2G9GA

Crystal structure of his-tagged mouse pngase c-terminal domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
189
Chain Sequence
GRVSGSLAWRRKEILFIPSENEKISKQFHLRYDIVRDRYIRVSDNNTNISGWENGVWKMESIFRKVEKDWNMVYLARKEGSSFAYISWKFECGSAGLKVDTVSIRTSSQSFESGSVRWKLRSETAQVNLLGDKNLRSYNDFSGATEVTLEAELSRGDGDVAWQHTQLFRQSLNDSGENGLEIIITFNDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords peptide N-glycanase
publication title Structural and biochemical studies of the C-terminal domain of mouse peptide-N-glycanase identify it as a mannose-binding module.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 189
sequence length 198
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04721 PAW PNGase C-terminal domain, mannose-binding module PAW
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1020 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2g9gA00
2G9FA 2G9GA 2I74A
chains in the Genus database with same CATH superfamily
4L2NA 1NT0A 1VB4A 2DU1A 5IYYA 1GP6A 4ZU7A 1QJEA 2GH2A 4I02A 3AYEA 2BVVA 2EICA 2A7AA 2JG8A 4Q5OA 5HPOA 1W8FA 5CG8A 3ME2A 4WVWA 3NNJA 4LBQB 1R082 4P14A 4XF1A 1HDKA 4GA9A 3O1VA 4IV1B 2J1VA 3TOJA 5CFCC 1IPSA 4Q4Y3 3DXUA 1ASJ1 3CKHA 2V73A 1N3PA 3PMEA 4LK6A 2VGDA 3RZMA 3WZ1A 4ZONA 1OSGA 3WG1A 4OUEA 3G7DA 4A7ZA 2VL4A 2JB8A 4XABA 4NE9A 2B7YA 2VCAA 4LKFA 3HD8B 4IV1C 2ZGKA 4YSFA 4Z07A 5IHRA 1UXZA 2VW1A 5F3EA 3N9NA 1S2BA 4NPMA 4AGRA 2Y26A 4XPVA 3T30A 1RL3A 3IMNA 3VBRA 3ETQA 4K7JA 3VKMA 5ISLA 3AKRA 3ECQA 3APBA 5K0UB 1H6YA 3I2KA 5C8CA 1L7QA 2XJQA 1O4ZA 2XBO2 3VN4A 1VLNA 1J83A 1TME1 3OGRA 3AZZA 3RS6A 2RVAA 3RPQA 4JDNA 1OLRA 3UKTA 2HWD1 4UI9L 1R1ZA 4OZXA 1LESA 1VBB2 2IFWA 3D5OA 5BPXA 2YYOA 2Q8CA 3MZHA 5EIYB 2VULA 3ABZA 3JZVA 2WA4A 1AX0A 4FFIA 4NWVA 3J7LA 4LKEA 2GU9A 1VBE3 4Y1VA 1LEMA 1W6OB 2XHKA 2Z42A 1D4M3 5F5CA 5FPLA 3HPNA 4HT1T 5BNOA 2TNFA 2W08A 3WW3A 2DCZA 1KS4A 2ILMA 2WLQA 2A73B 3N7MA 1WA4A 2NPIA 3BOPA 1OFNA 3GYDA 5I8SA 5FUPA 2P3KA 1G9DA 1Z0HA 1KRIA 4KGGA 2W9XA 4FAHA 1XJAA 4Q4X3 4GD4A 4FOWA 3OGSA 1RUJ3 3OJBA 2EIBA 3VBOB 1W28A 1KITA 3MPPG 1X50A 4META 2QBXA 5LBBA 3ZFEA 4WVMB 4GH4B 2X8KA 3ZXFA 1PHMA 1POV1 4LJHA 4CEYA 4PJYA 4ZKTB 2KR2A 2PAMA 4UFHA 3JB8A 4HSJA 3ZXLA 3PTRB 5JIUA 1DHKB 3ITQA 1OUSA 2CGNA 1MEC3 2HH9A 3VBOC 5FO7B 4BJ0A 4CCCA 1FXZA 1CAVB 1QF3A 2VQTA 1OKQA 1V6JA 4GH4C 1R091 5A6XA 3U0ZA 3PJYA 3R6SA 3IDAA 5DUUA 1O5LA 1ZA4A 4AXOA 3U4XA 3UT0A 3TN91 1HXS2 4LBJA 2UWAA 3E1F1 1GYKA 1FOD1 4UW6A 4CDQA 5FPUA 3J8F1 2ADEA 2ZGTA 1KQRA 4KU8A 2Y60A 1IKPA 5IAXA 3ZSLA 3ZYJB 2G4IA 4OUMA 1W2NA 3AZVA 4DMIA 3KHCA 4P9YA 4L92A 3TNPB 3A7QA 4KG0A 3BTZA 3OBZA 2VCMA 5FP7A 5FMOS 1X36A 3HBZA 1UYYA 5FREA 2GC1A 5H9SA 1ENXA 2GN3A 4CU8A 4BQXA 1SFYA 1RUI2 3OBAA 4BLIA 1GNZA 5FLJA 3OGJA 1OQEA 1C28A 2R1BA 1AR62 4Q0SA 2BFUS 2R6QA 2VY0A 3CMGA 2RM22 2Z4FA 5FYCA 5GM0A 1VBA2 1DLCA 4GMP0 4QU1A 1JXNA 2LROA 2X09A 2JDUA 3JD72 5LBEA 1U5XA 1IG3A 3AP7A 5FYZA 4PQ9A 4D94A 3CDZB 4QU2A 3F2ZA 2D40A 3ACGA 3VV1A 4CCKA 2VCBA 1OFSA 5A6QA 2GMPA 1U0AA 2KA3A 2W91A 3UJQA 4Y1YA 1AZDA 1RUG1 5D2AA 2EVXA 4LHSA 3AP4A 4CP2A 1GQGA 1YQ8A 2E9QA 2HWF1 1VAVA 2WS92 4QPWA 4FAGA 1V9U2 3BVCA 4BDVB 4LBNA 1PO23 2B45X 5LB6A 3WCRA 1XE7A 4KH9A 4P9IA 2ZHMA 1Q43A 2ZGUA 3RYRA 3LOBA 4C1WA 1BYHA 1WBFA 4E9KA 4BQ3A 1VBD3 1DGLA 5JIAA 1UX7A 1SPPB 3I2JA 3ZLIA 4CP9A 2JG9C 2ZEZA 3KS7A 3BUCA 1BZWA 5T50A 2VE1A 1R1A2 4AZZA 4XBNA 2SBAA 4ASLA 2PMWB 3ZXAC 1EUTA 4RGGA 5E6HA 5L7OC 3SMHA 3WNPA 2XOMA 2BOJA 3KV5A 3PDQA 3VHRA 5HI0A 5F32A 3ZYGA 4WV8A 1RUH3 2PHUA 1H1MA 2J1TA 2VR4A 5EJZB 2Z69A 1MS5A 1RUC3 3AX4A 3DUIA 2JB4A 2UYAA 1S1AA 4Y20B 4AVSA 1PZ8A 2ZHLA 3OPZA 2ZHNA 4CCMA 4CU9A 3N7LA 4UF0B 4A4AA 1NOVA 4X6RB 5AC91 3I2FA 4UW3A 1RGSA 3W59A 3GALA 1K12A 2K0GA 3MLKA 5JXHA 1AR93 2ZMNA 4JKKA 3ZSJA 2ZX2A 5FYUA 3T08A 1EUUA 3GNEA 3IT8A 1W03A 3GBWA 1ZBE2 1PO13 2IUWA 1S2EA 4JZRA 3PLQA 3KB5A 4Z8BA 5FFOC 2EIEA 4P9XA 4OYUA 1GKBA 2Q8DA 1IKQA 2W94A 4LLOA 3KF3A 5JWPA 1GBGA 4LORA 4XACA 5LATA 4Q8KA 3LEIA 1VALA 3OTFA 2QDNA 2OKXA 2XUEA 2BW8A 3CO2A 5FY9A 5A6ZA 2K2SA 4CDXA 3ZFGA 1XC6A 4S2DA 3FC0A 1D7PM 1C8NA 4XDQA 1NLRA 1AX1A 1J3RA 3T0BA 5DDJ2 5CNAA 3HNYM 5I93A 1QNWA 2W92A 1RHI2 3ACFA 4YVSB 2XKPA 3BTXA 2Q5TA 2ARXA 3POSA 4IE6A 4RHV1 5FJKA 1MZ6A 1Q8OA 3MYXA 1X9TA 2OX0A 2ZX3A 4QKFA 4AQSA 2W0XA 2RS33 1WLDA 4IEXA 2V72A 3WW1A 1IPKA 1ULOA 1FMD1 4PDWB 2Z79A 5K7PA 4UBGA 4AHYA 5DUWA 4YVSC 1GANA 1CZSA 2BOIA 2A5ZA 1UU4A 1NUKA 3DEMA 4JGZB 4BHPA 2WNVA 5FY1A 5FZFA 3U1XA 4HN0A 2OW4A 4QPYA 2JDZA 1XNCA 4ASKA 3AL5A 1A6CA 4ET7A 4PDWC 4ZU4A 4BB3A 4O9EA 3NL1A 3T2TA 4P9LA 4N53A 4I3PA 4E4DX 1H2KA 3DECA 5IVJA 3GCWA 1TE1B 2D6KA 1MS8A 1X33A 3OOXA 4AFDA 4PQQA 2WYSA 5BNNB 3FHIB 1ULGA 2XL7A 1ASJ3 1WWYA 3KF5A 3T3YA 4ARXA 4XILA 4OMDA 3PUIA 1NCQB 3D0JA 1VBC2 3U14A 3VKLA 3WD5A 5CBLA 5JUVA 1G9BA 3CNAA 4TWTA 4QM8A 2EAAA 5IVYA 2ZACA 1OLQA 2R0HA 5E89A 2FHRA 2VUCA 2I07B 5CIRA 4D69A 2TBVA 1UZVA 5BNNC 3VHPA 3TEYA 3HBKA 4FCAA 4XE9A 1NCQC 4PIYA 3S5AA 3SLIA 2F6BA 2HWB1 2VOWA 3OF1A 2CAVA 1NXD1 1ZRFA 3J7NA 3HMYA 1NG0A 5CFCA 3MUZ1 3I8TA 3THDA 5FOBB 1TME3 5F5AA 3DN7A 4FFGA 2JDNA 2QQLA 2DUQA 4P00B 3T09A 1AXKA 4AFMA 2HWD3 3H3LA 3I2DA 1SFNA 5AVAA 