5ABJB

Structure of coxsackievirus a16 in complex with gpp3
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
SDRVAQLTIGNSTITTQEAANIVIAYGEWPEYCPDTDATAVDKPTRPDVSVNRFFTLDTKSWAKDSKGWYWKFPDVLTEVGVFGQNAQFHYLYRSGFCVHVQCNASKFHQGALLVAVLPEYVLGTIAGGTGNENSHPPYATTQPGQVGAVLTHPYVLDAGIPLSQLTVCPHQWINLRTNNCATIIVPYMNTVPFDSALNHCNFGLLVIPVVPLDFNAGATSEIPITVTIAPMCAEFAGLRQAVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Structure Elucidation of Coxsackievirus A16 in Complex with Gpp3 Informs a Systematic Review of Highly Potent Capsid Binders to Enteroviruses.
pubmed doi rcsb
source organism Coxsackievirus a16
total genus 54
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5abjB00
2WS92 5CFCA 1RUC2 2RR12 1COV2 2HWB2 1PVC1 4RR3A 1M06G 2MEV3 4CDWA 5CFDC 3VBHA 2RMU2 4RHV1 1HRV3 1RVF2 1PO11 4N53C 3S6PA 1FOD3 4QPGC 1MQTB 1VRH3 4JGYB 3IDEA 1AR81 2RS31 1QJX3 3J8F3 3VBRC 4CDXB 2BFUL 4WM7C 5C8CB 3ZFGB 3VBSA 3VBRA 4RS5C 3ZFFA 1MEC3 1Z7S1 1RMU3 3JBG3 2Y26A 2RS13 4CEWC 1FPN3 2ZZQA 1AYN3 2GH8A 4AEDB 1HRV2 5L7OA 2DF7A 5AC91 1FMD2 5A33A 1PO21 1RUC1 2RR11 4CEYB 1EAH2 1COV1 1PGW2 2HWB1 1POV0 1VRH2 1NA1B 5D8AC 4YVWC 2RMU1 5D8AA 3NAPC 5A32B 1POV3 1ASJ3 3JBG2 3NAPA 2RM23 1FPN2 3CJIB 1AYN2 5BNNC 2HWE2 3VBUA 2VQ0A 3ZXAC 4JGZB 5C9AA 4GB33 1NCRA 2R042 4IV1A 5CFCB 1HRV1 4WM8A 1RB8G 1VB2A 4RR3B 2RM22 1FOD1 1PGW1 1VRH1 4CDWB 1MQTC 1A6CA 3VBOA 4JGYC 3VBHB 4CDQB 1QJX1 3J8F1 4JGYA 2R073 4CDXC 1HRI3 1D4M2 5C8CC 2ZAHA 4GB32 1VBE3 4CDXA 2X5IB 1VBC2 3JBG1 3ZFGA 1RUH3 1FPN1 1F2NA 5C4WB 4IV3A 1AYN1 2HWE1 4AEDC 2HWC3 2BPA2 1VBA2 3ZFFB 4AEDA 4CEYC 1NA1C 1AL23 2R072 5L7OB 5A33B 4Q4Y2 1POV1 1RUJ3 1ASJ1 1RUH2 2RM21 4Y4YA 3CJIC 3VBFA 1EV12 3CJIA 4RFT0 5LK7B 1R083 1ND2B 1D4M1 4GB31 4JGZC 1HXS3 1VBC1 1AL22 1RUI3 1RUE3 2GSYA 1AR92 1X33A 1AR73 3VBUB 2HWF3 1RUJ2 5CFCC 1C8M3 1PO22 4RR3C 3VDDB 5C9AB 1QQP3 2BFUS 1RUF3 4CDWC 1TME3 1NCRB 3VBHC 5JZGA 4IV1B 4CDQC 2R071 4WM8B 1R082 4CDQA 4Q4Y1 1VBE1 1HXS2 2X5IC 5BNPA 1RUH1 1RUE2 3VBOB 1AR63 1AR72 2X5IA 2HWF2 5FMOS 1C8M2 1EV11 1ND3B 5C4WA 3VBSC 3ZFFC 1RUF2 1TME2 4IV3B 2MEV2 1AL21 1AR91 5L7OC 1RUJ1 4Q4W3 1OHFA 5BNOA 1AR62 1FOD2 5FMOL 4QPIA 4FTEA 5ACA3 1QJX2 3J8F2 4YVSA 1R081 5GKAC 1MEC2 1ND2C 1HXS1 3JD73 2FZ2A 1RMU2 1ND2A 1RUE1 2WZR3 4Q4V3 2RS12 3VBFB 1AR71 2HWF1 3VBUC 1AYM3 4Q4W2 1B35B 1C8M1 1ZBE3 1NY72 3VDDC 5C9AC 1VBD3 1RUF1 1TME1 1GFF2 3VDDA 4Z92B 5ACA2 1NCRC 2MEV1 4IV1C 1QJY3 4WM8C 1VBB3 1ASJ2 3ZFEA 2WZR2 1V9U3 1AR61 4FTSA 4RQPB 3VBOC 5JZGB 2TBVA 1AYM2 1NCQB 1ND3C 1BEV3 1K5MA 1VBD2 1ND3A 5BNPB 1MEC1 3ZFGC 4N43B 1RMU1 4IV3C 4CDUA 1QJY2 1RUG3 1CD3G 2RS11 1VBB2 4Q4W1 1NY71 3DPRA 1R1A3 5ACA1 3FBMA 1BEV2 1RHI3 1HRI2 5BNOB 1VBE2 3JD71 2WZR1 1RUG2 4QPIB 3VBFC 1NOVA 1QJU3 1AYM1 1WCDJ 4YVSB 5J96B 1PGL2 4Q4X3 2HWC2 1B35C 1AR83 2BBVA 1VBD1 1B35A 4RS5B 4PDWA 5K0UA 5DDJ3 1QJY1 1RHI2 4FSJA 1VBB1 2R063 2WWSA 5J98B 2WFF3 1RUD3 4BCUA 1OPOA 2WS93 1QJU2 5JZGC 4RQPA 4GMP0 5ABJA 1NCQA 1BEV1 3ZFEB 1VAKA 1HRI1 2RMU3 5BNPC 1PIV3 2RS53 1RUG1 2PLV3 4N43C 1RUI2 1RVF3 2R062 4GMP3 4SBVA 4N43A 5C4WC 1PGL1 1OOPA 1K5MB 2WFF2 2HWC1 1QQP2 1H8TA 4CDUB 2WLPA 1NG0A 4GH4B 1R1A1 1RHI1 3TN93 5BNOC 3DPRB 5CFDA 1PIV2 2RS52 2PLV2 1FMD3 3JB4C 4QPIC 1QJU1 1EAH3 4Q4X1 4YVSC 4N53A 4QPGA 2QQPA 3LOBA 4FTBA 2HWD3 2XPJA 4EJRA 2FZ1A 1E57A 4WM7A 5DDJ1 1AUYA 1RUI1 4RS5A 2R061 3TN92 1CJDA 1X36A 2WFF1 1RUD1 2HWE3 4CEWA 2WS91 1QQP1 4PDWB 5K0UB 2BUKA 2XBO3 2HWD2 3ZFEC 4YVWA 3JD72 2R043 1PIV1 2RS51 2PLV1 4Q4V2 1RVF1 4GMP1 5ABJB 1ZBE2 1K5MC 1BBT3 1W39A 5BNNA 1AL0G 2XBO2 1TMF3 3JB8A 1QJZA 4CDUC 1D4M3 4GH4C 1VBC3 1OOPB 4GH4A 3TN91 1BMV2 4LLFA 3DPRC 1H8TB 1ZBA3 1V9U2 1FMD1 1R093 1VBA3 1EAH1 1PVC3 1BBT2 1F8VA 1MQTA 5CFDB 1TMF2 2HWD1 4Q4Y3 4RHV3 4Q4V1 5C8CA 1PO13 4N53B 4QPGB 3HAGA 1ZBA2 1ZBE1 1R092 1EV13 3VBSB 3VBRB 4WM7B 2RS33 2XBO1 4PDWC 5K0UC 1DDLA 1PVC2 1C8NA 4CEYA 1R1A2 4NWVA 1Z7S3 4CEWB 1NA1A 2ZTNA 1BMV1 5FOJB 1AR93 2R041 4RHV2 1V9U1 5AC93 1PO12 4Y5Z0 1PO23 5A32A 1RUC3 2RR13 4RQPC 5ABJC 1COV3 1IHMA 2HWB3 4Q4X2 1NCQC 1BBT1 4NWWA 5D8AB 4YVWB 1AR82 2RS32 1TMF1 1HX6A 3NAPB 5DDJ2 1Z7S2 4JGZA 1OOPC 1VB4A 3M8LA 2IZWA 5BNNB 1HQNA 1ZBA1 1RUD2 1SMVA 5AC92 1H8TC 1R091 1VBA1
chains in the Genus database with same CATH superfamily
2WS92 1KD7A 5JSPA 1COV2 4UF0A 5T3NA 4ZZ8A 3OGSA 4CP9A 2VTXA 2ID4A 1H2LA 2IFWA 2ZHNA 3VBHA 1OSGA 3HT1A 4XBNA 4RHV1 3PJYA 5JIUA 3U78A 1MACA 5D1IA 3U75A 1DQ6A 2A5ZA 2XOMA 4MVTA 1FOD3 4XAEA 2W1UA 3K77A 5CG9A 3J7LA 4MGKE 3T0BA 1AR81 4WVZA 4UFHA 3VBRC 3J9SA 5C6CA 4WM7C 3WLUA 4KWLA 5J3UA 4XYXA 5C8CB 4F8AA 2IVIB 3ZFFA 1IS3A 3EBRA 2DCYA 2XJQA 2OT7A 4KU8A 2ZPXA 5F3GA 1PMHX 3T2QA 2QCSB 2VZ3A 1FPN3 3ECQA 2CYFA 3M3OA 2ZMKA 2GMMA 1U5ZA 1D0HA 3CO2A 1FMD2 4K21A 5KXEA 1CESA 1MVEA 1PO21 3LFIA 4AGRA 2HWB1 4FXGB 1QEXA 1POV0 4KMQA 1VRH2 5A70A 4QDQA 5FBZA 2CU5A 4Y1YA 3AP5A 1I5ZA 4OHVA 4HVOA 4BM8A 3P3NA 5I0DA 2DBNA 4HPKB 1P8JA 5A7QA 3T2TA 5FZGA 4K20A 3WP3A 2VNVA 1QXJA 4ASLA 5L9BA 2F4LA 3NAPC 5A32B 2P6CA 4AHWA 1HQWA 4HL0A 3JBG2 1HKDA 5LK5A 2RM23 4EWDA 4DXSA 3J4UH 4I0AA 5FZDA 5I0RA 2B9UA 2JDKA 4QKBA 3VBUA 4YFZA 1BKZA 3U11A 3PDQA 