4BIFA

Biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
MEIKRVGSQASGKGPADWFTGTVRIDPLFQAPDPALVAGASVTFEPGARTAWHTHPLGQTLIVTAGCGWAQREGGAVEEIHPGDVVWFSPGEKHWHGAAPTTAMTHLAIQERLDGKAVDWMEHVTDEQYRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords CUPIN 2 CONSERVED BARREL DOMAIN PROTEIN
publication title Biochemical and Structural Characterisation of a Novel Bacterial Manganese-Dependent Hydroxynitrile Lyase.
pubmed doi rcsb
source organism Granulicella tundricola
total genus 30
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bifA00
2CV6A 2BEOA 2FMYA 2IXCA 1I6XA 1O5UA 4PIXA 5I0TA 1UD1A 4XFIA 1OFNA 2Y0OA 2VQAA 2OYZA 1J3RA 1ZZ7A 4HVRA 4QMAA 1CAVA 4Q0UA 2V09A 1ZVFA 1X8MA 3ZDSA 5KHHA 3BPZA 2KXLA 3TNPB 2CAUA 2CGPA 2Q30A 2I45A 3OCPA 3RPQA 3ES4A 3CO2A 3MPBA 2EAAA 4J1WA 2Q0AA 2GZWA 3DKWA 4O9GA 4B29A 1CAVB 2Z69A 3SCFA 3D0JA 3RZZA 5K8SA 4BYYA 3FX3A 1YUDA 4XFBA 1RL3A 4MUVA 1X82A 2E9QA 2DCTA 3S7IA 3NL1A 1UIKA 4XF3A 3S7EA 4P9GA 5I91A 4XF1A 1J3QA 3MDPA 3OTFA 2OZJA 2XKPA 1QXRA 4EROA 4ZU7A 1J58A 4E2SA 1ZZ6A 1J59A 5FQ0B 4XEZA 2GC1A 4IEQA 1ZRCA 1OMIA 2ZKLA 1VP6A 3FE5A 2MHFA 3H3UA 2GU9A 4XETA 1WGPA 3ACLA 2BYVE 2XL7A 3PLQA 4WVZA 3S0MA 4IEUA 4LA3A 4CYDA 1XE8A 4AQ6A 4I09A 3MYXA 4RD7A 2N7GA 3I7DA 1GQHA 5JSRA 1FXZA 3HT2A 3OF1A 4MGIE 5EFUA 3SMHA 2D5HA 1EYBA 4AVCA 4FT8A 2QDRA 3NKTA 1O3QA 4BH9A 2OA2A 3JZVA 1ZRRA 4XFAA 5FCCA 4ONUA 3TNQA 3LOIA 4MZUA 3L2HA 4Z82A 4X6RB 3H7YA 1I5ZA 1XRUA 2C0ZA 2D93A 1LRHA 1FT9A 4EWAA 1VJ2A 1CAWA 4Q0SA 1RTVA 1H1IA 4HN1A 1DGRA 5D1IA 4KU8A 5FLJA 5I8SA 4IERA 1SFNA 3G7DA 2QVSB 1RUOA 2K0GA 1NZCA 2PHDA 3CL1A 2XLFA 4KU7A 3ELNA 1LKNA 3H8UA 4QXKA 1PMIA 1YFYA 3EJKA 4AXOA 1QWRA 4F7ZA 5KBFA 2XLAA 3IDBB 3I59B 4JTOA 5C6CA 3E6BA 5FPXA 1PM7A 4QGLA 3EBRA 3EQEA 4K8FA 1GQGA 2Q1ZB 4WBBA 5JSPA 2UY8A 2O8QA 4HVQA 3FZ3A 2PFWA 1ZNPA 5LEJA 3D0SA 2K9ZA 2UYBA 1RC6A 3GYDA 1WLTA 5CADA 5JAXA 4IESA 3IIAA 1CAXB 1QXJA 4IEVA 4IEXA 4FAHA 5I8TA 1CX4A 1Q43A 2HKXA 4XF9A 2ET1A 3VHRA 4Z07A 4EWDA 4HLTA 4XFCA 2BNMA 3LAGA 3BCWA 2GH2A 4QM8A 2EVXA 1X7NA 4UBGA 4KWJA 2F4PA 2IXHA 4XFHA 5E1RA 3E6CC 5I0UA 4MH0E 4DINB 4FBFA 4XFFA 3MZHA 3RYRA 5FQ0A 1YFXA 4I01A 4PJYA 5I93A 1J3PA 2BGCA 3E5XA 2HJIA 4XF0A 4EWEA 3PVBB 3NSTA 4R52A 2UY9A 1IPJA 5BXXA 3OD0A 2PYTA 1O3SA 2ZCWA 3LWCA 1U12A 2VECA 1L3JA 5FLIA 4I02A 2B5HA 1UIJA 1YWKA 4Q29A 3H1MA 3LZZA 4LUMA 4YSFA 3H9AA 4QGNA 4EV0A 4IEWA 3FHIB 3U10A 1SEFA 2XKOA 4OFGA 3CJXA 3HT1A 2BNOA 4H7LA 4LULA 4KWLA 4R8HA 2GC3A 3EHKA 4HBNA 5LRRA 1HW5A 5JR7B 5KHKA 3E5UA 2PQQA 2ATFA 2XL9A 2IXIA 1EY2A 1UPIA 3KCCA 2MNGA 1ZZ9A 1IPKA 1ZZ8A 2QCSB 3NJZA 3PNAA 2IC1A 4L2NA 1UCXA 3RYKA 3CEWA 4IEYA 3FFQA 4HN0A 3M70A 3UKNA 4Q0QA 4BIFA 1ZX5A 1XE7A 3BB6A 3EO6A 4GULA 3I59A 4META 2CAVA 4LA2A 2OPKA 3H1WA 1FI2A 4I0AA 1OI6A 3D82A 4XF4A 3H3ZA 4YARA 5KHGA 1EP0A 1EPZA 4QM9A 4LLOA 4Q0VA 5FPZA 1CAXA 2GC0A 2H0VA 4L11A 2OZ6A 4PIYA 3LA2A 2PA7A 5CVRA 5JCTA 1ZZBA 4D7TA 5I0RA 4YRDA 4JTNA 1DZTA 2UYAA 3QOPA 4NVPA 2O1QA 3BU7A 2IXLA 4IEZA 4UBHA 2PTMA 1ZRFA 2GC2A 1O5LA 4AVAA 1YFWA 3SCGA 5HI0A 2D5FA 4UXAA 4AQ2A 1CAUA 4WZCA 4LEJA 2XLGA 2QNKA 1ZRDA 1LR5A 2GAUA 5BY5A 1WA4A 4ZU5A 4ORFA 4Q0PA 3NW4A 5J7MA 4HSLA 1YHFA 4O9EA 3R6SA 3RNSA 3GBFA 3KGLA 2XHKA 1LB2A 1O3RA 4HMZA 3O14A 1NE4A 3E6DA 1X8EA 1JUHA 4AVBA 3QACA 2B9UA 1VR3A 4A2UA 3WW4A 1Q5OA 1V70A 5BUVA 3FJSA 2ETEA 1CAUB 2PAKA 1CGPA 5BV6A 2Q4SA 1UW8A 5T3NA 4N9IA 4HZFA 2FQPA 3RDIA 4KWKA 4D7SA 1G6NA 1YLLA 5I0SA 1NYWA 3U0ZA 1ZREA 4F8AA 1SQ4A 5KHJA 2PHLA 4QGMA 3H50A 3SCHA 5LEKA 3IDCB 5BPXA 5J3UA 2WC2A 3B02A 3H1YA 4QX5A 3KMHA 5LRSA 2QJVA 4LUKA 4LTAA 4HVOA 3SXWA 4TLFA 4I2OA 5JSOA 3ST7A 4J1XA 2P17A 3LA3A 5C8WA 4X6QB 2EA7A 3RYPA 3OGJA 3H7JA 3BALA 1TQ5A 3IBMA 4JVAA 5KHIA 1QY4A 4MGZE 1Y3TA 3C3VA 2BNNA 4MV2A 2MPFA 2ET7A 1DZRA 4MX3A 5J48A 3USSA 3ES1A 1RUNA 2H6CA 3M3IA 1OD5A 4E2QA 1NE6A 4IETA 3CF6E 3WW2A 3ROUA 5FDBA 1Q3EA 3KGZA 3IWZA 2PAEA 3LA7A 3U11A 3HQXA 4HSJA 4JV4A 5FLHA 3ETQA 3NVCA 2WFPA 4IEOA 3E97A 2B8MA 5EZWA 4PIZA 2XGXA 3WW3A 1RGSA 3CLPA 1O7FA 2Z2SB 3I54A 4MGKE 3KSCA 4I3PA 5F1RA 3DL3A 4YYOA 4OLLA 2IXKA 4N9HA 3UKTA 3DN7A 2H6BA 2PAMA 1ZZCA 5I8YA 1H1MA 3UKVA 3FWEA 5AVPA 5CU1A 1O4TA 1NXMA 4MGYE 3DV8A 3SHRA 1Y9QA 3HIFA 1O3TA 2D40A 2IXJA 2VPVA 4I0BA 4XFGA 1YFUA 4ZU4A 1DGWA 4E2GA 4KL1A 1J1LA 3WW1A 3N4MA 4FAGA 4BHPA 4IEPA 3E5QA 4YNIA 1CAWB 5E16A
chains in the Genus database with same CATH superfamily
