2G9GA

Crystal structure of his-tagged mouse pngase c-terminal domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
189
Chain Sequence
b'GRVSGSLAWRRKEILFIPSENEKISKQFHLRYDIVRDRYIRVSDNNTNISGWENGVWKMESIFRKVEKDWNMVYLARKEGSSFAYISWKFECGSAGLKVDTVSIRTSSQSFESGSVRWKLRSETAQVNLLGDKNLRSYNDFSGATEVTLEAELSRGDGDVAWQHTQLFRQSLNDSGENGLEIIITFNDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords peptide N-glycanase
publication title Structural and biochemical studies of the C-terminal domain of mouse peptide-N-glycanase identify it as a mannose-binding module.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 48
structure length 189
sequence length 198
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04721 PAW PNGase C-terminal domain, mannose-binding module PAW
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1020 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2g9gA00
2G9FA 2I74A 2G9GA
chains in the Genus database with same CATH superfamily
1SHWB 3WDTA 1ENQA 4AGRA 3KVAA 1FPN3 5CNAA 1SPPB 5IK7A 4QWNA 2ZX3A 2GDFA 4I30A 1SLAA 4QXKA 4XXAA 3VV1A 3WW3A 1JOJA 4YSFA 3AJZA 1RUI2 3WQ0A 1GICA 1XJAA 3MF9A 5DMYA 5IAXA 1COV1 1H8TA 4N53B 1CAXB 1DQ5A 4DY5A 3SMHA 4LBMA 5FYVA 4N9HA 2ZHKA 3VDDC 4XVHA 3NNFA 3WW1A 2VM9A 3JB8A 1J58A 4SLIA 3D8CA 1KS4A 2J7MA 5FPUA 2VBBA 2C6SA 1V6NA 5SV8A 1JYNA 2QJVA 4S2HA 3ZX7A 3NV1A 4MXWA 1AUYA 1UQXA 3QBQA 4GAZA 1W6NB 3URFA 1HQNA 3V65A 2D7FA 1PZ8A 4W6WA 3NAPA 4NMIA 4V1PA 3G7DA 5FWEA 1GOGA 1HV0A 3JQXA 1CPNA 2UWCA 5K0UA 1VE0A 4WM8B 4BA6A 1V6KA 4IDZA 1W6QA 3USUA 5EIYB 4UFMA 2A75A 1W3XA 1LECA 4NWWA 1PO11 1UN1A 3HNBM 5F3IA 3N7JA 1G9FA 5DDJ1 4LTAA 4EYUA 5ERLA 2IXJA 3ZXFA 2VG9A 3RZHA 2ZMNA 3VBRC 5JLVA 2GZWA 4Y1ZA 1NZCA 3EYPA 1ZYBA 2CDOA 2HWD2 4XFBA 2WA4A 5D21A 5FK8A 4DS0A 4COWA 1KEXA 3NJZA 4QXBA 3VUOA 1H4GA 3J4UH 5IVEA 1DQ4A 4CEYC 1RC6A 3GF6A 5C8CB 1HB3A 1WCUA 2J1RA 3OD4A 4JHZA 2VULA 4BQWA 3MDPA 2P4EA 4MXVA 1W8UA 5A33B 4QMAA 3KSCA 3SISA 1CPMA 1OVSA 1VMHA 3GJAA 3JUUA 4MGYE 4DEVA 2O8OA 2VTXJ 4D6QA 2ZMLA 4J1WA 4CCNA 1L7QA 3ATGA 5FJKA 3T1LA 2TUNA 2PLV2 2BGPA 3DYMA 1POV0 2Z4FA 3LQCA 1TME2 3AFGA 3WF1A 3WF4A 1ZX5A 3MIHA 4CVUA 3WV6A 4XPVA 2OZJA 2WO7A 4IEYA 2AEYA 4E4ZA 5F1RA 1JZ2A 1H8TB 3BTAA 5FZ0A 3KV6A 3OGJA 1IGOA 3BALA 1LGBA 1H4HA 1RHI3 3PNAA 3LDRA 2BNOA 4Z82A 1OF4A 3Q8AA 3HT2A 1ND2A 2EXKA 5FPLA 3S6PA 5FZAA 4LXLA 3AB0A 4YFZA 1R092 3MBWA 5FZ6A 5HCFA 5F5CA 2PLV3 2Y6LA 2WC2A 5CVRA 1ZZ8A 3KQ4B 4MXWB 4YYOA 4DUWA 1VRH2 4KU7A 2RG4A 5KXEA 1QMJA 2MEV3 2WZR2 5JDBA 1L3JA 5LRSA 5A1FA 2BBAA 3KF5A 3NAPB 4KWKA 1ULFA 4XCBA 4XETA 3RDIA 2DFCA 4LK7A 4QM8A 1QDOA 1E5HA 5K0UB 1NCRC 2HEWF 1S0GA 2ZMKA 1W6QB 1S2BA 3VD3A 3USUB 4CDXA 4PLOA 5EQUA 2YGMA 2YGLA 1H9PA 5EFUA 1AZDA 2NYYA 3DUIA 1T6BX 4CUBA 