4BIFA

Biochemical and structural characterisation of a novel manganese- dependent hydroxynitrile lyase from bacteria
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
b'MEIKRVGSQASGKGPADWFTGTVRIDPLFQAPDPALVAGASVTFEPGARTAWHTHPLGQTLIVTAGCGWAQREGGAVEEIHPGDVVWFSPGEKHWHGAAPTTAMTHLAIQERLDGKAVDWMEHVTDEQYRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUPIN 2 CONSERVED BARREL DOMAIN PROTEIN
publication title Biochemical and Structural Characterisation of a Novel Bacterial Manganese-Dependent Hydroxynitrile Lyase.
pubmed doi rcsb
source organism Granulicella tundricola
molecule tags Lyase
total genus 30
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4bifA00
3H1YA 3OGJA 4KL1A 4EWAA 2BYVE 4IETA 1GQHA 1GQGA 3CLPA 1QWRA 5C8WA 2UYAA 5BUVA 3QACA 3WW4A 4PIZA 1O3RA 2PQQA 4UBGA 2WFPA 1YFWA 5E16A 4IEOA 4FAHA 5KHJA 5T3NA 2B5HA 4XF9A 3CEWA 2OA2A 5J3UA 1FT9A 1UIKA 4WBBA 3KGZA 1Q43A 1XRUA 3I54A 2ZKLA 1NE6A 4Q0PA 1ZZ8A 1J59A 2HJIA 4LEJA 4Q0SA 4XFCA 3MYXA 4IEWA 4TLFA 1DZRA 4EV0A 4WVZA 4FT8A 4L11A 3IWZA 5FCCA 4Z82A 1NE4A 3IDCB 1UPIA 2MPFA 3WW2A 2Q30A 1SEFA 4QMAA 4HSJA 5EFUA 4HLTA 2N7GA 3DN7A 2UY9A 4XF0A 5JR7B 4AVAA 2CV6A 5FQ0A 1YLLA 3ELNA 1I5ZA 3NW4A 3U10A 2VQAA 4X6RB 4J1XA 3BCWA 3E6CC 3TNQA 4XF3A 1O5UA 1ZZBA 2ETEA 4HZFA 5I0SA 2PFWA 3ES1A 4IESA 3JZVA 3I59A 4H7LA 3CL1A 4I0AA 1J3PA 4FAGA 4EWEA 2QDRA 3GBFA 4NVPA 4YARA 4N9IA 2KXLA 4ZU4A 3LA2A 2EAAA 3EJKA 1X82A 3WW3A 4E2GA 2XHKA 1O5LA 1CAWA 1WLTA 3ST7A 5F1RA 4XEZA 1OMIA 3FFQA 4JTNA 4META 3HIFA 1Q3EA 3ES4A 4IEZA 4XF4A 3SXWA 1O4TA 1NXMA 2XLGA 3D0SA 2H6CA 5KBFA 2UYBA 4ZU7A 1RL3A 1IPKA 4PJYA 3VHRA 3ETQA 5FLHA 5FLIA 4Q29A 1YFYA 4AXOA 1LB2A 4LA2A 4LLOA 4XFGA 2OZ6A 3DL3A 2GC1A 3KGLA 5D1IA 1YUDA 5I93A 3UKNA 2PA7A 3MZHA 3S0MA 1LR5A 2ZCWA 1QXJA 4MGIE 1Q5OA 3U0ZA 2IC1A 2PAEA 2P17A 3EBRA 4KWLA 3RYRA 4I2OA 3KMHA 1HW5A 3SCFA 3L2HA 4KU8A 1ZREA 4IEXA 1RUNA 4AVBA 4HVRA 2VECA 4HN1A 1J58A 4MGKE 2DCTA 3NL1A 4MZUA 4MV2A 3ACLA 2XLAA 3S7EA 4RD7A 5BXXA 3FHIB 5LEJA 4XF1A 1ZZ9A 3LA7A 4JV4A 4MX3A 3H7JA 1CAVA 3H9AA 2D93A 2GC0A 4HMZA 5J48A 5FQ0B 3M70A 1CX4A 3E97A 4PIYA 2Z69A 4YSFA 5LRSA 1YWKA 5I91A 5JSOA 1ZZ6A 4N9HA 2PAKA 4MGZE 5JSPA 2BNNA 3LA3A 2IXHA 3I59B 4QX5A 1UIJA 4BYYA 1CAUA 2O1QA 2PYTA 3QOPA 4I3PA 2IXCA 3RPQA 5E1RA 3E5QA 3NSTA 1CAXA 4ORFA 4OFGA 3BU7A 5JSRA 1J1LA 4QGMA 1V70A 1RTVA 2Q0AA 1CAWB 5LRRA 5HI0A 1LKNA 1ZZCA 3FE5A 2OZJA 2QJVA 2QVSB 5CADA 2XKPA 3SHRA 3CO2A 4YRDA 1FI2A 1TQ5A 3BB6A 4CYDA 4XFAA 4IEYA 2CGPA 4E2SA 1Y9QA 3MPBA 3IIAA 3TNPB 4D7SA 5KHIA 3H1WA 3H8UA 5FLJA 4IEVA 2ATFA 4Q0QA 3KSCA 5CU1A 2GZWA 2IXKA 2IXIA 2E9QA 3R6SA 4EROA 3NKTA 2B8MA 4O9GA 1O3QA 4QXKA 4QM8A 3SCHA 2OPKA 5I8SA 1EPZA 2BEOA 5FPZA 3PNAA 5LEKA 3HT1A 4FBFA 3H50A 3H1MA 3MDPA 2PTMA 3G7DA 3RYKA 1EP0A 2OYZA 3CJXA 3ROUA 3GYDA 4L2NA 2PHDA 1WGPA 4UXAA 1ZRFA 1UW8A 2PHLA 3LOIA 1RGSA 2BNOA 3EO6A 2QCSB 1OD5A 2ET7A 3OCPA 3U11A 4LTAA 4HVOA 1J3QA 4KU7A 5I0UA 4E2QA 4XFFA 2HKXA 1ZZ7A 4O9EA 1CAVB 4B29A 4HVQA 3UKVA 2XLFA 3H3ZA 1PMIA 5I0RA 5FDBA 2XGXA 5FPXA 2Y0OA 2H6BA 2XL7A 1IPJA 1ZRDA 3ZDSA 2Q4SA 3E6BA 5JCTA 3H3UA 3D82A 1CAUB 5EZWA 3OF1A 4WZCA 2MHFA 3EHKA 1X8MA 4PIXA 1YHFA 2FQPA 2GAUA 4JVAA 4A2UA 1YFUA 4XFHA 1CAXB 4MUVA 2GC3A 4LUKA 5BY5A 4Z07A 4DINB 1DGWA 4BHPA 3KCCA 4ONUA 1UCXA 3E5UA 3N4MA 4AQ6A 3B02A 2O8QA 4R8HA 4Q0UA 3SCGA 4QGLA 1I6XA 4UBHA 5CVRA 5BPXA 1OI6A 2EVXA 1NZCA 2F4PA 1UD1A 1G6NA 1O3SA 4IEUA 5JAXA 3RDIA 3FJSA 4XFBA 4MGYE 1ZRCA 3LAGA 4F7ZA 5BV6A 4KWJA 2I45A 1U12A 1OFNA 2BGCA 2VPVA 4IEPA 2CAVA 2GC2A 2D5FA 1H1MA 2WC2A 2IXLA 1XE8A 3HQXA 2QNKA 4K8FA 2V09A 4GULA 3E6DA 2UY8A 4MH0E 3WW1A 3EQEA 4YYOA 4AQ2A 3UKTA 1DGRA 4P9GA 1EY2A 3DKWA 1SFNA 1FXZA 2PAMA 2XL9A 5I0TA 3FWEA 1DZTA 4HSLA 4HN0A 3BALA 1CGPA 4XETA 4KWKA 1YFXA 4D7TA 4IEQA 5C6CA 5AVPA 2IXJA 2B9UA 3NVCA 1XE7A 4QM9A 1QY4A 1SQ4A 3OTFA 4R52A 3FX3A 4LULA 2FMYA 1Y3TA 5KHKA 4HBNA 3NJZA 1PM7A 5I8YA 2K9ZA 2C0ZA 4IERA 3SMHA 3DV8A 3PVBB 2CAUA 2D5HA 5J7MA 5I8TA 3RNSA 2EA7A 3E5XA 2ET1A 2XKOA 4BIFA 4Q0VA 1NYWA 4I0BA 4I01A 4F8AA 2BNMA 1O3TA 3FZ3A 3BPZA 4LUMA 4AVCA 1EYBA 4EWDA 2Q1ZB 1LRHA 2D40A 4X6QB 4J1WA 1X7NA 1H1IA 4OLLA 1WA4A 2GH2A 3LWCA 5KHGA 4QGNA 3LZZA 3O14A 4BH9A 1L3JA 1ZRRA 5K8SA 1JUHA 1ZX5A 1O7FA 2H0VA 4XFIA 4ZU5A 3USSA 1X8EA 3C3VA 4I09A 1VJ2A 1ZVFA 2GU9A 3D0JA 3RZZA 4I02A 3CF6E 3IBMA 1RC6A 4YNIA 4JTOA 3IDBB 3M3IA 3PLQA 4LA3A 1VR3A 1ZNPA 2MNGA 1QXRA 1VP6A 3RYPA 3I7DA 1J3RA 5KHHA 3H7YA 3HT2A 2Z2SB 3OD0A 3S7IA 2K0GA 1RUOA
chains in the Genus database with same CATH superfamily
