3BIWE

Crystal structure of the neuroligin-1/neurexin-1beta synaptic adhesion complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
177
structure length
177
Chain Sequence
HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/cell adhesion
molecule keywords Neuroligin-1
publication title Structures of Neuroligin-1 and the Neuroligin-1/Neurexin-1beta Complex Reveal Specific Protein-Protein and Protein-Ca(2+) Interactions.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 36
structure length 177
sequence length 177
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3biwE00
1BKZA 1KJRA 1W6MA 1SACA 2W39A 3LSEA 4CRQA 1LOAA 2OUHA 1SBFA 3POSA 2I2SA 2VXRA 4Y24A 3HR9A 2PHWA 3MW3A 1NLSA 2P3JA 1WBLA 4XILA 3AYAA 1MS9A 3PMEA 1JN2P 3WG1A 2EXJA 1CQ9A 1UL9A 3AP6A 3SH3A 4UW5A 3M3OA 1OKQA 2JKBA 2LTNA 3ILRA 4XXPA 1CN1A 5E8AA 1W6OA 4XYXA 5GJ6A 1SCSA 1ULCA 3WDTA 4YFZA 2V73A 1O4ZA 2NMNA 4Q8LA 4U36A 5T55A 2P3KA 1AXZA 1AX2A 4FOVA 1ENRA 3TAYA 1LHOA 1C4RA 1Y7BA 4FPEA 3VKMA 2JDZA 1HQLA 2UWBA 4YGCA 3V64A 5IK7A 2RHPA 4RL7A 5KXCA 3SLIA 4XBLA 4AVTA 2JD4A 3FBYA 5DZFA 1IKPA 1WCSA 2JE9A 2WLQA 2XB6C 3OBTA 4K1YA 1LU2A 2ZACA 3W58A 3W59A 1F5FA 3ATGA 3C2UA 1QOTA 1SLAA 2G4IA 1N1TA 2P2KA 2NYYA 3B00A 4Q2FA 5AVAA 3OPZA 4F83A 2AGSA 4R9CA 3VV1A 1LHUA 4GXLA 3AZZA 1I1EA 1D0HA 5KXDA 1MS5A 1URXA 4LBKA 5DUVA 4DFSA 1GBGA 1LECA 3BODA 3IPVB 5GLVA 2PHFA 1W0OA 1DQ0A 5GM0A 4D69A 3FLTA 3WLUA 1TEIA 2ZGSA 3AZVA 3OJBA 4FPKA 2ZGRA 5F5QA 3ZYPA 5T5JA 2EXHA 2DVGA 4XIOA 2A70A 1UZYA 1DIWA 4XHXA 4YM2A 1V6OA 1UPSA 2YMZA 4ATEA 2GALA 2UU8A 2PELA 1S0GA 3ZVXA 1SLLA 2D44A 4Y1YA 2VU9A 3ZXLA 3AK0A 2WT2A 3N3HA 1LGBA 1QNYA 4XHBA 4XJAA 3B69A 1AJKA 4LBQD 2NM1A 2D6NA 4XJWA 3UL2A 5JLVA 1MS3A 1N1VA 2ZGTA 3WDYA 1SFYA 1LODA 3RMYA 2GNMA 2ERFA 2E7TA 3ENRA 1N1SA 3MEPA 4Y22A 1GNZA 1ONAA 1DFQA 3NV3A 5GZGA 4YM3A 4M3CA 1YI7A 5JOZA 5EYYA 1LU1A 2UWAA 1QKQA 1S0JA 4FPHA 1S0FA 4LBLA 1MS1A 4CTEA 3B01A 1N3PA 1RIRA 2UWCA 2NZ9A 3UJQA 2CWSA 1UKGA 2LALA 4XIKA 1GZCA 2GNTA 3ZXJA 2EALA 4BQ1A 1V6NA 2JECA 4XJ8A 1ENQA 3ZXKA 2B7YA 4YW5A 1Q8OA 5GZEA 2DVAA 2ZGLA 1GZWB 1FX5A 4FOYA 1HKDA 4R9AA 4CZSA 3SH4A 1N47A 4FP3A 1LOEA 3D4KA 1Z0HA 1UN1A 1V6LA 5GZDA 2ZHKA 5L73A 3V0AA 1JBCA 3A4UA 2VUAA 3HMYA 1KQRA 3WNXA 4YW4A 4YM0A 1CPMA 4XJZA 1DBNA 4FQ4A 4HL0A 1IS3A 4Q1RA 3M1HA 3WOGA 1WLWA 2NP0A 1SLIA 2VY0A 3FLPA 3ZSKA 4WZFA 1WW6A 2AUYA 1UZZA 2E6VA 4Y26A 1WUVA 2SLIA 1VALA 3VKNA 1MZ6A 1YXWA 2WKKA 1BJQA 2GMPA 2YV8A 4WVVA 4DRVA 2D7FA 2E51A 3OBRA 1Q8SA 1W6NA 1Q56A 1W6MB 4W65A 2ZGNA 2GN3A 1V6MA 1JYIA 1AXYA 1HDKA 1LOBA 4PBOA 1MVEA 1AX0A 4AVSA 1S0CA 2XG3A 1ZA4A 2D6MA 3DGTA 4Q27A 2ZA9A 3CNAA 1CESA 5HCFA 3H0OA 2Z42A 5DG2A 3ZXEA 2WNEA 4XJUA 2W52A 2YY1A 3O0WA 1WLCA 1W6OB 4Y1ZA 3WDUA 1LEDA 3FUOA 5IK4A 4YW3A 3WHTA 4GWMA 3RMXA 1C1FA 2A7AA 1AXKA 3HN1A 5SV8A 1F31A 5JDBA 3B9CA 2PHXA 2A3XA 2ZMNA 4DS0A 1YO8A 1MS4A 1FATA 4M3CE 5HCAA 4C1XA 1OQ1A 3INAA 2DVFA 4HANA 3OY8A 1WD3A 1I3HA 1MS0A 5IUQA 1ULDA 3AX4A 4DPNA 4FQZA 1S1AA 1LHNA 3RS6A 4Z8BA 1W6PA 1WLDA 3USUB 4AVVA 1PZ7A 2WSUA 1N3QA 1NXD1 4YGBA 5DXDA 1DQ1A 2P34A 2E53A 1DQ6A 1N1YA 5KXEA 4ZKTB 4GA9A 3NV1A 1QMJA 2GMEA 4LBJA 3ZYRA 1QU0A 1WW4A 5LK5A 1DZQA 1V6KA 3AZYA 4YG0A 1APNA 1IS4A 2D6OX 2WT0A 3TB0A 3O12A 4YM1A 2C9AA 1DYKA 2ZABA 2DV9A 2D3RA 4XTMA 2DYCA 1QDOA 3MPPG 1LENA 3RSJA 2A71A 3R4SA 4JCKA 3VUOA 1H9PA 1JXNA 1A3KA 2GNDA 1VIWB 4XMIA 4YG6A 4UW3A 2W68A 2WJSA 1G9DA 5JVVA 3PVNA 3PVOA 4ITCA 3AZXA 3NWKA 2DWRA 4XXAA 5IK8A 5JOYA 2A6VA 2ARBA 3BOPA 1MVQA 1KRIA 5H9PA 1FV3A 3FLRA 1O4YA 1SLCA 3O0VA 1LHVA 4Y20A 4BLIA 2DUPA 2ZMLA 3M3QA 1S0DA 3OYWA 2ZGPA 1OFSA 4PQ9A 3V65A 2ZZJA 1AF9A 1MR5A 3APBA 4Y22B 3ILNA 3WCSA 3Q9OA 4M3CB 4FPOB 1RINA 2VW1A 3AYCA 2FHRA 1XQNA 1PZ8A 1IS5A 1G8WA 1Q8QA 1DQ5A 2R0HA 2TEPA 1MS8A 4XE9A 2AR6A 3O5SA 4Y1VA 1D2SA 2D6PA 2A6YA 2DVDA 4I30A 4DQAA 4Q8KA 3BIWE 1UMZA 1QF3A 5DG1A 2NMOA 2EXKA 1MACA 3SISA 2PHRA 3ILFA 5T5PA 2YXSA 1QDCA 1JHNA 4M01A 5T5OA 1FNZA 3RQ0A 4C1WA 2CNAA 5H9RA 4BOWA 4Y1UA 5T52A 3WG4A 3KM5A 2R16A 5CAZA 1SCRA 2GMMA 2GNBA 3WDWA 1PZ9A 3I4IA 1IKQA 1JOJA 1LOGA 5GZCA 1BZWA 3UJOA 4LBQB 1KITA 1SLTA 3AXDA 3WDVA 5BYNA 3ASIA 4LBOA 5GLUA 2WSVA 3T1LA 2VW0A 1W6QB 4PBPA 3M2MA 4AGVA 5E88A 3U4XA 4AWDA 1W6NB 2DUOA 2A3WA 3JU9A 4YG3A 1ULGA 3WUCA 2UURA 1S0IA 1LOFA 2CL2A 2KM2A 2V5YA 3A0NA 2D3SA 4SLIA 5CA6A 5JOXA 1LJ7A 4XMAA 3N35A 2ENRA 1GKBA 1H30A 5IT6A 2PHUA 1BXHA 1ULFA 2OVUA 4ASMB 4K1ZA 5GLTA 2DTYA 4FVVA 4K21A 4XJ9A 1AJOA 1LCLA 5FREA 4XDQA 2NN8A 4FPYA 2OW4A 2P3IA 1ENSA 4ATFA 1YIFA 3PJQA 2ZAAA 3POYA 3T2TA 2H0BA 4FP2A 5JOWA 1ULEA 3JUUA 2P37A 4LBMA 3AP4A 3V0BA 3OY8B 2PHTA 3BTAA 2ZGOA 3WCRA 2R1DA 3IM0A 2A3YA 2ZHMA 1CIWA 1GANA 3B3QE 4TZDA 4ZXKA 1W0PA 4TYSA 1F9KA 3MW2A 2DVBA 4YZ1A 5KXBA 2DU0A 1UAIA 3LSDA 3R05A 1DGLA 1JYCA 4FPGA 4AGGA 1LGNA 3O0XA 1GV9A 1GLHA 1LOCA 2A6WA 2C5DA 1Q8PA 4M3CF 1S0BA 1FAYA 1QNWA 2ZGMA 1G9BA 4WV8A 2DUQA 1VAVA 4AGRA 4GKYA 2YROA 2VH9A 2EIGA 2FMDA 3AFKA 4Y1XA 2CWMA 2R49A 1IS6A 4ISQA 2A6ZA 3M3EA 4XBQA 1G7YA 3POWA 4BMBA 3ZPYA 3N7KA 3ZSJA 3DUIA 5GLZA 3AP9A 4YZ4A 2D3PA 4PCRA 1LEMA 1B09A 2YZ4A 3R4UA 4AYUA 1GYKA 4XBNA 