1CJPA 1XOYA 4AEJA 3I49A 3KZ4C 1PHMA 1R093 1UU4A 5L9RA 5E16A 1PM4A 2ORXA 5DN2A 2VPVA 1D2SA 4HSLA 5HXVA 2YZ4A 4ATFA 4XABA 2JDNA 4DXRA 3A22A 4Q1RA 4MG2A 2QQKA 2EIDA 4JZRA 4CCLA 2ERFA 5F9TA 2XGXA 1Y9QA 1AL21 4AHYA 2XLGA 5C3OA 2R49A 2X29A 4CP9A 1Z7S2 1OMIA 1OD5A 1SFNA 3OBRA 5F5QA 5FLIA 1HB1A 4QB2A 1LNSA 1YO8A 3AMPA 3BODA 3VBHC 2PTMA 2ZBJA 1GOHA 4ET7A 4Y26A 2XKOA 2Q1FA 5JPNB 1RVF2 1RUF3 4UXAA 2RJ2A 1MACA 1W8ZA 1YEWA 4XDPA 4TXWA 5KC5A 1LESA 1W90A 3UK9A 2BGOA 3U4SA 3L2YA 2SBAA 3P5BA 1J3QA 1OOPC 2GP5A 1JYIA 3AZVA 5FMOL 3WNKA 5J36A 1S1AA 3T0DA 4M0HA 4FPYA 2Y38A 3OF1A 4DZGA 2P37A 4MHUA 2XBO1 4YM2A 3AP7A 3ZXJA 4QPIC 4CE8A 3I3EA 4E9KA 2WN3A 4XF1A 5IVJA 3VB9A 1ND2B 2WIIB 5GKAC 2X09A 3HQRA 5F8PA 5E8AA 2LM3A 3GGLA 3UKVA 2VMEA 1ND3C 3MPBA 1CAWA 4E27A 2QTWB 5FPAA 5FO9B 3HWJA 4YGEA 4PLNA 4K3UA 4PI0A 2PA7A 2YHJA 2Z79A 1EV13 4FOWA 4IE7A 1GUIA 3M1HA 4RFT0 1QJX2 4S2GA 2WNUC 1MR5A 1TNRA 4FOQA 4YWAA 5A3OA 4AI0A 3ZN5A 4CDXB 3A7QA 2LUWA 3I4IA 2RJLA 3TEXA 2ZEXA 4A45A 5F3CA 2VZPA 1C28A 1XRUA 3DV8A 1VMFA 4YGCA 1QJEA 3KQRA 1RUD2 3V0BA 2AH2A 1I3HA 1K12A 2CGNA 2OT7A 3HIFA 4BXFA 2ZGOA 1AR82 1CIYA 2WQ4A 3UETA 3WF3A 3D6EA 1RMU1 2AYHA 1AR93 5FY7A 2VZTA 1HW5A 5EZWA 1C4RA 5A7SA 2NMOA 1EV11 4GIQA 1LGCA 5FXVA 3MIBA 5LZ6A 2AGSA 4P08A 1NQJA 1B35A 2EIEA 4HLTA 1ZM1A 1XNAA 4CP9B 4XTMA 5J1XA 1ZRDA 2IXCA 3VDAA 4CUCA 4E2QA 1OQDA 1SBEA 1LULA 1OA3A 4JGZA 1W0NA 5I93A 4MO3M 1SG3A 4OQ9A 1QOTA 5FYYA 3GM8A 1GZWA 3F95A 1NA1C 1W8TA 1IG0A 2RDNA 4CCMA 2ILMA 1CGPA 5KHJA 5LEKA 3GCWA 5FYCA 1AX2A 4W6XA 4AI1A 3NJXA 1MVQA 4UFIA 1XE0A 1PO22 2G9ZA 3PIJA 4M3CF 3CIHA 1Q3EA 3DCQA 4RGKA 5FZCA 3Q8FA 1QEXA 4NN0A 2NMNA 2YB7A 4NROA 1UY4A 3RJ2X 1RGSA 5L9VA 1YHFA 2MHFA 2AEZA 1KXGA 2ZA9A 3AVSA 2G4IA 1F15A 1JU4A 3HNYM 4A44A 5GJ6A 3MIEA 2QVSB 4ORFA 1US3A 4QB1A 2B45X 2XVGA 1F5JA 1V00A 4AVVA 3T2OA 3FMGA 1R082 4LHKA 4S2DA 3ZKYA 2BYVE 5C9AA 3WP4A 1HB4A 3OPTA 5FUPA 2YC4A 5F5IA 4LT5A 3T2QA 1S0JA 1UW8A 3LIHA 4Z8BA 3LA7A 3M3QA 3MIDA 4Q0VA 2EXHA 1X9PA 1CAWB 1YNAA 2CV6A 1DF0A 1RIRA 3TAYA 3D0JA 1AYM2 2DFBA 1QJY2 2VMHA 1HX6A 4ONUA 5BPXA 1TMF2 5FP3A 1UYXA 5IJRA 1JI6A 4Y24A 1HJGA 1O5UA 3E5UA 2Y0OA 1OH3A 2ZEWA 1BCXA 1REDA 5A3NA 3H3ZA 2WNEA 3POYA 3NV2A 2D6KA 4XUTA 3TWIA 1WMEA 1UYZA 5C71A 1CZTA 2ARAA 1Y43B 4LBNA 5FKBA 2EIBA 4LEJA 3VD4A 3ACLA 2VZ3A 3AK0A 4JAAA 3B69A 3TB0A 5CFCA 2VXRA 3SH4A 3V0BB 1CZSA 1CN1A 1F9KA 1GKBA 4I3PA 3OB8A 5BXXA 1VPHA 2XJTA 4CXXA 1E5SA 3U37A 4E4SA 2J42A 2Z2SB 3FBMA 1GBGA 4FFFA 2XMLA 4URAA 1UU6A 1B35B 2ZABA 5FP7A 3ENRA 3BOWA 3O7OA 2GNTA 2Q0AA 1UX7A 2DYCA 4QX2A 5FMOS 2DCYA 5LY2A 2UURA 3ZMNA 2PHXA 4A4AA 2B9VA 2XHKA 4I02A 4JGZB 4U36A 3B3QE 2J1EA 5K4LA 3ITQA 1ENSA 3GZUC 3WG1A 4IEZA 1JYWA 1GZWB 4MH0E 2H0VA 3GZAA 5IVVA 1NXD1 1RUG1 1Y9GA 2BQPA 2R1DA 2E51A 1O8PA 