1UOBA 2DDUA 2Z79A 3Q8AA 4DXTA 5C9AA 2VZUA 2ZGUA 3ZXKA 4XFHA 1YI7A 3WW3A 2VTXJ 1JN2P 2YROA 4META 1ENRA 1V6JA 3O0WA 2PA7A 3GCXA 4NIIA 3MIFA 4NHLA 3BPSA 1NKGA 2ZGMA 4RR3B 2ORZA 3RI9A 1JOJA 1SPPA 2PHTA 4XUNA 1FOD1 4QQ2A 4Z8BA 5AFBA 4JC1A 4HANA 1S0IA 2H0BA 4I0BA 1URXA 1DU3D 2KA3A 5FYYA 3AVRA 4JGYA 5EJ3A 1GNYA 2QKDA 1Y9GA 1GQGA 2MPFA 4FFFA 4GB32 4AQTA 2X5IB 1VBC2 2JD9A 2FMDA 1YFUA 1QXPA 2J22A 2JIJA 4LHLA 1RUH3 3V0BA 1FPN1 4HVQA 5HI0A 4LULA 3NKGA 4H2AA 1KFXL 4Q5OA 4BB3A 1JYXA 1CAUB 4CPBD 5JLVA 4AEMA 4LJHA 4JKMA 4CEYC 5IVVA 2RVAA 4IE6A 2NM1A 4BISA 4N7IA 4OQ9A 1NA1C 4CP0A 5C3SA 2R072 4BLIA 3WDYA 1UYXA 5GLTA 3VZNA 5L7OB 5A33B 4YM0A 1Q43A 3Q8EA 4Q4Y2 4LA2A 1G7YA 4MGTA 1YQCA 1ENSA 2B46X 2RM21 1RUNA 4NN0A 4NIAA 1O3QA 3CJIC 2QNKA 3GXUA 1OQ1A 1GQHA 1O4TA 5FYTA 4WVWA 2OVUA 3VBFA 5LCWL 2ORXA 2WAOA 2WT1A 5EHDA 3UGFA 4ORFA 3P3PA 1QH7A 4LLOA 3GBGA 4LNVA 4C0BA 1DGRN 1V6KA 3AVSA 4Y33A 1DHKB 2B9VA 4OHXA 3C7EA 5LY2A 1RUI3 2VNOA 1S55A 2GSYA 3KM5A 4GULA 4GAZA 1QDCA 4BQ5A 1ZA4A 3GHNA 2JDUA 2HLEA 1ZYBA 2LS6A 3T3YA 3MDPA 1RC6A 1BQPA 3C7OA 2JD4A 2PAEA 1PO22 4XBQA 1H2MA 3MIGA 3VHNA 3CZJA 2I2SA 1RUF3 3EYPA 4YGBA 1TME3 1NCRB 3VBHC 1H30A 2YBKA 3POEA 2JDHA 4IV1B 3WNNA 5CA6A 2GNDA 2YDEA 1WMXA 1CAWB 1WWYA 3QH7A 5DZEA 5FZOA 1OKQA 2GH2A 4BQWA 1RUH1 2PHWA 2XJPA 3PUQA 1SDDB 4BQ1A 2AEZA 3ZDVA 4COVA 4LE4A 5BYNA 2HWF2 2JX9A 1UU6A 2A6VA 3DXUA 3R4UA 2UYBA 4FPLA 4QHZA 4AVCA 3N7JA 5FP7A 5FMBA 1W8OA 2VCAA 3OTFA 1H6XA 1MS3A 1U0AA 3U4XA 3ZFFC 2ZHLA 1YO8A 1DYOA 4AEDB 3H1MA 5FY5A 4FVVA 3P5BA 5JOWA 4IV3B 3BTAA 2CGPA 1KS4A 3AMNA 4QPWA 1XNDA 4Y22B 4URTA 3ZXGA 2OXBA 3ZX7A 1L7RA 2GMEA 1REDA 2Q30A 4Q4W3 4AFAA 3VL8A 2PAMA 2P34A 4LORA 2PHFA 5BNOA 4XCBA 3TRSB 2C24A 1FOD2 5FZKA 4XIOA 1MVQA 2OZJA 3MHZA 4QB1A 4ZXKA 5FMOL 3WVJA 3KHCA 2WINB 4QPIA 5C3PA 3ZYRA 1NQJA 5JR2A 2RDQA 4OUSA 1ZZBA 4OI1A 3VD4A 1BZWA 4NRMA 1REEA 3FUQA 5ERLA 1C28A 1CAVA 3HQXA 1HJGA 5K4LA 3MW3A 3LFMA 1QMJA 2D44A 1OFSA 2CV6A 4Q4V3 3HQRA 4B4QA 4XXAA 3OPWA 3VBUC 2JB8A 2JG8B 2PMWB 1TNRA 1H9WA 1B35B 5DAXA 3MW4A 3IN9A 1W28A 5L9RA 4AK3A 3T4HB 1RTVA 1W8UA 2OYZA 4PLNA 4DPNA 2NZ9A 5C9AC 1ZNPA 1RUF1 1GOGA 2NMNA 5IHRA 1TME1 2XWJB 1MR5A 3C8XA 5A7SA 5LA2A 3ETPA 4W4ZA 5BNQA 3POJA 4Y1ZA 2QQMA 4C1WA 1QJY3 2VW2A 1OFNA 2AENA 2O14A 2XG3A 3ELNA 4A45A 1N3OA 5ISLA 3I2JA 1A3KA 4BXFA 4COUA 4FTSA 2YXSA 1XU1A 5FZFA 1MS5A 2D5FA 2ZGPA 1PNFA 2HBUA 5FY0A 5CISA 2DVGA 2DVFA 3I4IA 5GM0A 3HNBM 2WUHA 4BMEA 4YW3A 3VHRA 2J1TA 3T30A 4LBKA 5H9QA 3W9AA 1YFXA 3KS7A 2XLFA 4UFMA 2OQ6A 3FLPA 4CU7A 1V00A 2Y6LA 2ZEWA 3VD5A 1RMU1 1HDKA 1CD3G 1DYKA 5HXMA 2EALA 1SHWB 3H7YA 1XNCA 3MW2A 4E4DX 5C3RA 1UD1A 4Q29A 4Q4W1 4A7YA 3LGRA 2VOWA 1V6LA 1LOEA 3I3MA 2BWAA 3LEGA 4FP3A 4LO8A 1N1VA 1NY71 3ZN4A 2RHPA 4JTNA 3LQCA 4P9JA 1SBFA 1BEV2 4U36A 3NV3A 3PMEA 3A0NA 1H0BA 1GSLA 5APAA 2PHXA 3RYKA 5GLWA 1S4CA 2PQQA 4AQSA 2BERA 2P37A 3SC7X 3FFZA 1ZRIA 2DUQA 4KWKA 4W65A 3VBFC 2Q5TA 1YNAA 4NHXA 5J96B 1PGL2 3TNQA 3VUOA 4UT5A 3LB9A 3O0XA 2D6OX 4Q2FA 1OT5A 2YFUA 2H6BA 4LMFA 3KWVA 5B4XA 4YZ1A 2QQOA 4XACA 4K8RB 1W2AX 5DDJ3 2BEOA 2WT2A 1QJY1 1R1ZA 4GWMA 5FY8A 5HCAA 4QQHA 3DL3A 1UO9A 1D4VB 1C57A 4MX3A 2C5DA 2E7QA 3RMXA 3WW2A 2DYCA 3BU0A 2VMFA 3HEIA 4P9GA 4A3XA 4BCUA 5KWRA 2HEYF 5C33A 4XPVA 2VMIA 5FXXA 2C6SA 5IVYA 3IM0A 5IVBA 1N3QA 2JG9A 3OD0A 4RQPA 4AHXA 2AGSA 2ZGRA 1JZ5A 1NCQA 2W95A 3VD7A 1CX4A 3ZFEB 4JV4A 5JSRA 2XHNA 2RMU3 2YBPA 3ATGA 3OEBA 4PI2A 2G19A 4FOYA 2D7FA 1PIV3 1LHVA 2RS53 3AXDA 1SLTA 1V70A 1W04A 2FCVA 1RUI2 1W6OB 4K6BA 4QDSA 1XNBA 1D7PM 4IERA 1OPMA 4M3CE 1OOPA 4RGKA 5LASA 2DCTA 2WFF2 3ME2A 4LIVA 4LIUA 4ES8A 2VOVA 3CZUA 5A1LA 1N1TA 2J1AA 2VECA 2Q1MA 2WLPA 4A6SA 5KR7A 1G9BA 4GH4B 3VHOA 4F7ZA 1XYPA 2ZA9A 5FPZA 1KDKA 3QCWA 4CCMA 5FLHA 2C0ZA 1DGWA 5E88A 3RWKX 3TN93 5BNOC 1H6YA 4AW7A 1JYVA 2WNUA 1O4ZA 1W03A 1W9TA 1OA2A 3CF6E 1F5JA 1MPXA 2PLV2 2VUJA 2WLQA 4B1MA 2VULA 3IAQA 2NMOA 3QBQA 4G4FA 4HKWA 3ITQA 4FXKB 4QPIC 4XDPA 5FXWA 5DUXA 2LTNA 3LF7A 4FPHA 2X09A 4N53A 1NLQA 4QPGA 1K12A 4L2NA 2VZ1A 2QQPA 3LOBA 4JRAA 3RVHA 1TEIA 4I01A 1NUKA 4J25A 5IUQA 3UETA 2JE7A 2HWD3 1W90A 1F4AA 1OF4A 3FWEA 4I30A 3HN1A 2VOXA 3BN6A 5DDJ1 4D7TA 3KV4A 3W59A 2OPWA 4P14A 3ZSLA 5G04L 4PJYA 1CJDA 1NX9A 1X36A 4XE9A 2HWE3 2VZTA 3M4FA 2JDPA 2EXJA 1UOGA 2ZHMA 3GJBA 1V6MA 3THPA 2DUPA 5B2GB 4PDWB 1VMHA 5CYYA 2BUKA 5HCHA 4S2GA 1UZ0A 3INAA 3T4VA 5BV6A 1YJLA 5FPXA 5FPUA 5FZ9A 4QX5A 3USUB 3UNPA 4OCTA 3WNKA 1PMJX 3AZXA 2KM2A 4PQQA 1H2KA 1FYUA 2AACA 1PIV1 4A42A 2RS51 4AHYA 4TZDA 4Q4V2 5AVAA 1UPIA 1MS9A 4WZFA 2EICA 5SV8A 3OUJA 4AVVA 1J3QA 3VKNA 4L97A 4BQXA 4LBMA 3TYJA 4LOTA 2TEPA 3AZYA 4A44A 3MF9A 4L9BA 2EAAA 4K9SA 3WR0A 1WLTA 3MI8A 4JVAA 4Q0SA 1XNTA 2VVFA 1D4M3 4YW7A 4XAAA 2GP3A 3URFA 3VDCA 2XDVA 1LESA 4IE4A 5FQ0B 5F9TA 3POWA 2P3JA 3TN91 1N47A 1YQ8A 1BMV2 2OUHA 4CU8A 4BA6A 1OXCA 5FOBB 4JQTA 4D7YA 5FP9A 4CP9B 3EB7A 3ILFA 3DN7A 4M3CF 4PT6A 2G9GA 2J7MA 1PVC3 3BALA 4RGGA 4AHZA 1IG3A 1F8VA 4OMDA 3ES4A 1AJKA 1MQTA 5FZ3A 5CFDB 1WBFA 2BZDA 1GP5A 1VE0A 4KI5M 2HWD1 5FLJA 2W68A 1E5HA 4GZ9A 5EXOA 1OUSA 5FPVA 2OX0A 4A6OA 3HBZA 4Z82A 4JKKA 2YFZA 3GJAA 3BTZA 3FZ3A 5IVEA 1BVP1 2BW8A 