1WA6X 2BEOA 1BYHA 4UFHA 1YNAA 4ZS3A 1NQDA 2IXCA 3NKGA 1WMDA 3ZFFC 5F6LB 4DB5A 5I0TA 1HRV2 1UD1A 4XFIA 2EIDA 3N7MA 4D6QA 5CISA 3BVCA 1CONA 2OYZA 4LJHA 3WF1A 4CDUC 1ZZ7A 4QMAA 4HVRA 4QKNA 4BLIA 2W91A 1LOGA 4R9CA 2E26A 4BOWA 5CB7A 3N7LA 3VBOA 3WEZA 2RE9A 3ZDSA 4CCLA 5BNPC 1CPNA 2GNTA 1HJGA 2XWJB 2ZEXA 3BPZA 2GP3A 2KXLA 4QPGC 4L92A 2ARBA 3PVEA 1BHGA 1RYYA 3I49A 1CJDA 2XBO3 3BN6A 3BIEA 1J1TA 1D2SA 3WUCA 5C5UA 4GMP0 1RUI2 3OBAA 5FMOL 3UJQA 1S2KA 1ZA4A 2E33A 4H55A 4AZZA 4UF0A 3HQRA 4QX8A 1W8FA 2AC1A 3PUSA 1POQA 1REFA 3B9CA 1ZBA2 5CKMA 1C8M3 2A7AA 3NWKA 3SCFA 1OLRA 1IS4A 2B39A 1QJY3 3D0JA 5JWPA 3Q9OA 2SLIA 1H2LA 3OJBA 4HOOA 3FX3A 4YGBA 5FUIA 5KXCA 1REEA 1PNFA 2JE9A 2XJUA 3KLSA 3SEEA 1X82A 3NV4A 2ARCA 5IVFA 4AHYA 4RQPB 1JODA 1QOTA 1XNCA 1CX1A 1TMF2 1UIKA 4RYDA 1ALYA 1UU6A 1RHI1 1WCQA 3PIGA 1VBD1 1JZ5A 4SLIA 1OH4A 3CJIA 4GJZA 3MIGA 5GZGA 2YFUA 5CG9A 5GJ6A 5JLVA 5JXGA 4FPOB 3PU8A 3OGRA 4CDXC 1ZZ6A 4E2SA 5FQ0B 4XEZA 3IDAA 2Z42A 1XPWA 4YGEA 1FX5A 1WD3A 1DQ4A 1N3PA 1W0PA 2ZKLA 3VBUC 2VG9A 4NHLA 2OIIA 2MHFA 5FZCA 1QJX3 5DPNA 3ZO0B 2AGSA 4XILA 2GU9A 2VOXA 4XETA 3ZSLA 1WGPA 2XL7A 1S1AA 3WLUA 4CDQA 4DZGA 3OY8A 3S0MA 3FBMA 3HVDA 5HXVA 4IEUA 4LA3A 3CBNA 3CNAA 2N7GA 2B7YA 5JSRA 4KMQA 1MZFA 1K5MA 5JXHA 1XXNA 4MGIE 1RXFA 4MG2A 1LECA 1FOD3 1ZYBA 2D5HA 1NOVA 2XVGA 3A7QA 4OQ8A 1N3QA 3AK0A 4MXWA 4AI0A 4CE8A 2ZGKA 2Y34A 4QKFA 1BEV3 4NWVA 5FZ1A 3WNKA 4AK3A 4XXPA 3POBA 4DPNA 3PURA 5A6QA 4JZRA 2W92A 3LF7A 4B7KA 5DAVA 3WHUA 5IATA 2FD8A 1OF3A 1V9U3 4XFAA 2XJPA 5F5QA 4COZA 1XYPA 4MZUA 4Z82A 5DMYA 2X5IB 1D4M2 2VOVA 1TME2 3C2UA 1R081 4LQRA 5FP3A 4RS5C 2DVGA 1N1SA 2D93A 4P14A 1LRHA 2WLPA 1RUE1 1CAWA 3LIHA 4L0PA 4O61A 4C0BA 1RTVA 1W2OA 1DGRA 3MIDA 5DZEA 5LWBA 2RDQA 5L73A 2P6CA 2GDFA 4QQOA 3DXUA 4IERA 3LDKA 3VBFB 3CL1A 2WNUA 1ODNA 2XG3A 3DPRC 1QQP3 2XHNA 4OQ9A 4Q5OA 5DAXA 3I2GA 1VRH2 4B8EA 1NCQB 1BQPA 3W5MA 2Y6HA 1SLIA 1RUH3 4QXKA 2NLRA 5DAPA 5FUNA 4CSWA 4E9KA 2D6OX 3CKHA 3EJKA 3JXSA 5C5TA 4AEDC 3OPTA 2WWJA 1CPMA 3IDBB 3VBHC 1MS3A 1MZ6A 1YCIA 3INAA 3VD9A 3N9LA 4ZXEA 3E6BA 4TZDA 2WNVB 1HRV3 1W06A 4QX2A 1F31A 1PO22 3EQEA 4YZ3A 5DQ0A 5FY7A 4KQ7A 3U37A 1GZTA 1HB1A 2BTVC 1S0FA 3D0SA 4NHKA 3T1LA 5FP8A 1OA3A 2XBO1 2VZ1A 2VU9A 3JBG2 3EMRA 5JAXA 1FPN2 2R30A 1CAXB 1QXJA 1AR72 3K77A 3GALA 1ZBE2 4RHV2 1RJ7A 1Q43A 4WM7B 1A8DA 2WS92 4XZUG 3J4UH 1B35B 1DZQA 1KDMA 4QPIB 3VHRA 1EUTA 1UF2C 1W6PB 4JGYA 2BW8A 5L7OB 1C57A 4W8JA 1C8M1 1RUI3 1IS5A 4XFCA 4EWDA 2BNMA 3A22A 2DU0A 4XE9A 4E4HA 2VZQA 3BCWA 4RQPA 1QJY1 4HPKB 3N9MA 1S0GA 4RGAA 4XJ9A 5DN2A 3OGVA 1RINA 1ZBA3 3C7OA 4UBGA 4KWJA 2EALA 3GBGA 4A6SA 2WINB 5E1RA 4H14A 3BOWA 4CCNA 4DUXA 4URTA 5CKNA 3O1MA 3VBOC 4XQWA 4E27A 3UNPA 4FBFA 1L7RA 2QUOA 3RYRA 4F3JA 3L9JT 5FQ0A 1FATA 2A75A 1TG7A 3HQUA 4Q4Y2 5AVAA 5JPNB 4RR3B 2BGPA 4YM0A 1TMF3 1J3PA 5FZIA 2E6VA 1XNTA 5EV7A 4COUA 1PMJX 4W6WA 1WLCA 5F3IA 1XBFA 1E5HA 1F4HA 1XNDA 2R073 2WO3A 4UOJA 1FV3A 3LSDA 4NR1A 4LK6A 1QJX1 1W2NA 1MS8A 1DLCA 1NT0A 1Y9GA 3I8TA 4AI2A 5L19A 1RUC2 1JHNA 2RG4A 3IM0A 4OHWA 1KFXL 4QKDA 4YGDA 1HDKA 5FREA 3ZN4A 4N43B 3TEZA 1QEXA 1XQNA 1YIPA 2YB7A 4EV0A 4IEWA 4V1PA 5FZMA 1FOD1 4DFSA 3SH4A 4HFSA 3WY6A 5JIUA 1A3KA 1SEFA 5F9TA 2X5IA 1BEV1 5C3SA 1E5RA 4LBNA 3V0AB 1WCUA 3R0RA 2XJVA 4R8HA 5IAVA 4ASMB 4DQAA 1DG6A 3AKRA 4XJUA 5IK5A 1CESA 4PLNA 1V9U1 3CJIC 1HW5A 3MV11 2ZGMA 5LRRA 2PQQA 4FOWA 2QFEA 3OGGA 3F95A 3CDZB 3N7KA 5D2AA 3GBWA 4XBQA 2MNGA 1RUF2 1ZZ9A 3PVOA 4Y26A 4DEQA 1ZZ8A 3QLQA 4AFAA 4ZPIA 3VBFA 1VMFA 3PNAA 4IE5A 1TME3 2W39A 4L2NA 3ZXLA 3R05A 2FDHA 4YW1A 2LROA 1NCQA 3RYKA 3CEWA 4IEYA 4ARXA 4AEMA 4Q0QA 2G4IA 1O59A 5FK7A 2FZ2A 1IG0A 3R4UA 4KGQA 5F2SA 2GSYA 1QJU3 2Z5WA 2XJTA 4XMIA 1QQP1 4E4ZA 3IT8A 4LA2A 2RS32 2AEZA 3NNJA 5FZBA 2JG9B 3GZAA 1RUH1 3BU0A 5C70A 5G05L 4Y1UA 3WQ0A 4AR2A 4W50A 4BQ5A 2HYKA 1W2TA 2CDPA 2DVAA 1VRH3 4CPBA 1LHWA 4XF4A 4HKOA 2VCBA 2XWBB 2ZGPA 5FZLA 5KHGA 1EP0A 1HRV1 1V00A 3A4UA 3LD8A 1WD4A 2HWB2 4LLOA 4QM9A 4XUQA 1CAXA 2GC0A 1HN0A 1ONAA 4L11A 1GOGA 1Z0HA 1U5YA 4UFMA 2GH8A 3LA2A 4WM7A 4Y1XA 5I0RA 3O12A 1B35A 1GP5A 2WQ8A 4QPIA 1PO23 4YRDA 1W6PA 3ZVXA 5JXIA 5KXBA 3SISA 1AXKA 5L7OA 2JDYA 3U75A 1LODA 3J9SA 3GCWA 5FY0A 5FO7B 3WP3A 5ANNA 4AGGA 2BOIA 3OBTA 4UYBA 2PTMA 3JBG3 4YW3A 4HPKA 2GC2A 1ZRFA 1K45A 1SBDA 2P4EA 2XQXA 1C3HA 1FPN3 3AX4A 4RHV3 1ZBE3 1RUI1 1PGL2 4XOGA 1CAUA 5FXZA 1JYTA 3M3EA 3LE0A 1G9FA 4L8QA 2P2KA 2A6YA 5GZEA 4YW5A 5BY5A 2X8KA 1ZBA1 1N1TA 3UT0A 4G4FA 2TUNA 2WT0A 4NIAA 2J42A 2RJ2A 5T54A 3PMSA 3VD3A 3WQBA 4HSLA 5KR7A 2WKKA 4QX3A 4RR3A 1ULGA 2CU5A 1GU3A 2BJSA 3MLKA 4YVWB 1PGW2 4K6BA 4LO5B 1VBC2 4BXFA 4CU9A 4EE2A 3KT1A 4R9AA 1O3RA 5A3WA 3AFGA 2W9XA 1NE4A 2VULA 4M3CB 5L36A 3O1VA 1X8EA 1WZXA 2Y6JA 4GWIA 4Y5Z0 1JZ6A 2DU1A 3RWKX 4HANA 4AVBA 3AKPA 3QACA 4FFIA 1TMF1 1LOFA 2JD4A 2XB6C 2VQTA 2ZGNA 2QQPA 5BUVA 1UL9A 2E51A 3FJSA 4BQ4A 4XDQA 5DZGA 2QQIA 4Q4Y3 5FP7A 4OVEA 3Q8EA 5C8CB 3N35A 5BNQA 3KCYA 4QX7A 4AOCA 1JYVA 3H8OA 3AP7A 1N1YA 2R071 3NJYA 5H9PA 1BMV1 5LCWL 2FDKA 3OEBA 3RWNA 3LDRA 1G9BA 3RDIA 4KWKA 4D7SA 1G6NA 3PU3A 5I0SA 3WDYA 5FKCA 2ZX4A 4NHYA 3WDXA 4F8AA 1SQ4A 3BTZA 1OSGA 2V72A 3POWA 4B3NA 3V0AA 5FZOB 2HWE2 3B3QE 4ZHNA 3JU9A 5KHJA 5A7SA 4FPJA 5J3UA 1RUC3 3SH5A 3WX5A 4QXCA 5EP9A 2XQRA 5E89A 2EAKA 4GMP3 5KXDA 3O1PA 4NO4A 1PIV3 5GALA 3BPSA 4XHBA 3K46A 3W58A 1V6IA 2DUQA 1UZYA 4WVVA 1FNZA 5LY2A 2HBUA 1UMHA 4RFRB 3HN3A 3VKFC 1NXD1 5F37A 1GOFA 2VMGA 4MSVA 3H7JA 2GN7A 3R4DB 4PHZA 2DCKA 5F5CA 5F2WA 5CZKA 4Q1PA 4JVAA 1DP0A 4RFT0 1TME1 3AVRA 3HAGA 3BGAA 2BNNA 4MV2A 4AWDA 5FZ8A 4YZ1A 2MPFA 4IGOA 3P3PA 5DUWA 1RUF3 2JG9A 2WN2A 3VZLA 2A5ZA 3IDEA 1K3IA 1QJU1 3LEKA 2A6XA 4A41A 1W9FA 2G9GA 4M00A 4OUEA 4BISA 3VZKA 3VHNA 3GM8A 2ZHMA 3N9NA 3ZFEB 2XPJA 4AW7A 3WNMA 5FWEA 4FOYA 2Y60A 1VRH1 2C4XA 2PAEA 3GDBA 2RS33 4XC9A 1GANA 2ORXA 2W1WA 3WQ7A 2VY0A 