3H1WA 3ZYHA 1ENRA 5JSRA 1RTVA 1C5HA 2CYFA 2ZXQA 3ZYGA 1RUJ3 3LA3A 1E57A 2A1XA 1H1AA 4LBQA 1JN2P 1D7PM 1HQLA 5CFDC 5G04L 3WSOA 5A3TA 1W04A 2QZ3A 4H14A 5FZIA 2YFUA 3MZHA 2BVVA 2P17A 3AYEA 3C3VA 5JZGA 2FDKA 4YVWC 3DN7A 4C90A 1W2TA 3POGA 1PVC1 2VGDA 1VAKA 1RJ7A 2NPIA 1AL0G 2Y6GA 4GWNA 4PF5A 4AL9A 3KHBA 3DGTA 4AI9A 5FZ7A 1HRI3 3JQWA 2R32A 3EB7A 5C9AB 3LIGA 2Q8CA 1UY2A 2GN3A 1PMIA 1BYHA 1SLCA 3CF6E 2QUOA 3P3PA 1RUJ1 4COUA 3W5MA 4UBHA 4OHYA 3IMMA 2ZGPA 2GMPA 2ZEYA 3FN9A 2HWE2 1YWKA 5FV3A 4AEDC 1LB2A 4QHOA 3O5SA 3LEIA 3P6BA 3AL6A 3E6CC 3POSA 4NRQA 4DXTA 5A1AA 4OVEA 3VBOA 4DO0A 3VHOA 2OPKA 3O0WA 4Y4YA 4JTOA 1W99A 3AKPA 4IGOA 4KWLA 1ONAA 2JE9A 3SXWA 2YBSA 4MGTA 4X6QB 1HRI1 4BXSV 5J7MA 2IVJA 2DF7A 4LKSA 3FJSA 1E5RA 2WAOA 4XQ4A 4XF3A 1V9U3 2UYBA 3AP5A 5CFCB 2Q8OA 2G1MA 4LIVA 4CDQA 4XUOA 1XB9A 3ZPYA 3HJRA 1QQP1 1UCXA 3ZR5A 2Y0IA 2Y6KA 1QNYA 3NNJA 2IXLA 5IUQA 3QACA 1ZBA2 3ZFFA 2FMDA 1VIWB 4XJ8A 3Q8BA 5F7UA 4P02B 1YXWA 3O1VA 4FAHA 4GB33 3SKVA 1YUDA 4Q4V2 4Z1VA 3B01A 5GLZA 5JSOA 1PX4A 3MLKA 1GV9A 1O6UA 2W1SA 1AJOA 1I5ZA 2HWB2 2XXZA 2VMGA 4I0WB 3OUJA 2J22A 2BBVA 2KR2A 2I45A 5JXHA 2RV9A 2VNOA 2Q1ZB 5AC93 4KQ7A 4FCAA 1RXGA 1XC6A 1R1ZA 1ZBA3 1BBT2 2ZX2A 4R8HA 1LENA 3JBG3 4LBQB 5A80A 3ACGA 3W20A 1G8WA 5F2WA 4QQLA 4XZUG 2X05A 2NLRA 4GB31 3AP4A 1ASJ3 4NHMA 1O59A 3W59A 3R4DB 3U14A 5JZGB 1JZ8A 1NCQC 1V6MA 1OF3A 2V5DA 2YU1A 3FZ3A 4CEWA 1KS5A 1GWMA 3O1TA 5FZ3A 2WFF3 4NRPA 3WG3A 2QQPA 1I6XA 4QQ2A 2XR4A 4YG3A 5AC91 2VVEA 1NOVA 5FJHA 1JZ7A 1JU3A 4LOSA 1O3RA 2HWC3 2RMU3 2WO1A 5BNNC 1XNKA 3DPRA 1OUXA 4QX8A 1WBLA 5IW0A 1REEA 3I2JA 2EALA 2L9LA 1IQAA 3TYJA 3RZMA 4YGDA 3ZSKA 2BWCA 1LOCA 5CEHA 1LKNA 4JKMA 3VBOB 5C33A 5DPNA 1IS3A 2VQAA 3RS6A 4QPYA 4GWJA 4GH4A 1OH4A 2WFF1 1NX9A 1UY1A 4L2NA 1WCDJ 3NNMA 4MV2A 2ET1A 3T3YA 3K75B 2A6ZA 2VZSA 2IWGB 2X5IC 3E6DA 1YC61 4D3WA 5FWJA 4HN0A 4B3NA 1C8M3 1UU5A 2HWC1 2JICA 2RMU1 3N35A 4KL1A 5BNOA 3PURA 1OPMA 5JOWA 3WDVA 2EA7A 3B02A 4CDQB 2YBPA 3VKFC 4HKOA 1SZBA 4BH9A 4E2GA 3KS7A 2QQUA 5EJ1B 4K20A 3MFCA 1ZA7A 2W1QA 3ZFFB 3VL8A 3SITA 1EPZA 3ZDVA 1TEIA 1EAH2 3PJYA 3T0BA 5FR3A 2BEOA 1WMXA 4L9BA 1LR5A 1SQ4A 3AZZA 2K9ZA 3EXUA 4XXPA 5FZDA 1GP6A 1NLSA 3ELNA 5DAQA 4NJ4A 1HN0A 1WW5A 1OQEA 2B7YA 4FPGA 3ZM8A 2DUOA 5ACA3 4OHVA 1D0GA 1D0HA 2Y6HA 2PQSA 1XE8A 2JX9A 2OA2A 4FPLA 3WW4A 4A3XA 3AKTA 1C8M1 3ETQA 3WQ7A 3ZXLA 1Q5OA 1R64A 2XL7A 1NKGA 4C91A 1RUH1 4FP3A 3HD8B 1LJ7A 1LEDA 4EN8B 3AP9A 4CDWC 2VMIA 1VBB3 2PHWA 2JDHA 2RJKA 2ZHMA 1JYTA 1EAH3 1KJRA 4ZS3A 4XIOA 1YFWA 3ORJA 1QXPA 2O8QA 3IBMA 1V0AA 4Q8LA 3OYWA 3GJBA 5F3GA 4HT1T 4AFAA 4CEWB 5ACA1 1SBFA 5LBEA 3T08A 1GP4A 4CPBD 5JSPA 3AX4A 5KHGA 5F6KA 1QGLA 3I54A 4K6BA 1H9WA 2RDQA 4R52A 4DPNA 1BKZA 2ZX4A 2HWF1 3IM0A 4MSVA 4OULA 5A3MA 1TG7A 3E97A 1D4M3 