3AMMA 4EE2A 1ZZ9A 2DVAA 1PK6A 1ZBA2 1OA4A 1WCSA 1GOFA 4AGGA 5IT6A 2RS33 1WUVA 3AMHA 3RJ2X 4KH9A 1UYYA 2Q8DA 1C8NA 1QOOA 2WDBA 3M3QA 4JRLA 3QLQA 1KJLA 2JWPA 2WQ4A 3A21A 4OI0A 2YHJA 2ZTNA 4R4XA 1L7QA 1PM7A 2CTVA 2WWJA 4BIOA 1XJAA 1CQ9A 4XFAA 3OD4A 5LEJA 2JG9C 4RQPC 1COV3 3MFAA 1RXFA 2WIIB 1NCQC 3AYEA 4ATEA 1EUTA 1WA4A 4Y26A 3N7LA 3LIHA 3OBZA 4AF9A 3D3AA 2CWMA 3LIGA 3IT8A 5AFEA 5JMOA 4UBGA 4AEKA 4O61A 1O5LA 4GKYA 5DDJ2 4P9YA 1Z7S2 3UESA 3B00A 3AX4A 2IXJA 4JGZA 1AF9A 1D2QA 1OOPC 1VB4A 1HQNA 2Q8CA 5IW0A 5HV0A 2XVLA 4ZZ5A 3HD8B 4QWNA 1IQDC 2DUOA 2WNOA 4NO4A 5I8SA 3POSA 3LPGA 1IS6A 1PVC1 1WCUA 3HR9A 1D2SA 4XJ9A 3ORJA 4LK6A 4R52A 4X8PA 3WQ0A 3K3OA 3O1RA 3RDIA 2MEV3 4CDWA 1XNAA 4QDRA 2WNUC 2RMU2 3DEMA 1IGOA 1UOJA 3UL2A 5KBFA 4QB6A 3ACFA 1LR5A 3B9IA 3FBYA 3ETQA 4N53C 3S6PA 3WF0A 4QPGC 4KWJA 1VRH3 4JGYB 1UY4A 3IDEA 4P9IA 1US2A 1XOYA 3N7KA 5EZWA 1I1EA 2RS31 1QJX3 3J8F3 4TN7A 1RUOA 5A7WA 2W08A 1AVBA 5CZKA 4QM8A 3T2OA 3VBRA 4AWDA 3V0BB 4BQ3A 3H3ZA 1G9DA 5LA1A 5LBEA 1UW8A 3JBG3 3O1VA 2D3RA 5JXIA 4YW6A 4HG6B 4MGQA 2VZOA 2GH8A 2PHLA 4UW3A 3I2OA 1W3XA 3PNAA 1W0NA 3LEKA 3POYA 4K40A 1REFA 1ODMA 1W6NA 3LE0A 3KGZA 1COV1 2A75A 3PUAA 4RGAA 2GC1A 4E4HA 4R9CA 2W91A 4XF1A 2A73B 4MGIE 4H7LA 4HXCA 2ADEA 4ZS3A 5D8AC 3ACIA 1DQ4A 1JI6A 1UNBA 5JUVA 2YY1A 1C4RA 3NNMA 2N7GA 1GWLA 4XZUG 1OD5A 3E5XA 4C91A 3PIGA 1OH4A 5A3NA 4Q8KA 2YYOA 2Y6KA 2CGNA 1DF0A 3NAPA 2YGLA 2WO3A 3UT0A 5HPOA 3AL6A 4OZXA 4AFCA 4EN9B 4ITCA 5GZGA 2HWE2 3VB9A 5DG2A 1LOBA 1KQRA 5T52A 1NXD1 4URAA 4NE9A 4OHWA 1J3PA 5CVRA 3ZXAC 4HZFA 3TEWA 2YMZA 4GB33 5L73A 1AXKA 2DCKA 4GWJA 2XKPA 4JHZA 5CFCB 3LA3A 4D7SA 4WM8A 5T5JA 3PJQA 4XW3A 3B3QE 3VZOA 3CDZB 3KT4A 3HOBA 1SDWA 3KVBA 4LUMA 2CDPA 1VRH1 1RIRA 1PM4A 2B42B 1MQTC 2VQTA 4XFIA 5FMCA 3OY8B 3VBOA 1HB4A 5I8YA 2Y60A 1QJX1 3J8F1 3QOPA 4YLZA 3AXEA 2J42A 2R073 4CDXC 4DINB 3OEAA 2K2SA 1HRI3 4CE8A 2JB4A 1D4M2 1CPNA 1UX7A 3DECA 4H3WA 5FZ0A 2JDAA 3MEPA 1VALA 1YIFA 2QQWA 1J3RA 1C3HA 3JBG1 4Q8LA 5DABA 1PK6C 1KFUL 1O3RA 1V6OA 1GZWB 3N36A 1B09A 1I9RA 5FJHA 4AEDC 4ARYA 2YPJA 3O0VA 2QQNA 2BPA2 2NLRA 4V1PA 4QHBA 2W1QA 3VZKA 1AZDA 5SV5A 3ZM8A 3OGJA 2ZEYA 3OUIA 1XYOA 4K8FA 3UKVA 2P2KA 4FP2A 4AE2A 4RN5A 5L9VA 4GWIA 2BOJA 4MGZE 2VZPA 5FWJA 2RDSA 3DKWA 3GGLA 3N9LA 3PMSA 1XU2A 3U14A 1SZBA 2VVDA 1GANA 2Q1FA 2Y6HA 3I3EA 1UKRA 3LEIA 3R6SA 3CNAA 4UI9L 5CADA 3WDTA 3FLTA 4GA9A 5FXVA 4FPCA 3ZR6A 1NT0A 3RZHA 3MZHA 2Y6JA 1HB1A 3AMQA 1LKNA 3OYWB 3UYJA 4ONUA 3KGLA 1VIWB 4B1LA 5A80A 3CJIA 2OKXA 4EYUA 1CAVB 4RFT0 3GBFA 5LK7B 1UY2A 4AFBA 1NZIA 2MHFA 1DYPA 4GB31 4JGZC 4TSVA 4W6XA 4BJ0A 2OUJA 1VBC1 3OJBA 1G9FA 1OQDA 4UW6A 1JU3A 1O6UA 4PIYA 4P9XA 4XJWA 4AFMA 3OBAA 1SCSA 5FXZA 5C3OA 1FXZA 1RUJ2 2HWF3 2WT0A 4CXXA 1YQ6A 4ZXEA 3J7NA 4XJAA 1APNA 1R64A 1QQP3 2D6NA 4CDWC 2E7AA 5DAPA 2AUYA 3ZXDA 5JZGA 3WF4A 4CDQC 4DOUA 2R071 3R4DB 4AZZA 1R082 3LDKA 1HB3A 2IXHA 4GIQA 1YQ2A 4Q4Y1 1A8DA 3AKQA 2ENRA 3ZMNA 5A7NA 3NV2A 1RUE2 2JE8A 5BNPA 5LBFA 5JPMB 2V5YA 1LOGA 3R4SA 2WAAA 1QHDA 2ET1A 3PUIA 2A7AA 3PUHA 1C8M2 3OCPA 4MGYE 1F35A 1GUIA 2IC1A 4Q0QA 4L0PA 3K2OA 1SQ4A 4HETA 5TSWA 1UXZA 1YYNA 3GZAA 3NV1A 2MEV2 2XL9A 3ZYIB 3B01A 1W99A 5JCTA 1YLLA 2E63A 4IETA 2ZGLA 1ULEA 4S2HA 1MS0A 2VC9A 2WO7A 3I2KA 3MIDA 1RYYA 4Z1VA 4PBOA 4MH0E 4XFFA 2QTWB 3GYDA 4FOQA 1S0DA 1Y9MA 3FN9A 5IWFA 2E53A 2J1RA 1QJX2 1WW4A 3J8F2 4YVSA 4CCNA 4QKNA 5FO8B 4DFSA 5GKAC 1ND2C 2FZ2A 4N90A 1C5IA 4W50A 4MGSA 5IFPA 5F5IA 5FUPA 4G3YC 5F6LB 1ULCA 4ASMB 1MS8A 2HWF1 2ZJCA 3W5MA 3KF5A 3NQHA 1GU3A 1O5UA 4AGVA 1O8SA 2YBSA 4JKLA 4UYBA 1GZTA 4YZ2A 3VDDC 4YW5A 3MIEA 1G8WA 2ZX3A 5JDBA 1DFQA 1XSQA 1X9TA 1AX1A 3KV6A 4I3PA 1NLRA 4M3CA 4WM8C 5DUVA 3ZXEA 4NIGA 1ULPA 4IGOA 1WD3A 3U10A 2VBDA 1CVNA 1W6PA 2WYFA 4AFDA 4YPJA 4JHTA 4A4AA 3K4DA 4RQPB 3VBOC 1UMIA 2TBVA 4XURA 2ZX4A 1AYM2 1S2BA 3MF6A 1NCQB 4QB2A 4OVEA 5JSOA 2Z5WA 1ND3C 4PLOA 5J37A 5C3QA 2W0XA 3IMMA 1BEV3 1K5MA 5GZDA 5CNAA 4IE0A 4B3NA 4YG3A 2BBAA 3E1F1 4BQYA 4EWAA 2XHKA 5I91A 1DG6A 4CDUA 4FPFA 4Z07A 5FKBA 2C9KA 5FR3A 1VBB2 3CBNA 3E5QA 5FY7A 1OD3A 1UN1A 1ULGA 2BNOA 5F32A 4XUOA 4NRPA 5DAVA 1IPSA 4MZUA 4DIQA 1DZTA 3MV01 4H7MA 3WCSA 2ZACA 3PU3A 4MXWA 3AYAA 2BGPA 3WQ1A 4NVPA 3ZMOA 4H14A 3A4UA 3BYWA 4DY3A 3V0AA 4D94A 3ZKYA 4PBPA 1LGCA 4NPLA 1HRI2 1U5IA 2D6LX 3FJSA 4NPMA 2HEVF 2JKXA 5HCFA 2XQXA 3BVCA 3KV5A 1IPKA 5F7UA 1WZXA 1WCDJ 4AQ6A 4M4PA 2FMYA 3VKFC 1S0JA 2UY9A 4JAAA 2WNVA 4HN1A 4LITA 3RYRA 3C7HA 4CP2A 3I2HA 4DEVA 5F2SA 1SFNA 2E6VA 4CXYA 3H1YA 4OULA 4A3ZA 2IWGB 1CPMA 1GWMA 4KBBA 4JCKA 2YZ4A 5J7MA 1RHI2 5GLUA 4FSJA 4V2WA 2R0FA 1GLHA 1GV9A 4YWAA 1TG7A 4OLLA 2BOIA 2WFF3 2Q4SA 4QGNA 1UXXX 1KEXA 2WN3A 1J1TA 1AXZA 2R0HA 3K3NA 5JZGC 5EV7A 1LU2A 4CUBA 1ZZ8A 5ABJA 4IEZA 1ZRCA 2A3XA 4YM2A 1BEV1 5EYXA 5EWSA 1WBLA 2VM9A 4IGQA 5CIRA 1QWRA 3K4AA 5FWEA 4A2UA 4QXHA 4CSWA 3U07A 5BNPC 3T1LA 1A8MA 2VCBA 3IAPA 5IVCA 1IS5A 4N43C 1X50A 2BGOA 2PLV3 3K46A 1RVF3 4QQOA 2R062 4GMP3 2A6YA 3KHBA 2E51A 4I02A 4SBVA 3WD5A 4BK4A 2WN2A 5DMYA 1PGL1 2OW4A 3S30A 3KT1A 4P9WA 2X10A 3GHMA 2WQ8A 2EXKA 1QQP2 2FD8A 1CIWA 4KQ7A 1H8TA 4BPZA 5FREA 2IXCA 1EUUA 4CCLA 1XB9A 3D4KA 3TWIA 