5ABJB

Structure of coxsackievirus a16 in complex with gpp3
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
SDRVAQLTIGNSTITTQEAANIVIAYGEWPEYCPDTDATAVDKPTRPDVSVNRFFTLDTKSWAKDSKGWYWKFPDVLTEVGVFGQNAQFHYLYRSGFCVHVQCNASKFHQGALLVAVLPEYVLGTIAGGTGNENSHPPYATTQPGQVGAVLTHPYVLDAGIPLSQLTVCPHQWINLRTNNCATIIVPYMNTVPFDSALNHCNFGLLVIPVVPLDFNAGATSEIPITVTIAPMCAEFAGLRQAVKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Elucidation of Coxsackievirus A16 in Complex with Gpp3 Informs a Systematic Review of Highly Potent Capsid Binders to Enteroviruses.
pubmed doi rcsb
source organism Coxsackievirus a16
molecule tags Virus
molecule keywords VP1
total genus 54
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5abjB00
1ND2C 1TME1 1R083 1RUF1 2ZAHA 4GH4B 2QQPA 1RB8G 3IDEA 3ZFFC 1RUH2 2DF7A 1PO22 3NAPA 3M8LA 1PIV3 4CDQC 1RUH1 1ZBA3 5K0UA 2R072 2HWE3 1BMV1 5BNNC 4YVWC 1DDLA 1NA1C 4Q4W2 5BNNA 1VBD2 3VBRC 2PLV2 5JZGB 1B35C 2FZ2A 1VBE1 5ABJB 1NCRA 1AR61 2HWE2 2TBVA 2HWF1 1FOD2 5AC92 3JBG3 3DPRC 1PO23 1AR92 2MEV3 1RUG1 2PLV3 5C8CB 2HWD3 2RMU1 1VBB3 2HWC1 4IV3A 2X5IA 1FPN2 1VBC3 3ZFFB 4IV3B 1POV3 1A6CA 1RUE3 3VBUB 1NOVA 2ZTNA 1PGL2 3J8F2 1NA1B 1VBB2 4GB31 3HAGA 5JZGC 3VBFC 4GB32 4CEYC 1EAH2 1EV12 3J8F1 1Z7S2 5JZGA 5C4WC 3JBG2 1TMF3 2BFUS 4FTEA 4Q4X3 1HRV2 1R1A1 4NWVA 4Y4YA 5C8CC 1MQTC 1NY72 1K5MA 4N43B 1RUG3 1R082 1COV3 4WM8A 5FOJB 4Z92B 2RMU2 2RS11 4NWWA 1RUF3 2HWB1 1BBT1 1R091 3LOBA 1RUJ3 1RVF1 5FMOS 5ABJA 4QPIC 4QPIA 1PIV2 4QPGC 1ZBA1 2HWF2 2GSYA 1X33A 5CFDB 1H8TB 1AR62 1NA1A 1RUC1 4CEWB 2R061 1C8NA 3CJIA 2RM23 4Q4Y3 4JGYB 4N53B 5ACA3 2WZR2 1HXS3 1AYN3 5L7OA 3ZFEC 2BBVA 5C9AB 2R071 1NCQC 1NCQA 1D4M3 4Q4X1 1PVC1 1PO21 5ABJC 1ND2B 2WWSA 1QJU3 1TME2 2HWC3 4RQPC 3VBOA 1V9U2 1AYM2 1BBT3 1MEC2 5BNPA 3TN93 4CDXB 4CDWC 1H8TC 1AL22 3JB8A 1QJZA 1RMU1 4FTSA 2WS92 4CEWC 4AEDC 1RVF2 2RS32 1MEC3 1QJY3 4N53C 3VBSC 2HWB2 1BEV3 2RS12 4Q4Y2 2BPA2 4FTBA 1R081 1WCDJ 4JGZC 1AL0G 4RHV2 1GFF2 1D4M1 1K5MC 2R042 5C4WB 1QQP2 5DDJ1 4CDQA 1EV11 4WM7A 1EAH1 4WM7C 3ZFFA 4IV1A 4BCUA 1BEV2 5K0UC 4N43C 4N43A 4QPGA 1COV2 5DDJ2 3VBFA 1OOPB 1AR63 5CFCC 1FMD1 3S6PA 3JD73 1QJX3 1RUI2 4RHV1 3VBSB 1TMF2 4CDUB 1FPN1 1Z7S3 4CDWA 2WZR3 1AR73 1HRI2 4Q4V1 5CFDC 2HWC2 1ZBE3 5A32B 2HWD1 1HXS1 1QJU2 2RMU3 4PDWB 3JB4C 1RHI2 1RUG2 1AR91 3ZFEA 2XBO2 4YVSB 3VBRB 1RMU2 1POV1 1FOD1 1RUE1 2XPJA 3VDDB 2HWE1 1ASJ2 1VBE2 1VAKA 1AYM1 2RM22 1AR83 4GB33 5J98B 1VBA3 5A33A 3TN91 3VBRA 1BMV2 5CFCB 5D8AB 4IV1C 1H8TA 4AEDA 3VBHA 4GMP1 4Q4X2 4CEYA 1ND3C 1RUF2 2WZR1 1AR71 1SMVA 5J96B 1PO11 5A32A 1C8M2 3ZFGB 1C8M3 1RUC2 3VBFB 1AR93 2MEV2 4WM8C 1OPOA 1MQTA 1FOD3 1ZBA2 1RUE2 4FSJA 1OOPA 1PIV1 3ZXAC 1M06G 1EAH3 2XBO1 4RQPB 4JGYA 1RUC3 1PGW1 5BNPB 1CJDA 5GKAC 2HWD2 1VBA1 1HRI1 4WM7B 2GH8A 1AR82 1AYN1 5CFCA 5D8AA 1TMF1 1RUI1 5C4WA 1VBE3 2BUKA 1ASJ3 5AC93 1POV0 1QJX1 2Y26A 3JBG1 1VBC2 4YVWB 1COV1 2WFF1 1VRH3 1VBD3 4JGZB 1RHI3 4Q4W3 2X5IC 2IZWA 1RUJ1 1VBB1 2WFF2 3NAPC 2BFUL 1QQP1 1F2NA 3ZFEB 4PDWC 2R041 1QJX2 4PDWA 1RUH3 5BNPC 4RQPA 1VBA2 4Q4Y1 3VBHC 1W39A 4RS5A 5ACA1 4RR3A 1OOPC 2R073 4RR3C 1RUI3 3VBUA 3FBMA 4CDUC 1HQNA 1RUD3 2RR12 4EJRA 5C9AA 4IV1B 2MEV1 2PLV1 1V9U1 4CDQB 4RS5B 4CEYB 4Q4W1 2FZ1A 1ZBE2 1PO12 2RS13 1AR72 4CEWA 4LLFA 3VBOB 3JD72 1RVF3 2R043 1RMU3 1VB2A 5LK7B 1PVC2 1MQTB 4RFT0 1AL23 1FMD3 2XBO3 3JD71 4WM8B 3VBSA 4RHV3 4CDUA 2RS53 1K5MB 3TN92 4GH4C 1VB4A 3DPRB 1ZBE1 4JGZA 1HRI3 5D8AC 4RR3B 2RM21 2R062 4QPGB 5C8CA 4YVSA 5K0UB 1ASJ1 2RR11 1R1A3 5BNOB 1F8VA 1PVC3 1RUD1 5DDJ3 1VRH1 1R092 1RHI1 1AYM3 1BBT2 4JGYC 5A33B 1HXS2 1QJU1 5ACA2 2HWB3 3VBOC 4Q4V2 5C9AC 1NCQB 1R093 2RS33 1QQP3 4Y5Z0 2WLPA 1NY71 2WS93 5L7OC 4YVWA 1FMD2 2X5IB 3VDDA 1B35A 4YVSC 1HRV1 1R1A2 3CJIC 2HWF3 3NAPB 4GMP3 1HX6A 1AUYA 1Z7S1 3VDDC 2RS51 4Q4V3 2R063 1RUJ2 3ZFGA 1QJY1 1PO13 1QJY2 1BEV1 1TME3 4IV3C 4CDXA 4CDXC 3VBUC 4CDWB 1NCRB 2RS52 5BNOC 1VBC1 1PGL1 2RR13 4AEDB 1IHMA 5FMOL 5BNOA 1D4M2 2ZZQA 4SBVA 1E57A 1V9U3 1AYN2 1AR81 2VQ0A 1EV13 1ND3B 5BNNB 4GMP0 3DPRA 1PGW2 1ND3A 3ZFGC 5L7OB 1VRH2 2RS31 4RS5C 3J8F3 4GH4A 1OHFA 1X36A 2WS91 1B35B 3CJIB 1RUD2 4N53A 5AC91 1NG0A 1AL21 1CD3G 1HRV3 3VBHB 1ND2A 1MEC1 5CFDA 2WFF3 1FPN3 1VBD1 1C8M1 4QPIB 1NCRC
chains in the Genus database with same CATH superfamily
1TME1 5HCFA 3ALQA 1RUF1 1ULCA 3WDTA 2WT2A 1RB8G 2DUOA 2V4VA 2WT1A 4N90A 3ZFFC 3AZYA 3FC0A 4LBMA 3H42B 2J1VA 4N7IA 1GWMA 3TYJA 1UZYA 1H1MA 2FBEA 5K0UA 4A44A 4HXCA 2NZ9A 3PVNA 3WG1A 1BMV1 3BI3A 3K46A 2PHTA 5DXDA 5DMYA 3BOPA 1D7PM 1DQ5A 5GLVA 5A7WA 1CZVA 1GQHA 3M3QA 4GWIA 2XHKA 5FY9A 5LK5A 2FDHA 1FYUA 1B35C 4NOTA 4C0BA 2YGLA 2DVDA 4AFAA 1DGLA 3RS6A 3ZN5A 4YLZA 4FPFA 1XB9A 2V09A 3TNQA 3AYAA 3ZYIB 2JD4A 4J6GA 1E5IA 2JDPA 4F3JA 3I97A 3AZZA 2D6PA 4QKBA 2TNFA 4A3ZA 2ZGUA 2K46A 1AR92 1MZ6A 2MEV3 1DQ2A 1RL3A 3J7HA 2PLV3 2AACA 2WLQA 3LF7A 3JQXA 2ZGTA 5K9YA 3KCYA 1SZBA 2DUPA 2WRAA 1IG3A 1VBB3 5FXZA 4IV3A 1XNDA 3CIHA 3SXWA 1AX0A 3NL1A 2XB6C 2GN3A 1JODA 3FJSA 5GZDA 1XOYA 5J37A 5DZGA 1POV3 1GZTA 2N7GA 5KHHA 3VBUB 4LBQD 2X53S 3EMRA 1JOPA 3MFAA 4NRPA 5KXBA 4IETA 4HL0A 3WDUA 4CPBD 2JDMA 4P9YA 1W0NA 