2G9GA

Crystal structure of his-tagged mouse pngase c-terminal domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
189
Chain Sequence
GRVSGSLAWRRKEILFIPSENEKISKQFHLRYDIVRDRYIRVSDNNTNISGWENGVWKMESIFRKVEKDWNMVYLARKEGSSFAYISWKFECGSAGLKVDTVSIRTSSQSFESGSVRWKLRSETAQVNLLGDKNLRSYNDFSGATEVTLEAELSRGDGDVAWQHTQLFRQSLNDSGENGLEIIITFNDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords peptide N-glycanase
publication title Structural and biochemical studies of the C-terminal domain of mouse peptide-N-glycanase identify it as a mannose-binding module.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 48
structure length 189
sequence length 198
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04721 PAW PNGase C-terminal domain, mannose-binding module PAW
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1020 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2g9gA00
2G9GA 2G9FA 2I74A
chains in the Genus database with same CATH superfamily
1LU2A 3MGUA 2R073 1URXA 3D4KA 5FFOC 3ZX7A 4IEQA 4CXXA 1MS8A 3OGRA 2WUHA 5L7OB 5A7SA 4XUOA 4AFDA 2FD8A 2WO1A 4E4DX 5DAVA 3E5XA 4CDUC 2ARXA 3OGVA 3VHOA 2DVFA 4PQQA 2J1VA 2YV8A 1IGOA 2O8OA 4FP3A 1EAH2 2QDNA 2LROA 2K0GA 2QKDA 1F2NA 2YZ4A 4YVSA 5FZOB 3N7LA 2B39A 4WBBA 3VBRC 2BTVC 2JDNA 1YQ8A 4D6RA 2CSGA 2E7AA 4LQRA 4YZ3A 4QXBA 3RZKA 3NJYA 1UPIA 5FUNA 4EQVA 4YVWA 4WM7B 4NOTA 2B45X 3AKPA 3WP6A 4YZ1A 4E2GA 3OPZA 2ERFA 5DMYA 2QZ3A 3DYOA 2XPJA 5A3TA 4RGAA 4GWJA 3W5NA 3O7OA 4XFCA 1GQHA 1X36A 3UKTA 1ZZBA 4CDQC 4LKDA 2XHNA 3J8F3 1CAXA 2BP6A 2YU1A 3DYMA 3GBFA 4GWNA 2CGPA 4IXLA 3LDRA 4CE8A 1SG3A 1J1LA 3VLBB 2Q8EA 5IATA 3MUY1 2Y33A 5CVRA 1W2UA 3O0VA 5J3UA 5I8TA 2EXJA 2Y26A 1KRIA 3RZJA 4IEPA 5HXVA 1CAWA 1RGSA 1J3QA 5FV3A 3ZXFA 1DIWA 1W04A 1YIPA 2C26A 2WS92 2AEZA 1R64A 4NAOA 2X8KA 2D6KA 1QGLA 5FPLA 3CJIC 3IM0A 1JHNA 1W8NA 1R1ZA 1BJQA 3OEBA 4XETA 4A7ZA 2HYXA 3MO4A 2W3JA 3I97A 4XW3A 5CISA 3D0SA 3VGIA 1SACA 5JMOA 4HN1A 4RR3C 1PK6C 4PIZA 4AQ6A 4QX1A 5EJ3A 2CTVA 2PAMA 4RGKA 2HWF2 4JX0A 1NY71 1UZYA 2DUPA 1RUC1 5G05L 3HQRA 4PBPA 4DEVA 5LCWL 2Q8DA 3Q8FA 4GZ9A 4D6SA 1SMVA 4DB5A 2FDGA 2JG8C 4S2FA 4FPLA 5CYYA 1DZQA 1PO11 3VBOB 5DUWA 4EN6B 4Q0PA 4LLFA 3AFKA 3GZEA 3WNPA 1FI2A 5LASA 2VZ1A 1QU0A 4P9WA 4QKFA 1J84A 1KGYA 1FNZA 2XB6C 2WAAA 4XBQA 1EY2A 4AEDB 5IW0A 3ZFEC 1K5MB 5FPZA 4WZFA 4AVBA 1XPWA 1X82A 3N9OA 2E6VA 3ZFFA 1OQ1A 4PBOA 2WC2A 3DCQA 4A45A 4CUGA 3O1MA 4K9SA 2DU0A 2VJXA 2VCCA 1XU2A 1C4RA 4Y1VA 5D1IA 1H1MA 1JZ3A 4B4QA 2K2SA 4IV1C 2A6VA 4CDXC 1SEFA 1YQ5A 2HH9A 4DINB 5JAXA 1OF3A 3N9MA 5CG9A 2HWF3 5FPAA 1OKOA 3AZZA 3MW3A 2XL9A 2IUWA 5LBEA 2Z4FA 4YRDA 3MFAA 2YPDA 3NL1A 3ZYBA 1LOAA 2MEV1 4N43C 5FKCA 3T09A 2XQXA 4AAXA 1DQ2A 5A6ZA 1D0GA 1PIV1 3A7QA 1SFPA 5D2AA 3H8UA 5FZGA 2HWB2 1AR81 1RUH2 1W0OA 2VVEA 5H9QA 1TQ5A 2HEVF 1NCRC 1X7NA 3LEMA 4F3JA 3JQWA 4JAAA 4NMIA 4XFIA 4BQWA 3ZN5A 3X29B 2VTXA 1VP6A 5JZGA 3T4VA 1W39A 3AZYA 4YW6A 4JC1A 4DUVA 1O3RA 1CAUA 2H0BA 1NYWA 2WN2A 3HQUA 4LBQA 2D7FA 4Q1PA 2FHRA 2ZEYA 4QB1A 3RG0A 1JOBA 2AZ5A 3VD5A 4IQPA 3WSOA 4YGCA 5JOXA 4QGMA 1QHDA 1XQNA 2HWE1 4HVQA 1W8HA 3AP5A 3UESA 2FCVA 4AEJA 3FUQA 5K8SA 3OJBA 4AGVA 5DG2A 1SDDB 3OBAA 5CFDB 2IXIA 1N1VA 1YEWA 3LA2A 1NY72 2CWMA 4AVSA 3EYPA 2JDYA 5CKNA 1RUC2 2VUCA 3HEIA 1ZBA1 2JKXA 2OQ6A 5FYZA 3M3EA 1VPHA 1OPMA 1BKZA 1LENA 2E7QA 4NIHA 4E4ZA 2DF7A 2H0VA 4Q27A 3IT8A 1H6YA 4Q0VA 3FLRA 2B5HA 2DVAA 1S0CA 1RUH3 2HWB3 5FZ8A 4G4FA 3PUSA 2D6PA 4XHXA 5FYHA 4YPJA 2A6XA 5C3SA 2WNUC 3L2HA 5A1FA 3CZUA 4AQTA 1ENQA 2FCUA 4COVA 1FYUA 1ZRRA 2RS11 3U10A 1JUHA 3ZFGB 1TNFA 1PO21 2B8MA 3EO6A 4KNCA 1CGPA 5BNOB 4XTPA 2GALA 3NSTA 4M4RA 2D44A 1MS5A 1MS4A 1ND3A 4QHZA 2FDJA 4NIIA 3W21A 4AFAA 3AP7A 1K12A 4LKSA 1W6PA 4P5HA 2ZX2A 5L9RA 4COUA 2JG9C 1F4AA 3WNLA 2DCKA 2BZDA 4JGZC 3WW2A 4NHLA 3SNMA 1SBFA 3CEWA 3POIA 3T2PA 1JYXA 4ZHNA 1RUC3 4IGOA 1Y3TA 5A33A 1WD3A 3LKJA 4NN0A 4R52A 1CJPA 5A70A 2V5YA 4QX5A 3EXUA 2MEV2 2PHTA 4RD7A 3ZIXA 2RM21 3C7EA 4ITCA 3POWA 2VG9A 3MIBA 3TWIA 1C3HA 1PIV2 3USSA 4XABA 3B3QE 4XFGA 4CCLA 2ILMA 1IPKA 4ZY9A 1VBC1 4Y1UA 3VUOA 4GKYA 2YBSA 3OTFA 4LULA 1ZRIA 4LORA 3J7NA 2VMIA 4LE4A 3DKWA 2E51A 4I3PA 4PLNA 3ME2A 1W6OA 3MZHA 5LEJA 1QJEA 2JX9A 3UETA 4BA6A 3T0BA 2R1BA 2E26A 2VO5A 4Q1RA 5K4LA 2DURA 4WVZA 3DF0A 3Q8EA 2SLIA 2ZOEB 3AKTA 3AP6A 4FBFA 1LGBA 4CEWC 1ULFA 2LALA 4FPEA 3CNAA 1W8TA 3T2OA 4EZ4A 2DVGA 3JU9A 4MV2A 2ZGNA 2BQPA 2PA7A 1O3SA 1YXWA 4XIKA 3VDDC 1CZSA 2V09A 2C9AA 5A80A 1GZWB 1XNAA 1S0DA 1ALYA 1YRZA 3H8OA 1OFNA 2VOKA 5FLHA 3ZPYA 1JUIA 3H8XA 4RN5A 2RJKA 4S2HA 1ZBA2 1BHGA 2RJ2A 2XWJB 5KR7A 1CZVA 2IVJA 1EUTA 3N35A 5FXVA 5BNNC 1AL21 4QU2A 4NWVA 1MEC1 3FMGA 4QHBA 2MEV3 5JOYA 3LPFA 3VD7A 1JOJA 1O5LA 3HT1A 1PIV3 3V0BA 2YPJA 1YC61 1AR83 2R042 3TN91 2UY9A 1XBFA 3VKFC 1AUYA 3SEEA 3ILNA 1FX5A 5AVAA 3H1MA 3ECQA 3H9AA 2AUYA 4ZXEA 3S30A 5FZFA 1UYYA 4YGBA 2RS12 4A2UA 4IV3C 1OMIA 2NPIA 1PO22 2HWD1 2VQAA 1J3PA 1AYM2 3KM5A 2A7AA 4DFSA 4EWDA 1PMIA 4LOTA 2XVGA 5LWBA 5L9VA 3MLJA 5FPUA 2V4AA 2WO2A 2DCYA 3MF6A 2R0FA 4NRQA 1W90A 4A3XA 5C9AB 1Y4WA 4I0AA 3I59A 3BALA 2HWE3 2ZGPA 1H4HA 4DO0A 5J36A 4V1PA 4KBBA 2VECA 1YO8A 1RUD1 1RC6A 1LJ7A 4ZXKA 