3BVCA 3OGJA 1AR91 5LY1A 3U1XA 1XJAA 5GKAC 1GQHA 5DUXA 4RFRB 1ZRCA 1POV3 1V6LA 3NQHA 3U75A 4NHMA 5F3EA 2UYAA 2RM21 4B1LA 4OHYA 4PIZA 4KBBA 5LY2A 4AI1A 2PQQA 2XJVA 5KHJA 2UWBA 5FZIA 2GP3A 3D8CA 2WWUA 4AAPA 5A7PA 2WFF3 2YBSA 1QNWA 4GQ7A 4LE4A 1GLHA 1LAJA 2E53A 4G3YC 2OA2A 2W3JA 2YYOA 3GJBA 5J3UA 3UL2A 2W1SA 1V9U3 5FPLA 5A6QA 4URTA 2C6SA 1GV9A 3NWKA 4Q0PA 2XWBB 4DUXA 1NCRB 4BLIA 4P9JA 4XQ4A 1QU0A 1QJX3 1AR72 5J1XA 3MYXA 1DZRA 1NX9A 1OF4A 2BERA 2G9ZA 2WT0A 4WVZA 2RVAA 3M2MA 3TYJA 3WF3A 1C5IA 5FCCA 4YSFA 3C7EA 2BQPA 3IDCB 4AQTA 3POJA 3NV3A 1C28A 1OVSA 1W6QB 4R4XA 4A4AA 4MGTA 5BNNC 1LECA 1JTZX 3UJOA 2Y8KA 5F5IA 5EFUA 4CVUA 2VOVA 5APAA 3ZN4A 5DMYA 5JMCA 1DQ1A 1LOFC 2HEYF 4GWJA 4H2AA 5A3MA 2PELA 1ENRA 5J98B 2VL4A 3HPNA 3ELNA 2Q8CA 3U10A 1IS5A 2W5FA 4QHZA 3E6CC 3VD5A 1IQDC 3PU8A 1D4M1 3WP6A 3MW3A 4IESA 1POQA 3OYWA 1RUC2 2RR12 3MV01 1W9SA 4H7LA 1AR73 2VCAA 1R091 4WV8A 2RV9A 2VOXA 2ZZJA 3QH6A 2R042 3EYPA 5FZBA 1SCSA 4YARA 4DFSA 4AEKA 2QQVA 1MS0A 1GZCA 1OF3A 2KXLA 2JD4A 1EUTA 3NJVA 1UX6A 3LEIA 3M3OA 3RFRA 3S6PA 4D8MA 1CJPA 2X5IC 4QPWA 1GZ9A 4HPKB 4XJ9A 1GP6A 2W95A 5ABJA 4UFKA 2TEPA 2DCYA 3HNBM 3CZJA 1RJ7A 1CAWA 3WUDA 3ZFGC 1IQAA 3T2OA 4JTNA 1VBB2 5CKQA 2JG9A 3DEMA 2J1VA 5FO8B 1Q3EA 4CCDA 1IOAA 4XF4A 4XUTA 3SXWA 1BMV2 1RUC3 1O4TA 3ITQA 5CG9A 2RR13 4XZPA 1VBD1 2H6CA 1JOBA 5FWEA 2GMPA 4RGKA 1STMA 2JDKA 1WD3A 1EUUA 2R043 5CIRA 4XMIA 3FFZA 5A7NA 4CCEA 5FZ9A 1RUE1 2YMZA 1MVEA 1PIV1 3DXTA 5FLIA 3RJRA 1J84A 3TAYA 4Q29A 4AHXA 3MBWA 2VNVA 4FPYA 1DQ5A 4UFHA 4AG4A 2Q1FA 5DAQA 1TEIA 2GC1A 5EWSA 4PI0A 2YG0A 3AYAA 4CDUB 4ES8A 2EIDA 2GH8A 3KGLA 4NO4A 3UKNA 4I30A 3I2DA 4AEDA 2RS11 4A7YA 4CUBA 2PA7A 4WM7B 2J22A 4HKWA 4YGEA 3DYOA 4QX0A 4AQSA 5BNOC 1VBB3 3BTZA 4OHXA 2NN8A 2W52A 4OULA 2ZAAA 3EBRA 1SLTA 4P9YA 3SCFA 1RUNA 1UYPA 1Q8QA 2WSUA 3FC0A 4AHZA 2ARCA 2RJLA 1VBE2 2CL2A 2VOWA 1OPOA 2ZGRA 4LT5A 3IPVB 3MI8A 4HN1A 1QJU1 3RI8A 1OLQA 1NA1C 2Y6KA 1NY72 1ALYA 3I2KA 4MZUA 2VZTA 2V73A 1KXGA 1ODNA 1WW6A 4CUCA 4LMFA 4DXTA 2WZR2 3F2ZA 3AMNA 5DAPA 1DQ2A 2E26A 2JDNA 3POWA 1W2AX 3B9IA 3K77A 4QPIA 5CNAA 3NNJA 2A73B 2XWJB 3ZR5A 2KM2A 1G9AA 3O1RA 4LHKA 1PO21 2BWAA 3VBSA 1ULDA 4JDMA 1TG7A 5A7QA 4UWDA 4YW1A 2ZJCA 3MIDA 2GC0A 5LA1A 3M70A 3NO8A 1K5MB 3E97A 4CSWA 3ZN6A 1YIFA 4XC9A 5GJ6A 1MEC1 1ZA4A 2PAKA 2W1QA 4CU9A 3T2PA 1VBE3 3BODA 4GH4A 5AFBA 2BNNA 5C5UA 3I59B 4AEJA 4QX5A 4C91A 1QDOA 4R9BA 4FP2A 4E8CA 1FOD2 3AKSA 2O1QA 4QB6A 3VD3A 4UF0A 4DIQA 1IHMA 3WEZA 4M4PA 2WZR3 3MUY1 2FCUA 2DUPA 4NIAA 4NIDA 5FJKA 4MGSA 5E1RA 3D4KA 3GHNA 1C8NA 5A80A 4HETA 5IVVA 4LHLA 4AFCA 2VZUA 3ZMNA 1DQ4A 3VD9A 4ORFA 3GBWA 1J1LA 3CKHA 3HWJA 1Y4WA 1UPSA 4QGMA 3M4FA 4LR4A 3OEBA 3DKQA 2VMDA 1GWKA 3HNYM 5HCFA 4FXGB 2GDFA 5HI0A 1FV3A 5GZCA 1CZTA 1SLIA 1ZZCA 3CJIB 2QVSB 3DCQA 3FE5A 1AJOA 3CQOA 4NRPA 1NLQA 4Y24A 5A3WA 5FXXA 1RUI3 1SDWA 2BWCA 4YRDA 5B2GB 1FI2A 4CEWB 3DPRB 1UZZA 1GU3A 1W8TA 2YZ4A 4AFBA 2VC9A 2P4EA 4YGDA 4IV1B 2WNEA 4IEYA 3N7KA 4YVSC 4PBOA 3NJXA 4E27A 4E2SA 2DVDA 4D7SA 2B46X 5FZCA 3U07A 1IG3A 2BW8A 2ZOEB 3PHMA 3N7MA 5FUIA 2WABA 2R1BA 3SKJE 3THTA 1P8JA 4LHSA 4LJHA 4FQ4A 4AR2A 1LGCA 3WZ1A 1QH7A 2VCBA 1JMUB 3HEIA 1HXS2 4UW5A 5IUQA 3WQ0A 4YFZA 1JZ3A 2XQRA 1K5MC 4LIVA 5FY9A 3SLIA 4XBLA 1GSLA 1IKPA 1OFSA 3AMQA 2ARBA 2OPKA 1BVP1 2MEV1 3UETA 2OQ7A 1POV1 1LOCA 2Y6FA 5FPZA 3JD72 4K3UA 1D0HA 1KFUL 3H1MA 5LK5A 4GALA 5KXBA 1Q56A 3T0BA 4QPGA 1JZ8A 4B1MA 4LBNA 4AW7A 1UU6A 2R072 1FX5A 1CN1A 1QH6A 1MS8A 3K3OA 1CPNA 4XBQA 3ZYFA 3UGFA 1RJ8A 1W03A 3AP7A 5FPUA 1VLNA 2OW4A 3OPTA 1URXA 5DXDA 5F6LB 1V9U1 1CIWA 3TN91 2VVDA 3T2QA 2A6VA 3N9OA 5FYIA 3GGLA 4JDOA 2DUQA 4TN7A 5LA9A 2BVBA 1FV2A 1V6MA 3KV4A 4HOOA 4QKFA 1QJX1 3ZDVA 4EN7B 2VZ3A 4FSJA 1QNYA 1VB2A 1J3QA 4PCRA 2RS32 5EV7A 5I0UA 1I1EA 2QQIA 4E2QA 4CEWC 3DPRC 4XTMA 3VBOA 3T4HB 4B29A 3LSEA 5GLZA 4C0BA 4HVQA 4BISA 4NPRA 3JD73 2VMCA 2IUWA 4UW6A 3WINE 4JZRA 5SV5A 3OBTA 3Q8EA 5FZOA 3H3ZA 3O12A 4LBQA 1N3PA 5I0RA 5F2SA 2W68A 2KA3A 2QTWB 2R073 2ZMNA 5LZ6A 4OUMA 1ZRDA 2W39A 1PGL2 3ZDSA 1OKOA 5A3OA 1N1TA 1SLCA 3H3UA 5CEHA 1ASJ3 4H14A 3ZXGA 4YW3A 1LHOA 2YROA 3L2YA 4KMQA 3VB9A 5LATA 2WNUA 1HRV2 1O8SA 3EHKA 3PJQA 1X8MA 3I4IA 4AGVA 3KQ4B 1AR71 1AL22 1SPPB 1W04A 1YFUA 3VBUC 5FKBA 1CAXB 5ACA3 2DCZA 4RQPC 5FXWA 1H8TB 2GC3A 2RS33 3CBNA 4LUKA 5FY5A 4MLOA 5BY5A 1V6OA 4CCCA 1GWLA 4RR3C 4FTEA 3HVDA 4EYUA 4BWOA 5EJ3A 3WUCA 3JQWA 4EN6B 4R4ZA 3B93A 3ETPA 2QQLA 1UCXA 2C1FA 5JIUA 4DS0A 4W4ZA 5GLTA 1ND3B 2YPDA 3ZSKA 1NLSA 2VBBA 4FP3A 4PQQA 5A33A 3LEGA 1GR3A 2Y6LA 3B02A 4GWNA 1GMMA 3J7MA 1GZWA 3MO4A 4QGLA 4P5HA 5FXZA 2XMLA 1FPN3 5CVRA 2Y33A 4H55A 1AR61 4B8EA 2VBDA 2EVXA 1E57A 2SLIA 5C5TA 2JEMA 3AKRA 4XHBA 1HRV3 2GALA 4ZZ8A 2LTNA 4EZ4A 3T2TA 1XOYA 2DBIA 1RUC1 1L7RA 2WRAA 3MUZ1 2RR11 2JE8A 3LAGA 2Q8DA 3R4SA 2ES3A 1PX4A 4GMP3 4KWJA 5GLWA 1HIXA 1JOJA 5BV6A 2BGCA 2VTFA 5FZ3A 2R041 3W9AA 2GC2A 3KT4A 2Y6HA 4BDVB 4DXZA 2YDEA 3WNOA 3LIGA 4HK9A 1XNAA 5ANNA 4XTPA 3PTYA 2IXLA 5FPVA 1PMHX 4IW3A 2XPJA 4K7JA 4K8FA 4CDXB 3ZOIA 4AWDA 5LWBA 5T5PA 5C4WB 2VVFA 1OH3A 5C3PA 2VUDA 3FLTA 3ZFFC 2V4AA 1JYNA 2UY8A 2JDMA 4DOUA 3JBG2 3WNKA 1CPMA 3KM5A 2ZGKA 3J4UH 1B09A 3M3EA 4CEYB 5T54A 2VW1A 2W87A 3TEZA 1K12A 1KRIA 4JGZC 4RGGA 1N3QA 3N9NA 4NOTA 4AFAA 2XXZA 2V4VA 1WW5A 4XETA 1YFXA 1ENXA 1LULA 3V64A 4D7TA 2WLQA 3VBHB 3C8XA 3N9QA 2YU2A 3IMNA 4NAMA 4NE9A 2Q8OA 1HB2A 4JRLA 2YV8A 3CIHA 1N1VA 3TOJA 4CDWA 4QM9A 5A3PA 4YPJA 1QY4A 1H30A 1UYZA 2FMYA 1QQP2 4JGYA 1EV12 3VBFC 2BZDA 3T3YA 3NJZA 3LSDA 2RG4A 1BYHA 1DCSA 4AVVA 4QAWA 2HEWF 3DV8A 4AFDA 1U5IA 5HCAA 3WXPA 4A3ZA 3ZIXA 1XNTA 2HWE2 5A3NA 3A7QA 2AEYA 2JB4A 4Z2AA 5J7MA 4BQ1A 2HWF2 1EAH1 2YU1A 5K0UC 4GJYA 3MHZA 1HQLA 3V0BA 3RNSA 4WVWA 1IS3A 4YW5A 1DYPA 5CFDB 3O1OA 