2JE7A 3FFZA 1AX1A 3IMNA 3I8TA 3WG3A 3VKFC 4Y20B 4JC1A 3KQRA 3OYWB 1N3OA 3A0KA 1HLCA 1H9WA 5DZGA 1V6IA 1FNYA 1WW5A 1J1TA 4JRAA 4K20A 3N7JA 2A6XA 2Q5TA 5DUUA 1LULA 2A75A 5F9TA 4YZ3A 4YW1A 4P9YA 5H9SA 3L2YA 3USUA 1V00A 2WT1A 3AJZA 2ZGQA 3NV4A 3AP5A 2GDFA 5HCBA 1AZDA 2D43A 3SNMA 2A5ZA 5DZEA 4XTPA 2JJ6A 4XZPA 1GZ9A 1YYNA 1A8DA 1ZM1A 1DYPA 5CB7A 5GZFA 1SBDA 3AZWA 4YGDA 2WQZC 3ZSLA 2ZHLA 1CONA 3LCPA 4IQPA 4XOGA 2EF6A 5H9QA 4H55A 5T50A 1A78A 3WV6A 2GN7A 3RG0A 2EXIA 4PF5A 3WDXA 1FV2A 2VW2A 3N7LA 3ZXFA 5T5LA 3D6EA 2ZGUA 1LHWA 3SH5A 3WUDA 1V6JA 1G9FA 1DHKB 4KBBA 1QOOA 4YGEA 1QOSA 4YW2A 4LBNA 1G86A 1CJPA 3IPVA 4L8QA 5DUXA 2CTVA 2E7QA 2ZKNA 3MW4A 4YZ2A 1S0EA 4BPZA 2ZGKA 4M00A 2DTWA 2DURA 1WW7A 2ES3A 3M3CA 3QCWA 1G9AA 5GALA 3V0AB 4FPLA 1RITA 4YLZA 1AVBA 1C57A 1DQ4A 1JUIA 3D5OA 1KJLA 1BYHA 5EXOA 2ARXA 1VLNA 3N36A 3WG2A 1KDMA 5E89A 1U0AA 5T54A 1C1LA 1LESA 3IKWA 3SITA 3WZ1A 3QLQA 1CPNA 2BQPA 2AENA 4RA0A 5FRAA 2ZMKA 2R0FA 3WHUA 4WVWA 4FOQA 1DQ2A 3VKOA 4GKXA 1LTEA 3OGGA 3VKLA 2ZBJA 4FPJA 2AREA 2D6KA 4FOWA 1SLBA 1GSLA 1WBFA 4NOTA 3IN9A 4R9BA 1KDKA 1EPWA 2CYFA 1DLLA 3AJYA 4Q1PA 4R9DA 2EAKA 2W08A 1MZ5A 1QGLA 1HQWA 5JMCA 1Q8VA 3WVJA 4BLJA 2AH2A 1GNHA 1VAMA 4YFWA 2D6LX 3PVEA 4BMEA 1JW6A 4ISRA 3V0BB 3RRDA 5GLWA 1FYUA 3FUQA 2DU1A 4UW4A 1Z78A 3AP7A 3AYDA 3GALA 4FPCA 4P9WA 1LGCA 4P9XA 4OZXA 2HYKA 4GWNA 1GZWA 3UK9A 3AXEA 4FPFA 2SBAA 5CNAA 1IOAA 1X50A 4P14A 3NV2A 5CBLA 4UW6A 1CR7A 4GALA 4LBQA 1UX6A 4Q26A 1BQPA 2R1BA 4BM8A 1YRZA 1SBEA 1W6QA 2AYHA 1G9CA 1W6PB 3AYEA 4DRRA 3T1MA 4MYEA 5EWSA 2ZHNA 1LOFC 1GICA 5IK5A 3ZSMA 2OUJA 4U2AA 4YZ5A 5EYXA 1R1ZA 1WD4A 2CY6A 5DUWA 3N7MA 4NO4A 3GNEA 1CVNA
chains in the Genus database with same CATH superfamily
3FHAA 5LY2A 2K2SA 1BKZA 4D6QA 1KJRA 1W6MA 3LSEA 2W39A 3IB3A 1BBT2 4E2QA 1XE8A 2JDAA 3PVBB 1PNGA 1SBFA 4G3YC 5FJKA 4FFFA 3WF2A 5JXGA 4UBHA 1PX4A 2WN3A 2BTVC 1J58A 2PHWA 3MW3A 4CUAA 1ND3A 2OZ6A 3AKPA 3ETQA 4XW3A 1MS9A 4TLFA 4RHV2 3AMNA 4I0BA 2OA2A 4M0HA 4UW5A 2R6QA 1OKQA 2GP3A 1F8VA 2JKBA 4XXPA 1J83A 4HVOA 1CN1A 1W6OA 1U5YA 1LKNA 5FFOC 5JMOA 4L9BA 4H2AA 4QQPA 4YFZA 4U36A 1O4ZA 2NMNA 5IVVA 2P3KA 1AX2A 5I8SA 1ENRA 1RUD1 2XKOA 5C71A 5AFBA 1SEFA 1C4RA 1Y7BA 4IEYA 2BYVE 4AVAA 4DEQA 1HQLA 3ALQA 2UYBA 1XNAA 3Q8AA 1OF3A 2RHPA 5FZAA 3V64A 3FL7A 5BY5A 2WBKA 5C4WB 2BWCA 3O1OA 3RZZA 4KNCA 3ZYHA 5DZFA 2P6CA 2JE9A 2VE1A 3VBHC 4CEYC 3I3QA 2YU2A 4JHZA 1PK6B 2BGPA 2QNKA 4IV1A 3ZXGA 1QJY3 1HRV3 5FUPA 1O3RA 4R9CA 1U12A 2WO1A 4N9HA 2X09A 3IDEA 4QKNA 1ND2C 4FCAA 1AR61 2HWF1 1R64A 3AZZA 3Q8CA 4IEXA 4QU2A 4YVWC 4P9GA 2JG9B 4QKFA 2VOTA 3JD71 5D21A 3K48A 4QXCA 5KXDA 1JZ3A 3OSDA 4RQPC 4Q0SA 5KHKA 5LY1A 3O7OA 5FZOA 3VBSC 1JZ7A 2G9ZA 3DXTA 1IPSA 1NCRC 1TEIA 3HT1A 3RWNA 2ZGRA 5F5QA 4LPLA 3CBNA 4AFBA 5IVJA 4OZOA 1UZYA 4DO0A 1DIWA 3OPWA 2R30A 2IFRA 1DGRN 4JGYB 4YM2A 2GALA 2Z2SB 5A3MA 2VOVA 3PJYA 3ZXLA 4AFAA 5I0SA 2NQYA 1J1LA 3AK0A 5FP9A 3N3HA 3JB8A 2ZEYA 1WCUA 3ACGA 3VBOC 4Q4Y3 4UF0B 4CXYA 3O1TA 2JE8A 1NXMA 4WM8B 4Q4Y2 3V56A 1EAH3 4LO6B 2OYZA 4DOUA 4AI8A 2VMCA 1MS3A 2YU1A 1LODA 1JOPA 3H50A 1Y43B 5JZGB 3ME2A 3DPRB 4ZY9A 4XURA 4XFGA 1AR92 2UWAA 4W6WA 4CDQA 1EUTA 1S0JA 1W9WA 1EYBA 4GQ7A 1MS1A 3B01A 1OOPA 3J8F3 4DXRA 3SEEA 1K5MB 5FWEA 3RDIA 1RIRA 2UWCA 2Q8DA 2IZWA 2W87A 4GB31 1GZCA 4QU1A 5K0UB 2EALA 4DMIA 3LKJA 5CFDC 2HYXA 1XNCA 1DLCA 4XJ8A 5KC5A 4NIHA 3LPFA 4YW5A 4RR3C 2DVAA 2VMIA 5FO8B 1FX5A 4R9AA 1N47A 5FY8A 2CV6A 2XBO3 3G6JB 2PHLA 1ZBE1 4D0QA 4MGIE 5C8CC 2D98A 2CGNA 3D0SA 4N43C 3ZFFB 4J1XA 3IAQA 3GF6A 3C3VA 1VE0A 4XJZA 1BMV1 4HL0A 1IS3A 3IIAA 1SLIA 3NNLA 1W2AX 1WW6A 2E6VA 2XHNA 4WZFA 2PFWA 2PAKA 4AI3A 1WUVA 2JDUA 3RZHA 4IE5A 4W6XA 1YXWA 3R4DB 2VNRA 4WVVA 2YV8A 1GWMA 4B7EA 4DRVA 2E51A 1W6NA 1Q56A 2G19A 2X10A 2ZGNA 4XFHA 1AX0A 4N8MA 2VVDA 1UYPA 3VD5A 1VJ2A 4BYYA 4CDWC 3VHNA 2HWB3 3HVDA 2F4LA 3P5BA 4RS5B 1OBNA 5HCFA 3E6CC 1V9U2 4AL9A 1UYXA 1S4CA 1F35A 4HLTA 5DG2A 3ZXEA 2WNEA 3ZFGC 5FYBA 1WLCA 1FXZA 4QHOA 4XPVA 4Y1ZA 3CJIC 5ERLA 1VBC1 1QQP3 1BK0A 5FMOS 3RMXA 1AXKA 1QQP2 2ZAHA 1MS4A 4M3CE 5FK7A 4AVBA 5D2AA 5HCAA 3INAA 2WFPA 5KHIA 1NQDA 1I3HA 4X6RB 3AX4A 1KD7A 2O1QA 5FLHA 4DPNA 3O1RA 1LHNA 2ZTNA 4B4QA 3BKZA 1W6PA 3WF0A 2B9UA 1RJ8A 2HBTA 3OD0A 5DXDA 1O4TA 2E53A 2VQUA 2VR4A 2RR11 5ABJA 2JX9A 2J22A 3ZN5A 2ADEA 1ASJ3 4GULA 1D4M3 1E5SA 3ZYRA 1AL23 3PURA 5ACA3 2IXIA 4QXBA 1E57A 3H8XA 1RXGA 1V6KA 4MXWA 5ACA2 5FPAA 3IT8A 4CPBD 1APNA 1IS4A 2D6OX 3OEAA 4IXLA 1O5LA 3PUAA 4W4ZA 4YM1A 3SCFA 5C8WA 2WZ8A 1GU3A 3PUIA 1RUG2 4JCKA 4E8CA 1G9DA 4YG6A 1YFWA 2WJSA 3AKSA 2W95A 1O59A 1W9TA 4GMP0 3PVNA 4I3PA 2VZQA 4FFIA 3P3PA 4ITCA 5A6XA 2JWPA 3NWKA 3GBFA 3ZDSA 1US3A 3GBGA 4CEWC 4JDOA 3OGSA 2IXHA 2WFF3 2X8KA 1H1IA 3EYPA 1O4YA 3FLRA 3O0VA 4NPMA 5KHJA 3D8CA 3LIHA 2ZMLA 4PQ9A 1S0DA 2B39A 1W2NA 3EJKA 2ZZJA 1AF9A 1W2UA 4Y22B 5CEHA 3WCSA 2FDGA 1B35A 5HV0A 5K9YA 3N9QA 4M3CB 1NCQA 3GJAA 4PI0A 4CP0A 4FPOB 5ANQA 1UY0A 3AYCA 2AACA 2GH2A 1IS5A 2R0HA 1Q8QA 1DQ5A 2Y64A 2VNOA 4CP9A 1BEV1 5JI7A 2W2IA 4A6SA 4CCEA 2DCKA 1Y9QA 3H7JA 3O5SA 4R4ZA 1ZA7A 5FZ0A 2A6YA 3RYKA 3C7FA 5CIRA 3LWCA 1FT9A 1UMZA 3NNJA 3WW2A 