5IVCA 5F3CA 1UY1A 3M4FA 3AZVA 4DRVA 5LZ6A 4GJYA 5SV5A 2IUWA 4CEYB 2BWCA 3NVCA 4IEOA 4NPRA 3POEA 4Z1VA 4QHBA 3UJOA 1MEC3 2O0OA 5LA0A 4AI8A 1PO21 1KJLA 3V64A 2GMMA 2HWB3 1O7FA 3UYJA 3WNLA 3Q8BA 1NCQC 1DBNA 3NO8A 2BQPA 2DURA 3VZMA 5A3TA 3W5NA 4YG6A 3ZDVA 3KSCA 4PI2A 2B4KA 2VBDA 3JBG1 3PTRB 1R1A3 4N9HA 4GD4A 1FPN1 3UKTA 1W3VA 4HXCA 4RHV1 1ZBE1 1RUD2 1NLQA 2WNVC 3BKZA 1CVNA 4QXHA 4YVWA 1W90A 4PCRA 4KI5M 3WNXA 3C7HA 1SLLA 4ZS2A 3FWEA 5FP9A 5DG1A 2PMWB 3RGBA 1DGWX 2KM2A 4M3CA 5CU1A 1O4TA 3OUJA 3DV8A 1JHJA 1UQXA 1JYCA 2NN8A 4KGGA 2OW4A 3OYWB 4NOTA 3VDDB 4B4QA 1C1LA 1O3TA 4IGPA 5DDJ2 5EWSA 3RJ2X 1OH3A 4NN0A 3U07A 5HV4A 3O7OA 2P3YA 2DVDA 3AP6A 3O0XA 3WR0A 5C8CA 4PQQA 4JKKA 4BQXA 4D3WA 1YC61 1T2XA 1BKZA 5F39A 4CUAA 1XSRA 4O7XA 4JHTA 1D2QA 5E8AA 3WW1A 3N4MA 3W9AA 4Q4Y1 1RUE2 4BHPA 1IGOA 3E5QA 4YNIA 5HPOA 3VD7A 2BVVA 3ACGA 4JAAA 4F83A 2CL2A 1UMZA 5FZOA 2YGLA 4JKMA 3THTA 4LXLA 1EPWA 2BZDA 1JYNA 1YJKA 5C71A 1AX0A 1HXS2 4YLZA 2G9FA 4JRLA 4LITA 1OFNA 2VQAA 2EIEA 2XJQA 3PHMA 5ABJC 5BNOC 3ZXGA 4JHZA 4BIOA 2E7QA 1CAVA 5HCFA 5E6HA 5C7GA 1AF9A 3CZUA 2R7EB 1AR62 1RUC1 3MLJA 1UOBA 3HOBA 2OT7A 3FMGA 2VE1A 5KHHA 2ID4A 3ZKUA 4GMP1 2WJSA 2HWE3 4AF9A 4LK7A 2BDRA 2PHUA 1PIV1 3DYPA 4SBVA 3TNPB 4XCAA 1VIWB 1W6NB 1CWPA 2AYHA 1Q8PA 2Q30A 1WMEA 3RG0A 1A8MA 2VMHA 1BLZA 3K3NA 4RL7A 2VNGA 2ZGRA 1GFF2 1PGSA 1AX2A 4Z2AA 4OZXA 1GKBA 2XBO2 4J1WA 1YIFA 1O6UA 2ZAHA 5FZHA 1Q8OA 2WZ8A 1UYXA 2QQKA 2BWAA 3H8RA 5FYZA 2GZWA 3DEMA 2OQ6A 3DKWA 3N7JA 1RJ8A 4N43C 4O9GA 4C1WA 1REDA 1SFYA 1A6CA 4FFGA 2Z69A 5F3GA 3ZYGA 4CP9B 1RUF1 5TSWA 2A1XA 1J84A 4AFMA 2WT2A 2ZGLA 3WDTA 2OUHA 1GICA 4GZ9A 4FTBA 3KT7A 3RZZA 1AJKA 3TRSB 3ZFEA 3ALQA 4BYYA 5K8SA 1N47A 3H8XA 5JUVA 3IB3A 1P8JA 2R32A 4MUVA 1PX3A 4D6RA 4ATEA 1GMMA 1C5HA 5D8AC 2F6BA 1QJY2 1HQLA 2C24A 4JDOA 4QHOA 2E31A 1S4CA 4CTEA 4DO0A 1E5SA 2WWUA 4XF3A 2YGMA 3OBZA 4CEYA 2D3SA 4AQSA 2RS31 4L9BA 5FMDA 5LBEA 2RDSA 2VD7A 4DMIA 1QKQA 5CIRA 3WVJA 5B4XA 4IQPA 2OZJA 4LPLA 1H4GA 1ULOA 1DQ1A 2QQLA 1BVP1 3AYAA 4MHUA 4OHVA 4EROA 5FR3A 1J59A 4WVMB 4G9SB 2GC1A 4UW5A 5IAXA 4AAPA 1MEC1 2A71A 1ZRCA 3TAYA 4CCJA 4ZY9A 1W8WA 1JUIA 4P08A 1D7PM 2VVEA 2D6PA 1F35A 1W9SA 1RIRA 2HWB1 2X53S 4KH9A 3KV6A 4UAPA 4CZSA 3ACLA 3PLQA 4I0WB 3TN93 3H3LA 5FAXA 1Y9MA 5ANQA 1CZVA 4XIOA 4XJ8A 1GBGA 2J1EA 4AQ6A 1R1A1 1GQHA 3LFIA 3MFCA 3OF1A 4BA6A 1HV0A 2HWD2 1BK1A 3MGUA 4AVCA 4AYUA 2QDRA 2W5FA 3PDQA 3Q8FA 3OYWA 3VDDA 3NKTA 1Q8VA 1O3QA 4IXLA 4CCOA 1V6MA 3JZVA 1RUD3 1PGL1 4EZ4A 1JZ2A 1FOD2 1ZRRA 4A45A 2BBAA 2JKXA 5FCCA 4AAXA 1UZZA 2ZGQA 5JOZA 1NA1B 4ZXKA 2VW2A 4G3YC 3T3YA 2ZX2A 1YI7A 1XRUA 3A23A 1JZ8A 3I3DA 3OG2A 4YM1A 4CDQB 1V9U2 2UWBA 5F5AA 2XXZA 1FT9A 3UGGA 1UO9A 1VJ2A 2HWC2 2Q8DA 2NM1A 1H1IA 2C26A 5DDJ3 3FBYA 5HCHA 5FLJA 5I8SA 1W2AX 1ENQA 5A6XA 1SFNA 2QVSB 1HV1A 3VBSB 4QU1A 4FTSA 5T5PA 4K1ZA 1I5PA 4A7YA 4XABA 3AJZA 3J26N 3H8UA 2P3IA 5CNAA 3MUY1 2DYCA 4D6SA 4Q26A 4RN5A 1QQP2 3WD5A 2A3WA 1NY71 4A7ZA 4GH4B 3GZEA 3PMEA 4HETA 1HXS3 2J1SA 1G9DA 5GLWA 3EBRA 2WO2A 4OYUA 4UW3A 5LBCA 5EYYA 3S5QA 2VCAA 4K8FA 4D0QA 1YJLA 4MHRA 1XB9A 1LEDA 4YG0A 2HWE1 2VZVA 5FZFA 4HVQA 2VMCA 2RS12 1RITA 4EN6B 1AR63 2CHHA 3M7AA 2WIIB 2AREA 2K9ZA 2WNUB 1RC6A 3W21A 4ISRA 3VDBA 1NG0A 1W6QB 4GWNA 4IESA 4CPBD 3P6BA 5IVVA 5HXMA 4S2HA 5I8TA 2DCYA 3I2IA 4CP9A 1ASJ2 2YDEA 3AZXA 2JD9A 1AYM2 1Z7S2 2TBVA 3H0OA 1SPPB 4W6YA 2YC2A 1MVEA 2Y8KA 5A7WB 4FPHA 4LBOA 1NKGA 2AENA 1X36A 2JXAA 1N1VA 3NAPB 2PLV2 4P00B 5EPAA 1RUG1 1X7NA 3ZFGC 5G04L 3RZMA 4QQ2A 1XNBA 4OHXA 3V65A 2F4PA 4HG6B 1IG3A 4R9BA 1OKQA 4XFHA 4A44A 3IAPA 3E6CC 4S2GA 1S2BA 2DBIA 2W46A 3L2YA 4YW6A 4K8RB 4MH0E 4CVUA 2YBPA 3ZMNA 5A1LA 3K48A 1HB2A 1CIWA 4WVMA 4OI2A 2ZGTA 1WBLA 1NX9A 5IUQA 1E57A 5CFCC 4JGYB 4XF0A 4QKBA 1S0JA 2W3JA 3ACFA 3HMYA 3UETA 3A21A 3WP5A 4CU7A 3LEIA 3W20A 2UY9A 4FPCA 1EV12 5JZGC 4Y5SA 1UZVA 2DCZA 2X09A 4XACA 2ZMLA 1DYPA 3AXEA 2ZACA 4AG4A 2PYTA 2B42B 4KBZA 1U12A 4NPMA 4JKLA 1L3JA 2VW0A 1R64A 4XTMA 5DZFA 1W3XA 3K4AA 1UIJA 1UPSA 1QH6A 4MLOA 3TN91 4BK4A 1BMV2 2R072 2GP5A 4GXLA 2W52A 3J7MA 1OLQA 3TYJA 4B7EA 4URAA 1V6JA 2OXBA 3IN9A 4HKWA 2VOKA 4QDRA 4LBKA 4IE4A 4YSFA 1GP6A 3K2OA 4QGNA 2XH6A 3EXUA 3FHIB 1NA1A 4KNCA 1GWKA 1Q8QA 2CTVA 4FXGB 1X33A 4OFGA 4AQTA 5HCAA 2BNOA 1GZWB 2QE3A 4LULA 5CFDC 4KWLA 2HWD3 4MVTA 1RUD1 1ULPA 2JICA 1XU2A 4XW3A 4Q4X3 1W8UA 4GB32 3E5UA 3RVHA 1KQRA 2Q1MA 4IV3B 2IXIA 2Q8OA 1ST8A 3B94A 3KCCA 1OPMA 5LBFA 4WV8A 3KV9A 1AR82 4DNYA 1UY2A 4XBNA 5A3PA 2YG0A 4XAAA 3JB4C 1IQDC 3KF3A 4E4DX 3HN1A 2I74A 2FBEA 4QHZA 5DDJ1 1GNZA 4TN7A 2ZKNA 1TNRA 2FHRA 2VZ3A 4M4RA 2I2SA 3M70A 2HWC3 2ZXQA 4BIFA 1XSQA 3FFZA 3TBDA 3W59A 2CGNA 5A33B 4GULA 5FPVA 1JOJA 4KG0A 4XDPA 3M3CA 4GH4A 3MBWA 5FZKA 1PK6B 4BJ0A 3GGLA 2FDFA 3VDDC 1QJU2 4D8MA 5GLVA 2WA3A 1BJQA 1VE0A 5FYBA 3WCSA 3ZXDA 2WYSA 3I3EA 2Z4FA 3GJBA 1V6KA 2XONA 3TEWA 4CRQA 1WMXA 1HXS1 3H3ZA 2W68A 2L9LA 1EPZA 4Q0VA 1W6QA 4CA9A 2H0VA 5KC5A 2GN3A 1HIXA 4CEWB 3VZJA 1DLLA 4UFJA 4FSJA 1AR61 1ENXA 4GAZA 5FY1A 4DRRA 3PTYA 3QOPA 1SPPA 1QHDA 2LW8A 2YPJA 4N90A 5A7WA 1HB4A 1AZDA 2RS13 2R062 1ULCA 3NAPA 1L7LA 1YQCA 2IXLA 5FTTC 