1AYN1 2EALA 1COV2 3I3DA 4LBQA 4JDMA 5DMYA 5CKMA 1LU2A 2J7MA 4IV1A 1FV2A 1QXPA 1QWRA 3OUJA 3URFA 1E5IA 4AHWA 1O5UA 3S7IA 2B9UA 3FHAA 3PHMA 4NHXA 3H3UA 3R0RA 4D0QA 3N36A 5HCFA 3VZMA 2E26A 4LQRA 3GZUC 1DYPA 5LA0A 1PIV2 4QT6A 4R4XA 5IJRA 5A1FA 3VD7A 4EZ4A 5LA1A 2WSVA 4COZA 4IESA 2CGPA 2IZWA 1STMA 4Q4V1 1H30A 1JZ5A 5FY0A 1H6XA 1LOGA 2Y0IA 5FYBA 4W6XA 1UY3A 4BLJA 2N7GA 5GZGA 1M4WA 2GNTA 5K0UA 2D3SA 4KMQA 4QGNA 3G6JB 4BH9A 1UYZA 4JKMA 2B8MA 3ES1A 1ULPA 1POV3 3I2IA 4GWNA 4Y4YA 4B4QA 1HQWA 3LEGA 4K1YA 3PUHA 1JN2P 1B09A 5GALA 4N7UA 3K48A 3WINE 2XJVA 5D1IA 5F3CA 1CIWA 1AR72 1JYXA 3LA2A 2WR9A 3MBWA 2XQXA 3UKVA 1ODMA 3CZJA 1W6OA 4HOOA 1QQP1 1R093 3RZKA 3ELNA 3RNSA 3U75A 1PVC2 3B9CA 4YNIA 3VBRB 4BCUA 1SLLA 2VM9A 2C1FA 5IVBA 1FOD3 3PVEA 1PNGA 4R9BA 3J8F3 2ZEXA 3PU3A 4HETA 4QWNA 2A6VA 3QCWA 1ST8A 1DQ5A 3AYAA 4LA2A 2XLAA 1L7LA 3N7KA 4RGAA 2GZWA 5J37A 2QE3A 4UFKA 1DF0A 1EAH3 3O1MA 2AC1A 3FBMA 4ZS2A 3WNLA 4C0HA 1YNAA 1BEV3 1C1LA 1PMIA 1UYXA 3VBRC 4XAAA 2D6NA 3DL3A 3LB9A 5IW0A 3WR0A 2XJTA 4P5HA 5A32A 4GIQA 3I3QA 1QJY2 1SBEA 3VHNA 1CGPA 3LSDA 1OPMA 1JYIA 1K5MA 3H50A 2WINB 4WVMA 1OHFA 4FVVA 3WDXA 2HYKA 2PFWA 1IPJA 1TMF2 1YXWA 1NKGA 4A3XA 5DN2A 1HXS1 4LLFA 1GWKA 2DCYA 1DIWA 2ZZJA 2YU1A 1AR82 4H2AA 3QD6A 4PI2A 2HWE1 4JGYA 1HRI2 3KT1A 1CAVA 3GBGA 4NIHA 4RQPB 5JPNB 2AREA 1V70A 3SEPA 2IXLA 3H7JA 5FR3A 4IQPA 5FUIA 4D6RA 2HWF3 4KBZA 4OHVA 4A2UA 2P1BA 5HXMA 2OZJA 2RE9A 1VR3A 3TAYA 4RD7A 5ANNA 4O7XA 1WW6A 1G8WA 5FIXA 4AHXA 4CEYB 1BQPA 1W8UA 1LB2A 1RUI1 1D0GA 2MEV2 1BK1A 1VP6A 1RUE2 2XMLA 2WNOA 4QHBA 5F2SA 5LK5A 3HNBM 2Q8EA 4DOUA 1AR61 5KHIA 2Q30A 4YG6A 4GJYA 1QJU2 3WNNA 3LIGA 1OURA 2ZHKA 4GALA 2BGPA 2DBIA 2YY1A 2O8QA 3VBFB 4GWMA 3W20A 2G9ZA 1QNYA 3IZOA 5LCWL 1BLZA 1EPWA 5CB7A 5IVEA 3K75B 2EIGA 4CEYC 5FP4A 2IVJA 3L2YA 4ORFA 5J48A 2KXLA 2ZJCA 3ZMOA 3QBQA 4HVRA 3LDKA 1N3QA 3WQ0A 2XB6C 1DLLA 5B4NA 3T2PA 2JD4A 2DTWA 1H4GA 2D3PA 4YM2A 4FTEA 2R062 4ZS3A 5FZKA 5A33A 3WNXA 1UO9A 4OVEA 2VNRA 4XF3A 2H6BA 2YDEA 3Q8EA 5J96B 1W9FA 3AMHA 5A3TA 5FK7A 3WP3A 3OPTA 3MPBA 2DUOA 2YC2A 5AC93 2Q4SA 1LOFC 5LZ6A 2QZ2A 3R4SA 1HRV3 5A7QA 5FYYA 4NPRA 3SH4A 1O7FA 3PTYA 3ZMNA 4CCOA 1E5SA 2O14A 1LTEA 3VBUA 1AL21 3MLJA 3RGBA 4DRVA 4HG6B 1REEA 3K77A 2XQRA 1MEC1 1JODA 3D4KA 4IGOA 1WCQA 3SCGA 1LHWA 4ATFA 4PF1A 4C90A 3WV6A 1ND2B 1EV13 1QJX1 3USUB 4B7KA 2D44A 1I6XA 1NY72 2Y6HA 1SQ4A 2R042 4FPFA 3WT3A 4BQYA 1JZ3A 1SZBA 4AHZA 4MGKE 3POJA 3UL2A 3WDYA 2D97A 2LM3A 4AFBA 2OYZA 4CUGA 2E6VA 3E6DA 2A75A 1C4RA 3A23A 4OHWA 1W99A 4PLMA 4XIOA 1ND2C 1H4HA 4QXCA 3B69A 5JSOA 4AGGA 4Y20A 2RS52 2WBKA 1VAMA 1H2LA 1LU1A 2J1UA 2HEVF 2Z2SB 4I0WB 4F83A 4CP9B 2YBSA 2LS6A 1GQPA 2I2SA 2XONA 1RUF1 2EXHA 1MS9A 1MZEA 3AK0A 3ACLA 4U36A 3ZN4A 5APAA 1FMD3 4CYDA 2C0ZA 3KQRA 4L0PA 4GWIA 4LIVA 4P9WA 4Q0QA 5A1AA 2XGXA 1RJ8A 2ZGSA 4NIGA 1W0NA 4YG3A 2J1RA 2ZGOA 2QQKA 3HWJA 4XDOA 5HV0A 5LEJA 1WLCA 4IEPA 5FZGA 4QGLA 3KT4A 3S7EA 2RS12 1PVXA 5HBAA 3WY6A 4XC9A 2DWRA 3AP9A 1BKZA 1J59A 2B42B 1W6NA 4XFGA 3L9JT 2QQVA 4LA3A 1PO21 3MF9A 5ACA3 3S30A 1PK6A 3LAGA 5IK8A 3K4DA 1XNAA 3OBTA 2LTNA 3OGGA 5B4XA 5A6YA 2DVDA 4HN1A 2B5HA 5JAXA 1XXNA 2ATFA 3C7EA 4LEJA 3TNQA 4DZGA 2WZ8A 2WO7A 4LE3A 4Q1PA 4XUOA 5JI7A 1W05A 5C9AB 2JWPA 1QOTA 3POYA 1C1FA 3LDBA 4GXLA 4NO4A 2EAKA 4CE8A 1RC6A 3IB3A 2A6WA 5FYMA 3WCSA 1UOJA 4X6QB 3KGLA 2WFF2 2YFZA 4YG0A 3WG3A 4YW1A 1WW7A 4J25A 5F6KA 4MGYE 3ZXDA 1VPHA 5CISA 1ND3B 2IXIA 4B8EA 1DQ4A 1RUH1 1JYTA 3CZUA 4LHNA 2P6HA 3M70A 4GB32 4JGZA 1GZTA 3T1LA 2VMHA 3ZKUA 4AE2A 1W9YA 1N47A 3KM5A 4LBQD 1XYNA 5JXIA 1F4AA 4MO3M 4KWJA 4CSWA 3IKWA 5EXOA 2V5YA 3OGVA 4FBFA 1F15A 1LNSA 3I2GA 4YW2A 3E6BA 1ND3C 1AYN3 4LHLA 4DINB 3TEWA 4URAA 3ZFGC 2E32A 3CF6E 2WZR1 4BIOA 3U4SA 4FPYA 1G7YA 2PQQA 3VDCA 4B4RA 4CPBA 2VOVA 1AR91 4R9AA 5BNNA 3BI3A 2UY8A 1ZBA1 2GAUA 5EP9A 1CN1A 4CZSA 3RZZA 2VBDA 1MVEA 2PHWA 2WABA 1O3RA 4V2WA 2JDHA 3MLLA 4IEWA 4QB2A 5FXVA 2JIGA 4ZXEA 4DIQA 5DG1A 4B4PA 5D8AB 2XDVA 3PU8A 3ORJA 2X5IB 1LOCA 5I0DA 4Q4V3 3MDPA 1EPZA 3DYPA 4N53B 1Q8PA 4FFFA 2E33A 3N3HA 1N1SA 1FAYA 4CCNA 1A8MA 3UKNA 3ZKYA 2WQ8A 3RJ2X 5D8AC 2PHTA 1O8PA 3LA7A 1UY4A 4E2QA 2X5IC 3AP6A 1B35A 3NRUA 5A7SA 3ROUA 1XNTA 2RDQA 4N53C 1JOBA 3O0VA 3QLQA 4FO9A 4UFJA 3B02A 4ZY9A 4Y26A 1D0HA 5FYSA 2DFCA 4A6SA 1X82A 2WA3A 5FXXA 5KHJA 4CDWB 4DY5A 1W8ZA 2RS31 1LOEA 5FUNA 1CWPA 3OG2A 5FZ0A 5EFUA 3GXUA 4NHLA 1QQP3 1T6GC 4QGMA 3DGTA 4NHKA 4BQ2A 2PAEA 1NE6A 2P34A 1OF3A 3AFGA 3J9SA 4OFGA 3BPSA 2ZMLA 1CAWA 4M3CF 1TNFA 4Q0UA 3V0AB 5KR7A 3O0XA 4OI2A 1VRH1 2XWJB 3LEMA 1QOOA 2BWAA 4B29A 2A6YA 3H1MA 1GMMA 5FPAA 5L19A 4EN6B 4JKLA 4YZ3A 4N9HA 1DP0A 2HEWF 1QKQA 4UW5A 1Y7BA 4SLIA 3SKJE 5E16A 4W50A 3CEWA 2ET1A 4IL7A 3S57A 5EYYA 1XE8A 1KEXA 4AI0A 1Y9QA 1ALYA 5C6CA 5DZGA 3FFZA 4LO6B 1UMZA 3JUUA 4QAWA 4ZU5A 1PVC1 3P3NA 4H7LA 1YCIA 2ZKNA 1HXS3 5FZAA 1CQ9A 1GNYA 4HK9A 1U5ZA 3ST7A 4BQ4A 5JSRA 4PBOA 4LNVA 1SLCA 4W4ZA 3GBFA 4YVWB 1YI9A 2HWE3 5AVPA 1S0EA 4Y1UA 4CCEA 1UL9A 4NHMA 2QNKA 2QKDA 5IVCA 5EV7A 5JOZA 3ZYFA 4IEQA 2XJRA 4K40A 5T5PA 2G9FA 1AYM2 1VIWB 1OPOA 2R0FA 4RN5A 4HVOA 4YVWC 1RUI3 5FWEA 4A41A 1AR63 1MS3A 2EXJA 4N90A 1SDWA 5EWSA 2RM23 3WEZA 4Q8LA 3THCA 