA 1UZ0A 5FY0A 5EJZB 4SLIA 1RJ7A 2R041 3MLJA 4I30A 1V6LA 2VZQA 1OVSA 1SDDB 3CJIB 2YY1A 4QM8A 1LNSA 1B35C 4P02B 1QMJA 4JRLA 4YW4A 1YFXA 4MXVA 3VV1A 3RDIA 2CYFA 2RV9A 4AF9A 5FZHA 1H1AA 2DBIA 2W0XA 3ZFEC 4JHZA 5JSPA 4OFGA 4O7XA 4HFSA 2K9ZA 3M8LA 4RHV3 4P9JA 4XOGA 5E16A 1OOPA 5FZGA 1SPPA 2WSVA 1HX6A 4AHXA 1J1LA 2X05A 4XJZA 2CSGA 3V0BB 2IVIB 4CDWC 4DXSA 3M3QA 2CHHA 4M3CA 4GMP3 4H7LA 3GBFA 5FXXA 3IPVB 2EAAA 5IAVA 3B7MA 3WNOA 4B1MA 1WCDJ 3MYXA 3USUB 5A32A 4JGYC 1S55A 4CUCA 1FATA 3C7GA 1LOFC 4QDSA 4ZXKA 4XJ9A 3POSA 4PBPA 4FTEA 3LFIA 5KR7A 1KFUL 4LUMA 4PQQA 2GC0A 3AZVA 4Y1YA 1KEXA 1T6GC 2KM2A 3PJQA 3NWKA 4KNCA 1CAUA 4YRDA 5I91A 1RC6A 2B4KA 4OQ9A 4C1WA 1PZ8A 4YSFA 3OBTA 3MGUA 5ACA3 3ZR6A 2D98A 2AGSA 1H8VA 1WLWA 2HWE1 5FY1A 1FMD3 1PK6B 1PNGA 1DP0A 2OX0A 2ZHKA 1NLSA 4LHNA 3O0WA 1NZIA 4URAA 4OCTA 5J96B 4YVSA 1RGSA 1R082 3QD6A 1FPN2 4DXRA 4N43C 3FUQA 3FWEA 5IWFA 1H30A 1OKQA 2A7AA 2WL1A 3MIDA 3OBZA 1S0DA 4LOTA 4RA0A 2RJ2A 3KV9A 4V2WA 4WM8A 5E6HA 1PO21 3JU9A 2CTVA 4BB3A 3OGVA 4IDZA 1VBC2 3NJYA 3A0KA 1V9U3 2XXZA 1RUH1 5FMOS 5I8TA 4IV1C 1MZ5A 5FY7A 1VBB3 3LSEA 3RS6A 3EXUA 1SLAA 3V56A 2JG8C 4S2DA 3MW2A 2DTWA 4HOOA 1C28A 2R042 1XBFA 3U75A 3AM2A 2ORZA 2R1BA 4CPBD 2BBVA 4XTPA 4IERA 4NHLA 2C24A 4Y1XA 4OHZA 2AEYA 4QMAA 2ZGLA 1QOOA 4OUEA 1K45A 1LTEA 4I0BA 4QPIC 5D1IA 5FBJA 4C0HA 1QU0A 4HT1T 2JXAA 1Y43B 1ZZ7A 2CDOA 4BQ1A 1SDWA 3HT2A 3GBGA 2RS31 1T6BX 2ADEA 1UQXA 4XBQA 5FXZA 2LALA 3WQ1A 1DGRN 1LHUA 1S0FA 4LO8A 2P4EA 3O1VA 3AYDA 5AC91 2DWRA 3CJIA 1HRV3 1V6MA 2DCZA 3I49A 1LOEA 4Z07A 4ATFA 3GZEA 5J98B 3ZXFA 2KR2A 3POBA 5FPLA 5T3NA 3BPZA 4JTOA 1S0GA 3NV2A 3K75B 1ZRDA 1ZZ6A 4FFHA 4BIFA 1NE6A 3DPRC 4I3PA 5A80A 2ZEXA 2WZR3 1VPHA 2K46A 4IEWA 4JKMA 2HEVF 4AHZA 1D4M1 2VUCA 2XGXA 2EAKA 3R4DB 1BZWA 3V0BA 1JZ6A 2AREA 2EALA 3JBG1 1CESA 3WP4A 5IUQA 1J84A 4AQTA 3IPVA 5AVPA 3M3OA 2VVFA 4YW2A 2XJQA 4COYA 3LSDA 3USUA 2WYSA 2VBPA 4LMFA 1REDA 4BK5A 2GN7A 3VKLA 4CCNA 4XHBA 5DZEA 1K12A 3CKHA 1MVEA 3FMGA 2ZGQA 3OTFA 3R4UA 5IATA 3R05A 4CCCA 1XQNA 1R1ZA 3O1PA 4KQ7A 4OHXA 3WY6A 1F5FA 4MLOA 1AR81 2EXIA 1ZBA2 2PELA 5C8CC 2FBEA 1URXA 3BTXA 1UCXA 2BQPA 1NCQC 1O7FA 4JKLA 3MLLA 1BK1A 3TEYA 2LM3A 3WP5A 1PK6A 4I01A 3LIHA 1RUH2 5A3TA 3PU3A 1US2A 5EHDA 3LCPA 4CU6A 4D0QA 5C6CA 2D5HA 3HIFA 4AI9A 1Q8PA 2RDQA 2ZMKA 3WLUA 3O1MA 5KXDA 1US3A 4DFSA 3CMGA 5A1AA 1IHMA 3RFRA 5IVBA 3KQ4B 2D3PA 5CFDB 2ZGUA 2CNAA 3OF1A 1TMF1 4Q0PA 5JVVA 5JPMB 1PGW2 1MS5A 1RMU3 2RS32 3I3DA 4O61A 1JOJA 4AAXA 3WP6A 1QXJA 2PFWA 4LE3A 1SBFA 3ALQA 2AR6A 1E5HA 5BNNB 1XE8A 4JDNA 2W1QA 5FRAA 3S7EA 2VZRA 4AI3A 3BU7A 5FYSA 5C5UA 4GWIA 5EWSA 2G19A 3D3AA 4M4RA 1SBDA 2OVUA 3W21A 2DURA 1LHVA 2E6VA 4XFGA 2VMHA 2NQYA 3KMHA 5JI9A 1QOTA 1S1AA 2W94A 4SBVA 1G9CA 3I3EA 2GAUA 4JZRA 4CP1A 2VU9A 2HWD1 2ZZQA 4XJ8A 5C5TA 1D4M2 5FMCA 2VQAA 3NMBA 4LO5B 4BOWA 3O1OA 1UYYA 2UWCA 4KMQA 1DZRA 1QXRA 2ADDA 2O0OA 3DKQA 1RUJ1 3LPFA 4NN0A 5F5IA 