3WY6A 2ARAA 4PT6A 4JVAA 5KWRA 2PHRA 1EY2A 3ILFA 5J09A 2WZR2 4CPBA 1FNZA 1VMJA 4OUEA 4QPIC 2JDHA 4PIXA 4UT5A 1O91A 4PDWA 4XFCA 5H9RA 3WQBA 2J1TA 4BU2A 3JQWA 5BNPC 4JKMA 4I3GA 4JGZB 1SCRA 4ORFA 4QB2A 2E26A 5BNOB 4BQXA 2Z4FA 5FZKA 3WDWA 4A6OA 2IXJA 3RZGA 3RWKX 1JOJA 5F2SA 2LW8A 1WA6X 3VBFA 5JPMB 5BNQA 1BZWA 5GZCA 1C8M1 1JU3A 1KITA 1QXPA 1SLTA 2PXJA 2XJTA 3WDVA 3O1SA 4LIUA 4E27A 1RUD3 2VW0A 5A3NA 3QACA 4AGVA 1NOVA 1GOFA 1RUC1 3I7DA 2GSYA 3K3OA 2A3WA 4X8PA 2JXAA 3TNQA 4YG3A 1RYYA 4HKOA 1L3JA 4PQQA 3C7OA 1S0IA 5LEKA 2FDKA 4NPLA 2WWSA 3SCGA 5CA6A 5I0DA 5JOXA 4FSJA 1W8WA 2ENRA 5BUVA 5LCWL 4CU6A 4J1WA 5FMOL 4G4FA 1ULFA 1QXJA 3THTA 4P08A 1AR63 2HWF3 3P6BA 4FVVA 2BOIA 5FREA 5AC92 2NN8A 1OVPA 4FPYA 4HPKA 3USSA 2FMYA 2W5FA 2HWC2 3JD72 3VBRC 1HX6A 1YIFA 1H8TA 4P5YA 5C9AB 5JOWA 3O1PA 3AP4A 5LBEA 1QXRA 2O8QA 5A3OA 3JCIA 1PO22 3WCRA 1JYVA 1Y4WA 1RUF2 2PYTA 4IE4A 1CIWA 4TZDA 1A34A 4ZXKA 1CAVA 4YNIA 2ZXQA 3MW2A 2MEV1 5BNNB 2DU0A 3LSDA 3A21A 3KVBA 4O9GA 1PIV1 1M06G 4D8MA 4S2FA 3WNNA 3DL3A 5L36A 4AGGA 2XGXA 3O0XA 3RI9A 4OHZA 4RGKA 4LO4B 1Q8PA 4S2DA 2ZGMA 1HXS1 4CDUC 5FZEA 4L2NA 4WV8A 2DUQA 3NKTA 5A3UA 3CHXA 4HKWA 3VDCA 2XJPA 2ET1A 1NCRB 3C7EA 2JICA 1XYOA 1JTZX 1IS6A 1U5XA 4HETA 4ISQA 5C3SA 3M3EA 1G7YA 2F6BA 2XOMA 3POWA 3C7GA 1OC1A 4BMBA 3ZSJA 1NZCA 2PAMA 4QD2A 4GB33 1HJGA 1H6YA 3AP9A 3KF5A 2VQTA 3SKVA 2JIJA 3WNOA 2XJQA 3R4UA 2LS6A 3LF7A 4WVMB 3GZUC 2YGLA 4AAPA 1J84A 1RUH1 2O8OA 3UV9A 1X7NA 5FK8A 4GD4A 4Y20B 1ZBE3 2ZX0A 3KQRA 3OYWB 1N3OA 3WW3A 1H1AA 1TME1 1EV11 2I74A 4B4PA 5CFCA 3POBA 1CWPA 3IWZA 4A7YA 2EIEA 1FNYA 3U07A 4K6BA 3CIHA 5FZDA 1C5HA 2VC9A 4YZ3A 4I09A 1W3VA 4YW1A 5H9SA 4BK5A 4P9LA 2WT1A 4LE3A 4CU7A 2WO2A 5M0TA 2ZGQA 3AVSA 5FCCA 3T30A 4IEZA 3QH6A 4R52A 5IVBA 2DFBA 2D43A 3OB8A 3RI8A 4NHXA 4CDQB 3GXUA 1L7QA 4D6RA 4A3XA 2W3JA 5GZFA 3AZWA 4YGDA 1UD1A 4LJHA 3ZSLA 2LROA 2IXLA 2EF6A 1P8JA 2JG8C 4IQPA 4YRDA 3CF6E 5LZ6A 1YWKA 3H8UA 2EAAA 1UYZA 3N7LA 2OX0A 2ZEWA 2JG9A 2ZGUA 3AMQA 3D6EA 1LHWA 3I3BA 4Q4X2 5IW0A 3WUDA 3I2FA 1G9FA 3LA3A 3JQXA 1OA2A 3PU3A 4LBNA 1JYXA 1CJPA 4QX7A 5DUXA 2CTVA 2E7QA 3MW4A 5LA9A 4BPZA 2E32A 2DTWA 1WW7A 3D3AA 4D94A 1VBC3 4Z2WA 1PMJX 1RITA 4XFFA 1RUOA 1AVBA 2FDIA 1VBC2 1C57A 5J96B 4JGYA 3BB6A 4MZUA 3KCXA 2WNVB 4UFMA 1IQAA 2C0ZA 3RPQA 3WG2A 4BHPA 3MV01 2W94A 5JXJA 4ARYA 4MX3A 5T54A 3S5QA 4CDWB 1SPPB 4FT8A 4UF0A 3QLQA 1CPNA 4BA6A 4RA0A 5FRAA 1VBE1 5FZ7A 2ZMKA 3O1UA 1IPKA 2WWJA 5JSRA 4FOQA 1OQDA 2J1VA 2RR13 3SQOA 5IK5A 4FPJA 1E5IA 2Z69A 2D6KA 3DPRA 3ZFGB 5CKNA 1GSLA 1WBFA 4Q4W2 5FV3A 4NOTA 3DKQA 3I3MA 4K8FA 5FTTC 2VQAA 3CJIB 2BVBA 5FPVA 4R9DA 1PO12 2EAKA 4WZCA 1QGLA 4E2SA 1HQWA 1K5MA 1T6BX 1Q8VA 4LHSA 4BLJA 1C28A 3B9IA 4JKLA 4BMEA 5I91A 1UZ0A 5K0UA 1ALYA 1Z78A 3AP7A 4XEZA 2QCSB 3GALA 2BU9A 4P9XA 4OZXA 3HPNA 2HYKA 5DAVA 2SBAA 5CNAA 4FTBA 2VUJA 1X50A 2BDRA 5EQUA 4AEJA 1DF0A 1OLQA 3T0DA 1TNFA 3THDA 3BN6A 2VNVA 1W9YA 1UX6A 4Q26A 1BQPA 3VZOA 4D7SA 3E5UA 3EBRA 4CCOA 1YRZA 3QBQA 1W6QA 1W6PB 5FYZA 1UU6A 1DYOA 3KZ4C 5FYUA 4TTGA 4ZZ8A 3ORJA 3WEZA 2WDBA 3N9PA 2OUJA 5K4LA 3VBUC 5EYXA 4RGGA 5DUWA 4ASLA 2VXJA 4E4HA 2QKDA 2VBDA 2XVGA 3BGAA 4IW3A 1W0NA 4MGSA 4F8AA 1RC6A 1BEV3 3SCHA 1HV1A 1QJU1 4MXWB 4AI2A 1W06A 4DUVA 3ACLA 1SACA 4CRQA 1RUJ1 1UNBA 2I2SA 1Z7S1 1ZRFA 3HR9A 3OGRA 4RS5A 4AFMA 1R1A1 3ZOIA 4META 2OPKA 2P3JA 4XILA 4S2HA 4ES8A 5C5TA 4D7TA 4OI0A 2FQPA 1VRH1 4M4PA 1CQ9A 4GMP1 3AP6A 1AR72 3M3OA 1GOGA 2WNUA 4BE3A 1UOGA 3PLQA 2B5HA 4CU9A 5FYYA 2ZS6B 3NSTA 1CIYA 3WDTA 3ZIWA 4CCJA 1TMF1 4LKSA 4FOVA 3TAYA 1LHOA 2AEYA 1C8M3 1YIPA 2VZUA 2JDZA 4YGCA 4MSVA 3U37A 1ENXA 5F6KA 2QVSB 1AYM1 1RUC3 4SBVA 4DXZA 4AHZA 1IKPA 1VBD1 1WCSA 2XB6C 2H0VA 5KHHA 1LU2A 3W58A 3MV11 1QOTA 1QH7A 1SLAA 2NYYA 3B00A 4Q2FA 3MHZA 3ZIXA 4CP9B 2PHDA 2AGSA 2B4KA 1LHUA 2Q4SA 2VULA 4IGQA 4GXLA 5JIAA 1D0HA 3TBDA 4J6GA 3E5QA 1JYTA 1WCKA 1VPHA 4LBKA 5DUVA 1GBGA 1MQTB 4Q0UA 4EWAA 4ZU7A 1DQ0A 2JDMA 1RGSA 2WQ8A 4OULA 5KR7A 2ZGSA 4FPKA 4KGGA 2EXHA 4PDWB 4XIOA 4HONA 4QXKA 2ZCWA 4R8HA 3MGUA 4K7JA 4XHXA 5F3EA 2ZX4A 2YMZA 2JEMA 3MUZ1 3VZJA 4ATEA 4BH9A 5HV4A 4XFIA 1OUXA 4UAPA 1QNYA 2C26A 2VMEA 4XUTA 4PJYA 3J7HA 2DBIA 1VAKA 2D6NA 2MEV3 5FP8A 3T4HB 5D8AB 1N1VA 1PIV3 2ZGTA 1FOD3 5J98B 2C1FA 3RMYA 1FMD1 2W1SA 4Y22A 1PIV2 2D97A 3MEPA 1ONAA 5HPOA 4ZXEA 4M3CA 1GQGA 1HXS3 5JOZA 1UIKA 1QKQA 4FPHA 1QH6A 4BDVB 3LD8A 4B8EA 1N3PA 2VZOA 5FKCA 4B29A 5LW9A 4AAXA 2X5IB 1T6GC 3N9MA 2CWSA 4HVQA 1UKGA 1QJEA 3PIGA 3ZXJA 4BQ1A 1K42A 2R042 1NLRA 4NJ4A 3ZXKA 1Q8OA 4LKFA 1RHI1 3X29B 2HBUA 4YVSA 3SH4A 1W8OA 2Y6GA 3GCWA 1HRI1 1Z0HA 2RDNA 1RUH3 2VM9A 4N53C 2JDYA 1YFXA 3V0AA 4NHMA 2ORZA 1YQ2A 3U75A 3VB9A 3MIBA 3HMYA 1NA1A 1KQRA 1EV13 4JGZA 1SFPA 1UW8A 5BNOA 4C8DA 2PLV2 1WKYA 4FQ4A 3DV8A 3VL9A 4Q1RA 1TME2 1EV12 3W21A 5FZLA 4E4DX 3M1HA 1J59A 1CAUB 2ZX3A 4H14A 3TEYA 2QQMA 1PGL2 1TE1B 2TNFA 3ZSEA 3RNSA 4AG4A 4Y26A 5JSOA 4LT5A 4HXCA 2XJUA 1AL0G 1BJQA 1GR3A 2XLAA 1UZVA 4P02B 4NRMA 3NL1A 1AR81 3LAGA 1V6MA 1W90A 4AVSA 3DYOA 1JHJA 2WABA 4XC9A 4HVRA 1IHMA 3NMBA 4M0NA 1CESA 3ZR5A 4XQ4A 2DF7A 3HQUA 3ZX7A 2RS31 3AMHA 5IATA 5IVFA 4QX8A 1QWRA 2JDKA 