5A1AA 5KR7A 5HV0A 5IVJA 2XKOA 4Q0VA 4OI1A 3OGGA 2BFUL 3WCSA 1UZYA 5L73A 5A7WA 1VBE1 3WP3A 5IK4A 2BNMA 4QQPA 5JOZA 5C7GA 3ZXFA 1UXXX 5A7OA 1UMHA 1EYBA 4P08A 4D69A 1BHGA 4EWDA 3LCPA 3LDRA 3MW2A 4OUSA 3ZYPA 1HDKA 1NY71 1FMD2 1QQP3 5C4WC 1EV13 1MVQA 4Y5TA 5IFPA 3IIIA 2WT2A 2WZR1 5FBJA 1GP4A 1PZ7A 2RMU1 2WAAA 4C1XA 4SBVA 3AVRA 1OOPA 2A75A 2VU9A 2ZTNA 2VCCA 4CEYC 1CVNA 1XYNA 2HWE3 4QWNA 1Y43B 2HWF3 5C3QA 1GKBA 4QKBA 4NPMA 3LKJA 1ZRRA 5FYCA 5F37A 5LASA 5FZGA 3U37A 5K8SA 4XJUA 1ZX5A 3M8LA 4BMEA 1O7FA 2HYXA 2H0VA 3VBRA 4CU7A 2P3JA 4B4QA 2QZ3A 2ZACA 4A6SA 3QBQA 3TEWA 3ZSLA 1GNHA 2EXKA 3KVAA 1X8EA 1Z7S2 2DWRA 4EN8B 1ZVFA 3D0JA 2TBVA 2VQTA 1KDKA 4XCAA 4XE9A 4YM0A 3VDBA 5EXOA 4JTOA 2IVIB 2X8KA 1FOD1 2WAOA 3IDBB 4GMP0 4Y22A 1FMD3 2D3PA 1S0DA 4N53B 4AI8A 4Q2FA 1XSRA 1R1A2 2DVAA 3B9CA 1QXRA 1VP6A 3RYPA 1TVGA 4YZ2A 1ACCA 3I7DA 4WM8B 3HT2A 1LOBA 2Z2SB 2VUCA 2E7AA 4FTBA 2V5DA 3H1YA 4KL1A 4CCOA 4IETA 1GQGA 4QXCA 4NROA 3ZO0B 4ET7A 3BOPA 4RYDA 2VOKA 5DZEA 5A1LA 4GB32 3ATGA 4Q4W2 4BLJA 3N7JA 3T30A 3QACA 1O3RA 3IB3A 5FKCA 1LGBA 3I8TA 2WFPA 4FAHA 1ZYBA 3Q9OA 4IEOA 1Y7BA 3ZYBA 2WWJA 4HK8A 1OQDA 1Z7S3 1XNBA 2V72A 4QB1A 4YVWA 3AYEA 2F4LA 2P2KA 5JVVA 1FT9A 4WBBA 2WS92 5FOBB 1B35B 3ZYRA 3I54A 4N43B 2CU5A 2W1WA 1OD3A 3HR9A 1R1A3 4Y5SA 3SH3A 3ZXEA 2VULA 4LEJA 2JICA 5DZFA 2VZSA 4XFCA 4E9KA 4ES9A 1DFQA 4BA6A 4CDQA 4EV0A 1U5YA 4GJZA 3HOBA 4FT8A 3P3PA 1Y9GA 2VMGA 1HXS1 3RZGA 1NE4A 3OUHA 4HT1T 2JIGA 3ZXKA 1UPIA 3TEYA 3ALQA 1G9BA 3WW2A 2TUNA 2RS52 2D6NA 4GB33 4Q4W3 2YUEA 3J26N 3B00A 1BJQA 1IGOA 3HAGA 3NRUA 3DN7A 5F5CA 2VGDA 5F8PA 3RJ2X 3BTYA 1QIQA 1W6PB 1UU4A 3JD71 2ZHNA 4ASKA 3V56A 3PUHA 2WS93 4BK4A 2HBUA 4BOWA 4IL7A 2RJKA 1UYXA 1V6NA 4MOAA 4XF3A 1MZEA 2ETEA 2R071 1S0JA 3ES1A 5JIAA 5A6YA 2W91A 5CG8A 2QDNA 4I0AA 4EWEA 2QDRA 2VW0A 1LNSA 2PHWA 3ILRA 4QU1A 2PQSA 5GLVA 1ZM1A 3LEMA 5FYTA 2VVEA 2C5DA 2RS53 3ZYHA 3MIFA 2BJSA 3LA2A 2W08A 1KEXA 2EAAA 1QJY2 3I2JA 5FO7B 4CUGA 5FWJA 3OOXA 4BJ0A 3AP6A 3GCWA 2ZS6B 1PVC2 2RS31 4M3CA 1X82A 3WW3A 2WO3A 2YFZA 2AUYA 2HH9A 3DYPA 1H9PA 2ZGLA 1PZ9A 3AVSA 3RGBA 5IHRA 5F1RA 3FFQA 3I3BA 1ODMA 4META 2VMHA 3HIFA 3ES4A 2JJ6A 1PGL1 2XLGA 2C24A 3NAPA 1HB3A 3QCWA 4MXWB 3VD4A 5KBFA 1O4YA 1A3KA 2UYBA 3EXUA 1N3OA 1PNGA 4LLFA 3VZMA 3QD6A 2VE1A 1RMU2 1DP0A 1V00A 1HRV1 4NUBA 1SLBA 1IS6A 1LB2A 3A23A 4LA2A 1QJY3 2G19A 1AL21 1K3IA 5TSWA 1CIYA 1RITA 1LHVA 1PVC3 1UNBA 5G04L 4Q27A 3FL7A 4V2VA 1VIWB 5I93A 1VMHA 1W9WA 2X05A 1YI7A 4QX8A 3O1MA 1RUJ2 1W2OA 5BNNB 4ZS2A 3MZHA 3VL9A 3RSJA 1W6NA 2XQXA 5FYZA 4MGIE 2NMOA 4KG8A 1C3HA 2EIBA 4NIGA 1ZBE1 4LHNA 2H0BA 2IC1A 4R9AA 2PAEA 1VBC2 2P17A 3RYRA 1F9KA 5KXDA 4FXKB 2NMNA 2DCJA 4XZUG 4Z2WA 2LM3A 2YBKA 2HWD1 1OHFA 1RMU3 3LOBA 3RZHA 3WNLA 2CWSA 1CX1A 1J58A 4MGKE 1OA4A 3K48A 4LBJA 5C9AC 1SZBA 5DAWA 2Z42A 3NL1A 4ZXKA 1XYPA 4NN0A 1PK6A 1VB4A 3ACLA 2CGNA 5D8AB 1KGYA 4I0WB 4LIUA 3S7EA 3SEPA 3ME2A 1DYKA 3WQBA 5BXXA 4GA9A 3NNGA 3FHIB 2VNOA 1G7YA 1RUJ3 3ABZA 3ON7A 2P1BA 4XF1A 1H0BA 5C9AB 5LA0A 4JV4A 2X5IB 4K20A 2FDKA 1YJKA 5IK7A 3H7JA 1CAVA 3H9AA 3R05A 3D6EA 1VBC3 4GKXA 4HMZA 1ULPA 4QX1A 1W9FA 2J1AA 5FQ0B 2ZXQA 5EJZB 5F6KA 5IW0A 1MS4A 1GANA 3ZFGB 3JBG1 4AHYA 4D7YA 1YQ5A 5I91A 1KJLA 2DURA 1BMV1 2A6XA 1QOSA 1UMIA 5F2WA 4M0HA 1L7LA 1G86A 4QX2A 3VDDA 4FOWA 5GZGA 1BCXA 3RZKA 4M4RA 1UIJA 5F5AA 2X09A 3KWVA 1VE0A 4BYYA 1KDMA 2ZX3A 3N36A 4S2FA 3QOPA 4V2WA 1YQ6A 4ASLA 2AC1A 3I2IA 2IXCA 1JYCA 5T55A 2BFUS 3RZLA 1H6YA 3AJYA 2ZEXA 2YB7A 4AVTA 1XU1A 3VZLA 1BVVA 1RUH1 3VBSC 4MSVA 2W47A 1H4HA 2NLRA 3GALA 5FRAA 3VHPA 3HJRA 1QQP1 3C7OA 3AZVA 4DEVA 3K51A 1JYWA 1V70A 4XDOA 1S1AA 3LD8A 3I97A 2Q0AA 4AK3A 3VKLA 2VJXA 2ZX0A 5LRRA 4JKLA 1UY4A 1DDLA 4QHBA 2OZJA 1S0GA 3GNEA 4XUNA 3SHRA 1MZ6A 5BNOB 3POEA 3POFA 4GH4C 2HWE1 2RHPA 3O1PA 1TQ5A 1RUD2 2E6VA 3K4DA 2EICA 3HD8B 2VNRA 3M3QA 3Q8FA 5C8CA 1BEV2 2Y38A 4CXYA 1ND2B 1AR82 2ZAHA 1JZ5A 3PUIA 1Y9QA 4XDQA 5D8AC 4IE6A 4W6XA 4RFT0 4H3WA 4LBOA 4LKDA 5FLJA 4M0NA 2E31A 3SEEA 4IEVA 4Q0QA 1JS9A 1WCDJ 4XDPA 3KSCA 3WLUA 1GOHA 2GZWA 1DHKB 1TE1B 3LDBA 3NMBA 3OUJA 4JKMA 4YZ1A 3WF2A 3R6SA 5J96B 2VQ0A 3MIHA 2FDFA 1VAKA 1CZVA 1NA1B 2XJTA 2Q8EA 4O9GA 2WO7A 2WQZC 2VTXJ 1UO9A 3NNFA 4BZ4A 2WNVA 3SCHA 2BRTA 1LHWA 1YCIA 2P34A 2RDNA 2GNMA 2OUHA 3MIGA 2R16A 1PMJX 1EPZA 1I3HA 2PHTA 3WG3A 4ISQA 5CFCA 3PNAA 1RUD3 1YO8A 3Q8CA 3WCRA 3MDPA 1WMFA 1BEV3 1YNAA 3LIHA 2RDQA 3MW4A 1AR83 2ADEA 1HRI2 2OYZA 3SKVA 1H8VA 3ZMOA 3CJXA 4AEMA 5BNPA 1W6OB 3Q8BA 2AZ5A 4CXXA 1BZWA 1W6MB 2YGMA 2D6KA 4LITA 2QZ2A 3VKNA 3H8RA 2HBTA 4DY3A 4XILA 1HQNA 3AP9A 2DFBA 2OT7A 4UXAA 5DDJ2 1UW8A 2AACA 1WLDA 2PHLA 1W9TA 3AFKA 3B3QE 3FLPA 3LOIA 3LQCA 4FCAA 1QMJA 4ISRA 4Y20A 2QCSB 1OD5A 1I5PA 4D0QA 1R1A1 2C26A 4BMBA 4R9DA 3AFGA 3C2UA 3OCPA 3X29B 4LTAA 4HVOA 5F32A 4P14A 2PHUA 4CP9B 4ZZ5A 5L7OB 2HKXA 3AXDA 4O9EA 4S2DA 4CZSA 4Z8BA 1A8DA 2W46A 3S30A 3WP5A 4Q4W1 2LALA 1FNYA 1ND2C 1UWWA 2VBPA 2BGOA 3PIGA 4LO6B 1PMIA 3OGSA 2JECA 4QPGC 5DPNA 2P3IA 2E7TA 1HRI3 3MF6A 4W8JA 3MIBA 5F3CA 3FN9A 5EQUA 2H6BA 3ZFEB 5FPXA 4UI9L 1IPJA 1GZTA 4INDA 1PHMA 4XJZA 1OQEA 4KWUA 4CPBD 4NIHA 3D82A 2JDAA 1CAUB 2W0XA 4RN5A 