5K0UC 5FMBA 3PVOA 1SDDB 1AR81 3HNMA 2YGMA 3K3OA 3TEZA 3LQCA 1O4TA 4FPJA 1UZYA 1VMHA 2IWGB 3OYWB 1WLTA 1YI7A 3GZAA 2VZOA 4FPEA 4OQ9A 2ZXQA 1PGL2 3WDVA 2VECA 3FLTA 3WP4A 4GULA 1V9U3 4A7YA 3NV4A 1WCKA 5A3MA 3ZYHA 1DQ6A 2YV8A 3ZOIA 4C8DA 2NZ9A 4LIUA 4RQPA 1RTVA 2PXJA 1BBT2 1RUE1 4R9CA 5A32B 5CADA 2OA2A 1JU4A 1LAJA 2VCCA 2XG3A 4B1LA 5J09A 1AXYA 2VMCA 5HCHA 4K3UA 3LIHA 1QJZA 4IEUA 1ZZ7A 1ZA7A 1K5MB 2IXJA 4CEWB 1JS9A 2DUPA 3QH7A 5FRAA 1R1A3 4QXHA 3WQ1A 4D3WA 2DBNA 1KDKA 1AL23 4HSLA 4HZFA 5LEKA 3N9MA 4AYUA 1ZRIA 3HQRA 1RUOA 2P2KA 2DVGA 1WLWA 5FZBA 4JVAA 1RMU2 5JXJA 2KM2A 4XXPA 4JGYB 5G04L 3V64A 3VBFA 1K5MC 4HKLA 4NAOA 2YGLA 3VHOA 2WO2A 1MACA 1QJX3 3QH6A 2RMU2 3WSOA 3AJYA 1BHGA 1G9CA 4XYXA 2YB7A 1YFXA 4XCBA 3VDDA 4WM7A 4QX0A 1CD3G 3IIAA 3U37A 1ZZ8A 2AUYA 3C2UA 1LOFA 1SEFA 4DXZA 5DQ0A 4FSJA 4NVPA 1L7RA 1YQ5A 4JGYC 4YZ4A 5JMOA 3MICA 3I2OA 2Q1FA 1GLHA 2ZGQA 3SHRA 1DQ0A 1O91A 2PLV1 1EAH1 2JEMA 5CVRA 3ZXJA 1BEV1 1UD1A 3VZKA 4Q4Y2 3BIWE 2PTMA 3QACA 1W2AX 2JX9A 4XJZA 2HWC2 1BVVA 1CJDA 1RUF3 3JU9A 4BMBA 3NNFA 4DB5A 1JUHA 5CEHA 1GZCA 4BQ1A 4XXAA 2A6XA 4XAEA 2VQUA 2R041 2XVKA 1NQJA 4XW3A 1BMV1 3OUHA 1VE0A 4R52A 1OVPA 5FZ6A 2R16A 3NKTA 4N7IA 4AQ2A 3V0BB 1F2NA 4CCJA 5A33B 1FYUA 1RITA 3SNMA 2O8OA 2TUNA 3B5LB 4GKXA 1AJKA 1Q5OA 1ND2A 3OUIA 4H3WA 3USUA 4CP0A 2FMDA 4O9GA 1WGPA 3UV9A 3ACIA 4F7ZA 2CNAA 3C7GA 3GZEA 1IZ3A 5LWBA 3O5SA 4CCLA 2C26A 5ABJB 3I3EA 3RMXA 3D6EA 3BTYA 3ZO0B 4QKNA 3WXPA 2JE9A 4BE3A 4EROA 4IERA 4OMCA 2BBAA 4DEVA 3VBUB 1YEWA 3W9AA 4Q4W2 3WUDA 1KGYA 2CL2A 3NNMA 4PLOA 2WQZC 5FDBA 2V5DA 1YUDA 1JZ8A 1WMXA 4KI5M 5FZ8A 1SHWB 2BJSA 1WW4A 2YC0A 2QQMA 5KXBA 1W3XA 3FUQA 3OCPA 1O6UA 4W6WA 3VBUC 3JBG2 5FBJA 2Y64A 4QX2A 4XDPA 2DDUA 1J3QA 1UPSA 2XVGA 5FP9A 4A44A 1KFUL 1V0AA 4Q4X2 2GNBA 1XSQA 5L9VA 5FPZA 4XQ4A 1RUJ2 3M3QA 4GAZA 3FMGA 4LULA 4K1ZA 4AAPA 1TVGA 3DXTA 4CPBD 4QDSA 3H0OA 2RR12 4NJ4A 4YWAA 3CHXA 1FNYA 1JUIA 1N1YA 3T2OA 4EN0A 1HRV1 3HOBA 2WWUA 1S55A 2WZR3 1SCSA 2ZKLA 4CDUA 3UJOA 3WUCA 4BMEA 5A3LA 3LA3A 4YW6A 2F4LA 3JXSA 1ZBA3 3SH3A 2J42A 1V6OA 2VMDA 3E5QA 1QHDA 4LKSA 3NJZA 1QY4A 4JQTA 3ILNA 4XUNA 5KWRA 2E51A 5J98B 3WHTA 2RJLA 2PELA 5C9AA 3WX5A 4XFCA 3MW4A 1ENRA 3T4VA 3OEBA 3RG0A 1EV11 1F31A 5JSPA 4QPIA 2ZMKA 2OT7A 2VNVA 3BN6A 2HYXA 1DGWX 1W6NB 4HK8A 5EJ1B 2I74A 4YZ5A 4R4ZA 3B01A 3A21A 1ND3A 3HT1A 1QIQA 3GHNA 2VTFA 3I59B 4GQ7A 4RFT0 1PK6B 2YZ4A 1T6BX 5FZ1A 5FZEA 1PGW2 4AQ6A 2R1DA 3SCHA 3D3AA 4L11A 4BK4A 1FPN1 5C33A 1FNZA 4OUSA 5I8TA 1M06G 4RFRB 1MVQA 5JDBA 2XL9A 2ORZA 3AC0A 3ON7A 2D5HA 5T5JA 1YFUA 1PK6C 1HB2A 2E7QA 1OUXA 3LGRA 4Q2FA 3HR9A 3H8UA 3HIFA 2ORXA 4KWKA 1IHMA 4KU7A 4RA0A 1Y9GA 2CWSA 4MVTA 3FLPA 5FPXA 2QQIA 4HPKA 4XJ8A 5KXEA 1NZIA 2BNNA 2Y6LA 5GLTA 1ULDA 3MIGA 1YQ2A 1VRH3 5D8AA 4ZZ8A 1OXCA 1J1TA 1F35A 2X5IA 4FOQA 3JCIA 4OHZA 2NP0A 1XYPA 1HN0A 2PYTA 2ZX0A 4ZXKA 1W6QA 1KD7A 3MGUA 1VBD2 1W6PB 4JGZC 4Y22A 5ACA1 3OD0A 1CESA 2R32A 3IDEA 5DAXA 2CV6A 3M1HA 1ZNPA 4LBKA 4PBPA 3BPZA 4MUVA 1O4YA 1RXFA 1GUIA 4D6QA 4XHBA 1PVC3 2B39A 1WZXA 1C57A 1YJLA 3HN1A 4J1WA 2JDMA 4LT5A 5KBFA 4YGCA 4CDWA 1GWLA 5JOYA 3E5XA 2JDAA 1OVSA 4KG8A 4G9SB 2A3YA 3U10A 5JR2A 3AB0A 2ZAAA 1AX2A 1RUC2 2JD9A 5FZ4A 1OT5A 1QXRA 4NIDA 1W06A 3AKSA 2P4EA 4R9DA 1JHJA 1R081 2V4AA 5FXWA 1S4CA 1AL0G 3V0AA 4MGTA 2MNGA 4RS5A 4Y3OA 5FZMA 2W39A 1LOAA 4OLLA 5KXDA 3K4ZA 5F37A 1B35B 4IEYA 5EJ3A 1W0OA 3KV4A 1POQA 4LTAA 3ATGA 2IXHA 5C5TA 3RWKX 3W58A 1WMEA 3BGAA 4CXXA 3ASIA 3HJRA 3O1UA 2DCJA 1AR83 5FZLA 5DG2A 4Y1ZA 5A7OA 5GJ6A 1PO12 1B35C 3Q8FA 4LOTA 1UIKA 1CAWB 2OIIA 2WWJA 2HLEA 3FLRA 2QVSB 4M4RA 1OH4A 4QPGA 3U07A 1XYOA 5FOJB 1S0JA 2DU0A 4RGKA 3WW4A 1LEDA 2XBO1 4A6OA 1AYM1 3AMNA 5JPMB 4O65A 4YVWA 1OLMA 4OQ8A 3MIDA 4IW3A 4XFHA 4AI8A 5A1LA 3LSEA 4LBLA 3UGGA 2P3YA 2XKOA 4AK3A 1RUE3 3PIJA 4QQPA 2VTXJ 3OEAA 1AXZA 5C3QA 1VBB1 3POEA 4UW4A 3ZYRA 3GGLA 4G3YC 1QXJA 4QB6A 4BYYA 3WW2A 4PI0A 5EYXA 2OQ6A 1LR5A 4YGEA 1DYOA 3O12A 1CONA 2QQWA 4AEDB 2NMOA 2WUHA 5CU1A 3LF7A 3DV8A 3N4MA 4QXBA 3C7OA 3VD5A 3FHQA 2ZS6B 2GNDA 2BZDA 2JIJA 4CU6A 5GZCA 5LRSA 2VPVA 3PUSA 4WZCA 4QQHA 3GCXA 2WZEA 1L3JA 3KVAA 5LY2A 3AKPA 2ZX4A 3K51A 5L9RA 4R8HA 5FCCA 3OYWA 1DBNA 4A45A 1BBT1 3BKZA 5FMDA 3ENRA 3PJQA 3NNGA 4IDZA 4MADA 4QQ2A 2GMEA 2Q0AA 4N9IA 2C5DA 1W90A 2K46A 2PLV3 2B4KA 2R7EB 3NV3A 5ERLA 4AAXA 4CUBA 4DXSA 3A22A 4MGSA 4XJ9A 5BNPB 4YPJA 1DDLA 1ZVFA 1ASJ2 4UWDA 3AL6A 5DAVA 1IQDC 4IE4A 4P02B 4Q0VA 2ZBJA 3NNLA 5AFBA 2PA7A 4CEWA 1LHOA 2YBPA 5IATA 1MQTB 3FBYA 1F4HA 3VKNA 4KNCA 2RMU1 3O0WA 4JHZA 3NW4A 2R043 4NN0A 3WDWA 5GZDA 5DABA 2PN5A 2VAUA 2W87A 3R4DB 2QQJA 3KWVA 2Q1MA 2UWCA 2JDKA 3LE0A 3ZYPA 1POV0 4EN8B 1QDOA 5A3PA 4PLNA 1MQTC 4F8AA 1JOPA 3D82A 4FTBA 3FFQA 4EYUA 1TME2 2RS53 3LFMA 4EWEA 4D6SA 4QKDA 5E88A 3BOWA 4JAAA 2XVLA 4LITA 3VD3A 2W68A 2HWD2 5KHGA 1HW5A 5AFEA 4Q26A 5FZ3A 2ES3A 3E6CC 2RDRA 4RQPC 5L73A 4XQDA 5A7PA 1RB8G 1YO8A 1K45A 3U78A 2FDKA 4HVQA 1NCRA 1XSRA 2RM21 4CVUA 4AVBA 1VBA1 1JH5A 4QKBA 4Y5SA 4IUGA 2H0BA 5C5UA 4PT6A 3JD71 1SBDA 2WO1A 3FL7A 3VGIA 1D4VB 1OQDA 1ZRDA 3ZR6A 3POWA 1AUYA 3BTAA 4B7EA 1JYNA 3AMMA 1CR7A 4MX3A 3WG4A 1DGRN 5T54A 4U2AA 3WG2A 3VDDB 3TEXA 3WP5A 3MW2A 3A0KA 4WM7B 