4X6QB 4URAA 2QQJA 2YY1A 3CQOA 4Y5TA 4RD7A 3MF6A 2KXLA 3CEWA 3WDUA 3FUOA 5IK4A 4JDMA 4LHKA 2XQXA 2XVKA 4YW3A 4LKEA 3WHTA 1HN0A 4HOOA 3SXWA 4GWMA 1C1FA 5SV8A 1WCDJ 5CFCB 2A3XA 3WQ7A 1YO8A 2JD9A 5C9AA 3VDBA 4O61A 2DVFA 2J1AA 4LORA 3CKHA 5DN2A 2JKXA 4XCAA 4MOAA 3MFAA 5F3CA 1ZYBA 5IWFA 4I01A 3RS6A 2Y6FA 1PVC1 4I0AA 4TLGA 1WLDA 4MHUA 5F5CA 3VBHA 1PZ7A 1YJLA 2WSUA 5AVPA 4GH4C 3ROUA 4XFBA 5BNNA 1DP0A 4KQ7A 4XVHA 2RDRA 4LUMA 5A7QA 1DQ6A 2JG8B 1N1YA 3UESA 4GA9A 4LHNA 1VBE3 4XUNA 4YVWA 1RUI1 3ZXDA 4HSJA 4CE8A 5J48A 2GP5A 4IEVA 1MEC1 1R091 1DZQA 3LA2A 4YG0A 1VBB1 2RJKA 4NN0A 4MH0E 4LTAA 2B8MA 5FY1A 1NCRA 3O12A 3NJXA 2VMFA 5E6HA 4AEDC 2F17A 2D3RA 1QJY2 1HRV2 1QDOA 2DYCA 2WYFA 5I0UA 2BOJA 1ND3C 3VUOA 1H9PA 1JXNA 1A3KA 4OCTA 1R081 4K8RB 5EZWA 1JZ8A 2C6SA 5JVVA 4JDNA 3PVOA 4N9IA 3M4FA 4HFSA 5F5AA 1JUHA 2ARBA 4WVMA 3BOPA 3OUIA 2W47A 3K4AA 1FV3A 4OHYA 1LRHA 1SLCA 4Y20A 2HEYF 3OYWA 2ZGPA 2WO7A 1YQ5A 1UU5A 2VOWA 4LHLA 5FY7A 3ZXAC 1J3PA 4LK6A 3H1WA 3LFIA 4RN5A 2XLGA 4AI9A 3M3IA 1AUYA 3GM8A 4KWKA 2FHRA 2Y0OA 5DAXA 4EZ4A 1WZXA 2ADDA 1TZOA 5I8YA 1M4WA 2X29A 1COV1 2QQUA 4IV1C 1EAH2 2I07B 1MS8A 3NO8A 2IC1A 1Y9MA 3AMPA 1ZRIA 1D2SA 2DVDA 2F4PA 3I59B 3P1IA 1QF3A 4LIVA 1KFUL 1QJU3 3N9NA 5DG1A 4RR3A 4E4ZA 3WNLA 4QKBA 1RUJ3 5T5PA 2YXSA 3Q8FA 2I45A 1OSGA 3MLJA 3J8F2 5T5OA 2X53S 3ZDVA 1Z7S3 5FZ9A 2CNAA 4WVZA 1R1A3 4IEPA 2J1SA 3J7MA 3U1XA 2VO5A 5C5UA 3K4DA 1VRH3 2EVXA 2R16A 4COWA 5CAZA 4GMP3 4Z2AA 1O3QA 2K46A 3NJYA 1PGSA 2ATFA 3QOPA 1DZRA 1OURA 1RUE1 3J7LA 1UXZA 1VRBA 3GCXA 2BV4A 4IUGA 1KEXA 2XBO2 4QDRA 3AXDA 3VBUB 1TMF3 1UOJA 3TEZA 2PAEA 1W8TA 1YFUA 1VR3A 2Q1MA 4LBOA 4B7KA 4LE4A 1W6QB 4EN8B 2MNGA 3M2MA 5SV5A 2QQLA 2WNVA 1UO9A 3VDDB 4CXWA 5L19A 1ULGA 2WLPA 1W2TA 3A0NA 1UX7A 1AYM3 2KM2A 3MIFA 5F5IA 5DQ0A 1SPPA 2D3SA 4BZ4A 4CDWA 1VBD3 5LATA 2WUHA 5IHRA 1XXNA 4BQ2A 1H6XA 3TOJA 3LDBA 3NJVA 3GZTB 5FMBA 3JB4C 4I02A 3T0BA 1ZNPA 1S2EA 5L7OB 2D40A 4MADA 2C9KA 1C8NA 3ZFGA 4CCCA 2DTYA 2HWD1 3CJXA 4XJ9A 1AJOA 1RMU1 4XDQA 5LK7B 1NG0A 2P3IA 3CJIA 4LUKA 4QKDA 4FBFA 3H8OA 1PNFA 3RVHA 2HWB2 3WP3A 2FBEA 4NIAA 3POYA 1OFNA 3GDBA 3LZZA 3D0JA 4Q0VA 3JUUA 4M4RA 2P37A 4LBMA 3WD5A 4I2OA 5I93A 1O3TA 1DZTA 2WNUB 2ZGOA 2R1DA 2VZRA 3ZLIA 2XWJB 3DYPA 4TWTA 4N7IA 4EN9B 2DVBA 1TNRA 5B2GB 3R05A 3FX3A 4LO5B 2WN2A 3OEBA 1X33A 2Y6KA 4LULA 3KSCA 1GV9A 2V4VA 3I2OA 2TBVA 3OG2A 2A6WA 3LEGA 4QHZA 3RJRA 4QXHA 5G04L 1G9BA 3BTYA 2RM21 1FMD3 2V4AA 4AGRA 4C0BA 3WW4A 2YROA 3AVRA 4QPWA 4V1PA 4Q5OA 3WQ0A 2ZKLA 3AFKA 3B02A 3KF3A 5A3PA 1ZZ6A 2R49A 3GGLA 1NT0A 1XNDA 2WL1A 2XVLA 2MPFA 3ZPYA 5GLZA 1ASJ2 1W8NA 2JDNA 1D4M2 1SDWA 2QQVA 1AL22 3KT4A 4DIQA 4XUOA 4QQHA 2CDPA 1LEMA 3OTFA 1UY2A 5A32A 3IAPA 1GYKA 3IBMA 4FXKB 1RHI3 4XBNA 1OH4A 1XOYA 2W9XA 2JE7A 5EPAA 2CAVA 3ZFEC 3FFZA 1AX1A 2W0XA 4CDXC 5FMCA 3I8TA 5F1RA 1HB3A 1HRI3 4JC1A 1WA4A 3A7QA 5JR7B 3VZLA 1H9WA 1HRI2 5DZGA 3W9AA 1V6IA 2W46A 3I2DA 3S0MA 4K20A 2A6XA 4LA2A 5DUUA 3THCA 5C70A 4NR1A 4Y33A 1D0GA 3HEIA 3VD9A 4LXLA 3F95A 3NV4A 4XF9A 3AP5A 2WFF2 2XH6A 2GDFA 2HLEA 4AXOA 5ABJC 5DZEA 2CAUA 2QUOA 2RDQA 3CU7A 3D82A 4NIGA 4A7ZA 1A8DA 2K9ZA 3LEKA 2XWBB 1AR83 4LK7A 1CZTA 5CB7A 1HB2A 1JOBA 4UFJA 3OUJA 2BNMA 1CONA 3KGZA 1HN1A 2PN5A 3LCPA 5H9QA 5T50A 4H55A 4N53B 4E9KA 2J1EA 2EXIA 4CUCA 1FV2A 2VW2A 5FPUA 2RS33 5T5LA 3SH5A 5JUVA 3GBWA 4IE6A 3T2QA 4KBBA 2RS32 4YGEA 4YVSB 1MQTA 1QJZA 1QJFA 4AVCA 2ZKNA 4WBBA 4YZ2A 4COYA 3O14A 2ZGKA 4M00A 2DCJA 2ES3A 5FP7A 1G9AA 5FBZA 2YDEA 3I2HA 4XF0A 3V0AB 1W9FA 2RMU1 3M70A 4YLZA 1NA1B 1GP4A 1JUIA 2W92A 3D5OA 4XDPA 1KJLA 1BYHA 3RZJA 1PMHX 3TEXA 3CL1A 2AZ5A 3MF9A 3ZKYA 4P00B 1B35C 1KDMA 3ZMOA 5FZGA 3BU0A 3C7HA 3DF0A 4KI5M 5E16A 1LESA 1PVC3 3SITA 4EN6B 5HXMA 5LWBA 3VLBB 1AYN1 1YQ6A 2AENA 1OD3A 4QQ2A 1O7FA 5KC6A 5D8AA 1K3IA 1PGW1 2RS53 3NNFA 3HD8B 5FPBA 4WVWA 4X8NA 3WHUA 1DQ2A 1RUD2 2UY8A 4WM7C 5FY5A 1LTEA 3VKLA 4XZUG 2ZBJA 5JSPA 1RUI3 5D1IA 1NQJA 1O8PA 2HWE1 2IXCA 4R9BA 3HNYM 1BLZA 1MEC3 1R093 1EPWA 1W8HA 4UWDA 4XF4A 4QM8A 2P3YA 1VBB3 3HQRA 4IV3C 4CP1A 5FIXA 5JMCA 4XAAA 2X5IA 5FYTA 2D6LX 3PVEA 3UETA 4FAHA 1JW6A 4ISRA 3V0BB 2VVFA 3KHBA 1FPN1 5GLWA 3MUY1 2ID4A 2RE9A 5C3OA 3FZ3A 3FFQA 4AOCA 4P9WA 2HWF2 4FPCA 2Q8CA 4ES9A 4F7ZA 1R083 1AR62 1ZZBA 4KBZA 2P4EA 2P6HA 2LUWA 4GWNA 4UOJA 2ZX2A 5LBFA 3U10A 4A2UA 1GNYA 1OLME 4FPFA 1IOAA 4P14A 5FLIA 3VBFC 5LB6A 5CBLA 1G6NA 3PUSA 4UW6A 1SFNA 1UIJA 2VD7A 4LBQA 4LR4A 3WSOA 5CVRA 2R1BA 4INDA 3ECQA 4BM8A 1H0BA 1SBEA 4EYUA 1G9CA 1LB2A 4CDUA 1GOHA 5FZ4A 3VBHB 2BW8A 4CEYB 4Z92B 4QB1A 2BGCA 1NY71 1JMUB 2XQRA 4E4SA 2ZHNA 1CAUA 1FOD1 1GICA 2BERA 2Q0AA 3W5MA 4QM9A 2EIDA 1YCIA 4YZ5A 4LMFA 5FZBA 1ND2B 2CU5A 4YVWB 5F3IA 1COV3 4NAOA 3GNEA 1CVNA 1PM4A 4KG0A 2FCTA 1JZ6A 1COV2 4RQPB 1DDLA 4QDSA 3WNKA 3VBSB 1PMIA 3ETPA 1KS5A 4DZGA 2OT7A 1LOAA 1GP5A 2OUHA 2WO3A 3OGJA 4MGYE 3LOBA 3LGRA 4LOSA 1Y9GA 3NAPC 4Y24A 2WA4A 1UU4A 1JZ5A 3K75B 2J1RA 1D2QA 3FC0A 4KH9A 1A8MA 1WBLA 5JWPA 1H8TC 3PMEA 2EXJA 2WZEA 1UL9A 4QPGC 2Z5WA 5A6ZA 3I3DA 1Q5OA 4GB32 1YLLA 3VBOB 3ILRA 3IDBB 5FO7B 4EQVA 4XYXA 1YC61 1XBFA 4A41A 2G1MA 4FTEA 5FQ0B 2V73A 1LR5A 1XPWA 5CU1A 1RUE3 