5DDJ3 3WP4A 4YVSB 2RDSA 2ZGNA 5A3UA 1AXKA 1JHNA 5K9YA 4BM8A 1GNZA 1YHFA 2DBNA 4Y4RA 3SH4A 2HYKA 4AI3A 3C7HA 4IUGA 1C8M2 4XFHA 1F5FA 1QKQA 2YC4A 2A6ZA 4D6RA 1A34A 1DIWA 1QF3A 4W6WA 5E6HA 3RQ0A 2WINB 4Z07A 3VBOC 4BQXA 3KCCA 1REFA 1X9PA 4LO8A 4AZZA 4ONUA 2RS51 4O65A 1KQRA 4R9CA 2FDHA 1V6JA 4BQWA 3N4MA 1XQNA 2B7YA 3GDBA 3PU3A 5FP8A 5FZAA 1RUI2 1S2BA 3MLLA 4CCMA 4C0HA 3UV9A 3SCGA 1I6XA 3O0XA 1JYVA 2XJUA 2LW8A 4UBHA 1A78A 5F3IA 1S0IA 4E4DX 2ZPXA 5IATA 2ID4A 1NZCA 2F4PA 1UD1A 1O3SA 2JKXA 4IEUA 1WD4A 1LOFA 3ENRA 1X36A 3RDIA 2IFWA 4XFBA 4RSUA 3OGRA 4MGYE 3RI9A 4EJRA 5F7UA 4F7ZA 5AC92 4LOTA 5L19A 1OFNA 1C8M3 4V1PA 4E8DA 2Q5TA 5L7OC 1CR7A 3EB7A 4Q4V3 4RS5A 4DPNA 1NAEA 2ZKNA 1H1MA 1LEDA 2WC2A 4AGGA 1XE8A 3HQXA 4UT5A 3DYMA 1QJY1 1SCRA 4H7MA 5JOXA 1AX0A 2WA3A 5FZ1A 4PDWB 3ZFEC 1PVC1 2V09A 2D6LX 2WR9A 3AXEA 1F8VA 5JMOA 2FBEA 3UK9A 4IXLA 2E63A 3OG2A 2C9AA 4MH0E 4YM1A 1T6GC 3WW1A 3ZSEA 4YYOA 4CU8A 1JODA 4OMDA 1I9RA 5IAVA 1V0AA 3T0AA 5A6XA 2W94A 3I3EA 1NT0A 1ZBA2 1DGRA 3LFMA 4FI9A 4P9GA 4C1WA 1BLZA 3DKWA 1SFNA 4XURA 1G9CA 1SLAA 2Y26A 2GN7A 2JDZA 3FWEA 1DZTA 4Y26A 5I0TA 2OKXA 5AC93 3V0BB 3BALA 2FZ2A 1UOBA 3LB9A 2GMEA 4NHLA 2FDIA 1WWYA 4IEQA 3WDVA 5C6CA 1RMU1 5KWRA 5AVPA 1XPWA 3QH7A 4URAA 2OIIA 3DUIA 4MO3M 1NCRA 2ZX2A 3M3CA 1XE7A 1LOEA 1F5JA 1LOGA 3N3HA 1SACA 2XUMA 1VALA 3IN9A 3MICA 5FTTC 4ARYA 1SQ4A 3IM0A 3OTFA 4XAEA 5F5QA 1WMXA 2KD7A 3FX3A 1W90A 3OY8B 4JRAA 4LULA 3VBUB 4TZDA 4RQPB 4HANA 5KHKA 1COV2 1RUG2 4HBNA 3V0AB 4RR3B 1PM7A 3NV4A 1BQPA 2K9ZA 5GALA 1RUJ1 2DCKA 2O0OA 1LOAA 1W3XA 1AYM2 4LO4B 1UX7A 2CAUA 1BXHA 2D5HA 3BN6A 1ZBA3 4XBNA 4NHYA 2WFF1 1K5JA 2JB8A 1W06A 2GMMA 1DZQA 2EA7A 1ASJ2 5DUWA 1RHI2 5JPNB 4LK6A 2ET1A 4JCKA 3GF6A 2WQ4A 1NYWA 4BIFA 4DQAA 3HQRA 2CYFA 4DNYA 4I01A 1LCLA 1DG6A 4QHOA 1O3TA 3FZ3A 4DZGA 2ZHLA 2JXAA 4FQZA 2A3XA 4LUMA 4PT6A 1WBLA 4BU2A 1RUF2 1OUXA 1W8UA 3LPFA 5ERLA 4PDWC 3PMEA 4JGYC 5EP9A 5ACA2 4PLOA 1COV3 1RUG3 2XONA 1MQTB 2ZGSA 4DMIA 5EIYB 4FTSA 4X6QB 2X10A 4FPFA 3KV6A 5FK7A 4J1WA 1HKDA 1JW6A 4YW7A 1FAYA 2ZZQA 1WA4A 1AYM3 5A32B 3LWCA 4HPKA 2ZEYA 3LZZA 3MIEA 1TME3 4MYEA 3BGAA 3ZFFB 1NCQB 1FPN2 1NOVA 2ZX4A 3OPZA 2NQYA 3VN4A 1RHI3 2B9VA 3B7MA 4DRVA 3IDAA 2ZA9A 3VLBB 4YZ5A 2ZHMA 4JGZB 3C3VA 1VJ2A 1PGW2 2D6PA 5IVCA 1UZVA 3RMXA 2VM9A 3IBMA 4YLZA 3POBA 4A6OA 1RUF3 3PLQA 4PQ9A 4JHZA 1C1LA 1AHSA 3U4XA 3GZAA 4YG0A 2ARXA 2OQ6A 2FHRA 2XJRA 5KHHA 3H7YA 1E5IA 3S7IA 1RUOA 3K3NA 5HXVA 1REDA 4NJ4A 2CY6A 3WD5A 3CLPA 4NAOA 4CDUA 2VD7A 3VBFB 5C8WA 1XNDA 2XR4A 2A3WA 1HN1A 5BUVA 3AMPA 3USUB 2YPJA 4Q26A 1MZ5A 3WW4A 3KT1A 4QX7A 3VBRC 4WM7A 3HN1A 2RE9A 4UBGA 4C90A 1LU1A 1N1YA 4XVHA 2VAUA 4CP0A 2BPA2 4K1ZA 4KH9A 1UY2A 1N47A 4PHZA 1DQ6A 1MPXA 5FY1A 1ENSA 5K0UB 3PVOA 3CEWA 4XF9A 1RUD1 3ZVXA 4AE2A 3BTAA 5KXCA 2Y64A 3DECA 5EYYA 3WDXA 5JLVA 4NR1A 4CCNA 2ERFA 4IV3B 3KGZA 1Q43A 3OGVA 1AR81 1GFF2 1XRUA 2VG9A 4YG3A 4AI0A 1MQTC 2ZKLA 2X29A 3MFAA 2UURA 1RIRA 3IPVA 2XG3A 3H8OA 4TLFA 4MG2A 1FYUA 3POIA 4L11A 2ZBJA 3IWZA 4HXCA 1F35A 5A7SA 2D3SA 1CQ9A 4UFJA 3VL8A 1NCQC 5CISA 1F15A 1APNA 2W92A 4QMAA 4AL9A 4HSJA 2VNGA 4LO5B 3UJQA 2N7GA 1AR92 1VBB1 4XPVA 4AVAA 1GICA 1YYNA 2BOJA 3K2OA 3RMYA 2RM22 4JQRA 4L0PA 4IE7A 4YVWC 1WBFA 2OUJA 5DUVA 1YLLA 1K5MA 1JZ6A 1I5ZA 4JX0A 4HFSA 4AAXA 2GSYA 3DF0A 5DN2A 4QD2A 1HRI1 2JG8B 3CMGA 1S55A 4KG0A 5FZEA 1O5UA 1JH5A 3KT7A 4N7IA 1ZZBA 4ZXEA 5I0SA 2PXJA 3FMGA 2WWSA 1HB4A 3JZVA 2P3KA 3S5QA 3I59A 1VMJA 1BK1A 2HEVF 1U0AA 2PHXA 3CL1A 3JCIA 4WVMB 3MLKA 4XIOA 4CDQC 1OURA 1J3PA 3HQUA 3PUAA 3O1UA 1N1SA 3GBFA 5DDJ1 5HV4A 5FK8A 2JKBA 3POYA 1OPMA 2EXHA 4Y33A 4TXWA 1WA6X 4FPJA 1DLCA 3PMSA 4GIQA 1SHWB 5FP3A 4YGBA 1AR93 1TZOA 5LW9A 4CXWA 1BBT2 1G8WA 4E2GA 2VZRA 2RM23 1KS5A 2XHKA 5CAZA 2RJ2A 4IV3C 3ST7A 1VPHA 2BDRA 2ZGQA 4PF1A 1WCSA 4XEZA 1UQXA 5JZGB 3CJIA 1TMF2 2OXBA 1HX6A 2QQKA 4X8NA 2C4XA 3AM2A 4CEWA 1CWPA 3DGTA 3DPRA 2CDOA 5FO9B 3I3DA 4IV1A 2P6HA 5BYNA 1UOGA 1RL3A 1XYOA 4XOGA 1LODA 1IPKA 2WBKA 2XJSA 2WUHA 4PJYA 1VRBA 3MGUA 4Q8KA 2XBO2 1WMDA 3ETQA 1S0EA 4X8PA 3BIWE 3BYWA 1W05A 5FLHA 3TB0A 5A3LA 4XJAA 2ZGOA 4AXOA 2QE3A 4P9XA 4LLOA 2HWC2 5KC6A 1RINA 2R062 4XFGA 2OZ6A 3HBKA 3PVEA 4YW2A 1XC6A 1IPSA 4UFMA 5JWPA 5FZKA 3ACFA 1YQ8A 1EPWA 3RG0A 1BBT3 5D1IA 5E8AA 1YUDA 3WDTA 3D5OA 3GZUC 3B94A 3K75B 1ONAA 5FY4A 3ZIWA 2BV4A 5K7PA 3AX4A 2JG8C 1TMF3 1QXJA 1Q5OA 1RUI1 4KGQA 4QDSA 1Y9MA 1XB9A 3H3LA 5CA6A 1F4AA 1O8PA 4W6YA 2D98A 2A5ZA 4Y5Z0 1F2NA 1K45A 1YXWA 2W2IA 4D6QA 1ZREA 5JOWA 4AVBA 4MGQA 2B4KA 2RDRA 2Z4FA 4ZPIA 1VRH2 2XBO3 1OLME 2VECA 3TWIA 2AGSA 5FMCA 2HWC3 4QPYA 2R063 3UGGA 5A6ZA 2R6QA 3UESA 1GYKA 3J7LA 4TSVA 4RD7A 2WYFA 3IDEA 1PIV2 2WIIB 3H42B 2DV9A 3M7AA 3WG1A 4COWA 1QJEA 2LROA 1H2MA 5JZGC 5LEJA 2CHHA 1QGLA 4FOQA 3P3NA 3WHUA 2J1UA 3JQXA 4MX3A 2WDBA 4QQOA 4FOYA 1OUSA 3OPWA 2WZPP 4XHXA 4IE5A 2D93A 4IGOA 4GAZA 5H9QA 4PIYA 2RS12 3AC0A 1YWKA 4P5YA 4EE2A 2BUKA 1XBFA 3WDUA 4E4SA 2XH6A 5FYBA 1W0PA 4N9HA 4N7UA 2JE9A 4YW4A 1SBEA 4YW6A 3WSOA 1TNRA 2PLV2 1VRH3 4MGZE 4MVTA 3OYWB 1NKGA 1R64A 3LA3A 3WVJA 5L36A 4OHWA 2NZ9A 4LKEA 1V6KA 1C57A 1PK6C 2Z5WA 2J1TA 3RS6A 4I3PA 5DG1A 1H9WA 1UL9A 1DGLA 