2BERA 2VVFA 4YM3A 4AGVA 2WS91 5IAVA 2Y6FA 1GZ9A 1V9U1 2UU8A 4UAPA 3VBFC 3V0BA 3MIEA 4BXSV 2VW2A 2JICA 1ULEA 4BISA 1HN1A 2FDHA 1SLIA 5F5QA 4FPCA 4FPGA 1FT9A 1GNHA 2ARBA 2Y6JA 3CL1A 3VDDC 4QQOA 2ZEWA 1W2TA 4WM7C 4DO0A 3ACHA 5CAZA 3MIFA 1SLBA 1NLSA 3P5BA 1UMHA 4XETA 1Q8VA 1UYPA 5LBCA 3VD4A 2NN8A 1GSLA 5GLVA 3GZTB 5M0TA 1FX5A 1R1A1 5GZFA 2XJSA 2A70A 1GICA 3NV1A 1PNFA 5FBZA 2EIDA 3OD4A 4IE7A 1OI6A 2WFF3 1H1IA 1GV9A 1P8JA 1Q8QA 3AJZA 3JBG1 4P9JA 4HKOA 2R30A 2RHPA 2UURA 4KL1A 1R092 3R05A 1RUNA 3AYCA 2W1SA 2D5FA 3TN92 3PVNA 2J1AA 1FOD2 1V6IA 4WM8B 3FE5A 3J8F2 2XWBB 2LUWA 1OH3A 4GMP1 4I01A 1J84A 4L99A 3ZPYA 3WF4A 3Q8BA 4NRQA 1ZZCA 2YG0A 3PUAA 3ZN6B 2WT2A 2WRAA 1NZCA 1C8M2 2RR11 5LK7B 2VMIA 2V4VA 4FPOB 4BQWA 1YQ6A 3AKTA 1W8WA 2EXKA 4N8MA 4NROA 1VJ2A 4CP1A 2GMMA 2JE8A 2PQSA 2QFEA 2Q8OA 5CG9A 4QX1A 4WM8C 4Z92B 1REDA 1BXHA 1FPN3 1MZ5A 1U5YA 1WW5A 2E31A 2BWCA 2OPKA 3AMPA 3I7DA 1UX6A 5FZIA 4Z2WA 1O3SA 4D7YA 2FQPA 3WF3A 4K9SA 2G19A 5FP8A 1ZBE1 1I9RA 1OMIA 2WNEA 1AVBA 4XFBA 3RMYA 5DZFA 3VKFC 2VQAA 4LO8A 5K9YA 1C5HA 1DCSA 2W1WA 3N9QA 4XMIA 4M0NA 3J26N 1F5JA 4MHRA 1OA3A 1UOBA 1CJPA 2K9ZA 2Y0OA 2ZABA 1K3IA 2VBPA 1RUG2 4JTOA 4MGZE 5GLWA 4IV3A 4UXAA 5LRRA 1O59A 1A8DA 2HWF2 4J1XA 4M3CB 3NWKA 2VH9A 2Y33A 5DDJ1 2BEOA 3VBSB 1MR5A 1RHI1 4K8RB 5EPAA 2HBUA 3ZXKA 3ZM8A 2ZA9A 3I59A 5CFDA 3H1WA 4AVAA 4CDUB 1S0BA 2P3IA 4TYSA 1QEXA 5IK5A 3EBRA 2QTWB 2JDPA 1W3VA 1FATA 4MOAA 4LR4A 2WFPA 3RSJA 5I0SA 3VBSC 1H9WA 2CWMA 2EA7A 4FPKA 2GC3A 3VZLA 1UF2C 2VXRA 2XHNA 1XRUA 2E63A 3ZDVA 3LOIA 3ZFFA 4QPIB 2VMEA 4AEMA 2R072 1QH7A 4YLZA 4CDUC 1XU1A 5FYIA 2W52A 5J36A 2GP3A 4ZZ5A 4DPNA 4LE4A 4GKYA 5C3OA 2XJPA 4QHZA 5C9AC 4UYBA 2VNOA 1R083 2HBTA 1MS1A 2BVBA 2FZ2A 3KZ4C 1DFQA 3THPA 5DAWA 4QPIC 4KGQA 4UFLA 5LY1A 2ZPXA 4X8NA 1N1TA 5AC92 2IC1A 2VNGA 4ES8A 4ISQA 1Z7S2 2W47A 3PUQA 1VBC1 5CZKA 5BUVA 4A42A 4HFSA 4JV4A 1CVNA 4LBMA 3WF2A 1F8VA 4TTGA 5FLIA 1W6PA 1LKNA 3POGA 1A34A 1VRBA 1UKRA 4UFMA 1YC61 3IWZA 4PIZA 4HPKB 1XQNA 1XB9A 2D93A 2DYCA 3NJVA 3RYKA 2YPJA 3ZR5A 3VD9A 2XBO3 1AYM3 2XLFA 2YU2A 3BCWA 1EP0A 2NQYA 1VAKA 2VOKA 3IPVA 3TRSB 2FBEA 4LMFA 1ZX5A 4MXWB 3ETPA 3J7HA 1W6QB 1VBB3 4E4ZA 4Y22B 1OA4A 2DVFA 4CA9A 2XPJA 1COV1 3LDRA 2WL1A 4YGDA 2BRTA 4FXGB 4HONA 2P17A 5F3GA 1UY0A 2A3WA 4RHV2 3C7HA 1SLTA 4PHZA 1NXMA 4IE5A 1ACCA 3KLSA 5LA2A 1XBFA 3P3PA 4FXKB 1DGRA 1FMD2 1TZOA 2F17A 1S2KA 1V6LA 4FQ4A 1BJQA 3M3OA 1PIV1 3Q8AA 5GZEA 3GHMA 2F4PA 4F3JA 2DTYA 3NKGA 3NJXA 1Q8SA 4HBNA 1BVP1 1X8MA 1UNBA 1BBT3 2DFBA 1XPWA 3KCYA 4YFZA 1JU3A 4XJAA 4BXFA 2QZ3A 3E5UA 4DUXA 4RS5B 4AR2A 5B2GB 4CDWC 3ZPOA 3SEEA 1HB4A 2W5FA 4EN9B 2BYVE 2FDIA 2C9KA 2ERFA 1RYYA 5FYHA 4CXYA 3OPWA 2YUEA 1AR71 1ZM1A 3HEIA 4RS5C 4I2OA 1PGSA 3HT2A 3ZXGA 4QB1A 2G9GA 2O1QA 1UZZA 3WHUA 4AEDA 2R49A 4DFSA 4ZHNA 4BU2A 1SMVA 3IMMA 2RMU3 4QPGB 3K3NA 3HQUA 5FV3A 5GKAC 4P9GA 1NE4A 2D7FA 3JQXA 1NYWA 5C7GA 2C9AA 2FDFA 4E27A 5H9RA 2CAUA 2HWB2 1MZFA 2D6LX 1W9TA 3IIIA 3MUY1 4XEZA 2C6SA 5FKBA 3LPFA 3RQ0A 2WKKA 2ZX1A 4M01A 1LULA 3WNKA 4QPGC 1MS4A 2I45A 1RVF2 5H9PA 3FJSA 1YJKA 5C3SA 1WD4A 1GWMA 4LBOA 1JYCA 5E8AA 4JC1A 4XBLA 1QJY1 5DAPA 1I5ZA 3IDBB 5EZWA 2HWC3 3DPRA 1G9FA 1RXGA 1AYN2 3RZGA 3IBMA 4FPLA 4BPZA 5A70A 4DXTA 1TMF1 2VZSA 1OA2A 1O8SA 3LEKA 5F5IA 5CKNA 1QOSA 3K4AA 5BNPA 3WNOA 1GZWA 1VBA3 1WMDA 3PL0A 4XFFA 5FY8A 1W8NA 2ZGPA 1JZ6A 2ARCA 4JX0A 3JD73 2H6CA 4QHOA 1CIYA 3LZZA 3M2MA 3H8RA 2JE7A 1N3OA 1HRI1 1RUD2 4OCTA 3OSDA 4AW7A 3EO6A 4LO7A 5CYYA 3U11A 1MQTA 5FJHA 4JRLA 2OXBA 4YM1A 2FMYA 3VL8A 1HJFA 5FMOL 1S0IA 2TEPA 2WS93 3OY8B 5A7WA 4INDA 4A3ZA 1OLME 4Q4V2 4AFCA 4LO4B 1UN1A 3LCPA 4OI0A 1HX6A 4LUKA 1KXGA 2BQPA 3B94A 3NQHA 4JHTA 5IVVA 2FDGA 1QH6A 4HXCA 4IEOA 2MEV1 4CRQA 1CPMA 5FTTC 1V6MA 3MIBA 1GOGA 2AGSA 5E1RA 4YYOA 1WBLA 2BFUL 4Q4W3 2ZGLA 5BYNA 1I5PA 2NYYA 2OUJA 3N7JA 1QJU1 3RJRA 2DV9A 2IXKA 1ZZBA 3C8XA 2VBBA 4XZUG 3VZNA 4W8JA 1G6NA 1URXA 4ES9A 1IS4A 1OOPA 2VZRA 3AM2A 2FCVA 4XBQA 3NAPB 4XHXA 2ET7A 4NHYA 2WN2A 4IXLA 1NLQA 3LFIA 3MV11 3JBG3 1H0BA 4X8PA 4GJZA 5F39A 2W46A 1J58A 1QQP2 3RWNA 3I3BA 1EY2A 3D0SA 2WNUA 4Z82A 2Y34A 4NUBA 5FAXA 3V65A 5BY5A 4CEWC 2R061 4B1MA 2CY6A 4XCAA 4GMP3 5FZOB 5JMCA 3NAPC 1OQ1A 2XJUA 2BTVC 5KC6A 4CUCA 1H2NA 4IGPA 5FLHA 1R64A 2ARAA 2GH8A 2RR13 2FCUA 4NRMA 4AOCA 4BOWA 1W9WA 2VVDA 2IXCA 4PF5A 3S0MA 3KSCA 2VZ1A 4ATEA 3FUOA 1ONAA 5JZGA 3OB8A 3VUOA 4QXKA 1NCRB 4RL7A 5F7UA 2WDBA 4LXLA 1NX9A 1UOFA 1W6MA 5HCBA 4XTPA 4BK5A 4EJRA 3S5QA 4QX7A 3B7MA 4C1XA 1W39A 4S2FA 4XFIA 1ZBE3 1JW6A 4XF9A 1NAEA 5J1XA 3VDBA 2WIIB 2DURA 5ANQA 1UY1A 3HN3A 1NY71 3RZLA 2OUHA 5C4WB 1NCRC 1CAUB 2HWE2 1PZ7A 1ZYBA 2CSGA 3PURA 1C8M1 1LODA 1UPIA 2GC2A 4DUVA 4FOVA 1AJOA 2Q1ZB 2E7TA 5K8SA 4V2VA 2O0OA 4M4PA 4WM8A 2BNOA 3KHBA 2AEZA 4XUQA 2XR4A 3TYJA 2CU5A 5DDJ3 2WZPP 2BUKA 1YWKA 2RS51 5C4WC 1RHI3 5F9TA 2SLIA 4TN7A 3ZN6A 4AG4A 2VG9A 4PIXA 1DQ2A 3NJYA 2VMFA 4PCRA 4XUTA 3ZVXA 4Z1VA 4UT5A 2X53S 1ZRCA 3N9PA 3CJIB 2IVIB 2JDYA 3KQ4B 4QD2A 5K4LA 2HJIA 3DF0A 1HQNA 1ZZ9A 5LBFA 1VBE2 3ZN5A 3B9IA 4OHXA 1D4M2 1ENQA 2AEYA 2VU9A 5T5OA 5JOWA 2VZ3A 3CBNA 4L97A 4BWOA 5F3IA 2BP6A 3O1RA 2RS11 3CJIC 4YW3A 3EB7A 4YRDA 1JZ4A 2JG9B 4URTA 3T0DA 