1RITA 2Q5TA 2W1SA 3B00A 1OKQA 4Z2AA 5F3GA 5T5JA 2ZGRA 3QCWA 4IESA 3VB9A 2XLFA 3WDYA 3LB9A 1ZX5A 2VCMA 3AFGA 4B7EA 4CEYC 1EAH2 1F9KA 2PHFA 1QDCA 3AYDA 1QY4A 1YQCA 1VMHA 2IVJA 1CPNA 1HRV2 2A7AA 3LA3A 4FPCA 4K1ZA 4WVWA 5FZLA 2VTXJ 4PBOA 4LEJA 4QQ2A 3T09A 2J22A 2VOVA 4COYA 3CLPA 1N1TA 4XCBA 2BBAA 2JDAA 4WM8A 5FOJB 2QVSB 4K3UA 1QOTA 1QNWA 4MV2A 4I2OA 2X09A 2C6SA 3P1IA 1W06A 4LBQA 4NWWA 5FPUA 1LHWA 4BHPA 5FQ0A 1NE6A 1DQ1A 1SEFA 3OGGA 3RWNA 1CAXA 3OPWA 1HN0A 4QPIA 2AGSA 3H9AA 3LSDA 3LPGA 1XYOA 2OPKA 5IK8A 2RDQA 1IS5A 4Y3OA 4XYXA 3D0SA 3WNPA 1H8TB 4IGPA 3DXUA 3NWKA 1CQ9A 3IMMA 1WCQA 4W4ZA 4XBLA 3I59A 3KWVA 4XAEA 2AH2A 4D7TA 1KRIA 1KEXA 3CJIA 4Q4Y3 3OB8A 3KT1A 1EPZA 4N53B 3RMYA 5D21A 4QX2A 1HXS3 2VY0A 2VMEA 4YW7A 1AYN3 5L7OA 4DS0A 5EP9A 1H6YA 4GALA 1UW8A 5E89A 3ZFEC 2BBVA 1AX2A 4P9GA 4NIAA 1POQA 4PQQA 1NE4A 3ZPOA 4E2QA 2ORZA 5ANQA 4M3CF 4UF0B 1IS3A 1EUUA 4FPKA 3WW2A 4OHVA 4LBKA 3WP5A 5ABJC 1S1AA 3GNEA 4IEYA 1XQNA 4E2GA 4LBNA 1OURA 1YIPA 3PDQA 4CUGA 1ND2B 3MW3A 3ZXDA 2OW4A 5JLVA 4HFSA 2NQYA 2KR2A 4OUSA 2EAKA 1P8JA 1DQ6A 1Q8VA 4QM9A 4QQPA 3THTA 2BVBA 3MIEA 1KITA 3D6EA 3BTAA 2CYFA 1AYM2 1MEC2 4NVPA 1CR7A 1SACA 3OGVA 3WNMA 3H8XA 3TN93 4XJAA 3ON7A 4XAAA 4U2AA 1J83A 4JZRA 2EXJA 1NT0A 1SLBA 5EQUA 1CAUB 1GNZA 1QJZA 2GNDA 5JOXA 1RMU1 5FZFA 1JZ4A 4Q27A 2WS92 4LUMA 3PUQA 4D7YA 5GZEA 2VOXA 2OPWA 1RVF2 5C71A 4BA6A 2P5BA 4P5HA 4XQDA 4QT6A 1MEC3 5F39A 3CDZB 4N53C 5JI9A 5LWBA 4J25A 3ILNA 3WHTA 1J59A 2BPA2 4FTBA 1WA4A 2EIGA 4IEVA 5JOYA 3T2TA 3T30A 1W8NA 3BTYA 2JDHA 4FAGA 4OUEA 2QQOA 1UY2A 2BZDA 5A7QA 3UKVA 4CU7A 5BYNA 1YYNA 1XE8A 4RN5A 3LDRA 1QQP2 2EXIA 2CWSA 3WG3A 3BTZA 1GQGA 5DDJ1 2D6LX 5LBBA 4LXLA 4CU6A 1HDKA 4IV1A 4BCUA 2VZ1A 3VL8A 1ZZBA 4ZU7A 4DUXA 4PJYA 4K8FA 4QKNA 1DU3D 2PHXA 2CGOA 1K12A 2CSGA 1FV2A 4LO8A 3N7LA 5C70A 1CONA 2HYKA 2Z79A 2WIIB 5CFCC 1MS4A 1MS0A 1UX6A 2VBBA 1S0GA 2E7AA 2PA7A 2VC9A 3KCXA 4Q29A 5DUWA 5A3PA 4RHV1 3MPBA 3DECA 5JIUA 1FPN1 3FHAA 1AR73 1DGWX 2ORXA 1SHWB 2B39A 4CXYA 2B46X 2HWC2 4JDMA 2DV9A 3AP7A 2WA3A 3GJBA 3LAGA 1Q8QA 1FNZA 3BGAA 4HLTA 5GZFA 3JB4C 5FTTC 3ZXKA 2XUEA 5FLJA 1E5SA 3B7MA 5JWPA 3MV01 2Z69A 1UZVA 2A3WA 3POJA 4XBNA 3ZYBA 4L0PA 5F5QA 5JMOA 3VDDB 3WG2A 1RJ8A 3INAA 3H3ZA 4Y24A 3QH6A 3ZSKA 1UZZA 1VAKA 1ZZCA 2UURA 4HKLA 4MXWA 1LOFC 3S0MA 1AYM1 1ALYA 3MIBA 5FZEA 2BGOA 1W2NA 4ORFA 1AR83 4MGKE 1QU0A 3FN9A 5J98B 3EBRA 1LOFA 2UWCA 2XKOA 3WUDA 4FPOB 3WXPA 1D4VB 3H3UA 3NJVA 3ACFA 5CFCB 2YB7A 1BMV2 5D8AB 3MGUA 4HETA 4IV1C 1YXWA 2A6ZA 5E1RA 3SKJE 1V6KA 2W9XA 1AXKA 1RXGA 4BB3A 3E6CC 5JPNB 2OYZA 5ANNA 2VU9A 1ND3C 2WSVA 1YFYA 3HMYA 3SEEA 2LS6A 3HNYM 5I0DA 4TYSA 1ULGA 3ZFGB 4K9SA 1C8M3 3B3QE 4IE0A 4LBLA 2JB8A 4AI0A 4PF1A 1AR93 2MEV2 3OPTA 4JCKA 5A3WA 2XG3A 4XJUA 1QOOA 2WJSA 5HV4A 1JYNA 4UXAA 1ZBA2 2C1FA 2VQAA 3OD4A 2CAUA 1ZREA 1AHSA 2XXZA 4MO3M 1X9TA 3KF3A 3D3AA 1O3SA 1RUC3 1PGW1 4IE5A 4LULA 2VZQA 4AQSA 5GKAC 2V4AA 2YGMA 4AFMA 1OUSA 5FKCA 1VBA1 1HRI1 2ARXA 2P1BA 4IERA 5I8TA 1DZRA 1I6XA 1JUHA 1H4GA 5JAXA 1UY4A 4LHKA 5C4WA 4AVCA 1VBE3 4M4PA 3POBA 4RFRB 3Q8FA 3TEXA 4XF4A 1J3RA 4CTEA 4Q0VA 3AZWA 4V2WA 3JBG1 3DL3A 3H8RA 5FUIA 1U5YA 2XUMA 3LIGA 5KHKA 1VRH3 3MIGA 3MICA 2ZZJA 1O8PA 3AX4A 1UYXA 1V00A 2BNNA 2P3IA 1PK6A 4FOQA 2XWBB 3HVDA 1A3KA 4XXPA 2X5IC 2I74A 4DY5A 2WFF2 5FP4A 4I30A 2AUYA 4XDOA 3NAPC 1UL9A 4JVAA 1OQDA 2A3XA 1H0BA 1BQPA 4PDWC 1QJX2 3PIJA 4TN7A 5IWFA 3WQ0A 5FZ4A 3R05A 2FMDA 2Q1ZB 2V72A 4MUVA 1JI6A 2EIEA 2OQ7A 1XNCA 3SHRA 3JUUA 3H7YA 5CNAA 1BVP1 1UMHA 2D40A 3IDAA 1KD7A 1VBA2 3WVJA 1XE0A 3P5BA 1NKGA 5FWJA 4CP9B 4CCOA 5F1RA 3N7KA 4NN0A 1LKNA 3QD6A 5FJKA 1OKOA 2R073 3KV5A 3WHUA 2Q8OA 1J3PA 4XQ4A 3VZLA 2Z4FA 4JRLA 5HI0A 3H7JA 3PMSA 3GZUC 3WDVA 3FBMA 1GMMA 1U5IA 1O7FA 2G9GA 1QNYA 3C2UA 4PLNA 5FMCA 4WVVA 4PIXA 1KDMA 3TWIA 3WUCA 4EJRA 3X29B 5C9AA 2FD8A 4A2UA 3OOXA 4NR1A 4ZXEA 1V9U1 1GYKA 4NIGA 2GH2A 2FZ1A 2QQUA 1WUVA 4FXGB 1PO12 1UYZA 1FV3A 4KWJA 1G6NA 3K4AA 3ROUA 4CEWA 3MPPG 4KI5M 4LLFA 3O1PA 3QOPA 3R0RA 2A6WA 4MX3A 4ASLA 4LO4B 2Q30A 5G04L 3JD72 4QB2A 5IAVA 1QOSA 5T5PA 2Y38A 3ZLIA 1ENSA 4FFIA 2R043 4B8EA 1RMU3 1V6IA 1VB2A 5LK7B 3U10A 3K3NA 2JE8A 1AL23 2YFZA 5KXEA 2R1DA 4WM8B 3VBSA 4RHV3 4XBQA 3JZVA 3HNBM 3M4FA 5FPXA 5K8SA 1DYKA 5AVAA 4GH4C 3DPRB 5A6QA 2I07B 2F6BA 4IEPA 4Z8BA 2Y6JA 5C6CA 5D8AC 2DCJA 4YZ5A 2FCTA 5F37A 4NAOA 1OVPA 3LCPA 2CGPA 4IGOA 4BMEA 3URFA 3WP4A 4NE9A 1OI6A 4CCCA 3AXDA 5JDBA 4HPKB 1ASJ1 1TVGA 3ZYJB 3VKLA 3VKOA 1ULFA 3VHRA 5D2AA 1UX7A 4OHYA 2HH9A 1C3HA 1W6QA 3GHNA 5DDJ3 5FZKA 1QDOA 5HV0A 5C8WA 1YRZA 1Q3EA 4OYUA 1RHI1 3IDCB 1SG3A 1JHNA 5APAA 3O14A 1ZZ8A 1QJU1 3PVEA 5H9RA 1CIWA 3A21A 1VIWB 3MI8A 1U5XA 1ZRRA 2NLRA 5GZCA 4YZ2A 5C9AC 4QM8A 5JXJA 4LOSA 1OLRA 3FUQA 1PX3A 3KT7A 5IVCA 4QMAA 5FLIA 4MGSA 5FZ3A 2O1QA 4FI9A 4YVWA 1FMD2 3IZOA 2ZX3A 3UL2A 3VDDA 1HRV1 1IS4A 3CJIC 3K48A 5LRSA 4GMP3 5CYYA 1HX6A 4QB1A 4UW5A 1AUYA 3DUIA 3VDDC 3VHPA 3LDBA 4NPLA 2OUJA 4XTMA 4KGQA 3LFIA 1G9FA 1MZFA 2P3KA 1QJY1 3OGRA 1E5RA 2WNUC 3QACA 2W1UA 2GC2A 1JTZX 5FK8A 1TME3 1XYNA 2JDZA 1LOAA 5FXXA 3IAQA 4X8PA 1OSGA 1VAMA 4MVTA 4CDXC 2RS52 1NQJA 2UYBA 4QAWA 5FZHA 1W9TA 3BCWA 3J4UH 