5FOJB 1RUE3 1UKGA 1PIV3 2IZWA 4LORA 3ZXLA 3RPQA 1QJU2 1VAMA 3NV2A 1US3A 2ADDA 3P5BA 1DGRN 3E5QA 4K21A 2XUEA 1SPPA 2JIJA 2OS2A 2JE7A 2ZGUA 1F4HA 1GOFA 1CAXA 1H8TA 4OZOA 3BU7A 1ULCA 3WOGA 1IKQA 5ABJB 1COV1 1RUG1 3GHMA 4BQ2A 1YRZA 2WZ8A 4P02B 1CAWB 5J48A 5FPAA 2RS13 4XUQA 1LKNA 2VOTA 2DF7A 5DAXA 1AYM1 5CADA 1ND3A 4O7XA 2JG9B 2NM1A 5GZEA 3VDDC 2PLV3 3BB6A 3I2OA 5HBAA 4XFAA 1ASJ1 1O4ZA 4ZS3A 3W59A 1RHI1 2D7FA 3FBYA 4YWAA 3TNPB 1AYN2 1MEC2 3H1WA 3KCYA 1W8OA 5KHIA 4JDNA 3H8UA 3O0WA 5CBLA 5LBEA 3WY6A 1VMFA 1OA3A 2ATFA 1UZ0A 1G9FA 1QJU3 1RYYA 3EMRA 1DQ0A 2WN2A 5CU1A 3R4UA 2E9QA 5G05L 4U2AA 4M00A 3NKTA 2B8MA 4EN9B 5ACA1 4RGAA 1J1TA 1WCQA 1VBA2 4YM2A 4BIOA 4ZKTB 3VZOA 4QXKA 5J37A 4QM8A 2ARAA 4QDQA 3LGRA 3B01A 1JBCA 4AEDB 2VO5A 3OD4A 3KHBA 2DTYA 1QXPA 2UU8A 3AKQA 5I8SA 4XMAA 3ZKUA 4LKSA 4CDXA 3UNPA 5C4WA 1D0GA 1LTEA 4M3CF 2D44A 3LDKA 2BVVA 3HT1A 4K9SA 3H50A 1FPN1 2AYHA 1M4WA 4UAPA 5T50A 3M1HA 3G7DA 2B42B 1E5HA 1W8WA 1AYN3 1MEC3 3ZR6A 4CEYA 4CCKA 4AYUA 1AJKA 4BPZA 1PVXA 2J1RA 3ZYJB 3WNMA 1CD3G 1MS3A 4B7KA 5FP7A 4GMP1 4DEQA 1OXCA 1Z78A 1VBA3 1YQCA 5ABJC 3VBHA 3W5NA 1RGSA 2WKKA 1RXFA 1YQ2A 1LJ7A 1X50A 2WNVC 4QB2A 2JENA 4IE4A 4QPIB 2ZGPA 3WDYA 2ET7A 3ZPYA 4Y1VA 1UKRA 5JDBA 4P9LA 3U11A 3VBSB 2JG9C 3J8F2 3ZM8A 4XFFA 5LB6A 1ZZ7A 2OVUA 5CYYA 4AI2A 2QUOA 5DZGA 4ZY9A 4DXSA 1A8MA 1G9DA 3PDQA 2XLFA 3ZN6B 1MACA 4OZXA 3W20A 4JHTA 1U5ZA 4WZFA 5BNPC 3MV11 5DG2A 2XGXA 3NV1A 1Q8SA 1UY0A 3AKPA 2XL7A 4GH4B 4A7ZA 1SBDA 3VKOA 4DUWA 2VZPA 1JU4A 2P37A 2Q4SA 3E6BA 4UFLA 1NZIA 5FREA 5CFDA 3NNMA 4UF0B 3D3AA 1W9YA 4WZCA 4LKFA 4NHKA 2MHFA 4XJ8A 4K6BA 3A21A 1GUIA 3IAPA 4PIXA 4AEDC 2GAUA 2FQPA 4JVAA 4Q4X2 3WNNA 4A2UA 1UOJA 2VMEA 2C9KA 3J8F3 3PTRB 4LOSA 4Y1ZA 3FUQA 5FBZA 3TN92 3FUOA 2VXRA 4XQWA 1UY3A 4Y4YA 3WX5A 4B4RA 4BHPA 2P3YA 4EN0A 3O7OA 1NUKA 3R4DB 1JXNA 2MEV3 1W28A 4BXFA 2XJQA 1NXD1 4AQ6A 1XXNA 5T52A 2ZMLA 1S2EA 1RXGA 2O8QA 4U36A 1QOTA 4Q0UA 4AF9A 4QKNA 3AZXA 2PN5A 3T4VA 3BUCA 2YC2A 3ZXDA 2VZ1A 5BPXA 2D97A 1WCUA 3VD7A 4A7KA 5FYUA 4RL7A 1Z0HA 4LQRA 1W8HA 2DYCA 1G6NA 4FPCA 5LBFA 5JAXA 4QPIC 2A70A 2X53S 3OBAA 4XIKA 4L92A 3W21A 5FIXA 4Q4X3 2LS6A 2I45A 2A7AA 3DXUA 5IWFA 3CNAA 3UT0A 1YJLA 1HV1A 1DLLA 2VPVA 4KBZA 4IEPA 3TN93 1EV11 4OI2A 4N53A 4BQ3A 3PUQA 5DQ0A 2D5FA 4UFIA 3TEXA 5DUUA 4UOJA 4ITCA 4WM8A 5L9VA 2IVJA 2R1DA 2DTWA 2QNKA 2R7EB 2YC0A 2L9LA 2R0HA 3E6DA 2HWF1 1BBT1 2D43A 2WO2A 3N7LA 2CTVA 1X33A 4QPGB 2GN3A 1TMF1 2YGLA 5LBCA 1E5SA 1OVPA 1PO12 4Q5OA 2WNOA 3AKTA 2VUJA 4OI4A 3VV1A 1FXZA 2XL9A 1GP5A 3SISA 1DU3D 2WT1A 4HN0A 4G4FA 1AR62 3I49A 5FY7A 2WSVA 4RS5C 5FY8A 1JYIA 1B35A 1FMD1 3N9LA 3A22A 4N43A 1UN1A 5DABA 4YM3A 2XBO1 1PZ8A 1OLMA 5FZ0A 2Y0IA 2AENA 2G1MA 3I3QA 4MXVA 3BU0A 2F17A 1QJZA 2BOIA 2HWC1 2R061 3MLJA 3ZSMA 5FXVA 3A4UA 3P6BA 1Y3TA 1H1AA 3S57A 2WN3A 4NRMA 3LF7A 3VBOB 2J7MA 1DGWX 1ST8A 5HPOA 1LGNA 4GZ9A 4JC1A 5FZOB 4C8DA 5IVFA 4GD4A 1T2XA 2GP5A 3SMHA 3PVBB 3BOWA 2I2SA 4LBQB 3V65A 3O5SA 1PO13 1SDDB 2JX9A 2JDUA 2LUWA 1W8NA 3AB0A 3O1SA 4FPLA 1Z7S1 2YFUA 5I8TA 1W6PA 3LEKA 5C71A 4GXLA 3ZKYA 1OT5A 4Q4Y2 1AR63 3KF3A 4K8RB 4ZHNA 3SH5A 2YBPA 2DVGA 5ISLA 3BIEA 1W2TA 2F6BA 4YGCA 2VQUA 2WNUB 1NCRC 1VRH1 2UWAA 4CUAA 4F8AA 1VAVA 2AREA 3BPZA 2G4IA 2VUAA 4FFIA 4J25A 1CESA 3AL6A 1NQDA 4YZ4A 2R0FA 4QT6A 4Y1UA 4OQ8A 2VMFA 4OI0A 3TBDA 1MS1A 2D40A 1T6BX 2DUOA 5JXIA 2I07B 4GB31 3POGA 5D21A 3ZLIA 4OLLA 5FPBA 1Q8PA 2GH2A 2ZEZA 1US2A 2NP0A 5AFEA 3NNLA 3JB4C 4XACA 5A33B 3VZNA 4NWWA 1OLRA 1XSQA 3O14A 2B39A 5FZHA 1GZWB 2A71A 4BH9A 3TNQA 1POV0 1KFXL 1ULOA 1XNCA 4QQLA 4Q4Y3 5KC5A 2WS91 3AP5A 4BK5A 4XFIA 1FNZA 2WYSA 3VKFC 3WV6A 2G9GA 4ZU5A 1YIPA 3USSA 2PLV1 2Y34A 1EAH2 1NG0A 4HKOA 5A1FA 2EIGA 4I09A 4A41A 2FD8A 2GU9A 4MXWA 2Y60A 4I02A 1RC6A 3JU9A 2D6MA 4YNIA 3M3IA 5GZDA 5J09A 2E32A 3GZEA 3I2HA 4LA3A 4Q4V2 3WNXA 4TLGA 3RVHA 2DU1A 3B69A 2MNGA 3RWNA 4CCJA 3BKZA 3ILFA 2Y6GA 1W39A 2VMIA 4IQPA 2FZ1A 3LFIA 5B4XA 2QQOA 4D6SA 1JYXA 3B5LB 4CP2A 2VZVA 4EWAA 1PM4A 2BYVE 3AP4A 1QWRA 3FLRA 3THCA 1WW7A 2RMU2 2VTXA 4AGRA 2QBXA 4E4HA 3CDZB 2FCTA 2ORZA 4SLIA 5BNNA 4FPOB 4ZONA 3BTXA 1AL0G 1H2LA 1UU5A 1O59A 3QLQA 3IZOA 5E16A 1YFWA 2WNUC 4QXHA 5EPAA 1RB8G 5T3NA 1CONA 1EAH3 2B5HA 2R49A 3INAA 1JI6A 3FHQA 1S2KA 1KITA 2ZHKA 1Q8VA 1BKZA 1UIKA 4LBMA 3OEAA 3W5MA 1A6CA 1AYN1 1NE6A 3ECQA 1ZZ8A 1J59A 5J36A 2HJIA 2D6OX 4D94A 2ILMA 3AL5A 4Q0SA 2A3YA 4CDWB 1F31A 5C33A 3O1TA 4GKYA 4AHWA 4IEWA 2VZQA 1JZ7A 4XQDA 2AEZA 1HLCA 2IWGB 3J7HA 4JGYB 4I3GA 1VBA1 2WO1A 4L8QA 1OA2A 4Z82A 5D8AA 3U78A 2WL1A 4CDUC 5IT6A 2RMU3 3N9PA 2GNDA 2MPFA 2Q30A 3RRDA 4DRRA 2J1EA 3WR0A 4WM7C 5EYXA 1SEFA 1WUVA 5C9AA 4A45A 2R32A 4HLTA 4ARXA 2X5IA 4CPBA 2UY9A 4XF0A 5JR7B 4HONA 4CCLA 1QJFA 2NPIA 2CV6A 2FCVA 1ULGA 1W8FA 2XOMA 3ACIA 5FQ0A 2CDPA 1R1ZA 3CZUA 3NW4A 4MADA 5IYYA 2VQAA 3PIJA 4X6RB 3PVNA 4FPEA 4J1XA 3BCWA 3ZFGA 4Y3OA 3ZSJA 4CU6A 2YY1A 4QU2A 5FYHA 5A7WB 1K42A 5CB7A 4HZFA 2PFWA 3MEPA 4LBQD 4XAAA 3WQ7A 2DVFA 3T1LA 1JN2P 1FOD3 2JDYA 4FAGA 4NWVA 3AYDA 4NVPA 3AZWA 3I2GA 5FP4A 4PLNA 4N9IA 4KI5M 5FMBA 1C5HA 1W6QA 4TWTA 1V6IA 4JAAA 4ZU4A 3ZYIB 5KXEA 1OOPB 2FMDA 5M0TA 4UW3A 1AXZA 1LEMA 