1GQHA 3RDIA 5HCAA 1TEIA 2B9VA 3P1IA 3O1OA 1LHVA 2D6PA 3PVBB 2WWSA 5F2WA 3VBHA 2X05A 4Q27A 5L7OB 1UOGA 2C4XA 1OBNA 3GJBA 3M8LA 4M3CA 1D2QA 4YGBA 3JB4C 2CDOA 1E5HA 5T5LA 2RG4A 2V09A 1VBC3 2NLRA 1DG6A 3VBSA 3MIHA 4FP3A 1JZ7A 3MI8A 5BV6A 4TXWA 3GJAA 1UY2A 4FQZA 3KMHA 1AL22 2W3JA 1DYKA 1YQCA 1JBCA 4DY3A 2RDSA 3Q9OA 2BBVA 2R071 1MEC2 1X7NA 4Q0PA 2WFF1 3ZSMA 4GZ9A 5FY4A 5FPVA 4E2SA 1APNA 1U5IA 1IG0A 5T3NA 1LGNA 1CX1A 1IS3A 1QJX2 2LALA 1UW8A 3WF0A 4IV3B 5JLVA 4L8QA 3IM0A 4LO5B 2J1SA 4GB31 5H9QA 2OQ7A 4H7MA 1N1VA 2GALA 5JVVA 2P6CA 4WBBA 2YBKA 5A80A 2DCKA 3SQOA 3ZSKA 4DS0A 1J3PA 1UIJA 4K20A 4XTMA 4XQWA 3T4HB 1YIFA 2QQUA 1Q3EA 2UYBA 3I4IA 5I0UA 3RFRA 1Z7S1 3SC7X 1A78A 1PX4A 1V00A 2QQPA 1WD3A 5CFDB 3RRDA 4IV3C 4AQTA 1COV3 1YYNA 3BIEA 4HANA 4DEQA 4M00A 5ABJC 1W0PA 1K42A 4LHKA 3FN9A 4XF0A 3USSA 4QX8A 4OZOA 1HB3A 2ID4A 1HIXA 4HMZA 1V6KA 3ZSEA 2ZGRA 3CU7A 1RUF2 2EF6A 5DAQA 3DYOA 5FKCA 3SITA 2QUOA 3AXDA 5F6LB 2ETEA 2WJSA 2YXSA 5A3UA 1NA1A 2A71A 3W21A 3ZFFB 5CFDC 1ZREA 2VOTA 1VB2A 1PIV3 1LCLA 3WDUA 5FO9B 1D2SA 1SFPA 3CIHA 4I30A 1HJGA 2YPDA 1H8TA 1CAXB 2VZPA 4AF9A 4E4HA 3BU0A 2DF7A 3EXUA 1PMJX 1FI2A 5EQUA 2PHXA 3ZFFC 1CZVA 1Z78A 2W1UA 4I0AA 4QM9A 1H2MA 1PO22 2VQ0A 2CDPA 1I3HA 4N43A 3CQOA 2X10A 3RZJA 3DYMA 2LRPA 4MXWA 1JYVA 1TNRA 1LGCA 4BQ5A 1QU0A 1AF9A 2YMZA 3PMSA 4Q1RA 1AR73 3VDAA 3H1YA 4K21A 4RSUA 2Y8KA 1C5IA 1EYBA 1Y9MA 1KS5A 2NM1A 5TSWA 3AKQA 4AFAA 5FYVA 1UZ0A 1H1AA 2VC9A 5DXDA 5SV8A 1LHNA 1CZTA 1CX4A 1PMHX 1WCDJ 2MPFA 3F95A 3T2QA 2W1QA 4RR3B 5FO8B 3UGHA 2OZ6A 5SV5A 4ASMB 2WT0A 2XUMA 3LKJA 1JOJA 1WA6X 4EWAA 3IPVB 2J22A 2JKBA 1JYWA 1DZQA 1RUH2 3I2HA 4JQRA 3AVSA 4Y5TA 1PM4A 4TLGA 2WAOA 4COWA 3V56A 5FYTA 5FQ0B 5I0RA 4LPLA 4DQAA 1UAIA 4FPHA 4RR3C 4YZ1A 2FDJA 3MFAA 1QJY3 1UMIA 4COVA 2YROA 5LA9A 1IQAA 1YFWA 3A4UA 4CU7A 4DRRA 2UY9A 3ZYBA 1DQ1A 1TMF3 2WZR2 4FT8A 1V6NA 4XMAA 1AR92 4QDRA 1DZRA 5FZ9A 1ZBA2 2GN7A 1LGBA 2PHDA 3BYWA 3E97A 3VLBB 4I09A 4MXVA 4LOSA 4XOGA 5DZEA 1HRI3 4IETA 1K5JA 4CXWA 3HQXA 3FWEA 2WC2A 2WT1A 4EV0A 4IEVA 4MGQA 3INAA 3B00A 2QJVA 3BU7A 1QMJA 5C3PA 4Y1XA 5C3RA 2ZZQA 1RVF1 1SLAA 3S6PA 1W8HA 5IVFA 4MH0E 1LRHA 5F8PA 1Y4WA 4AEKA 3WNMA 5A3NA 4C91A 1SCRA 3W5MA 3O1PA 2MEV3 1BCXA 1YFYA 3POBA 3MFCA 2KD7A 5JCTA 2AENA 2GP5A 1QJU3 4ONUA 2X29A 2FD8A 4EN7B 3KGZA 3VB9A 3WF1A 2AACA 5FWJA 2VJXA 3IN9A 2CHHA 3CJXA 4XFAA 4COYA 1RUD1 3ZIXA 3AP5A 1QJFA 3EHKA 3ZX7A 3EYPA 2RS32 3H7YA 3X29B 2BGOA 1ULFA 2J1EA 4WVVA 5I8YA 4D8MA 1PGL1 1ULCA 1WKYA 3GDBA 2JG8B 3PIGA 3IAPA 2ADDA 2Y38A 2ZGNA 4AEDC 1C3HA 1HKDA 2R063 4YFWA 1W2OA 3RI8A 2P3JA 2VZQA 4JDOA 3W5NA 1ZZ6A 2VVEA 5DUVA 1VRH2 2H0VA 4QQLA 1MPXA 3SXWA 3O7OA 4NR1A 3OY8A 2PHFA 4XJUA 2ZCWA 2QQNA 1LECA 2JG8C 3DPRB 4ITCA 1TQ5A 5D21A 5BNQA 2D6OX 4OHYA 3UK9A 1UCXA 4DNYA 1T2XA 3IAQA 2GNMA 1WMFA 2CYFA 4K8FA 2L9LA 1GZWB 1W2UA 3EQEA 3T0AA 1IS6A 2A1XA 2ZTNA 4QDQA 1W8OA 2W95A 4OULA 4W6YA 5IT6A 1RMU1 1W8TA 1O3QA 1PX3A 4UBHA 1KFXL 2EXIA 4Z2AA 2DVAA 1W04A 3DPRC 1JZ2A 3TN93 3EMRA 1O3TA 5IK7A 3O1TA 3NVCA 5C8CB 2UWBA 5A3WA 1RJ7A 3MHZA 4C0BA 2P37A 3NAPA 3J7MA 4A7KA 5L36A 5BNPC 5FP3A 5A7WB 2JECA 5GLZA 5FY7A 1XNBA 3DKWA 4IE0A 1C8M3 1GR3A 3H9AA 4GWJA 1XNKA 3P6BA 5JXGA 3PNAA 1A3KA 4NIIA 4XF4A 1UWWA 3I97A 4L9BA 5FZOA 5C8CC 1E57A 3VBOA 4Q4Y1 3LPGA 2BU9A 5FMCA 4J6GA 1GP5A 5BNOB 2ZGMA 5C70A 3M3CA 4GH4A 5A7NA 1Q56A 1YLLA 1OOPB 2HWC1 4ISRA 4M0HA 5GLUA 4E2GA 5KC5A 3AFKA 1F9KA 1YHFA 3ZIWA 3UESA 3POFA 4MG2A 4NAMA 5HV4A 2YFUA 3IDCB 2WNUB 5BNOC 1Y43B 2Z5WA 1J1LA 2VUJA 3ZDSA 3ZXEA 1REFA 5KHHA 1RUG3 4SBVA 3ILRA 1OOPC 4IEZA 4XVHA 5FZDA 3RZHA 5IFTA 1G9AA 2RS13 3SCFA 3DKQA 3H3ZA 5T52A 3M3EA 5C4WA 1WCUA 3N35A 4MHUA 3ZFEB 1CAUA 3KV6A 4MSVA 1Y3TA 2NMNA 3K46A 5JI9A 2WNUC 2VZUA 2GDFA 3B3QE 2A3XA 2AYHA 3WP6A 4P08A 5JZGB 2VO5A 5J7MA 2QQOA 2WAAA 4Q4W1 1W6MB 4B3NA 2E7AA 4CUAA 4FI9A 4S2GA 3SKVA 3BALA 1VBE1 2WN3A 3LD8A 3ZFEC 4YARA 1D4M1 3AZYA 2VXJA 5EHDA 4BIFA 5C8WA 4V1PA 4MV2A 2Y6GA 4MYEA 4HKWA 1XNDA 3UNPA 3RVHA 2G1MA 5L9BA 4CDQB 5JZGC 3LWCA 3CJIA 2ZEYA 2R073 1G86A 4JRAA 3VKOA 1IGOA 3I49A 2D43A 3EJKA 2CTVA 3THTA 1E5RA 1UU6A 3SH5A 3AXEA 4GB33 1RINA 4G4FA 4Q4X1 1RIRA 3ES4A 2PAKA 3GF6A 4TLFA 2RJKA 4CDQC 1RUJ1 1VMFA 1GU3A 1JMUB 2JG9A 1US2A 3RYPA 1QGLA 5IFPA 1HV1A 1X8EA 1Z7S3 4XURA 1UZWA 2ENRA 2ZAHA 4ARYA 5JOXA 2PLV2 1EAH2 1DZTA 1LENA 2RDNA 3UETA 4AVCA 1BEV2 1UQXA 2QCSB 3KCCA 3NV2A 4YM0A 3MW3A 5L7OA 1UXXX 4FOYA 4JTNA 1KJRA 3UGFA 1GOHA 1HB1A 2GC0A 1SPPA 2RJ2A 2BNMA 2VOXA 4UOJA 4TZDA 1ODNA 4NWWA 3M7AA 3L2HA 3POIA 1I1EA 3K2OA 4NRPA 3UYJA 1S0GA 1OC1A 4NPLA 4DXRA 4XIKA 1H9PA 1IOAA 4Y24A 1SBFA 1BMV2 3BB6A 5FXZA 4AI9A 2BDRA 2BGCA 4IGQA 4QX3A 4BZ4A 3HAGA 2ZOEB 4RYDA 4NOTA 3TB0A 1JTZX 4CCDA 4EWDA 3KVBA 3I54A 5FZCA 1MS0A 2WSUA 3VBHB 4BM8A 1U12A 3MO4A 3C3VA 3I3MA 5KHKA 1YRZA 4EE2A 2OPWA 5ABJA 1PGW1 2VMGA 2WO3A 4UF0A 1PM7A 2IFRA 4UFIA 4RHV3 4KWLA 4E4SA 5JR7B 4CTEA 1JHNA 4MLOA 1XE0A 3DCQA 5IWFA 4H55A 3NMBA 3AMQA 3VBHC 2AZ5A 3AYDA 4Y33A 4COUA 2YHJA 4D7TA 2Y6KA 1GP4A 2AR6A 2PHRA 1OF4A 2XXZA 4I0BA 4AI3A 3D8CA 4AVTA 4KQ7A 2VW0A 5FK8A 2FCTA 1W9SA 4LUMA 2DVBA 1KDMA 3FX3A 2OS2A 4XUPA 1F5FA 4MGIE 4P5YA 3NSTA 1UU5A 2RV9A 3HVDA 3VZJA 1DU3D 