3WF4A 1PGL1 4A6OA 2RR13 2LW8A 4AI9A 4Y1YA 2PAMA 1DYOA 1HB2A 2QZ2A 5FMOL 2Q0AA 5FO8B 5CVRA 1WLWA 4B29A 2ZZQA 5CEHA 2R0FA 3K3OA 4JV4A 4LT5A 1KDKA 2PMWB 2WR9A 1WWYA 2ETEA 1OLQA 1YQ6A 3B93A 4L97A 2F17A 2VUCA 4CCNA 3M2MA 2ZHLA 4GMP0 1MS5A 4LKSA 1G7YA 3OUIA 2MNGA 5FYIA 3CHXA 3KV9A 3PMEA 1GR3A 1VRH2 4Z2WA 3K2OA 4RS5C 2CTVA 1WA6X 4ZY9A 3RZGA 3J8F3 1MACA 1X36A 3OUJA 5EZWA 3OBZA 3RDIA 1RUD2 1S2BA 3LD8A 4N53A 3VD3A 4DXTA 3FFQA 3ZOIA 3VDAA 5KBFA 4BQ2A 3KF5A 4QPYA 5B2GB 1Y7BA 3VBHB 4D69A 1UMIA 5ERLA 3IPVA 1X7NA 3GALA 1ND2A 1O59A 1W04A 3BPSA 3M3IA 1KJLA 4CRQA 2IFRA 4EWAA 4XFGA 1W9WA 1SLIA 2F4PA 4KWLA 4ET7A 2E9QA 1NCRC 2OQ6A 1ND2C 1IGOA 2A73B 3AP4A 5JR7B 4AEJA 1Q56A 1CAXB 1WW5A 2XVLA 1V6NA 4Q2FA 2VZPA 1RUH2 2JECA 4IEWA 1PO22 3NAPA 1PIV3 4YGBA 3MW2A 4U36A 1ZBA3 1NZIA 3ZYRA 5FY7A 2E63A 4OQ8A 2HWE3 1TNRA 3I3MA 4V1PA 4E8DA 4XTPA 2UYAA 5FY1A 3WDXA 2BOIA 4AI8A 1N1SA 2VMFA 2BGCA 2JDYA 5BXXA 2ZX4A 3VBRC 1XPWA 4UFIA 4W6YA 1C57A 1UMZA 2J1SA 5FLHA 4Q0PA 3VL9A 5FUNA 4D0QA 2LRPA 1IKQA 4M00A 3WZ1A 2HWF1 1FOD2 3FWEA 4OQ9A 4KU8A 2ZS6B 4XFFA 1GLHA 4E4ZA 2HJIA 2AC1A 4JHZA 1RINA 2VUAA 5JPMB 4HZFA 4CA9A 4LKEA 4XJWA 2WDBA 2PAKA 2Y0OA 2NYYA 4JHTA 4UW4A 4BU2A 2YU2A 5FYSA 1D0GA 1W8OA 3N36A 3J7MA 1UN1A 2UU8A 1FPN2 1VBC3 1STMA 1YUDA 3KSCA 3F2ZA 2WKKA 1LRHA 2JJ6A 4FOYA 3UETA 1W2OA 2Y6KA 1ZZ7A 3OGJA 4IV3B 2E53A 1XXNA 1NOVA 2OUHA 1N1VA 1YFUA 4AFBA 4NUBA 1PGL2 1BK0A 4JX0A 2D3PA 3GZTB 3HJRA 2QDRA 1NA1B 2DCKA 5L19A 4IW3A 5IATA 4OHZA 1UPIA 3AJYA 3HAGA 4LBQB 1S0BA 4LO7A 5FYZA 2VW1A 4GB32 4QXHA 5FXVA 4LLOA 2YFUA 4K20A 1GOGA 4EE2A 4BK5A 4Q4X3 3LIHA 4X6RB 1R1A1 5HCBA 3RWKX 3HN3A 5C8CC 1MQTC 1NY72 2BP6A 4FT8A 1BK1A 1BYHA 5FPZA 5L9RA 4GJZA 4QX8A 5BUVA 4Y22B 1UY0A 2RMU2 4Y1UA 5IW0A 1RUF3 2HWB1 2YXSA 3RYPA 1BBT1 2IVIB 1CAVB 4HN0A 3MDPA 2DBIA 1W8HA 5FMOS 3VHOA 1PIV2 1IQDC 2GALA 2BNMA 2VOKA 5T3NA 1AXZA 2DURA 1ZBA1 5F2SA 1NUKA 2GSYA 3UKNA 4AQ6A 4BLJA 4AAXA 4YSFA 5SV8A 5CFDB 4NHXA 1C1LA 1RUC1 3WNKA 2VD7A 3JU9A 3ZO0B 1C5HA 2P6CA 5FYYA 3WF3A 2G9ZA 2HEWF 2RM23 2IXLA 3WW1A 3M3OA 5ACA3 2D5FA 1H2LA 3ZR5A 3RZHA 2XL7A 2WNUA 2ZHNA 3OD0A 1O8SA 1PZ8A 1NCQC 3USUA 2YV8A 4I02A 1DF0A 1PVC1 3AC0A 3POEA 4K7JA 4OCTA 4QDSA 3RPQA 2Y8KA 5FPLA 1JZ6A 1KJRA 2RVAA 2XVGA 3WINE 3C7HA 4AHYA 2B45X 3I2FA 4LHSA 2WWSA 3I2DA 2QQJA 1ONAA 1TME2 3I2KA 4AZZA 3E1F1 2IXCA 2JE7A 4F7ZA 3VBOA 2VULA 3FHIB 1CX1A 3DXTA 3E5QA 1US2A 3AM2A 1GZWA 2AREA 1WLTA 4CDXB 1H8TC 1CGPA 1X9PA 2D3SA 4G3YC 3I2HA 4XFAA 4DZGA 3IAPA 4I0BA 1KGYA 4Q5OA 4CU9A 4CCMA 3CEWA 2BW8A 1BEV3 2RS12 4GZ9A 3ASIA 4Q4Y2 5FZOB 1DFQA 2H6CA 4OMDA 1W03A 2B42B 4NPMA 4XIKA 1WCDJ 2E31A 3N9NA 4AQTA 5C7GA 3PTYA 5IK4A 1V6OA 3WF1A 3A0NA 1JW6A 2X8KA 5DZFA 1J1LA 2GN7A 1K5MC 3T1MA 4OULA 2K0GA 1U0AA 3AJZA 5FZBA 4F8AA 1VAVA 4WM7A 4LBOA 1UYPA 2VTFA 4QHBA 4EWEA 2BEOA 5A7OA 4C8DA 4XCAA 4L9BA 4XIOA 4N43C 4GXLA 2ILMA 4QPGA 5DG2A 5DDJ2 1LOEA 1JZ2A 2W5FA 4S2DA 2DVBA 3WNLA 2FCUA 4O9GA 1AR63 1ENQA 4W6XA 4YZ4A 2PHUA 2VZOA 3SISA 3MF6A 2C24A 3E6DA 1FMD1 4HT1T 5I0TA 3S6PA 3JD73 3I3BA 3RMXA 3G7DA 3MUZ1 4BIFA 3KHBA 3TBDA 5T52A 1CWPA 3RJ2X 2YBKA 1H2NA 4LNVA 2WZR3 4RGAA 3AMHA 3ETPA 3UYJA 4LQRA 1CN1A 2JD9A 2V5YA 3OBRA 4XHBA 5A32B 3SC7X 1QJU2 1UY1A 2A1XA 4CCEA 5FOBB 1RUG2 1PNGA 1UIJA 5FYVA 4JTOA 5B4XA 1G8WA 1K3IA 4YVSB 4ES9A 2OVUA 2UWBA 1RMU2 2KD7A 2XJVA 1POV1 4LK7A 4BDVB 2ZXQA 3RVHA 4BLIA 1JZ8A 3A0KA 1NAEA 4L11A 1JH5A 1UO9A 4MADA 2ZEYA 4XW3A 1ASJ2 5DAPA 1OXCA 4K40A 4MZUA 4YM0A 2BOJA 5G05L 1Y4WA 2VUDA 2XJQA 2JWPA 4CUBA 3GGLA 4CUCA 2VMCA 3N35A 3NV4A 4YGCA 4YRDA 1VBA3 5K4LA 1LB2A 1UQXA 2WO1A 5A33A 3K51A 4UT5A 3GBFA 4P5YA 1ZZ6A 3RZZA 1U12A 4GD4A 1RTVA 4LMFA 3TN91 3ZXJA 1KFUL 4FPHA 4AEKA 4OI0A 3N9MA 4AEDA 1WLCA 3VBHA 2CAVA 4PF5A 1Q43A 5FZGA 1NYWA 2FQPA 4GIQA 2B8MA 2X29A 1PHMA 4LE4A 5FAXA 4QX0A 5FZ6A 4YW6A 1HB4A 4O65A 4EROA 2ZGNA 4AXOA 3HNMA 4LHNA 2QDNA 2WZR1 1AR71 2QNKA 3AP9A 3H0OA 3POFA 4YG6A 4FPJA 1PO11 2QBXA 5FP7A 3W58A 4DQAA 3ZDVA 1BJQA 3VDCA 5A3NA 1W6PB 5C33A 4LPLA 2J1UA 4FAHA 4DINB 3IB3A 4JTNA 4M0NA 5KHIA 1JOBA 1G86A 2G19A 3DV8A 2J7MA 4AHZA 4UWDA 1MQTA 3ACGA 3HN1A 1RUE2 4BISA 5A6YA 1XNTA 1RXFA 1OOPA 3ZXAC 3BTXA 3KGZA 2XBO1 3RI9A 3ZYPA 3QH7A 1JYTA 1W8TA 5BNPB 2EAAA 4E27A 2GNMA 3I3EA 1EY2A 4M3CA 3WQBA 2XLAA 2HWD2 4QQOA 4C0HA 1GQPA 2D6OX 2VG9A 2GH8A 3UV9A 1AYN1 2YY1A 2D3RA 3T2OA 4QKDA 4MSVA 5D8AA 1TMF1 5I0SA 3WCSA 3MLJA 2GC0A 1ZZ9A 2VPVA 1ASJ3 5F9TA 1HQWA 2ZHKA 5AC93 1HLCA 1ENXA 4QWNA 2ZCWA 2VNOA 4FPYA 1POV0 4Q1RA 4YFZA 3S7EA 1LCLA 3VZMA 1Y3TA 1GBGA 3LQCA 2OKXA 4GKYA 3W59A 2GC1A 4YVWB 2DTYA 4PHZA 5BNQA 2GNBA 3PU8A 5A1LA 1SBDA 4A45A 3DN7A 1VBD3 4EN8B 5LY1A 1PMJX 3AYCA 1OQEA 2J42A 2JIJA 2IZWA 4IEQA 1VBB1 5IVBA 4NRQA 2K2SA 1LOGA 1W6PA 1X8EA 1DQ0A 2PQQA 4W6WA 3KD4A 1QQP1 1F2NA 3THCA 5LASA 4E9KA 4MH0E 5AFEA 4PDWA 1YFXA 2JG8A 3CQOA 3EB7A 1XBFA 3S57A 1DHKB 4UFKA 1WMDA 2Y64A 4QX5A 2VGDA 2Q8DA 5KXDA 1NQDA 2E33A 4RSUA 4XMAA 4WVMA 1W2UA 4JDNA 3ZVXA 4Q1PA 1PMIA 4LHLA 4N9HA 1UNBA 2EALA 4RS5A 1W9FA 4FOVA 1OOPC 1H8VA 3ATGA 4C91A 5AFBA 2XQRA 4P9IA 5LW9A 1DP0A 3P6BA 3VZKA 4B7KA 2JEMA 4FPEA 4NAMA 4XF0A 2E7QA 4YG0A 5LCWL 4S2HA 3E5XA 1XE7A 3KT4A 