1UKGA 3VHRA 5JZGA 1O8SA 1S2EA 1A34A 2CGPA 5EXOA 1VMHA 1A8MA 1QDCA 2FMDA 4QPGC 4NRMA 4Q0SA 4A3ZA 2BRTA 4DUXA 1X7NA 5FZAA 1OLQA 3AMMA 1REEA 1VMJA 4QXCA 4XF4A 1QJEA 5K8SA 1BEV1 3GM8A 4N53C 4B4QA 4BK4A 3D5OA 3IDBB 2Y6KA 3AB0A 1IOAA 3DYOA 3ZSJA 2VMDA 3J7LA 3DKWA 4TLGA 1CAXB 1AR82 2ZXQA 1EPWA 4Q4Y3 4XF1A 5H9PA 3HN1A 4ET7A 1BYHA 1GANA 3S5QA 2UYAA 5J09A 4FTBA 2X8KA 3C3VA 3ZPYA 1U0AA 4B7EA 2DFBA 2VOKA 3AYCA 1HB2A 1MPXA 2FDJA 2VZSA 2XBO3 2CU5A 4LO4B 4N9IA 2VOXA 5FZ3A 3VBRC 4CDXC 4OHYA 4TTGA 4AEJA 4QU1A 4HK9A 4UFKA 3WNXA 1SQ4A 1G7YA 2RM23 1LGCA 2XVLA 2BJSA 3H9AA 3MIHA 4W6XA 3CEWA 2R062 3BPSA 3DYPA 5I8YA 4I02A 4LORA 5FBZA 3OUIA 5C9AB 3VN4A 5FV3A 5BV6A 4XZUG 2BNNA 3SC7X 3VBUC 4P00B 4JDMA 5FKBA 5GM0A 1KGYA 1WW7A 5C4WB 4XHXA 2ZACA 2W87A 1W9TA 3HPNA 3N9NA 2DBNA 2O8OA 2WBKA 1TMF2 2WKKA 4FFGA 4DUWA 1ZZ9A 3LAGA 3MDPA 4FFFA 4XIOA 5HCBA 4DY3A 1NG0A 4CCEA 2WIIB 2LRPA 5LBCA 3ACIA 4PLOA 4DB5A 3I3BA 1QH6A 3ORJA 3SKJE 4XUTA 1LOCA 5ANQA 3WF0A 4P5YA 1DBNA 3WR0A 1OOPC 4D8MA 1RINA 1G9FA 2W08A 2C1FA 2HLEA 4OULA 1JZ7A 1JYCA 2HWC1 3B9IA 3WQ7A 2YPJA 3I2DA 4MSVA 1DLCA 4BYYA 1DZQA 1H4HA 3URFA 1N3QA 1J3QA 1OF4A 1HV1A 2WT0A 4MADA 3CO2A 1RXFA 4JHTA 5HCHA 2VZTA 2ZX4A 1QHDA 2IXIA 3M3EA 1GZTA 2HWD2 4D6QA 1MEC1 4Y5TA 1R093 2ZX1A 5AFEA 1FOD3 5BNNA 2DF7A 5FZLA 5FZ7A 4UBHA 2DCYA 5HI0A 1XSRA 1HN1A 4P9GA 3OPZA 4URTA 5E1RA 3W58A 5L19A 1H8TA 3O5SA 2OIIA 2ZOEB 1RUF3 1RUJ2 5FY5A 1JZ2A 5CADA 1W28A 4GB33 2ZCWA 3WF3A 1RUOA 1ZRCA 3N9PA 3RYKA 3CF6E 3HWJA 3AFKA 2JDNA 3GDBA 4GXLA 1WCSA 4MHUA 1TG7A 1RUD3 4D7YA 5F5QA 4IQPA 2UWBA 4NPRA 2WAOA 3OPWA 4GWNA 1BEV2 1HN0A 4M0NA 2Y60A 4FPCA 4XQDA 2WFF1 5F3GA 5EFUA 3LA3A 3N4MA 5FYIA 1DGLA 2W1WA 1FX5A 2VE1A 4HLTA 2D6OX 5FOBB 4WM8C 3NJVA 2ARAA 5BNPB 4DZGA 4CEYC 4ES8A 4K1YA 4GH4B 5CAZA 4YG3A 3EB7A 2QJVA 4CSWA 5L7OB 2BP6A 4RGAA 3UK9A 1U12A 5L73A 5HXMA 1H9WA 3KD4A 4QU2A 5H9RA 2X5IC 3ZYRA 2WO7A 5FR3A 4Z92B 1A78A 1DYKA 1CAXA 1X36A 2DYCA 2O1QA 3CBNA 4LA2A 2H6CA 3SEEA 1G9AA 3KHCA 5KXEA 1KITA 2XKOA 2R49A 1OUSA 3GF6A 1YCIA 4LKSA 3SEPA 3THDA 2J1SA 3I2KA 5FQ0B 1MACA 4LEJA 5JLVA 1VBA1 1S0CA 5DUXA 2WUHA 4NHYA 3LEGA 4P9XA 1D2QA 3POGA 3D0JA 4GULA 2W39A 1AL23 1UMZA 3H7YA 2JD4A 4Q0UA 1PMHX 2YFZA 4W6WA 3KCCA 5GKAC 1H2NA 1W9SA 5C9AA 2HWC2 4XAEA 5DAQA 3AKQA 4CDUB 1QOSA 1XXNA 2HWB2 3WZ1A 3ACHA 4M01A 1N1VA 1OT5A 5FZ0A 4K8RB 4YW5A 4KI5M 1VP6A 4YFZA 1Q8QA 4BA6A 2DCKA 3MV01 3M70A 4HG6B 4K40A 4K9SA 4XMIA 2IWGB 2UY8A 2Q1MA 1JYTA 3R0RA 3VL9A 1EV11 2WQ4A 4JQRA 4RQPC 4LO7A 4OMDA 1WBLA 3U4SA 4Z82A 5T55A 2ERFA 3AZYA 4YZ5A 3MI8A 5LY1A 1JOBA 1CQ9A 1RXGA 3RYRA 1OLRA 2IXLA 1NLQA 5LZ6A 3I2OA 4BDVB 5DXDA 3VD4A 2DVAA 2QUOA 3B5LB 2E31A 3ZXJA 5C3RA 3B00A 1O3QA 4XC9A 4XFFA 1VRH3 1LRHA 2DU0A 1UOGA 1XU2A 1YI7A 1MZEA 2VZPA 4Y3OA 1STMA 4X8NA 3ZYPA 1C5HA 3NQHA 2WNUC 4UYBA 2FZ2A 1POV3 2QQKA 4A7KA 2WFF2 4UW6A 2BWCA 1H6YA 2NMOA 3T1LA 4ARYA 1O3RA 1DDLA 1W2OA 5FZEA 2XLGA 3H3UA 2RS51 