3N3HA 2DFCA 2VE1A 2EXHA 1HRV1 4UFMA 5T50A 4CEYB 1W0NA 3HIFA 2Y0OA 4FQZA 2G9GA 4M0NA 1ZBA3 2AENA 3AK0A 3SC7X 5FO9B 3TAYA 2P5BA 3OG2A 1JH5A 3UJQA 2E7TA 2BGCA 2ZMNA 4WVMB 1F4HA 2WJSA 4CDXA 4J6GA 4XFBA 3SEPA 3WF2A 5HCHA 2W9XA 4HFSA 4RS5B 3SLIA 2HBTA 2OPKA 2I45A 4N53A 3VBHA 2BBAA 3LD8A 2R043 2EIGA 2PTMA 4Q26A 3V65A 2E31A 2X10A 5FP4A 4LKFA 4CDWC 2YFZA 2F4PA 3P1IA 1I5PA 1H2MA 4K7JA 4IEYA 3OGGA 2GMEA 3LOBA 4XCAA 2VZVA 5DZEA 4CU9A 4NRMA 4RFT0 2RS13 2W1WA 1QMJA 3AB0A 5EIYB 1NCRA 1PO23 3ST7A 2GNTA 4JZRA 1OLME 1AYM3 4CXWA 3RNSA 1HW5A 1AR61 1W06A 4BISA 5JXIA 3WQ0A 5LY1A 2WQZC 1UF2C 2OUJA 5FYSA 3ZSJA 5T55A 2GNDA 4EV0A 4XILA 5B4XA 4K21A 3ZM8A 1NX9A 3E97A 2RE9A 1RITA 1UU5A 1C1FA 2A73B 4GD4A 3WG3A 4H55A 3KF3A 4FP2A 1OHFA 1S2BA 5K9YA 2WKKA 3POJA 2VBDA 4QGNA 3POSA 2XONA 5FCCA 3O1UA 3EMRA 1AL22 4B1MA 4LK6A 4CVUA 1MEC2 1J1TA 4PLMA 3T3YA 5FUPA 2RM23 1UYXA 2X5IA 1POV0 4U36A 4OUEA 2P6HA 4W8JA 2ZX0A 3RWKX 4BIFA 3RZHA 4X6QB 3POEA 4BOWA 1VBC3 1UCXA 5C70A 4YM1A 2VVFA 4RQPA 1H2KA 1A6CA 2RJLA 2V4VA 1H9WA 1ODNA 4GKXA 5FUIA 3IB3A 1NT0A 4YW5A 4XMIA 1G7YA 5C5TA 1SDWA 4QQHA 3DYPA 5D8AA 1DBNA 2DCJA 1JZ6A 5BNPC 2RVAA 1K45A 2JDZA 3UYJA 3VN4A 2Y6LA 5AVPA 3WHUA 5F3CA 1BZWA 5A7WB 5HCAA 3APBA 3N7JA 1Y9GA 5DAXA 3LFMA 4CP9B 2P3JA 1LOEA 3MI8A 3RFRA 1RUG1 5FMBA 1LESA 2VL4A 1MQTB 2CY6A 5JZGB 5DAWA 1HRV2 2X05A 3VKNA 4IEXA 3URFA 3WVJA 1CAUB 4OLLA 4LBQB 2ZJCA 2JECA 4A42A 2Q0AA 2ADEA 1AL23 1D4VB 1MEC3 2X29A 4AI3A 3OBTA 1S2KA 3R05A 1AL0G 3LA3A 4JHTA 2RMU1 4JDOA 4XF1A 5FZOA 5LY2A 3PIJA 5I0UA 4JVAA 4AE2A 4EN8B 4JCKA 2I74A 3H7JA 3ETPA 3RZLA 2JIJA 4HANA 1C8M2 1Z78A 4Q29A 2YC0A 1JODA 4MOAA 5IWFA 4WM7A 4RA0A 4LUKA 2VMDA 5C7GA 3Q8BA 4C1XA 2YC2A 4QPGA 4UXAA 2G1MA 4XF4A 2WDBA 5IVFA 1LOFA 5FY1A 1T6BX 1ULDA 4PF5A 2ZGQA 3AZWA 5HXMA 2J1SA 4K1ZA 5K0UA 1AR62 1H6XA 3LFIA 2HEYF 2DVBA 2O0OA 1W8ZA 2XBO1 3THTA 5IK7A 3H0OA 3IMNA 4KGGA 2W91A 4GJYA 4QPIC 3AZXA 4K8FA 4CU7A 4OYUA 5L36A 3NVCA 1LKNA 3SCHA 3SCGA 1HRV3 5BY5A 2VULA 3O14A 1ASJ1 3WQ7A 5FY4A 5IAXA 3H50A 3OBRA 3T0DA 2BFUL 3MICA 4CUBA 4L11A 3T4HB 3MYXA 5E6HA 4YW4A 4NIGA 3J7MA 1W6MB 3KD4A 3NNFA 5KHGA 2ZEXA 4N9IA 4AK3A 5APAA 1IQAA 4R9AA 4Y4RA 1KFXL 3KLSA 5FZMA 2R1DA 5JVVA 3RYRA 4A6OA 1OF4A 5EQUA 1C8M3 4BQ3A 4YW2A 3O1OA 2D43A 1SZBA 4BQ4A 5A33B 5FO7B 4B4RA 5I0DA 3PIGA 2VZOA 1Q56A 5IVJA 4SLIA 3WNMA 3ABZA 1WBFA 5GLVA 3AMMA 3VBRB 3N9LA 1LHNA 2TUNA 4K8RB 2VY0A 4ZKTB 1V00A 3VBOA 2IXLA 1XE8A 5HBAA 1CAVA 2WNVA 4GB32 1AR63 2AGSA 2IVIB 3TBDA 3O1SA 4LJHA 2IWGB 5CKQA 5JR7B 1PNGA 1PHMA 2JWPA 2GZWA 1D7PM 3GZTB 3IIAA 3LA7A 3O0XA 5JPNB 4DUWA 3ACHA 4QDSA 1ZREA 5IVYA 4AEDA 4AQSA 1K5MA 4NR1A 3LIGA 2IC1A 1H8VA 2JXAA 1WCKA 1WCDJ 5CZKA 4CPBD 1QJU1 4C0BA 4UI9L 2VOXA 3ACLA 1RTVA 1OC1A 4R4XA 5J37A 4IUGA 2ZMKA 1AX1A 1DQ5A 1RJ8A 4Q8KA 2UU8A 1QY4A 3CJIB 4M3CF 3B93A 5T5JA 5JLVA 1UXZA 5FO8B 1ULOA 2CL2A 5A3NA 3ZXEA 1HIXA 1JYWA 1UY0A 1HX6A 2WA4A 2E53A 4XF0A 1US3A 1W8UA 1YFXA 3E6CC 1REFA 4RR3B 4E4SA 3VBFC 2PLV1 1L3JA 2P2KA 5JWPA 1TME1 1BMV2 1UAIA 3B94A 4P00B 4XAAA 5EJZB 3LSEA 3VD9A 3V0BB 1NE4A 2D5FA 2R062 2D3PA 2XBO2 2CDPA 4AI8A 5C8CC 2IXCA 5BXXA 1YFYA 1GV9A 2JG8B 2WFF1 3VBSC 5DAPA 2BJSA 2W39A 5EV7A 1FAYA 3IDCB 2EAKA 3OGSA 4Y5TA 3M3IA 1ASJ2 3AYCA 2VXJA 4GAZA 3AKQA 4I0BA 3WCSA 4H7MA 1OD5A 4UFLA 2RDNA 2CYFA 4COYA 5FY7A 1YI9A 1AJOA 1CPMA 1OD3A 4CCJA 4O9GA 4YG6A 3I59B 4R9DA 3BTAA 1NLQA 3NNLA 4Q4W1 4R4ZA 4OMDA 3OD0A 2OKXA 5CFDA 4FFHA 1QQP2 4O61A 3AVRA 5GJ6A 5IVEA 2ET1A 3K3OA 3M1HA 2XL7A 1XNTA 4L9BA 1DGWX 3D8CA 4QX7A 3RQ0A 4XMAA 4A7YA 5IHRA 1AVBA 3AX4A 3OUJA 5HCFA 4E2QA 2VU9A 1LAJA 2VNRA 2KXLA 3BU0A 3JBG1 4M4PA 4IV1B 4MXWB 2C0ZA 4FPFA 1HB1A 4CDXB 4Q0UA 2D3SA 2WT1A 5KHIA 4FOWA 1BVP1 1IG0A 3M3QA 4TZDA 4OHXA 5CU1A 4L0PA 1IPJA 1ZA4A 2A3WA 1UNBA 3N7KA 4N53B 3BCWA 3VBHB 2XBO3 2R063 4LO4B 4LIUA 4I3GA 5DUUA 4B1LA 4W6YA 1RB8G 2FMDA 3PUHA 4N43B 4RHV1 5FRAA 1D4M1 2HLEA 2GC2A 2VQ0A 2BGOA 2RS52 3WZ1A 3VHRA 4MZUA 2ZS6B 5FJKA 2OIIA 2W95A 1CONA 3KVBA 4QKNA 4J1XA 3HJRA 2PYTA 3RGBA 5C5UA 1ASJ3 2FZ1A 2K46A 3ZFGA 4M3CB 1NCRB 3L9JT 5FYMA 3OPWA 1QXPA 3ZXLA 5BNOA 5A7QA 5GLTA 1RUI1 2QFEA 5LA1A 4Y1ZA 2RDSA 4DY3A 3T2QA 4W65A 2Q5TA 2J1TA 2W5FA 3DXTA 1E5RA 4IW3A 2F4LA 3FFQA 3TB0A 2R072 1TVGA 5D21A 4HONA 4AFCA 1SPPA 3ZXAC 5ABJC 3ZDSA 3VKLA 5LK5A 3M2MA 5JCTA 4CPBA 3ZYGA 2JDAA 2RS32 4DUXA 1AZDA 2VXRA 3PUAA 1HN1A 4JDMA 2XJSA 4N9HA 4U2AA 1BXHA 3H3ZA 2BBVA 5FQ0B 4QKDA 1AXZA 3HN1A 3ZYRA 1WMFA 5F2SA 5FJHA 4MLOA 1XNBA 2BFUS 1OUSA 2FBEA 1Y7BA 2W1QA 4X8NA 3B69A 4YGEA 1V6JA 3EQEA 2GSYA 4FFIA 4MSVA 4XTMA 5ANNA 3UL2A 4AVTA 4ASLA 2Y6HA 4WV8A 2ATFA 2ZHLA 3VL8A 4Y5SA 1ZVFA 2GC3A 2RS53 1DYOA 3N9PA 3VBUC 4LIVA 2QUOA 1GBGA 3ZR6A 5L19A 2A70A 1KDKA 3B00A 4LA2A 2VMCA 4LBMA 2VOWA 1G9CA 2ZGUA 1OA4A 5C6CA 4OI2A 2YGLA 4IEWA 2ZBJA 3WP5A 1DGLA 3JZVA 4Q4W2 5FZHA 2XVKA 3P5BA 4FQ4A 4ES9A 5BUVA 2P6CA 1GZWA 1ODMA 4AFMA 1CD3G 4CRQA 3W20A 1LTEA 1ULGA 3U78A 4FPHA 1W2OA 2EALA 1MACA 3O0WA 1PZ7A 3GNEA 2OPWA 1SLCA 4XAEA 3R6SA 4LMFA 5FYBA 3O1VA 1DGRA 4JQTA 2RS33 1TMF1 3AL6A 4AAPA 1ZRDA 1H30A 2JG9B 2LS6A 1H1IA 2ZEWA 1O8SA 4BCUA 4HXCA 2CGNA 1FPN2 3POYA 4JGZB 2B9VA 1YJLA 4MGIE 5FZ1A 5I0TA 1S0JA 1QDOA 2AEYA 1GNZA 1YQCA 