1U5YA 1O3TA 4CU9A 1US2A 3CL1A 5FDBA 3DEMA 3DPRB 5J48A 3BYWA 1VR3A 4EWDA 4P9LA 4FOYA 1CONA 3RYRA 4RHV1 2OYZA 1RITA 4H7LA 4DXZA 4LUKA 3I7DA 1LOFA 4AXOA 3SCHA 1WMDA 2Y8KA 4GH4B 3EQEA 4I2OA 5LASA 2W94A 1VBA2 4Q0UA 4YW6A 1LODA 2JECA 3ZFEA 2P3YA 4QX3A 4FPCA 4PQ9A 4M3CA 5BNOB 2R072 1A8MA 2VY0A 5FO7B 4ZU4A 4AQTA 3HBKA 3D82A 4W50A 3OBTA 2W1UA 2R0HA 1IKPA 1BXHA 3K51A 1YIPA 4CZSA 1QXRA 5C4WA 2D98A 2FBEA 3LWCA 4M0NA 1BMV1 4N53C 2R30A 2VZUA 1LHNA 1UIJA 3LEGA 2ID4A 1Q8QA 4FPHA 3BU0A 5DAPA 2D44A 3UGFA 1RUE3 4YW7A 1GOFA 1DYOA 2K2SA 5FZBA 5LB6A 1UYYA 5F6LB 1UIKA 2WL1A 4IETA 2C26A 3ILRA 1ULGA 3CJXA 1COV2 2W3JA 3JXSA 2AREA 3U10A 3CLPA 1FX5A 5JI7A 2WWUA 4M4PA 4FI9A 1WBFA 4LKEA 1W39A 1N3PA 2EF6A 2OS2A 1VBC3 1HXS1 2FDGA 1YQ2A 3AYCA 1NAEA 4MZUA 1PK6C 2Q4SA 4LBKA 5LBCA 4QDQA 4R9CA 3VN4A 4WM8C 1XU2A 5C5UA 2WLQA 4ARXA 4Q26A 5E6HA 3OYWB 1W3VA 4J6GA 2D43A 1FPN2 1RUE1 2P34A 4MUVA 3MYXA 4MGKE 2VMFA 5I8SA 3ZXKA 2JIGA 3AMHA 1MQTA 3ZXGA 4B1MA 1G9DA 1COV3 4LOTA 4Y3OA 3APBA 4Z07A 1SACA 3WVJA 5HPOA 3H9AA 3WQ1A 2QDNA 2VTXA 1LTEA 2D3SA 4IQPA 4QX1A 5DG2A 4CCDA 1PO12 2EICA 4FPEA 2Q8DA 1VBC1 1CWPA 5DDJ2 4IGQA 1D2QA 2VOXA 4Q4Y1 4RQPA 2CAVA 4P9GA 1F4HA 4COZA 2ZAHA 1JZ5A 1HIXA 1QJFA 3I2FA 1LCLA 5I8TA 5HV0A 5KWRA 1R1A1 5C8CC 4AI2A 5A6YA 4K21A 5I0RA 4CDUA 3LEMA 2JKXA 2VUJA 3T2TA 4OZOA 2DTWA 4XJAA 1N1TA 1T2XA 3BU7A 3H0OA 4WVZA 4GJZA 4D6SA 1AYN1 3RZJA 4Q2FA 4NAOA 2QDRA 4EN9B 2VQUA 1PGW1 2WYFA 4XFFA 2G19A 1ODMA 3HVDA 1UO9A 4WV8A 3ZFEB 1PO13 5BNQA 4M3CB 5DDJ3 1U12A 5FXZA 5FY8A 4BM8A 3ZYBA 5IK4A 2ZGTA 4E4HA 4NAMA 2ZCWA 3ZXAC 1RUOA 3M70A 4KG8A 4QPWA 3T30A 5C4WB 3IDBB 5FOBB 4ZKTB 2JDMA 3S7EA 5C6CA 2GH8A 3AXEA 4XF4A 1H8TC 3WNOA 4ES9A 3IWZA 4IV3A 4BOWA 3ES4A 3O1RA 2A71A 5C5TA 5CG9A 1EP0A 3RVHA 5FPZA 4XURA 1UKGA 3MV01 2A3XA 4XQWA 4G4FA 1QXJA 3NNLA 2Y6JA 1VP6A 4BIFA 2PXJA 3C7EA 3Q8CA 1OT5A 3M7AA 4Q4W3 5A6QA 2ZHLA 4XF9A 2FQPA 3J7LA 3MW3A 3OOXA 4AVSA 2GP3A 1JBCA 5JCTA 3NAPC 1YQ8A 2WLPA 3H1YA 5EYYA 2RS13 1ZBE1 3ME2A 3EJKA 1GNHA 3M8LA 4XFIA 4LLOA 4AVBA 4IEQA 2W95A 5IVFA 4K1YA 1W8FA 4LJHA 4I3GA 3VKNA 3HN3A 4QKFA 1FOD3 4BCUA 4ZY9A 1MQTB 2RM21 2X53S 5JXJA 5LY1A 2ZGSA 1X8MA 4NWVA 4GKYA 5ABJA 5FP8A 4Q4W1 3U75A 1GZCA 4XILA 1VAVA 2A6WA 2DCJA 4MLOA 2QBXA 3VZLA 1RHI2 4DNYA 5KHIA 5KBFA 2G9FA 3OGSA 3CBNA 2RS11 3WNNA 4XAAA 1I9RA 4N7IA 2IFWA 4QAWA 2JDPA 1VAMA 4RQPB 5IVCA 4CP0A 4XJUA 4DUVA 1C57A 5ISLA 4XFAA 5FUIA 1GQHA 1SLTA 2W92A 3N7MA 2MEV2 3TN91 1FOD1 4CDUB 4O65A 1W2AX 2FHRA 1WLWA 3BVCA 4WVWA 3A23A 3U11A 2JDZA 5EV7A 3A0NA 3GYDA 2YY1A 3IAQA 4Q1PA 3FBYA 1NY71 4NUBA 2DVFA 4G3YC 2FZ1A 4JV4A 4JKKA 1O4ZA 1WD4A 4UFKA 1IS4A 2P3IA 2PQQA 4NIHA 2QQMA 4UF0A 4CXWA 3INAA 1K45A 2VCCA 4ES8A 2IXIA 1A3KA 1VRBA 5IFTA 1M06G 2BU9A 2XL9A 3ST7A 2XOMA 4DQAA 1OLRA 3ZIXA 1V70A 