4R9BA 5A7NA 3DYOA 3ZKUA 1JMUB 3O1RA 1V6JA 1ZRFA 1CESA 3PL0A 3FLTA 2CV6A 4IV1B 2JX9A 3VLBB 4HANA 4K6BA 4Y20A 5GLTA 2GNTA 2PLV1 2HBTA 3IBMA 2O0OA 4CEYB 1FNYA 4Q4W1 4DO0A 4IEXA 3UNPA 2OZ6A 3AKPA 4K21A 1EPWA 1PM7A 1AR72 2O8OA 2RS13 3FX3A 4YGEA 4B3NA 1ZRDA 5JSOA 4QDRA 5M0TA 1XU1A 4F83A 4D6RA 3PTRB 3RSJA 5JR2A 4UFMA 4A4AA 4QX7A 1W6NA 4ZU5A 4DEQA 4XE9A 1GWKA 4A3XA 1PVC2 4IE7A 4COWA 1YI9A 5GALA 3Q8AA 5IYYA 3JD71 1UU6A 5F6LB 3WP6A 3Q9OA 1NLSA 3PJYA 4CDUA 5I8YA 1UWWA 4CPBA 4XF3A 3WP3A 3O1TA 4NMIA 1VB4A 3VUOA 1HJGA 3ZYFA 2WN3A 3O1OA 1ZBE1 1ZYBA 1US3A 4JGZA 4GQ7A 4NHMA 3W21A 4CP9A 1H9PA 4BWOA 2J1AA 1H9WA 3S30A 2R062 1WW4A 2H0BA 3ZR6A 4QPGB 3WF2A 5C8CA 3WT3A 3T2PA 3MFCA 4AK3A 1GANA 2YBPA 3ZMNA 1OH4A 4AVSA 5B4NA 3B01A 3V0BA 2W39A 4QQLA 1KXGA 4JKKA 3H3LA 1H4HA 3U1XA 1AXYA 4YZ3A 1DGWA 1ZRCA 2IXJA 1UCXA 1PX4A 3KGLA 2YYOA 1GU3A 2WAAA 3A7QA 1G9CA 1AJKA 1N3QA 1PZ7A 4LE3A 4NO4A 3N4MA 5CZKA 1K5JA 3LZZA 1OUXA 1SLCA 2TEPA 3OG2A 1ST8A 5GJ6A 3T1LA 2DCTA 2A71A 3ZXEA 5ACA2 3I2GA 2WNVB 5T5LA 1NCQB 1R093 2Y0IA 2ET1A 1QQP3 2WL1A 2WLPA 1NY71 3HQXA 5FY5A 3KLSA 3MZHA 2WS93 2VUJA 1HB1A 3LEKA 3NJZA 4YM1A 1WBFA 4TLFA 3ME2A 4YVSC 1R1A2 3POWA 3WX5A 1RUNA 5FZAA 3POGA 5J96B 1PMHX 4D3WA 4Y5SA 3WNOA 3RFRA 3ZSJA 1AF9A 1W9YA 4OMCA 1K42A 5HCHA 1GOHA 5FZ7A 4JQRA 4LA3A 4IV3C 3UGHA 2OX0A 3VBUC 4Y33A 1NCRB 2EF6A 3ACIA 2R1BA 5FCCA 3E5UA 3GBWA 4R9DA 4D6QA 4R4ZA 3CJXA 4P9LA 1F4AA 4CCDA 5IVVA 3ZSEA 3DCQA 4Z07A 1IHMA 1RC6A 4XF9A 1YIFA 3WW3A 4AE2A 4BJ0A 1S4CA 5FYMA 4SBVA 4S2FA 3MIHA 4AQ2A 1E57A 4GWNA 3GCWA 1AYN2 1AR81 1GZCA 2CWMA 2VQ0A 2ZEWA 5A3UA 3RZJA 1Q8SA 2WNVC 3THDA 1UOBA 5BNNB 4LOTA 4TTGA 4YFWA 4GKXA 4XUPA 1UIKA 2GMMA 1PGW2 3T0BA 1ND3A 3ZFGC 5DABA 1LEDA 2RS31 1GICA 3ENRA 3BIWE 3UKTA 4AVBA 3B94A 4Y5TA 4QU1A 3LDKA 5J48A 3W5MA 1NG0A 4DMIA 2OT7A 3AKSA 4ZU4A 3O0VA 4JQTA 3KHCA 1QWRA 4C1WA 2HEYF 2W91A 1MS8A 3OYWB 3GM8A 4HBNA 5CFDA 1FPN3 5A6ZA 5C3RA 1C8M1 1O6UA 3UT0A 4GH4B 3OBAA 2VMDA 3DKWA 1VJ2A 3I3QA 3IDEA 2BQPA 4XDPA 5FP8A 5KC5A 2H6BA 2JG9C 3GZEA 2DBNA 2QKDA 2W92A 5HCAA 3TEYA 1DCSA 2BJSA 3M8LA 1BKZA 4P9WA 4CDQC 4ARYA 4CXWA 2ZMNA 1OC1A 4ISRA 4LO5B 4QKFA 3OF1A 1SCRA 5CADA 5LRRA 4YW2A 3BIEA 4ZS3A 4IE6A 5BNNC 5LEKA 4YW3A 4PLOA 4UBHA 4XF1A 2W46A 3NVCA 1NA1C 3H1YA 1WKYA 4BZ4A 4Q4W2 4KBBA 5BNNA 3AMPA 4P02B 2WYFA 1S0EA 1YQ8A 1U5ZA 3SCHA 2GMPA 3NJYA 4R52A 1UKGA 3AFKA 3WDWA 3SCGA 3ZM8A 5FZIA 3PUAA 2HWE2 2VBDA 4Y4RA 1JXNA 4IEOA 3LGRA 2TBVA 4UOJA 1PO23 5EXOA 1W8ZA 1OF3A 2WFPA 1KS5A 2VVFA 2Z5WA 3E6BA 1OLMA 2R7EB 1RUG1 3T2QA 4JKMA 5FZCA 4AI2A 1RGSA 1OBNA 4E2SA 2HWC1 5E88A 4YARA 2X5IA 2VZVA 2DU0A 2QQLA 4QDQA 3D8CA 5C5TA 3IIAA 2G4IA 3PIGA 1J84A 4H2AA 4OZOA 1N3PA 4XJ8A 3AK0A 2V5DA 1IQAA 2AR6A 1L7RA 4WZFA 3LEMA 5EV7A 1MVQA 2VM9A 3W20A 2D7FA 1BZWA 1QIQA 1URXA 2HYXA 3J8F2 3FE5A 4QXKA 3IM0A 4XFHA 3EHKA 3ELNA 1VBB2 2JG9A 1JU3A 4GB31 4AWDA 1SBFA 1OA2A 2NMNA 5JZGC 4Q0SA 5DAQA 1A8MA 2Q1FA 3DYPA 4MGIE 1RUOA 1DGRN 1ODNA 4UW3A 1W6MB 1JU4A 1ULEA 2VL4A 3PUHA 3H8OA 1Z7S2 2PHRA 2D6NA 5F5AA 5JZGA 1UPSA 3LFMA 1YC61 1TMF3 2WABA 4D94A 1D2SA 3T3YA 4FTEA 1W3VA 5L9BA 2ZGLA 4HKOA 4AOCA 5CISA 1IPSA 3RG0A 2KM2A 1LU1A 5L36A 3NRUA 5DUVA 4WVZA 3LOIA 1K5MA 1SLLA 3TAYA 5H9PA 1PK6B 3NNGA 5IUQA 2FDFA 2DDUA 1Y43B 4QB6A 3I7DA 3WY6A 2ZA9A 1C5IA 3T0DA 2LALA 4YNIA 1XRUA 1S0CA 1R091 3LOBA 4MHUA 5I0RA 2VMGA 5JIAA 1JHJA 1RVF1 3WG4A 1UKRA 4XDQA 5ABJA 2QJVA 4QPGC 5A80A 1REDA 2C26A 4XURA 5LZ6A 2NMOA 4LTAA 1W6NB 2VNRA 2ZGMA 4YW5A 2YDEA 2B5HA 2GU9A 3FZ3A 2EIDA 4XJ9A 1C1FA 3APBA 1SFNA 4FQZA 4AF9A 5FZMA 4Y26A 4TWTA 5DUXA 1C8NA 4QD2A 4E8CA 4NRMA 3N3HA 1QF3A 4H14A 1LGBA 4PIZA 4FPLA 3OY8B 4R4XA 4OHWA 4BQ4A 3O1UA 2DFBA 1SBEA 3K75B 3GZAA 4KWKA 3AKTA 2R071 3MLKA 4FO9A 4FBFA 1NCQA 5EJ1B 3SQOA 3LA7A 1YJLA 2JENA 2YU1A 2ZGPA 5GM0A 2H0VA 5JMCA 2FHRA 4FFHA 1J1TA 3I3DA 3GXUA 3NV3A 2FMYA 3TB0A 4I3PA 4A7KA 3TOJA 1YCIA 2X10A 1QJU3 2CU5A 1CAWB 4HVRA 4CP1A 4CP0A 1EP0A 1YFWA 3VD5A 1YNAA 4RQPC 2JG9B 5LATA 4LIUA 1OFNA 1HKDA 1LOCA 1J58A 1IKPA 1V9U2 4DNYA 4A42A 1NLQA 4XC9A 2XJRA 3I8TA 2A6YA 3HPNA 3FFZA 4META 1JS9A 4CDWC 1AVBA 3IN9A 3HR9A 1A34A 3B02A 4AI3A 2JG8B 1AL22 2VVDA 2WQ4A 3JB8A 2ZMKA 1HB3A 5A3TA 5F32A 2ZGOA 1DZTA 4OFGA 4AEDC 3C7OA 1O3QA 3SEPA 2VVEA 2HLEA 3H8UA 2RS32 5IVYA 3MO4A 2RDRA 2QQMA 1GSLA 1QJY3 3VBSC 5IT6A 3OSDA 4O7XA 2HEVF 1SPPA 1UU5A 2DFCA 2PHDA 2YHJA 2YMZA 3M70A 1LECA 1VPHA 3DGTA 4ITCA 4LJHA 4YPJA 5FZ1A 5IFTA 4QX3A 2RDSA 5CG8A 1AL0G 3A4UA 2OA2A 3NMBA 3UJOA 4RHV2 1JN2P 1L7QA 4HKWA 1GFF2 2E51A 1D4M1 3LWCA 3PVBB 2ZACA 3BYWA 1O5LA 4X6QB 3RQ0A 3HBZA 5CBLA 1UAIA 2G1MA 3BN6A 2R042 1DIWA 1LJ7A 2D6MA 1F35A 1JYCA 3ZIWA 4LUKA 4OUMA 1Q5OA 1HIXA 2B7YA 3IT8A 4CDQA 5C5UA 4WM7C 4NHYA 1LHUA 5EJZB 4CXXA 2W2IA 4DY3A 3ILRA 1JUIA 2IXKA 1BEV2 1W6OA 1ZA7A 1CPMA 3UK9A 2BGPA 2J1RA 4HPKA 4QQHA 5GLWA 1S2KA 5FV3A 1VRBA 4INDA 2ADDA 4N43A 1COV2 4CSWA 3OJBA 2WNEA 3AYEA 1PGSA 2ARAA 3VBFA 1I9RA 3D0JA 1OOPB 3I49A 2SBAA 1KFXL 2WO3A 2YC4A 4EQVA 1ZVFA 1FATA 5JXGA 1W3XA 4FOWA 1QJX3 2QFEA 3VD7A 3VBSB 4KGGA 4IXLA 4AGGA 4XQWA 4CDWA 5JXHA 1ZBE3 2CGNA 2RHPA 2VZUA 2HWD1 3C7FA 2VJXA 4PDWB 2PQSA 3V56A 1UD1A 2C9KA 3OYWA 2WWUA 