2CGOA 3MV01 1XOYA 4LKDA 1UKGA 1CAXA 3A0NA 1OD5A 3VZOA 5I0TA 2LW8A 3R4UA 4M3CE 5DUXA 4NIAA 3T1MA 1VBD1 3AZWA 3O1SA 3H8OA 1HQLA 4S2HA 4YVSA 1X9PA 4AEJA 4OI1A 1HRV2 4I3GA 1LOBA 3B93A 1QDCA 4AL9A 2VUAA 2DCTA 5F1RA 2GSYA 1OKOA 1XU2A 2VTXA 1NA1B 1CPNA 2A6ZA 2B46X 2FZ1A 2WYFA 4YW5A 2JJ6A 4BA6A 3KCXA 4MZUA 4PDWA 3MEPA 1KJLA 2VUDA 2HWB3 4WVZA 5FPBA 5DPNA 1NQDA 4CDXB 1H8TB 3WQ7A 1S0FA 2XH6A 1YIPA 3ZFGB 1RUC1 1EV12 4FP2A 1FV3A 3J4UH 1SG3A 4Y4RA 4RR3A 1LJ7A 1HV0A 1NA1C 1RVF3 1S0CA 3C7FA 4ZPIA 4YW7A 5BXXA 3VL9A 2WQ4A 5CA6A 3ILFA 4XJWA 4H14A 4LK7A 4N43B 2VZVA 5I91A 3H42B 3FZ3A 1TG7A 4OI4A 1LHUA 1HLCA 1H8TC 3AVRA 4CDXC 5FQ0A 1VMJA 2WLPA 2D6MA 1SACA 2D98A 3ALQA 4HL0A 4DUWA 5LW9A 3SISA 2HKXA 1US3A 1FPN2 4QMAA 3O14A 2W2IA 4E8CA 2VD7A 4YW4A 1NCQA 5G05L 4N43C 1RUD3 1PO11 3JQWA 3KV9A 5HXVA 2WNVB 3AZXA 3GM8A 2BV4A 4XZPA 4FTSA 2E53A 2JKXA 3TBDA 1OD3A 4YZ2A 3N9LA 4AVVA 4EQVA 5C71A 2BPA2 3WLUA 2XLGA 3WDTA 5T55A 2PHLA 2MHFA 2QDRA 4KBBA 4K6BA 4QX5A 1S0DA 5CKQA 4Q29A 4E8DA 3Q8CA 5J3UA 1H8VA 1DGWA 5FZ7A 2WNVC 3WQBA 2OVUA 1ENSA 3WOGA 1AHSA 5IK4A 3ZYIB 3RI9A 2P5BA 3QOPA 4FFHA 1WCSA 1WUVA 4KWUA 4TSVA 4AI1A 4HLTA 2JXAA 3M3IA 2C24A 1JI6A 5LASA 3TWIA 3WVJA 4AI2A 4AWDA 5KXCA 3M4FA 5ACA2 3N9OA 1BK0A 2YC4A 5A3OA 3OBRA 3NO8A 4W65A 2AH2A 1IS5A 3CLPA 4JCKA 2HEYF 1RMU3 1GOFA 3KT7A 4Y5Z0 1PZ9A 4NMIA 5FZHA 4D7SA 1GFF2 2D3RA 2JENA 1ZRRA 3KD4A 4O61A 5FY5A 5IUQA 4EZHA 3H8XA 3BODA 2VZTA 5CFCB 4WZFA 3MF6A
chains in the Genus database with same CATH topology
4L2NA 1VB4A 2DU1A 4ZU7A 2GH2A 4I02A 3AYEA 2BVVA 2A7AA 2JG8A 5CG8A 3ME2A 4WVWA 4LBQB 1R082 4P14A 4XF1A 1HDKA 4GA9A 4IV1B 3TOJA 5CFCC 4Q4Y3 1ASJ1 2V73A 1N3PA 3PMEA 2VGDA 1OSGA 3WG1A 3G7DA 4A7ZA 2B7YA 3HD8B 4IV1C 2ZGKA 4YSFA 4Z07A 2VW1A 1S2BA 4AGRA 2Y26A 4XPVA 1RL3A 3IMNA 3VBRA 3ETQA 4K7JA 3VKMA 3AKRA 3ECQA 3APBA 5K0UB 5C8CA 2XJQA 1O4ZA 2XBO2 3VN4A 1VLNA 1TME1 3AZZA 3RS6A 3RPQA 4JDNA 1OLRA 3UKTA 2HWD1 1R1ZA 4OZXA 1LESA 1VBB2 2IFWA 3D5OA 5BPXA 2YYOA 3MZHA 2VULA 3JZVA 2WA4A 1AX0A 4NWVA 2GU9A 1VBE3 4Y1VA 1LEMA 1W6OB 2XHKA 2Z42A 1D4M3 4HT1T 5BNOA 2TNFA 2W08A 3WW3A 2DCZA 1KS4A 2ILMA 2WLQA 2A73B 3N7MA 1WA4A 2NPIA 3BOPA 1OFNA 3GYDA 5I8SA 2P3KA 1G9DA 1Z0HA 1KRIA 4KGGA 4FAHA 4Q4X3 4FOWA 1RUJ3 3OJBA 3VBOB 1KITA 3MPPG 1X50A 4META 3ZFEA 4WVMB 4GH4B 2X8KA 3ZXFA 1PHMA 1POV1 4CEYA 4PJYA 4ZKTB 2PAMA 3JB8A 4HSJA 3ZXLA 5JIUA 1DHKB 2CGNA 1MEC3 3VBOC 5FO7B 1FXZA 1CAVB 1QF3A 1OKQA 1V6JA 4GH4C 1R091 1ZRDA 3U0ZA 3PJYA 3R6SA 4AXOA 5DUUA 1O5LA 1ZA4A 3U4XA 3TN91 1HXS2 4LBJA 2UWAA 1FOD1 1GYKA 4UW6A 4CDQA 3J8F1 2ZGTA 4KU8A 1KQRA 1IKPA 3ZSLA 3ZYJB 2G4IA 4OUMA 4DMIA 3AZVA 4P9YA 4L92A 3TNPB 4KG0A 5FMOS 1X36A 3HBZA 5FREA 2GC1A 5H9SA 1ENXA 2GN3A 1SFYA 1RUI2 4BLIA 1GNZA 5FLJA 3OGJA 1OQEA 1C28A 2R1BA 1AR62 4Q0SA 2BFUS 2R6QA 2VY0A 5GM0A 2RM22 1VBA2 4GMP0 1JXNA 3JD72 1U5XA 3AP7A 4PQ9A 4D94A 4QU2A 2D40A 3VV1A 1OFSA 2GMPA 1U0AA 2KA3A 3UJQA 4Y1YA 1AZDA 1RUG1 2EVXA 3AP4A 4CP2A 1GQGA 2E9QA 2HWF1 2WS92 1VAVA 4FAGA 1V9U2 4LBNA 1PO23 2B45X 3WCRA 1XE7A 4KH9A 4P9IA 2ZHMA 1Q43A 2ZGUA 3RYRA 3LOBA 4C1WA 1BYHA 1WBFA 4E9KA 1VBD3 1DGLA 5JIAA 2JG9C 3KS7A 1BZWA 5T50A 1R1A2 4XBNA 2SBAA 4ASLA 3ZXAC 4RGGA 5L7OC 3SMHA 3VHRA 5HI0A 3ZYGA 4WV8A 1RUH3 2PHUA 1H1MA 2Z69A 1MS5A 1RUC3 3AX4A 3DUIA 2UYAA 1S1AA 4Y20B 4AVSA 1PZ8A 2ZHLA 3OPZA 2ZHNA 3N7LA 1NOVA 4X6RB 5AC91 4UW3A 3W59A 1RGSA 3GALA 2K0GA 3MLKA 1AR93 2ZMNA 3ZSJA 2ZX2A 3GNEA 3IT8A 3GBWA 1ZBE2 1PO13 3PLQA 3KB5A 4Z8BA 5FFOC 4P9XA 1GKBA 1IKQA 4LLOA 5JWPA 1GBGA 4Q8KA 1VALA 3OTFA 2QDNA 2BW8A 3CO2A 2K2SA 4CDXA 3ZFGA 4S2DA 3FC0A 1C8NA 4XDQA 1NLRA 1AX1A 1J3RA 5DDJ2 5CNAA 5I93A 1QNWA 1RHI2 4YVSB 2XKPA 2Q5TA 2ARXA 3POSA 4RHV1 1MZ6A 1Q8OA 3MYXA 2ZX3A 4AQSA 2W0XA 2RS33 1WLDA 4IEXA 3WW1A 1IPKA 1FMD1 4PDWB 2Z79A 5K7PA 4UBGA 4AHYA 5DUWA 4YVSC 1GANA 2A5ZA 1UU4A 4JGZB 4BHPA 2WNVA 4HN0A 2OW4A 4QPYA 2JDZA 1XNCA 1A6CA 4PDWC 4ZU4A 4O9EA 3NL1A 3T2TA 4P9LA 4N53A 4I3PA 4E4DX 1H2KA 1TE1B 2D6KA 1MS8A 1X33A 4AFDA 5BNNB 3FHIB 1ULGA 2XL7A 1ASJ3 4XILA 1NCQB 3D0JA 1VBC2 3WD5A 3VKLA 5CBLA 1G9BA 3CNAA 4TWTA 4QM8A 2EAAA 2ZACA 1OLQA 2R0HA 5E89A 2FHRA 2I07B 5CIRA 4D69A 2TBVA 5BNNC 3VHPA 4FCAA 4XE9A 1NCQC 4PIYA 3SLIA 2F6BA 2HWB1 2VOWA 3OF1A 2CAVA 1NXD1 1ZRFA 3HMYA 1NG0A 5CFCA 3I8TA 5FOBB 1TME3 3DN7A 2DUQA 1AXKA 4AFMA 2HWD3 3I2DA 1SFNA 5AVAA 1AYN1 2EALA 1COV2 4LBQA 4JDMA 1LU2A 4IV1A 1FV2A 1QXPA 1QWRA 3URFA 4AHWA 1O5UA 3S7IA 2B9UA 3PHMA 3H3UA 3R0RA 3N36A 5HCFA 3VZMA 3GZUC 1DYPA 1PIV2 4QT6A 4R4XA 2CGPA 2WSVA 4COZA 4IESA 2IZWA 4Q4V1 1H30A 1LOGA 2Y0IA 4W6XA 4BLJA 2N7GA 5GZGA 1M4WA 2GNTA 5K0UA 2D3SA 4QGNA 3G6JB 4BH9A 2B8MA 3ES1A 1POV3 4GWNA 4B4QA 4Y4YA 1HQWA 4K1YA 1JN2P 1B09A 5GALA 4N7UA 3K48A 3WINE 2XJVA 5D1IA 1CIWA 1AR72 3LA2A 3UKVA 1W6OA 1QQP1 1R093 3ELNA 3RNSA 1PVC2 3B9CA 4YNIA 3VBRB 4BCUA 1SLLA 2C1FA 1FOD3 3PVEA 1PNGA 4R9BA 3J8F3 4HETA 2A6VA 3QCWA 3AYAA 1DQ5A 4LA2A 2XLAA 3N7KA 4RGAA 2GZWA 5J37A 2QE3A 1DF0A 1EAH3 3FBMA 4C0HA 1YNAA 1BEV3 1C1LA 1PMIA 3VBRC 3WR0A 4COWA 2D6NA 3DL3A 3LB9A 5A32A 2XJTA 4P5HA 4GIQA 1QJY2 1SBEA 3VHNA 1CGPA 3LSDA 1OPMA 1JYIA 1K5MA 3H50A 2WINB 4WVMA 1OHFA 4FVVA 3WDXA 2HYKA 2PFWA 1IPJA 1TMF2 1YXWA 4A3XA 1HXS1 