1QJZA 2WYFA 5C9AA 4UBHA 3D3AA 3OBRA 5DAWA 1UZ0A 5A1FA 2QKDA 4XQ4A 3SCGA 1DGLA 3ZXJA 1ENSA 1IS3A 1ASJ3 4WZCA 4CXYA 3ZOIA 1W8OA 2ZTNA 3IKWA 1AYM3 1Z7S3 2PN5A 1CN1A 2HEYF 1WLWA 1TE1B 2RHPA 1WA4A 2C1FA 5FFOC 3I3BA 2VUAA 5LB6A 2VM9A 1AJOA 4ZU5A 1LEMA 3J7LA 4C8DA 5J7MA 2PLV3 3VZOA 2BPA2 1NAEA 4NMIA 3R6SA 2OUJA 3S6PA 1QU0A 5C4WB 1LB2A 1UY4A 2RV9A 4JX0A 2WZPP 4MXVA 4ZZ5A 2VH9A 3VBRB 1FNYA 3MIHA 3DF0A 2VO5A 1H1AA 1CJPA 1MQTB 5FY5A 2SBAA 2D6KA 4CCEA 4A2UA 1Q5OA 5FY8A 1SCRA 2IWGB 3DGTA 5J1XA 1CAUB 3KWVA 1CGPA 4AI3A 4GALA 3ZYFA 5GZCA 2BFUL 4FP2A 1IZ3A 4N9IA 1COV3 1AYN3 4EQVA 4HZFA 5A6ZA 4RGGA 4NWWA 1EV13 2EXHA 2Q5TA 2VUCA 2W47A 2ZBJA 1YXWA 1PVXA 2VCMA 1H6YA 1GZWA 3RMXA 2PHLA 1BVVA 1HQNA 2O8OA 5IVBA 3B02A 3KZ4C 3H1YA 4JRAA 3KMHA 4Y22B 5LRSA 4NAMA 2C5DA 1MPXA 4LUKA 4YFWA 4IV3A 1SBFA 3SXWA 4TLFA 4Q2FA 5FMBA 1LHNA 5J09A 3ST7A 4J1XA 2HWD1 3K75B 5IK7A 4UWDA 4IV1B 4WM8B 4X8PA 4Q4X1 5C8WA 4Q4V3 3VKLA 2J1RA 4CUCA 3RYPA 2WLQA 4IUGA 1PIV2 2CY6A 5D21A 5C3OA 5FBJA 4BQWA 4Z2WA 4FI9A 1AXZA 3DXTA 4FPYA 4GB33 4LMFA 4YVSA 2CYFA 3ZMOA 1JW6A 5KHIA 1OURA 5IK4A 4IW3A 3N36A 1SLTA 5A33A 1VB2A 1Y3TA 2VCCA 3NNLA 3C3VA 4CDWB 1BZWA 4BQ3A 3BUCA 1LU2A 1MS4A 2XDVA 1AR83 4YM2A 1H8VA 1PK6A 2QQNA 2HWC1 3KV4A 3FUQA 4K7JA 1LHVA 1UYZA 2TNFA 3M3IA 1RB8G 1I3HA 4P02B 2A6WA 1W04A 3IAQA 3S5AA 2V5YA 3N9PA 4IETA 4DEVA 1POV0 3WW2A 2ERFA 2WO7A 2JIJA 2A70A 3ROUA 2O14A 2P1BA 5FDBA 2VBPA 1WBFA 5DXDA 4DUWA 3B01A 5IK8A 3LA7A 4CDQC 4DXSA 3AMHA 3ATGA 3U11A 3B00A 3HQXA 4HSJA 4FCAA 4TTGA 1F15A 5T55A 1UX7A 1UYPA 1K5MC 1IS6A 2JDMA 5F8PA 4TXWA 2QQJA 1A78A 3E97A 4NROA 4DY5A 2WL1A 4D94A 2XGXA 2G19A 1A34A 4QAWA 4N53B 4XZPA 4DUVA 2IFRA 4M4PA 4XTPA 1XJAA 3RZJA 5KC6A 1BXHA 2Z2SB 3ITQA 3I54A 1H2KA 2RS11 1MEC2 3OGSA 2P6HA 4Y4RA 3MO4A 5F1RA 4JGZB 4AVVA 5CYYA 2YBKA 2RJKA 2IXKA 2ZGUA 3NV3A 2AEYA 3DN7A 4GH4C 4XMAA 2R063 2WZR2 3USUB 3WV6A 3MUZ1 1HX6A 2ZEWA 1ASJ1 3J7HA 2H6BA 3FC0A 1ULEA 1AYM1 1Z7S1 1H1MA 1R1A2 1RUJ2 2JECA 5K4LA 5C4WA 2K46A 3UKVA 3I2FA 3QD6A 3WDVA 3VBRA 3KCXA 4YM3A 2E7AA 4MGYE 2W1UA 1MQTA 3LPGA 2PLV1 2WNUC 3ZIXA 2R1DA 1Y9QA 4M3CF 1AXYA 1JBCA 3FHQA 2ZX3A 2D40A 4I0BA 4CCCA 1HJFA 1NCRB 3JB8A 1DGWA 1JMUB 1VBA3 2Q8EA 5A3NA 2W94A 1W0OA 2WFF3 4Q8KA 4LBJA 1W9YA 2ARXA 4FAGA 1W39A 3NAPC 5IFTA 5FZ4A 4MGQA 2JDPA 1OF4A 3RQ0A 3GNEA 1COV1 4NHXA 2R0FA 1AYN1 1JOPA 2HEWF 1OQEA 3POIA 3ABZA 5FMCA 5A7QA 3VLBB 1BBT3 2FMYA 3HNYM 4ARYA 1LNSA 1EV11 3I2DA 5AFEA 4Y22A 1Q56A 3ILFA 3O0WA 1VAVA 1US2A 1WCDJ 2WDBA 1W99A 2WAOA 2WZEA 2LM3A 5FYYA 4LO6B 3B5LB 4IV1A 4WM8A 4NRPA 1YQ5A 2KA3A 4J25A 4JGYC 3LPFA 1W8HA 2W1SA 1NY72 3NNMA 4HK8A 1VMHA 2WT1A 2QQWA 4UW4A 2KD7A 3THDA 4AI9A 3O1UA 4NIHA 2CAUA 4RQPC 4CCKA 2CGPA 1IKPA 1LESA 4Q4V1 3MW2A 2B45X 5FYVA 5C33A 3ES4A 4CDWA 3CO2A 1TEIA 3MPBA 1UY3A 1S0IA 3CZJA 5KWRA 3WXPA 2RMU2 4GB31 3LEGA 2Q0AA 2YC4A 3P3NA 3GHMA 3VN4A 4COWA 3LEMA 5A70A 2XUEA 3WF2A 1CAVB 4LBMA 3KD4A 1AR81 3KVAA 3WP6A 2EIGA 3V56A 4PLMA 3K51A 5FOJB 3NQHA 1DCSA 2A3YA 4E8DA 2XOMA 2GNMA 4YZ2A 1YUDA 5FMOS 1CQ9A 1YYNA 1RL3A 5BNPB 3ZPOA 1OLME 4LO8A 1IHMA 2E9QA 3S7IA 2QQUA 4BQ2A 1OHFA 5IHRA 3NL1A 1WW7A 1H2MA 1NLRA 1RUG2 1YQ6A 2DCJA 4IV3C 3AB0A 2TEPA 2J7MA 3I2KA 4P9GA 4XPVA 5I91A 4QDQA 4K1YA 4XF1A 2YXSA 2LRPA 3T0DA 3ZIWA 1J3QA 3KQRA 3MDPA 1K42A 3OTFA 1DYOA 4N53A 3QCWA 1OFSA 1QXRA 4ZU7A 1J58A 4Y20B 3WF3A 4IEQA 4Y1VA 2X5IC 1U5ZA 1W9TA 1OMIA 4JGZA 5LBBA 4CXWA 4BE3A 4DXRA 1JYXA 3FE5A 2VL4A 2VOTA 3H3UA 3JUUA 2PHFA 3USUA 3RRDA 4LBQB 1PK6C 2BYVE 4NPLA 1F5FA 5FZ7A 1W8NA 4IE6A 3NJXA 3PL0A 3AL5A 4I09A 3I7DA 3J8F3 2XMLA 3HT2A 2R061 3SMHA 1XE0A 1UY0A 2R16A 4Y3OA 3RSJA 3TN92 1EYBA 4C91A 3VBFC 2AUYA 1LJ7A 4FT8A 2W2IA 5CAZA 4QQLA 4RA0A 4XUOA 4BH9A 2JENA 1E5IA 5KXEA 2WZR3 3ZYBA 1GQPA 3ACHA 4EN8B 1NCRA 4ONUA 2VZRA 2VMEA 1RUJ3 1H6XA 1W9WA 1I5ZA 1JU4A 2D6MA 3VBUB 4R4XA 3KVBA 4UI9L 1JXNA 4H3WA 2D3PA 1QDOA 1VBA1 4FP3A 5JOWA 3N3HA 2WFF1 4AHZA 1DHKB 3LKJA 1PZ9A 2D97A 2ILMA 1ND2B 1YRZA 2J1VA 2HWF2 3PJQA 4JDNA 5BNNB 1GWLA 1LGCA 2Y0IA 4AI1A 1RUOA 1IQAA 2XLFA 3POGA 5J96B 5FO8B 2ZGOA 4XXAA 4BZ4A 1B09A 2WAAA 1CR7A 3AC0A 4WM7C 1BBT1 3KHCA 2UURA 1B35C 2BU9A 4QPIC 1H8TB 4U2AA 5FPAA 5FZEA 2VZUA 1LU1A 5L7OC 1QWRA 4F7ZA 2PQSA 2XLAA 4D7YA 5KBFA 1I1EA 1H9PA 3ETPA 4JTOA 1EAH2 4LO4B 2BP6A 4RS5B 5C6CA 5FPXA 1PM7A 4PT6A 1US3A 3T2OA 1LOBA 4A3ZA 3NNFA 4XJAA 3ZPYA 4RSUA 3D5OA 1HQWA 4CP1A 2EXIA 1K12A 3HNMA 3B69A 4PF1A 5JSPA 2O8QA 2ZZQA 3FZ3A 2PFWA 4B1MA 1ZNPA 3DKQA 4K40A 2UYBA 3GYDA 3OSDA 3ZFFA 1RVF3 4H2AA 2MEV2 3IIAA 4QT6A 4RR3C 4FAHA 5FY4A 2HKXA 4ES8A 3AYCA 1SG3A 4QXBA 4XF9A 3VL8A 2ET1A 4KG8A 2UWAA 4Z07A 2UWCA 3T30A 4AVSA 4AEDB 4YPJA 4BB3A 1PZ8A 4LKFA 2R0HA 3VBHB 1NQJA 4HLTA 4QPGA 4BDVB 5BNPA 2RMU3 2GMEA 2R49A 2GH2A 5F32A 1LOFC 4LORA 4QM8A 2BUKA 3F2ZA 4OULA 3MIEA 4PI0A 4OHZA 3VKOA 2EVXA 4BMBA 1QNYA 3KV5A 4DIQA 5JI9A 3UV9A 3RI8A 5FYTA 4IV1C 4WM8C 5H9RA 1MS0A 2HLEA 4XFFA 5A7PA 4PBPA 2EICA 4I3GA 2A6VA 4Y20A 1BCXA 5LA9A 1FV2A 4MOAA 1YFXA 4I01A 4PJYA 5ERLA 4LOTA 1RUG3 5EHDA 3SKJE 2D44A 3E5XA 4NAOA 2YU1A 5DAQA 4AL9A 2JWPA 5LY1A 2BBVA 4CDWC 1ZRIA 4EWEA 3PVBB 3NSTA 4R52A 3S30A 3WDWA 1AL22 