1WLTA 4XQWA 4FPEA 4KL1A 3FE5A 1EPZA 4BIOA 4O9EA 1ZBE2 3KV5A 4PLNA 1NLQA 4RL7A 2MHFA 4A44A 2YG0A 4CCDA 4QX2A 1K12A 4XBLA 3FBYA 4AVTA 1XNTA 2R061 2WLQA 4HKLA 2P1BA 2ZACA 2VQ0A 3C2UA 4HK9A 2G4IA 1BMV2 2P2KA 4XF3A 4F83A 3BPZA 2JG8A 3VV1A 5A1LA 1BCXA 3T2PA 5CFDB 1OT5A 5BV6A 1MS5A 1IGOA 2VBPA 4RR3B 4DFSA 1LECA 2HWD3 1HJFA 2IVIB 2PHFA 2UYAA 1W0OA 3BODA 1RMU3 4GZ9A 5GLVA 5GM0A 1XE0A 4D69A 3AZVA 2HWD2 4MHRA 3ZYPA 5T5JA 4EZHA 3HAGA 2WS91 2IXKA 5C8CB 2A70A 1MPXA 4NWVA 3IIIA 4N43B 3U11A 4UFIA 1W99A 2UU8A 3I3EA 2BPA2 2PELA 4FFGA 2VMDA 4OFGA 4Y1YA 3ZVXA 2VU9A 3WX5A 2WC2A 2WT2A 4CU8A 1LGBA 3GHMA 3J7NA 4H7MA 1JZ2A 4QGLA 4XJAA 3B69A 3K77A 3PDQA 2P17A 1ULOA 2DFCA 2NM1A 3UKNA 4BWOA 1ZZ8A 2PQSA 2OPWA 2YUEA 4LA3A 3NW4A 4BIFA 5JLVA 2VBBA 3AB0A 1XU1A 1SFYA 2GNMA 1PVXA 1BBT1 4K3UA 2E7TA 3UGFA 4HN0A 2L9LA 3NV3A 5GZGA 2GU9A 4YM3A 2BEOA 1JH5A 1L7RA 1LU1A 2RM23 4IESA 5C4WC 4OQ8A 1XB9A 2BZDA 5HXVA 1GWLA 1S0FA 4LBLA 5FYSA 4CTEA 1XYNA 3KCYA 1PK6C 2JDPA 3E5XA 2NZ9A 3CZJA 5FYMA 3UJQA 3P3NA 4P9JA 2GNTA 4S2GA 2RR12 4LEJA 1REDA 5J7MA 4IEQA 4Z82A 3I59A 3VD4A 2JG9C 1ENQA 2JB8A 4W8JA 3WXPA 4NIDA 2Q8OA 4AFDA 5LBBA 4FOYA 1HKDA 4CZSA 1JZ4A 4BK4A 4COUA 3HIFA 3S7IA 1KGYA 4AQSA 3PL0A 3WW1A 1V6LA 3BCWA 1XNKA 2FDJA 5GZDA 5CZKA 4ZHNA 3A4UA 2CHHA 2VUAA 2QE3A 4JGYC 2EIBA 3SMHA 4YW4A 3LA7A 1O6UA 4YM0A 1DBNA 4HG6B 4QWNA 4RFRB 2NP0A 1WLWA 3FLPA 3KT7A 3ZSKA 1UZZA 5FXVA 3VBUA 4DB5A 4MO3M 4ET7A 1POQA 4WM8C 1K5JA 4YW7A 4L97A 1X8EA 2OZJA 2WKKA 3MIEA 4XUQA 1ZREA 2XXZA 4MV2A 2D7FA 3I97A 3OBRA 1UWWA 2Y6HA 3VDDA 5JZGC 2GN3A 1JYIA 4ZONA 1AXYA 2RV9A 4PBOA 2VZTA 2VUCA 3ES1A 2WAOA 2XG3A 4Q27A 1ZZCA 3I2KA 4CDXB 1US2A 1RJ7A 1RTVA 3H0OA 4NPRA 1PHMA 2P5BA 2UY9A 2Z42A 3B5LB 3LOIA 5EHDA 4C91A 5L7OA 1OH3A 3ZPOA 4QT6A 3S7EA 1BEV2 3BI3A 4XJUA 5K0UC 5LRRA 5A32B 5EJ3A 3T08A 3FHIB 5F6LB 4CEWB 4YSFA 4NAMA 5L9RA 4MLOA 1MZFA 1F31A 3MBWA 3B9CA 3FJSA 4CP2A 2BRTA 5JDBA 5CKMA 2Q30A 1FATA 2VZVA 4XCBA 2WAAA 4UI9L 2RMU3 1OQ1A 4C1XA 4HANA 1AR91 4N90A 5F37A 2Y0IA 1MS0A 3EB7A 5IUQA 1D4VB 1ULDA 2IWGB 3VHRA 2OXBA 4FQZA 3ZFFC 2Y60A 5IFTA 5LRSA 4Z8BA 4AVVA 2VOXA 2Y26A 1REEA 5FP3A 1N3QA 4YGBA 5DABA 2DBNA 3JZVA 1GQPA 2P34A 4F3JA 2QQIA 2VNGA 2VZ1A 4CXXA 1AYN3 3PTRB 4R4XA 5IJRA 4DY5A 1C8M2 3NV1A 1QMJA 2EICA 4XAEA 3O1MA 4B3NA 2J7MA 1PGW2 2Y6LA 1RUC2 3AZYA 4A42A 3F2ZA 2HWE3 4CSWA 4HK8A 2NPIA 2VMHA 4L92A 4QPIB 4MG2A 1DYKA 2ZABA 4PLOA 2BNOA 2DV9A 4ZZ5A 4TXWA 3HT2A 5IVYA 3RSJA 2VL4A 4EJRA 3R4SA 3M7AA 5ANNA 5F8PA 5BNPB 5CG9A 5J36A 4XMIA 2GNDA 2HH9A 2W68A 3E6BA 1FPN3 3H42B 4GAZA 1W28A 1GMMA 2R071 3I2GA 3AZXA 2XJSA 2XLFA 3VZKA 5I0TA 5JOYA 4BQ3A 2H6CA 2A6VA 1ZRDA 4UXAA 2IUWA 1MVQA 5H9PA 3AL6A 4BLIA 2X05A 4QX5A 2DUPA 1O3SA 3FBMA 4OHWA 3V65A 1OFSA 1WGPA 3NKGA 4WM7B 1MR5A 2GC3A 2FDHA 3KV4A 3ES4A 4UYBA 4OI2A 3DN7A 1IQDC 5T3NA 3NRUA 5FYHA 5G05L 3T2OA 3KHCA 1V9U1 1XQNA 4QB6A 4QX0A 1UXXX 1PZ8A 1WCQA 1G8WA 4P9IA 1NY72 2MEV2 1NE4A 3KV6A 5LA1A 3MIGA 1FOD2 4MXVA 2D6PA 4I30A 4DQAA 4Q8KA 2CSGA 3BIWE 3KD4A 5A1FA 3DEMA 3VBRB 1HXS2 3SISA 2AC1A 2G9FA 2C24A 1QDCA 1JHNA 2WA3A 3EMRA 3WF1A 4M01A 4LKDA 4HMZA 2V5DA 1TQ5A 3RQ0A 2Y38A 1I1EA 4C1WA 4N53A 1RUNA 3U14A 3IDCB 5T52A 4LITA 3ST7A 4UBGA 3KM5A 4CCKA 2ZOEB 4IE7A 1VB2A 4XQDA 3MO4A 3HBKA 4UFKA 1J3RA 1PZ9A 1KS4A 1IKQA 4ASKA 1LOGA 3BPSA 2V09A 4H7LA 2WNOA 2ILMA 2VTFA 4LBQB 4OHXA 4LNVA 2GH8A 2O0OA 3WT3A 3ASIA 3TRSB 1RUH2 1W39A 4AK3A 2WSVA 3T1LA 2W91A 2Y34A 4CDUB 5E88A 3U4XA 2DUOA 1U5ZA 3QH7A 4NHLA 3JU9A 4CVUA 3WUCA 1LOFA 2CL2A 3ZYGA 2V5YA 3JBG1 4SLIA 2R063 4Q0PA 4XMAA 1RUG1 1JU4A 2WIIB 1RB8G 2XJVA 3LFMA 1BXHA 4QPGB 1W03A 2OVUA 2V72A 4PIZA 4ASMB 5GLTA 3T09A 4E2GA 3AKQA 5FYCA 3RZKA 4ATFA 3TYJA 2ZEXA 3OGVA 1VMFA 4BQ5A 2J1UA 2KA3A 4FP2A 2VVEA 1J3QA 3I54A 1ULEA 2WS93 4DXTA 4XABA 3V0BA 1F4AA 3OY8B 2PHTA 3BTAA 5I0RA 1I6XA 2PMWB 2A3YA 2FCUA 3IM0A 4EN7B 4AHXA 2ZHMA 1GANA 3B3QE 4MVTA 3U78A 5BNOC 1UYYA 4KWLA 4TYSA 5FZHA 1OMIA 4LQRA 1F9KA 1OPMA 3IMMA 4GH4A 4YZ1A 1UAIA 1PX3A 1DGLA 4FPGA 4QX3A 2VZ3A 3SHRA 5L9BA 2WQ4A 1LGNA 3NQHA 1LOCA 3GZEA 1W2OA 3E1F1 2C4XA 4QPYA 4BQYA 1FAYA 1QNWA 3PMSA 4COVA 1UPIA 1BBT3 1WMFA 3ABZA 1VAVA 2WZR1 4KU7A 4CEYA 3T3YA 1ODMA 1EP0A 2RS51 1YNAA 5EP9A 5J1XA 4H3WA 4Y1XA 5CYYA 1H2NA 4Q0QA 4OUMA 4AEDA 1ND2A 3AL5A 2A6ZA 1DG6A 3GYDA 4RHV3 2VUDA 3VHPA 1VBE2 3N7KA 4AQ6A 4RQPA 5FOBB 5DPNA 2D3PA 3VBSA 4PCRA 4CUBA 4MGTA 2YZ4A 1B09A 1SDDB 2R7EB 2VAUA 4AYUA 3GHNA 4QAWA 2BVVA 1QHDA 1HW5A 1WMXA 3IMNA 3POEA 3WG3A 2CGPA 3PUHA 3A0KA 5C9AC 1NX9A 2GC0A 1WW5A 4RYDA 1J1TA 3N7JA 1LULA 3TN91 3VBOA 3Q8EA 4ZPIA 4GWJA 5F9TA 1UZWA 3USUA 5FQ0A 2QQPA 3AJZA 1OVSA 3AMMA 3GJBA 2YBKA 2YFUA 5FZ1A 5BNNC 4I0WB 1OA3A 1OLMA 1VB4A 3MDPA 3R0RA 5HCBA 1AZDA 1CAWA 4QDQA 3SNMA 5AC91 2QZ2A 2A5ZA 2VGDA 4QQOA 5FXXA 2JJ6A 3HWJA 1GZ9A 2HWC1 4HN1A 4L99A 1ZM1A 4UFHA 1DYPA 1JODA 1QJX1 1SBDA 2BWAA 4JQTA 4A4AA 2WQZC 1EUUA 3ACIA 3H3UA 4NUBA 5B4XA 1UY4A 1I5ZA 1XSQA 4XOGA 1PO21 2GN7A 3LE0A 1RUF1 1UY3A 5CFDA 3ZXFA 4QQLA 1V6JA 1WMDA 1DHKB 1VBA1 2LM3A 2OIIA 1QOSA 1QJU2 1G86A 4KWJA 4L8QA 4OLLA 5KBFA 4EWEA 2DCTA 2ZPXA 1POV1 1RUJ2 5FY4A 1F15A 1DGWX 3OF1A 3M3CA 3L9JT 5FR3A 