3GCXA 4YZ3A 4FXGB 2MHFA 5HV4A 5L36A 4META 5EP9A 2XLAA 3WEZA 1RHI1 1RUC1 1HV0A 2ID4A 4CUAA 4IE7A 3MUY1 1QWRA 1PO11 3FHQA 3A21A 2QQOA 1G8WA 2B9VA 3KLSA 3OBRA 3UGHA 3VUOA 3T0DA 3I2FA 3O1UA 3MV11 1QH7A 3JD73 5L9RA 1O3TA 3NNJA 3I2JA 3NL1A 1BLZA 2VZ1A 3KV5A 4DMIA 5F2SA 3NAPB 1WW5A 4PQ9A 2RDSA 3NKTA 5BNPA 2NYYA 3J8F2 3PMEA 2WA3A 3SHRA 2V09A 1EUTA 1UMHA 4GH4A 3WCSA 4DO0A 5CFCB 5L7OA 1OSGA 3Q8BA 3U0ZA 1CIYA 1VB4A 1LEDA 1VBA2 4CCOA 1UU5A 2QTWB 2HWF3 4BQXA 2GMPA 5LRSA 1C3HA 2Y6HA 3D0SA 4NE9A 5FJKA 3U07A 1GP5A 1NAEA 1HXS3 2QDNA 1SACA 1V6OA 1AR62 2VCMA 4XURA 1SCSA 1UKRA 1BBT3 3T1MA 3I2GA 3I3QA 4NIAA 1VMFA 3OUHA 2VMEA 3ZKYA 1MR5A 2XB6C 2Q4SA 4GAZA 4XDOA 4A6SA 4Y4YA 1TNRA 3U14A 1EV12 1F15A 2W52A 1D0HA 4BCUA 5FQ0A 1VALA 5IVVA 3UKVA 2J1TA 4WV8A 1LR5A 4QQ2A 5FK7A 3P3PA 3POJA 5LRRA 4B29A 5JOZA 2EXHA 2ZX2A 4HSJA 1OUXA 5LK5A 4IEYA 1GQPA 1UX6A 4QX3A 1HRI3 2W68A 4JGZB 2IUWA 3GALA 3TN91 5LEKA 1AR91 4CXYA 3MO4A 2V73A 4LQRA 3PUAA 4MZUA 1WBFA 3GJBA 2QQJA 4ORFA 3OSDA 4PT6A 4XUQA 3W5NA 1UY0A 3LPGA 1YQCA 2VR4A 1GOFA 1QJY1 3ZPOA 5DDJ1 3OYWB 3ZXEA 4L0PA 4CDQA 5FZ4A 1UIJA 2IFWA 2HWE3 4IGQA 1J83A 4UBGA 4MGQA 2RS52 2VZUA 3ECQA 4ZU4A 5DMYA 3WF4A 2PHWA 4YM0A 4LITA 3VBFC 3BODA 2WNVB 5FZOB 1WMEA 4JAAA 1QQP1 1RHI2 1TME3 1LHNA 1LHWA 2WN2A 4MOAA 3ACGA 3T3YA 2J1AA 1ULCA 2BFUS 4AEDB 1FXZA 1PO12 1PO23 2PYTA 4NPLA 2XJSA 5JPNB 1QJU1 1W0OA 1WCKA 2FZ1A 2WO2A 1GSLA 3R4SA 2AENA 1QJZA 5A6ZA 3WW2A 3GZTB 1DIWA 4DEVA 4LA3A 1GV9A 3IDCB 4IEPA 1ZNPA 3GHMA 1ZBE1 1UYXA 3E6DA 4Y22B 4TLFA 4P9YA 2R0HA 3WF1A 4J6GA 5GALA 2BWAA 1W0NA 5BXXA 4LBLA 1DYPA 3ZSKA 3H8UA 1KDMA 4HKWA 4YVWC 4D94A 4MGZE 2EIDA 2JEMA 3N36A 1OLMA 4LNVA 4TN7A 2BU9A 2FHRA 1AYN3 4CP0A 1V6NA 3BTAA 5D8AC 3H1YA 2CGOA 4PF5A 4CXXA 5JDBA 3NAPA 3RZKA 3WNPA 1FV3A 3KT7A 5T54A 4YG6A 3BTZA 3LA2A 2QQNA 3OB8A 4C91A 4YW7A 4Y26A 5CFCA 5CFDC 4AFAA 5AC93 4ZU5A 2BZDA 5CISA 1JZ3A 3T4HB 1XPWA 1NLRA 4ARXA 4XBNA 2ZBJA 2E26A 3M3CA 4XJUA 5FUPA 1W06A 5BNNC 1VBE1 4AI1A 1AX0A 2YC0A 3EJKA 3KSCA 3QACA 1S2KA 1VAMA 3CDZB 5G05L 4GIQA 4Q0QA 4DOUA 1KS5A 3DXTA 4A4AA 5IVYA 2Q8OA 1AR92 3S30A 3POYA 4XVHA 3LE0A 3SITA 1L7QA 3C7EA 3KWVA 4AVCA 2JDKA 4E4SA 2LROA 3JBG3 4NIIA 4M00A 4Z2AA 2P37A 1O91A 2B46X 2GC1A 2XJPA 3LOIA 3SH4A 3UGFA 3ZR5A 1ND2B 1C8M3 2P17A 2ZJCA 1LENA 4Q1PA 5DDJ2 4QB6A 1Q8OA 5EPAA 4NVPA 1FPN1 3VZKA 3U1XA 3MF6A 1GU3A 3K4ZA 4R8HA 2C4XA 2EIBA 2C9AA 4Q29A 3WV6A 1PX3A 2Q8DA 4JGZA 3TB0A 1ULGA 5CU1A 5CG9A 1R1A3 5FOJB 2CGNA 4HONA 4K7JA 3I97A 5LCWL 3LFMA 3V64A 1JYXA 2Z79A 1SCRA 1VBD3 1VBC1 2W3JA 1F9KA 5AVAA 5FZCA 4XUPA 1JYNA 4KWJA 4UWDA 2VTXJ 5DZFA 1QJU2 3OYWA 2IFRA 1W3VA 2ETEA 3HN3A 5FPBA 1XNTA 1UU4A 2XKPA 5CVRA 3WCRA 2JG9B 2XG3A 1O59A 4I3GA 1N3PA 2GMMA 3UJQA 1JBCA 3Q9OA 3SXWA 5F3EA 2GALA 3VDAA 2XWJB 1ZBE2 1D7PM 2V5DA 3A0NA 2WNVA 5DG1A 5FZOA 2JJ6A 4WM7B 4H2AA 5DAXA 2VO5A 1XYOA 4HMZA 2DUPA 1YQ6A 1YO8A 1REFA 5FPVA 4L9BA 4K21A 4FPLA 3KB5A 2RG4A 