3OPWA 2RJLA 4LBQA 1IPJA 2YMZA 3QH6A 1UU5A 1TNFA 2VMIA 5CKQA 5FJKA 1YEWA 3LCPA 1W03A 1QDCA 5EJ1B 5LATA 2K2SA 2VECA 3BIWE 3KT4A 5T52A 5FLIA 4I02A 2VTXJ 4Q27A 1V0AA 1W6OB 2RR12 4ZZ8A 1QMJA 2FCVA 1YWKA 5HCBA 2QDNA 4Q29A 2DUOA 2Z79A 5IWFA 3H1MA 1UXXX 1SACA 2LUWA 1Z78A 5JDBA 3OOXA 3H9AA 3J8F1 4R4ZA 2ORZA 5FZDA 1UN1A 2DBNA 2W08A 4CU6A 4GWJA 4NJ4A 2XJRA 1YQ2A 4CCMA 1CD3G 2ADEA 3CJXA 4JQTA 2JX9A 1Y4WA 2XR4A 3VBUA 2GC3A 2JG9C 2WZR1 2ZZJA 3EHKA 2CWMA 3E1F1 1QH7A 4FPEA 4P9JA 3PUHA 5KHKA 2ATFA 2XL9A 3D4KA 3GCXA 1O8SA 1OUSA 1EY2A 1RUJ1 2QQOA 4QPWA 1CZSA 4NIGA 5ACA2 2HYXA 3DUIA 3TB0A 4Q4X2 1ND2A 1IPKA 4M0NA 2QCSB 4JGZC 5A3MA 3ILNA 3LGRA 3PUQA 1U0AA 1LHUA 1H2NA 3ZN6B 1H0BA 1XYOA 4YWAA 1C4RA 1F5JA 4M0HA 5FZ3A 3RJRA 2VUDA 4GIQA 1POV3 1UKRA 3UKNA 1H8TA 1SZBA 5JMOA 4OMCA 1XE7A 3Q8AA 1F9KA 4OCTA 1X9TA 1JN2P 2WWSA 4FXKB 2JE8A 4META 3ZSKA 4UW6A 1GLHA 4RS5A 3VHOA 5FPUA 1F4AA 4AFCA 4EN0A 3HWJA 2HWF3 1TZOA 3SLIA 3WF4A 5AC93 2OPKA 1FI2A 3A0NA 1UXZA 4MGTA 2VQUA 4I0AA 3RZKA 5HV0A 1SDDB 4Y5TA 3FL7A 2JDUA 1OXCA 2D6NA 5FPLA 3AMMA 3MF9A 1VBB3 3SQOA 1GYKA 4WVWA 5BYNA 1MZ5A 2LTNA 4XAEA 3QH7A 1C28A 1EAH3 2VW1A 2VZSA 1ND3B 4YVWC 3AP5A 2J22A 1DF0A 2JDNA 2B9VA 1KXGA 1PX4A 4JTNA 1DZTA 1RVF1 2UYAA 1ULFA 5DG2A 4CUBA 4M01A 3TWIA 4AEDA 4LHKA 5APAA 3VBHA 3U14A 2QBXA 4LBLA 4ES9A 2ZEYA 1AHSA 2MEV3 1W2UA 5FZ9A 2D5FA 4UXAA 4QPYA 3AMNA 1DIWA 4W4ZA 2CDOA 2FMDA 4NRQA 5C8CC 3WG2A 2RMU1 1GUIA 4LEJA 2DDUA 2QNKA 3ZXKA 3AFKA 1DGRN 1WKYA 3NV1A 2GAUA 4MYEA 1GZ9A 1FMD2 4Q8LA 2NZ9A 3VKMA 4ORFA 4Q0PA 3NW4A 2GMPA 2WSUA 4O9EA 4AFBA 2VQ0A 4N8MA 4LT5A 3WZ1A 3GBFA 1QNWA 3HBZA 3ECQA 1JYIA 5L9VA 2IVIB 4KWUA 1LOEA 2DVFA 3M3OA 4LE4A 5GLZA 3UK9A 5C9AB 3ASIA 3WW4A 4BCUA 4FPGA 1V70A 2E53A 2DTYA 2ETEA 4K9SA 4XUTA 2VXRA 1W6OA 2C9KA 5BV6A 3T2TA 1LOCA 4K21A 2Y6FA 3NV2A 5F5IA 4GWMA 4ISQA 1AX1A 3J7NA 1OQ1A 1VAKA 3JQWA 1AL23 3T09A 1LCLA 1YLLA 4INDA 4S2DA 4P9WA 1HKDA 3U0ZA 2FDGA 1COV2 1AYN2 3ILRA 1NUKA 3O1OA 3POSA 2R041 5GM0A 5LEKA 3CMGA 3CHXA 2RR13 4QGMA 3SCHA 2CWSA 3LIGA 1ACCA 3M2MA 1UOFA 2ZOEB 2YBSA 4IL7A 4LR4A 3T08A 3MI8A 1WLDA 2QJVA 1G86A 3NRUA 3VDCA 4LTAA 4XQDA 4AHWA 4DXZA 4I2OA 5A3UA 3V0BB 3U1XA 3O1TA 5FXXA 1C1FA 3M1HA 2P17A 1KITA 3LA3A 3D6EA 4X6QB 1J83A 3ZFEC 3ZXAC 1HN1A 4BLJA 2EA7A 4EJRA 2DF7A 4MGSA 3ZN6A 4Y1YA 3NNGA 2NPIA 3EYPA 4Q4V2 3IBMA 1O4YA 3I2JA 4YZ5A 5FZGA 2BERA 4QDSA 4CEYC 1KJRA 3CQOA 1M4WA 2H0BA 1GWMA 5ACA3 5GZDA 4NRMA 4OI0A 5FYSA 1DZRA 1POV1 3FN9A 3WUDA 2RS51 4MX3A 5J48A 1YO8A 4LOSA 3ES1A 2JDHA 4LE3A 2D3RA 5GLUA 5A80A 2WSVA 3ZSEA 1OD5A 5A6YA 2WQ4A 1L7QA 3LSEA 3WSOA 3JQXA 4E2QA 4QB6A 1MVQA 5DUVA 4YW2A 2HWF1 4L99A 2VMFA 1CZTA 4PF5A 4Q4W3 5AC91 5IT6A 4XUPA 5FKBA 3KGZA 4PDWB 3AL6A 1G8WA 5FXVA 3UL2A 3IMMA 1ND3A 4YVSB 3QBQA 4W65A 4KBBA 2PHRA 4AFDA 1VBB1 5FLHA 1JZ3A 1DQ5A 2WFPA 1EAH1 1I9RA 4EN7B 5A32B 2OX0A 2B8MA 5EZWA 1ND2C 2GNBA 4OI4A 3OUIA 2J1UA 4Y33A 2W87A 3WW3A 2XJSA 3CLPA 2JDKA 2D98A 2ZPXA 1UMIA 4BPZA 5B4NA 3PUIA 1V6LA 2JKBA 3ENRA 1H8TC 4I3PA 1DDLA 3DL3A 1UOJA 3OEAA 4YYOA 2ZGSA 3VB9A 4HL0A 4AGVA 4IGQA 2MEV1 5IVEA 3AP9A 3SEPA 1Q8SA 5EJZB 5A3OA 1S2EA 4DOUA 2VJXA 5T5LA 3FLRA 3ZKYA 4P9XA 4FQ4A 4DY3A 1R092 4UFLA 5AVPA 2VNVA 3ME2A 2GNDA 4C0HA 1NXMA 3ZYHA 4U36A 3POJA 2P3KA 3ZR6A 3AMQA 3NJVA 5FP4A 1FMD3 2F17A 3I2OA 2IXJA 3APBA 1KD7A 4AVTA 2VPVA 2W95A 3O1SA 3JCIA 4ZU4A 3AZYA 2ZABA 2JEMA 4K20A 3B9IA 3MIBA 4BMEA 3ON7A 3POFA 4E2GA 1ODMA 1KEXA 1AR92 5A1AA 3VD5A 2KR2A 5GZFA 3I3MA 1V6OA 1VBA2 2A73B 2WFF2 2V5DA 2RM22 3C7EA 2CV6A 4UFKA 1U5XA 1TVGA 4ATFA 1QJFA 3ZM8A 1AL21 1I6XA 2YFZA 3UESA 1O5UA 2FDIA 3AKSA 4PIXA 5FZAA 3ZYJB 5BNNA 4C1XA 3VV1A 4QB1A 2Y0OA 3RFRA 3V0BA 2VR4A 3ZSMA 1J3RA 1VBE2 1BBT2 1XNKA 1XC6A 2QZ2A 2WR9A 3MFAA 4NE9A 2RR11 4Q0UA 4HT1T 5EXOA 5F3EA 5K0UB 3X29B 5JPMB 1KS4A 2V09A 1ZVFA 3KS7A 1F8VA 5FV3A 2J1TA 1X8MA 2Y26A 2YZ4A 1VLNA 2ZHKA 4IDZA 4W6XA 1W05A 2UU8A 2JG8B 5LASA 5LW9A 1OC1A 1H9WA 1VALA 3FHAA 3THCA 3WDUA 2WUHA 2I45A 1SHWB 2FCUA 2YYOA 3OCPA 1KFUL 4NIIA 2PXJA 2I07B 1FYUA 5IVYA 3FLTA 3RPQA 2BGOA 4P9YA 2VVDA 5JMCA 2QQVA 2XUMA 4YW7A 2VNOA 1Y7BA 2EAAA 1JH5A 3AKQA 2E32A 3MW4A 1QIQA 2AR6A 3HD8B 2BVBA 5SV8A 2E7TA 3O0VA 4B29A 3O1RA 5ACA1 4LNVA 5ABJB 1XU1A 5BNOB 1LGNA 3ORJA 1SFPA 3O5SA 2ZS6B 3TEYA 4TYSA 1KGYA 4Z92B 4XFBA 4PDWA 3T1MA 3MF6A 2DCTA 1W8ZA 4FQZA 3WG1A 1Y43B 5FXWA 4Q4W1 3S7EA 3DCQA 1QF3A 4TWTA 2JDZA 2WQZC 4COYA 2G9ZA 2IZWA 1OOPB 5A32A 1M06G 1DQ0A 3RI9A 1GOHA 3T0AA 1IOAA 2G1MA 1ZM1A 1WW4A 2XKPA 1V6NA 4X8NA 5JOYA 2ZMNA 3T2PA 5LK5A 4E4SA 4BQYA 1NA1C 1S0CA 1WWYA 4PLOA 2ZX0A 4MO3M 4YFZA 1VP6A 3CU7A 3NMBA 1R1ZA 4FFHA 4P9LA 4FFFA 3HNBM 1PVC2 4WVZA 3WT3A 3ZXEA 5D8AB 1DU3D 2QQMA 2W1QA 4HONA 5FRAA 4CYDA 1XE8A 2RDRA 3MYXA 4RD7A 1DQ2A 4BQ1A 1FXZA 4FO9A 1C8NA 4LBQD 5EFUA 1GZCA 4FOVA 5GKAC 3BOPA 3U78A 1SLCA 2DFCA 1D4M3 2VGDA 2DUPA 2QZ3A 4O65A 3PIJA 3J8F2 2OA2A 4BXSV 3JD72 2HBTA 3VL9A 1K5JA 1LAJA 1ND3C 5CA6A 5J98B 3TNQA 3ZYPA 2D6LX 2W0XA 3LOIA 3L2HA 3LFMA 2NYYA 2VZPA 4X6RB 3H7YA 1R093 2IFWA 4COVA 2C0ZA 1FMD1 1VRBA 2WNEA 5EJ3A 1LGBA 4EWAA 2WNVA 3BTAA 5LA2A 3MIFA 1JU3A 4Q0SA 2PHWA 4HN1A 5D1IA 4EYUA 4KU8A 1GP4A 