4XEZA 4EN0A 5F3CA 1AR91 3QLQA 4LBJA 3ZFEA 5E6HA 3RJRA 1D2QA 4URTA 2K9ZA 3VBRB 4I01A 4IL7A 4FFGA 4LIVA 1NX9A 4ZONA 5F8PA 3ZIXA 3U4XA 3ECQA 1RUE1 1Z78A 1SLTA 4RGKA 3RRDA 1PK6C 5IK5A 2HWE1 4WV8A 2RG4A 3AP5A 3WNXA 1LTEA 2JIGA 1VBE2 2B9VA 2ZKLA 4NHKA 4DPNA 4PI0A 4XMIA 1QH7A 1REFA 4V2VA 2AZ5A 4PBPA 2RM22 1SQ4A 3WEZA 5J36A 3CL1A 5CU1A 3RYKA 3VBRA 2R0HA 1WMXA 3SMHA 1KS4A 3I2IA 2D44A 1F5JA 4XOGA 3WNNA 2W1WA 2BU9A 2LTNA 1O5UA 3IDBB 4DOUA 1H30A 1AZDA 2R6QA 4GMP1 4X8NA 1V6MA 3P3NA 5SV5A 4AYUA 3AVSA 4LO6B 3NV1A 4AGVA 2ZOEB 4KMQA 2OIIA 1GKBA 1S55A 2WZEA 2DVFA 4UFJA 1RUF2 1MR5A 2VH9A 3BB6A 1SMVA 1UU4A 5H9SA 5A32A 1C8M2 1OMIA 4BQYA 1WCUA 3KM5A 2R30A 1O4YA 3OBTA 2WINB 5L73A 1VMFA 2RJLA 4YG3A 1RUC2 3ACHA 2MHFA 3KCCA 3VBFB 4URAA 3M3EA 4FFFA 2ZABA 2P3JA 1L3JA 5BPXA 4BYYA 2NP0A 1OPOA 3NKTA 3B9CA 4FXKB 3O0XA 4FSJA 2VQTA 3H50A 3K4ZA 3M1HA 3ES1A 4KQ7A 4QXCA 1M06G 5HPOA 4RQPB 3KS7A 2Y60A 4TSVA 1GV9A 2QQIA 4E4HA 1JYIA 1OPMA 2Q8CA 3MEPA 1BHGA 3J9SA 1NXMA 4P14A 5A7SA 1LAJA 4CCJA 3R4UA 4XETA 5KHGA 4G9SB 3L9JT 3LSEA 4WM7B 1AR82 4PCRA 2CDPA 4LKDA 4ASKA 4NHLA 4G4FA 4XVHA 1JOJA 2WQ8A 4OZXA 4TXWA 2BUKA 5EYXA 4MG2A 2PXJA 4CUAA 4EV0A 1CZTA 5I0UA 2Y26A 3U14A 1VBC2 5BY5A 3BALA 5CB7A 1COV1 4H7LA 2ZEXA 5J1XA 5GLZA 2B4KA 1L7LA 1XU2A 2F4LA 4JGZB 4Q4W3 3AL6A 3WCRA 3O1MA 3FLPA 4I0WB 4R9AA 1RUJ1 2ES3A 4MOAA 4MGYE 4S2GA 3VKFC 1Z0HA 4CZSA 1S0JA 3V64A 4JRAA 2XWJB 2BWCA 2VZTA 1V0AA 2VW0A 4H55A 1J3QA 3V65A 2RJKA 5C3SA 2W08A 5DQ0A 1ULOA 5BNPC 2GDFA 5FZ8A 2VZRA 4EN7B 4ZHNA 4EN6B 3LEGA 4XACA 5JCTA 1V6LA 4RQPA 3GHMA 4NIHA 4EZHA 1RJ7A 1ULPA 3W5NA 1DQ4A 2Q8EA 4QU2A 3ZN6B 3SKVA 1W99A 3QBQA 1XNKA 4XUOA 4Y20B 1YJKA 2DYCA 1ZNPA 1FX5A 2KA3A 4NJ4A 1ULDA 3VBUA 4I09A 2WO7A 5I91A 4KL1A 5E16A 4FP2A 4BXSV 3POSA 2JE9A 1F31A 3TNPB 3O1VA 3RZKA 2D97A 4RS5B 1LESA 3HQUA 2XJTA 5FYHA 3KVBA 5FY0A 4XZPA 4QHZA 3RGBA 3ZDSA 1B09A 2HBUA 2W68A 3ZKYA 3UGGA 1IG0A 1Q8OA 4PLMA 4AHXA 4ZPIA 2ET7A 1WBLA 3ETQA 3VBOB 5T55A 1RVF3 3BOWA 3MIDA 4UYBA 3SCFA 1IS6A 3OTFA 2ZMLA 4A7YA 1XJAA 2L9LA 3D4KA 2JKXA 2VCAA 2XBO3 1YLLA 3T08A 5FP9A 1K5MB 3L2HA 5FBZA 3C3VA 3TN92 1O91A 2C5DA 3VZNA 4PI2A 1LNSA 3NV2A 4Q8KA 3IWZA 1HRI3 1YWKA 5FPAA 1SFPA 1FT9A 2RM21 4RR3B 1VMJA 1QXPA 2WNUB 3ZXLA 3P3PA 4HONA 2IXHA 4LR4A 5K0UB 1HV0A 1XNBA 2IC1A 3BPZA 4HSLA 1R1A3 1XYPA 4J1XA 1F8VA 2VCCA 3U37A 3LPFA 1TZOA 5FMDA 2XLGA 1RUD1 4CYDA 1OA4A 4NIIA 1AJOA 3VN4A 1O4TA 1VRH1 2XJPA 1SDDB 1R092 2RJ2A 1AYM3 4BIOA 2D93A 2XQXA 3FL7A 1HXS2 2WN2A 2PHLA 2PHWA 4PT6A 2HWB3 3Q8EA 2W3JA 3PUSA 4M01A 4M3CE 3USUB 3HWJA 1G9AA 3W9AA 4M0HA 2X5IB 1IOAA 3KB5A 4NROA 1B35A 3LKJA 3O7OA 4HVOA 3FHQA 1ENRA 2NPIA 4Q8LA 2UY8A 4BPZA 4CCKA 1Z7S1 2RS51 5IFPA 4QGNA 2R063 2XVKA 4ISQA 3ZXGA 3AMQA 1V70A 2YPJA 5DN2A 1DZQA 3ZN6A 3EXUA 1BEV1 5DG1A 3S5AA 3CZUA 4W50A 2QTWB 3Q8CA 2ZGKA 4CDWB 1MZ5A 3ITQA 2VNVA 1FI2A 2RDNA 3FBYA 3KV4A 4W8JA 1CAVA 4CP2A 1E5HA 1QKQA 5CA6A 5KWRA 2I2SA 1OFSA 4AEDB 2PFWA 1BCXA 3OGSA 1F15A 2TUNA 1D4M2 2Z42A 5FYBA 1QJFA 1W8UA 2P37A 2EICA 1OF4A 3BVCA 3VGIA 4IE4A 3MLLA 3VHNA 4KNCA 5J3UA 1ND3B 5A6XA 1UXZA 1Y9MA 2WO2A 3CF6E 5DZEA 2LUWA 2GP3A 3DPRA 2V73A 3UGFA 3VKNA 5L7OB 3PLQA 1GOFA 2KXLA 1A8DA 2ARBA 4GH4A 2WS91 3CJIB 5A3MA 4K1YA 1MPXA 3NNMA 2VAUA 2P17A 1AL21 2WNOA 1HRV3 4HOOA 4Y1ZA 2GP5A 5F7UA 3U4SA 4MGQA 4Q26A 2Y6GA 3AMNA 1W8FA 4KU7A 3THPA 1MEC1 2XMLA 5TSWA 5IVJA 2A5ZA 5A1FA 1VP6A 2R49A 4QPIB 1SPPB 3ZYHA 5I93A 1WGPA 2BNOA 2YZ4A 1DG6A 1R083 2WA4A 2DVGA 3AP6A 4Z1VA 2ZAHA 1GP5A 3AKRA 2QQPA 2Y33A 3AKQA 4AVVA 2WYSA 2ZAAA 2QUOA 3PNAA 4R8HA 2DF7A 1SDWA 4MYEA 1RUH1 1JYXA 5FZ0A 3WQ7A 1RIRA 4AFDA 5H9QA 1UY3A 1OH3A 1S0IA 2D6KA 5GZGA 2R072 2NN8A 5LBFA 4HN1A 1H2KA 1A78A 3K77A 5FMBA 4YVWC 1DDLA 4DUVA 1HQLA 5FK7A 3E97A 2VECA 1IPJA 1VBD2 1QH6A 3B5LB 1QMJA 2J1EA 2PLV2 1W9SA 5JZGB 2FZ2A 1VBE1 3GCXA 3T0AA 1W6MA 4CVUA 5ABJB 1NCRA 1AR61 4AI1A 2W94A 3I2JA 4OLLA 1JZ3A 4L99A 5AC92 3JBG3 3VKMA 3VZJA 3DPRC 1EUTA 4EN9B 3MUY1 3UESA 2VMIA 2WQZC 3C8XA 2W87A 3CO2A 5ISLA 2VOWA 5FJHA 4IUGA 5C8CB 1BXHA 4DXRA 3OY8A 4L2NA 3GJAA 5EIYB 1WCSA 2JDKA 2HWD3 5FFOC 2RMU1 1M4WA 2VE1A 4UAPA 5GLUA 5JI7A 3ZFFB 1LR5A 1UZWA 1LHNA 2BWAA 4P08A 3LEIA 5LB6A 3AZVA 1RUE3 1A6CA 4D7SA 1OA3A 2ZTNA 4OI4A 2IWGB 1X50A 3ACLA 5FYTA 2WSUA 2WZ8A 1XSRA 4MHRA 5DAVA 5JSRA 3SNMA 4P9XA 3VBFC 3GBGA 1C28A 2WZPP 2ZKNA 4JAAA 5CG9A 3N9OA 3V0BB 4KG8A 4OHXA 4ES8A 1EV12 2P4EA 3J8F1 3T4VA 4BH9A 3F95A 2YROA 2GAUA 5C4WC 3JBG2 2BFUS 4N7UA 1MZEA 3PHMA 1JZ5A 4NWVA 4Y4YA 3A22A 3EYPA 3AXEA 3LE0A 5AVPA 5FYCA 2A6XA 2E7TA 4AHWA 2RV9A 3ZN4A 4BQWA 2GMEA 4EZ4A 2OS2A 4N43B 1RUG3 1R082 4ATFA 1COV3 5LBEA 4BQ3A 2EIBA 4XJZA 4AG4A 4UI9L 2XHNA 1W6OB 4AEMA 2RS11 5LA0A 3TEWA 3I4IA 4Z92B 4J1WA 3ZXFA 3RI8A 1DBNA 4B1MA 3CZJA 1LULA 4B1LA 5EFUA 3M7AA 1RUJ3 4DRRA 4C90A 3DYMA 2ATFA 4MGTA 4QPIC 4WZCA 3ZSLA 4SLIA 3H1WA 4YW4A 2E32A 2HWF2 3IKWA 1X33A 2BDRA 1Y9GA 2P34A 3EJKA 3KV6A 5LY2A 2CY6A 1DYPA 4KH9A 1O4ZA 4RGGA 1NA1A 1XSQA 4I0AA 1AR62 5EWSA 4XUTA 3D82A 2XDVA 2P3YA 3AZXA 4CEWB 4FCAA 4YGDA 2R061 4B4QA 3USSA 3EO6A 4E4DX 5FKBA 1WMEA 4JGYB 4KBZA 1OD5A 4GWMA 5J09A 2WZR2 3WF0A 3S7IA 4QPWA 3ILFA 5FR3A 2WUHA 5FRAA 1QXJA 