4AEDA 2A71A 1JU4A 2G4IA 3NW4A 3TBDA 1AYM2 1VAKA 2VTFA 5JAXA 3PVOA 2IZWA 3GXUA 1BXHA 1COV1 3N9LA 1L7RA 4B4RA 4DEQA 1O4TA 1H1IA 5K7PA 2YU2A 3C2UA 3ZVXA 1GQGA 3FN9A 1WLTA 2QBXA 4B4PA 2YROA 1AJKA 1OC1A 4DRRA 3L2YA 4XCAA 5C4WC 4HVRA 2Q1ZB 2B7YA 1UNBA 4PI0A 4IGPA 4Y22A 5D2AA 2A6ZA 4NAMA 2HYKA 1PMIA 3ELNA 4NROA 1AL22 1GQHA 3BN6A 3ETPA 4MGSA 2VW2A 3ASIA 1W6MB 3M4FA 2ZTNA 3EYPA 3OGJA 3VD3A 3I54A 1VBE2 3GNEA 1DZTA 4Q4W3 1AXKA 1S4CA 1UMIA 1ZYBA 5A7PA 1U5XA 2PLV3 1JZ8A 1AR73 2R071 5FYBA 5EV7A 1QY4A 1H1MA 3VBSC 1O8PA 2VCCA 4QKNA 1UXXX 3TRSB 3BU0A 1HW5A 4RR3B 1FYUA 1W0PA 2VECA 5H9SA 3HEIA 4XF3A 5JXIA 5F5AA 3RSJA 2FCVA 4WVVA 1YNAA 4AXOA 3ROUA 3K3OA 2WLQA 4M3CE 3EO6A 2HJIA 1LJ7A 4AGRA 5I0DA 2GZWA 1PVC3 2W5FA 1JMUB 1N1TA 1NKGA 3Q8CA 2I45A 1BMV1 1IS3A 1DQ6A 2ORXA 2VUDA 2WQ8A 3RZGA 2RR11 2E7TA 2PAEA 1I9RA 2OW4A 1F2NA 1ZBA1 4A2UA 3FL7A 4D7SA 5IK8A 1OA2A 1P8JA 1UYZA 1HB1A 4FT8A 1SFYA 2RMU3 2OZJA 1GNZA 1WZXA 4GMP0 3RWNA 2XVGA 4Y5Z0 1H6XA 3VDDB 1TQ5A 1UY2A 3M3IA 2DVDA 3MEPA 1ND2A 1ENSA 1SBEA 1W2TA 2GNBA 2JDAA 2R30A 2YU1A 3HAGA 3IIIA 3KQRA 4HKLA 5CBLA 4XPVA 3RGBA 4L99A 4K8FA 2TBVA 3IKWA 3J4UH 2XUEA 4IEXA 4QPYA 1AUYA 2OT7A 2FDGA 4AOCA 2Y6FA 2Z69A 4QX5A 1SFNA 1UY1A 1NQDA 2YXSA 3USSA 4XXAA 4AFBA 3AP7A 4CEWC 1B09A 3VZMA 2PAMA 3MLKA 4E9KA 3VDCA 4F83A 4FOWA 2GC2A 1PGW1 3ZIXA 3ZFFA 2WWJA 5F32A 1COV2 2RS13 1W03A 2Q5TA 5LEJA 2D6MA 1RUE3 2ZGMA 5EQUA 4JQTA 3WNNA 2JG9A 2P3KA 3UKTA 2BNMA 4IL7A 4MX3A 2D97A 2WWUA 1SZBA 3LWCA 1GOGA 1MQTB 4EQVA 4FPFA 2DFCA 2EA7A 2KA3A 1HLCA 4WM7A 4BXSV 2PQQA 5JZGB 4LBOA 2J42A 2VVEA 3ZYHA 2QQWA 4UFMA 3ZMOA 1RUG1 5F8PA 5JCTA 1H0BA 4IE6A 4IUGA 1H2MA 3HD8B 2VY0A 3WD5A 2W92A 1GWMA 4OHVA 4RS5B 3RNSA 3UL2A 4AVTA 4Q8KA 4JX0A 2BVBA 2P5BA 4ZS3A 4F7ZA 3CJXA 3ZFGB 3MBWA 1RUI1 1ZX5A 2VCAA 4IE5A 5CB7A 4LIUA 2R072 4KU7A 4CDUC 1QNYA 3UJOA 1MEC3 1RL3A 4CCLA 5L9BA 2Y38A 3ZN5A 4B8EA 5A6YA 4RL7A 3VZJA 1IS6A 1W6MA 3H1MA 3JZVA 4NHMA 3OOXA 4QGNA 3W9AA 2GNDA 2BUKA 3MFCA 4ITCA 1BMV2 3VGIA 1W9YA 3ATGA 3S7IA 5JOWA 1W2NA 4AWDA 1PGL1 2RR12 1FAYA 4FOVA 3IZOA 1RVF1 4AAPA 3IWZA 4RR3A 5FP3A 1MS8A 4A42A 1NCRB 2H0VA 2C5DA 4UF0B 2HBUA 5F3CA 1DU3D 4NR1A 4A45A 3RI9A 1ASJ1 1HIXA 5JI7A 4LT5A 4M3CF 2VNOA 1W9FA 2A5ZA 1M06G 1VB2A 2D44A 2R061 2Z5WA 2JDZA 5GLZA 4AVBA 5ABJB 1ZM1A 3PUSA 3N9OA 1TNFA 4QX0A 2P3IA 4Q0VA 4PBOA 1PIV1 2P2KA 2YBPA 1QJX3 4YYOA 4Q4X1 5J1XA 4Q5OA 3VDDA 3ENRA 1XSQA 2WNEA 5FCCA 4DPNA 2XJTA 2R7EB 2GP3A 5FYYA 4YM2A 4CP9B 4Q4V3 4QXKA 2BV4A 5BNOC 1W8TA 1F4HA 2GP5A 4JDOA 5LA9A 4RYDA 5IHRA 2GC3A 1H8TB 3OUJA 5JOXA 3NAPC 3POFA 2AC1A 2PXJA 2YPDA 3F95A 4JV4A 4PIXA 4XEZA 5I0TA 3ZN4A 2RDNA 1C57A 2CV6A 3KV6A 1JTZX 2LUWA 5IFPA 2Q1FA 5FZMA 2Y0IA 1RUG2 3MHZA 2JECA 4RHV1 1HJFA 3N7MA 3E5XA 3PVNA 4XW3A 2DVFA 3NSTA 2JE8A 3PURA 3QH7A 1LHOA 1OQ1A 1XE7A 1HQWA 4XF0A 3BI3A 3GCWA 5FZFA 2WA4A 5A7QA 4ASLA 4FFIA 1RUI2 1OQDA 3WP3A 1ND3B 1GMMA 2VZ3A 4GMP1 5C3PA 1ODMA 1MQTA 4QT6A 