1X8MA 4Q29A 2AEZA 5GALA 5C8CA 5EIYB 5JI9A 1Z7S2 1CD3G 1GP6A 5JAXA 3RYPA 1DCSA 1R1A2 4N43A 2XUMA 1RVF1 4BCUA 1VRH2 2VCBA 2ARXA 1AR93 1SQ4A 1VLNA 3N36A 4IGOA 4NE9A 4AZZA 4ARXA 5E89A 3OCPA 3B7MA 1A6CA 1C1LA 3EXUA 4O7XA 3IKWA 1ZBA1 3NNMA 4IDZA 2RJLA 2KD7A 1H1MA 1HB1A 1TMF2 5A3WA 3WINE 5FO9B 4QMAA 1W8FA 2YPJA 4OQ9A 3VKOA 4GKXA 5A3TA 3BTZA 3FN9A 1I9RA 5F3GA 4FO9A 1SLBA 3H1YA 4A7KA 3CO2A 3UNPA 5FZ3A 3IN9A 4LOTA 3VD7A 4CDQC 4O65A 1KDKA 5FMDA 1AYM2 3WP6A 1OOPC 1W8UA 2W08A 1MZ5A 1VBD2 3J26N 1BVP1 1L7LA 3H3ZA 3WVJA 1GNHA 2HKXA 2RJ2A 1BK1A 2IFWA 5K7PA 1JYNA 3W20A 2PA7A 2DU1A 4UW4A 5A3LA 3L2HA 4D3WA 3AYDA 1GQHA 5JXHA 5L9VA 1LGCA 4XACA 4G9SB 3LEMA 4JHTA 4Z1VA 2R073 1UKRA 2GC1A 4ONUA 4PI2A 3UK9A 2ZX1A 1ACCA 4IGPA 5A7SA 3MICA 2R072 3VZNA 2BGOA 4B4RA 2PTMA 1O8SA 3H9AA 1Q43A 4KU8A 1UOBA 3POGA 4E8DA 4DY3A 1JS9A 2AYHA 5DAWA 3MPBA 3BOWA 3E97A 4BB3A 5A6YA 3H7YA 2WNVC 4DRRA 1KFXL 3GZAA 1LAJA 4MYEA 5C6CA 3KLSA 1SG3A 1PM7A 1W04A 2XJRA 3B94A 2XL9A 4N7UA 1DU3D 4U2AA 5A80A 1V9U3 2VPVA 2ORXA 5CADA 1WD4A 3FHQA 4Q4X1 4BXFA 3CZUA 1VP6A 5JPNB 2VMGA 2Z79A 3MLLA 2VJXA 2RVAA 2HEVF 5A7OA 1FMD2 1CX4A 3IZOA 2BNNA 1OLRA 4FTSA 3POSA 2ET7A 2YYOA 1OXCA 2QQWA 2VXRA 4CDXA 3CMGA 3ZFEA 3AKTA 5FZMA 3POJA 4OUSA 1NLSA 2BJSA 3AYAA 1H4HA 4AF9A 1JN2P 5A33A 2W1WA 3WG1A 5C33A 5CG8A 3SH3A 3LPGA 2LTNA 5DDJ1 5E8AA 5GJ6A 1YI9A 4CEWA 1HV0A 1SCSA 1QY4A 1ULCA 5F7UA 5HI0A 3K3NA 4Q8LA 1RHI2 1ZRRA 3JXSA 3OOXA 3Q8BA 4QX1A 1AXZA 3KMHA 5T55A 2E63A 3UGHA 3ZYFA 2YGMA 3VKMA 1ST8A 4D6SA 3ACFA 2UWBA 4Q4W1 3MYXA 5IK7A 4Q4V1 3K4ZA 2XUEA 5KXCA 4MUVA 3SLIA 2JD4A 4ZS2A 1PO11 3ZR6A 3OBTA 4K1YA 5C3QA 3FWEA 4IEWA 2B45X 4JQRA 3W59A 1OI6A 3ZM8A 1F5FA 3ATGA 3U0ZA 3O1VA 1N1TA 3JBG3 3ELNA 5DAQA 5AVAA 3OPZA 2BFUS 1RUG3 3JBG2 3CLPA 2Y8KA 5FKBA 2W1QA 3RGBA 4IL7A 3ZN6B 1GWKA 1URXA 5F2WA 4AHYA 2Q8EA 2ZEZA 3FMGA 3BYWA 3MI8A 4P5HA 3IPVB 5FPLA 5FYVA 4ZU5A 2BBVA 1AR82 3FLTA 1T2XA 1CAXB 3WLUA 4QPIA 3OJBA 1V70A 2DVGA 4EWDA 3TWIA 1I5PA 3PUQA 5BNPA 1V6OA 4YARA 1UPSA 1H2LA 3THPA 4L0PA 3WF3A 1S0GA 4HBNA 1SLLA 2D44A 4NHKA 1H4GA 1YHFA 4NWWA 4Y4RA 2CDOA 2XR4A 3HNMA 4XHBA 3MIHA 1AJKA 4LBQD 4KMQA 1OD5A 2WR9A 4XJWA 4L11A 3UL2A 3WDYA 4RFT0 4QGMA 3EHKA 4IETA 4WM7A 1H2MA 2ERFA 3ENRA 2FZ1A 1N1SA 2BP6A 4HT1T 1GNZA 1DFQA 1JI6A 1NCQC 1YI7A 1S55A 5EYYA 4CYDA 3ZKUA 1NZIA 4A3ZA 3LQCA 4DXSA 2E7AA 2WZR3 3BIEA 4RSUA 2OS2A 1PVC2 1F2NA 3HBZA 4IV3A 2D5HA 3RZMA 1IG3A 5K8SA 1AR71 5FZCA 3E6DA 2RS52 2LALA 4XIKA 1F5JA 2A1XA 3S6PA 2O14A 3VDAA 1V6NA 4XDOA 4DINB 1RUI2 2JECA 2B7YA 4PHZA 5GZEA 3VBRA 1GUIA 1GZWB 2ZGLA 1MQTC 1MEC2 1R092 4CCMA 3T0AA 4FP3A 1LOEA 1VBB2 1REFA 2XKPA 1UN1A 3D4KA 4LLOA 5FXWA 4AE2A 3PTYA 2W1UA 1SHWB 4PDWC 2Y33A 2ZHKA 4JAAA 5L73A 1JBCA 2QTWB 5A7WA 2VCCA 1UY1A 3KWVA 3WNXA 1CPMA 1R082 3TNPB 4GH4B 5IFPA 3TN93 3WOGA 2VY0A 1X82A 2AUYA 4MGZE 5C3RA 1CZVA 3TN92 2OKXA 4FI9A 2SLIA 1VALA 3VKNA 1MZ6A 5D8AC 3SC7X 2XDVA 3HOBA 1STMA 2GMPA 1Q8SA 1YEWA 4W65A 1W6MB 2ARCA 3QD6A 4EROA 5AC93 1LOBA 1HDKA 1MVEA 2HWC3 3JD73 1S0CA 5FZIA 3WNMA 4BQ4A 1ZA4A 2D6MA 3DGTA 4GJYA 4AEDB 3NAPA 2ZA9A 3J9SA 1QJX3 2VG9A 3CNAA 5GKAC 5LA2A 1ND3B 3LEIA 4XF1A 5JIUA 3PNAA 3OPTA 1O5UA 5IVEA 1QJX2 5LEJA 2X5IC 1OUSA 1PO23 4Y3OA 4QPGA 2VZPA 2K0GA 2YHJA 3ACHA 3DYMA 1U5IA 5FYIA 1RL3A 1RUF3 2W52A 2FDFA 3O0WA 4OVEA 1XSRA 1W6OB 4HSLA 2FCVA 1VBA3 1LEDA 1LNSA 2G9GA 2N7GA 2YC0A 4LO8A 1X9TA 4FFHA 2E9QA 3UKVA 1CGPA 1VBA2 2A7AA 3HN1A 5FXZA 1POV3 2PHXA 2ZMNA 3B93A 4W50A 4DS0A 2XMLA 4NIIA 3OY8A 2BFUL 3RFRA 1WD3A 4OMDA 4NHYA 3R6SA 1OHFA 1RVF3 1S1AA 2WRAA 3USUB 1RVF2 4XFAA 1IZ3A 2VCAA 4GJZA 4IV1B 1NXD1 1OKOA 5FZFA 1ZRCA 1DQ1A 4NROA 3H3LA 1ZBA3 1RUE2 1CAWB 4OHVA 3VN4A 2R041 5KXEA 4Y5Z0 4ZKTB 3N9OA 3T4VA 1ZBA2 5FBJA 2GMEA 3C8XA 3NVCA 1ZZ7A 4LBJA 5A70A 1QU0A 1WW4A 5LK5A 4BXSV 5FZOB 5FZ8A 2OQ7A 1W3XA 1UQXA 2WT0A 2QQNA 5FUNA 3TB0A 2C9AA 4A45A 1XU2A 2KR2A 3NJZA 4DNYA 4JTNA 4NRPA 4XTMA 3MPPG 4LLFA 1LENA 2A71A 4PIYA 4AQ2A 3H1MA 2PLV1 1VIWB 2NLRA 1UCXA 4UW3A 5F39A 4GIQA 2WWUA 5ISLA 3WF4A 3I49A 1PGL1 2DWRA 4XXAA 5IK8A 1S2BA 1RMU2 3HNBM 5J37A 1AHSA 1KRIA 3PHMA 1LHVA 4FAGA 3M3QA 4CUGA 5CFCC 2D93A 1BVVA 1V0AA 3APBA 1OA4A 3ILNA 3TEWA 3Q9OA 4OYUA 5A7PA 2FZ2A 3S5AA 2B9VA 3OD4A 3AM2A 5C4WA 5JR2A 3WNPA 1RINA 2RS11 2VW1A 4DEVA 5IVCA 2ETEA 1OOPB 5J3UA 2HEWF 2BBAA 1PK6A 3ON7A 3BALA 5AFEA 2TEPA 4XE9A 4EV0A 2QQKA 1NE6A 2IVJA 2AR6A 4Q4X3 3WR0A 4Y1VA 1XJAA 3PIJA 4URTA 3K2OA 2YPDA 4KWUA 5FUIA 4MGQA 3UGGA 3ZN4A 2NMOA 2YC2A 2EXKA 5APAA 1MACA 2RM22 4YWAA 3ZYJB 4RHV1 1W9SA 4NVPA 2VTXA 1XNBA 4AHWA 3DCQA 4BOWA 4Y1UA 1SZBA 2QDRA 1WWYA 3WG4A 5HBAA 3G7DA 1X36A 4BISA 2YBPA 2Y6JA 2XONA 2GMMA 2GNBA 4D7YA 1Y3TA 3I4IA 5DDJ3 2DCZA 3RJ2X 1POV0 2JIGA 3NNGA 3UJOA 5JCTA 5DAPA 2B42B 5DDJ2 5BYNA 1XYPA 4WM8A 5GLUA 3VD3A 2E31A 3HJRA 4PBPA 1E5RA 1NKGA 4Q4W3 3KT1A 1W6NB 1F4HA 2XHKA 4AI1A 2Q1ZB 4Q4V3 4AWDA 3RYRA 1UF2C 1MZEA 5FP4A 4JV4A 5A6QA 5JZGA 4DUWA 2UURA 1XE7A 5EV7A 3K51A 4Q4V2 1PO13 1QJY1 1HRV1 3ITQA 1LJ7A 2E33A 3N35A 3VHOA 1GKBA 1H2KA 1H30A 5F32A 5IT6A 2BUKA 2PHUA 2FD8A 3HN3A 2GC2A 3WP5A 1ZVFA 1ZZ9A 2DCYA 1NAEA 3DPRC 4K1ZA 4QGNA 4B1LA 5I8TA 3CDZB 4K21A 