2K9ZA 1V70A 2WSVA 1GANA 4RHV2 1D4M2 5FZ7A 3KB5A 4QPGB 2VZUA 3NNGA 4P9IA 4QXKA 3T1LA 1DZTA 1JYNA 4XHBA 3RZGA 4XFAA 3NO8A 1FT9A 1NLRA 4I09A 3FN9A 3LE0A 2Z79A 3NAPC 1JZ4A 3JD71 2ZACA 3SH4A 4B29A 1OLQA 3LEIA 5K0UB 1RUI2 1SBEA 4KU8A 4LBQD 4BQYA 4IESA 1QNWA 3WUDA 5C9AA 1S0EA 1O7FA 1OOPC 4Q4W3 2F6BA 5E8AA 3UKNA 4MHRA 2Y6GA 3VZKA 5IK8A 4LT5A 1AYN2 2HWC1 4CEWB 1VBE1 4XUPA 3ZN6A 2YBKA 1YLLA 2GH2A 2ZAAA 4CEYA 1HJGA 3T0AA 4EJRA 3VDDB 4BK5A 4WVMA 2R0HA 4IE4A 4I30A 3VDAA 4K1YA 1SLBA 1U5YA 3K77A 4FPYA 1FPN3 4RS5A 3U14A 5A3UA 4D6QA 1PX4A 4I02A 2ZXQA 3KQRA 1WW7A 1GZTA 1UU6A 2A71A 3A4UA 4FAHA 5BNNB 3AJZA 3WW4A 4DRRA 1LHOA 3CZJA 4FOYA 4RHV3 2Y64A 4Q5OA 1WLDA 1D4M3 2LRPA 3HWJA 1LOCA 2QQVA 3QCWA 5LRRA 4QQLA 5TSWA 1PMJX 5JSPA 3LAGA 4AI1A 1M06G 1Q43A 1XNKA 1IOAA 1I5ZA 2F17A 1G9BA 2D6NA 2XDVA 2Q1ZB 4P9YA 1CAVB 2QJVA 1UMZA 2WNVB 3PJYA 1GOHA 1J3RA 1RUI3 4Q0QA 5JIUA 3BTYA 1MS0A 3BGAA 2Y8KA 5DG1A 1NA1C 3RS6A 4IV3B 3U75A 2EA7A 3GJBA 1GR3A 1RYYA 2ZTNA 1Q5OA 2WR9A 1AYN3 4KG0A 1V6NA 3WX5A 2XQRA 1SLTA 1DHKB 3HNYM 2WWJA 4RL7A 5FOJB 1TMF2 4LE3A 3WNKA 1WWYA 1LGNA 4MO3M 4NHMA 5CFCC 4QAWA 5GKAC 1R1A1 1AXYA 2MPFA 3MBWA 4WM8C 4XQDA 4P9JA 4LNVA 1A8MA 3S6PA 5EHDA 3ZR5A 4GULA 5T5OA 3K51A 4TLFA 3K4DA 5T5LA 4AHZA 1PVC1 2XJQA 2WIIB 2WWSA 1TEIA 5FXZA 2W87A 5A3PA 2LUWA 5FIXA 2VCMA 4HZFA 1YI7A 3VDBA 5A1LA 2Y0IA 4OQ8A 1GICA 1U5ZA 1E5IA 3JD72 2X53S 3C8XA 5F32A 2HJIA 4BLIA 1UKGA 4XJUA 2D97A 4LBLA 5F2WA 2ORZA 4FPGA 1OVSA 2GP3A 5A7WA 5C4WC 3ALQA 3ES1A 4HBNA 4UYBA 4CP9A 1NCQA 3UKVA 2ORXA 2YY1A 1OFSA 3VKMA 1JYTA 3PVEA 1MQTA 2JD9A 2HWC2 3HBKA 5A3WA 1VBE2 3NQHA 4BQ2A 1EV11 3LQCA 3OYWB 4BQXA 5I8SA 3AYEA 3WY6A 1U5XA 4M3CE 4V2WA 4HSJA 2QCSB 3WQ1A 5ACA1 2BU9A 3OSDA 3ZIWA 3C7GA 5DAQA 1TMF3 4CTEA 3N36A 1IPSA 4Q4X1 2XG3A 1UIJA 3EHKA 4YWAA 3W58A 5L73A 4WVVA 4QXCA 2AR6A 3ZKYA 1S0GA 3D82A 4NROA 2W47A 3G7DA 2UURA 5GZEA 1WLWA 1DYPA 3NW4A 4DXTA 1LHVA 1VAMA 4CCKA 4UFHA 2WNOA 2DUOA 1PO12 1SBDA 3JD73 5EYYA 5LZ6A 3IBMA 3QBQA 4HG6B 5FZLA 2G4IA 4OULA 2VOVA 4K6BA 5J98B 4E8DA 3I49A 2CAUA 2VBPA 4LR4A 5BNPB 3GGLA 3LCPA 4CUCA 3FC0A 2HWC3 1VBE3 2YGMA 3BU7A 1ZRFA 5GZFA 4ZS3A 2WFPA 3WDYA 2NMOA 1GP4A 1G6NA 5EWSA 3ZVXA 1OQDA 2Z69A 2BUKA 1XNDA 3WD5A 1W05A 1VBA1 1R1A2 1LHWA 2A75A 4YGDA 1PGW1 1W6MA 1ZM1A 1AR91 1UQXA 3MV01 5GLZA 1OURA 5LBCA 3J4UH 1KDMA 2BYVE 4Y22A 4CDUA 2I07B 3PLQA 3DGTA 4N8MA 1SPPB 4V2VA 1KQRA 1BK0A 4QDRA 2PHLA 2Z42A 3D6EA 5JXHA 1JI6A 2AACA 3BTZA 4B4PA 2JE9A 4FPOB 2ZABA 3ITQA 3VBRA 5FZCA 4GWMA 2DDUA 1VAVA 1KJRA 5B4NA 4FI9A 1S4CA 1PO13 1ST8A 2WINB 4OUSA 1CESA 4NHXA 1FV2A 1AR82 1OH3A 4L99A 5L7OC 4HK9A 1BLZA 3Q9OA 2XJTA 4XIOA 3BODA 4IETA 2QDRA 3ZYFA 1SFNA 1V6IA 4IEVA 1DLLA 4ATEA 4D0QA 1WCUA 5A6QA 4I01A 5FMCA 4AGRA 4CDQA 4OI0A 4XQ4A 4C1WA 3S5AA 1OQEA 5EFUA 5L9BA 5AC91 2DBNA 4LK7A 5ACA2 1CIYA 5FWEA 4KMQA 4DXZA 1W6QA 3WDXA 2HWE2 1WD4A 4Q4X2 1NXD1 5A7PA 4CCEA 1R1A3 5J48A 3GHMA 2MNGA 2FZ2A 3ZPOA 2DCZA 1UMIA 1UX6A 2BEOA 3PL0A 5FPVA 4Y1XA 3CJIA 2HEWF 1VALA 4QM9A 2IXHA 3NKTA 4KWJA 4UOJA 1PVC3 2BV4A 2D5HA 3WF4A 4BPZA 1SLAA 3MPPG 2HKXA 4RR3A 1NLSA 1PK6A 3I3MA 3N7MA 4QQOA 3TEZA 4EROA 2ZX4A 1MVQA 4BQ1A 1F5JA 1WW6A 5GLUA 4AW7A 5J96B 3PU8A 4BJ0A 3F2ZA 2GH8A 2YU2A 2Z5WA 3QD6A 1UWWA 2JG8A 1LGCA 1Q8SA 1MR5A 1RUOA 1D2QA 3WG2A 4F8AA 5FWJA 3CF6E 3BPZA 1E5SA 3FWEA 4NE9A 5FBZA 1JYCA 1LOBA 3FHIB 3B9IA 4YSFA 5CEHA 5LW9A 3NKGA 5FXXA 1UZWA 1Y9MA 5LBBA 5ACA3 4FT8A 2PAEA 1VBA2 4OI4A 1Q8OA 1CJDA 1TZOA 1O3QA 1UY1A 3KCCA 2B42B 3N9NA 1PGW2 4Q4X3 5JOZA 4AEMA 2WYSA 1AR92 3ZFEA 1HLCA 2PELA 2VOTA 1UO9A 1H2LA 2ZZJA 1UD1A 5FZ0A 3ACGA 4Z92B 3ZN6B 3M3OA 1OSGA 1OA3A 3K2OA 3ACIA 1RL3A 4Z1VA 1OI6A 2VC9A 3ATGA 3CO2A 3A23A 4MXWA 3PVNA 4IV1A 5KXEA 1L7QA 4P9GA 1IHMA 2RM22 1I6XA 2J22A 2JB8A 4WZCA 2ZMLA 4R8HA 1VBC2 3RPQA 1MS3A 2YUEA 2W46A 3GXUA 3EBRA 4L8QA 3KT7A 3VBFB 4CCMA 5HPOA 3S57A 1KS4A 3KWVA 4N43A 4OUMA 1J59A 5BNQA 1KITA 3FE5A 3L2YA 4HMZA 4MXVA 5E1RA 4BB3A 4AEKA 1VB4A 1PVXA 2N7GA 2JIGA 3KVAA 5JI7A 5T52A 4M3CA 3J26N 1W28A 1Q8VA 1LODA 3VBSB 2P3KA 3V64A 1YFWA 3SHRA 1VBA3 2XR4A 1W8FA 3I2JA 1B09A 2QQNA 4DS0A 3GBGA 3VZMA 4FSJA 1XE7A 4JGYC 5A32A 5DQ0A 1AR93 4AL9A 2YDEA 4OQ9A 1D0HA 3KSCA 1N1YA 1YJKA 2V72A 2WSUA 3C3VA 2WA3A 4BXSV 5KHKA 2FDKA 2Q1FA 3Q8AA 1PM7A 2E9QA 4YG3A 2R16A 5JSOA 4Z82A 3WF1A 3WHTA 1UOBA 3NRUA 3KGLA 4X8PA 4JKMA 3AL5A 5FQ0A 4GQ7A 2QBXA 3KT4A 1OT5A 4H3WA 3TN92 3JQXA 3DPRC 1GYKA 3WXPA 1O59A 1K3IA 1X50A 2RDRA 1COV1 1CWPA 3C7OA 3POBA 3VHPA 4YZ5A 1JMUB 4MGSA 1GWMA 5JIAA 3RI9A 3I2HA 1FATA 3R0RA 4XPVA 3RYKA 3TEWA 3GJAA 4D7SA 1ZRCA 5GZCA 3H3UA 2EIBA 1DDLA 3ZSMA 2UWAA 2VTXJ 4GWIA 2HWD2 3H3LA 1YHFA 2VCAA 5IK5A 5AC93 1Q3EA 2P17A 1JYIA 3ENRA 3CMGA 4HLTA 5FK7A 3I8TA 2WNUA 3LDBA 1FNYA 1YNAA 4P9XA 4DIQA 2BNMA 1NCQB 4LITA 2V73A 1RUD2 3MPBA 5F3GA 1KEXA 5IJRA 1JYVA 1UIKA 1ENRA 4GH4C 4NHYA 5FAXA 4AI9A 4QDQA 2DVDA 3IAQA 2E63A 3KQ4B 3VZOA 5KHHA 1V6KA 4FTEA 5HV0A 3O12A 1Y9QA 3RSJA 2Q30A 3PHMA 2JDMA 3AMPA 3QOPA 3KF5A 3HBZA 2JG9A 4Q4V1 4NIDA 1MPXA 2VZTA 2TBVA 5E16A 4AVAA 1BEV1 4JGZA 1Z7S1 3R4UA 3ZSLA 5C3PA 2JDUA 4JRLA 3INAA 1CX4A 1MZ6A 3AKRA 5F5AA 4XC9A 4AI2A 2KM2A 3TN93 4TWTA 3SH5A 2J7MA 4Y3OA 1HB2A 1PX3A 4XZPA 3FBMA 