1KS5A 1S0CA 5J09A 2GC2A 2C9AA 1JODA 1H9PA 2W47A 1W8TA 4XFBA 4YW2A 3W58A 4DXRA 4E2SA 5M0TA 3RG0A 3DPRB 2GC0A 3EJKA 2KXLA 3TEYA 5KHHA 2TUNA 3JB4C 2PELA 2LROA 4KGQA 5LRRA 3RPQA 2NN8A 4LBQA 4X6QB 3S7IA 3F95A 4N7UA 4YVSC 4EN7B 1PX4A 2B39A 4CCDA 1LGNA 2CHHA 5FBJA 4WVMB 4BLJA 2F6BA 3Q8FA 1E5SA 3T08A 4Y5SA 4DEQA 4WBBA 1CIYA 3ZIXA 4PLMA 5E6HA 1E57A 2FZ1A 3LSDA 3AKTA 4K1YA 1JZ6A 4IE7A 3E6CC 1AUYA 5T54A 1CJPA 1RUI1 4CVUA 5GZCA 1Q3EA 2P3IA 3AYCA 3RZLA 3SKVA 1JYTA 2J1EA 4BQ4A 1G6NA 4Y20B 2YU1A 1W6MB 2JJ6A 2WABA 2WFF1 3FMGA 4CEWA 4QKFA 3O14A 1W9FA 3ZYFA 5K0UB 3OUHA 4M01A 5H9SA 2ZOEB 2BWCA 4DY5A 5A3PA 4FFGA 1POQA 3L2YA 4Y1VA 4UBHA 1C1FA 4NMIA 2G1MA 3AKRA 2DV9A 5BPXA 1BVVA 2B4KA 1UYPA 5FZBA 4ZHNA 5FPLA 4YVWA 3RWNA 3E97A 2VMEA 1DQ5A 2G9FA 2XJVA 2PLV1 1RVF1 3GZEA 4MSVA 1GQPA 4GMP1 1JS9A 5FMDA 2Z42A 5L19A 5EJZB 1J1LA 3C7FA 4QX3A 4YSFA 1G86A 4FPJA 1LODA 2WKKA 4XFGA 2XLAA 4CCJA 1K5MC 4ISQA 3RJRA 2A6WA 2IUWA 1AL0G 2EXIA 2ZMLA 4CUCA 5BNNA 1LB2A 5JXHA 2QZ3A 4LBJA 2X29A 3KQRA 4GALA 1EPWA 1S0EA 5E16A 4CDUC 2WNEA 4Q1RA 5CEHA 4V2VA 2EXHA 4DNYA 3POBA 4RFRB 1QIQA 2BU9A 1JZ3A 1PZ9A 1FNYA 1ZM1A 3SITA 1SFPA 4XHBA 2H0VA 4NHYA 1W0OA 3G6JB 4ZY9A 1ZBA3 4I2OA 1UIKA 1W2UA 2PHDA 2VZQA 1YFWA 3SNMA 2DTYA 2LALA 1I5PA 1BBT2 5FYMA 1JHNA 3DUIA 1OVPA 3CJXA 3WF1A 4E27A 3IB3A 4BOWA 5A7PA 4XJUA 4LBOA 2D6MA 2GN7A 5EQUA 3M3CA 2A1XA 3O12A 1QDOA 2ZAAA 2WYSA 1JOPA 4Q4V1 5C71A 5C8CA 1SLIA 4Q0PA 4YRDA 3PU8A 3WQ7A 2ZBJA 2ILMA 2R1DA 5FCCA 2HBTA 1GR3A 1JU4A 2WNVC 2E26A 2HYKA 3ZN6A 1LEDA 5A7WB 5IFTA 3HMYA 4BE3A 1LAJA 4CCCA 1EV13 2Q1ZB 3N9MA 1JMUB 4PI0A 3VBRB 1KDMA 2J1SA 4OUEA 4WM7B 5BY5A 4LE3A 1BXHA 1FAYA 1YC61 4MOAA 3FLRA 3SQOA 3UGGA 3W5NA 1DDLA 3IZOA 4NWVA 2ZABA 4XUPA 3CHXA 4HK8A 1Z7S3 1KJRA 5FJKA 3VKMA 1BMV1 4COZA 1AR93 3S5AA 1W6NB 5EJ1B 4HPKA 3H8XA 4WVVA 2PFWA 2ET7A 1PO12 2XQRA 4ZPIA 5A32A 1JUIA 1Y9QA 4DUWA 5ABJC 1IHMA 3SH3A 3FHIB 2W3JA 4NWWA 4DUVA 1GP6A 1IKPA 2EIDA 4QU2A 3SMHA 1HX6A 2VUCA 4D6SA 5FKCA 1XXNA 2QFEA 3NAPB 2WBKA 4XMAA 2JEMA 2Y6GA 4QX1A 2JDZA 4AXOA 5EFUA 3WEZA 4BU2A 2HJIA 3MV11 4NHMA 4AL9A 1ONAA 2IZWA 1GZ9A 3ILRA 5FYVA 4AQ2A 4HVRA 3ZN5A 1ZBA1 4K7JA 4QXBA 5EIYB 4EN6B 1UU4A 5AC92 1H8TC 1EPZA 5A6QA 1QGLA 2BGCA 1RUC2 2RR12 1K5JA 3RI8A 5C70A 1DCSA 4RR3A 4BIFA 2UURA 3AFKA 1VAMA 4MLOA 4NOTA 3AZVA 4C8DA 1V6IA 3AKSA 1AXYA 3E6DA 4EROA 2WSUA 1S0FA 1RVF2 2W9XA 4MXVA 4TWTA 1NAEA 1VMFA 2K46A 2XVKA 3NRUA 5FZIA 1DGLA 5FK7A 2ARAA 1OURA 3JXSA 5CKQA 5CAZA 5LB6A 1LNSA 4UOJA 2BFUL 5T50A 2HEWF 4F83A 1CAUA 1UOFA 3FC0A 4LKFA 2D98A 1MEC3 2JIGA 4UXAA 1Z7S1 3CKHA 2VW0A 1U5XA 2CDOA 2RS13 5E89A 2ZZQA 4QX7A 1NZCA 4CEWC 1PVXA 1HRV2 5L7OA 4I0WB 3HNYM 5FIXA 5A33A 4ZS2A 3I54A 4CEYB 5FZEA 3WG3A 1PGW2 3AC0A 2A6XA 3N9PA 4NJ4A 1QNWA 4KBZA 2GNTA 5FP3A 1UPSA 3P1IA 1NA1B 3WG2A 2QQJA 4XQDA 1JYNA 2FDFA 1CZTA 2B8MA 2X53S 1NQDA 4YVWC 4DRRA 2W87A 2G9ZA 2E9QA 4D6QA 5T5LA 1LHOA 2RMU1 5D8AA 4QX0A 3EO6A 5FYSA 1POV3 1SLCA 1OLRA 4YZ4A 4UFLA 5FZLA 5CBLA 2R32A 2Z69A 2ZX0A 4CU9A 5H9RA 3CJIB 1H2NA 3AYDA 4HONA 4DUXA 1AYN2 3BOWA 5BNNC 2B45X 5CKNA 3BTYA 3ILNA 5I0SA 3OBTA 4R8HA 1YRZA 1OI6A 3U0ZA 3VKLA 2CL2A 2CY6A 4XCAA 2OQ7A 4XOGA 2VMGA 2VQ0A 2ZGKA 4RYDA 1PX3A 1US3A 2YUEA 3O7OA 4TLFA 1UMZA 2K9ZA 3HVDA 3WSOA 4NROA 2D5HA 5ANQA 5AVPA 3B69A 2JE9A 1NCRA 1HQLA 3KV9A 4IV1A 3O5SA 4DXZA 4UF0B 1RB8G 1VB2A 3B93A 4YW4A 4FFHA 2Y34A 3PL0A 4YARA 3MLJA 1CAWA 3V65A 5C8WA 1O4YA 3KD4A 3HQUA 1ZRFA 1UWWA 1ZZCA 1ZZ6A 5FZHA 2JDYA 2D93A 3VBHB 1RJ8A 4UW4A 4HT1T 3NL1A 1V6NA 1Y7BA 4N9HA 4IEYA 1IKQA 4IEWA 2WJSA 2ARBA 4HBNA 5C8CC 3P6BA 1VBE3 4CDXA 2W2IA 4QU1A 1Q5OA 4QD2A 3FHAA 3ZFGA 3I2DA 2DU0A 3ZSKA 3H3LA 4YYOA 1F2NA 1QOTA 2ZEXA 4IV3A 4J6GA 4C0HA 2OS2A 3IPVA 2HWE1 2P3YA 1LOFA 4CPBA 2HWC3 4ZKTB 2JDNA 2IXIA 2LRPA 3ZFFB 4AEDA 4EQVA 5A3TA 5HBAA 4FBFA 2YC4A 2UWBA 3B02A 5FPAA 1LJ7A 3VV1A 4ISRA 1WA6X 1GNHA 5GALA 1RITA 2W5FA 1BK0A 4OYUA 1X8MA 3LA2A 3SHRA 1LHNA 1WCQA 4XZPA 2R49A 1POV1 1RUJ3 2C1FA 3EXUA 3WP5A 4AI0A 3RZJA 4QX2A 3SH5A 3W20A 3IIAA 1VP6A 1CN1A 1U12A 2QBXA 2VY0A 2W1SA 1JW6A 3K75B 4Y4YA 3B94A 4KNCA 3RNSA 4QGLA 5KXBA 2ZGSA 1EV12 2BJSA 3BKZA 4JDOA 2JG8A 3NMBA 5A1FA 1YXWA 5FP4A 2Z2SB 3K48A 1R083 1SACA 4AI8A 2YPDA 1D4M1 1HV1A 2A71A 2XGXA 3GNEA 5T55A 3C7GA 4E4ZA 5A6XA 1AL22 3WP4A 1ENQA 3LA7A 2Z4FA 5IATA 1RUE3 5L36A 2VMHA 1AR92 1X33A 1PZ7A 3VBUB 4LO7A 4EV0A 4W8JA 3OOXA 5FZ4A 1OC1A 1C8M3 4RR3C 5C9AB 2BFUS 4CYDA 4HOOA 2XUMA 4LPLA 3WG4A 2VNGA 3POGA 4M3CB 1G9AA 3UKNA 1LGBA 1W6PB 3TOJA 1L7LA 4MO3M 1GZCA 4M0NA 4CDQA 1VBE1 1SPPB 1HXS2 3CIHA 1TZOA 2GAUA 2L9LA 3LDBA 4INDA 3TEXA 2X5IC 1W9YA 3PVNA 4XJZA 1AR72 4XJ8A 1O7FA 5DQ0A 1DZRA 2AEYA 4AOCA 3OGVA 3B9CA 3K51A 4LXLA 2W52A 1ULFA 4Q27A 5CU1A 4YW1A 5IAVA 5C4WA 3ZR5A 5F5QA 1J59A 3H8UA 4IEOA 4W6YA 4AAPA 4GWNA 5F5CA 2X8KA 2PQSA 2VGDA 3H1WA 2YC0A 4QX8A 2QUOA 3A7QA 2A6ZA 3SEPA 5L7OC 4EWEA 3S57A 3IMNA 2VZVA 1RUJ1 2XLGA 4EN8B 4MXWB 4AR2A 1AR62 3KCXA 5G05L 4UFKA 1W6QA 1WW5A 1TNFA 2ES3A 5F3EA 3V0AB 4FTEA 3F2ZA 3Q8CA 4FT8A 2AR6A 2PHUA 1NXMA 3ON7A 3JQXA 4LBNA 1R081 1LOAA 3J26N 3LPFA 3T1MA 4W6WA 1N1SA 4ZONA 1MEC2 1GBGA 3JD73 4FAGA 1ST8A 4QXKA 5FTTC 1ND2A 1RUE1 