2D6NA 3DYMA 4H7MA 4HKOA 1EP0A 5GZGA 3VBHB 3D6EA 1NA1B 4FPJA 4K3UA 4EWDA 1ULEA 4MUVA 2YB7A 5A7NA 2J1EA 2B8MA 3WNLA 3AYEA 1X8MA 1UN1A 2QCSB 5FPXA 1OA4A 3GZAA 4RS5A 5K0UC 5B4XA 1O5LA 4PF1A 4QX8A 1UAIA 3N9MA 1SMVA 3OD4A 3ZFGA 4QQPA 1HQNA 2ZEZA 2OXBA 2ZEYA 3RI8A 1CZVA 5A70A 3H8RA 1BCXA 1V00A 1PGL2 2I07B 1RVF2 5A33B 1JZ4A 5ACA1 2RHPA 3T0BA 4JGZC 1JN2P 3MW3A 5KC5A 1NOVA 3QH6A 4RGKA 1AZDA 1IZ3A 3I8TA 1C8M2 4HBNA 2DDUA 2KXLA 3FLPA 2XL9A 1LODA 4XXPA 3AKSA 4A41A 3I59B 3BALA 3O7OA 4YGBA 5SV8A 1ASJ2 1W99A 1RUC3 2WNOA 1IKPA 4W50A 3FFQA 1VLNA 4C8DA 3VBOB 3VLBB 1R1A2 2AZ5A 5EYYA 2JD9A 4Q27A 2VUAA 3QLQA 2YBSA 4PJYA 1PIV2 4AG4A 4CP2A 5C3QA 1QKQA 1X9TA 1XU1A 1NCRA 3D82A 5FP4A 5T52A 3WDWA 1VBB1 3NO8A 2PA7A 4UF0A 4AEDC 1LESA 1OQEA 2IVJA 2IXJA 2BGCA 1TE1B 2HKXA 4XUOA 1YQ5A 4L97A 5DG2A 3DEMA 2F17A 2GDFA 3ILFA 1CJPA 1PVXA 3IMMA 2C26A 2DCJA 4GKXA 2TNFA 5ABJA 4W65A 2JENA 3WQ0A 4BHPA 1GKBA 1LOAA 2HWB1 5A3NA 1UOJA 1W8ZA 2XWBB 1DCSA 2BGPA 2VM9A 1K3IA 3FHAA 3LQCA 4GA9A 1Y9MA 2FMYA 4OI2A 4CDWB 1Q5OA 3CL1A 4GD4A 4RHV2 1K5MB 3AL6A 4M4PA 2V4AA 3AMNA 4BJ0A 1RUNA 5HV0A 4LBMA 2Y26A 2QQLA 4JGYB 4W8JA 4Z2WA 1JH5A 4R4ZA 4CP9A 1HRV1 3LDBA 4ASMB 3ZOIA 2UY9A 5C8WA 1JODA 1LCLA 1LULA 1ULOA 4FCAA 3H8OA 2O14A 2X09A 4QPWA 2W95A 1HB4A 3LDKA 3JCIA 5GJ6A 5LASA 2N7GA 3POIA 2J1UA 2PQSA 2FCTA 4XE9A 1W8HA 4Q8LA 4KGQA 2DU1A 2E63A 4RGGA 4QQOA 5B4NA 2WS93 5H9QA 5FZ1A 3SCFA 2WZR1 4IEVA 3ZXLA 3TN93 3PDQA 3P3NA 4B1LA 5LK7B 4TWTA 1EAH3 1ENXA 5J48A 4UFIA 4YVSC 3TEZA 4FSJA 1XOYA 2MEV3 4NWVA 4BLJA 1ND3A 1WW4A 5CEHA 4PI2A 2BVVA 5FO7B 1PMJX 3ST7A 4N43B 3TYJA 4MGIE 3F2ZA 5T5LA 5ACA2 1QJY3 3IN9A 5G04L 1DFQA 2WQZC 1IG0A 1E5RA 2D40A 1NA1A 1W04A 4RD7A 1FMD2 2Y0OA 4RN5A 1CIWA 3RMXA 1KRIA 5E89A 4BLIA 2J22A 1GBGA 3FUOA 3QCWA 2BYVE 2BNOA 2VQUA 1GNHA 4QKFA 5FLIA 5A6XA 5JIUA 3O12A 1Z7S3 4PDWB 1UZZA 1QQP3 2ET1A 3THTA 1MS4A 4I0AA 4IEQA 4IV1B 5I0UA 4ZXEA 4FBFA 3CHXA 1OBNA 4L8QA 1OI6A 2JG8B 4ZS2A 4DRVA 3LKJA 3RG0A 3WNMA 4H55A 5A33A 3LD8A 5FYCA 3KGLA 4D3WA 4AVAA 2YG0A 1V9U2 3HQRA 1WKYA 4CTEA 3J8F1 2VNRA 3ACFA 1VBB2 2VMFA 2E53A 2VMIA 4X6QB 4QPIB 3HJRA 1G86A 3RMYA 1F5JA 1VAVA 4TSVA 3VD7A 3I59A 1W90A 3PJYA 4N9HA 3MPBA 2JIGA 5F1RA 5C7GA 4XQ4A 2Q8CA 2W91A 3AC0A 3VBOA 4GWJA 4ES9A 1K42A 1AR61 4DS0A 3AVRA 3CJIC 4L2NA 4AGGA 3K48A 1RMU1 2GMEA 4ZPIA 5FMBA 4RFRB 4I09A 3ZX7A 4PHZA 4HK8A 2GH2A 3IT8A 1Z0HA 3N7JA 3C7HA 2PHFA 2XVKA 1G9DA 4F3JA 4WVWA 4XABA 1QJFA 4AI0A 1OPMA 5M0TA 1YC61 1HRV2 5GLWA 3OGSA 2P34A 1DGWA 4CDQB 3DPRB 1Q43A 4A6OA 2ZA9A 2A6VA 1YJLA 3KV4A 5F6KA 1V0AA 3MIGA 4ONUA 2TEPA 2WWSA 2VXRA 4CDWA 4EROA 3KM5A 1NE4A 2D6KA 5CNAA 1K5MA 3UYJA 3V65A 2CWSA 4LBNA 2WZR2 2G9FA 2ES3A 3WDUA 1IGOA 3PTRB 3LOBA 4JGYA 5JXGA 4U2AA 4YW3A 1R64A 4J1WA 1LOFA 3TEXA 3ZYJB 2GU9A 2DUOA 5J7MA 3BOWA 3HR9A 4MV2A 5IVFA 4XFHA 3JXSA 4R52A 3E6CC 5FAXA 2A73B 2DVGA 2E7QA 2TUNA 2UYBA 4L11A 4ZONA 3WG4A 3RVHA 4JKKA 1R083 5A7SA 5C8CB 