1RINA 4UW5A 5FYVA 2D6LX 4A3ZA 1W3VA 3HT2A 5FP9A 1RMU1 1H8TC 1DQ0A 1XJAA 4XUTA 1JTZX 3HN3A 1L7LA 4S2DA 4DRVA 4BHPA 4LPLA 4Y5Z0 1I9RA 5EPAA 3E6BA 1K5JA 2PHXA 2HWD3 4NIAA 4ASKA 3ZYJB 4IEOA 5KC5A 3C7HA 2AC1A 5H9RA 4DPNA 4IEZA 5H9PA 4BZ4A 3ES4A 3VBUB 3ZMNA 3LZZA 5DDJ1 1OKQA 5BYNA 4ZU4A 3ZO0B 3OOXA 1F9KA 1RUD3 3E5UA 5F37A 4CEWA 3U4SA 3TNQA 1L7RA 2OZ6A 2QQMA 4CDUB 2ZGRA 2DU1A 1RUJ1 4UF0B 1QOOA 3W9AA 4IERA 1LHUA 3J9SA 2JB4A 3VDDA 4AFBA 1R091 4XDPA 5C71A 4FFGA 4OI1A 5E88A 3FHAA 1B35C 2CU5A 3KV5A 5A7OA 4AHXA 5CAZA 3MFCA 2BWCA 4LUMA 2XGXA 4Y22B 2VNOA 2LW8A 5FKBA 3WDWA 5BNNA 1NAEA 2NLRA 1DGWA 3HNMA 1GMMA 2XMLA 3PJQA 1MZEA 3HAGA 1GFF2 2RG4A 1QIQA 4KGQA 1RUF1 5FZKA 1JU3A 1G8WA 1ND2C 2LTNA 3AFGA 3NV3A 1H0BA 1PMHX 3HD8B 3CBNA 4UFIA 4X6RB 2W08A 4CCOA 2ET7A 1DLCA 1S0FA 4IL7A 4RFRB 4L2NA 1A3KA 2W1UA 3UGFA 4KH9A 4J25A 3HMYA 4AGGA 4C0HA 4LBOA 4E8CA 3BPSA 3FJSA 3JCIA 1JXNA 1RIRA 2EF6A 2Y38A 3I3EA 4QD2A 3HOBA 3TEXA 4Y1YA 3OBZA 1RUG2 4IV3A 4CDQB 3B9CA 5DUVA 4AR2A 1XB9A 2TNFA 4URAA 4YVSC 3M7AA 4FAGA 1OA2A 4QM8A 1GWKA 2EAAA 3PUIA 2VNGA 5CB7A 1OOPB 3THPA 1G9FA 1C8NA 5IVBA 3VD4A 4LHLA 3K4AA 4Q4V2 4YVWC 5F8PA 3KS7A 4NJ4A 1W6QB 3MIHA 1BEV2 2B7YA 3LOIA 4LHKA 1MZFA 2RMU2 3ILRA 4LO7A 2ES3A 1OBNA 2QZ2A 3T2TA 4FXKB 2FDIA 1DG6A 1U0AA 3IZOA 2G9ZA 1BBT1 1OUXA 1LOGA 1COV3 1HV0A 1QOTA 4PLOA 3SH3A 5IK4A 1C57A 2C24A 1RMU2 5A3OA 4M01A 4PIYA 5F5QA 1FOD1 1PK6B 5F6LB 4LO8A 1O5UA 4JDNA 1UY3A 4NAMA 4BLJA 3RDIA 4P08A 5C3QA 3U0ZA 1UN1A 4HK8A 1CN1A 4CDWA 4UFJA 5E89A 4DMIA 2VR4A 1GZ9A 3I2OA 1ZBE1 1Q8PA 1UZZA 2UWBA 4KBZA 4YW1A 1YUDA 5DDJ2 3FBYA 3FZ3A 1YYNA 2GDFA 3Q8CA 4ZPIA 5DABA 1VMFA 3WUCA 2OXBA 1RUG3 2GC0A 3JUUA 4N7UA 4ET7A 1YFUA 4H2AA 1PNFA 1QF3A 4R9CA 5JMCA 3OYWA 1WKYA 2J1AA 3GYDA 4XYXA 2DCTA 2VD7A 1NQJA 1RUJ2 2ZKNA 1H2NA 3QLQA 3IKWA 3UNPA 1R092 4J1WA 1DP0A 4Q4V3 5JXGA 1DZRA 1W8OA 4XVHA 1BEV3 1Z7S3 3ZFEB 2XXZA 3NJVA 2GU9A 2RMU3 1WMXA 2XJUA 4DY5A 2E33A 2OQ7A 2OZJA 4BIOA 3ZSEA 5C3RA 5CKMA 3OPTA 3WNXA 1VAKA 1QEXA 1LR5A 4WM8B 2JDPA 4UT5A 4UBGA 1RUF2 1J83A 1RMU3 3AMNA 3CDZB 2JKBA 3KV4A 1W6NB 2QE3A 1H1AA 4JQRA 4N7IA 1N47A 2WL1A 3I2KA 4NRPA 3S7IA 4CUAA 3GCXA 4PDWC 4C91A 3A21A 4CCNA 4Y24A 1LRHA 2QQKA 2RDQA 3KCXA 3NWKA 2VZRA 5ERLA 3VZLA 5JR2A 3IAPA 3LGRA 2AREA 1GQGA 4LBJA 3RVHA 3ZFFC 5DDJ3 2YXSA 3BI3A 1XXNA 2UYAA 1VBB1 3ZN4A 5BNPA 3KV9A 2BVVA 4YM0A 1JZ7A 2BNNA 3IDBB 1F5FA 3ZXKA 4P5YA 2VZPA 4OZOA 1VBD1 2QQOA 2O14A 3LEGA 1RUJ3 1UL9A 2OA2A 3BIWE 1HB4A 1QJU2 3WNOA 1HQNA 1R093 4IGQA 3ZXJA 3AP9A 2R49A 4NPLA 4HETA 5I91A 4KL1A 2WQ4A 1WW5A 5FYTA 4PF1A 1EAH1 4ZU5A 3PVBB 5A32B 1C28A 1LEMA 3BTXA 3CJXA 4D69A 1BBT2 5IVCA 5KHJA 4CSWA 4Z8BA 2CHHA 2H6BA 2QQWA 2BW8A 4NPMA 5SV8A 4ATFA 3I3DA 3SMHA 3R4DB 1FOD2 1MS1A 2PHRA 1ENSA 1RUF3 1VIWB 4MVTA 3V0AA 2Q8OA 2PLV2 4XJ8A 5LA9A 3SCFA 3CKHA 1NG0A 1TME2 2XUEA 2YC4A 5GM0A 1DCSA 4XZUG 5JZGC 1F15A 2WQ8A 4KU7A 1V9U1 1RXGA 1ZBE2 3I2FA 3AMHA 3VV1A 2EXKA 4XE9A 1GWLA 1RVF1 1HB3A 1WCSA 2WFF2 5BV6A 2PHDA 1C1LA 1KXGA 3B01A 5FMOS 1G9AA 4UFKA 2WS91 4FXGB 5CADA 5FBJA 4CA9A 5LRSA 1YIFA 1IZ3A 2PHWA 4KI5M 1ZNPA 2EICA 4AG4A 1ZZ8A 3WF0A 3WP4A 3PDQA 1HKDA 2YB7A 4URTA 5C8WA 3LB9A 4QPIA 3HQXA 1QJU3 2C1FA 2WNUB 3I3BA 3OGJA 3OY8B 3UT0A 5FZIA 2YBPA 5FMDA 4BH9A 3AP4A 1OVPA 4QKBA 3VKOA 2R6QA 4INDA 3SISA 2W92A 3SKJE 4HKWA 1BBT3 1GLHA 4YFZA 5FY5A 1N3OA 2X09A 3CU7A 5LBFA 5KXBA 4COWA 1FOD3 3JBG2 1GNHA 4GJZA 2VQTA 1QJY1 1BYHA 3MUZ1 5FYIA 2EIEA 2PLV3 5KC6A 1N3QA 4O65A 1X33A 1O91A 1TME3 4AHYA 4LO6B 4MGZE 4ARXA 1DFQA 1GU3A 1ZBE3 4UBHA 2DV9A 5EXOA 1MZ5A 2YROA 4LKEA 2BOIA 4JKKA 2ZZQA 2WFF3 4YARA 3MEPA 1JZ2A 2PMWB 4R9BA 5FZ4A 1ND3C 1BVVA 2VAUA 4QXHA 4LHNA 5CG8A 2P34A 2BDRA 1WLCA 1VBD2 1VJ2A 2AYHA 4YM2A 2C5DA 4MH0E 3VHNA 4DXRA 1EPWA 2ZAHA 1E57A 2VZSA 2C4XA 4QX0A 4D8MA 2ZKLA 4GMP1 4QX3A 2J1RA 3PURA 1I3HA 3EJKA 1DGRN 3O1TA 1JZ8A 3T08A 1XYNA 4BU2A 4MG2A 4G9SB 4JKLA 3G6JB 2H6CA 2VZQA 3H1YA 1ZZ6A 3LIHA 2CNAA 3USUA 2R30A 1W03A 4AHWA 5FPXA 3DXUA 2PQSA 5HI0A 4XOGA 4Z07A 2C6SA 3SXWA 4M00A 2UY8A 5LB6A 1W9TA 4FFFA 2YHJA 3JBG3 1CPNA 2Y60A 2XWBB 2ZX3A 2OYZA 4Z2WA 1LCLA 2V5DA 2A6YA 3KCYA 1GUIA 1TNRA 4Q0SA 2G19A 4OHWA 3ILFA 1V9U2 2HWB1 1RUH1 3CQOA 3M3CA 3MF9A 2B9UA 3MHZA 1DYKA 1BCXA 3K4ZA 3KHBA 3HNBM 4XXPA 3TNPB 3BKZA 4EYUA 4JRAA 3VBFA 1RVF2 3OF1A 3ZXDA 3NNMA 2JE7A 1S0BA 1RUNA 1T6GC 4KG8A 2PAKA 2DBIA 4XCBA 1VBB3 5FY9A 1SFYA 2D98A 3BOPA 1YCIA 5GZDA 1VBD3 1U12A 2NZ9A 3ZMOA 2P1BA 5C8CA 3J7HA 5IVVA 1VE0A 3QH6A 3VBSA 1GP5A 2OUHA 3KGZA 1C5IA 2CV6A 3TEYA 2VTFA 2OW4A 1EAH3 3OUIA 4BK4A 3CLPA 4QPYA 3I2DA 3MW2A 1VB2A 1AJKA 3QH7A 1R081 2OT7A 3FLPA 4D3WA 2IFWA 3AMQA 1X8EA 3WV6A 4EN9B 3LWCA 1QJY2 2OX0A 4QGLA 3AM2A 1PGL1 3AKSA 4CP2A 1D2SA 2ZX1A 2WT0A 3P6BA 4XQWA 4NHKA 1SQ4A 5DZGA 2P4EA 4PT6A 4XF9A 1V9U3 4HVRA 1QDCA 3CHXA 1IG3A 1IQDC 4PI0A 5FZBA 4UW6A 1RVF3 3CL1A 4TLGA 4IE6A 3JB4C 1XSQA 1RUE1 4MGKE 4PDWA 4RYDA 4AWDA 4Z2AA 1EPZA 4MADA 3OEAA 4RSUA 1S1AA 2WS93 2P37A 2VUJA 5FPBA 2BNOA 4ZZ8A 1NOVA 4CDWB 4KQ7A 3NMBA 1REDA 2HYKA 3PTRB 3M70A 4LTAA 3UK9A 2B4KA 2ZGSA 1RJ7A 2Q8CA 3K3NA 2SBAA 4YNIA 3WF3A 4DNYA 2NM1A 4QQ2A 3OD4A 2GNMA 5A7NA 5JI9A 2R32A 1F31A 3POFA 2FDHA 4XBLA 3BIEA 5A6YA 4AI0A 