5C9AB 3A23A 4DB5A 1D4M3 3RZLA 4MXVA 4Q4X1 2QZ3A 1PO21 3AL5A 3BODA 5C3QA 3VV1A 2XH6A 2WT0A 4GJYA 2Y6HA 4XZUG 3N7JA 2BYVE 5F3EA 3BU0A 3HEIA 1W6QB 2Y6FA 2OXBA 5JOZA 1YQ5A 1OD3A 4Y1XA 5KR7A 2HWC3 2YUEA 2QCSB 1I5PA 1W0OA 4Y1VA 4XUNA 4C1XA 3NQHA 1BBT3 2DUQA 3BUCA 1N47A 3CNAA 4WBBA 5BNPA 1FXZA 3JCIA 3PVOA 4GA9A 1LGCA 3WQ1A 1LOBA 4LORA 4NPRA 5EHDA 2DCYA 1UZ0A 2ZJCA 4YM2A 4I3GA 2PAEA 4FTSA 4O61A 2JB4A 4CEWC 1VALA 5J7MA 1I1EA 1OT5A 4IEZA 3POIA 2E26A 3R4SA 5FUPA 4FPGA 3POYA 1GNYA 1QGLA 2BVVA 5LA1A 2HWB2 4LA2A 1WMFA 4Z82A 5FZ9A 2Z2SB 1MS3A 3AB0A 3D5OA 1G9DA 1Y9QA 1R081 2DCZA 4XXAA 4DFSA 4AFCA 2IXIA 4JGZC 5FREA 4ATEA 3N7MA 2XGXA 1DLLA 4HG6B 5FYUA 5IJRA 2WNVA 4EYUA 1XNAA 2W0XA 3G6JB 4H7MA 5HBAA 3V0AA 5HXMA 1GUIA 3MHZA 4HMZA 3FUOA 4M3CB 2ZHMA 4CCLA 5C4WB 2CL2A 3IPVB 2Q4SA 2VNGA 4TLGA 4KG0A 4Q0UA 1EV11 1EAH1 4HSJA 1X82A 3ZFFA 4A7ZA 3NKGA 1JYVA 1GZ9A 1PZ9A 5K0UC 2QE3A 4QXBA 1Q8PA 3CBNA 1O3RA 2FDKA 2A6VA 4ZS2A 1CJPA 4AR2A 4COUA 4RL7A 4TZDA 2JICA 5F6KA 4E4SA 5FDBA 5JVVA 1WD3A 4XHXA 3WW4A 3RZMA 2VR4A 3B69A 4UBGA 1RUI2 3VD9A 1TMF2 4XILA 2MPFA 2BRTA 3O12A 4CDUB 2BV4A 1ACCA 4N8MA 4BM8A 1Z7S3 2G9FA 4P9JA 1VR3A 1HRI2 4Q4V1 5CFDC 2D5HA 2UWAA 5FWEA 3N9QA 1HXS1 3NW4A 2RMU3 3H1MA 3ZX7A 2VTXA 1ZM1A 1RHI2 1DGRA 2XBO2 2ZX0A 2A70A 2C9AA 1S2EA 2D43A 3V0AB 2W95A 1FOD1 3R6SA 4DIQA 2XPJA 2IFWA 4UF0A 2VQUA 4RD7A 2LM3A 4UW6A 2YPDA 5C3OA 5FO9B 2VCBA 5IVFA 4JC1A 1PVXA 3RYRA 3WV6A 2VXJA 1N3OA 1CVNA 3Q8BA 1HJFA 4GB33 4QX1A 3WOGA 1REEA 2O8QA 2JKBA 2YC2A 4OI2A 5IAXA 1CIYA 1T2XA 1QXRA 3JXSA 4COZA 1DLCA 4PQ9A 5FO7B 1H8TA 1TE1B 5LA2A 3JQWA 5L9VA 1W28A 3T4HB 2AEZA 4Q4X2 1LODA 2ZGSA 4MGZE 4CEYA 3O0WA 3ORJA 1WCKA 5DPNA 2QQVA 1CX4A 5FBJA 4DXZA 2FDJA 4GULA 4IGQA 1I3HA 5JSPA 2C0ZA 1LENA 4IEUA 3VD4A 2JXAA 4BE3A 4B4PA 2CDOA 1JZ7A 1W0PA 2Q1MA 1H1AA 1S0DA 3HQRA 4XABA 4BK4A 1WW7A 4WM8C 4OVEA 3MW4A 3AMMA 5T50A 1KQRA 4YWAA 3MYXA 1FOD3 2ZX1A 1W90A 3MV11 1PIV1 4O9EA 1HV1A 1HW5A 1N1YA 1YHFA 2GZWA 4HK8A 5DAWA 1EAH3 1SLAA 4XFCA 2RE9A 1UOFA 3TRSB 1NZCA 1QEXA 4JKLA 3KZ4C 2E6VA 2XL9A 4JGYA 5A1AA 5EJ3A 2NM1A 2VZ3A 1CJDA 3PURA 2J1TA 2ZEZA 5F5IA 3HT1A 4DUWA 2WAOA 2JG8C 3CKHA 1LU2A 1R64A 4LK6A 4A6SA 1K45A 5CFCA 1ZRIA 4XPVA 1RUI1 2FCVA 4QHOA 3OEBA 4XUQA 1TQ5A 4XFIA 1LEMA 5F5CA 5FY8A 3PUIA 1QJX1 3EQEA 3HBKA 2FDGA 1W05A 2DU1A 2ERFA 2R16A 2AEYA 4YM3A 5F2WA 1W2TA 4MXWB 3WR0A 1GWLA 5FY4A 2VMHA 4AVAA 4K8RB 2WFF1 3ZYGA 5FPVA 1RHI3 5LEJA 2W47A 4BQXA 1YI7A 1H1IA 2YC0A 2ZGQA 3M3CA 3U78A 4BOWA 3OCPA 1MS9A 5A3LA 3U75A 4WVMB 1GZWB 2ENRA 1QJEA 3KMHA 5BV6A 2JDNA 1QHDA 2BFUL 2ZPXA 3CMGA 2ZX2A 4AGRA 3ZMOA 3ZFEB 4IQPA 2R041 1CAUA 1GP6A 1CZSA 1RUH3 3MBWA 4QGLA 3CU7A 5A3OA 5E8AA 2EXKA 3OUHA 2PELA 5JXIA 1UYYA 2EXHA 3GYDA 5D1IA 3K4DA 3B9IA 3KQ4B 3NSTA 5FIXA 1GNHA 4Q4Y1 3VBHC 1W39A 1T6BX 3WLUA 2A75A 2BERA 4RR3A 5A7WB 3SH5A 3U11A 4ZZ8A 5ACA1 4YW1A 1TEIA 3C7GA 4ARXA 5IK7A 3ZSMA 4YZ1A 1WLDA 1JBCA 2WC2A 1OQ1A 3FMGA 4RR3C 1LHVA 2XJUA 2VO5A 3ST7A 3N9LA 4KWUA 1RUI3 1T6GC 2OZJA 3O1SA 2UY9A 3SH4A 4CDUC 4QGMA 1HQNA 1APNA 1RUD3 1XC6A 5DUUA 2RR12 4LKFA 5KXCA 5CAZA 1TNFA 2MEV1 2LROA 3S5QA 2CNAA 4CDQB 2Y34A 3VZOA 1UOJA 4IDZA 1ZBE2 2B9UA 2ARCA 3I54A 4AL9A 4HK9A 2WBKA 3VDBA 4CE8A 3L2YA 4ZKTB 4ONUA 2A3YA 3IMNA 3ZPYA 4DRVA 2YG0A 4FP3A 1VLNA 1IZ3A 3AVRA 3WSOA 4A41A 5F3IA 5T5OA 3KQRA 4UFHA 5EYYA 1BLZA 1MQTB 1D0HA 1NLRA 4HVQA 1GP4A 4RFT0 5LBCA 1FMD3 3PJQA 4MLOA 4L8QA 4Y22A 1PNFA 2RS53 5CKQA 3LA2A 2XJSA 5A70A 1W8WA 4BMBA 1LGNA 1UOGA 3IIIA 1FAYA 3OEAA 4D6SA 3NNLA 3DF0A 2W1QA 4XFBA 2W52A 3BU7A 2DWRA 4PIYA 3U0ZA 1OLME 1ZA4A 4RYDA 3NNFA 1MVEA 1JYWA 2C4XA 5A7PA 4YVSA 4YYOA 1BVVA 5K7PA 2AENA 1PM4A 1TG7A 5I8SA 2D98A 2RR11 1S0FA 2EA7A 5BNOB 2WWJA 1VE0A 3ES4A 1G9BA 1PVC3 5FPBA 1LHOA 2FDIA 2JDUA 5CIRA 4FVVA 1IPKA 2CHHA 1WD4A 2AYHA 1CAWA 2VOTA 1OVSA 3MIFA 2HKXA 1BBT2 4JGYC 5A33B 2P2KA 1HN1A 3J26N 5C3PA 5KHJA 4RA0A 4GWJA 1AX1A 3MF9A 3U07A 3VBOC 4Q4V2 5LA9A 2GC3A 3NNJA 2R32A 1SCSA 2QQNA 2RS33 4OI1A 3GF6A 4Y5Z0 1UF2C 1O3TA 2ADEA 4N9IA 4R9CA 5FZOA 5L7OC 3RNSA 4DEVA 3DKQA 2P6HA 3I2OA 3DEMA 2EVXA 2PTMA 3PU3A 2HWF3 2SLIA 3NAPB 3SLIA 4UFLA 4W65A 3I59B 3SH3A 4AVTA 2YBSA 3HD8B 4DXSA 4Q4V3 1RUJ2 2ZBJA 3ABZA 1W2AX 3ZFGA 4BQ1A 5FP3A 1PO13 5IHRA 1QJY2 5JOWA 1X8MA 2XR4A 2VW2A 2QQWA 2VZSA 4CDXA 4ZZ5A 3BKZA 2O14A 2VXRA 1YO8A 3HIFA 3FLRA 3HOBA 4L92A 5CKMA 3J7LA 1VBC1 1YEWA 5BNOC 5KC6A 2XOMA 5FQ0B 3UJQA 4B4RA 1EYBA 3KVAA 3NO8A 4GAZA 4D8MA 1R1ZA 5FXWA 4ZXKA 4M4RA 5BNOA 4H3WA 2VBPA 3C7EA 1H2MA 2DTWA 3NJXA 3GDBA 3N9PA 4AAPA 1V9U3 1YQ2A 5HXVA 1SFYA 4AW7A 4CU8A 1EV13 1C4RA 3HT2A 5DAXA 5FZDA 1WW6A 1F5FA 1MS1A 5T54A 3SITA 2BTVC 4JDOA 1F4HA 2XKPA 5EPAA 4EWDA 4FQ4A 2X05A 4COVA 1I5ZA 2XONA 4BQ5A 1OHFA 1B35B 2IUWA 3TEZA 2PN5A 5AC91 2DVAA 5CKNA 5JUVA 1H6XA 2QQKA 1CD3G 2ID4A 1ODMA 4BXFA 4P00B 2I45A 1UXXX 3OPZA 5IVEA 1RYYA 1WZXA 2Y6LA 1NXD1 2WFF3 3J7NA 3WD5A 2PYTA 4NIDA 1VBD1 3O5SA 4LITA 4Q0QA 4ASMB 3R4DB
chains in the Genus database with same CATH topology