2Y6LA 4D69A 4S2FA 1OKOA 3G7DA 1HRI2 3MHZA 3HPNA 1RMU2 3K3OA 5H9SA 2K0GA 1NZCA 2PHDA 5H9QA 4KU7A 5A7NA 1AR93 4LKSA 1KDKA 1LTEA 3ELNA 3B7MA 1LKNA 2JE7A 4CEWA 3GZTB 5K0UA 1PMIA 4Y4YA 4OZOA 1YFYA 1VPHA 3WP4A 4AXOA 2RM23 3BYWA 3MICA 5FUPA 1QXPA 1PZ7A 3I59B 1EUUA 5JR2A 1OD3A 2WRAA 2YHJA 1GR3A 4OMDA 2JG8A 5FY9A 5GLTA 4QGLA 2DWRA 5FPBA 5C9AC 4XCBA 3DECA 2ENRA 4UT5A 1UAIA 1PHMA 2X10A 4XUNA 1DYKA 3VBSA 2ZAAA 1T6GC 2CGOA 1GQGA 2Q1ZB 1VBE3 4WBBA 4Y24A 2JB8A 1AR73 1LHOA 2UY8A 1XYNA 5LEJA 2WS93 2VUJA 4Z8BA 3VD4A 5L9BA 3ZN5A 1WLTA 4LHNA 5CADA 2Q1FA 1OVPA 4N7UA 2Y6KA 3MW3A 2FZ1A 1AUYA 2JIGA 2VZOA 3G6JB 5JIAA 3ZYIB 4IEVA 2OQ7A 5ABJA 4IEXA 5BNOA 5FOBB 1OA2A 1CX4A 1QJEA 4BK5A 1O8PA 5FYCA 3WOGA 4B4PA 1LENA 3MLLA 1HB3A 1RVF2 4HK9A 5E88A 5DABA 3ZR5A 2ZHLA 5B2GB 3TEXA 4NIDA 2P34A 3LQCA 4CUGA 3LAGA 1AVBA 2RVAA 3POYA 5BNNC 1ENRA 1WW5A 1PMHX 4GKYA 1S55A 2WO1A 1VMJA 3THPA 4P5HA 1OOPA 2IXHA 4YGCA 4J6GA 3KM5A 5I0UA 3ZFFB 2NMNA 3ZSJA 4DINB 4CCDA 2A6ZA 4LKDA 3MZHA 3C7GA 3R4SA 4CDUB 5DUXA 4N43A 3U4SA 1IKQA 4A3XA 3T4VA 1NLSA 4JQRA 5I93A 1PO12 2LS6A 2BGCA 3RMYA 3VKNA 2HJIA 4XJWA 4XIKA 4ITCA 4QPGB 4YG3A 1YQ8A 2EIBA 5FBZA 4IE0A 4M3CE 4QB2A 3T4HB 2RDNA 4QX1A 2A3XA 4FTEA 3AVSA 3MPPG 1MS5A 2YC0A 3DYOA 4XJZA 3SKVA 4C90A 3MEPA 5D8AA 5BXXA 2CNAA 4BM8A 3GHNA 3OD0A 1O3SA 2ZCWA 5FZ0A 3LWCA 3A0KA 5ISLA 3ZFGB 2P3JA 3GJAA 5FYHA 2Y38A 1SCSA 1UKGA 2WBKA 3B93A 3OD4A 2B5HA 1D0GA 4A6OA 5C3PA 3SITA 2PHXA 4V2VA 4E8CA 5FJHA 3VHPA 3LZZA 4Q1RA 5C3QA 4LUMA 3AKTA 3CIHA 1D4VB 1S0BA 2D43A 2VBBA 3M3QA 4PDWC 3OUHA 4P5YA 4TLGA 4Y1ZA 4XBLA 1CIYA 2VTFA 1PVC3 4GKXA 1SMVA 2E63A 1JTZX 3PUAA 4YVSC 3K4ZA 3URFA 2BRTA 3ZXFA 3U10A 4LO7A 3TOJA 1G9CA 2XKOA 1WCSA 3LB9A 5CFCB 1D4M1 3HT1A 2R042 4H7LA 5IVJA 2JB4A 4QU2A 2NQYA 2FCTA 5F6KA 4HBNA 4AEJA 4A4AA 3IPVB 5JZGB 5K7PA 5JR7B 1H4HA 1OUXA 3AZWA 3HR9A 4IE7A 3SH3A 3WNNA 2Y33A 1R091 1UPIA 3JD73 2AACA 4CXXA 1LOAA 4K3UA 2QTWB 2VOWA 4RGKA 3NJZA 1G7YA 1OA4A 2IC1A 1PM4A 5T50A 2NP0A 2OS2A 1IPSA 3C7FA 1UCXA 2V4VA 4CDXB 3FFQA 4LKEA 5FZ6A 2V4AA 3M8LA 4HN0A 4YZ4A 1ZX5A 3BB6A 3EO6A 1ULDA 4AEKA 1T6BX 4QWNA 3I59A 1AR91 4ZKTB 3OB8A 1ZA7A 1RHI2 2CAVA 2WN3A 4P9IA 1VBD2 2Y64A 1HRI3 3OPZA 5CFDB 3RZGA 1RMU3 2RS52 3IMNA 1QOSA 2YY1A 3H1WA 3BODA 4WZFA 4AHXA 2RM21 1OI6A 5CEHA 2BV4A 4YW4A 1JZ7A 2HH9A 1OT5A 4MADA 1RXGA 5T5OA 3D82A 3FUOA 2X05A 2WA4A 3WF0A 1H30A 3BTYA 5AC92 1W6MB 4YARA 1XOYA 1WUVA 1WW6A 3LDBA 4ASKA 1JOBA 1DQ6A 5IW0A 1UX6A 2OVUA 5DUUA 5FPZA 1VBE1 2OZ6A 2DFBA 4PIYA 1AR71 2YPDA 1KRIA 5JCTA 2PA7A 5CVRA 3I97A 1ZZBA 4D7TA 3PVNA 1VBB2 2WS91 3ZYRA 5C4WC 4V2WA 4FPKA 2DV9A 4BWOA 1W28A 4NVPA 2VAUA 1OVSA 3VBRC 2ZHNA 2O1QA 1GNYA 2HEVF 2DTWA 3AXDA 1O4ZA 2P37A 1OLMA 3T0BA 1MQTC 1URXA 3BU7A 2Q8CA 4IEZA 3KQ4B 3VDAA 1O91A 2VC9A 5T5JA 3MV01 4AVAA 1O5LA 4XHXA 1YFWA 5FYIA 5HI0A 3C8XA 4AQ2A 4CEWC 2VXJA 5K0UC 2F4LA 1JYWA 1NZIA 4JDMA 2R6QA 1G9AA 2XLGA 1S0DA 4LIVA 2VNRA 3DPRB 1VBC3 4ET7A 1ZRDA 1VAMA 2D7FA 3SNMA 1LR5A 1R082 4CDUA 1X9PA 1AL0G 2YUEA 3N9QA 2JG8C 2J1AA 2LALA 5FIXA 1MS1A 4QX0A 1YHFA 5EYXA 3VBSC 3AZZA 5IFPA 1SLAA 3RNSA 3KGLA 2XHKA 2BOJA 4HMZA 3WQ1A 1FAYA 3O14A 2ZA9A 3E6DA 2Y6GA 5JVVA 1F2NA 1JUHA 1WCKA 1W0NA 2B9UA 1VR3A 4JCKA 3BI3A 1UWWA 4NUBA 3HBKA 4CP2A 3WINE 1MS9A 3ZFGA 4PBOA 2B46X 2PAKA 3I2HA 2XVKA 3SC7X 4LIUA 2PELA 2Q4SA 1U5IA 5JOXA 1MACA 1PO13 5IJRA 1UW8A 2FDJA 1GV9A 4GA9A 5T3NA 3AJYA 4FOQA 4FVVA 3WNOA 5F7UA 4ZONA 3WHTA 2FQPA 3IZOA 3AP4A 3P1IA 1NYWA 1QOOA 1WMFA 4NHMA 4FPLA 1UNBA 2ES3A 3K4DA 5FK8A 4AGRA 1ZREA 5CFCA 5AFBA 4EN9B 3ZX7A 2BFUS 1OOPC 2ZJCA 4HKLA 3H50A 2WNOA 3IDCB 2R1BA 3IPVA 5BPXA 1PVC1 2WC2A 5JZGA 3S57A 4QX5A 1C5IA 3AYDA 3RZHA 3U4XA 3WG3A 4HVOA 5FO9B 1MZEA 2VVFA 5FYUA 4LLFA 4ASLA 5JSOA 1LULA 5FWJA 4R9DA 5M0TA 3N9OA 3WNPA 3VBOB 1KS5A 3KB5A 5LK7B 5C3RA 3HJRA 1OQDA 2R043 2XVLA 1QGLA 3OGJA 3JD71 4XYXA 2EXKA 1C8M2 3RS6A 4CDXA 2OPWA 3BALA 3P5BA 4UFIA 1TQ5A 4A7KA 1SBEA 4LHLA 3GXUA 2YROA 3VGIA 5CBLA 1QY4A 4L97A 4OHYA 4MGZE 4QD2A 3DYMA 3LOBA 1W8TA 2NMOA 4AE2A 4BU2A 2ET7A 5CFDA 1SLBA 3UGHA 5LA1A 2CSGA 4OUMA 5CG8A 2DVBA 4UF0B 3GF6A 4N53C 1GSLA 3USSA 1RUNA 2H6CA 5FYMA 4LHSA 3BTXA 1OPOA 2VTXA 3KF5A 4OUSA 2WABA 5JXJA 1NE6A 1HRI1 3CF6E 4GQ7A 1RMU1 4CU8A 3RZLA 3AMPA 1W6MA 1Q3EA 1GNHA 2YV8A 5HBAA 2ZMKA 3HEIA 1RHI3 3IWZA 1VBD3 3FLPA 2ARAA 2RS53 2JJ6A 4Q4W2 2JDAA 4JV4A 1YI9A 2OKXA 1MR5A 3ETQA 2X29A 4H7MA 5J36A 1STMA 1QJX2 2YU2A 3VUOA 4CP0A 5K9YA 4PIZA 3CJIB 2V73A 4QQPA 1RGSA 3T2QA 1XNAA 4FPFA 2ADDA 2C6SA 5J37A 4OI1A 2C9AA 1JZ4A 1PNGA 1NCRC 2P5BA 4DXTA 2EXJA 4MGKE 3WCRA 1UU4A 3I3QA 2AH2A 4PQ9A 1JI6A 1SDWA 3DPRA 1D0HA 3GZUC 1BEV2 4JC1A 4OLLA 3D8CA 5EIYB 3AYEA 4QQHA 5A7OA 3ACIA 1S0EA 3OY8B 4XDOA 2PAMA 1ZZCA 3VZNA 2ZX1A 1PGW1 5I8YA 1VBC1 4B4RA 1HLCA 1K5MB 3H42B 2GALA 3IIIA 3AM2A 3PJYA 1X50A 3SHRA 1UYYA 3WG4A 4MXWB 1OBNA 5IYYA 3EB7A 3Q8CA 1BK0A 1VB4A 3I4IA 2VZTA 1N3OA 1R083 3HIFA 3ZLIA 4I30A 1UOGA 2PHTA 1UZWA 1RUE3 3KHBA 4XFGA 1YFUA 4DS0A 4B1LA 2EF6A 2VMDA 4KL1A 1J1LA 1APNA 2ZEZA 4TSVA 4XVHA 5A3LA 1JS9A 4EZHA 5L9RA 2IVJA 5EQUA 3UGFA 1DFQA 2AZ5A 4IEPA 4N7IA 1RUH2 1W6NA 1CAWB 5E16A 5JI7A 4A42A 1PO11 5I0DA 4XURA