1QXRA 4FCAA 4N53C 2EIDA 3VBHC 1W9YA 3N9QA 3P3NA 1XNCA 3AXEA 4LHSA 5ANQA 3U1XA 2KA3A 2GNBA 4JGYB 4FPCA 1QJY3 2FQPA 4TTGA 3H8RA 2XH6A 1HQWA 3AYAA 4UWDA 1AX2A 5ABJA 1AR71 1JU4A 1HXS1 5DPNA 5J1XA 1UMHA 1WW4A 1ACCA 1UX7A 2JDHA 3GDBA 1ONAA 2QTWB 3SKVA 4UW4A 2VNVA 4B7KA 4NWWA 2D6MA 3O1RA 3DKQA 2P3YA 3W5MA 3DPRB 3BB6A 1W9WA 1DQ6A 2GMPA 1G9DA 1M4WA 2IZWA 3RMYA 3ZOIA 4A7KA 4GMP3 2Y6FA 5I0SA 3VBUA 5CIRA 5LA2A 1ENXA 4W50A 2ENRA 1O4TA 2CAVA 3WEZA 2X5IC 1QJFA 1UZVA 1R082 1H9PA 1PZ9A 2GAUA 2W2IA 4ZONA 3WDUA 2ID4A 5DUXA 2DFBA 4UF0A 4RQPC 2QNKA 1W3XA 2D93A 3GHNA 1CIWA 1H4GA 1AXKA 3U37A 2NN8A 1PGL2 4XXAA 4GH4B 3DV8A 4TXWA 4UAPA 5D8AC 4HPKB 2R041 2VGDA 1C5HA 3MIFA 5GZGA 1NXMA 5LA0A 2GN3A 1PVC2 4MUVA 1BQPA 3MDPA 3AJYA 4LO5B 4QWNA 3GF6A 1XYPA 1RUE2 3PUQA 4O9EA 4RGGA 1UYPA 2PXJA 5DZFA 2BVBA 5JSRA 2VCBA 3J7LA 1GNYA 1LULA 3V0AB 4CCCA 2ZA9A 1QNYA 5FREA 3K46A 2VUAA 2W52A 3VZJA 1AYM1 1YQ2A 1ZZ9A 1TE1B 1GZCA 2DTWA 4BYYA 4FPKA 1NUKA 1H8TB 1S0IA 4HSLA 1KS5A 5F3IA 2ZPXA 3OCPA 3K48A 2Y6JA 2OS2A 1IS3A 3NAPA 3VZNA 4E2SA 4EN7B 5F5CA 3C7FA 1EV12 4HL0A 3BYWA 1R083 5FY0A 2WZEA 4E9KA 2WWUA 3ROUA 3TRSB 1WCQA 1OOPA 2D40A 4P9LA 1UYZA 5F1RA 4E27A 4QPIB 3BOWA 5FYCA 2HBUA 4WM7C 2XKOA 4AOCA 1WMDA 4Q4Y1 4QPGC 3VB9A 2ZGMA 1LOFC 1AR72 4BDVB 1HXS2 3S5QA 5ISLA 2XJRA 3WG1A 1VRH1 3D5OA 3WT3A 1V0AA 5FYYA 5CBLA 4OVEA 5K0UC 1VLNA 4NPRA 1N1TA 4GALA 4CP0A 3IPVA 2O1QA 1QOSA 1RUE3 1B35B 2PFWA 3B02A 1NQDA 5FLIA 2BPA2 1WA6X 3I4IA 5A3MA 1VR3A 2WLQA 1K42A 1JS9A 1A78A 5IUQA 1UPSA 2JEMA 2GP5A 3V56A 1G86A 4EZHA 4XURA 4MHUA 1U5IA 1T2XA 1ND2B 3AYDA 3LEKA 4HVOA 4META 4B7EA 4GXLA 5FZAA 1V6MA 4C90A 2I2SA 5A1AA 1CQ9A 5FK8A 4AZZA 5I8YA 1LNSA 1EV13 3I7DA 3R4SA 4XFFA 1W0PA 4Y20A 3S7EA 2QVSB 4OMCA 2Y6KA 1NA1A 3H42B 3ELNA 2QQPA 3FX3A 4GIQA 5LATA 4BQ5A 3PMEA 5FZ9A 3KMHA 4OHVA 4YVSB 5H9SA 5IT6A 4DEQA 1AR73 2LM3A 1HXS3 2UYBA 5FLJA 3USUB 3S0MA 3VBOC 3RJRA 1UOFA 2BWAA 4YVWB 2WNVC 2A3XA 4BWOA 5CFCA 4LA3A 4WM8A 3NJXA 1W6NA 4OHZA 2OVUA 5T54A 4ES8A 3A22A 4HOOA 4WVWA 1V6OA 4AVVA 3ZYPA 2VMGA 4AVCA 3M4FA 3AZVA 1CAXB 2JDKA 3T1MA 3D0JA 1HN0A 4AEDC 1CVNA 3VD3A 5JDBA 1K5MC 1O3TA 5FZ6A 3E5QA 3ON7A 3VDCA 1GOFA 5F5IA 3ZXGA 2EXIA 1CAWB 1W9FA 2XOMA 1NE6A 2WLPA 1JHJA 4HT1T 5T3NA 5C4WA 1EUUA 4HKLA 3B5LB 1ZZ7A 1QH7A 3FFZA 2J1EA 3IMMA 3UGHA 5AC92 5C8CB 3T30A 1JN2P 3ORJA 3LF7A 1O4YA 4Q4Y2 2ZCWA 3JXSA 3NV1A 4COZA 4QT6A 4CP1A 4W4ZA 3D3AA 1APNA 4UW3A 5J09A 4F7ZA 4BM8A 5FOBB 1PM4A 1VRH2 2RV9A 1C8M1 3KHCA 4FPJA 2VBBA 1W2NA 1KD7A 3TOJA 4H7LA 2JD4A 2XKPA 4QX2A 4LBNA 3FL7A 1XOYA 3O5SA 2ETEA 2WO3A 3WG4A 2C9KA 1ZX5A 1A34A 1NZIA 3RRDA 3LPGA 2IFRA 1DF0A 2DTYA 1WLTA 1XE0A 4QMAA 5EYXA 1OH4A 4L92A 4C8DA 2XLFA 4XUNA 3ZKUA 3P3PA 4PHZA 3WDTA 1WUVA 4PDWB 5EP9A 4CZSA 5C3OA 3ASIA 1FXZA 4JTNA 1FMD1 1JOPA 3UV9A 2GC1A 3WQBA 2WZR1 5CFDC 2DUQA 4FO9A 3EB7A 3ZFFB 5IAVA 3U07A 2W94A 2YMZA 5FZDA 4MGTA 1REEA 3OY8A 1WA4A 2CDOA 2WNEA 4KWLA 4ASMB 3PVOA 3PNAA 4Q4Y3 4KWKA 2BOJA 3OUHA 2YYOA 4QPWA 4DOUA 5IFTA 2XLAA 2NP0A 2VH9A 1J58A 2ZHNA 3U4XA 3NV2A 4Y26A 2P3IA 4ONUA 2DYCA 1QJX1 1VRH3 2RHPA 4A44A 2VQUA 4XACA 4DZGA 3M8LA 1QXJA 5A6XA 2WT2A 3AVSA 5A3LA 2UWCA 4F83A 2QQUA 3ACFA 4OCTA 3IN9A 2NQYA 1SCRA 5ABJB 4GB31 2FMYA 4QHOA 1HDKA 2ZGOA 1IS6A 4Q2FA 3DN7A 3THCA 2GMMA 2WZPP 3ZFGC 2MHFA 4SBVA 5BNOC 5FDBA 3NNJA 3WCRA 1A8DA 1SLLA 3POGA 4QB2A 2PHFA 1XYOA 5JXJA 4M0HA 1UU4A 2FDFA 5L7OA 3GZAA 1GP6A 2ARBA 1O8PA 4TSVA 2IXJA 5FP3A 1Q8QA 2XJPA 5HV4A 1IS4A 1OLRA 1POV1 5JUVA 5KBFA 3FLTA 1N3PA 4P14A 5KWRA 1OPOA 1KJLA 1QWRA 2A1XA 4IDZA 2QQJA 3SQOA 1ZZCA 5G04L 4A41A 1LU1A 1AHSA 3H7YA 4TYSA 2O8QA 2VMFA 4AQ2A 3IIIA 4Q8LA 4O7XA 5FY8A 1STMA 3RJ2X 3ETQA 5F39A 4FOVA 2Q1MA 3HVDA 1SLIA 4JTOA 1P8JA 3BVCA 4PI2A 1LEDA 1DQ1A 4JHZA 1BMV1 4EN0A 2A6ZA 4AYUA 2XUMA 1MVEA 4XEZA 2R061 3NV4A 5FMOL 4QX8A 3WINE 2JENA 4ORFA 4HN0A 2ZGKA 4K3UA 2A5ZA 1COV2 4IGPA 1UY4A 5FXWA 2FCTA 3RYPA 5HCBA 5B2GB 1FMD2 2BGPA 3A0KA 2WZR2 5AFBA 1CX1A 4EE2A 3IDEA 2NMNA 3RI8A 4IE5A 1HRI1 1UKRA 1XRUA 1CR7A 1ND3B 2RR11 4E4HA 4FTSA 4W6XA 1S55A 2D6OX 3MLLA 3PU3A 1W6PB 5IYYA 5EJ1B 2WZ8A 4I2OA 3NAPB 1VRBA 1QQP1 3CIHA 3LSDA 2WABA 4XDOA 1QJX2 2PHUA 2A3YA 4MGYE 4NO4A 1X8MA 1EYBA 3H1WA 1XC6A 4IE0A 2IXKA 2VVDA 4XJAA 2J42A 1Y43B 5J7MA 2R7EB 1W2AX 2WO7A 2EVXA 5SV5A 1W9SA 1RHI1 3KV6A 5IFPA 1HQLA 1Z7S2 3DEMA 2Q4SA 3GM8A 3WW3A 4CCDA 5M0TA 5K7PA 5I93A 1E5HA 2W0XA 4NVPA 3IDAA 4YYOA 1W2TA 3GALA 2KD7A 5F9TA 1IKPA 3WW1A 3ZYHA 5C9AC 3IPVB 2RS51 1W6OB 2DWRA 4BE3A 1CZTA 3RWNA 3ZDVA 1FMD3 3K75B 2QQLA 1SHWB 5FP8A 3ZYIB 3WNNA 2XVLA 3AC0A 2WZR3 4D7TA 4LBKA 4MYEA 1MS9A 3SITA 4YW3A 4DQAA 4BMBA 4A6SA 4CEYC 4PCRA 1YWKA 1GKBA 2KR2A 2TEPA 2JE8A 4ISQA 3ZSKA 2ARCA 2YFUA 1V6LA 4I0WB 3N4MA 4LLOA 3GBWA 4NUBA 5FZEA 4EWAA 1DQ4A 2Z2SB 2R071 4GA9A 3PTYA 1ULPA 3RMXA 4D7YA 4FTBA 1UW8A 4K40A 1JW6A 4ARYA 2VW1A 2VZ3A 2WAOA 1QJX3 4IEUA 4RS5C 5FP7A 5CA6A 2PN5A 4Y20B 2VMHA 1NA1B 4CYDA 2RS31 1O4ZA 4ZZ5A 1XU1A 3IWZA 4JGYA 2YG0A 4XFHA 1HV1A 2GN7A 4KWUA 5FYUA 2QQIA 3LDKA 1KFUL 4FVVA 1OLMA 4MX3A 1NZCA 2VW0A 1RXFA 4QB6A 4GB33 1FV3A 4XUQA 4B8EA 4CU8A 4Y4YA 2NYYA 4ISRA 3ZLIA 1IS5A 2WYFA 1TG7A 4XF3A 5CFCB 1W8WA 1O6UA 1WBLA 3I3QA 3OB8A 5KXCA 4MGQA 2JICA 