4ISRA 1X82A 3B9IA 5DUVA 2WFPA 4NO4A 1BEV1 2WKKA 1AL23 4IV3B 3E6BA 4IESA 3PIGA 5LA2A 1UOFA 3FFZA 4NHLA 4UFJA 3LFMA 1HB2A 1DG6A 1OLMA 3ES1A 1ND2C 3AKQA 5FZKA 3SH3A 3ZFGC 4BE3A 1W9SA 2CDPA 1JS9A 1W8HA 1AXYA 2XUEA 1G9CA 4O61A 2K0GA 4R4XA 2DV9A 1CVNA 4GA9A 4EROA 2JEMA 1RUF2 1YFYA 2Y34A 4RS5A 2D6LX 2XVKA 5TSWA 2QQLA 3WCSA 4C8DA 2A6VA 5LRRA 3HOBA 2E7AA 5DQ0A 3HAGA 2JDAA 1W0PA 2D6NA 1X33A 1J84A 4DEQA 2OIIA 1BQPA 1PZ7A 5T50A 4CDXC 1V6LA 2YV8A 1VBE3 3EBRA 2EXJA 2AENA 4FVVA 3KCXA 4M00A 3ZIWA 3D3AA 1V6IA 5BY5A 5ABJB 1J59A 1DU3D 3J26N 4AOCA 4A42A 1G9AA 2WR9A 3NO8A 4K8RB 2XBO3 5CZKA 1KITA 2XUMA 4FPKA 4QPGA 2HYXA 5KHKA 2UY8A 3BPZA 4IEWA 1TE1B 3WF0A 1J3PA 3U0ZA 4HONA 1VBE1 4NHYA 2GC2A 3V64A 1O3QA 1J3RA 4OFGA 5A7PA 2Y33A 1OKQA 4OYUA 4WM7A 1EV12 1BK0A 1C5IA 1DZRA 4JTNA 1U5XA 2BZDA 2VBPA 5J37A 1UMHA 3BIWE 5FBJA 4CUGA 3PUHA 1UZZA 4LO4B 1APNA 2HLEA 4BZ4A 3R4UA 1WLDA 1Y4WA 2D5HA 4Z2AA 3U1XA 1VRH1 2JG9C 3A0KA 3O1UA 1GZTA 2RR13 3L9JT 4X8PA 4ZS2A 3CQOA 2ZZQA 4UF0B 3WNMA 1DCSA 2WJSA 1ODNA 1RXFA 1Q56A 3B00A 5D2AA 1GMMA 1WKYA 4LQRA 3UT0A 1XQNA 2B39A 1W9YA 3ZN4A 3O1SA 3OBZA 2R16A 1T6GC 1RMU3 2PHUA 2VC9A 4HMZA 1AR92 4K40A 3POFA 1AXKA 2BOJA 4Y5Z0 1Y3TA 4PLMA 1YYNA 4LMFA 4AFCA 2WT0A 2ZGRA 3DF0A 4AF9A 4CCOA 5LWBA 2FD8A 1FATA 1OLQA 4HKLA 5A3UA 5F2SA 4QQHA 2CNAA 4META 4XUQA 4UI9L 2RR11 1MZ6A 2Z5WA 1QH7A 1QKQA 5L36A 4ASMB 1RUC1 4D7TA 1XNBA 3FLTA 1NE6A 1QOSA 2HEVF 4DXSA 3JCIA 5C8WA 4RS5B 4AVTA 3SEEA 4FT8A 4LR4A 1HQWA 2DVGA 2X10A 5FY4A 2J1VA 4K9SA 4LA2A 1K5MA 1DLLA 1LHOA 1PX3A 3K48A 4NIDA 2A6YA 4MGSA 4HVQA 4R9AA 5LBFA 1WWYA 3PVBB 3WOGA 5J96B 4JQTA 4IEOA 1OA2A 5A3WA 4Z2WA 2DU1A 1EPWA 2GNDA 1IHMA 5BV6A 1UOJA 3AKSA 2P6HA 3M3OA 1SEFA 3VDCA 2E9QA 3WP5A 3FUQA 4OCTA 1WCQA 5A70A 1QJZA 2TEPA 1AF9A 1W9FA 3PUSA 4Y5TA 2CY6A 3MW2A 5GLUA 2B46X 2D6OX 4XJZA 5AVAA 5A3PA 1FNZA 4JCKA 3HR9A 3E1F1 1VBD3 1RINA 4PQQA 4OQ8A 3MF6A 1XYPA 4N43C 2ET7A 1HRV3 1S0FA 2HKXA 5JIAA 4QPGB 1B35C 4TLFA 5L73A 5DZGA 1CX4A 5JXIA 1K5JA 1UPSA 2GMMA 3GALA 4QU2A 1CJDA 4B4PA 2J1TA 2IVIB 3U4XA 3A21A 1O5LA 4I0BA 2UWAA 2E31A 2D93A 2BFUL 3FHQA 2VOVA 4JGZC 4WM7B 2GNBA 2CWMA 3HPNA 5I91A 4BIOA 5E88A 2VD7A 1MEC3 5F5AA 3BUCA 3MFAA 2CTVA 3O1PA 1UXZA 1VBD1 1OPOA 4K8FA 4OUMA 4D7YA 3GHMA 3WDXA 4LHLA 4QQPA 3DKWA 4P9YA 1HRV1 5I0TA 5DABA 1GR3A 4QX7A 2ZGMA 1LAJA 1ZRRA 4TLGA 5FZ8A 1QJX1 3ZN6A 2LW8A 1STMA 2BOIA 4ZZ5A 3B94A 1RUG2 2JE8A 3M2MA 3THCA 2YYOA 4NIAA 2SLIA 5DAXA 2ENRA 4Q0SA 5JIUA 3THDA 4YM1A 1POV1 3OSDA 4OLLA 1KFXL 1MEC1 1UOBA 3WDUA 2RVAA 4FTEA 3KGZA 1CX1A 5CISA 2C5DA 3BGAA 1O8SA 2DBIA 2WBKA 5C9AC 1AR81 2PFWA 1CIWA 2UY9A 1MZFA 3GHNA 3FWEA 1AR63 2RS31 1IPKA 2C1FA 5JI9A 4QX0A 4BK5A 4CPBA 4YW2A 4A7ZA 4AHWA 2X8KA 5JMOA 5FZFA 1YJKA 3DKQA 4HPKA 1RUG3 4AQ2A 2QQWA 3I2GA 4CSWA 