chains in the Genus database with same CATH topology
2BEOA 1BYHA 1YNAA 1NQDA 2IXCA 3NKGA 1WMDA 3ZFFC 5F6LB 4DB5A 5I0TA 1HRV2 1UD1A 4XFIA 3N7MA 1CONA 2OYZA 4CDUC 1ZZ7A 4QMAA 4HVRA 4BLIA 4R9CA 1LOGA 4BOWA 5CB7A 3N7LA 3VBOA 2RE9A 3ZDSA 5BNPC 1CPNA 2GNTA 2XWJB 4QPGC 3BPZA 2KXLA 4L92A 2ARBA 3PVEA 1CJDA 2XBO3 1J1TA 1D2SA 3WUCA 4GMP0 1RUI2 5FMOL 3UJQA 1S2KA 1ZA4A 4H55A 1REFA 3B9CA 1ZBA2 1C8M3 2A7AA 3NWKA 3SCFA 1OLRA 1IS4A 2B39A 1QJY3 3D0JA 5JWPA 3Q9OA 2SLIA 1H2LA 3OJBA 4YGBA 3FX3A 5KXCA 1REEA 1PNFA 2JE9A 2XJUA 3KLSA 1X82A 3NV4A 4AHYA 4RQPB 1QOTA 1XNCA 1TMF2 1UIKA 1ALYA 1UU6A 1RHI1 1VBD1 4SLIA 3CJIA 3MIGA 5GZGA 5CG9A 5GJ6A 5JLVA 4FPOB 4CDXC 1ZZ6A 4E2SA 5FQ0B 4XEZA 2Z42A 4YGEA 1FX5A 1WD3A 1DQ4A 1N3PA 1W0PA 2ZKLA 3VBUC 2VG9A 4NHLA 2OIIA 2MHFA 1QJX3 3ZO0B 2AGSA 4XILA 2GU9A 2VOXA 4XETA 3ZSLA 1WGPA 2XL7A 1S1AA 3WLUA 4CDQA 4DZGA 3OY8A 3S0MA 3FBMA 5HXVA 4IEUA 4LA3A 3CNAA 2N7GA 2B7YA 5JSRA 1MZFA 1K5MA 1XXNA 4MGIE 1LECA 1FOD3 1ZYBA 2D5HA 1NOVA 2XVGA 1N3QA 3AK0A 4MXWA 4AI0A 2ZGKA 1BEV3 4NWVA 4AK3A 4XXPA 4DPNA 4B7KA 3WHUA 1V9U3 4XFAA 2XJPA 5F5QA 4COZA 1XYPA 4MZUA 4Z82A 2X5IB 1D4M2 2VOVA 1TME2 3C2UA 1R081 4RS5C 2DVGA 1N1SA 2D93A 4P14A 1LRHA 2WLPA 1RUE1 1CAWA 4C0BA 1RTVA 1DGRA 3MIDA 5DZEA 5L73A 2GDFA 4QQOA 4IERA 3VBFB 3CL1A 2WNUA 2XG3A 3DPRC 1QQP3 1VRH2 4B8EA 1NCQB 1BQPA 1SLIA 1RUH3 4QXKA 2NLRA 4E9KA 2D6OX 3EJKA 4AEDC 1CPMA 3IDBB 3VBHC 1MS3A 1MZ6A 1YCIA 3INAA 3E6BA 4TZDA 2WNVB 1HRV3 1F31A 1PO22 3EQEA 4YZ3A 4KQ7A 2BTVC 1S0FA 3D0SA 4NHKA 3T1LA 1OA3A 2XBO1 2VU9A 3JBG2 5JAXA 1FPN2 2R30A 1CAXB 1QXJA 1AR72 3GALA 1ZBE2 4RHV2 1RJ7A 1Q43A 4WM7B 1A8DA 2WS92 3J4UH 1B35B 1DZQA 1KDMA 4QPIB 3VHRA 1UF2C 1W6PB 4JGYA 2BW8A 5L7OB 1C57A 1C8M1 1RUI3 1IS5A 4XFCA 4EWDA 2BNMA 4XE9A 2DU0A 3BCWA 4RQPA 1QJY1 4HPKB 1S0GA 4RGAA 4XJ9A 1RINA 1ZBA3 4UBGA 4KWJA 2EALA 3GBGA 2WINB 5E1RA 4H14A 3BOWA 4URTA 3VBOC 4XQWA 4E27A 4FBFA 2QUOA 3RYRA 4F3JA 3L9JT 5FQ0A 1FATA 2A75A 5AVAA 5JPNB 4Q4Y2 4RR3B 4YM0A 1TMF3 1J3PA 2E6VA 5EV7A 4COUA 4W6WA 1WLCA 1XNDA 2R073 1FV3A 3LSDA 4NR1A 1QJX1 1MS8A 3I8TA 4AI2A 5L19A 1RUC2 1JHNA 3IM0A 4OHWA 4YGDA 1KFXL 1HDKA 5FREA 3ZN4A 4N43B 1XQNA 1YIPA 4EV0A 4IEWA 4V1PA 1FOD1 4DFSA 3SH4A 4HFSA 3WY6A 5JIUA 1A3KA 1SEFA 5F9TA 2X5IA 1BEV1 4LBNA 3V0AB 3R0RA 2XJVA 4R8HA 4ASMB 4DQAA 5IK5A 1DG6A 3AKRA 4XJUA 1CESA 4PLNA 1V9U1 3CJIC 1HW5A 5LRRA 2ZGMA 2PQQA 4FOWA 2QFEA 3OGGA 3N7KA 3GBWA 4XBQA 2MNGA 1RUF2 1ZZ9A 3PVOA 4Y26A 1ZZ8A 3QLQA 4AFAA 3VBFA 3PNAA 1TME3 2W39A 4L2NA 3ZXLA 3R05A 4YW1A 1NCQA 3RYKA 3CEWA 4IEYA 4AEMA 4Q0QA 2G4IA 2FZ2A 3R4UA 4KGQA 2GSYA 1QJU3 2Z5WA 2XJTA 4XMIA 1QQP1 4E4ZA 3IT8A 4LA2A 2RS32 2JG9B 3GZAA 1RUH1 3WQ0A 4Y1UA 2HYKA 2DVAA 1VRH3 1LHWA 4XF4A 4HKOA 2XWBB 2ZGPA 5KHGA 1EP0A 1HRV1 1V00A 3A4UA 4QM9A 1WD4A 2HWB2 4LLOA 1CAXA 1ONAA 2GC0A 4L11A 1Z0HA 1U5YA 2GH8A 3LA2A 4WM7A 4Y1XA 5I0RA 3O12A 1B35A 4QPIA 1PO23 4YRDA 1W6PA 3ZVXA 5KXBA 3SISA 1AXKA 5L7OA 1LODA 3J9SA 4AGGA 5FO7B 3WP3A 3OBTA 4YW3A 2PTMA 3JBG3 1ZRFA 4HPKA 2GC2A 1SBDA 1C3HA 1FPN3 3AX4A 4RHV3 1ZBE3 1RUI1 1PGL2 4XOGA 1CAUA 3M3EA 1G9FA 4L8QA 2P2KA 2A6YA 5GZEA 4YW5A 5BY5A 2X8KA 1ZBA1 1N1TA 4G4FA 2TUNA 2WT0A 5T54A 3PMSA 4HSLA 2WKKA 4RR3A 1ULGA 4YVWB 3MLKA 1PGW2 4K6BA 4LO5B 1VBC2 3KT1A 4R9AA 1O3RA 3AFGA 1NE4A 2VULA 4M3CB 5L36A 1X8EA 4Y5Z0 2DU1A 4AVBA 4HANA 3AKPA 3QACA 1TMF1 1LOFA 2JD4A 2XB6C 2QQPA 2ZGNA 5BUVA 1UL9A 2E51A 3FJSA 4XDQA 5DZGA 4Q4Y3 4OVEA 5C8CB 3N35A 5BNQA 3KCYA 3AP7A 1N1YA 2R071 5H9PA 1BMV1 3RWNA 1G9BA 3RDIA 4KWKA 4D7SA 1G6NA 5I0SA 3WDYA 2ZX4A 3WDXA 4F8AA 1SQ4A 1OSGA 3POWA 4B3NA 3V0AA 2HWE2 3B3QE 3JU9A 5KHJA 4FPJA 5J3UA 1RUC3 3SH5A 3WX5A 5E89A 2EAKA 4GMP3 5KXDA 4NO4A 1PIV3 5GALA 4XHBA 3W58A 1V6IA 2DUQA 1UZYA 4WVVA 1FNZA 3VKFC 1NXD1 2VMGA 4MSVA 3H7JA 2GN7A 3R4DB 2DCKA 4Q1PA 4JVAA 4RFT0 1TME1 3HAGA 2BNNA 4MV2A 4AWDA 4YZ1A 2MPFA 3P3PA 5DUWA 1RUF3 2JG9A 3VZLA 2A5ZA 3IDEA 1QJU1 2A6XA 2G9GA 4M00A 3VZKA 3VHNA 2ZHMA 3ZFEB 2XPJA 4AW7A 4FOYA 1VRH1 2PAEA 2RS33 1GANA 3WQ7A 2VY0A 3M4FA 3AZVA 4DRVA 5SV5A 4CEYB 2BWCA 3NVCA 4IEOA 4NPRA 4Z1VA 4QHBA 3UJOA 1MEC3 2O0OA 4AI8A 1PO21 1KJLA 3V64A 2GMMA 2HWB3 1O7FA 1NCQC 1DBNA 3NO8A 2BQPA 2DURA 3VZMA 4YG6A 3KSCA 3JBG1 1R1A3 4N9HA 1FPN1 3UKTA 4RHV1 1ZBE1 1RUD2 2WNVC 1CVNA 4YVWA 4PCRA 3WNXA 1SLLA 3FWEA 5DG1A 1DGWX 2KM2A 4M3CA 5CU1A 1O4TA 3DV8A 1JYCA 2NN8A 4KGGA 2OW4A 3OYWB 4NOTA 3VDDB 4B4QA 1C1LA 1O3TA 5DDJ2 3RJ2X 5EWSA 4NN0A 3U07A 3O7OA 2DVDA 3AP6A 3O0XA 3WR0A 5C8CA 4D3WA 1BKZA 1D2QA 5E8AA 3WW1A 3N4MA 3W9AA 4Q4Y1 1RUE2 4BHPA 1IGOA 3E5QA 4YNIA 2BVVA 4JAAA 4F83A 2CL2A 1UMZA 2YGLA 3THTA 1EPWA 1YJKA 1AX0A 1HXS2 4YLZA 2G9FA 4JRLA 1OFNA 2VQAA 2XJQA 3PHMA 5ABJC 5BNOC 3ZXGA 4BIOA 2E7QA 1CAVA 5HCFA 1AF9A 1AR62 1RUC1 3MLJA 3FMGA 5KHHA 4GMP1 2WJSA 2HWE3 4AF9A 4SBVA 2PHUA 1PIV1 3TNPB 1VIWB 1W6NB 2AYHA 1Q8PA 2Q30A 1WMEA 3RG0A 1A8MA 2VMHA 4RL7A 2VNGA 2ZGRA 1GFF2 1PGSA 1AX2A 4OZXA 1GKBA 2XBO2 4J1WA 1YIFA 2ZAHA 1Q8OA 2BWAA 2GZWA 3DKWA 3N7JA 4N43C 1RJ8A 4O9GA 4C1WA 1REDA 1SFYA 1A6CA 3ZYGA 2Z69A 1RUF1 5TSWA 4AFMA 2WT2A 2ZGLA 3WDTA 2OUHA 1GICA 4FTBA 3KT7A 3RZZA 1AJKA 3TRSB 3ZFEA 3ALQA 