2ETEA 2PN5A 5E8AA 1RJ7A 2RS12 3VBFB 4YZ5A 1JZ7A 5DZGA 2WZEA 3NNJA 1AYM3 2DTWA 4NAMA 1YUDA 3DKQA 1ZBE3 1C8M1 2XB6C 1UZWA 3DYMA 1VJ2A 2VTFA 5D21A 5FY9A 1W8NA 2JECA 3D82A 4CUAA 3BCWA 1BCXA 3WDVA 3VDDA 1JOBA 4Z92B 5ACA2 3DYOA 1NCRC 2MEV1 2QE3A 3IWZA 3L2HA 3WUCA 4IV1C 4D8MA 2D97A 1RXGA 1KITA 1AX0A 1VBB3 2VZSA 3KLSA 4A41A 2GN3A 3DGTA 3M7AA 4S2FA 3U1XA 2YGMA 3ZFEA 2WZR2 1V9U3 3NW4A 3BGAA 3MPBA 5IK5A 1M4WA 3O1PA 3UV9A 3V56A 2PHRA 2PTMA 3BIEA 1W6OA 3HBKA 2Q8OA 3NJXA 1LRHA 4KWUA 5H9PA 1XYNA 5IAXA 1DLCA 2E31A 2IFRA 2YV8A 1VBD2 3PVEA 2G4IA 5FZOB 1ND3A 1UZYA 1F15A 3D5OA 4OMCA 5IVJA 2RDNA 3ZFGC 1QJFA 1Y4WA 4L11A 1IQAA 4P5YA 4IV3C 5B4NA 4HFSA 3AP7A 4XIKA 1C1LA 3A0KA 4IUGA 1LOFC 1DP0A 4Z2AA 2H6CA 3BUCA 4E8DA 2Y8KA 1UL9A 1WMFA 1H8VA 3BOPA 4XQ4A 4AEJA 2BNMA 4N9IA 3H8RA 1QOSA 1R1A3 2EA7A 3ZYGA 3WW1A 4XILA 3FBMA 5DPNA 1RHI3 1H1AA 4HSJA 2QJVA 5BNOB 1JYIA 1Y3TA 1UCXA 1VBE2 3JD71 3N9NA 4LBQB 1SG3A 1O91A 3MLKA 1RUG2 4PIXA 1CONA 1FX5A 4QPIB 2SLIA 4Y5TA 3ZXJA 4UFJA 2XH6A 1AYM1 4HN0A 4WV8A 2VCCA 2JG8C 4Q4X3 1ACCA 2HWC2 4TYSA 1JXNA 2R6QA 1B35C 2ZS6B 1DQ2A 2LM3A 2VZRA 1AR83 5A7OA 4R9AA 2F17A 4HKLA 4COWA 1YQ5A 4XVHA 1PNGA 2V72A 3I8TA 4PDWA 3ENRA 4BMBA 1OF3A 1NLSA 2D3PA 1VBB1 4OQ8A 2R063 2WWSA 3TB0A 3IDBB 3N9OA 3USUA 4R9DA 3OB8A 2OIIA 5GJ6A 5J98B 4YM3A 2GNBA 3RMYA 4YNIA 1QJU2 5FRAA 3NNLA 1HN1A 2X05A 5FYUA 1RL3A 3CEWA 2EIEA 2P1BA 3FX3A 4LEJA 2Y64A 1W06A 4E2QA 1VAKA 1HRI1 3I2IA 1XE0A 4BXSV 4FPGA 2UWAA 2Y33A 3ZO0B 2XONA 2VR4A 5IK4A 1JZ4A 3ALQA 4B7KA 3WW4A 4F3JA 4OUMA 4ZU7A 2O0OA 2QQKA 3JQWA 2JENA 4LTAA 4N43A 5C4WC 1GNZA 4NIDA 1DGWX 4IGPA 5F3IA 2P4EA 4M4RA 3WXPA 5EPAA 1QY4A 1UY1A 3BIWE 4IEUA 3D8CA 3IKWA 4JQRA 4XTMA 1WMDA 3HJRA 1OBNA 1R1A1 2KR2A 4OI2A 4IL7A 1W3VA 5DUUA 3OGGA 3HIFA 4H55A 3WG1A 1RHI1 4LQRA 4BDVB 4R4ZA 2ERFA 5FYIA 5D2AA 5DG1A 3R0RA 5CFDA 5FYZA 4LHSA 2W92A 2J1VA 5DAWA 4B4RA 2K0GA 4P5HA 4M0HA 1A34A 1EAH3 5E1RA 4Q4X1 2E7TA 2VOTA 1YFYA 5FY4A 4FTBA 2VCMA 1UX6A 1WLDA 2OPKA 3VHPA 2W39A 1X9PA 3VZLA 1YEWA 4Y3OA 4EJRA 3I49A 1LTEA 2VXRA 5DXDA 3APBA 3ZN6B 4RS5A 2R061 1AX2A 2EF6A 2VD7A 5KHJA 5JOZA 4D0QA 5A3MA 1XQNA 2XJUA 2GDFA 1JYWA 3H8OA 1QQP1 2NP0A 3IDAA 1E5IA 2WWUA 2YU2A 3OF1A 2FDHA 3PVOA 2XVGA 4L8QA 3AJZA 5JXGA 3M3IA 3PIJA 3I59A 5FUIA 2EAKA 5IYYA 1HN0A 3HN3A 3M70A 4NR1A 3ZFEC 2P3KA 1W8HA 3JD72 2R043 2VL4A 1NYWA 4BZ4A 2WZ8A 1X7NA 5F3CA 3TBDA 2IVJA 1CAXA 2PYTA 3ROUA 2JG9B 4I09A 4MG2A 3J7HA 1NE4A 2IXLA 3IIIA 1MZ5A 4B7EA 4XMIA 2WFPA 3VL9A 1EYBA 1ZBE2 3D0SA 1BBT3 4FOWA 4OHZA 3GBWA 1YHFA 1JUHA 1W39A 2Q8EA 1VLNA 3KMHA 2XBO2 5F39A 5HV4A 4HLTA 1QJZA 4FPKA 3LEMA 1SFYA 2QDNA 4GH4C 1DQ0A 1T6BX 4BH9A 2PXJA 1OOPB 5A6ZA 2SBAA 5C5TA 2R7EB 3VGIA 4XF0A 4CUGA 3M1HA 3IDCB 4LLFA 1W8FA 2D6PA 1WGPA 2FDKA 1DIWA 1V9U2 3SCHA 4PCRA 1VBA3 3ZYHA 3ZLIA 1EAH1 3WNPA 2LUWA 4AG4A 1RGSA 4TTGA 5J48A 2VBBA 2DU1A 3A23A 1S2EA 4NAOA 1LCLA 4JDNA 2WNUB 5A6YA 2V5DA 5LBCA 1TMF2 1W8ZA 5BUVA 2VBPA 5IVFA 1U5YA 4QPYA 1K45A 2P6HA 2Q0AA 5LA9A 1STMA 3VN4A 3DF0A 4ASKA 1PO13 3I2FA 4N53B 4PF5A 4QPGB 4GJZA 3AB0A 3N35A 2UY8A 3HAGA 3GCWA 1Z78A 2ARCA 4NIHA 4UWDA 1R092 3WINE 4EN0A 2HKXA 4PDWC 4AVBA 1OA3A 1PZ8A 2CGOA 5IK7A 2VAUA 1D0GA 3NJVA 4IE5A 5F6KA 2ZHKA 1R1A2 1DQ1A 5I93A 1QF3A 4MHRA 2BNNA 2ZEZA 2ZKLA 3JU9A 4XABA 4Y24A 1SLAA 1JH5A 2VXJA 3CQOA 1O3SA 2R041 2R30A 4RHV2 2RJLA 2GNMA 3ZYBA 4L92A 5AC93 2EIBA 4Y5Z0 4CTEA 1RUC3 2RR13 2AC1A 4Q4X2 1YIPA 1BBT1 2I07B 4PHZA 1WKYA 5D8AB 3WQBA 2CNAA 1AR82 2EVXA 4FFIA 3PTRB 3LCPA 3WF3A 2DBIA 5GZEA 1UY3A 1SLLA 2BTVC 2D6KA 2NYYA 5EYYA 4GXLA 4ES9A 5ANNA 3H50A 1ZREA 3M8LA 1XC6A 5F5AA 3U37A 3THTA 1SBDA 1Q8OA 4LUKA 5FZCA 3MICA 4QKDA 1VBA1 2Y38A 5A3LA 3RSJA 4AVAA 4M00A 5CFCA 2HWB2 2QZ2A 4HKOA 3ZSMA 3MUY1 3E5UA 3FHQA 2GALA 1M06G 5GLVA 4XXPA 1K42A 2AYHA 5FFOC 2E33A 1QKQA 1YJKA 2J1UA 3KB5A 4OFGA 3OY8A 4IEQA 1SBEA 3SXWA 3UJQA 5CFDC 3CLPA 5KXCA 2RG4A 3MBWA 2I45A 4GQ7A 1HRV3 5T5PA 2P17A 1OLQA 1PO11 2AREA 4J1XA 5FDBA 4XETA 2JICA 2DCZA 1MQTB 4WZCA 1GOHA 4AAXA 1ODNA 2XL7A 1CZSA 1GZWA 4CDXB 2WO1A 4E9KA 1W0PA 1OQEA 2Y6FA 2EIGA 2ZGNA 1A78A 3VD3A 3ZFGB 4CCOA 3VBSA 1XSRA 2TNFA 4RS5C 4FPOB 4CA9A 1S0BA 3D6EA 3IPVB 1RMU3 3X29B 1LU1A 1PK6B 2C4XA 4Z2WA 1G9CA 2Y26A 4DB5A 5J36A 3VKOA 1AYN3 2W1WA 3AJYA 3GALA 3MYXA 3MGUA 1J84A 2Y0IA 2D40A 2DF7A 4HSLA 4X6RB 4XUTA 5AC91 4XUQA 5A3UA 1RUC1 2RR11 1EAH2 4MADA 3QD6A 1EP0A 2XUEA 4Q1PA 2FHRA 2BDRA 4DS0A 3WDXA 4KGGA 3FL7A 3I7DA 3OYWA 4DZGA 2WSVA 3BPZA 4CU6A 5LW9A 3NJZA 5T5OA 4DMIA 1WLCA 1O8PA 2WRAA 1ZZ7A 4P02B 5LA0A 3TEZA 2VO5A 4AYUA 1ASJ3 3NNGA 2XR4A 4UW5A 4YGEA 5LRSA 1SEFA 3MPPG 4AI3A 1FPN2 1XE7A 3AM2A 4RA0A 3RS6A 5JAXA 2BRTA 1DZQA 3POFA 1FV2A 5C5UA 2RE9A 1OLME 5FY1A 1PHMA 2YG0A 4JGZB 1CWPA 4E4SA 2VNRA 3DV8A 1WD4A 2NQYA 1WW7A 2A70A 1H1MA 2R042 4A7ZA 4CP1A 3J7MA 2P5BA 1HRV1 2VG9A 2VVEA 2XXZA 5FPBA 1VAVA 2GU9A 2RM22 3AP4A 2R16A 1FI2A 1PGW1 4KG8A 4UFIA 4CDWB 3ZXLA 3LWCA 1A6CA 4JGYC 5I0UA 1F31A 4CDQB 4BYYA 3H0OA 3UGHA 5LY1A 3ZIWA 2IXKA 2XKOA 2ZAHA 1WW6A 1LECA 4XF4A 3GZUC 4YGCA 1JTZX 5C4WB 3UKTA 1ENXA 1AYN1 2VE1A 4LOSA 4KG0A 1PMIA 1VBA2 2QQLA 1Q56A 3MIBA 5JI7A 3JCIA 4L99A 2I74A 2GP5A 3N7MA 3OPTA 