4MADA 4CTEA 1K5MB 2PAKA 3TNPB 4IV1A 1XPWA 1RUJ2 4LA3A 2P1BA 3WF2A 3I2OA 4FBFA 1W2OA 3VL9A 4P14A 1S55A 4FFIA 3CEWA 2E63A 1NUKA 3CZUA 3WR0A 1NG0A 1POQA 2ZPXA 1AR61 1PVC3 3B93A 4N7UA 4OUSA 1F8VA 5CFCC 3IN9A 1U0AA 2R041 3WP3A 1MS5A 1UYPA 3S7IA 4TWTA 4XFCA 2BUKA 1HRI2 3H1MA 3H7YA 2BV4A 5FXXA 5CIRA 2J1SA 1H2NA 2HBUA 4UW4A 4Q27A 3TOJA 3WNPA 4CCJA 2MPFA 3SQOA 1OSGA 2OKXA 4H55A 3LF7A 1Z78A 3VBUC 1DGLA 1YI9A 2W08A 3QOPA 2A5ZA 2ZKLA 4Y22A 1ENXA 1LOBA 3VD7A 5JWPA 4LITA 1BZWA 4Y1UA 2PYTA 3OBAA 2WRAA 1S4CA 2XVLA 4G9SB 3MI8A 4QB6A 5BNPA 3OPWA 1FMD1 3LZZA 4KGQA 4CCCA 3POEA 3WHTA 1H30A 3PHMA 4XACA 1MZ5A 3U78A 1QJY1 1V9U2 4UFHA 2Z42A 2UU8A 4IE4A 1UMIA 3ZN6B 5KR7A 5FZGA 1PMJX 1NE4A 5JZGC 1QQP3 5AFEA 3WCRA 3TEZA 1NLQA 5FYUA 2C9KA 3PUAA 3R6SA 2EAKA 1UWWA 3AXDA 1H6XA 2NQYA 2W39A 4GB32 2YG0A 1QJU1 2ZEZA 4B7EA 4RFRB 1UZWA 2WDBA 4ZXKA 2AC1A 2JIJA 5HXMA 3K4ZA 3H50A 2VCAA 4P5YA 4RN5A 4YRDA 4NOTA 5K8SA 4IW3A 1MPXA 3W21A 3ZYIB 4ASKA 2XWBB 1LEMA 4HPKB 1ZA4A 4KG0A 4WZFA 2UWBA 4AWDA 5H9RA 1YQ6A 3FC0A 4BQ4A 5AC92 2XJPA 1YLLA 3VBOC 3KB5A 4IV1B 2JDYA 3ILFA 4LKDA 2WABA 5CG8A 3DYPA 4AAPA 3IIIA 3T09A 3JBG2 4D6RA 3OEBA 3RZZA 1X8EA 2BFUS 1Q8OA 1Y9MA 5FZHA 3E5QA 1ASJ2 5H9SA 1BK1A 5GZFA 3VZJA 4B1LA 5T54A 1NLRA 1NYWA 3V0AA 4HK9A 2QNKA 4FXKB 4A7KA 4OHWA 3C8XA 1HDKA 2ARXA 1F35A 1WUVA 2C9AA 4CDQC 1N1SA 2WFF2 4Y1YA 1FT9A 2ZX0A 1C3HA 2BPA2 2DCTA 3LDBA 4CU8A 2FMYA 3ZFFC 5DZEA 4MOAA 4V2VA 3N3HA 4LO6B 2CU5A 2CGPA 1WZXA 3PTRB 2HWC2 2RMU2 1YFUA 3K77A 1X7NA 1IG3A 3VBFA 5LA1A 1PVXA 2BVBA 2C0ZA 3ZYFA 4LK6A 3RZGA 3GZTB 2P5BA 4XOGA 4AR2A 4GMP0 1OQ1A 1XNTA 4Y22B 5IWFA 4C1XA 2W68A 3NJYA 5FREA 1SCSA 3VZNA 1UKRA 5BNPB 4KNCA 2HWE1 2NM1A 1ZZCA 1JOPA 5CBLA 1X50A 2FZ2A 3IB3A 4LHSA 2JDKA 2ZKNA 4AFDA 4RL7A 2CSGA 4LUMA 3UKNA 4CU7A 1GSLA 1C8M2 3VKLA 3MO4A 2WINB 4ZPIA 1AR73 4LBLA 3CMGA 2EAAA 4IGPA 2CWSA 4WBBA 3WNLA 5BNNA 2F4PA 4JKLA 4CEWC 2ATFA 2BTVC 5JVVA 1S0DA 1IS6A 5DZFA 5J09A 3K3OA 1JYXA 4Y5SA 3VD5A 4AGGA 3I97A 3ON7A 4DB5A 1WCSA 3K2OA 4QQOA 1AHSA 1CAVA 2JE7A 2EIGA 4D8MA 4O9EA 3PLQA 3NL1A 5ACA2 3C7OA 1SBDA 3M3IA 4M3CE 2ZHNA 2WWJA 4ZZ8A 4ZU7A 3DPRC 5H9QA 2ZGKA 5DUUA 3ZLIA 4QX5A 1UZVA 1XNCA 2F6BA 5CAZA 1IPSA 1AR71 1C1LA 4KGGA 5I8YA 1K42A 2D40A 2RDSA 1C1FA 3AYDA 2HWF2 4YG0A 1RUH3 4Q4V1 4KI5M 4PIYA 3WEZA 2TBVA 1MZEA 5T5JA 4YW5A 1VBB2 2HWB1 4AQSA 5L7OA 5C70A 5I0UA 4GH4C 3HT1A 1L7RA 2VL4A 2FCTA 3K3NA 1PIV3 1WA6X 3JU9A 4FPJA 3LOIA 3KF3A 3NKGA 1HKDA 1W9TA 4YM3A 4AHXA 5FBZA 5G05L 3V0AB 4BPZA 4XFGA 3NQHA 1UL9A 1FXZA 4MYEA 4P5HA 4YVSA 5FZ9A 4A3ZA 4Q4X1 2KD7A 4A6OA 4LHNA 3RZKA 5BNOC 3I59A 2PHTA 4ISQA 4EWEA 3J8F1 3ZR6A 2IXKA 5FAXA 1ZZ6A 1UXXX 2HWF3 1VALA 3CJIA 4FPOB 3ZXDA 3RG0A 1AVBA 2NZ9A 3ZPOA 1D4M2 4IERA 3TEYA 3POBA 2XLFA 3AZWA 2GC3A 5JMCA 3VBFB 2W1WA 