1LCLA 4W6YA 2WYSA 4K40A 5IAVA 2OW4A 1OQEA 4YW6A 1ENSA 3WQ1A 1NUKA 1OF4A 3ZFEB 4J25A 2ZJCA 1K5MC 3PJQA 3LDRA 2ZAAA 5A33B 4JX0A 3T2TA 2H0BA 1HB4A 3W5NA 4AR2A 4PLMA 2ZZQA 4KG8A 3KQ4B 4YYOA 4Y5SA 2RG4A 2TUNA 1XRUA 3LDKA 4FXGB 1ZX5A 4CCLA 3ZFFA 4JKKA 1BHGA 1UMIA 2GAUA 3K46A 4Q4Y1 3SKJE 5FJHA 2XPJA 1W0PA 1HIXA 4ZS3A 2QJVA 5KXBA 1EAH1 3EQEA 3N9LA 1S2KA 2VOKA 3MLKA 1JYCA 5FY0A 2VCMA 2EA7A 5ABJB 2VZSA 1GLHA 2C5DA 2RMU2 5LASA 4M3CF 1S0BA 5FOJB 1CZSA 1YQ8A 2QQOA 4OI1A 5B4NA 4HZFA 4JZRA 3VDDC 4GKYA 3LB9A 3J8F1 4BQWA 2VH9A 2EIGA 2FMDA 5FDBA 2B46X 2CWMA 1W05A 1XC6A 3HQXA 4XBQA 1JYWA 1AYN2 1AR73 3I2JA 5L7OC 4TSVA 1IPJA 3DUIA 4V2VA 4XETA 4UFLA 3ZO0B 4RGAA 4YZ4A 4AEKA 5DMYA 5JXIA 3VL8A 2QFEA 2XBO1 2HJIA 2HWE2 4LO7A 4YPJA 1YJKA 4AEMA 5A7NA 1SMVA 4RS5C 1D7PM 1OPOA 3UT0A 2YB7A 3VKFC 3S30A 3S57A 3ZYIB 4TN7A 2WZPP 1HLCA 3A23A 4AW7A 1B35B 3BTXA 4JRAA 3ZYBA 2WNUC 3J4UH 1FPN2 1NCQB 2Q5TA 4AQTA 2A75A 1QIQA 1CJDA 4P9YA 5EJZB 3L2YA 4ZU4A 3KB5A 4CCNA 1V00A 5EFUA 5C7GA 5CISA 4EN0A 1UMHA 1GZTA 2OQ6A 1CX1A 1YQCA 2D5FA 3OUHA 3KS7A 1ODNA 1VMHA 4XUPA 4XTPA 2RDSA 4EE2A 4XZPA 5FZ6A 1YYNA 2QZ3A 5CKQA 3VGIA 2QDNA 2HWB1 3I2IA 4IV3B 3LIGA 4JRLA 4NRQA 1TVGA 3KV9A 1UOFA 4OI4A 3IDAA 2ZHLA 3MIDA 3A22A 3EO6A 4K9SA 2LRPA 1A78A 1C3HA 1GFF2 2JB4A 3M8LA 3RG0A 4PF5A 3WV6A 3UKTA 3WDXA 2Q1FA 3ZN6A 4IEOA 3N4MA 3VZMA 1ULPA 5FY9A 1QOOA 4YW2A 1DGWA 3IPVA 3URFA 3DKWA 1QQP1 5FWJA 2PQQA 1S0EA 5LBCA 1CAXA 3VBFB 2DURA 5TSWA 3H8RA 2VECA 3QCWA 4DUXA 4FPLA 3RZLA 5C3PA 5EJ1B 1C5IA 4KGQA 5BXXA 1YUDA 2QBXA 1DGRA 1DQ4A 3KVAA 5A7WB 2A73B 5EXOA 5FLJA 3PU8A 2JENA 2WINB 3POIA 1H8VA 2DDUA 5FAXA 1U0AA 2H6BA 5FPXA 3POFA 1K45A 3WZ1A 2YFZA 2BQPA 3KGLA 4PF1A 3U4SA 2R0FA 1ASJ1 1D4M1 5ACA1 3BUCA 1AL21 2GZWA 3MFCA 2R043 3OGGA 3ZMNA 3OBZA 4FOWA 2AREA 2YC4A 1E5HA 3BU7A 4IE0A 5BPXA 3DXUA 4HPKB 4AI0A 1TG7A 3NAPB 4MGKE 4BJ0A 2CYFA 1DLLA 3AJYA 3BVCA 4Q1PA 2R062 1HQNA 1H8TB 2AH2A 1VAMA 2XL7A 4V2WA 1QEXA 4YFWA 3WP4A 4C0HA 4COZA 2CGOA 3RRDA 1FYUA 4B1MA 3FUQA 1RXFA 2PLV3 1IG0A 1TME3 2J42A 4CA9A 1GZWA 1YFYA 1CAVB 4YVSC 1Q3EA 3AXEA 3KCCA 2WFF1 4OMCA 3AC0A 3UYJA 5IAXA 1FI2A 5IYYA 3NV2A 1NYWA 1CR7A 2VTXJ 4GALA 4QHBA 3DECA 5KHGA 1X9PA 1W8ZA 2WS92 4IERA 1NA1C 4Z07A 3MZHA 4JGZC 5LA0A 3AFGA 4GWIA 3AYEA 5E1RA 2YBSA 4Y4YA 5FPZA 3T1MA 5EWSA 4JTOA 1LOFC 2R32A 2RS13 3OBAA 3ZSMA 1WMEA 4C90A 4AFCA 4NMIA 5A1AA 1R1ZA 1KXGA 2CY6A 2RS12 3N7MA 4IEUA 4NO4A 3SEPA 3AKRA 5HCHA
chains in the Genus database with same CATH topology
2K2SA 1BKZA 1KJRA 1W6MA 3LSEA 2W39A 4E2QA 1BBT2 1XE8A 3PVBB 1PNGA 1SBFA 4G3YC 4UBHA 2BTVC 1J58A 2PHWA 3MW3A 1ND3A 2OZ6A 3AKPA 3ETQA 4XW3A 1MS9A 4TLFA 4RHV2 3AMNA 4I0BA 2OA2A 4M0HA 4UW5A 2R6QA 1OKQA 1F8VA 2JKBA 4XXPA 4HVOA 1CN1A 1W6OA 1U5YA 1LKNA 5FFOC 4L9BA 4QQPA 4YFZA 4U36A 1O4ZA 2NMNA 2P3KA 1AX2A 5I8SA 1ENRA 1RUD1 2XKOA 5AFBA 1SEFA 1C4RA 1Y7BA 4IEYA 2BYVE 4AVAA 1HQLA 3ALQA 2UYBA 3V64A 5BY5A 2RHPA 5C4WB 2BWCA 3RZZA 4KNCA 5DZFA 2JE9A 3VBHC 4CEYC 1PK6B 2QNKA 4IV1A 3ZXGA 1QJY3 1HRV3 1O3RA 4R9CA 1U12A 4N9HA 3IDEA 4QU2A 1ND2C 4FCAA 1AR61 2HWF1 3AZZA 4IEXA 4YVWC 1I1EA 4P9GA 2JG9B 5KXDA 3JD71 3K48A 4RQPC 4Q0SA 5KHKA 3O7OA 3VBSC 3RWNA 1NCRC 1TEIA 3HT1A 2ZGRA 5F5QA 4AFBA 1UZYA 1DIWA 2R30A 2IFRA 1DGRN 4JGYB 4YM2A 2GALA 2Z2SB 5A3MA 2VOVA 3PJYA 3ZXLA 4AFAA 5I0SA 2NQYA 1J1LA 3AK0A 3N3HA 3JB8A 3VBOC 4Q4Y3 1NXMA 4WM8B 4Q4Y2 3V56A 1EAH3 4LO6B 2OYZA 4DOUA 4AI8A 1MS3A 1LODA 3H50A 1Y43B 5JZGB 3ME2A 3DPRB 4XFGA 1AR92 2UWAA 4W6WA 4CDQA 1S0JA 1EYBA 4GQ7A 1MS1A 3B01A 1OOPA 3J8F3 1K5MB 3RDIA 1RIRA 2UWCA 2IZWA 4GB31 1GZCA 5K0UB 2EALA 4DMIA 3LKJA 5CFDC 5KC5A 1XNCA 4XJ8A 4YW5A 4RR3C 2DVAA 2VMIA 5FO8B 1FX5A 4R9AA 1N47A 2CV6A 2XBO3 3G6JB 2PHLA 1ZBE1 4MGIE 5C8CC 2D98A 2CGNA 3D0SA 4N43C 3ZFFB 4J1XA 3GF6A 3C3VA 4XJZA 1BMV1 4HL0A 1IS3A 3IIAA 1SLIA 4WZFA 1WW6A 2E6VA 2PFWA 2PAKA 4AI3A 1WUVA 4W6XA 1YXWA 3R4DB 2VNRA 4WVVA 2YV8A 4B7EA 4DRVA 2E51A 1W6NA 1Q56A 4XFHA 2ZGNA 1AX0A 2VVDA 4CDWC 1VJ2A 4BYYA 3VHNA 2HWB3 4RS5B 5HCFA 3E6CC 1V9U2 4HLTA 5DG2A 3ZXEA 2WNEA 3ZFGC 1WLCA 1FXZA 4XPVA 4Y1ZA 3CJIC 1VBC1 1QQP3 5FMOS 3RMXA 1AXKA 1QQP2 2ZAHA 1MS4A 4M3CE 5HCAA 4AVBA 5KHIA 3INAA 2WFPA 1NQDA 1I3HA 4X6RB 3AX4A 1KD7A 2O1QA 5FLHA 4DPNA 1LHNA 2ZTNA 4B4QA 1W6PA 2B9UA 1RJ8A 3OD0A 5DXDA 1O4TA 2E53A 2RR11 5ABJA 2JX9A 3ZN5A 1ASJ3 4GULA 1D4M3 5ACA3 3ZYRA 1AL23 2IXIA 1E57A 1V6KA 4MXWA 5ACA2 3IT8A 1APNA 1IS4A 2D6OX 4IXLA 1O5LA 4YM1A 3SCFA 5C8WA 1RUG2 4JCKA 1G9DA 4YG6A 1YFWA 2WJSA 3AKSA 4GMP0 3PVNA 4I3PA 4ITCA 3P3PA 3NWKA 3GBFA 3ZDSA 3GBGA 4CEWC 4JDOA 2IXHA 2WFF3 2X8KA 1H1IA 3FLRA 1O4YA 3O0VA 5KHJA 3D8CA 2ZMLA 4PQ9A 1S0DA 2B39A 3EJKA 2ZZJA 1AF9A 1W2UA 4Y22B 3WCSA 1B35A 5K9YA 4M3CB 1NCQA 4CP0A 4FPOB 3AYCA 2GH2A 1IS5A 2R0HA 1Q8QA 1DQ5A 2VNOA 1BEV1 5JI7A 2DCKA 1Y9QA 3H7JA 3O5SA 4R4ZA 3RYKA 2A6YA 5CIRA 3LWCA 1FT9A 1UMZA 3WW2A 3WY6A 4JVAA 5KWRA 2PHRA 1EY2A 3ILFA 5J09A 2WZR2 1FNZA 4QPIC 4PIXA 5H9RA 1O91A 4PDWA 4XFCA 3JQWA 5BNPC 4I3GA 4JGZB 1SCRA 4ORFA 5BNOB 3WDWA 2IXJA 1JOJA 5JPMB 3VBFA 5BNQA 1BZWA 5GZCA 1C8M1 1KITA 1SLTA 1QXPA 2XJTA 3WDVA 4E27A 1RUD3 2VW0A 3QACA 4AGVA 1NOVA 1RUC1 3I7DA 2GSYA 