1FPN3 3UESA 1FT9A 4AQ6A 3MIBA 3ZN6B 2WC2A 1PK6C 3THPA 1Y9GA 3RZZA 5KC6A 1D0GA 4QGMA 2UU8A 3P5BA 4Q4Y1 4S2HA 1UWWA 4D69A 1JU3A 1VBC3 4JTNA 2BW8A 4FPYA 4UFJA 3NNMA 4YW1A 3GYDA 1OHFA 3C7FA 3JQXA 3AKPA 4N43A 3LA7A 4YZ2A 5I0SA 1JYVA 1WLCA 2VAUA 5C70A 1O6UA 3SQOA 2VXJA 4AFMA 5IFTA 3WW1A 2XBO1 5LA0A 1IQDC 3SMHA 3WF2A 4B7KA 5DZGA 1GUIA 2R043 5FYVA 3ZMNA 1AXZA 2RM21 2X10A 4GZ9A 4P9LA 5FYMA 4PDWA 2QVSB 5HCFA 4ZZ5A 3W20A 1BVVA 1MZ6A 1AX1A 2Y6JA 4IV1A 3WG3A 3PVBB 1DYOA 3ITQA 1POV0 2XL7A 2AH2A 1OA3A 2JG8A 3NV4A 4BE3A 2XJRA 2ATFA 1CGPA 1TZOA 1WA4A 3BTYA 2JE9A 3LEKA 2GH8A 1RMU2 4ZKTB 4YM1A 4E27A 3OGGA 5LW9A 4AQ2A 2V4VA 2PHLA 4CCDA 2XQRA 3POWA 4OLLA 4QPIA 1OD5A 2PHRA 3ETQA 2QKDA 1Z78A 4YZ4A 1DLLA 5FZBA 4D6RA 3TEWA 2SLIA 3AMQA 2Z42A 3KHBA 5FWEA 5C3OA 5C71A 3RRDA 1AJOA 2RJLA 2CAVA 3UGGA 3K2OA 1ZREA 1W8WA 4KBZA 1DQ2A 3TOJA 2ZGPA 1DQ4A 4F8AA 4XF9A 5JZGC 4NIDA 1I5ZA 4HN1A 3OG2A 5A3LA 2E9QA 2L9LA 2YMZA 1R091 1FOD1 5LBBA 4QPGB 3B94A 1AL0G
chains in the Genus database with same CATH topology
3OD0A 3QOPA 1CJDA 1YRZA 2LTNA 4BM8A 1RUF1 3ZFGC 3DPRA 1VR3A 4YNIA 4QQLA 3PLQA 1SEFA 1L3JA 5TSWA 3U11A 2GSYA 1CAWB 3ES1A 1LECA 2MPFA 2ZKNA 3VZNA 3ZSEA 1PNFA 1ZBA3 3PHMA 1UPSA 4QHBA 4XQWA 4CDXB 3VBRB 1CR7A 1LGBA 1SLIA 3FHIB 4Q4Y2 2UWAA 2B5HA 3ZXGA 4R4XA 1RUH3 5GLTA 1X50A 5C33A 2XBO2 5C8CA 1G9BA 3VBUB 5KHIA 3ZN6A 3AKTA 1N47A 3VHOA 3GHNA 2RM22 3K51A 1AYM1 1PGSA 4WVZA 1YIPA 2HEYF 1MVQA 5IK7A 2VH9A 5KHHA 2RS33 3WUCA 4AFDA 5J37A 4RFT0 5E88A 3NKGA 3PMSA 4COZA 5KBFA 2NLRA 3QBQA 1AL21 2WZPP 4BMBA 1XYPA 1F8VA 2ARBA 1NQJA 1OMIA 4Y1ZA 1S0IA 2RE9A 1H8TC 3IIAA 4N7IA 3GZUC 1YLLA 3AJZA 3AKRA 5T5PA 1LB2A 4NHKA 1D4M3 2ARXA 3M2MA 4Q26A 4Q1RA 1R092 1DQ5A 3M1HA 1FOD2 3KZ4C 4AQSA 4PIYA 5E8AA 1QNWA 4ISQA 4MYEA 1YI9A 4IEOA 3D8CA 5KWRA 1RUF2 2A3WA 2XHKA 2YGMA 1WMFA 1W2UA 2ZZJA 4GB32 3V0AA 1AHSA 1VRH1 3OJBA 3SNMA 4LUKA 1RUD2 2ZX3A 5T5OA 4E4DX 1W6OB 2G9GA 3DGTA 1JYIA 4AFCA 4CEYB 1KFXL 1MZFA 1POV1 4P14A 1AR83 4QPGA 2YZ4A 2A3YA 3L2HA 1ALYA 3ZFFB 4YZ1A 4EN7B 3ES4A 1BKZA 1C1FA 5GZFA 3SISA 2VVDA 5FLJA 2X5IB 3IM0A 2ZGRA 5BYNA 1DGWX 1YIFA 2ILMA 1CAWA 4AK3A 2R063 4EWAA 1NYWA 1ZZBA 4YARA 2ZHLA 5J36A 4AGVA 3JD71 1CVNA 2R1DA 4Y24A 4CDXA 4GALA 2JICA 2CWMA 3VBRA 4FO9A 2ET7A 1ZZCA 4G9SB 1WD4A 4Q4X3 3TAYA 1TMF3 4YGEA 4XIKA 3VBOC 3MZHA 5C9AC 4NO4A 4UW3A 1H2LA 1Q8VA 3AP6A 4OUMA 4EN8B 5B2GB 2SBAA 3VBUA 4Y1VA 3N7LA 2HWF1 4FPOB 3ILNA 3WT3A 4KWLA 3NVCA 1HXS1 3ZSLA 1NXD1 3SCHA 4LO6B 4RQPB 2X53S 4FXKB 4BH9A 1J3RA 1BBT1 4O9EA 4MH0E 4C90A 5CG8A 2XPJA 1XNBA 2HWD3 1U5YA 4FPHA 1PHMA 1X8EA 3W59A 4I0WB 4EV0A 1K5MC 5GLVA 2NM1A 4JCKA 4BMEA 1FNZA 1RUJ3 4WVMA 3BIWE 3E97A 1ZRFA 1XNDA 5KHJA 3HBZA 2WNUB 4EN0A 1HRI1 4PCRA 2B9UA 1WMDA 1VRH2 3IBMA 3MPPG 1BEV3 5JWPA 3FE5A 2XH6A 1IS5A 3ILRA 3B3QE 5FO9B 3I7DA 1EY2A 2PHXA 4PIZA 1OFNA 3N35A 4LE4A 4OUSA 1YYNA 5F9TA 4AVSA 1KS4A 3BB6A 3ZXAC 4EN9B 5I93A 2YDEA 2ZAAA 5KHKA 