3RZMA 1GQPA 2WN3A 3DPRA 3WDVA 4PQ9A 1UOGA 2BRTA 3I54A 1PZ8A 1HRI2 1X9TA 2WRAA 3J8F1 3MLKA 1POV3 1DU3D 3WOGA 1AX0A 2RR12 4ZU7A 1LECA 1GOGA 5F7UA 2AH2A 3JB8A 1F8VA 2JJ6A 1OXCA 2PQQA 4BXFA 2BERA 2XJVA 4D94A 1UY2A 2VM9A 1F35A 1ULCA 3DECA 5C4WB 2A6WA 2W1SA 4G3YC 4YLZA 1EP0A 5I0RA 1ZYBA 1POQA 3KT1A 5JPMB 4YZ2A 1US2A 4LXLA 1RHI2 4IE7A 1ZA7A 1FPN1 2CGOA 4ZS2A 4GH4A 4JV4A 3UGGA 1HJFA 4B3NA 2WBKA 4OFGA 3F95A 4HPKA 1UZ0A 3WR0A 5LK7B 3E1F1 4QU1A 2ADDA 3MIEA 2VPVA 2Y34A 3PMSA 3U11A 4N90A 1I1EA 3W59A 3GCWA 4OHYA 1AF9A 4LEJA 1WZXA 3HR9A 1WGPA 1XSRA 5DXDA 1IKQA 3E6DA 4XBNA 1NCQC 3WP3A 3HPNA 1QJZA 4QQPA 4YM3A 3UJOA 1MQTC 2VMEA 1SCSA 4P02B 3I2IA 4L97A 4S2GA 4BMEA 1QKQA 1HRI3 1UOJA 2W68A 3AXDA 3B7MA 4OZXA 4EWEA 5FR3A 1ULEA 1H8TA 2RR13 3VL9A 4W6WA 3GZUC 3WLUA 1NKGA 4PJYA 2D3RA 1UXXX 1YQ6A 4XJZA 3DUIA 4CU6A 5C33A 2E32A 1QQP3 3BN6A 1AYN1 1BK1A 3C2UA 2B46X 3MW4A 4H14A 5CNAA 1Z0HA 2ZGTA 3A0NA 5JOWA 4XJ9A 3THDA 2L9LA 3MIGA 4YFWA 5F3EA 4A4AA 2J1UA 5AFEA 4CXYA 1VMHA 5KXDA 5F6KA 5T5PA 3KZ4C 1JZ5A 4XDQA 5FTTC 3MIDA 4YZ4A 3TYJA 2X5IB 1RHI3 1N1SA 4Y33A 5BPXA 4GMP0 5LEKA 3FUOA 1JBCA 4RQPB 2HWF1 2XLGA 4FOQA 4YW7A 2VW2A 1PGSA 4K20A 1S2EA 3RZZA 2VUDA 4DXSA 5GALA 1WMEA 1LB2A 1B35A 4LOSA 5GLWA 2ZGLA 5D8AB 5DN2A 3MV11 3BUCA 3DL3A 2ZHKA 3FHQA 3QACA 3J8F2 2ZEZA 4AF9A 1GSLA 2ARAA 2XHKA 2CWSA 4XJWA 4PIXA 4TN7A 1VMJA 1X9PA 5EZWA 4HKOA 3O1PA 2G9FA 5FZ3A 4AXOA 1W99A 1ND2A 1QH6A 3I2GA 3NJZA 4YG0A 2ZHMA 1VBB2
chains in the Genus database with same CATH topology
1LU2A 3MGUA 2R073 1URXA 3D4KA 5FFOC 3ZX7A 4IEQA 1MS8A 5L7OB 4AFDA 4E4DX 3E5XA 4CDUC 2ARXA 3VHOA 2DVFA 2YV8A 1IGOA 2O8OA 4FP3A 1EAH2 2QDNA 2QKDA 2K0GA 2YZ4A 1F2NA 4YVSA 5JWPA 3N7LA 2B39A 4WBBA 3VBRC 2BTVC 4YZ3A 2E7AA 1UPIA 4YVWA 4WM7B 4NOTA 2B45X 3AKPA 3WP6A 4YZ1A 4E2GA 3OPZA 2ERFA 2QZ3A 2XPJA 4RGAA 3O7OA 4XFCA 1GQHA 1X36A 3UKTA 1ZZBA 4CDQC 3J8F3 1CAXA 3GBFA 2CGPA 4GWNA 4IXLA 3VLBB 1J1LA 5CVRA 1W2UA 3O0VA 5J3UA 5I8TA 2EXJA 2Y26A 1KRIA 4IEPA 5HXVA 1CAWA 1RGSA 1J3QA 3ZXFA 1DIWA 1YIPA 2WS92 2X8KA 2D6KA 1QGLA 3CJIC 3IM0A 1JHNA 1R1ZA 1BJQA 4XETA 4A7ZA 4XW3A 3D0SA 3VGIA 1SACA 4HN1A 4RR3C 1PK6C 4PIZA 4AQ6A 5EJ3A 2CTVA 2PAMA 2HWF2 1NY71 1UZYA 2DUPA 1RUC1 4PBPA 1SMVA 4DB5A 2JG8C 4S2FA 4FPLA 1DZQA 1PO11 3VBOB 5DUWA 4EN6B 4Q0PA 4LLFA 3AFKA 1FI2A 1QU0A 4P9WA 1FNZA 2XB6C 4XBQA 1EY2A 4AEDB 3ZFEC 1K5MB 5FPZA 4WZFA 4AVBA 1X82A 2E6VA 3ZFFA 1OQ1A 4PBOA 2WC2A 4K9SA 2DU0A 5D1IA 1XU2A 1C4RA 4Y1VA 1H1MA 4B4QA 2K2SA 4IV1C 2A6VA 4CDXC 1SEFA 4DINB 5CG9A 5JAXA 2HWF3 3AZZA 3MW3A 2XL9A 4YRDA 3MFAA 3NL1A 1LOAA 2MEV1 4N43C 1DQ2A 1D0GA 1PIV1 3H8UA 2HWB2 1AR81 1RUH2 1W0OA 2VVEA 5H9QA 1TQ5A 2HEVF 1NCRC 1X7NA 4F3JA 3JQWA 4JAAA 4XFIA 3ZN5A 3X29B 1VP6A 5JZGA 1W39A 3AZYA 1O3RA 4JC1A 1CAUA 2H0BA 1NYWA 4Q1PA 4LBQA 2D7FA 2FHRA 3RG0A 2AZ5A 5JOXA 4IQPA 4YGCA 4QGMA 1QHDA 1XQNA 2HWE1 4HVQA 3AP5A 4AEJA 5K8SA 3FUQA 3OJBA 4AGVA 5DG2A 5CFDB 2IXIA 1N1VA 3LA2A 1NY72 2CWMA 4AVSA 1RUC2 1ZBA1 3M3EA 1OPMA 1BKZA 1LENA 2E7QA 4E4ZA 2DF7A 2H0VA 4Q27A 3IT8A 4Q0VA 3FLRA 2B5HA 2DVAA 1S0CA 1RUH3 2HWB3 4G4FA 4XHXA 2D6PA 2A6XA 2WNUC 3L2HA 4AQTA 1ENQA 4COVA 1FYUA 1ZRRA 2RS11 3U10A 1JUHA 3ZFGB 1TNFA 1PO21 2B8MA 3EO6A 4KNCA 1CGPA 5BNOB 4XTPA 2GALA 3NSTA 2D44A 1MS5A 1MS4A 1ND3A 4AFAA 3AP7A 4P5HA 1W6PA 2ZX2A 4COUA 2JG9C 2DCKA 3WW2A 4JGZC 4NHLA 3SNMA 1SBFA 3CEWA 1RUC3 1Y3TA 5A33A 1WD3A 3LKJA 4NN0A 4R52A 1CJPA 2V5YA 4QX5A 3EXUA 2MEV2 2PHTA 4RD7A 3ZIXA 2RM21 4ITCA 3POWA 2VG9A 3MIBA 3TWIA 1C3HA 1PIV2 3USSA 4XFGA 3B3QE 2ILMA 1IPKA 1VBC1 4Y1UA 3VUOA 4GKYA 3OTFA 4LULA 2VMIA 4LE4A 3DKWA 2E51A 4I3PA 4PLNA 3ME2A 1W6OA 3MZHA 5LEJA 2JX9A 4BA6A 2R1BA 4Q1RA 2DURA 4WVZA 3DF0A 2SLIA 2ZOEB 3AKTA 3AP6A 4FBFA 1LGBA 4CEWC 1ULFA 2LALA 4FPEA 3CNAA 2DVGA 3JU9A 4MV2A 2ZGNA 2BQPA 2PA7A 1O3SA 1YXWA 4XIKA 3VDDC 2V09A 2C9AA 1GZWB 1S0DA 1ALYA 1YRZA 1OFNA 2VOKA 5FLHA 3ZPYA 1JUIA 4S2HA 2RJKA 1ZBA2 2XWJB 3N35A 5BNNC 1AL21 4QU2A 4NWVA 1MEC1 3FMGA 4QHBA 2MEV3 5JOYA 1JOJA 1O5LA 3HT1A 1PIV3 3V0BA 2YPJA 2R042 1AR83 3TN91 2UY9A 3VKFC 1AUYA 3ILNA 1FX5A 5AVAA 3H1MA 3ECQA 3H9AA 2AUYA 3S30A 4YGBA 2RS12 4A2UA 4IV3C 1OMIA 2NPIA 2VQAA 1PO22 2HWD1 1J3PA 1AYM2 3KM5A 2A7AA 4DFSA 4EWDA 1PMIA 2XVGA 3MLJA 3MF6A 2DCYA 5C9AB 2R0FA 4A3XA 4I0AA 3I59A 3BALA 2HWE3 2ZGPA 1H4HA 5J36A 4V1PA 4KBBA 2VECA 1YO8A 1RUD1 1RC6A 1LJ7A 4ZXKA 3N3HA 2DFCA 5T50A 2EXHA 1HRV1 4CEYB 3HIFA 2Y0OA 4FQZA 2G9GA 4M0NA 1ZBA3 2AENA 3AK0A 5FO9B 3TAYA 3UJQA 1JH5A 2E7TA 2BGCA 2ZMNA 4WVMB 2WJSA 4CDXA 4J6GA 4XFBA 4HFSA 4RS5B 3SLIA 2OPKA 2I45A 4N53A 3VBHA 2R043 2EIGA 2PTMA 4Q26A 3V65A 4CDWC 2F4PA 1H2MA 4K7JA 4IEYA 3OGGA 2GMEA 3LOBA 5DZEA 4RFT0 2RS13 3AB0A 1QMJA 1NCRA 1PO23 3ST7A 2GNTA 1AYM3 3RNSA 1HW5A 1AR61 3WQ0A 2WQZC 1UF2C 2OUJA 3ZSJA 5T55A 2GNDA 4EV0A 4XILA 4K21A 3E97A 2RE9A 1RITA 1UU5A 1C1FA 2A73B 3WG3A 4H55A 4FP2A 1OHFA 1S2BA 5K9YA 2WKKA 4QGNA 5FCCA 3POSA 1AL22 1MEC2 1J1TA 4PLMA 2RM23 2X5IA 1POV0 4U36A 2ZX0A 4BIFA 4X6QB 4BOWA 1VBC3 1UCXA 4YM1A 2VVFA 4RQPA 1H2KA 1A6CA 2RJLA 4GKXA 1H9WA 4YW5A 4XMIA 1G7YA 1SDWA 4QQHA 5D8AA 1DBNA 2DCJA 5BNPC 2JDZA 3VN4A 5AVPA 3WHUA 1BZWA 5HCAA 3APBA 3N7JA 2P3JA 1LOEA 3MI8A 1RUG1 1LESA 1MQTB 2CY6A 