2A3WA 4X8PA 2JXAA 3TNQA 4YG3A 4HKOA 1L3JA 5LEKA 1S0IA 3SCGA 2WWSA 5CA6A 5JOXA 4FSJA 2ENRA 5BUVA 4J1WA 5FMOL 4G4FA 1ULFA 1QXJA 3THTA 1AR63 2HWF3 4FVVA 5FREA 5AC92 2NN8A 4FPYA 4HPKA 3USSA 2FMYA 2HWC2 3JD72 3VBRC 1HX6A 1YIFA 1H8TA 5C9AB 5JOWA 3AP4A 1QXRA 2O8QA 3JCIA 1PO22 3WCRA 1RUF2 2PYTA 1CIWA 4TZDA 4ZXKA 1CAVA 4YNIA 3MW2A 2MEV1 5BNNB 2DU0A 3LSDA 4O9GA 1PIV1 1M06G 4S2FA 3DL3A 5L36A 4AGGA 2XGXA 3O0XA 3RI9A 4OHZA 4LO4B 1Q8PA 4S2DA 2ZGMA 1HXS1 4CDUC 4L2NA 4WV8A 2DUQA 3NKTA 4HKWA 2XJPA 2ET1A 1NCRB 2JICA 1XYOA 1JTZX 1IS6A 1U5XA 4HETA 4ISQA 3M3EA 1G7YA 2F6BA 3POWA 4BMBA 3ZSJA 1NZCA 2PAMA 4QD2A 4GB33 3AP9A 2XJQA 3R4UA 4WVMB 3GZUC 2YGLA 1RUH1 2O8OA 3UV9A 1X7NA 4Y20B 1ZBE3 2ZX0A 3KQRA 3OYWB 1N3OA 3WW3A 1H1AA 1TME1 1EV11 2I74A 4B4PA 5CFCA 3IWZA 4A7YA 1FNYA 3U07A 4K6BA 1C5HA 4YZ3A 4I09A 4YW1A 5H9SA 4P9LA 2WT1A 4LE3A 2ZGQA 5FCCA 4IEZA 3QH6A 4R52A 2DFBA 2D43A 3RI8A 4CDQB 4A3XA 5GZFA 3AZWA 4YGDA 1UD1A 3ZSLA 4IQPA 2IXLA 2EF6A 2JG8C 4YRDA 3CF6E 1YWKA 3H8UA 2EAAA 3N7LA 2JG9A 2ZGUA 3AMQA 3D6EA 1LHWA 4Q4X2 3WUDA 1G9FA 3LA3A 3JQXA 1OA2A 4LBNA 1CJPA 5DUXA 2CTVA 2E7QA 3MW4A 4BPZA 2DTWA 1WW7A 4D94A 1VBC3 4Z2WA 1RITA 4XFFA 1RUOA 1AVBA 1C57A 1VBC2 5J96B 4JGYA 3BB6A 4MZUA 3KCXA 2WNVB 1IQAA 2C0ZA 3RPQA 3WG2A 4BHPA 4MX3A 5T54A 4CDWB 4FT8A 3QLQA 1CPNA 4BA6A 4RA0A 5FRAA 1VBE1 2ZMKA 1IPKA 5JSRA 4FOQA 1OQDA 2RR13 4FPJA 2Z69A 3ZFGB 2D6KA 3DPRA 1GSLA 1WBFA 4Q4W2 4NOTA 4K8FA 5FTTC 2VQAA 3CJIB 2BVBA 4R9DA 1PO12 2EAKA 4WZCA 1QGLA 4E2SA 1HQWA 1K5MA 1Q8VA 4BLJA 1C28A 3B9IA 4BMEA 5I91A 5K0UA 1ALYA 1Z78A 3AP7A 4XEZA 2QCSB 3GALA 4P9XA 4OZXA 2HYKA 2SBAA 5CNAA 4FTBA 2VUJA 1X50A 4AEJA 1DF0A 1OLQA 1TNFA 1UX6A 4Q26A 1BQPA 3VZOA 4D7SA 3E5UA 3EBRA 1YRZA 3QBQA 1W6QA 1W6PB 1UU6A 3KZ4C 2OUJA 3VBUC 5EYXA 4RGGA 5DUWA 4ASLA 2QKDA 2XVGA 4F8AA 1RC6A 1BEV3 3SCHA 1HV1A 1QJU1 4MXWB 4AI2A 3ACLA 1SACA 4CRQA 1RUJ1 2I2SA 1Z7S1 1ZRFA 3HR9A 4RS5A 4AFMA 1R1A1 4META 2OPKA 2P3JA 4XILA 4S2HA 4ES8A 4OI0A 4D7TA 2FQPA 1VRH1 1CQ9A 4GMP1 3AP6A 1AR72 3M3OA 2WNUA 4BE3A 3PLQA 2B5HA 2ZS6B 3NSTA 3WDTA 3ZIWA 1TMF1 4FOVA 3TAYA 1LHOA 1C8M3 1YIPA 2JDZA 4YGCA 4MSVA 1ENXA 5F6KA 2QVSB 1AYM1 1RUC3 4SBVA 4DXZA 4AHZA 1IKPA 1VBD1 1WCSA 2XB6C 2H0VA 5KHHA 1LU2A 3W58A 1QOTA 1QH7A 1SLAA 2NYYA 3B00A 4Q2FA 3ZIXA 2PHDA 2AGSA 1LHUA 2Q4SA 2VULA 5JIAA 4GXLA 1D0HA 3TBDA 4J6GA 3E5QA 1WCKA 4LBKA 5DUVA 1GBGA 1MQTB 4Q0UA 4EWAA 4ZU7A 1DQ0A 1RGSA 4OULA 2ZGSA 4FPKA 4KGGA 2EXHA 4PDWB 4XIOA 4QXKA 4R8HA 2ZCWA 3MGUA 4K7JA 4XHXA 2ZX4A 2YMZA 2JEMA 3VZJA 4ATEA 4BH9A 4XFIA 1QNYA 4PJYA 1VAKA 2D6NA 2MEV3 5D8AB 1N1VA 1PIV3 2ZGTA 1FOD3 5J98B 2C1FA 3RMYA 1FMD1 4Y22A 1PIV2 2D97A 3MEPA 1ONAA 4M3CA 1GQGA 1HXS3 5JOZA 1UIKA 1QKQA 4FPHA 1QH6A 4B8EA 1N3PA 4B29A 2X5IB 1T6GC 4HVQA 2CWSA 1UKGA 4BQ1A 3ZXJA 2R042 1NLRA 3ZXKA 1Q8OA 1RHI1 3X29B 4YVSA 3SH4A 1HRI1 1Z0HA 1RUH3 4N53C 1YFXA 3V0AA 4NHMA 3MIBA 3HMYA 1NA1A 1KQRA 1EV13 4JGZA 1UW8A 5BNOA 2PLV2 4FQ4A 3DV8A 3VL9A 4Q1RA 1TME2 1EV12 4E4DX 3M1HA 1J59A 1CAUB 2ZX3A 4H14A 1PGL2 1TE1B 2TNFA 3ZSEA 3RNSA 4AG4A 4Y26A 5JSOA 4LT5A 2XJUA 1AL0G 1BJQA 1GR3A 2XLAA 3NL1A 1AR81 3LAGA 1V6MA 4AVSA 4HVRA 1IHMA 4M0NA 1CESA 4XQ4A 2DF7A 3ZX7A 2RS31 3AMHA 1QWRA 4X6QB 2YY1A 4RD7A 3MF6A 2KXLA 3CEWA 3WDUA 3FUOA 5IK4A 4JDMA 4LHKA 2XVKA 4YW3A 3WHTA 3SXWA 4GWMA 1C1FA 5SV8A 1WCDJ 5CFCB 2A3XA 3WQ7A 1YO8A 5C9AA 2DVFA 3MFAA 1ZYBA 4I01A 3RS6A 1PVC1 4I0AA 1WLDA 3VBHA 1PZ7A 1YJLA 2WSUA 5AVPA 4GH4C 3ROUA 4XFBA 5BNNA 4KQ7A 4LUMA 1DQ6A 2JG8B 1N1YA 4GA9A 4LHNA 1VBE3 4YVWA 1RUI1 3ZXDA 4HSJA 5J48A 4IEVA 1MEC1 1R091 1DZQA 3LA2A 4YG0A 1VBB1 2RJKA 4NN0A 4MH0E 4LTAA 2B8MA 1NCRA 3O12A 4AEDC 2D3RA 1QJY2 1HRV2 1QDOA 2DYCA 5I0UA 1ND3C 3VUOA 1H9PA 1JXNA 1A3KA 1R081 5EZWA 5JVVA 4JDNA 3PVOA 4N9IA 3M4FA 4HFSA 1JUHA 2ARBA 4WVMA 3BOPA 4OHYA 1FV3A 1LRHA 1SLCA 4Y20A 2HEYF 3OYWA 2ZGPA 1UU5A 2VOWA 4LHLA 3ZXAC 1J3PA 3H1WA 2XLGA 3M3IA 1AUYA 4KWKA 2FHRA 2Y0OA 5I8YA 1M4WA 2X29A 1COV1 4IV1C 1EAH2 2I07B 1MS8A 3NO8A 2IC1A 3AMPA 1D2SA 2DVDA 2F4PA 3I59B 1QF3A 1KFUL 1QJU3 5DG1A 4RR3A 4E4ZA 1RUJ3 5T5PA 2YXSA 2I45A 1OSGA 3MLJA 3J8F2 5T5OA 2X53S 1Z7S3 2CNAA 4WVZA 1R1A3 4IEPA 1VRH3 2EVXA 2R16A 4COWA 5CAZA 4GMP3 1O3QA 1PGSA 2ATFA 3QOPA 1DZRA 1RUE1 3VBUB 2XBO2 3AXDA 1TMF3 2PAEA 1YFUA 1VR3A 2Q1MA 4LBOA 4B7KA 4LE4A 1W6QB 4EN8B 2MNGA 3M2MA 5SV5A 2WNVA 3VDDB 5L19A 1ULGA 2WLPA 3A0NA 3MIFA 1AYM3 2KM2A 4BZ4A 4CDWA 2D3SA 1VBD3 1XXNA 3TOJA 3GZTB 3JB4C 4I02A 5L7OB 1ZNPA 2D40A 1C8NA 3ZFGA 2DTYA 2HWD1 3CJXA 4XJ9A 1AJOA 1RMU1 4XDQA 5LK7B 1NG0A 2P3IA 3CJIA 4LUKA 4FBFA 1PNFA 2HWB2 3WP3A 2FBEA 3POYA 1OFNA 3LZZA 3D0JA 4Q0VA 3JUUA 4I2OA 2P37A 4LBMA 3WD5A 5I93A 1O3TA 1DZTA 2WNUB 2ZGOA 2R1DA 2XWJB 4TWTA 4N7IA 4EN9B 2DVBA 1TNRA 5B2GB 3R05A 3FX3A 4LO5B 1X33A 4LULA 3KSCA 1GV9A 2TBVA 2A6WA 3RJRA 1G9BA 2RM21 1FMD3 4AGRA 4C0BA 3WW4A 2YROA 4V1PA 3WQ0A 2ZKLA 3AFKA 3B02A 1ZZ6A 2R49A 1XNDA 2WL1A 2XVLA 2MPFA 3ZPYA 5GLZA 1ASJ2 3KT4A 1D4M2 1SDWA 1AL22 4QQHA 1LEMA 3OTFA 5A32A 1GYKA 3IBMA 4FXKB 1RHI3 4XBNA 4CDXC 2JE7A 3ZFEC 2CAVA 3FFZA 1AX1A 2W0XA 3I8TA 5F1RA 1HRI3 4JC1A 1WA4A 5JR7B 3VZLA 1H9WA 1HRI2 5DZGA 3W9AA 1V6IA 3I2DA 3S0MA