3RQ0A 1TME1 2A75A 3IDEA 4COWA 5BNPC 1W6OA 3VHPA 4GH4C 1ENQA 2A70A 4CEYA 5L7OC 3FFZA 3JD72 1J3PA 4PDWC 2V5YA 2X29A 2B39A 1UD1A 1ENRA 4M0HA 2X5IA 1APNA 2JKBA 4LBQB 3HT1A 3TWIA 4AVVA 1WLDA 3J26N 1E57A 1YFYA 2CL2A 3ZYGA 2HWF2 3A4UA 1BJQA 2HWC3 1DF0A 1XRUA 2HWB3 1GLHA 1HXS2 2R0FA 4CRQA 1AYN1 2OUHA 2HEWF 1YXWA 4QD2A 1A6CA 1ONAA 1LOBA 1BBT2 3APBA 4KG0A 4UXAA 2EIGA 5FPZA 2DV9A 2VOWA 1VIWB 2YHJA 4LBQD 5JIAA 1HDKA 5JMCA 4OHWA 3WUDA 4KG8A 4KU8A 4LULA 1JHNA 4U36A 2P3JA 3R6SA 4GKYA 3RPQA 3BCWA 3E5QA 3ME2A 2Z2SB 4RQPA 4CZSA 1HRI2 1LGNA 2F6BA 4CDQC 1FI2A 1KJRA 4YG0A 3N7KA 4XFBA 4E2SA 2WFF3 4KGGA 2YV8A 3VBFB 1UPIA 3E5UA 1W6PB 1C8M1 5CIRA 1MS3A 1QXPA 2DVBA 1CONA 5DUVA 4RSUA 5GZDA 2HWE2 2QZ2A 3FJSA 4K20A 4WZCA 4HVQA 1J58A 4AEMA 4XDQA 3AK0A 2WNUA 1GR3A 4FP3A 4YGDA 4H3WA 4A3XA 1UF2C 1R1A1 2OA2A 1TME2 3H1WA 3WG2A 5JR7B 4I2OA 1VBD1 1PO22 5FMOL 3VKOA 3WW4A 5FO8B 3O0XA 5IT6A 3U4XA 3J8F3 2ZKLA 3FLRA 2H6BA 3KT1A 3O14A 2ZMNA 4DXZA 4KWKA 2ZGTA 3HMYA 5FDBA 4YVWB 4EJRA 1GZ9A 2CY6A 1VBA3 1O4ZA 3EBRA 2ZHMA 4IXLA 4XYXA 4ZU7A 5D8AB 5HXVA 4KL1A 4PLNA 4ATEA 5CFCC 1O5UA 1AR63 4MGYE 4YGCA 4QM9A 1AYN2 3NJZA 3SCGA 4OVEA 1C5IA 1D4VB 1HKDA 2UURA 5BY5A 3I4IA 1GZCA 3D4KA 4LBQA 4BZ4A 1EV13 1WGPA 4FPKA 1ULFA 4XFCA 2WJSA 2YYOA 5AC92 3G6JB 4HANA 3SH5A 4R9DA 1H9PA 2ZS6B 4AHWA 4FOYA 2K0GA 3AYAA 1W39A 1X33A 2IXHA 4Q4W1 3WVJA 3ZIWA 4E2GA 1SLTA 2B42B 2ZGKA 4KH9A 3ZSMA 4IEZA 5J3UA 4UW5A 2PLV1 1FNYA 1IPKA 1AR71 1UIKA 1W6QB 1X82A 3JB4C 4OI1A 3KT4A 1LU2A 4FTSA 2QE3A 1CD3G 3WINE 2VG9A 3WOGA 3KGZA 1I3HA 5GZCA 1H4GA 5A3MA 1W6NB 3IMNA 4P9WA 3JBG2 1CX4A 3MF9A 1DGRA 1FMD1 5EJ3A 2OYZA 4HZFA 2RS53 4NOTA 1GZWB 2EVXA 1ZRRA 3MIFA 1PVC1 2D7FA 3WX5A 4S2GA 2EXKA 4IEUA 3NV1A 1RHI3 4R9CA 3FBYA 2QQPA 1G6NA 4IV3B 1IPJA 1YJKA 5BPXA 3SLIA 4LBJA 4C0BA 1PO13 3OCPA 2BTVC 2RMU1 1VBD2 4QGLA 2WNVC 3PTYA 4PLMA 2YGLA 2JE7A 2IC1A 5DUUA 1V9U1 3VBFA 3AX4A 3RYPA 2VOVA 3KCYA 4XFIA 1W6PA 2PTMA 1B35B 1LOGA 3WG1A 5HBAA 5EYXA 2WSUA 4AI2A 1V70A 3TNPB 3S6PA 3ZFEB 1JUHA 2I74A 1S0EA 1OFSA 3LGRA 1V6JA 4G3YC 1KQRA 3VZLA 3VL8A 4R9BA 2RJKA 2QDRA 1Y9QA 4K1ZA 3WXPA 4JVAA 3ZO0B 1GICA 2RS11 1YWKA 1RUE1 2OZ6A 4GWMA 4L92A 4AEKA 2R16A 4HVOA 4FPGA 2VMGA 1U5ZA 4YVWA 2NMNA 5I0RA 1S0BA 1EYBA 1ULDA 4QQHA 1JUIA 3AMHA 3AZWA 5D8AA 1DQ1A 4HPKB 2PHDA 1YUDA 4COUA 3FLTA 4H14A 3H50A 3VBSB 4CYDA 5CFDA 4Q4W2 1CN1A 3WDXA 1O3SA 2PLV2 1AR72 1AR93 2VNGA 3PVEA 1ZZ8A 1LKNA 4MVTA 4JC1A 1JXNA 4BWOA 5DDJ3 1IS4A 3EHKA 3AXDA 2D93A 2OPKA 2F4PA 4XILA 3MFAA 3AP4A 1SLBA 2ZGSA 1PVC2 4FOQA 1RITA 1ND2C 1QF3A 1W6QA 3FBMA 4LTAA 4Z1VA 3U10A 2VPVA 4N7UA 1RJ8A 3DUIA 4G4FA 2GNTA 1W6NA 2RMU2 1QJU3 1PZ7A 3B9CA 4FQZA 2ENRA 4Y20B 5FFOC 1GFF2 4B3NA 3WDYA 4LHKA 4DY5A 4CEWB 1GZWA 4Y1UA 5DUWA 1ZBE3 3VHNA 1J1TA 3ZFFC 2ZGNA 1HQLA 3M7AA 4AYUA 2ZPXA 4LLOA 3DN7A 1SLLA 5T50A 2D3RA 4IV3A 4N90A 3FZ3A 2JG9C 3EQEA 1Q3EA 2DTYA 4XZPA 1V6IA 1QJX1 1AYM3 2QZ3A 4HN0A 3VKNA 4WM7C 3AMPA 