4LLFA 2DCYA 1DIWA 2ZZJA 1AR82 3QD6A 2HWE1 4JGYA 1HRI2 3KT1A 1CAVA 3GBGA 4RQPB 5JPNB 2AREA 1V70A 2IXLA 3H7JA 4IQPA 2HWF3 4OHVA 4A2UA 2OZJA 2RE9A 1VR3A 3TAYA 4RD7A 1LB2A 1WW6A 1G8WA 4AHXA 4CEYB 1BQPA 1RUI1 1D0GA 2MEV2 1BK1A 1VP6A 1RUE2 4QHBA 5LK5A 5KHIA 4DOUA 1AR61 2Q30A 4YG6A 1QJU2 2ZHKA 4GALA 2YY1A 2O8QA 3VBFB 4GWMA 1QNYA 1EPWA 5CB7A 4CEYC 2EIGA 4ORFA 3L2YA 5J48A 2KXLA 2ZJCA 3ZMOA 3QBQA 4HVRA 1N3QA 3WQ0A 2XB6C 1DLLA 2JD4A 2DTWA 1H4GA 2D3PA 4YM2A 4FTEA 2R062 5A33A 3WNXA 4OVEA 2VNRA 4XF3A 2H6BA 2YDEA 5J96B 3AMHA 3WP3A 3MPBA 2DUOA 5AC93 2Q4SA 1LOFC 2QZ2A 3R4SA 1HRV3 4NPRA 3SH4A 1O7FA 3PTYA 3ZMNA 1LTEA 3VBUA 1AL21 3MLJA 4DRVA 1REEA 1MEC1 3D4KA 3SCGA 1LHWA 4ATFA 4C90A 3WV6A 1ND2B 1EV13 1QJX1 3USUB 4B7KA 2D44A 1I6XA 1NY72 1SQ4A 2R042 4FPFA 3WT3A 4AHZA 4MGKE 3UL2A 3WDYA 2D97A 2LM3A 4AFBA 2OYZA 2E6VA 3E6DA 2A75A 1C4RA 4OHWA 4PLMA 4XIOA 1ND2C 1H4HA 3B69A 5JSOA 4AGGA 4Y20A 2RS52 4I0WB 1VAMA 1H2LA 1LU1A 2HEVF 2Z2SB 4F83A 2I2SA 1RUF1 2EXHA 1MS9A 1MZEA 3AK0A 3ACLA 4U36A 3ZN4A 5F1RA 1FMD3 4CYDA 2C0ZA 3KQRA 5JDBA 4P9WA 4Q0QA 2XGXA 1RJ8A 2ZGSA 4YG3A 2ZGOA 3HWJA 5LEJA 1WLCA 4IEPA 4QGLA 3KT4A 3S7EA 2RS12 1PVXA 5HBAA 3WY6A 2DWRA 3AP9A 1BKZA 1J59A 2B42B 1W6NA 4XFGA 3L9JT 4LA3A 1PO21 3MF9A 5ACA3 3S30A 1PK6A 3LAGA 5IK8A 3OBTA 3OGGA 2LTNA 2DVDA 4HN1A 2B5HA 5JAXA 1XXNA 2ATFA 4LEJA 4DZGA 3TNQA 4LE3A 4Q1PA 5JI7A 5C9AB 1QOTA 3POYA 1C1FA 4GXLA 4NO4A 2EAKA 1RC6A 2A6WA 3WCSA 4X6QB 3KGLA 2WFF2 3WG3A 4YG0A 4YW1A 1WW7A 5F6KA 4MGYE 3ZXDA 1ND3B 2IXIA 4B8EA 1DQ4A 1RUH1 4LHNA 4GB32 3M70A 4JGZA 3T1LA 2VMHA 4AE2A 4LBQD 1N47A 3KM5A 1XYNA 4KWJA 3IKWA 5EXOA 2V5YA 4FBFA 4YW2A 3E6BA 1ND3C 1AYN3 4LHLA 4DINB 3ZFGC 3CF6E 2WZR1 4BIOA 4FPYA 1G7YA 2PQQA 4B4RA 2VOVA 1AR91 4R9AA 5BNNA 2UY8A 1ZBA1 2GAUA 1CN1A 4CZSA 3RZZA 1MVEA 2PHWA 1O3RA 3MLLA 4IEWA 5DG1A 4B4PA 5D8AB 2X5IB 1LOCA 4Q4V3 3MDPA 1EPZA 4N53B 1Q8PA 3N3HA 1N1SA 1FAYA 1A8MA 3UKNA 3RJ2X 5D8AC 2PHTA 3LA7A 4E2QA 2X5IC 3AP6A 1B35A 3ROUA 4N53C 3O0VA 3QLQA 4FO9A 3B02A 4Y26A 1D0HA 2DFCA 1X82A 2WA3A 5KHJA 4CDWB 4DY5A 2RS31 1LOEA 5EFUA 4NHLA 1QQP3 1T6GC 4QGMA 3DGTA 4NHKA 2PAEA 1NE6A 2P34A 3AFGA 3J9SA 4OFGA 2ZMLA 1CAWA 4M3CF 1TNFA 4Q0UA 3V0AB 3O0XA 4OI2A 1VRH1 2XWJB 1QOOA 2BWAA 4B29A 2A6YA 3H1MA 5L19A 4EN6B 4YZ3A 4N9HA 2HEWF 1QKQA 4UW5A 1Y7BA 4SLIA 5E16A 3CEWA 2ET1A 4IL7A 5EYYA 1XE8A 4AI0A 1Y9QA 1ALYA 5C6CA 5DZGA 3FFZA 4LO6B 1UMZA 3JUUA 4ZU5A 1PVC1 3P3NA 4H7LA 1YCIA 2ZKNA 1HXS3 1CQ9A 4HK9A 1U5ZA 3ST7A 5JSRA 4PBOA 4LNVA 1SLCA 3GBFA 4YVWB 1YI9A 2HWE3 5AVPA 1S0EA 4Y1UA 1UL9A 4NHMA 2QNKA 2QKDA 5EV7A 5JOZA 4IEQA 2XJRA 4K40A 5T5PA 2G9FA 1AYM2 1VIWB 1OPOA 2R0FA 4HVOA 4YVWC 1RUI3 1AR63 1MS3A 2EXJA 4N90A 1SDWA 5EWSA 2RM23 4Q8LA 5K0UC 3PVOA 1AR81 2YGMA 1O4TA 4FPJA 1UZYA 2IWGB 3OYWB 1WLTA 1YI7A 3GZAA 4FPEA 1PGL2 3WDVA 2VECA 3FLTA 3WP4A 4GULA 1V9U3 4A7YA 3NV4A 1WCKA 5A3MA 1DQ6A 2YV8A 2NZ9A 4RQPA 1RTVA 1BBT2 1RUE1 4R9CA 5A32B 5CADA 2OA2A 5J09A 2XG3A 1AXYA 4K3UA 1QJZA 4IEUA 1ZZ7A 1K5MB 2IXJA 4CEWB 5FRAA 2DUPA 3QH7A 1R1A3 3WQ1A 4D3WA 1KDKA 1AL23 4HSLA 4HZFA 5LEKA 4AYUA 1RUOA 2P2KA 2DVGA 1WLWA 4JVAA 1RMU2 2KM2A 4XXPA 4JGYB 3VBFA 3V64A 1K5MC 4HKLA 2YGLA 3VHOA 1MACA 1QJX3 3QH6A 2RMU2 3AJYA 1G9CA 4XYXA 1YFXA 3VDDA 4WM7A 1CD3G 3IIAA 1ZZ8A 2AUYA 3C2UA 1LOFA 1SEFA 4DXZA 4FSJA 4NVPA 4YZ4A 4JGYC 3MICA 1GLHA 2ZGQA 3SHRA 1DQ0A 1O91A 2PLV1 1EAH1 2JEMA 5CVRA 3ZXJA 1BEV1 1UD1A 3VZKA 4Q4Y2 3BIWE 2PTMA 3QACA 4XJZA 2JX9A 2HWC2 1BVVA 1CJDA 1RUF3 3JU9A 4BMBA 4DB5A 1JUHA 1GZCA 4BQ1A 4XXAA 2A6XA 2R041 2XVKA 1NQJA 4XW3A 1BMV1 4R52A 2R16A 3NKTA 4N7IA 4AQ2A 3V0BB 1F2NA 5A33B 1FYUA 1RITA 3SNMA 2TUNA 2O8OA 3B5LB 4GKXA 1AJKA 1Q5OA 1ND2A 4H3WA 3USUA 4CP0A 2FMDA 4O9GA 1WGPA 3UV9A 4F7ZA 2CNAA 1IZ3A 3O5SA 3RMXA 3D6EA 3ZO0B 3WXPA 2JE9A 4BE3A 4EROA 4IERA 3VBUB 3W9AA 4Q4W2 3WUDA 2CL2A 4PLOA 2WQZC 5FDBA 1YUDA 1WW4A 2YC0A 5KXBA 3FUQA 3OCPA 4W6WA 3VBUC 3JBG2 1J3QA 1UPSA 2XVGA 1KFUL 4Q4X2 2GNBA 5FPZA 4XQ4A 1RUJ2 3M3QA 3FMGA 4LULA 4K1ZA 3H0OA 2RR12 1FNYA 1JUIA 1N1YA 4EN0A 1HRV1 1S55A 2WZR3 1SCSA 2ZKLA 4CDUA 3UJOA 3WUCA 4BMEA 5A3LA 3LA3A 3SH3A 1ZBA3 1V6OA 3E5QA 1QHDA 3NJZA 1QY4A 3ILNA 5KWRA 2E51A 5J98B 3WHTA 2RJLA 2PELA 5C9AA 3WX5A 4XFCA 3MW4A 1ENRA 3RG0A 1EV11 1F31A 5JSPA 4QPIA 2ZMKA 1DGWX 1W6NB 4HK8A 2I74A 4YZ5A 4R4ZA 3B01A 1ND3A 3HT1A 3GHNA 4GQ7A 3I59B 4RFT0 1PK6B 2YZ4A 4AQ6A 1PGW2 2R1DA 3SCHA 4L11A 1FPN1 5C33A 1FNZA 4OUSA 5I8TA 1M06G 1MVQA 2XL9A 2D5HA 5T5JA 1YFUA 1PK6C 2E7QA 3LGRA 4Q2FA 3HR9A 3H8UA 3HIFA 4KWKA 1IHMA 4KU7A 4RA0A 5FPXA 2CWSA 4MVTA 3FLPA 4HPKA 4XJ8A 5KXEA 2BNNA 5GLTA 1ULDA 3MIGA 5D8AA 1VRH3 1J1TA 2X5IA 4FOQA 3JCIA 4OHZA 2NP0A 1XYPA 2ZX0A 2PYTA 4ZXKA 1W6QA 1KD7A 3MGUA 1VBD2 1W6PB 4JGZC 4Y22A 5ACA1 3OD0A 1CESA 2R32A 3IDEA 2CV6A 3M1HA 1ZNPA 4LBKA 4PBPA 3BPZA 4MUVA 1O4YA 4XHBA 1PVC3 2B39A 1C57A 1YJLA 3HN1A 4J1WA 4LT5A 5KBFA 4YGCA 4CDWA 5JOYA 3E5XA 4KG8A 4G9SB 2A3YA 3U10A 3AB0A 2ZAAA 1AX2A 1RUC2 1QXRA 3AKSA 4R9DA 1R081 1AL0G 3V0AA 2MNGA 4RS5A 2W39A 1LOAA 4OLLA 5KXDA 1B35B 4IEYA 5EJ3A 1W0OA 4LTAA 3ATGA 2IXHA 3W58A 1WMEA 3ASIA 2DCJA 1AR83 5DG2A 4Y1ZA 5GJ6A 1PO12 1B35C 1UIKA 1CAWB 2OIIA 3FLRA 4QPGA 3WZ1A 2QVSB 3U07A 5FOJB 1XYOA 