3EJKA 1S4CA 3J8F1 1TME2 3J7NA 5GZFA 1VBC1 1O5LA 4L9BA 1WLTA 2JDHA 5EHDA 3MPPG 2ZGTA 2VY0A 4GWMA 3VBRB 1OMIA 4FO9A 3K46A 3F95A 4UW4A 4W50A 2DDUA 5BNOA 5C3SA 2WZEA 3VGIA 4IEZA 4LO7A 4CDWC 1NXMA 1LHUA 1NLRA 1ZRIA 3D0SA 1SLLA 3H0OA 4RHV2 4HKLA 4Y22B 2IFRA 4ZU7A 1ND2A 3AMMA 5FZMA 2YXSA 5F9TA 3SITA 3KQRA 1SG3A 3U14A 5E89A 4FPHA 3VHRA 4COYA 4CRQA 2QQPA 2JD9A 4D3WA 3T09A 2HLEA 2ZABA 2CGOA 1YFYA 4S2GA 3KV5A 4Q4X1 2VZOA 4QKDA 2E7QA 3KHCA 1HJGA 1NA1A 3DL3A 2BP6A 2K46A 3O0VA 1HXS3 3AZYA 4Q1PA 4W65A 5FMOL 1W2UA 4CA9A 1JU3A 1JZ2A 3T0DA 1AUYA 1WMEA 5K4LA 5HCBA 1W8ZA 3CJIC 4L97A 1L7QA 3ILNA 3WF1A 3KV9A 3S0MA 1LR5A 2ZCWA 4UYBA 1MR5A 5EJ1B 4DUVA 2NYYA 1YI9A 4XUOA 4LBKA 1TNFA 2PHFA 5JUVA 3U0ZA 4NHXA 4KWLA 4I2OA 4YVWB 1BK0A 3KMHA 1HW5A 4IV1C 4QXBA 3THDA 4RHV3 3L2HA 4KU8A 4IEXA 4JKKA 1QDCA 3URFA 3GJAA 1S0BA 2O14A 4IGPA 5FUNA 1NQJA 2VCMA 3WQ1A 1XE0A 2R30A 2W1UA 4HVRA 1W6OA 4NMIA 1WW4A 1HQWA 1W6MA 1OOPC 3A0NA 5FYVA 5FYMA 2DCTA 4LE3A 4QQHA 4OQ9A 1RVF2 4CDQB 5HXMA 5JR2A 4J6GA 5JOYA 4MV2A 3O1VA 3N35A 1H2NA 1OQ1A 2XLAA 4B3NA 1JZ4A 4FVVA 3VZKA 4XCBA 4Q1RA 3HNMA 1JOPA 2WJSA 3E1F1 4KGGA 3VZJA 5BNQA 5C70A 3ACGA 1GNYA 1ZZ9A 2BGPA 1R082 3LA7A 3P1IA 1W0NA 4M3CE 2VR4A 1WLCA 4CP9A 5L7OA 4TTGA 4DB5A 3APBA 4LXLA 1SBFA 1CX4A 1UMZA 1HN0A 1UOFA 2XVKA 2Z69A 4LK7A 5LRSA 1CZSA 1BEV1 1ZA7A 1ZZ6A 4LBLA 2CWMA 5JSOA 2HWB2 2AR6A 4IDZA 5L9BA 1PO11 5JSPA 1ZBE2 3C7GA 3ZFEA 5C3RA 2IXHA 3OJBA 2ZGMA 4F83A 1RVF3 1CAUA 2PYTA 4YVSA 1QOOA 4LNVA 2HWD2 1LENA 2FDJA 4COZA 4A42A 3GXUA 3U4SA 3VHOA 1LU2A 3W58A 4BQ4A 4AFMA 1AL23 3NSTA 3RWKX 1R083 4M3CB 4OFGA 4O61A 3I2FA 3GBGA 2ORXA 4LPLA 5JSRA 1DF0A 2KR2A 2PHRA 1ULFA 2GNTA 4P9IA 1RTVA 3GZTB 1S0CA 5FY0A 1GOGA 1IG0A 4N90A 1MS5A 2HWB3 4PF5A 3WHTA 2QJVA 2XKPA 5GLUA 3CO2A 1ZBE3 5FFOC 2VW2A 1H4GA 4CYDA 3NAPB 4XW3A 3PURA 2QKDA 4OMCA 1MZFA 5LA2A 2Q1MA 1LHNA 4Q4Y1 2CGPA 3KZ4C 4OUEA 3MPBA 3IIAA 2HWD3 2BBAA 3NKGA 4NPLA 4BE3A 1PX3A 1M06G 2ZX1A 5IK8A 2IXKA 2IXIA 4DXRA 3C7FA 2E51A 5IJRA 4EROA 1H8TC 1O3QA 5HCHA 5FZ4A 3SQOA 3VDCA 1WZXA 5JXHA 5L9RA 2QQMA 4QX3A 5E88A 1RUH2 5FUPA 4NRQA 2EAKA 1ND3C 1W6NB 4OHVA 4AOCA 2BEOA 4NIIA 4PDWA 3ASIA 1AZDA 4JQTA 3PJYA 5LEKA 4FBFA 1OBNA 2ZMKA 2G9FA 3JBG3 2PTMA 2E33A 4COUA 3AK0A 5FYYA 3I3MA 4K40A 3RYKA 1EP0A 3SNMA 3WG2A 2JDPA 1D4M2 1C1FA 4XXAA 5GM0A 4A44A 1GBGA 5FZ8A 2Y6JA 3ROUA 5IVYA 4B7EA 3KB5A 1X9TA 4TYSA 1R092 3GYDA 3K4AA 2PHDA 3FHAA 4L2NA 1WGPA 3ZX7A 2VH9A 5IFTA 1W2NA 1C8M1 3R0RA 1ZRFA 1PK6B 3BPSA 1LESA 4Q4V1 4XABA 2BNOA 3EO6A 3KLSA 4Y1XA 1AF9A 1H2KA 1RUH3 3SC7X 5H9SA 3NJYA 3OY8A 3OB8A 3VBUA 4CDXC 4KU7A 5CZKA 4RQPA 3T1MA 1CAVB 1IS4A 3NAPC 3V0AA 4RR3A 5CKMA 4ASMB 1E5RA 2D3RA 3UKVA 2P5BA 5FJHA 3OBZA 4IGQA 1DYOA 2FDGA 5FDBA 1D4M3 2Y0OA 3VDDB 3UGHA 1OKQA 1UY1A 1YC61 1VBD2 4DY5A 5JCTA 5IK5A 1R093 1MS9A 1SFYA 2WLPA 3PUSA 4OVEA 5AC91 2XVLA 5EZWA 2OPWA 2QFEA 3OF1A 3VBHC 2TNFA 1ULEA 4RA0A 1HB1A 3UYJA 5SV8A 5FP9A 1PNFA 1RUE2 5JXGA 3KD4A 2BBVA 1S0FA 1PGSA 3OBRA 1W3VA 5FMDA 2BU9A 4F3JA 4Q8LA 4OCTA 2EXJA 4WVVA 2CNAA 4FFHA 4MUVA 3WG4A 1SFPA 1D2QA 1H6XA 2I74A 1DGWA 4PI2A 1UYYA 1MQTA 3N9MA 4DINB 3BI3A 1QEXA 3T08A 3ZN5A 5ANQA 3PL0A 1GQPA 2PMWB 4BQYA 3POSA 3AYCA 4FPGA 3E5UA 4Y1YA 5A32A 4S2HA 4QDRA 2A6YA 5IVBA 1UZWA 1WKYA 3AMHA 3THPA 1ZBA1 4K1YA 4XXPA 4R8HA 2UWCA 3AJZA 3A0KA 3ZFFA 4BQ5A 5LCWL 1NCQA 1VBD3 2DFCA 3Q8AA 5C8CB 1YEWA 5CFDC 5FZDA 1OI6A 2OX0A 1Q8OA 4FPKA 1WCKA 3WF0A 5FAXA 1KJRA 4PBPA 5D2AA 1U5XA 3FJSA 4JGZA 1OC1A 1OH4A 2QQWA 3ZYGA 1HJFA 4MHRA 2GNBA 3HN3A 2EXIA 1U12A 1ENQA 2J42A 3IKWA 3MFCA 3GM8A 5FR3A 3JXSA 2CAVA 4A3XA 1DBNA 5FZ7A 2WNVB 1D7PM 1AVBA 5IVEA 1IZ3A 1PO22 5H9PA 5DAVA 5JI9A 4E4ZA 3VUOA 5T5LA 3WDWA 4P00B 4EQVA 1J83A 4GULA 1TME1 3FBMA 5CKNA 1UF2C 3CHXA 4QQ2A 5JI7A 3VBFA 5FMOS 5CFCB 3IT8A 5FV3A 3USUA 3EQEA 3KF5A 3VHNA 1C4RA 2QQNA 2LRPA 3UKTA 3ZPOA 4AQ2A 2J1SA 5BNPB 2QQUA 2WA4A 1EY2A 3MF9A 5AVAA 4COVA 1QHDA 3J9SA 4CP1A 5K0UA 2PAMA 2K2SA 4HSLA 4P9WA 4RHV1 1CGPA 1RUF1 4IV3A 4KWKA 5A3TA 1O6UA 2XB6C 4N53C 3JB8A 3HMYA 3KCXA 4KNCA 3HBZA 4Y20B 5FYSA 2IXJA 4HL0A 2B9UA 3NVCA 5FZ6A 4BCUA 4WM8C 3G6JB 2WQ8A 3WF4A 2XJPA 3ZXJA 1PO23 1CJDA 4R52A 2Z79A 5H9RA 2V5YA 2BTVC 4L99A 3LE0A 2YHJA 5C8CC 5F3GA 5I8YA 5F39A 5FZFA 2A6WA 3K4ZA 2C0ZA 3VKMA 1GWMA 3GCXA 4IERA 1REEA 2DVBA 4CTEA 4OHZA 5JXJA 4AVSA 2JWPA 4FFFA 3IMMA 4FFGA 5T5JA 1JUIA 1PGW1 1OSGA 3E5XA 3H8XA 1O91A 1KD7A 2EIEA 3TRSB 1B35C 4N43C 2CSGA 4Z92B 3JUUA 2JG8A 4I0BA 2W9XA 4OYUA 4PLMA 3LPGA 5LBBA 4DO0A 3KS7A 1D4VB 5IAXA 4AVCA 3WNPA 4WVMA 2QQJA 4AI9A 2EALA 1RVF1 2Q1ZB 2B45X 1W0OA 4M01A 3IAQA 4B4PA 5JPMB 2XDVA 3RZMA 3VDAA 1JHJA 1WLWA 1LRHA 3ACHA 5A70A 5CFCC 2P6CA 1AXYA 4BB3A 2VXJA 2XHNA 4G9SB 4YZ3A 5FZLA 2ZEWA 1X7NA 4ATEA 1AX2A 3S5AA 1H1IA 2MEV2 1R081 4N8MA 4EZHA 1UXZA 2A1XA 4XUPA 3WT3A 4QGNA 5KHGA 5T5OA 2XVGA 4IE0A 4XJWA 1FATA 5I0DA 1KS4A 1L3JA 4CE8A 1JYTA 2ENRA 1JUHA 3RZJA 2HWB1 5JZGA 4Z1VA 4YFWA 1W99A 3OUIA 4XYXA 2DU0A 2WFF2 3AZZA 5LK7B 1HV0A 1AX1A 3L9JT 4HG6B 4BXSV 3RZZA 3CF6E 5B4NA 4ATFA 4MHUA 3ORJA 1XNKA 1V9U2 1UAIA 2SBAA 1VR3A 4RS5B 2AH2A 4GWIA 4FOVA 2O8OA 1ZNPA 3CU7A 4KQ7A 1SMVA 1D2SA 4YG6A 2EF6A 3ZXAC 1XU2A 1QJX2 1J3RA 3OSDA 3KVBA 3OD0A 5C3OA 2K0GA