2ZMLA 2RS12 2WFPA 1B35A 1RUE2 3WHTA 4TZDA 3INAA 3O0VA 2ZHNA 4MXWB 4Q4V1 3L9JT 3ZDSA 3ZFEA 1FV2A 3ACLA 1C1LA 2A6WA 1NXMA 2DUQA 2EXJA 1KDKA 2VQ0A 4XTMA 4FAGA 4E4ZA 3E6BA 1J59A 1VBE3 1PM7A 3OY8B 1CAVB 3HQXA 5C4WA 1ZVFA 5HCAA 1D2SA 1KJLA 4WBBA 5SV5A 1ZA4A 3AFGA 4S2FA 1N1YA 3B02A 2VW0A 2A3XA 3DV8A 5I8SA 1MEC2 3AP9A 3ZYIB 3T2TA 1QDOA 1BQPA 1CPNA 2FQPA 2A6YA 5FLHA 2EF6A 1WUVA 4GQ7A 4HPKA 1UU6A 3VZOA 2NPIA 1AX2A 4K6BA 4RR3C 3VBSA 4Q2FA 3RJRA 1NCQB 2VW1A 2ZABA 3AZXA 5BNQA 2VULA 5EZWA 1RB8G 3LB9A 1YHFA 4XJAA 1N1SA 2D6LX 4HETA 3LZZA 1Q56A 4FPEA 2ZAHA 1AXYA 2O8QA 5K9YA 1VJ2A 3TNQA 3RJ2X 3PNAA 4A7ZA 1UL9A 5KHGA 2NN8A 4IETA 2NZ9A 3VDDC 4DNYA 2NP0A 3DL3A 2PN5A 2GNMA 1YFUA 4YFWA 3WW3A 3J9SA 1QJX2 1RTVA 2R6QA 2IXKA 3MW4A 1COV3 4KBBA 4R9AA 1NZCA 5BNOB 3MICA 4XBLA 4Y20A 2XUMA 1O4YA 2PHUA 3AZZA 2B45X 4CEWA 4XETA 3S0MA 3B69A 3KS7A 4W6YA 4Q4V2 3B93A 1V6KA 1IKQA 5AFBA 2XLFA 5CA6A 3CLPA 2E51A 2QNKA 2D3SA 5IK4A 4Z8BA 3V0AB 1EPZA 4O9GA 4OI0A 1MQTC 2IXCA 2K2SA 4INDA 1F31A 4P9IA 3WDVA 1BVP1 1KD7A 1UZYA 2R073 2WLPA 4MXWA 5GZEA 1PZ9A 3AP5A 3UKNA 3JB8A 4RS5C 3UV9A 3VKMA 1Y3TA 1I1EA 1C4RA 5K0UB 4FAHA 4N53B 1TEIA 4GB31 4DINB 1RIRA 4FP2A 4YLZA 4OZXA 4CDUA 2ZX0A 3OY8A 2WS91 4COVA 1SLCA 1CAVA 4X6RB 2CAUA 1RUD1 4AE2A 2XJUA 2BEOA 1EAH1 2RR13 4OI4A 4XJWA 2MEV1 1Q8SA 5IK5A 4AHYA 2MNGA 1WW6A 3GBWA 4FVVA 1M4WA 2DCTA 4TYSA 1I6XA 1Z7S1 1NCRC 1NCQA 1RUC2 3CNAA 1NY71 4YM3A 3JQWA 2Q0AA 1A3KA 2QFEA 4BPZA 3WHUA 3AXEA 3H7JA 1AF9A 3FX3A 2OUJA 4LHLA 1JW6A 1OOPB 2WT2A 3AJYA 4V1PA 5ABJC 5KXCA 1H2KA 2E7AA 1C8NA 2AYHA 3H3ZA 5F6LB 4M3CB 4X8PA 3WDTA 5JSRA 4ISRA 5GLUA 2ZGOA 1WD3A 1KXGA 4HL0A 4IESA 4WVMB 5A32B 4C1XA 4MGKE 4J1XA 3NV3A 4D7TA 1RUG3 4EN6B 3G7DA 2Q30A 2C0ZA 5BNOA 4E2QA 3X29B 3BOPA 4AW7A 4DQAA 1RUI3 1AVBA 1YFWA 2PHTA 1CAUB 2A6XA 2YUEA 3CU7A 5FTTC 1MS9A 1S2BA 4XMAA 4NWWA 1A8DA 2VGDA 4UW4A 1ND3C 4YVSB 1XNKA 5BUVA 2R32A 4A7YA 2WS92 3VBHC 1NA1C 2WINB 4EWEA 3B01A 2D5FA 3TN92 4WM8B 1XNCA 1Y7BA 2D6PA 1EAH2 4FQ4A 4XFAA 3N3HA 3VKFC 2MEV2 4LLFA 1RVF3 4AI8A 4P5HA 4HSLA 2XJVA 1LU1A 5T5JA 1N3OA 5FREA 1QJY2 5K0UA 1S0JA 1OPOA 1GYKA 4N53A 4LR4A 4WZFA 3DF0A 5JSOA 1QGLA 1DHKB 1R081 2H0BA 2I2SA 1DQ0A 1ASJ3 1IQAA 2BFUL 1LEMA 1DG6A 1MS1A 1Z7S2 2VUJA 1QQP2 2AUYA 3JUUA 3KCXA 4LBKA 3ZXKA 1NY72 3FC0A 3H0OA 1CPMA 2GN3A 2D43A 2BPA2 1XYNA 1U5IA 1MS0A 1PIV3 2PAKA 2WT1A 4IV3C 3SH3A 3MIEA 2JX9A 4BIOA 1UW8A 4JRAA 4SLIA 1RJ7A 2R041 3MLJA 4I30A 1V6LA 3CJIB 2YY1A 4QM8A 1B35C 1QMJA 4JRLA 4YW4A 1YFXA 4MXVA 3VV1A 3RDIA 2CYFA 4AF9A 1H1AA 2W0XA 3ZFEC 5JSPA 4OFGA 4HFSA 2K9ZA 3M8LA 4RHV3 4P9JA 4XOGA 5E16A 1OOPA 2WSVA 1HX6A 4AHXA 1J1LA 4XJZA 3V0BB 4CDWC 3M3QA 4M3CA 4GMP3 4H7LA 3GBFA 3IPVB 2EAAA 3B7MA 1WCDJ 3MYXA 3USUB 5A32A 4JGYC 1S55A 1FATA 1LOFC 4ZXKA 4XJ9A 3POSA 4PBPA 4FTEA 1KFUL 4LUMA 4Y1YA 2GC0A 3AZVA 2KM2A 1T6GC 4KNCA 3PJQA 3NWKA 1CAUA 4YRDA 5I91A 1RC6A 4C1WA 1PZ8A 4YSFA 3OBTA 3MGUA 5ACA3 2D98A