1W06A 1PIV1 2W87A 1GQGA 1KQRA 4IEPA 4XHBA 2AUYA 1H2KA 2VNVA 3AL5A 3LPGA 4O7XA 3WUCA 5GZEA 3TBDA 4RHV3 3D5OA 4BQ3A 4CCEA 5I0DA 3UGGA 1EUUA 3D4KA 2JG8C 4SBVA 1PGL1 4WVVA 1SFYA 4CP2A 3AP6A 3QH7A 1RJ8A 4XF0A 4W6YA 1F5FA 1SDDB 4HG6B 1RUNA 1ZZBA 5D8AA 2HYKA 3N9PA 2D97A 3ALQA 5LA9A 2HJIA 4RR3A 5IT6A 1Q43A 1L7LA 2WA3A 1JZ4A 1OFSA 2VBDA 3MLJA 5BNNB 1W6PA 2VVDA 5T52A 4LPLA 5E1RA 5BUVA 1DHKB 3PDQA 4XQDA 1BHGA 5GALA 2OPWA 4YARA 1ALYA 4QGNA 1QIQA 5CA6A 3VD9A 1MS1A 2AR6A 1N3OA 3HMYA 2WO2A 4JGYA 1H0BA 2D6MA 4TSVA 5KC6A 4MGZE 1CAVB 2C4XA 2JDUA 2YPJA 3B9CA 4BISA 1LHUA 3QD6A 4CP1A 2J1AA 4IXLA 3SHRA 5HI0A 2ZGNA 3DL3A 2LTNA 1RUE2 1OXCA 1YIFA 4KU8A 4DFSA 1Z0HA 2DVDA 4LIUA 1UZYA 2XONA 4AYUA 2EXIA 4D0QA 4NPRA 2WUHA 2WN2A 1YI7A 2Q30A 3OJBA 5FPXA 2G9GA 3P1IA 2JD4A 3HQXA 3C7FA 2JENA 3UJOA 5L7OB 2IXHA 3J9SA 1HXS3 1VBC2 3GZEA 1ZZ7A 4PDWA 4CU6A 4XJ9A 4EWAA 5CYYA 1XYNA 2J1UA 4Q29A 2ES3A 1ZRFA 2IFRA 4XMAA 3SLIA 4BQXA 4L99A 4A7YA 3ZFEC 1N3QA 3ZMOA 4YVSB 4AFBA 3I59B 1OKOA 4GALA 5DUXA 1ULOA 2XJRA 4I09A 1QF3A 3NRUA 1D4VB 4K1ZA 4L97A 4COYA 3ZDSA 3N36A 2R063 5SV5A 3CJIB 2QZ2A 2Y60A 1PGW2 2Z69A 2VO5A 2XQXA 2HEYF 4AI8A 4GKXA 1UD1A 2W0XA 3T4VA 3RJRA 4Q4Y3 2PN5A 4AZZA 2XKPA 1PK6A 5EP9A 3NMBA 4DUXA 2RE9A 4RA0A 3CO2A 2CHHA 1ACCA 2E26A 3AMQA 3EO6A 3KV9A 5T3NA 3UJQA 1R1A3 1SFPA 1S0CA 2PELA 2RS53 3I2IA 3SCGA 4HETA 5LCWL 1DQ1A 4XDQA 4Q5OA 2PHFA 3RSJA 3ZYRA 4CYDA 4ZHNA 3GBGA 3OEAA 3R4SA 3HN1A 3N9LA 2BNMA 2PHLA 1AYN3 2R061 2XB6C 3D0SA 5APAA 4IEVA 5D8AB 1BLZA 4LULA 2WNVA 3KWVA 1YRZA 4U2AA 4ZU5A 2VJXA 2HBTA 3VHRA 2A73B 4RR3B 3VBSA 3NV3A 4AAXA 1JZ6A 5A7NA 2VVFA 4PI2A 5IVBA 2QQNA 1BJQA 1LOGA 1W6PB 2NP0A 1F2NA 5FYMA 1VBA1 2XG3A 4P9WA 3H8OA 5KXBA 2DVAA 3RFRA 2RS51 2WZPP 2GMEA 1MQTC 2V4VA 4FTBA 1WW7A 1ZBE2 3O14A 3LB9A 4FFGA 4JGYB 4W65A 3WD5A 2FDIA 2O14A 1XSQA 2R071 1KJLA 1CR7A 1AJKA 1FV3A 1VB4A 1W8WA 4AE2A 2A3WA 2OQ7A 2FDHA 5IAVA 5FMBA 1GFF2 3VDDA 2WS93 2W46A 4EZHA 3S5AA 4V2WA 3S5QA 5EPAA 1KDKA 4JDOA 4Q4W2 1VJ2A 1DFQA 3FHAA 1JYCA 5T5PA 5BYNA 5C3QA 4TZDA 4LE3A 2XJUA 1SLLA 3ABZA 3MEPA 5EHDA 4YZ5A 2JKBA 2JXAA 4CDUC 1JODA 4DIQA 5LBBA 3PL0A 4PDWB 5IK8A 2RS12 1ZBE3 1AX0A 2ETEA 3A4UA 3HQUA 2FCUA 1URXA 2WQ8A 4Y20A 3AC0A 1JUIA 2WYSA 4JC1A 5LW9A 1OLME 2YC0A 4YM0A 1V6OA 3E5XA 3JD71 4LO8A 5FLJA 3WG4A 3TN92 1FOD2 5FPBA 2I74A 4YZ3A 4ASLA 2RM23 4HOOA 1TQ5A 2WS91 4QDRA 3ECQA 3I2KA 1UY3A 1NY72 2O0OA 5HCAA 5K9YA 3THPA 4QKDA 1ULPA 3OGRA 2YPDA 3VBRA 1FPN1 3WY6A 4AEKA 3ZO0B 4BMEA 4GWIA 2JJ6A 4IV3C 5F32A 5GLVA 4D7SA 1RUI3 3GBWA 5K0UC 1X9TA 1SMVA 1OUSA 1PK6B 4D69A 4W4ZA 2VOWA 1W05A 1OI6A 3AZYA 1WMFA 2QQOA 2VQTA 5KHHA 3PU3A 5FZ1A 3TN93 4F3JA 4HBNA 2DDUA 4CEYA 2BNNA 2DTYA 2OQ6A 3ZSEA 1BEV2 3PUQA 4IEXA 2ZTNA 4EN7B 1KRIA 4AQ6A 3LFIA 3IMNA 3ZYPA 2QE3A 4JDMA 4FSJA 