5JVVA 1AL23 3SKJE 3I2GA 3JUUA 1VMJA 1ASJ1 1W6QB 1ULOA 4FQZA 1ULDA 3EMRA 2VMCA 1RUH2 3BU7A 2YC2A 2CWSA 4O7XA 4SLIA 3VZJA 4DQAA 4C1XA 3AP6A 3JZVA 4IEXA 1X8EA 3O1UA 3USSA 2E32A 3H3UA 1CX1A 4YZ3A 4LKDA 1ALYA 1J58A 3T09A 4RD7A 3OBRA 5IK8A 1DBNA 1ND2B 4Y4RA 4GD4A 2CSGA 1HXS3 5F8PA 3WX5A 1AJOA 1QXRA 1LEMA 2LW8A 3CU7A 3H7JA 5FV3A 4ET7A 3GDBA 1AR73 5C7GA 5FO9B 1GYKA 1Z0HA 2UWCA 1N1YA 4ZU4A 3WF2A 5CFCC 5A3OA 3BB6A 4NPRA 1F4HA 1CR7A 1H1IA 3VDDB 1UKGA 5KHKA 3FE5A 4GJYA 4P9LA 4A7KA 1MZEA 3R05A 5FK8A 4CCKA 3ACLA 3ES1A 4U2AA 2MNGA 1QH6A 3MIHA 1UYZA 4IEPA 2RJ2A 5FYCA 5I0TA 5A3WA 3DCQA 1T6GC 4HMZA 4WM8B 4FPYA 4JDMA 4JTOA 1W2NA 2D3SA 1ZX5A 3MO4A 4FO9A 4FPEA 4LR4A 5HCBA 5JOXA 1W8WA 1FNZA 1AR63 3VBOB 4TXWA 4MYEA 2X5IA 3NV4A 4AI2A 1WCKA 5FZAA 3L9JT 3K4ZA 2VUDA 5FMOS 4LT5A 1BHGA 2QQIA 3WNLA 4YGDA 1EV11 1ND3B 4QAWA 5LEKA 3LD8A 1YCIA 3GF6A 3VBSC 5JR7B 1RUF2 5DZFA 1TME2 4IW3A 5JPNB 4E2GA 1AL21 5GLZA 3VLBB 1MZFA 1YI9A 4X8NA 4G9SB 4BQ2A 2RJKA 2KD7A 1AR91 3CMGA 1KRIA 4LO4B 1OHFA 1UF2C 3S7EA 1OUXA 4J1WA 4AI1A 2WL1A 3SH4A 1JZ8A 4XC9A 4NHKA 1GWKA 2QQUA 4FOVA 1W2TA 2VQAA 4PF1A 1L3JA 3PVBB 1HLCA 4XHXA 5ACA3 2A3YA 4LO5B 3BTXA 2DWRA 3HPNA 5I8TA 3WUDA 1HXS1 3ZPYA 3WV6A 1RMU2 5FLIA 3TNPB 2WZR3 1AR71 1F5FA 4Q4W2 3THDA 2O8QA 1H4GA 2DVBA 3AZWA 2DURA 3PHMA 4IESA 3ZSJA 5FZ1A 3RFRA 1NY72 3WDUA 3RZKA 1TQ5A 1S0GA 1YWKA 1LOCA 2D43A 1VBD3 3U4SA 1HV0A 2XJSA 1IG0A 3NO8A 1GFF2 1JZ2A 3ZDSA 4O9EA 5K9YA 1XBFA 1BJQA 3AMPA 1HIXA 3ST7A 4C90A 1O3TA 1I6XA 1W2OA 4TLGA 2ATFA 2C26A 1ASJ2 3N9QA 5A1AA 2VUAA 4LBLA 1AR61 4P00B 1S1AA 1UIJA 5JZGB 2WZPP 3NSTA 3EQEA 3M3EA 4OI4A 4HK9A 5LZ6A 4XTPA 1I3HA 1OMIA 2ZX1A 4Y1UA 1JYCA 1XPWA 2VPVA 2FQPA 2WR9A 4CCEA 5K8SA 1C5HA 2HYXA 1EY2A 1WMEA 2ZGQA 4XQWA 2FCUA 4YG0A 5DUWA 5BNPB 3O1OA 4QGMA 1MEC1 4JZRA 3KF3A 4N43B 3ZYPA 3N4MA 1XE8A 2DFBA 1QJY2 1RUG3 1JBCA 4DO0A 2RS11 1QJEA 5JI9A 1ZRRA 2BP6A 2VW1A 3Q8BA 4Q0VA 4QQPA 4Y22A 3I3QA 3VD9A 3KZ4C 3DPRA 3SEEA 2NPIA 3WNMA 3WHTA 4I3GA 4ATFA 3C2UA 1UU5A 3E6BA 4QT6A 2GMPA 2PAKA 5DN2A 1KGYA 3HWJA 1AHSA 5ACA1 3QACA 4IQPA 1PGSA 1IOAA 4Q26A 5CKMA 3VDBA 2QVSB 3V64A 1BYHA 1SLBA 1F9KA 3BODA 3G7DA 4WVMA 5J1XA 4LHNA 4S2DA 2WZR1 3PUSA 4D69A 3GZTB 3SISA 1IS4A 1NOVA 1QJU3 3KCCA 5FZ7A 4YVSB 3D0JA 2YB7A 4KU7A 2VJXA 4Y20A 3SCFA 3WNXA 4CXWA 2W46A 1W6MA 4LHKA 1VRBA 1VBD1 3MFCA 3OPZA 4DRVA 2BBVA 1B35A 5K7PA 3FUOA 4RS5B 3RGBA 4MUVA 5K0UA 2DCJA 4BHPA 1IPJA 2AH2A 2JDMA 3CL1A 5JMCA 2WA3A 1MS1A 3H42B 1K3IA 1WLWA 2BYVE 3T2PA 3WHUA 1W9SA 5LWBA 1RUD3 4Y1XA 1XRUA 2BVVA 5FP8A 2QDRA 1OPOA 2WS93 3I59B 3B7MA 1O59A 4YM1A 5FZ8A 5LATA 4GMP0 3NVCA 2DFCA 3AZZA 3MUZ1 4NUBA 5JXJA 1KXGA 2B7YA 1CAXB 1ZA7A 5FUNA 2V4AA 1RUG1 4EZ4A 3ASIA 4XFCA 2B5HA 5IJRA 2FDIA 4OHYA 4O65A 4LA3A 2XMLA 4LO6B 1K5MB 1LULA 2CAVA 1Q8QA 2HWC1 4QHOA 3ACHA 2FDGA 5FO7B 3NWKA 1N3PA 2JKBA 4CDUB 2W94A 1NG0A 3EHKA 3VZMA 4XBLA 2FBEA 1GMMA 3HT2A 2BV4A 4MHUA 1T2XA 1OVSA 2XWBB 1FV3A 3NNFA 4COYA 1ZRDA 4XDOA 1PIV2 1W9WA 5FYBA 4QXCA 1J83A 2RS52 3HNMA 3VDAA 1FMD3 2ZXQA 3B5LB 1UQXA 2ZKNA 1QJU1 3KVAA 2VH9A 4LBQD 4BWOA 5KHGA 5KXDA 3O1MA 4PQ9A 2VQUA 3S0MA 3O1SA 5KC6A 4XF3A 1OH3A 3UJOA 1QU0A 4GKXA 1V0AA 2JXAA 4FQ4A 3ZSEA 5JIAA 4B29A 1CGPA 2XPJA 3POIA 3T0AA 3RZGA 2XJTA 4WM7A 3OG2A 4LKEA 3RQ0A 1Q8PA 2FDJA 1QNYA 1FATA 1VR3A 3KT7A 3TN92 2WNVB 3RZMA 4CRQA 3RYPA 3DXTA 4IDZA 1RUD1 2DVDA 1NE6A 5FZ6A 2WS91 3PLQA 4QMAA 2QQVA 1Q8VA 2XBO3 3LDRA 4Q0UA 2GZWA 2VOKA 2ZCWA 5HXVA 4AVTA 2V73A 1Q8SA 2A3WA 3AKPA 1MS4A 2ZMNA 2HWD2 3QH6A 4FI9A 4K3UA 1GICA 3KCYA 4ZU5A 2OA2A 1DLLA 4AI9A 5KC5A 3I97A 3LOIA 2WA4A 3ZPOA 5ABJB 3N3HA 4B8EA 2ZGTA 1GP4A 5BXXA 1VPHA 2WQZC 3UK9A 5F1RA 5FYHA 2BVBA 3DYPA 2ZX2A 5F37A 1TMF3 3JB8A 4AVSA 3T0DA 1W05A 3LSEA 1LHWA 3NKTA 2V4VA 5GZFA 4JX0A 2XJRA 1H4HA 3SCGA 1VBC3 3BI3A 1E5RA 2V09A 3PURA 4GH4A 3H9AA 3FFQA 4YFWA 1LHUA 4BK5A 4FCAA 4P08A 2UU8A 3DPRC 5JOYA 1H8TB 3THCA 1FMD1 1XNKA 1MZ6A 3IBMA 1R093 1TE1B 1GKBA 3ZXFA 2VU9A 2WO2A 3A22A 3OSDA 4K1ZA 3ZYJB 4CZSA 5CG8A 3C3VA 4B4PA 2AZ5A 5FZMA 1FT9A 3KSCA 4FAHA 4OZOA 4UAPA 3WDWA 1TVGA 2RDRA 5EP9A 3WT3A 2ARXA 3AK0A 3PTYA 3ZOIA 4D3WA 4RL7A 5KHIA 2R1BA 3MLLA 4KL1A 4Q4Y3 4RHV3 3LZZA 4IEVA 3WP6A 3LAGA 1BLZA 1LENA 1ZVFA 2VMDA 4IXLA 3TAYA 3WOGA 5JWPA 4R9BA 3ABZA 4MV2A 3RRDA 2BQPA 3WZ1A 4RSUA 1CZVA 1ZBE1 3AL5A 2ADDA 3AFGA 5FAXA 3VBSB 3I3BA 4QQLA 2WC2A 2RV9A 2XBO1 4LK7A 5K0UC 1PVC2 3OGRA 1BK1A 1HW5A 4CEYA 2ZGOA 3Q9OA 3O1TA 4EZHA 1JHJA 4E8CA 3NJYA 3KQ4B 5CB7A 1HJFA 4N8MA 3RZZA 4CEWB 1NA1A 1UY0A 1UMHA 4D6RA 5FOJB 4QM9A 3LKJA 3SLIA 1OKOA 2F4PA 4XDQA 1OLMA 1V9U1 3GM8A 2HH9A 2CAUA 1PO23 1UZZA 2UYAA 2HWB3 2OZ6A 4O9GA 3WCRA 1S2KA 2O8OA 3M2MA 4XF9A 3WY6A 1Y43B 2O1QA 1X82A 4YVWB 4XEZA 4PIZA 2RS32 1UZVA 1SCRA 2Y0OA 1TMF1 1RINA 4NRQA 3AP9A 2GC3A 4YG6A 5DAQA 3ZKUA 2ZZJA 3I3DA 4LKSA 3S5QA 3W21A 5LBBA 1IZ3A 1DGRA 1HB2A 1UAIA 5F2WA 3WNOA 4ARXA 5BNNB 5FQ0A 1RUD2 1SMVA 2FCTA 3ACGA 3ZVXA 1R091
chains in the Genus database with same CATH topology