5JZGB 1HRV2 3VKNA 4IEXA 3URFA 3WVJA 1CAUB 4OLLA 4LBQB 2ZJCA 2JECA 2Q0AA 1AL23 1D4VB 1MEC3 2X29A 4AI3A 3OBTA 1S2KA 3R05A 1AL0G 3LA3A 4XF1A 2RMU1 4JDOA 4AE2A 4EN8B 5I0UA 4JVAA 4JCKA 2I74A 3H7JA 4HANA 1C8M2 1Z78A 4Q29A 2YC0A 4WM7A 4RA0A 4LUKA 4C1XA 4QPGA 4UXAA 4XF4A 1LOFA 1ULDA 4PF5A 2ZGQA 3AZWA 4K1ZA 5K0UA 1AR62 2HEYF 2DVBA 2O0OA 2XBO1 3THTA 5IK7A 3H0OA 3IMNA 4KGGA 4QPIC 3AZXA 4K8FA 5L36A 3NVCA 1LKNA 3SCHA 3SCGA 1HRV3 5BY5A 2VULA 3O14A 1ASJ1 3WQ7A 3H50A 3OBRA 2BFUL 3MICA 4L11A 3MYXA 4YW4A 1W6MB 3KD4A 5KHGA 4N9IA 4AK3A 1IQAA 4R9AA 5JVVA 1KFXL 3KLSA 4AI1A 2R1DA 4CDUB 3RYRA 1C8M3 4YW2A 2D43A 5A33B 5FO7B 4B4RA 1Q56A 4SLIA 3VBRB 1WBFA 5GLVA 3AMMA 1LHNA 2TUNA 4ZKTB 2VY0A 1V00A 3VBOA 2IXLA 1XE8A 5HBAA 1CAVA 2WNVA 4GB32 1AR63 2AGSA 3TBDA 5JR7B 2IWGB 1PNGA 1PHMA 2GZWA 3GZTB 3IIAA 3LA7A 3O0XA 5JPNB 1ZREA 4AEDA 4AQSA 1K5MA 4NR1A 2IC1A 1H8VA 2JXAA 1WCKA 1WCDJ 1QJU1 4C0BA 2VOXA 3ACLA 1RTVA 4R4XA 5J37A 2ZMKA 1AX1A 1DQ5A 1RJ8A 4Q8KA 2UU8A 1QY4A 3CJIB 4M3CF 3B93A 5T5JA 5JLVA 5FO8B 2CL2A 3ZXEA 1HIXA 1HX6A 2WA4A 2E53A 4XF0A 1YFXA 3E6CC 1REFA 4RR3B 4E4SA 3VBFC 2PLV1 1L3JA 2P2KA 1BMV2 1TME1 1UAIA 3B94A 3LSEA 3V0BB 1NE4A 2D5FA 2R062 2D3PA 2XBO2 4AI8A 5C8CC 2IXCA 5BXXA 1YFYA 1GV9A 2JG8B 2WFF1 3VBSC 2W39A 5EV7A 1FAYA 3IDCB 2EAKA 3M3IA 1ASJ2 3AYCA 3AKQA 4I0BA 3WCSA 4H7MA 1OD5A 2CYFA 4COYA 1YI9A 1AJOA 1CPMA 4O9GA 4YG6A 3I59B 4R9DA 3BTAA 4R4ZA 4Q4W1 3OD0A 5CFDA 1QQP2 5GJ6A 2ET1A 3M1HA 2XL7A 4L9BA 1DGWX 3D8CA 3RQ0A 4XMAA 4A7YA 1AVBA 3AX4A 5HCFA 4E2QA 2VU9A 2VNRA 2KXLA 3JBG1 4MXWB 4IV1B 2C0ZA 4FPFA 4CDXB 4Q0UA 2D3SA 2WT1A 5KHIA 4FOWA 1BVP1 3M3QA 4TZDA 4OHXA 5CU1A 1IPJA 1ZA4A 2A3WA 3N7KA 4N53B 3BCWA 3VBHB 2XBO3 2R063 4LO4B 4I3GA 5DUUA 4W6YA 1RB8G 2FMDA 4N43B 4RHV1 5FRAA 1D4M1 2GC2A 2VQ0A 3WZ1A 2RS52 3VHRA 4MZUA 2ZS6B 2OIIA 1CONA 4J1XA 2PYTA 1ASJ3 2FZ1A 3ZFGA 4M3CB 1NCRB 3L9JT 1QXPA 3ZXLA 5BNOA 5GLTA 1RUI1 2QFEA 4Y1ZA 4DY3A 4W65A 2Q5TA 3TB0A 3FFQA 2R072 4AFCA 3ZXAC 5ABJC 3ZDSA 3VKLA 5LK5A 3M2MA 5JCTA 3ZYGA 2RS32 1AZDA 2VXRA 4U2AA 4N9HA 4JDMA 2XJSA 1BXHA 3H3ZA 2BBVA 5FQ0B 1AXZA 3HN1A 3ZYRA 1WMFA 4MLOA 1XNBA 2BFUS 4X8NA 2FBEA 1Y7BA 4YGEA 3B69A 1V6JA 3EQEA 2GSYA 3UL2A 4MSVA 4XTMA 4AVTA 4ASLA 4WV8A 2ATFA 2ZHLA 3VL8A 1ZVFA 2GC3A 2RS53 3VBUC 2QUOA 1GBGA 5L19A 2A70A 1KDKA 3B00A 4LA2A 4LBMA 2VOWA 1G9CA 2ZGUA 1OA4A 5C6CA 4OI2A 2YGLA 4IEWA 2ZBJA 3WP5A 1DGLA 3JZVA 4Q4W2 2XVKA 4FQ4A 4ES9A 5BUVA 1GZWA 4AFMA 1CD3G 4CRQA 1LTEA 1ULGA 4FPHA 2EALA 1MACA 3O0WA 1PZ7A 3GNEA 1SLCA 3R6SA 1DGRA 2RS33 1TMF1 1ZRDA 1H30A 2JG9B 1H1IA 4BCUA 2CGNA 1FPN2 3POYA 4JGZB 1YJLA 4MGIE 5I0TA 1S0JA 1QDOA 1GNZA 2K9ZA 1V70A 2WSVA 1GANA 4RHV2 1D4M2 3KB5A 4QPGB 4QXKA 4P9IA 3T1LA 1DZTA 4XHBA 4XFAA 3NO8A 1FT9A 1NLRA 4I09A 3NAPC 2Z79A 3JD71 2ZACA 3SH4A 4B29A 1OLQA 5K0UB 1RUI2 1SBEA 4KU8A 4LBQD 4IESA 1QNWA 3WUDA 5C9AA 1S0EA 1O7FA 1OOPC 4Q4W3 2F6BA 5E8AA 3UKNA 3VZKA 5IK8A 4LT5A 1AYN2 2HWC1 4CEWB 1VBE1 3ZN6A 4CEYA 1YLLA 2GH2A 2ZAAA 4EJRA 3VDDB 4WVMA 2R0HA 4I30A 4K1YA 1SLBA 1U5YA 4FPYA 1FPN3 4RS5A 4I02A 3KQRA 1WW7A 1UU6A 2A71A 3A4UA 4FAHA 5BNNB 3AJZA 3WW4A 4DRRA 1LHOA 4FOYA 4RHV3 1WLDA 1D4M3 3HWJA 1LOCA 3QCWA 5LRRA 4QQLA 5TSWA 5JSPA 3LAGA 1M06G 1Q43A 1XNKA 1IOAA 1I5ZA 1G9BA 2D6NA 2Q1ZB 4P9YA 1CAVB 2QJVA 1UMZA 2WNVB 3PJYA 4Q0QA 1J3RA 1RUI3 5JIUA 1MS0A 5DG1A 1NA1C 3RS6A 4IV3B 2EA7A 1GR3A 4KG0A 2ZTNA 1Q5OA 1AYN3 1V6NA 3WX5A 1SLTA 1DHKB 4RL7A 5FOJB 1TMF2 4LE3A 4NHMA 1LGNA 5CFCC 5GKAC 1R1A1 1AXYA 2MPFA 4WM8C 4XQDA 4P9JA 4LNVA 1A8MA 3S6PA 4GULA 5T5OA 3K51A 4TLFA 5T5LA 4AHZA 1PVC1 2XJQA 2WIIB 2WWSA 1TEIA 2LUWA 4HZFA 1YI7A 2Y0IA 1GICA 1U5ZA 3JD72 2X53S 2HJIA 4BLIA 1UKGA 4XJUA 2D97A 4LBLA 5C4WC 4FPGA 3ALQA 3ES1A 4HBNA 1NCQA 3UKVA 2YY1A 1OFSA 3VKMA 3PVEA 1MQTA 2HWC2 1VBE2 1EV11 3OYWB 5I8SA 3AYEA 3WY6A 1U5XA 4M3CE 4HSJA 2QCSB 3WQ1A 5ACA1 3ZIWA 1TMF3 4CTEA 3N36A 4Q4X1 2XG3A 1UIJA 3EHKA 3W58A 5L73A 4WVVA 2AR6A 1S0GA 3D82A 3G7DA 2UURA 5GZEA 1WLWA 1DYPA 3NW4A 1LHVA 1VAMA 2DUOA 1PO12 1SBDA 3JD73 5EYYA 3IBMA 3QBQA 2G4IA 4OULA 2VOVA 4K6BA 5J98B 2CAUA 4LR4A 5BNPB 3LCPA 3FC0A 2HWC3 1VBE3 2YGMA 3BU7A 1ZRFA 5GZFA 2WFPA 3WDYA 2NMOA 5EWSA 1G6NA 3ZVXA 1OQDA 2Z69A 2BUKA 1XNDA 3WD5A 1VBA1 1R1A2 1LHWA 2A75A 4YGDA 1PGW1 1W6MA 1ZM1A 1AR91 5GLZA 3J4UH 1KDMA 2BYVE 4Y22A 4CDUA 2I07B 3PLQA 3DGTA 1KQRA 2PHLA 2Z42A 3D6EA 4B4PA 2JE9A 4FPOB 2ZABA 3VBRA 4GWMA 1VAVA 1KJRA 1PO13 2WINB 4OUSA 1CESA 1FV2A 1AR82 4L99A 5L7OC 4HK9A 3Q9OA 2XJTA 4XIOA 3BODA 4IETA 2QDRA 1SFNA 1V6IA 4IEVA 1DLLA 4ATEA 4I01A 4AGRA 4CDQA 4OI0A 4XQ4A 4C1WA 1OQEA 5EFUA 5AC91 5ACA2 4DXZA 1W6QA 3WDXA 2HWE2 1WD4A 4Q4X2 1NXD1 5J48A 1R1A3 2FZ2A 3GHMA 2MNGA 2BEOA 1UX6A 2DCZA 4Y1XA 3CJIA 2HEWF 1VALA 4QM9A 2IXHA 3NKTA 4KWJA 1PVC3 2D5HA 4BPZA 1SLAA 3MPPG 2HKXA 4RR3A 1NLSA 1PK6A 3N7MA 4QQOA 4EROA 2ZX4A 1MVQA 4BQ1A 1F5JA 1WW6A 5GLUA 4AW7A 5J96B 2GH8A 3QD6A 2Z5WA 2JG8A 1LGCA 1Q8SA 1MR5A 1RUOA 1D2QA 3WG2A 4F8AA 3CF6E 3BPZA 3FWEA 1JYCA 1LOBA 3FHIB 3B9IA 4YSFA 3NKGA 5ACA3 4FT8A 2PAEA 1VBA2 4OI4A 1Q8OA 1CJDA 1O3QA 3KCCA 2B42B 4Q4X3 1PGW2 5JOZA 4AEMA 1AR92 3ZFEA 1HLCA 2PELA 1H2LA 2ZZJA 1UD1A 4Z92B 3ZN6B 3M3OA 1OSGA 1OA3A 1RL3A 4Z1VA 1OI6A 3ATGA 3CO2A 4MXWA 