4BYYA 5K8SA 1N47A 2R32A 4MUVA 4ATEA 1C5HA 5D8AC 2F6BA 1QJY2 1HQLA 4CTEA 4JDOA 4XF3A 2YGMA 4CEYA 2D3SA 4AQSA 2RS31 4L9BA 4DMIA 1QKQA 5CIRA 3WVJA 4IQPA 2OZJA 1H4GA 1DQ1A 4EROA 1BVP1 3AYAA 4OHVA 1J59A 4WVMB 4G9SB 2GC1A 4UW5A 1MEC1 2A71A 1ZRCA 3TAYA 1JUIA 2VVEA 2D6PA 1RIRA 2HWB1 2X53S 4KH9A 4CZSA 3ACLA 3PLQA 4I0WB 3TN93 5FAXA 4XIOA 4AQ6A 4XJ8A 1GBGA 1R1A1 1GQHA 3MFCA 3OF1A 4BA6A 1HV0A 2HWD2 1BK1A 3MGUA 4AVCA 4AYUA 2QDRA 3VDDA 3OYWA 3NKTA 1Q8VA 1O3QA 4IXLA 1V6MA 3JZVA 1RUD3 1PGL1 1FOD2 1ZRRA 5FCCA 1UZZA 2ZGQA 5JOZA 1NA1B 4ZXKA 2VW2A 4G3YC 2ZX2A 1YI7A 1XRUA 4YM1A 4CDQB 1V9U2 2UWBA 1FT9A 1VJ2A 2HWC2 2NM1A 1H1IA 5DDJ3 3FBYA 5FLJA 5I8SA 1ENQA 1SFNA 2QVSB 1HV1A 4FTSA 5T5PA 4K1ZA 4A7YA 3AJZA 3J26N 3H8UA 2P3IA 5CNAA 2DYCA 4Q26A 1QQP2 3WD5A 2A3WA 1NY71 4A7ZA 4GH4B 3PMEA 4HETA 1HXS3 1G9DA 5GLWA 3EBRA 4UW3A 5EYYA 4K8FA 1YJLA 4YG0A 1LEDA 2HWE1 4HVQA 2RS12 1RITA 4EN6B 1AR63 3M7AA 2WIIB 2AREA 2K9ZA 2WNUB 1RC6A 4ISRA 1NG0A 1W6QB 4GWNA 4IESA 4S2HA 5I8TA 2DCYA 1ASJ2 2YDEA 3AZXA 1AYM2 1Z7S2 2TBVA 3H0OA 4W6YA 1MVEA 4FPHA 4LBOA 2AENA 1X36A 2JXAA 1N1VA 3NAPB 2PLV2 1RUG1 1X7NA 3ZFGC 4QQ2A 1XNBA 4OHXA 3V65A 2F4PA 4R9BA 1OKQA 4XFHA 3E6CC 4S2GA 1S2BA 3L2YA 4MH0E 3ZMNA 3K48A 1CIWA 4WVMA 4OI2A 2ZGTA 1WBLA 5IUQA 1E57A 5CFCC 4JGYB 4XF0A 1S0JA 3HMYA 3WP5A 5JZGC 2UY9A 4FPCA 1EV12 2DCZA 2ZMLA 1DYPA 3AXEA 2ZACA 4AG4A 2PYTA 2B42B 1U12A 1L3JA 2VW0A 4XTMA 5DZFA 1UIJA 1UPSA 1QH6A 4MLOA 3TN91 1BMV2 2R072 4GXLA 2W52A 1OLQA 3TYJA 4B7EA 1V6JA 3IN9A 4HKWA 4YSFA 2VOKA 4LBKA 4QGNA 2XH6A 3EXUA 3FHIB 1NA1A 4KNCA 1Q8QA 2CTVA 4FXGB 1X33A 4OFGA 4AQTA 5HCAA 2BNOA 1GZWB 2QE3A 4LULA 5CFDC 4KWLA 2HWD3 4MVTA 1RUD1 2JICA 1XU2A 4XW3A 4Q4X3 4GB32 3E5UA 1KQRA 2Q1MA 4IV3B 2IXIA 2Q8OA 3B94A 3KCCA 1OPMA 4WV8A 1AR82 4DNYA 4XBNA 3JB4C 4E4DX 3HN1A 2I74A 2FBEA 5DDJ1 1GNZA 2ZKNA 1TNRA 2FHRA 2I2SA 3M70A 2HWC3 4BIFA 3FFZA 3TBDA 3W59A 2CGNA 5A33B 4GULA 1JOJA 4KG0A 3M3CA 4GH4A 1PK6B 3VDDC 1QJU2 5GLVA 2WA3A 1BJQA 3WCSA 3ZXDA 1V6KA 4CRQA 1HXS1 3H3ZA 2W68A 1EPZA 4Q0VA 1W6QA 2H0VA 5KC5A 1HIXA 2GN3A 3VZJA 1DLLA 4FSJA 1AR61 1ENXA 4DRRA 3PTYA 3QOPA 1QHDA 4N90A 2YPJA 1AZDA 2RS13 2R062 1ULCA 3NAPA 2IXLA 5FTTC 1QJZA 5C9AA 4UBHA 3OBRA 2QKDA 4XQ4A 3SCGA 1DGLA 3ZXJA 1ENSA 1IS3A 1ASJ3 4WZCA 2ZTNA 3IKWA 1AYM3 1Z7S3 2PN5A 1CN1A 2HEYF 1WLWA 1TE1B 2RHPA 1WA4A 2C1FA 5FFOC 2VUAA 1AJOA 4ZU5A 1LEMA 5J7MA 2PLV3 3VZOA 2BPA2 3R6SA 2OUJA 3S6PA 1QU0A 5C4WB 1LB2A 2WZPP 4MXVA 2VH9A 3VBRB 1FNYA 3MIHA 3DF0A 1H1AA 1CJPA 1MQTB 2SBAA 2D6KA 4A2UA 1Q5OA 1SCRA 2IWGB 3DGTA 1CAUB 1CGPA 4AI3A 4GALA 5GZCA 2BFUL 4FP2A 1IZ3A 4N9IA 1COV3 1AYN3 4HZFA 4RGGA 4NWWA 1EV13 2EXHA 2Q5TA 2ZBJA 1YXWA 1PVXA 1GZWA 3RMXA 2PHLA 1BVVA 1HQNA 2O8OA 3B02A 3KZ4C 3H1YA 4JRAA 3KMHA 4Y22B 5LRSA 4YFWA 2C5DA 4LUKA 4IV3A 1SBFA 3SXWA 4TLFA 4Q2FA 1LHNA 5J09A 3ST7A 4J1XA 2HWD1 5IK7A 4IV1B 4WM8B 4X8PA 4Q4X1 5C8WA 4Q4V3 3VKLA 3RYPA 2WLQA 1PIV2 2CY6A 4Z2WA 1AXZA 4FPYA 4GB33 4YVSA 2CYFA 3ZMOA 1JW6A 5KHIA 5IK4A 3N36A 1SLTA 5A33A 1VB2A 1Y3TA 4CDWB 3C3VA 1BZWA 1LU2A 1MS4A 1AR83 4YM2A 1H8VA 1PK6A 2HWC1 3FUQA 4K7JA 1LHVA 2TNFA 3M3IA 1RB8G 1I3HA 2A6WA 2V5YA 4IETA 1POV0 3WW2A 2ERFA 2A70A 3ROUA 5FDBA 1WBFA 5DXDA 3B01A 5IK8A 3LA7A 4CDQC 3AMHA 3ATGA 3U11A 3B00A 3HQXA 4HSJA 4FCAA 5T55A 1K5MC 1IS6A 1A78A 3E97A 4DY5A 2WL1A 4D94A 2XGXA 4N53B 4XZPA 2IFRA 4XTPA 5KC6A 1BXHA 2Z2SB 3I54A 1H2KA 2RS11 1MEC2 5F1RA 4JGZB 4AVVA 2RJKA 2IXKA 2ZGUA 3NV3A 3DN7A 4GH4C 4XMAA 2R063 2WZR2 3USUB 3WV6A 1HX6A 1ASJ1 2H6BA 3FC0A 1ULEA 1AYM1 1Z7S1 1H1MA 1R1A2 1RUJ2 2JECA 5C4WA 3UKVA 3QD6A 3WDVA 3VBRA 3KCXA 4YM3A 2E7AA 4MGYE 1MQTA 2PLV1 2WNUC 3ZIXA 2R1DA 1Y9QA 4M3CF 1AXYA 1JBCA 2ZX3A 2D40A 4I0BA 1NCRB 3JB8A 1DGWA 1VBA3 1W0OA 2WFF3 4Q8KA 4LBJA 2ARXA 4FAGA 1W39A 3NAPC 3RQ0A 3GNEA 1COV1 2R0FA 1AYN1 2HEWF 1OQEA 3VLBB 1BBT3 2FMYA 1EV11 3I2DA 5AFEA 4Y22A 1Q56A 3ILFA 3O0WA 1VAVA 1WCDJ 2LM3A 4LO6B 3B5LB 4IV1A 4WM8A 2KA3A 4JGYC 4UW4A 1NY72 4HK8A 2WT1A 2CAUA 4RQPC 2CGPA 1IKPA 1LESA 4Q4V1 3MW2A 2B45X 5C33A 3ES4A 4CDWA 3CO2A 1TEIA 3MPBA 1S0IA 5KWRA 3WXPA 2RMU2 4GB31 2Q0AA 3P3NA 3GHMA 4COWA 1CAVB 4LBMA 3KD4A 1AR81 3WP6A 2EIGA 3V56A 4PLMA 3K51A 5FOJB 2A3YA 2GNMA 4YZ2A 1YUDA 5FMOS 1CQ9A 1YYNA 1RL3A 5BNPB 4LO8A 1IHMA 2E9QA 3S7IA 1OHFA 3NL1A 1WW7A 1H2MA 1NLRA 1RUG2 2DCJA 4IV3C 3AB0A 2TEPA 4P9GA 4XPVA 5I91A 4K1YA 4XF1A 2YXSA 3ZIWA 1J3QA 3KQRA 3MDPA 3OTFA 4N53A 3QCWA 1OFSA 1QXRA 4ZU7A 1J58A 4Y20B 4IEQA 4Y1VA 2X5IC 1U5ZA 1OMIA 4JGZA 4BE3A 3FE5A 3H3UA 3JUUA 2PHFA 3USUA 3RRDA 4LBQB 1PK6C 2BYVE 1F5FA 4I09A 3I7DA 3J8F3 3HT2A 2R061 3SMHA 2R16A 3RSJA 3TN92 1EYBA 4C91A 3VBFC 2AUYA 1LJ7A 4FT8A 5CAZA 4QQLA 4RA0A 4BH9A 2JENA 5KXEA 2WZR3 4EN8B 1NCRA 4ONUA 1RUJ3 1I5ZA 2D6MA 3VBUB 4R4XA 1JXNA 4H3WA 2D3PA 1QDOA 1VBA1 4FP3A 5JOWA 3N3HA 2WFF1 4AHZA 1DHKB 3LKJA 1PZ9A 2D97A 2ILMA 1ND2B 1YRZA 3PJQA 2HWF2 4JDNA 1RUOA 1LGCA 2Y0IA 4AI1A 1IQAA 2XLFA 5J96B 5FO8B 2ZGOA 4XXAA 4BZ4A 1B09A 4WM7C 1CR7A 1BBT1 2UURA 1B35C 4QPIC 1H8TB 4U2AA 1LU1A 5L7OC 1QWRA 4F7ZA 5KBFA 2XLAA 4D7YA 1I1EA 1H9PA 4JTOA 1EAH2 4LO4B 4RS5B 5C6CA 5FPXA 1PM7A 1LOBA 4XJAA 3ZPYA 4RSUA 3D5OA 1HQWA