1TME1 5HCFA 3ALQA 1RUF1 1ULCA 3WDTA 2WT2A 1RB8G 2DUOA 2WT1A 4N90A 3ZFFC 3AZYA 3FC0A 4LBMA 4N7IA 3TYJA 1UZYA 1H1MA 2FBEA 5K0UA 2NZ9A 3PVNA 3WG1A 1BMV1 2PHTA 5DXDA 3BOPA 1DQ5A 5GLVA 1GQHA 3M3QA 2XHKA 5LK5A 1FYUA 1B35C 4NOTA 4C0BA 2YGLA 2DVDA 4AFAA 1DGLA 3RS6A 3ZN5A 4YLZA 4FPFA 3TNQA 2V09A 3AYAA 3ZYIB 2JD4A 4J6GA 4F3JA 3AZZA 2D6PA 2TNFA 2ZGUA 1AR92 1MZ6A 2MEV3 1DQ2A 1RL3A 2PLV3 2WLQA 3JQXA 2ZGTA 5K9YA 3KCYA 2DUPA 1VBB3 4IV3A 1XNDA 3SXWA 1AX0A 3NL1A 2XB6C 2GN3A 3FJSA 5GZDA 5J37A 5DZGA 1POV3 2N7GA 5KHHA 3VBUB 4LBQD 2X53S 3MFAA 5KXBA 4IETA 4HL0A 3WDUA 4P9YA 1RITA 2Q5TA 3B00A 1OKQA 5T5JA 2ZGRA 3QCWA 4IESA 2XLFA 3WDYA 3LB9A 1ZX5A 3AFGA 4B7EA 4CEYC 1EAH2 1F9KA 2PHFA 1QDCA 3AYDA 1QY4A 1CPNA 1HRV2 2A7AA 3LA3A 4FPCA 4K1ZA 4WVWA 4PBOA 4LEJA 4QQ2A 2VOVA 4COYA 3CLPA 1N1TA 4WM8A 5FOJB 2QVSB 4K3UA 1QOTA 1QNWA 4MV2A 4I2OA 4LBQA 4NWWA 1LHWA 4BHPA 5FQ0A 1NE6A 1DQ1A 1SEFA 3OGGA 3RWNA 1CAXA 4QPIA 2AGSA 3H9AA 3LSDA 1XYOA 2OPKA 5IK8A 1IS5A 4XYXA 3D0SA 1H8TB 3NWKA 1CQ9A 4XBLA 3I59A 2AH2A 4D7TA 1KRIA 3CJIA 4Q4Y3 3KT1A 1EPZA 4N53B 3RMYA 1HXS3 2VY0A 1AYN3 5L7OA 4DS0A 3ZFEC 5E89A 4GALA 1UW8A 2BBVA 1AX2A 4P9GA 1NE4A 4E2QA 4M3CF 1IS3A 4FPKA 3WW2A 4OHVA 4LBKA 3WP5A 5ABJC 1S1AA 3GNEA 4IEYA 1XQNA 4E2GA 4LBNA 1YIPA 1ND2B 3MW3A 3ZXDA 2OW4A 5JLVA 4HFSA 2NQYA 4OUSA 2EAKA 1DQ6A 1Q8VA 4QM9A 4QQPA 3THTA 2BVBA 3MIEA 1KITA 3D6EA 3BTAA 2CYFA 1AYM2 1MEC2 4NVPA 1CR7A 1SACA 3TN93 4XJAA 4U2AA 2EXJA 1SLBA 1CAUB 1GNZA 1QJZA 2GNDA 5JOXA 1RMU1 4Q27A 2WS92 4LUMA 4D7YA 5GZEA 2VOXA 1RVF2 4BA6A 4XQDA 4P5HA 4QT6A 1MEC3 5JI9A 4N53C 3ILNA 3WHTA 1J59A 2BPA2 4FTBA 1WA4A 2EIGA 4IEVA 5JOYA 3T2TA 4FAGA 3UKVA 5BYNA 1YYNA 1XE8A 1QQP2 2EXIA 2CWSA 3WG3A 1GQGA 5DDJ1 2D6LX 1HDKA 4IV1A 4BCUA 3VL8A 1ZZBA 4ZU7A 4PJYA 4K8FA 1DU3D 2PHXA 2CGOA 1FV2A 4LO8A 3N7LA 1CONA 2HYKA 2Z79A 2WIIB 5CFCC 1MS4A 1MS0A 1UX6A 1S0GA 2E7AA 2PA7A 3KCXA 4Q29A 5DUWA 4RHV1 3MPBA 5JIUA 1FPN1 1AR73 1DGWX 2B39A 2B46X 2HWC2 4JDMA 2DV9A 3AP7A 2WA3A 3LAGA 1Q8QA 1FNZA 4HLTA 5GZFA 3ZXKA 3JB4C 5FTTC 5FLJA 3B7MA 5JWPA 2Z69A 2A3WA 4XBNA 5F5QA 3VDDB 3WG2A 1RJ8A 3INAA 3H3ZA 4Y24A 3QH6A 3ZSKA 1UZZA 1VAKA 1ZZCA 2UURA 4HKLA 4MXWA 1LOFC 1AYM1 1ALYA 3MIBA 4ORFA 1AR83 4MGKE 1QU0A 5J98B 3EBRA 1LOFA 2UWCA 2XKOA 3WUDA 4FPOB 3WXPA 1D4VB 3H3UA 1BMV2 5CFCB 5D8AB 3MGUA 4HETA 4IV1C 1YXWA 2A6ZA 5E1RA 3E6CC 1V6KA 1AXKA 5JPNB 2OYZA 2VU9A 1ND3C 2WSVA 1YFYA 3HMYA 4TYSA 1ULGA 3ZFGB 4K9SA 1C8M3 3B3QE 4LBLA 4AI0A 1AR93 2MEV2 4JCKA 2XG3A 4XJUA 1QOOA 2WJSA 4UXAA 1ZBA2 2C1FA 2VQAA 3OD4A 2CAUA 1ZREA 1AHSA 1O3SA 1RUC3 1PGW1 4LULA 4AQSA 5GKAC 2YGMA 4AFMA 1VBA1 1HRI1 2ARXA 4IERA 5I8TA 1DZRA 1I6XA 1JUHA 1H4GA 5JAXA 4LHKA 5C4WA 4AVCA 1VBE3 4XF4A 1J3RA 4CTEA 4Q0VA 3AZWA 3JBG1 3DL3A 1U5YA 2XUMA 5KHKA 1VRH3 3MIGA 3MICA 2ZZJA 3AX4A 1V00A 2BNNA 2P3IA 1PK6A 4FOQA 2XWBB 1A3KA 4XXPA 2X5IC 2I74A 4DY5A 2WFF2 4I30A 2AUYA 3NAPC 1UL9A 4JVAA 1OQDA 2A3XA 1H0BA 1BQPA 4PDWC 1QJX2 3WQ0A 3R05A 2FMDA 2Q1ZB 4MUVA 1XNCA 3SHRA 3JUUA 3H7YA 5CNAA 1BVP1 2D40A 1KD7A 1VBA2 3WVJA 5F1RA 3N7KA 4NN0A 1LKNA 3QD6A 2R073 3WHUA 2Q8OA 1J3PA 4XQ4A 3VZLA 4JRLA 5HI0A 3H7JA 3PMSA 3GZUC 3WDVA 3FBMA 1U5IA 1O7FA 2G9GA 1QNYA 3C2UA 4PLNA 3TWIA 4WVVA 4PIXA 1KDMA 4EJRA 3WUCA 3X29B 5C9AA 4A2UA 4NR1A 1V9U1 1GYKA 2GH2A 2FZ1A 4FXGB 1WUVA 1PO12 1FV3A 4KWJA 1G6NA 3ROUA 4CEWA 3MPPG 4LLFA 3QOPA 3R0RA 2A6WA 4MX3A 4ASLA 4LO4B 2Q30A 3JD72 5T5PA 1QOSA 2Y38A 1ENSA 4B8EA 2R043 1RMU3 1V6IA 1VB2A 5LK7B 3U10A 5KXEA 1AL23 2R1DA 4WM8B 3VBSA 4RHV3 4XBQA 3JZVA 3M4FA 5FPXA 5K8SA 1DYKA 5AVAA 4GH4C 3DPRB 2I07B 2F6BA 4IEPA 4Z8BA 5C6CA 5D8AC 2DCJA 4YZ5A 2CGPA 3LCPA 4BMEA 3URFA 3WP4A 1OI6A 3AXDA 5JDBA 4HPKB 1ASJ1 3ZYJB 3VKLA 3VKOA 1ULFA 3VHRA 4OHYA 1C3HA 5DDJ3 1W6QA 3GHNA 1QDOA 5C8WA 1YRZA 1Q3EA 1RHI1 3IDCB 1JHNA 3O14A 1ZZ8A 1QJU1 3PVEA 5H9RA 1CIWA 3MI8A 1VIWB 1U5XA 1ZRRA 2NLRA 5GZCA 4YZ2A 5C9AC 4QM8A 1OLRA 3FUQA 3KT7A 4QMAA 5FLIA 2O1QA 4YVWA 1FMD2 2ZX3A 3UL2A 3VDDA 1HRV1 1IS4A 3CJIC 3K48A 5LRSA 4GMP3 1HX6A 4UW5A 1AUYA 3DUIA 3VDDC 3VHPA 2OUJA 4XTMA 4KGQA 1G9FA 1MZFA 2P3KA 1QJY1 3QACA 5GJ6A 2WNUC 2GC2A 1JTZX 1TME3 1XYNA 2JDZA 1LOAA 4X8PA 1OSGA 1VAMA 4MVTA 4CDXC 2RS52 1NQJA 2UYBA 3BCWA 3J4UH 1PGL1 2RR13 4Y1YA 2PAMA 2QZ2A 5FMOL 2Q0AA 5FO8B 5CVRA 1WLWA 4B29A 2ZZQA 2R0FA 4JV4A 4LT5A 1KDKA 2ETEA 3B93A 1OLQA 4L97A 3M2MA 2ZHLA 4GMP0 1MS5A 1G7YA 2MNGA 3PMEA 1GR3A 1VRH2 4Z2WA 4RS5C 2CTVA 3J8F3 1MACA 1X36A 5EZWA 3RDIA 1RUD2 1S2BA 4N53A 3FFQA 5KBFA 4QPYA 5B2GB 1Y7BA 3VBHB 4D69A 3IPVA 1X7NA 3GALA 1ND2A 3M3IA 4EWAA 4CRQA 1KJLA 2IFRA 4XFGA 1SLIA 2F4PA 4KWLA 2E9QA 1NCRC 1ND2C 1IGOA 2A73B 3AP4A 5JR7B 4AEJA 1Q56A 1CAXB 1WW5A 2XVLA 1V6NA 4Q2FA 1RUH2 2JECA 4IEWA 1PO22 3NAPA 1PIV3 4YGBA 3MW2A 4U36A 1ZBA3 3ZYRA 2E63A 2HWE3 1TNRA 4V1PA 4XTPA 2UYAA 3WDXA 4AI8A 1N1SA 2BGCA 5BXXA 2ZX4A 3VBRC 3VL9A 4W6YA 1C57A 1UMZA 5FLHA 4Q0PA 1IKQA 4M00A 3WZ1A 2HWF1 1FOD2 3FWEA 4KU8A 2ZS6B 4XFFA 1GLHA 4E4ZA 2HJIA 1RINA 2VUAA 5JPMB 4HZFA 4XJWA 2PAKA 2Y0OA 2NYYA 4UW4A 1D0GA 3N36A 1UN1A 2UU8A 1FPN2 1VBC3 1YUDA 3KSCA 2WKKA 1LRHA 2JJ6A 4FOYA 1ZZ7A 3OGJA 4IV3B 2E53A 1XXNA 1NOVA 2OUHA 1N1VA 1YFUA 4AFBA 1PGL2 2D3PA 3GZTB 2QDRA 1NA1B 2DCKA 5L19A 4OHZA 1UPIA 3AJYA 3HAGA 4LBQB 1S0BA 4LO7A 2VW1A 4GB32 4LLOA 4K20A 4Q4X3 4X6RB 1R1A1 5HCBA 5C8CC 1MQTC 1NY72 4FT8A 1BK1A 1BYHA 5FPZA 5BUVA 