3PVNA 4IV1A 5KXEA 4P9GA 1IHMA 2RM22 1I6XA 4WZCA 2ZMLA 4R8HA 1VBC2 3RPQA 1MS3A 2YUEA 4L8QA 3EBRA 3KT7A 3VBFB 1KS4A 4N43A 4OUMA 1J59A 5BNQA 1KITA 3FE5A 3L2YA 4HMZA 4MXVA 5E1RA 4AEKA 1VB4A 1PVXA 2N7GA 5JI7A 5T52A 4M3CA 3J26N 1Q8VA 1LODA 3VBSB 2P3KA 3V64A 1YFWA 3SHRA 1VBA3 1B09A 4FSJA 4DS0A 3GBGA 3VZMA 1XE7A 4JGYC 5A32A 1AR93 2YDEA 1D0HA 3KSCA 1N1YA 1YJKA 2WSUA 3C3VA 2WA3A 5KHKA 1PM7A 2E9QA 4YG3A 2R16A 5JSOA 4Z82A 3WHTA 3KGLA 4X8PA 5FQ0A 4GQ7A 3KT4A 4H3WA 3TN92 3JQXA 3DPRC 1GYKA 3WXPA 1X50A 1COV1 3VHPA 4YZ5A 3RI9A 5JIAA 3RYKA 3R0RA 1FATA 4XPVA 4D7SA 1ZRCA 5GZCA 3H3UA 1DDLA 3ZSMA 2UWAA 2HWD2 1YHFA 5IK5A 5AC93 1Q3EA 2P17A 1JYIA 3ENRA 4HLTA 3I8TA 2WNUA 4P9XA 1FNYA 1YNAA 2BNMA 1NCQB 2V73A 1RUD2 3MPBA 1UIKA 1ENRA 4GH4C 5FAXA 2DVDA 2E63A 3VZOA 5KHHA 1V6KA 4FTEA 3O12A 1Y9QA 3RSJA 2Q30A 3PHMA 3AMPA 3QOPA 3HBZA 2JG9A 4Q4V1 4AVAA 2TBVA 5E16A 1BEV1 4JGZA 1Z7S1 3R4UA 3ZSLA 4JRLA 3INAA 1CX4A 1MZ6A 3AKRA 4AI2A 2KM2A 3TN93 4TWTA 3SH5A 4XZPA 3FBMA 1RINA 4UW5A 2D6LX 3HT2A 1RMU1 1H8TC 1DQ0A 4DRVA 1JTZX 4S2DA 4BHPA 4Y5Z0 1I9RA 3E6BA 2PHXA 2HWD3 3ZYJB 4IEOA 5KC5A 5H9RA 4DPNA 4IEZA 5H9PA 4BZ4A 3ES4A 3VBUB 3ZMNA 3LZZA 5DDJ1 1OKQA 5BYNA 4ZU4A 3ZO0B 1F9KA 1RUD3 3E5UA 4CEWA 3TNQA 2OZ6A 2ZGRA 2DU1A 1RUJ1 3W9AA 1QOOA 4AFBA 4IERA 1LHUA 3J9SA 3VDDA 1R091 4OI1A 5E88A 1B35C 5CAZA 3MFCA 2BWCA 4LUMA 2XGXA 4Y22B 2VNOA 3WDWA 5BNNA 2NLRA 1DGWA 3PJQA 1MZEA 3HAGA 1GFF2 4KGQA 1RUF1 1G8WA 1ND2C 2LTNA 3AFGA 3NV3A 1H0BA 3HD8B 4X6RB 2W08A 2ET7A 1S0FA 4IL7A 4L2NA 1A3KA 4C0HA 4KH9A 4AGGA 3HMYA 4LBOA 3FJSA 3JCIA 1JXNA 1RIRA 2EF6A 2Y38A 4QD2A 4Y1YA 1RUG2 4IV3A 4CDQB 3B9CA 5DUVA 2TNFA 4YVSC 3M7AA 4FAGA 1OA2A 4QM8A 2EAAA 2VNGA 5CB7A 1OOPB 3THPA 1G9FA 1C8NA 4LHLA 4Q4V2 4YVWC 3KS7A 1W6QB 3MIHA 1BEV2 2B7YA 3LOIA 4LHKA 1MZFA 2RMU2 3ILRA 4LO7A 2ES3A 2QZ2A 3T2TA 4FXKB 1DG6A 1U0AA 1BBT1 1LOGA 1COV3 1HV0A 1QOTA 4PLOA 3SH3A 5IK4A 1C57A 1RMU2 4M01A 4PIYA 5F5QA 1FOD1 1PK6B 5F6LB 4LO8A 1O5UA 4JDNA 4BLJA 3RDIA 3U0ZA 1UN1A 4HK8A 1CN1A 4CDWA 5E89A 4DMIA 1GZ9A 1ZBE1 1Q8PA 1UZZA 2UWBA 4YW1A 1YUDA 5DDJ2 3FBYA 3FZ3A 1YYNA 2GDFA 5GZGA 3WUCA 1RUG3 2GC0A 3JUUA 4N7UA 1YFUA 1PNFA 1QF3A 4R9CA 5JMCA 3OYWA 3GYDA 4XYXA 2DCTA 2ZKNA 1NQJA 1RUJ2 3QLQA 1H2NA 3IKWA 1R092 4J1WA 4Q4V3 1DZRA 1BEV3 1Z7S3 3ZFEB 2GU9A 2RMU3 2XJUA 4DY5A 2OZJA 4BIOA 3ZSEA 3WNXA 1VAKA 1LR5A 4WM8B 4UBGA 1RUF2 1RMU3 3AMNA 4AHXA 2JKBA 1W6NB 2QE3A 1H1AA 4JQRA 4N7IA 1N47A 2WL1A 3S7IA 4PDWC 4C91A 4Y24A 1LRHA 3NWKA 3KCXA 3VZLA 3LGRA 2AREA 1GQGA 4LBJA 3ZFFC 5DDJ3 2YXSA 1XXNA 2UYAA 1VBB1 3ZN4A 5BNPA 2BVVA 4YM0A 2BNNA 3IDBB 1F5FA 3ZXKA 1VBD1 1RUJ3 2OA2A 1UL9A 3BIWE 1QJU2 1HQNA 1R093 3ZXJA 3AP9A 2R49A 4HETA 5I91A 4KL1A 2WQ4A 1WW5A 1EAH1 4ZU5A 3PVBB 5A32B 1C28A 1LEMA 3CJXA 4D69A 1BBT2 5KHJA 4Z8BA 5SV8A 2H6BA 2BW8A 4ATFA 3SMHA 3R4DB 1FOD2 1MS1A 2PHRA 1ENSA 1RUF3 1VIWB 4MVTA 3V0AA 2Q8OA 2PLV2 4XJ8A 3SCFA 1NG0A 1TME2 5GM0A 5JZGC 4KU7A 1V9U1 1ZBE2 3AMHA 3VV1A 2EXKA 4XE9A 1RVF1 1WCSA 5BV6A 2WFF2 2PHDA 1C1LA 1KXGA 3B01A 5FMOS 1G9AA 2WS91 4FXGB 5CADA 5LRSA 1YIFA 1IZ3A 2PHWA 4AG4A 1ZNPA 1ZZ8A 3WP4A 1HKDA 5C8WA 4URTA 3LB9A 4QPIA 3HQXA 1QJU3 2C1FA 2WNUB 3OY8B 3OGJA 4BH9A 3AP4A 3VKOA 2R6QA 4INDA 3SISA 4HKWA 1BBT3 1GLHA 4YFZA 1N3OA 3CU7A 5KXBA 4COWA 1FOD3 3JBG2 1GNHA 1QJY1 1BYHA 2PLV3 5KC6A 1N3QA 1X33A 1O91A 1TME3 4AHYA 4LO6B 4MGZE 1DFQA 1ZBE3 4UBHA 2DV9A 5EXOA 1MZ5A 2YROA 4YARA 2ZZQA 2WFF3 3MEPA 4R9BA 1ND3C 1BVVA 4LHNA 5CG8A 2P34A 1WLCA 1VBD2 1VJ2A 2AYHA 4YM2A 2C5DA 4MH0E 3VHNA 1EPWA 2ZAHA 1E57A 2ZKLA 4GMP1 1I3HA 3EJKA 1DGRN 1XYNA 4G9SB 3G6JB 2H6CA 3H1YA 1ZZ6A 3USUA 2CNAA 4AHWA 2R30A 5FPXA 5HI0A 4XOGA 4Z07A 3SXWA 4M00A 2UY8A 2YHJA 3JBG3 1CPNA 2XWBB 2ZX3A 4Z2WA 2OYZA 1LCLA 3KCYA 2A6YA 1TNRA 4Q0SA 4OHWA 3ILFA 1V9U2 2HWB1 1RUH1 3M3CA 3MF9A 4XXPA 2B9UA 5FBZA 1DYKA 1BCXA 3TNPB 4JRAA 3VBFA 1RVF2 3OF1A 3ZXDA 2JE7A 1S0BA 1RUNA 1T6GC 4KG8A 2PAKA 1VBB3 1SFYA 2D98A 3BOPA 1YCIA 5GZDA 1VBD3 1U12A 2NZ9A 3ZMOA 5C8CA 3QH6A 3VBSA 3KGZA 2OUHA 1C5IA 2CV6A 2OW4A 1EAH3 3CLPA 4QPYA 3I2DA 3MW2A 1VB2A 1AJKA 3QH7A 1R081 4D3WA 3FLPA 2IFWA 3AMQA 1X8EA 3WV6A 4EN9B 3LWCA 1QJY2 4QGLA 3AM2A 1PGL1 3AKSA 4CP2A 1D2SA 2ZX1A 2WT0A 4XQWA 4NHKA 1SQ4A 5DZGA 4XF9A 1V9U3 4HVRA 1QDCA 4UW6A 1RVF3 3CL1A 3JB4C 4AWDA 1RUE1 4MGKE 4PDWA 1EPZA 4RSUA 1S1AA 2WS93 2P37A 2VUJA 2BNOA 1NOVA 4CDWB 4KQ7A 1REDA 2HYKA 3M70A 4LTAA 3UK9A 2ZGSA 1RJ7A 4YNIA 2SBAA 4DNYA 2NM1A 4QQ2A 3OD4A 2GNMA 5JI9A 2R32A 1F31A 4XBLA 4AI0A 1QXRA 4FCAA 4N53C 3VBHC 3P3NA 1XNCA 3AXEA 2KA3A 2GNBA 4JGYB 4FPCA 1QJY3 2FQPA 2XH6A 1HQWA 3AYAA 1AX2A 5ABJA 1AR71 1HXS1 1WW4A 1ONAA 4UW4A 4B7KA 4NWWA 2D6MA 3DPRB 3BB6A 1DQ6A 2GMPA 1G9DA 1M4WA 2IZWA 3RMYA 4A7KA 4GMP3 5I0SA 3VBUA 5CIRA 1ENXA 2ENRA 1O4TA 2CAVA 2X5IC 1R082 1H9PA 1PZ9A 2GAUA 3WDUA 5DUXA 2DFBA 4RQPC 2QNKA 2D93A 3GHNA 1CIWA 1H4GA 1AXKA 1PGL2 2NN8A 4XXAA 4GH4B 3DV8A 5D8AC 4HPKB 2R041 2VGDA 1C5HA 3MIFA 1NXMA 2GN3A 1PVC2 4MUVA 1BQPA 3MDPA 3AJYA 4LO5B 3GF6A 1XYPA 1RUE2 4O9EA 4RGGA 5DZFA 2BVBA 5JSRA 1LULA 3V0AB 2ZA9A 1QNYA 5FREA 2VUAA 2W52A 3VZJA 1AYM1 1ZZ9A 1TE1B 1GZCA 2DTWA 4BYYA 4FPKA 1H8TB 1S0IA 4HSLA 1KS5A 2ZPXA 3OCPA 3K48A 1IS3A 3NAPA 3VZNA 4E2SA 4EN7B