2WS92 1KD7A 5JSPA 1COV2 5T3NA 1H2LA 2IFWA 2ZHNA 3VBHA 1OSGA 3HT1A 4XBNA 4RHV1 3PJYA 5JIUA 1MACA 5D1IA 1DQ6A 2A5ZA 4MVTA 1FOD3 5CG9A 4MGKE 1AR81 4WVZA 3VBRC 3J9SA 5C6CA 4WM7C 3WLUA 4KWLA 5J3UA 4XYXA 5C8CB 4F8AA 3ZFFA 1IS3A 3EBRA 2DCYA 2XJQA 4KU8A 2ZPXA 2QCSB 1FPN3 3ECQA 2CYFA 3M3OA 2ZMKA 2GMMA 1U5ZA 1D0HA 3CO2A 1FMD2 4K21A 5KXEA 1CESA 1MVEA 1PO21 4AGRA 2HWB1 4FXGB 1POV0 1VRH2 5FBZA 4Y1YA 3AP5A 1I5ZA 4OHVA 4HVOA 4BM8A 3P3NA 4HPKB 3T2TA 3WP3A 4K20A 1QXJA 4ASLA 3NAPC 5A32B 4AHWA 1HQWA 4HL0A 3JBG2 1HKDA 5LK5A 2RM23 4EWDA 3J4UH 4I0AA 5I0RA 2B9UA 3VBUA 4YFZA 1BKZA 3U11A 2Z79A 5C9AA 2ZGUA 3ZXKA 4XFHA 1YI7A 3WW3A 2YROA 1JN2P 4META 1ENRA 1V6JA 3O0WA 2PA7A 3MIFA 4NHLA 2ZGMA 4RR3B 3RI9A 1JOJA 2PHTA 1FOD1 4QQ2A 4Z8BA 5AFBA 4JC1A 4HANA 1S0IA 2H0BA 4I0BA 1URXA 1DU3D 2KA3A 4JGYA 5EJ3A 2QKDA 1GQGA 2MPFA 4GB32 4AQTA 2X5IB 1VBC2 2FMDA 1YFUA 1QXPA 4LHLA 1RUH3 3V0BA 1FPN1 4HVQA 5HI0A 4LULA 3NKGA 1KFXL 1CAUB 5JLVA 4AEMA 4CEYC 2NM1A 4N7IA 1NA1C 4CP0A 2R072 4BLIA 3WDYA 5GLTA 3VZNA 5L7OB 5A33B 4YM0A 1Q43A 4Q4Y2 4LA2A 1G7YA 1ENSA 2B46X 2RM21 1RUNA 4NN0A 1O3QA 3CJIC 2QNKA 1OQ1A 1GQHA 1O4TA 4WVWA 2OVUA 3VBFA 2WT1A 4ORFA 3P3PA 1QH7A 4LLOA 3GBGA 4LNVA 4C0BA 1DGRN 1V6KA 1DHKB 4OHXA 1RUI3 2VNOA 1S55A 2GSYA 3KM5A 4GULA 1QDCA 1ZA4A 3GHNA 1ZYBA 3MDPA 1RC6A 1BQPA 2JD4A 2PAEA 1PO22 4XBQA 1H2MA 3MIGA 3VHNA 2I2SA 1RUF3 4YGBA 1TME3 1NCRB 3VBHC 1H30A 4IV1B 5CA6A 2GNDA 2YDEA 1CAWB 3QH7A 5DZEA 1OKQA 2GH2A 1RUH1 2PHWA 2XJPA 4BQ1A 4COVA 4LE4A 5BYNA 2HWF2 2JX9A 1UU6A 2A6VA 3R4UA 2UYBA 4FPLA 4AVCA 3N7JA 3OTFA 1MS3A 1U0AA 3U4XA 3ZFFC 2ZHLA 1YO8A 3H1MA 4FVVA 5JOWA 4IV3B 3BTAA 2CGPA 1KS4A 3AMNA 3ZX7A 1XNDA 4Y22B 4URTA 3ZXGA 2GMEA 1REDA 2Q30A 4Q4W3 4AFAA 3VL8A 2PAMA 2P34A 5BNOA 2PHFA 3TRSB 1FOD2 4XIOA 1MVQA 2OZJA 4ZXKA 5FMOL 3WVJA 2WINB 4QPIA 3ZYRA 1NQJA 4OUSA 1ZZBA 4OI1A 1BZWA 1REEA 3FUQA 1C28A 1CAVA 3HQXA 3MW3A 1QMJA 2D44A 1OFSA 2CV6A 4Q4V3 4B4QA 4XXAA 3VBUC 2JG8B 1TNRA 1H9WA 1B35B 3MW4A 3IN9A 4AK3A 1RTVA 2OYZA 4PLNA 4DPNA 2NZ9A 5C9AC 1ZNPA 1RUF1 2NMNA 1TME1 2XWJB 1MR5A 5BNQA 4Y1ZA 4C1WA 1QJY3 2VW2A 1OFNA 2AENA 3ELNA 2XG3A 1N3OA 1A3KA 4COUA 4FTSA 2YXSA 1XU1A 1MS5A 2D5FA 2ZGPA 1PNFA 2DVGA 2DVFA 3I4IA 5GM0A 4BMEA 4YW3A 3VHRA 4LBKA 5H9QA 3W9AA 1YFXA 3KS7A 2XLFA 3FLPA 1V00A 1RMU1 1HDKA 1CD3G 1DYKA 2EALA 3H7YA 3MW2A 1XNCA 4E4DX 1UD1A 4Q29A 4Q4W1 4A7YA 3LGRA 2VOWA 1V6LA 1LOEA 2BWAA 4FP3A 4LO8A 1N1VA 1NY71 3ZN4A 2RHPA 4JTNA 4P9JA 1SBFA 1BEV2 4U36A 3NV3A 3PMEA 3A0NA 1H0BA 1GSLA 2PHXA 3RYKA 5GLWA 2PQQA 4AQSA 2P37A 3FFZA 2DUQA 4KWKA 4W65A 3VBFC 2Q5TA 1YNAA 5J96B 1PGL2 3TNQA 3VUOA 3LB9A 3O0XA 2D6OX 4Q2FA 2H6BA 4YZ1A 5DDJ3 2BEOA 2WT2A 1QJY1 1R1ZA 4GWMA 5HCAA 4QQHA 3DL3A 1D4VB 1C57A 4MX3A 2C5DA 2E7QA 3RMXA 3WW2A 2DYCA 4P9GA 4A3XA 4BCUA 5KWRA 2HEYF 5C33A 4XPVA 2VMIA 3IM0A 1N3QA 2JG9A 3OD0A 4RQPA 4AHXA 2AGSA 2ZGRA 1NCQA 1CX4A 3ZFEB 4JV4A 5JSRA 2RMU3 3ATGA 4FOYA 2D7FA 1PIV3 1LHVA 2RS53 3AXDA 1SLTA 1V70A 1W6OB 1RUI2 4K6BA 1XNBA 4IERA 1OPMA 4M3CE 1OOPA 2DCTA 2WFF2 3ME2A 4ES8A 2VOVA 1N1TA 2VECA 2Q1MA 2WLPA 1G9BA 4GH4B 3VHOA 4F7ZA 1XYPA 2ZA9A 5FPZA 1KDKA 3QCWA 5FLHA 2C0ZA 1DGWA 5E88A 3TN93 5BNOC 4AW7A 2WNUA 1O4ZA 3CF6E 1OA2A 1F5JA 2PLV2 2VUJA 2WLQA 2VULA 4G4FA 2NMOA 3QBQA 4HKWA 4QPIC 4FXKB 5DUXA 2LTNA 4FPHA 4N53A 4QPGA 2QQPA 4L2NA 3LOBA 4JRAA 1TEIA 4I01A 5IUQA 2JE7A 2HWD3 3FWEA 4I30A 3HN1A 2VOXA 5DDJ1 4D7TA 3W59A 4P14A 3ZSLA 4PJYA 1CJDA 4XE9A 1X36A 2HWE3 3M4FA 2EXJA 2ZHMA 1V6MA 3THPA 2DUPA 5B2GB 4PDWB 2BUKA 4S2GA 3INAA 5BV6A 1YJLA 5FPXA 4QX5A 3USUB 3AZXA 2KM2A 1H2KA 1FYUA 1PIV1 2RS51 4AHYA 4TZDA 4Q4V2 5AVAA 1UPIA 1MS9A 4WZFA 5SV8A 4AVVA 1J3QA 3VKNA 4L97A 4LBMA 3TYJA 2TEPA 3AZYA 3MF9A 4L9BA 2EAAA 4K9SA 3WR0A 1WLTA 3MI8A 4JVAA 4Q0SA 2VVFA 1D4M3 3URFA 5F9TA 1LESA 5FQ0B 3POWA 2P3JA 3TN91 1N47A 1BMV2 2OUHA 4BA6A 5FOBB 4D7YA 4M3CF 3ILFA 3DN7A 2G9GA 1PVC3 3BALA 4RGGA 4AHZA 1F8VA 3ES4A 1AJKA 1MQTA 5CFDB 1WBFA 2HWD1 5FLJA 2W68A 5EXOA 3HBZA 4Z82A 3FZ3A 1BVP1 2BW8A 3AMMA 1ZZ9A 1PK6A 1ZBA2 2DVAA 1OA4A 1WCSA 4AGGA 5IT6A 2RS33 1WUVA 3AMHA 3RJ2X 4KH9A 1C8NA 1QOOA 3M3QA 4JRLA 3QLQA 1KJLA 2WQ4A 4OI0A 2YHJA 2ZTNA 4R4XA 1PM7A 2CTVA 4BIOA 1CQ9A 4XFAA 3OD4A 5LEJA 2JG9C 4RQPC 1COV3 3MFAA 2WIIB 1NCQC 3AYEA 4ATEA 1WA4A 4Y26A 3N7LA 4AF9A 2CWMA 5AFEA 3IT8A 4UBGA 4AEKA 1O5LA 4GKYA 5DDJ2 4P9YA 1Z7S2 3B00A 3AX4A 2IXJA 4JGZA 1AF9A 1D2QA 1OOPC 1VB4A 1HQNA 2XVLA 3HD8B 2DUOA 4NO4A 5I8SA 3POSA 1IS6A 1PVC1 3HR9A 1D2SA 4XJ9A 4R52A 3WQ0A 4X8PA 3RDIA 2MEV3 4CDWA 2WNUC 2RMU2 1IGOA 3UL2A 5KBFA 1LR5A 3B9IA 3FBYA 3ETQA 4N53C 3S6PA 4QPGC 4KWJA 1VRH3 4JGYB 3IDEA 4P9IA 3N7KA 5EZWA 1I1EA 2RS31 1QJX3 3J8F3 1RUOA 2W08A 1AVBA 4QM8A 3VBRA 4AWDA 3V0BB 3H3ZA 1G9DA 1UW8A 3JBG3 2D3RA 2GH8A 2PHLA 4UW3A 3PNAA 3POYA 4K40A 1REFA 1W6NA 3KGZA 1COV1 2A75A 4RGAA 2GC1A 4R9CA 4XF1A 2A73B 4MGIE 4H7LA 5D8AC 1DQ4A 2YY1A 1C4RA 2N7GA 1OD5A 3E5XA 4C91A 4Q8KA 2YYOA 2CGNA 1DF0A 3NAPA 2YGLA 4OZXA 4AFCA 4EN9B 4ITCA 5GZGA 2HWE2 5DG2A 1LOBA 1KQRA 5T52A 1NXD1 4OHWA 1J3PA 5CVRA 3ZXAC 4HZFA 2YMZA 4GB33 5L73A 1AXKA 2DCKA 2XKPA 5CFCB 3LA3A 4D7SA 4WM8A 5T5JA 3PJQA 4XW3A 3B3QE 3VZOA 3KT4A 1SDWA 4LUMA 1VRH1 1RIRA 2B42B 1MQTC 3VBOA 4XFIA 3OY8B 5I8YA 4YLZA 1QJX1 3J8F1 3QOPA 3AXEA 4DINB 2R073 4CDXC 2K2SA 1HRI3 1D4M2 1CPNA 4H3WA 3MEPA 1VALA 1YIFA 3JBG1 1J3RA 1C3HA 4Q8LA 1PK6C 