1S0JA 2DU0A 3WW4A 1LEDA 2XBO1 1AYM1 3AMNA 5JPMB 4YVWA 3MIDA 4XFHA 4AI8A 3LSEA 4LBLA 2XKOA 4AK3A 1RUE3 4QQPA 1AXZA 1VBB1 4UW4A 3ZYRA 4G3YC 4BYYA 1QXJA 3WW2A 5EYXA 1LR5A 4YGEA 3O12A 1CONA 4AEDB 2NMOA 5CU1A 3DV8A 3N4MA 2ZS6B 2GNDA 5GZCA 5LRSA 2VPVA 4WZCA 4QQHA 1L3JA 3AKPA 2ZX4A 3K51A 4R8HA 5FCCA 3OYWA 1DBNA 1BBT1 3ENRA 3PJQA 4QQ2A 2GMEA 2Q0AA 4N9IA 2C5DA 2PLV3 3NV3A 4XJ9A 5BNPB 1DDLA 1ZVFA 1ASJ2 4Q0VA 2ZBJA 5AFBA 2PA7A 4CEWA 1LHOA 1MQTB 3FBYA 3VKNA 4KNCA 2RMU1 3O0WA 3NW4A 2R043 4NN0A 3WDWA 5GZDA 2PN5A 3R4DB 2Q1MA 2UWCA 3ZYPA 1POV0 4EN8B 1QDOA 4PLNA 1MQTC 4F8AA 3D82A 4FTBA 3FFQA 1TME2 2RS53 4EWEA 5E88A 3BOWA 4JAAA 2XVLA 2W68A 2HWD2 5KHGA 1HW5A 5AFEA 4Q26A 1RB8G 2ES3A 3E6CC 4RQPC 5L73A 4XQDA 1YO8A 4HVQA 1NCRA 2RM21 4AVBA 1VBA1 1JH5A 2H0BA 3JD71 1SBDA 3VGIA 1D4VB 1OQDA 3POWA 1AUYA 3BTAA 4B7EA 3AMMA 1CR7A 4MX3A 3WG4A 1DGRN 5T54A 4U2AA 3WG2A 3VDDB 3WP5A 3MW2A 3A0KA 4WM7B 2VVFA 4YM3A 4AGVA 2WS91 1GZ9A 1V9U1 2UU8A 3VBFC 3V0BA 3MIEA 2VW2A 2JICA 1ULEA 1SLIA 5F5QA 4FPCA 4FPGA 1FT9A 1GNHA 2ARBA 3CL1A 3VDDC 4QQOA 4WM7C 5CAZA 3MIFA 1SLBA 1NLSA 4XETA 1Q8VA 2NN8A 1GSLA 5GLVA 3GZTB 1FX5A 1R1A1 5GZFA 2XJSA 2A70A 1GICA 3NV1A 1PNFA 5FBZA 3OD4A 4P9JA 1OI6A 2WFF3 1H1IA 1GV9A 1Q8QA 3AJZA 3JBG1 4HKOA 2R30A 2RHPA 2UURA 4KL1A 1R092 3R05A 1RUNA 3AYCA 2D5FA 3TN92 3PVNA 1FOD2 1V6IA 4WM8B 3FE5A 3J8F2 2XWBB 2LUWA 4GMP1 4I01A 4L99A 3ZPYA 1ZZCA 3ZN6B 2WT2A 1NZCA 1C8M2 2RR11 5LK7B 2VMIA 4FPOB 3AKTA 2EXKA 4CP1A 1VJ2A 2GMMA 2QFEA 5CG9A 2Q8OA 4WM8C 4Z92B 1REDA 1BXHA 1FPN3 1MZ5A 1U5YA 1WW5A 2OPKA 2BWCA 3AMPA 4Z2WA 3I7DA 1UX6A 1O3SA 4D7YA 2FQPA 4K9SA 1ZBE1 1I9RA 1OMIA 2WNEA 1AVBA 4XFBA 3RMYA 5DZFA 3VKFC 2VQAA 4LO8A 5K9YA 1C5HA 4XMIA 4M0NA 3J26N 1F5JA 1OA3A 1CJPA 2K9ZA 2Y0OA 2ZABA 4MGZE 1RUG2 4JTOA 5GLWA 4IV3A 4UXAA 5LRRA 1A8DA 2HWF2 4J1XA 4M3CB 3NWKA 2VH9A 5DDJ1 2BEOA 3VBSB 1MR5A 1RHI1 3ZXKA 2ZA9A 3I59A 5CFDA 3H1WA 4AVAA 4CDUB 1S0BA 2P3IA 4TYSA 5IK5A 3EBRA 1FATA 4LR4A 2WFPA 3RSJA 5I0SA 3VBSC 1H9WA 2CWMA 2EA7A 4FPKA 2GC3A 3VZLA 1UF2C 2VXRA 1XRUA 2E63A 3LOIA 3ZFFA 4QPIB 4AEMA 2R072 1QH7A 4YLZA 4CDUC 1XU1A 2W52A 5J36A 4DPNA 4LE4A 4GKYA 2XJPA 5C9AC 2VNOA 1R083 1MS1A 2BVBA 2FZ2A 3KZ4C 1DFQA 3THPA 4QPIC 4KGQA 2ZPXA 4X8NA 1N1TA 5AC92 2IC1A 2VNGA 4ES8A 4ISQA 1Z7S2 5BUVA 1VBC1 4HFSA 4JV4A 1CVNA 4LBMA 1F8VA 5FLIA 1W6PA 1LKNA 1UKRA 3IWZA 4PIZA 4HPKB 1XQNA 2D93A 2DYCA 3RYKA 2YPJA 2XBO3 1AYM3 2XLFA 3BCWA 1EP0A 2NQYA 1VAKA 2VOKA 3IPVA 3TRSB 2FBEA 1ZX5A 4MXWB 1W6QB 1VBB3 4E4ZA 4Y22B 1OA4A 2DVFA 2XPJA 1COV1 2WL1A 4YGDA 4FXGB 2P17A 2A3WA 4RHV2 1SLTA 1NXMA 3KLSA 3P3PA 4FXKB 1DGRA 1FMD2 1S2KA 1V6LA 4FQ4A 1BJQA 3M3OA 1PIV1 5GZEA 3GHMA 2F4PA 4F3JA 2DTYA 3NKGA 1Q8SA 4HBNA 1BVP1 1X8MA 1BBT3 2DFBA 3KCYA 4YFZA 4XJAA 2QZ3A 3E5UA 4RS5B 5B2GB 4CDWC 4EN9B 2BYVE 2ERFA 2YUEA 1AR71 1ZM1A 4RS5C 4I2OA 1PGSA 3HT2A 3ZXGA 2G9GA 2O1QA 1UZZA 3WHUA 4AEDA 2R49A 4DFSA 1SMVA 2RMU3 4QPGB 5GKAC 4P9GA 1NE4A 2D7FA 3JQXA 1NYWA 2C9AA 4E27A 5H9RA 2CAUA 2HWB2 1MZFA 2D6LX 3RQ0A 4XEZA 2WKKA 2ZX1A 4M01A 1LULA 4QPGC 1MS4A 2I45A 1RVF2 5H9PA 3FJSA 1YJKA 1WD4A 4LBOA 1JYCA 5E8AA 4JC1A 4XBLA 1QJY1 1I5ZA 3IDBB 5EZWA 2HWC3 3DPRA 1G9FA 1AYN2 3IBMA 4FPLA 4BPZA 1TMF1 1OA2A 1QOSA 5BNPA 1GZWA 1VBA3 1WMDA 4XFFA 2ZGPA 3JD73 2H6CA 3LZZA 3M2MA 2JE7A 1N3OA 1HRI1 1RUD2 4AW7A 3EO6A 4LO7A 3U11A 1MQTA 4JRLA 4YM1A 2FMYA 3VL8A 5FMOL 1S0IA 2TEPA 2WS93 3OY8B 4INDA 4Q4V2 4AFCA 4LO4B 1UN1A 3LCPA 4OI0A 1HX6A 4LUKA 1KXGA 2BQPA 3B94A 1QH6A 4IEOA 2MEV1 4CRQA 1CPMA 5FTTC 1V6MA 3MIBA 5E1RA 2AGSA 4YYOA 5BYNA 1WBLA 2BFUL 4Q4W3 2ZGLA 2NYYA 2OUJA 3N7JA 1QJU1 3RJRA 2DV9A 2IXKA 1ZZBA 3VZNA 1G6NA 1URXA 4ES9A 1IS4A 1OOPA 3AM2A 4XBQA 3NAPB 4XHXA 2ET7A 4IXLA 3JBG3 1H0BA 4X8PA 1J58A 1QQP2 3RWNA 1EY2A 3D0SA 2WNUA 4Z82A 5FAXA 3V65A 5BY5A 4CEWC 2R061 2CY6A 4GMP3 5JMCA 3NAPC 2XJUA 1OQ1A 2BTVC 5KC6A 1H2NA 5FLHA 2GH8A 2RR13 4BOWA 2VVDA 2IXCA 4PF5A 3S0MA 3KSCA 4ATEA 3FUOA 1ONAA 5JZGA 3VUOA 4QXKA 1NCRB 4RL7A 1W6MA 5HCBA 4EJRA 4XTPA 3B7MA 4C1XA 1W39A 4S2FA 4XFIA 1ZBE3 1JW6A 4XF9A 2WIIB 2DURA 1NY71 2OUHA 5C4WB 1NCRC 1CAUB 2HWE2 1PZ7A 1ZYBA 1C8M1 1LODA 1UPIA 2GC2A 4FOVA 1AJOA 2Q1ZB 2E7TA 5K8SA 2O0OA 4WM8A 2BNOA 3TYJA 5DDJ3 2WZPP 2BUKA 1YWKA 2RS51 5C4WC 1RHI3 5F9TA 2SLIA 3ZN6A 4AG4A 2VG9A 4PIXA 1DQ2A 4Z1VA 4PCRA 3ZVXA 2X53S 1ZRCA 4QD2A 3CJIB 2HJIA 3DF0A 1HQNA 1ZZ9A 1VBE2 3ZN5A 3B9IA 4OHXA 1D4M2 1ENQA 2VU9A 5T5OA 5JOWA 4L97A 4BWOA 2RS11 3CJIC 4YW3A 4YRDA 2JG9B 4URTA 1GQHA 3RDIA 5HCAA 1TEIA 1LHVA 2D6PA 3PVBB 2WWSA 3VBHA 4Q27A 5L7OB 3M8LA 4M3CA 1D2QA 4YGBA 3JB4C 5T5LA 2V09A 3VBSA 1VBC3 2NLRA 1DG6A 3MIHA 4FP3A 3MI8A 5BV6A 4FQZA 3KMHA 1AL22 1DYKA 1JBCA 4DY3A 3Q9OA 2BBVA 2R071 1MEC2 1X7NA 4Q0PA 2WFF1 3ZSMA 4E2SA 1APNA 1U5IA 5T3NA 1LGNA 1IS3A 1QJX2 2LALA 1UW8A 4IV3B 5JLVA 4L8QA 3IM0A 4LO5B 4GB31 5H9QA 4H7MA 1N1VA 2GALA 5JVVA 5ABJB 4WBBA 3ZSKA 2DCKA 4DS0A 1J3PA 1UIJA 4K20A 4XTMA 4XQWA 1YIFA 2UYBA 1Q3EA 5I0UA 3I4IA 1Z7S1 1A78A 1V00A 2QQPA 1WD3A 5CFDB 3RRDA 4IV3C 4AQTA 1COV3 1YYNA 4HANA 4M00A 5ABJC 1W0PA 4LHKA 4XF0A 3USSA 1HIXA 4HMZA 1V6KA 3ZSEA 2ZGRA 3CU7A 1RUF2 2EF6A 3SITA 2QUOA 3AXDA 5F6LB 2ETEA 2WJSA 2YXSA 5CFDC 1NA1A 2A71A 3ZFFB 1ZREA 1VB2A