4Y22B 2RMU2 4Y1UA 1RUF3 2HWB1 2YXSA 3RYPA 1BBT1 1CAVB 4HN0A 3MDPA 3VHOA 5FMOS 1PIV2 2GALA 2VOKA 2BNMA 5T3NA 1AXZA 2DURA 1ZBA1 3UKNA 2GSYA 4AQ6A 4BLJA 4YSFA 5CFDB 5SV8A 1C1LA 1RUC1 3ZO0B 3JU9A 1C5HA 2HEWF 2RM23 2IXLA 3WW1A 3M3OA 5ACA3 2D5FA 1H2LA 2XL7A 2WNUA 2ZHNA 3OD0A 3USUA 1PZ8A 1NCQC 2YV8A 4I02A 1DF0A 1PVC1 4K7JA 3RPQA 1KJRA 2XVGA 3WINE 4AHYA 2B45X 2WWSA 3I2DA 1ONAA 1TME2 2IXCA 2JE7A 4F7ZA 3VBOA 2VULA 3FHIB 3E5QA 3AM2A 1GZWA 2AREA 1WLTA 4CDXB 1H8TC 1CGPA 2D3SA 4G3YC 4XFAA 4DZGA 4I0BA 3CEWA 2BW8A 1BEV3 2RS12 3ASIA 4Q4Y2 1DFQA 2H6CA 4AQTA 2B42B 4XIKA 1WCDJ 3PTYA 5IK4A 1V6OA 3A0NA 1JW6A 2X8KA 5DZFA 1J1LA 2GN7A 1K5MC 3T1MA 4OULA 2K0GA 1U0AA 3AJZA 4F8AA 1VAVA 4WM7A 4LBOA 4QHBA 4EWEA 2BEOA 4L9BA 4XIOA 4N43C 4GXLA 2ILMA 4QPGA 5DG2A 5DDJ2 1LOEA 4S2DA 2DVBA 4O9GA 1AR63 1ENQA 4W6XA 4YZ4A 2PHUA 3SISA 3MF6A 3E6DA 1FMD1 4HT1T 5I0TA 3S6PA 3JD73 4BIFA 3RMXA 3G7DA 3TBDA 5T52A 3RJ2X 1H2NA 4LNVA 2WZR3 4RGAA 3AMHA 1CN1A 4XHBA 2V5YA 3OBRA 5A32B 1QJU2 5FOBB 1RUG2 1PNGA 1UIJA 4JTOA 1G8WA 4YVSB 4ES9A 2OVUA 2UWBA 1RMU2 2XJVA 1POV1 4BLIA 3A0KA 4L11A 1JH5A 4XW3A 1ASJ2 4K40A 4MZUA 4YM0A 2XJQA 3N35A 3NV4A 4YGCA 4YRDA 1VBA3 1LB2A 5A33A 3K51A 3GBFA 3RZZA 1ZZ6A 3TN91 1U12A 1RTVA 3ZXJA 1KFUL 4FPHA 4AEKA 4OI0A 4AEDA 1WLCA 3VBHA 2CAVA 4PF5A 1Q43A 1NYWA 2FQPA 4GIQA 2B8MA 2X29A 1PHMA 4LE4A 5FAXA 4EROA 2ZGNA 4AXOA 4LHNA 3AP9A 2QDNA 1AR71 2QNKA 2WZR1 3H0OA 4YG6A 5J96B 4FPJA 1PO11 3W58A 4DQAA 1BJQA 1W6PB 5C33A 4FAHA 4DINB 4JTNA 4M0NA 5KHIA 1G86A 3DV8A 4AHZA 1MQTA 3HN1A 1RUE2 1OOPA 3ZXAC 3KGZA 2XBO1 3RI9A 3ZYPA 3QH7A 5BNPB 2EAAA 4E27A 2GNMA 1EY2A 4M3CA 2XLAA 2HWD2 4QQOA 4C0HA 2D6OX 2VG9A 2GH8A 3UV9A 1AYN1 2YY1A 2D3RA 5I0SA 5D8AA 4MSVA 1TMF1 3WCSA 3MLJA 2GC0A 1ZZ9A 2VPVA 1ASJ3 5F9TA 1HQWA 2ZHKA 5AC93 1HLCA 1ENXA 2ZCWA 2VNOA 4FPYA 1POV0 4Q1RA 4YFZA 3S7EA 1LCLA 3VZMA 1Y3TA 1GBGA 3W59A 4GKYA 2GC1A 4YVWB 2DTYA 5BNQA 2GNBA 1SBDA 3DN7A 1VBD3 4EN8B 3AYCA 1OQEA 2IZWA 4IEQA 1VBB1 2K2SA 1LOGA 2PQQA 1W6PA 1X8EA 1DQ0A 4W6WA 3KD4A 1QQP1 1F2NA 4E9KA 5AFEA 4MH0E 4PDWA 1YFXA 2JG8A 1DHKB 1WMDA 4QX5A 2VGDA 5KXDA 1NQDA 4RSUA 4XMAA 4WVMA 1W2UA 4JDNA 3ZVXA 4Q1PA 1PMIA 4LHLA 4N9HA 2EALA 4RS5A 4FOVA 1OOPC 1H8VA 3ATGA 4C91A 5AFBA 4P9IA 3VZKA 4B7KA 2JEMA 4FPEA 4XF0A 2E7QA 4YG0A 4S2HA 3E5XA 1XE7A 3KT4A 4R9BA 1ZRFA 1V6JA 1CESA 3FLTA 2CV6A 4IV1B 2JX9A 3VLBB 4HANA 4K6BA 4Y20A 5GLTA 2GNTA 2PLV1 3IBMA 2O0OA 4CEYB 1FNYA 4Q4W1 4IEXA 2OZ6A 3AKPA 4K21A 1EPWA 1PM7A 1AR72 2O8OA 2RS13 3FX3A 4YGEA 4B3NA 1ZRDA 5JSOA 1XU1A 4F83A 3RSJA 1W6NA 4ZU5A 4XE9A 4A3XA 1PVC2 4COWA 1YI9A 5GALA 3JD71 1UU6A 5F6LB 3WP6A 3Q9OA 1NLSA 3PJYA 4CDUA 5I8YA 4XF3A 3WP3A 1VB4A 3VUOA 1ZBE1 1ZYBA 4JGZA 4NHMA 4GQ7A 1H9PA 4BWOA 1H9WA 3S30A 2R062 1WW4A 2H0BA 4QPGB 5C8CA 3WT3A 3MFCA 4AK3A 1GANA 3ZMNA 4AVSA 3V0BA 3B01A 2W39A 4QQLA 1KXGA 1H4HA 1AXYA 4YZ3A 1DGWA 1ZRCA 2IXJA 1UCXA 3KGLA 2YYOA 1G9CA 3N4MA 1AJKA 1N3QA 1PZ7A 4LE3A 4NO4A 3LZZA 1SLCA 3T1LA 2TEPA 3ZXEA 2DCTA 2A71A 5ACA2 2WNVB 5T5LA 1NCQB 1R093 2Y0IA 2ET1A 1QQP3 2WL1A 2WLPA 1NY71 3HQXA 3MZHA 3KLSA 2WS93 2VUJA 3NJZA 4YM1A 1WBFA 4TLFA 3ME2A 4YVSC 1R1A2 3POWA 3WX5A 1RUNA 4D3WA 3ZSJA 1AF9A 4JQRA 4LA3A 4IV3C 3VBUC 1NCRB 2EF6A 2R1BA 5FCCA 3E5UA 3GBWA 4R9DA 4R4ZA 3CJXA 4P9LA 3ZSEA 4Z07A 1IHMA 1RC6A 4XF9A 1YIFA 3WW3A 4AE2A 4SBVA 4S2FA 3MIHA 4AQ2A 1E57A 4GWNA 1AYN2 1AR81 1GZCA 2CWMA 2VQ0A 1Q8SA 2WNVC 5BNNB 4YFWA 4GKXA 1UIKA 2GMMA 1PGW2 1ND3A 3ZFGC 1LEDA 2RS31 1GICA 3ENRA 3BIWE 3UKTA 4AVBA 3B94A 5J48A 1NG0A 4DMIA 3AKSA 4ZU4A 3O0VA 1QWRA 4C1WA 2HEYF 1MS8A 3OYWB 4HBNA 5CFDA 1FPN3 1C8M1 4GH4B 3DKWA 1VJ2A 3IDEA 2BQPA 5KC5A 2H6BA 2JG9C 2QKDA 5HCAA 3M8LA 4P9WA 1BKZA 4CDQC 2ZMNA 4ISRA 4LO5B 3OF1A 1SCRA 5CADA 5LRRA 4YW2A 5LEKA 5BNNC 4YW3A 4PLOA 4UBHA 4XF1A 3NVCA 1NA1C 3H1YA 4BZ4A 4Q4W2 4KBBA 5BNNA 3AMPA 1S0EA 1U5ZA 3SCHA 2GMPA 4R52A 1UKGA 3AFKA 3WDWA 3SCGA 2HWE2 1JXNA 4IEOA 3LGRA 2TBVA 1PO23 5EXOA 2WFPA 1KS5A 2VVFA 2Z5WA 3E6BA 1RUG1 4AI2A 1RGSA 4E2SA 2HWC1 5E88A 4YARA 2X5IA 2DU0A 3D8CA 3IIAA 2G4IA 1N3PA 4XJ8A 3AK0A 1IQAA 2AR6A 4WZFA 5EV7A 1MVQA 2D7FA 1BZWA 1URXA 3J8F2 4XFHA 3FE5A 4QXKA 3IM0A 3EHKA 3ELNA 1VBB2 2JG9A 4GB31 4AWDA 1SBFA 1OA2A 2NMNA 5JZGC 4Q0SA 1A8MA 4MGIE 1RUOA 1DGRN 4UW3A 1W6MB 1ULEA 1Z7S2 2PHRA 2D6NA 5JZGA 1UPSA 1TMF3 4D94A 4FTEA 1D2SA 2ZGLA 4HKOA 3RG0A 2KM2A 1LU1A 5L36A 5DUVA 4WVZA 3LOIA 1K5MA 1SLLA 3TAYA 5H9PA 1PK6B 5IUQA 1Y43B 3I7DA 3WY6A 2ZA9A 1C5IA 2LALA 4YNIA 1XRUA 1S0CA 1R091 3LOBA 5I0RA 2VMGA 5JIAA 1RVF1 3WG4A 1UKRA 4XDQA 5ABJA 2QJVA 4QPGC 1REDA 2NMOA 4LTAA 1W6NB 2VNRA 2ZGMA 4YW5A 2YDEA 2B5HA 2GU9A 3FZ3A 4XJ9A 1C1FA 3APBA 1SFNA 4FQZA 4AF9A 4Y26A 4TWTA 5DUXA 1C8NA 4QD2A 3N3HA 1QF3A 4H14A 1LGBA 4PIZA 4FPLA 3OY8B 4R4XA 4OHWA 2DFBA 1SBEA 3GZAA 4KWKA 3AKTA 2R071 3MLKA 4FO9A 4FBFA 1NCQA 3LA7A 1YJLA 2JENA 2ZGPA 5GM0A 2H0VA 5JMCA 2FHRA 1J1TA 3NV3A 2FMYA 3TB0A 4I3PA 4A7KA 3TOJA 1YCIA 1QJU3 4HVRA 1CAWB 4CP1A 4CP0A 1EP0A 1YFWA 1YNAA 4RQPC 2JG9B 1OFNA 1HKDA 1LOCA 1J58A 1IKPA 1V9U2 4DNYA 2XJRA 3I8TA 2A6YA 3FFZA 4META 4CDWC 1AVBA 3IN9A 3HR9A 3B02A 4AI3A 2JG8B 1AL22 2VVDA 2WQ4A 3JB8A 2ZMKA 2ZGOA 1DZTA 4OFGA 4AEDC 1O3QA