1KFUL 1O3RA 1V6OA 1GZWB 3N36A 1B09A 1I9RA 4AEDC 2YPJA 3O0VA 2BPA2 2NLRA 4V1PA 4QHBA 3VZKA 1AZDA 5SV5A 3OGJA 1XYOA 4K8FA 3UKVA 2P2KA 4FP2A 4AE2A 4MGZE 3DKWA 3PMSA 1XU2A 2VVDA 1GANA 1UKRA 3CNAA 5CADA 3WDTA 3FLTA 4GA9A 4FPCA 3MZHA 3AMQA 1LKNA 3OYWB 4ONUA 3KGLA 1VIWB 3CJIA 1CAVB 4RFT0 3GBFA 5LK7B 4AFBA 2MHFA 1DYPA 4GB31 4JGZC 4TSVA 4W6XA 2OUJA 1VBC1 3OJBA 1G9FA 1OQDA 4UW6A 4PIYA 4P9XA 4XJWA 4AFMA 1SCSA 1FXZA 1RUJ2 2HWF3 2WT0A 4XJAA 1APNA 1QQP3 2D6NA 4CDWC 2E7AA 2AUYA 3ZXDA 5JZGA 4CDQC 4DOUA 2R071 3R4DB 1R082 2IXHA 4GIQA 4Q4Y1 1A8DA 3AKQA 2ENRA 3ZMNA 5BNPA 3NV2A 1RUE2 5JPMB 2V5YA 1LOGA 3R4SA 1QHDA 2ET1A 2A7AA 1C8M2 3OCPA 4MGYE 2IC1A 4Q0QA 1SQ4A 4HETA 5TSWA 1YYNA 3GZAA 3NV1A 2MEV2 2XL9A 3ZYIB 3B01A 5JCTA 1YLLA 2E63A 4IETA 2ZGLA 1ULEA 4S2HA 1MS0A 3MIDA 4Z1VA 4PBOA 4MH0E 4XFFA 3GYDA 4FOQA 1S0DA 2E53A 1QJX2 1WW4A 3J8F2 4YVSA 5FO8B 4DFSA 5GKAC 1ND2C 2FZ2A 4N90A 1C5IA 4G3YC 5F6LB 1ULCA 4ASMB 1MS8A 2HWF1 2ZJCA 1O5UA 4AGVA 4YZ2A 3VDDC 4YW5A 3MIEA 1G8WA 2ZX3A 5JDBA 1DFQA 1AX1A 4I3PA 1NLRA 4M3CA 4WM8C 5DUVA 3ZXEA 1WD3A 3U10A 1CVNA 1W6PA 4AFDA 4RQPB 3VBOC 2TBVA 2ZX4A 1AYM2 1S2BA 3MF6A 1NCQB 4OVEA 5JSOA 2Z5WA 1ND3C 4PLOA 5J37A 2W0XA 1BEV3 1K5MA 5GZDA 5CNAA 4B3NA 4YG3A 4EWAA 5I91A 2XHKA 1DG6A 4CDUA 4FPFA 4Z07A 1VBB2 3E5QA 1UN1A 1ULGA 2BNOA 4MZUA 1DZTA 4H7MA 3WCSA 2ZACA 4MXWA 3AYAA 3WQ1A 4NVPA 3ZMOA 4H14A 3A4UA 4DY3A 3V0AA 4D94A 4PBPA 1LGCA 1HRI2 1U5IA 2D6LX 3FJSA 2HEVF 5HCFA 1IPKA 4AQ6A 1WCDJ 2FMYA 3VKFC 1S0JA 2UY9A 4JAAA 2WNVA 4HN1A 3RYRA 4CP2A 1SFNA 2E6VA 3H1YA 4OULA 2IWGB 1CPMA 4KBBA 4JCKA 2YZ4A 5J7MA 1RHI2 5GLUA 4FSJA 2R0FA 1GLHA 1GV9A 4OLLA 2WFF3 2Q4SA 4QGNA 1J1TA 1AXZA 2R0HA 5JZGC 5EV7A 1LU2A 1ZZ8A 5ABJA 4IEZA 1ZRCA 2A3XA 4YM2A 1BEV1 5EYXA 5EWSA 1WBLA 4A2UA 5CIRA 1QWRA 3U07A 5BNPC 3T1LA 1A8MA 1IS5A 4N43C 1X50A 2PLV3 4QQOA 1RVF3 2R062 4GMP3 2A6YA 4I02A 2E51A 4SBVA 3WD5A 1PGL1 2OW4A 3S30A 3KT1A 4P9WA 3GHMA 2EXKA 1QQP2 1CIWA 4KQ7A 1H8TA 4BPZA 5FREA 2IXCA 3D4KA 3TWIA 1KS5A 1S0CA 5J09A 2GC2A 2C9AA 1H9PA 3W58A 4XFBA 4YW2A 4E2SA 3RG0A 3DPRB 2GC0A 3EJKA 2KXLA 5KHHA 2TUNA 3JB4C 2PELA 4KGQA 5LRRA 3RPQA 2NN8A 4LBQA 4X6QB 3S7IA 4YVSC 4N7UA 4EN7B 2B39A 1LGNA 4WVMB 4BLJA 2F6BA 4WBBA 3ZIXA 4PLMA 3E6CC 1E57A 2FZ1A 3LSDA 3AKTA 4K1YA 1AUYA 5T54A 1CJPA 1RUI1 5GZCA 1Q3EA 2P3IA 3AYCA 1G6NA 4Y20B 1W6MB 2JJ6A 2WFF1 3FMGA 4CEWA 3O14A 5K0UB 4M01A 5H9SA 2ZOEB 2BWCA 4DY5A 3L2YA 4Y1VA 4UBHA 1C1FA 3AKRA 2DV9A 5BPXA 1BVVA 4YVWA 3RWNA 3E97A 1DQ5A 2G9FA 2XJVA 2PLV1 1RVF1 4MSVA 4GMP1 5L19A 2Z42A 1J1LA 4YSFA 1G86A 4FPJA 1LODA 2WKKA 4XFGA 2XLAA 1K5MC 4ISQA 3RJRA 2A6WA 2ZMLA 1AL0G 2EXIA 5BNNA 1LB2A 2QZ3A 4LBJA 2X29A 3KQRA 4GALA 1EPWA 1S0EA 5E16A 4CDUC 2WNEA 4Q1RA 4DNYA 2EXHA 1PZ9A 1FNYA 1ZM1A 3SITA 4XHBA 2H0VA 1W0OA 3G6JB 1ZBA3 4I2OA 1UIKA 1W2UA 2PHDA 1YFWA 3SNMA 2DTYA 2LALA 1BBT2 1JHNA 3DUIA 3CJXA 4E27A 4BOWA 4XJUA 4LBOA 2D6MA 2GN7A 3M3CA 3O12A 1QDOA 2ZAAA 4Q4V1 5C8CA 1SLIA 4Q0PA 4YRDA 3WQ7A 2ZBJA 2ILMA 2R1DA 5FCCA 2WNVC 1GR3A 3ZN6A 2HYKA 1LEDA 3HMYA 4BE3A 1EV13 2Q1ZB 3VBRB 1KDMA 4WM7B 5BY5A 4LE3A 1BXHA 1FAYA 1DDLA 3FLRA 4NWVA 2ZABA 4HK8A 1Z7S3 1KJRA 3VKMA 1BMV1 4COZA 1AR93 1W6NB 4HPKA 4WVVA 2PFWA 2ET7A 1PO12 5A32A 1JUIA 1Y9QA 5ABJC 1IHMA 3SH3A 3FHIB 4NWWA 1IKPA 4QU2A 3SMHA 1HX6A 1XXNA 2QFEA 3NAPB 4XMAA 2JEMA 4AXOA 2JDZA 5EFUA 2HJIA 4NHMA 1ONAA 2IZWA 1GZ9A 3ILRA 4AQ2A 4HVRA 3ZN5A 1ZBA1 4K7JA 4EN6B 1UU4A 5AC92 1H8TC 1EPZA 1QGLA 2BGCA 1RUC2 2RR12 3RI8A 4RR3A 4BIFA 2UURA 3AFKA 1VAMA 4MLOA 4NOTA 3AZVA 1V6IA 3AKSA 1AXYA 3E6DA 4EROA 2WSUA 1S0FA 1RVF2 4MXVA 4TWTA 2XVKA 1DGLA 5CAZA 2BFUL 5T50A 2HEWF 4F83A 1CAUA 3FC0A 2D98A 1MEC3 4UXAA 1Z7S1 2VW0A 1U5XA 2RS13 5E89A 2ZZQA 4CEWC 1NZCA 1PVXA 1HRV2 5L7OA 4I0WB 5A33A 3I54A 4CEYB 3WG3A 1PGW2 2A6XA 1QNWA 2GNTA 1UPSA 3WG2A 1NA1B 4XQDA 2B8MA 2X53S 1NQDA 4YVWC 4DRRA 2E9QA 5T5LA 1LHOA 2RMU1 5D8AA 3EO6A 1POV3 1SLCA 1OLRA 4YZ4A 5CBLA 2R32A 2Z69A 2ZX0A 5H9RA 3CJIB 1H2NA 3AYDA 1AYN2 3BOWA 5BNNC 2B45X 3ILNA 5I0SA 3OBTA 4R8HA 1YRZA 1OI6A 3U0ZA 3VKLA 2CL2A 2CY6A 4XOGA 2VMGA 2VQ0A 2ZGKA 4TLFA 2YUEA 3O7OA 1UMZA 2K9ZA 2D5HA 5AVPA 3B69A 2JE9A 1NCRA 1HQLA 4IV1A 3O5SA 4DXZA 1RB8G 1VB2A 3B93A 4YW4A 4YARA 3MLJA 1CAWA 3V65A 5C8WA 1O4YA 3KD4A 1ZRFA 1ZZCA 1ZZ6A 3VBHB 2D93A 1RJ8A 4UW4A 4HT1T 3NL1A 1V6NA 1Y7BA 4N9HA 4IEYA 1IKQA 4IEWA 2WJSA 2ARBA 4HBNA 5C8CC 1VBE3 4CDXA 1Q5OA 4QD2A 3ZFGA 3ZSKA 3I2DA 2DU0A 4YYOA 1F2NA 1QOTA 4J6GA 4IV3A 4C0HA 3IPVA 2HWE1 1LOFA 2HWC3 4ZKTB 2IXIA 3ZFFB 4AEDA 5HBAA 4FBFA 2UWBA 3B02A 1LJ7A 3VV1A 4ISRA 1GNHA 5GALA 1RITA 1X8MA 3LA2A 3SHRA 1LHNA 4XZPA 2R49A 1POV1 1RUJ3 2C1FA 3EXUA 3WP5A 4AI0A 3SH5A 3IIAA 1VP6A 1CN1A 1U12A 2VY0A 1JW6A 4Y4YA 3B94A 4KNCA 3RNSA 4QGLA 5KXBA 2ZGSA 1EV12 4JDOA 2JG8A 1YXWA 2Z2SB 3K48A 1R083 1SACA 4AI8A 1D4M1 1HV1A 2A71A 2XGXA 3GNEA 5T55A 4E4ZA 1AL22 3WP4A 1ENQA 3LA7A 1RUE3 5L36A 2VMHA 1AR92 1X33A 1PZ7A 3VBUB 4LO7A 4EV0A 1C8M3 4RR3C 5C9AB 2BFUS 4CYDA 2XUMA 3WG4A 2VNGA 4M3CB 1G9AA 3UKNA 1LGBA 1W6PB 3TOJA 1GZCA 4M0NA 4CDQA 1VBE1 1HXS2 4INDA 2GAUA 2X5IC 3PVNA 4XJZA 1AR72 4XJ8A 1O7FA 1DZRA 3B9CA 3K51A 2W52A 1ULFA 4Q27A 5CU1A 4YW1A 5C4WA 5F5QA