chains in the Genus database with same CATH topology
3OGJA 1AR91 5GKAC 1GQHA 5DUXA 1POV3 1V6LA 4NHMA 2UYAA 2RM21 4OHYA 4PIZA 4KBBA 4AI1A 2PQQA 2XJVA 5KHJA 2UWBA 3D8CA 2WFF3 1QNWA 4GQ7A 4LE4A 1GLHA 2E53A 4G3YC 2OA2A 2YYOA 5J3UA 3UL2A 1V9U3 4URTA 4Q0PA 1GV9A 3NWKA 2XWBB 1NCRB 4BLIA 4P9JA 4XQ4A 1QU0A 1QJX3 1AR72 3MYXA 1DZRA 2WT0A 4WVZA 3TYJA 3M2MA 1C5IA 5FCCA 2BQPA 3IDCB 4AQTA 3NV3A 1C28A 4R4XA 1W6QB 5BNNC 1LECA 1JTZX 3UJOA 5EFUA 2VOVA 3ZN4A 5JMCA 1DQ1A 1LOFC 2HEYF 5A3MA 2PELA 1ENRA 5J98B 3ELNA 3U10A 1IS5A 3E6CC 1D4M1 3WP6A 3MW3A 4IESA 3OYWA 1RUC2 2RR12 4H7LA 1AR73 1R091 4WV8A 2VOXA 2ZZJA 3QH6A 2R042 1SCSA 4YARA 4DFSA 4AEKA 1MS0A 1GZCA 2KXLA 2JD4A 1UX6A 3M3OA 3S6PA 1CJPA 2X5IC 1GZ9A 4HPKB 4XJ9A 5ABJA 2TEPA 2DCYA 1RJ7A 1CAWA 3WUDA 3ZFGC 1IQAA 4JTNA 1VBB2 2JG9A 5FO8B 1Q3EA 1IOAA 4XF4A 3SXWA 1BMV2 1RUC3 1O4TA 5CG9A 2RR13 4XZPA 1VBD1 2H6CA 2GMPA 1WD3A 2R043 5CIRA 4XMIA 3FFZA 3RJRA 1RUE1 2YMZA 1MVEA 1PIV1 3TAYA 5FLIA 4Q29A 4AHXA 4FPYA 1DQ5A 4AG4A 1TEIA 2GC1A 5EWSA 3AYAA 4CDUB 4ES8A 2GH8A 3KGLA 4NO4A 3UKNA 4I30A 3I2DA 4AEDA 2RS11 4A7YA 2PA7A 4WM7B 4HKWA 4YGEA 4AQSA 5BNOC 1VBB3 4OHXA 2NN8A 2W52A 4OULA 2ZAAA 3EBRA 1SLTA 4P9YA 3SCFA 1RUNA 1Q8QA 2WSUA 3FC0A 4AHZA 2RJLA 1VBE2 2CL2A 2VOWA 1OPOA 2ZGRA 4LT5A 3IPVB 3MI8A 4HN1A 1QJU1 3RI8A 1OLQA 1NA1C 1NY72 1ALYA 4MZUA 2V73A 1KXGA 1WW6A 2WZR2 3AMNA 1DQ2A 3POWA 3B9IA 5CNAA 4QPIA 2A73B 2XWJB 2KM2A 1G9AA 4LHKA 1PO21 2BWAA 3VBSA 1ULDA 4JDMA 4YW1A 2ZJCA 3MIDA 2GC0A 3M70A 3NO8A 1K5MB 3E97A 3ZN6A 1YIFA 5GJ6A 1MEC1 1ZA4A 2PAKA 1VBE3 3BODA 4GH4A 5AFBA 2BNNA 3I59B 4AEJA 4QX5A 4C91A 1QDOA 4R9BA 4FP2A 1FOD2 3AKSA 2O1QA 1IHMA 2WZR3 2DUPA 5E1RA 3D4KA 3GHNA 1C8NA 4HETA 4LHLA 4AFCA 3ZMNA 1DQ4A 4ORFA 3GBWA 1J1LA 3HWJA 4QGMA 1UPSA 3M4FA 4LR4A 5HCFA 4FXGB 2GDFA 5HI0A 1FV3A 5GZCA 1SLIA 1ZZCA 3CJIB 2QVSB 3FE5A 4Y24A 1AJOA 5B2GB 1RUI3 1SDWA 2BWCA 4YRDA 1FI2A 4CEWB 3DPRB 1UZZA 2YZ4A 4AFBA 4YGDA 4IV1B 2WNEA 4IEYA 3N7KA 4YVSC 4PBOA 4E27A 4E2SA 2DVDA 4D7SA 2B46X 3U07A 2BW8A 2ZOEB 3PHMA 3N7MA 2R1BA 3THTA 4FQ4A 1LGCA 3WZ1A 1QH7A 4UW5A 5IUQA 1HXS2 3WQ0A 4YFZA 1K5MC 3SLIA 4XBLA 1GSLA 1IKPA 1OFSA 3AMQA 2ARBA 2OPKA 1BVP1 2MEV1 1POV1 1LOCA 5FPZA 3JD72 4K3UA 1D0HA 1KFUL 3H1MA 5LK5A 4GALA 5KXBA 1Q56A 4QPGA 4LBNA 4AW7A 1UU6A 2R072 1FX5A 1CN1A 1QH6A 1MS8A 1CPNA 4XBQA 1RJ8A 3AP7A 1VLNA 2OW4A 1URXA 5DXDA 5F6LB 1V9U1 1CIWA 3TN91 2VVDA 2A6VA 4JDOA 2DUQA 2BVBA 1FV2A 1V6MA 1QJX1 4EN7B 4FSJA 1QNYA 1VB2A 1J3QA 4PCRA 2RS32 5EV7A 5I0UA 1I1EA 4E2QA 4CEWC 3DPRC 4XTMA 3VBOA 4B29A 3LSEA 5GLZA 4C0BA 4HVQA 4NPRA 3JD73 4UW6A 3WINE 5SV5A 3OBTA 3H3ZA 3O12A 4LBQA 1N3PA 5I0RA 2W68A 2KA3A 2R073 2ZMNA 4OUMA 1ZRDA 2W39A 1PGL2 3ZDSA 1N1TA 1SLCA 3H3UA 1ASJ3 4H14A 3ZXGA 4YW3A 1LHOA 2YROA 3L2YA 2WNUA 1HRV2 3EHKA 3PJQA 1X8MA 3I4IA 4AGVA 1AR71 1AL22 1YFUA 3VBUC 1CAXB 5ACA3 2DCZA 4RQPC 5C33A 1H8TB 2GC3A 2RS33 4LUKA 5BY5A 4MLOA 1V6OA 4RR3C 4FTEA 4BWOA 5EJ3A 3WUCA 3JQWA 4EN6B 4R4ZA 3B93A 1UCXA 2C1FA 5JIUA 4DS0A 5GLTA 1ND3B 3ZSKA 1NLSA 4FP3A 5A33A 1GR3A 3B02A 4GWNA 1GZWA 4QGLA 4P5HA 1FPN3 5CVRA 4H55A 1AR61 4B8EA 2EVXA 1E57A 2SLIA 2JEMA 3AKRA 4XHBA 1HRV3 2GALA 2LTNA 3T2TA 1RUC1 1ZRCA 2RR11 3LAGA 3R4SA 2ES3A 4GMP3 4KWJA 5GLWA 5BV6A 1JOJA 1HIXA 2BGCA 2R041 3W9AA 2GC2A 3KT4A 4DXZA 2YDEA 4HK9A 4XTPA 3PTYA 2IXLA 2XPJA 4K7JA 4K8FA 4CDXB 4AWDA 5T5PA 5C4WB 2VVFA 3FLTA 3ZFFC 2UY8A 4DOUA 3JBG2 1CPMA 3KM5A 2ZGKA 3J4UH 1B09A 3M3EA 4CEYB 5T54A 2VW1A 1KRIA 4JGZC 4RGGA 1N3QA 4NOTA 4AFAA 1WW5A 4XETA 1YFXA 1ENXA 1LULA 3V64A 4D7TA 2WLQA 3VBHB 3IMNA 2Q8OA 4JRLA 2YV8A 3TOJA 1N1VA 4CDWA 4QM9A 1QY4A 1H30A 2FMYA 1QQP2 4JGYA 1EV12 3VBFC 3NJZA 3LSDA 1BYHA 4AVVA 2HEWF 3DV8A 4AFDA 1U5IA 5HCAA 3WXPA 3ZIXA 2HWE2 5J7MA 4BQ1A 2HWF2 1EAH1 5K0UC 1HQLA 3V0BA 3RNSA 4WVWA 1IS3A 4YW5A 1DYPA 5CFDB 2XKOA 4Q0VA 4OI1A 3OGGA 2BFUL 3WCSA 1UZYA 5L73A 1VBE1 3WP3A 5IK4A 2BNMA 4QQPA 5JOZA 3ZXFA 1EYBA 4D69A 4EWDA 3LCPA 3MW2A 3ZYPA 4OUSA 1HDKA 1NY71 1FMD2 1QQP3 5C4WC 1EV13 1MVQA 2WT2A 2WZR1 1PZ7A 2RMU1 4C1XA 4SBVA 1OOPA 2A75A 2VU9A 2ZTNA 4CEYC 1CVNA 1XYNA 2HWE3 1Y43B 2HWF3 1GKBA 3LKJA 1ZRRA 5K8SA 4XJUA 1ZX5A 3M8LA 4BMEA 1O7FA 3VBRA 2H0VA 2P3JA 4B4QA 2QZ3A 2ZACA 3QBQA 3ZSLA 1GNHA 2EXKA 1X8EA 1Z7S2 2DWRA 4EN8B 1ZVFA 3D0JA 2TBVA 1KDKA 4XE9A 4YM0A 5EXOA 4JTOA 3IDBB 2X8KA 1FOD1 4GMP0 4Y22A 1FMD3 2D3PA 1S0DA 4N53B 4AI8A 4Q2FA 3B9CA 1R1A2 2DVAA 1QXRA 1VP6A 3RYPA 4YZ2A 3I7DA 4WM8B 3HT2A 1LOBA 2Z2SB 2E7AA 4FTBA 3H1YA 4KL1A 4IETA 1GQGA 3ZO0B 3BOPA 2VOKA 5DZEA 4GB32 3ATGA 4Q4W2 4BLJA 3N7JA 3QACA 1O3RA 1LGBA 3I8TA 2WFPA 4FAHA 1ZYBA 3Q9OA 4IEOA 1Y7BA 4HK8A 1OQDA 1Z7S3 1XNBA 4YVWA 3AYEA 2P2KA 5JVVA 1FT9A 4WBBA 2WS92 5FOBB 1B35B 3ZYRA 3I54A 4N43B 3SH3A 3HR9A 1R1A3 3ZXEA 2VULA 4LEJA 2JICA 5DZFA 4XFCA 4E9KA 4ES9A 1DFQA 4BA6A 4CDQA 4EV0A 1U5YA 4FT8A 3P3PA 2VMGA 1HXS1 1NE4A 4HT1T 3ZXKA 1UPIA 3ALQA 1G9BA 3WW2A 2TUNA 2RS52 2D6NA 4GB33 4Q4W3 2YUEA 3J26N 3B00A 1BJQA 1IGOA 3HAGA 3DN7A 2VGDA 3RJ2X 1W6PB 1UU4A 3JD71 2ZHNA 3V56A 2WS93 4BOWA 4IL7A 2RJKA 1V6NA 4XF3A 1MZEA 2ETEA 2R071 1S0JA 3ES1A 5JIAA 5CG8A 2QDNA 4I0AA 4EWEA 2QDRA 2VW0A 2PHWA 3ILRA 5GLVA 1ZM1A 2VVEA 2C5DA 2RS53 3MIFA 3LA2A 2W08A 2EAAA 1QJY2 5FO7B 3AP6A 2ZS6B 1PVC2 2RS31 4M3CA 1X82A 3WW3A 2AUYA 1H9PA 2ZGLA 1PZ9A 5F1RA 3FFQA 4META 2VMHA 3HIFA 3ES4A 2JJ6A 1PGL1 2XLGA 3NAPA 3QCWA 4MXWB 5KBFA 1O4YA 1A3KA 2UYBA 3EXUA 1N3OA 1PNGA 4LLFA 3VZMA 3QD6A 1RMU2 1V00A 1HRV1 1SLBA 1IS6A 1LB2A 4LA2A 1QJY3 1AL21 1RITA 1LHVA 1PVC3 4Q27A 1VIWB 5I93A 1YI7A 1RUJ2 5BNNB 3MZHA 3VL9A 3RSJA 1W6NA 4MGIE 2NMOA 4KG8A 1C3HA 1ZBE1 4LHNA 2H0BA 2IC1A 4R9AA 2PAEA 1VBC2 2P17A 3RYRA 1F9KA 5KXDA 4FXKB 2NMNA 2DCJA 4Z2WA 2LM3A 2HWD1 1OHFA 1RMU3 3LOBA 2CWSA 1J58A 4MGKE 1OA4A 3K48A 4LBJA 4ZXKA 2Z42A 3NL1A 1XYPA 4NN0A 1PK6A 1VB4A 3ACLA 2CGNA 5D8AB 3S7EA 4I0WB 3ME2A 1DYKA 5BXXA 4GA9A 3FHIB 2VNOA 1G7YA 1RUJ3 5C9AB 4XF1A 1H0BA 4JV4A 2X5IB 4K20A 1YJKA 5IK7A 3H7JA 1CAVA 3H9AA 3R05A 3D6EA 1VBC3 4GKXA 4HMZA 5FQ0B 5J48A 5KWRA 4YSFA 5F6KA 4AHYA 1MS4A 1GANA 3ZFGB 3JBG1 5I91A 4D7YA 1KJLA 2DURA 2A6XA 1QOSA 4M0HA 1G86A 3VDDA 4FOWA 5GZGA 1BCXA 1UIJA 4BYYA 1KDMA 2ZX3A 3N36A 4S2FA 3QOPA 4ASLA 2IXCA 1JYCA 5T55A 2BFUS 3AJYA 4AVTA 1XU1A 3VZLA 1BVVA 1RUH1 3VBSC 4MSVA 1H4HA 2NLRA 3GALA 5FRAA 3VHPA 1QQP1 3AZVA 3K51A 1V70A 1S1AA 2Q0AA 4AK3A 3VKLA 2ZX0A 5LRRA 1DDLA 4QHBA 2OZJA 1S0GA 3GNEA 3SHRA 1MZ6A 5BNOB 4GH4C 2HWE1 2RHPA 1TQ5A 1RUD2 2E6VA 3HD8B 2VNRA 3M3QA 5C8CA 1BEV2 2Y38A 1ND2B 1AR82 2ZAHA 5D8AC 1Y9QA 4XDQA 4W6XA 4RFT0 4H3WA 4LBOA 5FLJA 4M0NA 4IEVA 4Q0QA 1WCDJ 3KSCA 3WLUA 4YZ1A 2GZWA 1DHKB 1TE1B 5C9AC 5J96B 3R6SA 2VQ0A 3MIHA 1VAKA 2XJTA 1NA1B 4O9GA 2WQZC 4BZ4A 2WNVA 3SCHA 1LHWA 1YCIA 2P34A 2GNMA 2OUHA 3MIGA 2R16A 1EPZA 1I3HA 2PHTA 3WG3A 4ISQA 5CFCA 3PNAA 1RUD3 1YO8A 3WCRA 3MDPA 1WMFA 1BEV3 1YNAA 3MW4A 1AR83 1HRI2 2OYZA 1H8VA 3ZMOA 3CJXA 4AEMA 5BNPA 1W6OB 2AZ5A 1BZWA 2YGMA 1W6MB 2D6KA 3VKNA 2QZ2A 4DY3A 4XILA 1HQNA 3AP9A 2DFBA 4UXAA 5DDJ2 1UW8A 3AFKA 1WLDA 2PHLA 3B3QE 3FLPA 3LOIA 4FCAA 4ISRA 4Y20A 5TSWA 1QMJA 2QCSB 1OD5A 1R1A1 4BMBA 4R9DA 3AFGA 3C2UA 3OCPA 3X29B 4LTAA 4HVOA 4P14A 2PHUA 5L7OB 2HKXA 3AXDA 4O9EA 4S2DA 4CZSA 4Z8BA 1A8DA 3S30A 3WP5A 4Q4W1 2LALA 1FNYA 1ND2C 4LO6B 4QPGC 1PMIA 2JECA 2P3IA 2E7TA 1HRI3 3MF6A 3MIBA 5FPXA 2H6BA 3ZFEB 4XJZA 1IPJA 4INDA 1PHMA 1OQEA 3D82A 1CAUB 2W0XA 5DDJ3 3WP4A 4YVSB 2ZGNA 1AXKA 1JHNA 5K9YA 4BM8A 1GNZA 1YHFA 3SH4A 2HYKA 4AI3A 1C8M2 4XFHA 1F5FA 1QKQA 2A6ZA 1DIWA 1QF3A 4W6WA 3RQ0A 3VBOC 2WINB 4Z07A 3KCCA 1REFA 4LO8A 4ONUA 2RS51 1KQRA 4R9CA 1V6JA 3N4MA 1XQNA 2B7YA 1RUI2 1S2BA 3MLLA 4C0HA 3UV9A 3SCGA 1I6XA 3O0XA 2XJUA 4UBHA 1A78A 1S0IA 4E4DX 2ZPXA 1NZCA 2F4PA 1UD1A 1O3SA 4IEUA 1WD4A 1LOFA 3ENRA 1X36A 3RDIA 2IFWA 4XFBA 4RSUA 4MGYE 3RI9A 4EJRA 4F7ZA 5AC92 5L19A 1OFNA 1C8M3 4V1PA 2Q5TA 5L7OC 1CR7A 4Q4V3 4RS5A 4DPNA 2ZKNA 1H1MA 1LEDA 2WC2A 4AGGA 1XE8A 3HQXA 1QJY1 1SCRA 4H7MA 5JOXA 1AX0A 2WA3A 4PDWB 3ZFEC 1PVC1 2V09A 2D6LX 3AXEA 1F8VA 2FBEA 3UK9A 4IXLA 2E63A 4MH0E 2C9AA 4YM1A 1T6GC 3WW1A 3ZSEA 4YYOA 1I9RA 1ZBA2 1DGRA 4C1WA 4P9GA 3DKWA 1SFNA 1G9CA 1SLAA 2Y26A 2GN7A 2JDZA 3FWEA 1DZTA 4Y26A 5I0TA 5AC93 3V0BB 3BALA 2FZ2A 3LB9A 2GMEA 4NHLA 4IEQA 3WDVA 5C6CA 1RMU1 5AVPA 3QH7A 2OIIA 3DUIA 1NCRA 2ZX2A 3M3CA 1XE7A 1LOEA 1F5JA 1LOGA 3N3HA 1SACA 2XUMA 1VALA 3IN9A 3MICA 5FTTC 1SQ4A 3IM0A 3OTFA 5F5QA 3FX3A 4LULA 3OY8B 4JRAA 3VBUB 4TZDA 4RQPB 4HANA 5KHKA 1COV2 1RUG2 4HBNA 3V0AB 4RR3B 1PM7A 3NV4A 1BQPA 2K9ZA 5GALA 1RUJ1 2DCKA 2O0OA 1LOAA 1AYM2 4LO4B 2CAUA 1BXHA 2D5HA 1ZBA3 4XBNA 2WFF1 2GMMA 1DZQA 2EA7A 1ASJ2 5DUWA 1RHI2 5JPNB 2ET1A 4JCKA 3GF6A 2WQ4A 1NYWA 4BIFA 4DQAA 4DNYA 2CYFA 4I01A 1LCLA 1DG6A 1O3TA 3FZ3A 4DZGA 2ZHLA 2JXAA 4FQZA 2A3XA 4LUMA 1WBLA 1RUF2 5ACA2 4PDWC 3PMEA 4JGYC 4PLOA 1COV3 1RUG3 1MQTB 2ZGSA 4DMIA 4FTSA 4X6QB 4FPFA 4J1WA 1HKDA 1JW6A 1FAYA 2ZZQA 1WA4A 1AYM3 5A32B 3LWCA 4HPKA 3LZZA 3MIEA 1TME3 4MYEA 3ZFFB 1NCQB 1FPN2 1NOVA 2ZX4A 3OPZA 2NQYA 3VN4A 1RHI3 3B7MA 4DRVA 2ZA9A 3VLBB 4YZ5A 2ZHMA 4JGZB 3C3VA 1VJ2A 1PGW2 2D6PA 3RMXA 3IBMA 4YLZA 1RUF3 3PLQA 4PQ9A 1C1LA 1AHSA 3U4XA 3GZAA 4YG0A 2ARXA 2FHRA 2XJRA 5KHHA 3H7YA 3S7IA 1RUOA 5HXVA 1REDA 2CY6A 3WD5A 3CLPA 4CDUA 3VBFB 5C8WA 1XNDA 2A3WA 5BUVA 3AMPA 3USUB 2YPJA 4Q26A 1MZ5A 3WW4A 3KT1A 3VBRC 4WM7A 3HN1A 2RE9A 4UBGA 4C90A 1LU1A 1N1YA 4CP0A 2BPA2 4K1ZA 4KH9A 1N47A 1DQ6A 1ENSA 5K0UB 3PVOA 3CEWA 4XF9A 1RUD1 3ZVXA 4AE2A 3BTAA 5KXCA 5EYYA 3WDXA 5JLVA 4NR1A 2ERFA 4IV3B 3KGZA 1Q43A 1AR81 1GFF2 1XRUA 2VG9A 4YG3A 4AI0A 1MQTC 2ZKLA 2X29A 3MFAA 2UURA 1RIRA 3IPVA 2XG3A 4TLFA 1FYUA 4L11A 2ZBJA 3IWZA 2D3SA 1CQ9A 3VL8A 1NCQC 1APNA 4QMAA 4HSJA 2VNGA 4LO5B 3UJQA 2N7GA 1AR92 1VBB1 4XPVA 4AVAA 1GICA 1YYNA 3RMYA 2RM22 4JQRA 1BMV1 4YVWC 1WBFA 2OUJA 5DUVA 1YLLA 1K5MA 1I5ZA 4HFSA 2GSYA 3DF0A 4QD2A 1HRI1 2JG8B 4KG0A 1S55A 3TNQA 1O5UA 1JH5A 3KT7A 4N7IA 1ZZBA 5I0SA 3FMGA 2WWSA 3JZVA 2P3KA 3I59A 1BK1A 2HEVF 1U0AA 2PHXA 3CL1A 3JCIA 4WVMB 3MLKA 4XIOA 4CDQC 1J3PA 1N1SA 3GBFA 5DDJ1 2JKBA 3POYA 1OPMA 2EXHA 4FPJA 3PMSA 4GIQA 4YGBA 1AR93 1BBT2 1G8WA 4E2GA 2RM23 1KS5A 2XHKA 5CAZA 4IV3C 3ST7A 2ZGQA 4XEZA 1WCSA 5JZGB 3CJIA 1TMF2 1HX6A 4X8NA 3AM2A 4CEWA 3DGTA 3DPRA 5FO9B 4IV1A 5BYNA 1RL3A 1XYOA 4XOGA 1LODA 1IPKA 2XJSA 4PJYA 3MGUA