5FYTA 1FAYA 4LO5B 4UWDA 5HCHA 1I5PA 2WNVB 3RGBA 1CQ9A 1KD7A 4P00B 3VBSB 4EJRA 1QNWA 3IPVA 4A6SA 2VXJA 4J25A 3SC7X 3T0AA 1RUI1 3LGRA 1DYKA 3POJA 4XBNA 4QHBA 1DGWA 4HZFA 3T4HB 5HV4A 4BQYA 4EE2A 3CHXA 3OGGA 1QOOA 4GXLA 5FY0A 2AACA 4B8EA 2Y6FA 3SCFA 3RI8A 4XMIA 5ABJC 1A6CA 1BEV3 4DRRA 3PTYA 1AL22 5GM0A 1QHDA 3IAPA 3BIEA 4HKWA 1WW4A 2ZJCA 3RWKX 2KA3A 2DURA 5A6XA 3NKTA 5IYYA 2AZ5A 5EYXA 1VB2A 3RNSA 2VMDA 3VKOA 3THTA 3VDDB 4XHXA 2HWD3 1GU3A 2P6CA 4P9IA 4YLZA 3RRDA 3N7LA 3WNXA 1IZ3A 1VLNA 4IE0A 4H3WA 1NXMA 3MIFA 2I2SA 3LKJA 3UL2A 1MS4A 2O1QA 3GNEA 3KCYA 3MIGA 5FYIA 1AX1A 1QU0A 3NV4A 4QKNA 4IUGA 4CXYA 1WGPA 4JHTA 4Y20B 3LEKA 1ULDA 2P3KA 1VBE2 4HXCA 5T55A 2OZ6A 1NCRA 4XUPA 2VNRA 3UV9A 1TZOA 2HWD1 3PMEA 4L11A 3ZFGA 4Q8KA 1H6YA 2E7QA 3C2UA 4QKBA 3MUY1 5FLHA 3TRSB 2VOTA 3PU8A 3GCXA 3N7KA 4PCRA 3VZMA 2YU2A 4UT5A 4BQ5A 2E7TA 2XBO2 2NN8A 1TME3 3VBRB 4UBGA 4BK4A 3FUOA 3L2HA 3POIA 4BB3A 1F31A 4FO9A 5JAXA 5JUVA 2E32A 1KDMA 2YROA 1N47A 5FXWA 3VDBA 3G6JB 4F7ZA 4DOUA 2IUWA 1UX6A 2ADEA 2VR4A 3CU7A 4IEUA 3TNQA 5F37A 2PAMA 2QQVA 4Q0PA 1LHWA 4LO7A 4TN7A 1RHI1 2VW2A 3M4FA 4CEYB 5DG1A 2GH2A 2FCVA 1OD3A 4Y1XA 2VUCA 5LK5A 4OHZA 4L8QA 5FKCA 1OHFA 3VBHA 5AFBA 4RS5C 3T2PA 2PLV1 1DGWX 4NHKA 5H9PA 1Q8VA 4L0PA 4BQ2A 1VRH3 1TME1 2RR12 4XUNA 1M4WA 2MEV1 2P2KA 2WZR3 1W0OA 1B09A 4QHZA 3IPVB 1RUC2 2WT1A 2OW4A 5AVPA 4FXGB 4RGAA 2VUAA 4PF1A 5GZCA 5C3PA 1RMU2 1J1LA 3AKRA 1J83A 2TNFA 5HBAA 5FYSA 5A32A 3AMMA 4A2UA 1OOPA 3S30A 1MS3A 5CADA 3O1MA 2BJSA 4WVMA 1R091 1OURA 5F3EA 3WINE 5C7GA 1UZ0A 3PUIA 4HFSA 4PT6A 1XSRA 2BP6A 4N90A 3J7NA 2W2IA 3MICA 4EZ4A 1ZRIA 3LSEA 2W91A 5A3LA 4CA9A 1J1TA 2QKDA 1FI2A 3BB6A 4QPGC 2JG9A 2WZR1 3IDCB 4QPIA 4OI0A 1RUC3 2ZX1A 2EVXA 4LKFA 1K3IA 4D94A 5KXCA 1UAIA 4OI4A 1W28A 4YW3A 4PHZA 1G9BA 2YUEA 4J1XA 3WQBA 1FV2A 1Z7S3 1DQ6A 2ADDA 4WM7C 1H1IA 1ND3A 2WZEA 3Q8EA 1JTZX 1REFA 3P3NA 3USSA 4N8MA 3K46A 4INDA 3K4DA 4OMDA 4UW6A 1OFNA 3NVCA 5FMDA 1W8OA 4FTSA 4XIKA 3ZOIA 5CKNA 2WNUA 1RVF3 3NWKA 1RUF1 3FFQA 1NT0A 1NCRB 3BN6A 1A78A 3KGLA 1VMJA 1W03A 2ZGUA 3ZFGB 1XE7A 4C0HA 1WA4A 3LE0A 4AEMA 1NZIA 3RYKA 3WW2A 1VBD2 4JRAA 1UPIA 1Z7S1 3PVOA 4CRQA 5IFPA 2IZWA 2XPJA 1HRV2 2W9XA 3FX3A 3KM5A 2P3JA 3H3UA 3ASIA 3H7JA 3OG2A 4PIZA 3ZKUA 5JOZA 2H0BA 3DXTA 5FUNA 3WDYA 3VKMA 5K7PA 1RVF1 3GXUA 3SNMA 3ACIA 3N9NA 1GZ9A 1MEC2 2H6BA 3VBHB 2XH6A 2LRPA 2VW1A 1ZZ9A 4IE5A 1XU1A 2PHRA 3NNGA 1UF2C 1K5MC 3VHPA 1NA1A 4QDSA 4XEZA 1W6MA 4N43A 2RS32 5JOYA 3AYAA 3F2ZA 4FOVA 4KH9A 4NPLA 3H8RA 1IS5A 2DWRA 2N7GA 1QJX3 3AFKA 4FQZA 4FP2A 3ZSLA 1NQDA 2B4KA 4QGMA 2OUHA 5JR7B 1EY2A 2WSUA 5CKQA 1JHJA 4KWJA 3LSDA 4IL7A 3LAGA 5A32B 2A70A 2K46A 1OOPB 4H2AA 1POV3 4LORA 4B7KA 2VE1A 1UNBA 2VZOA 1JXNA 4UAPA 3GDBA 4WVMB 5FOJB 1RUD3 4BHPA 2YXSA 4XZPA 3PVNA 1GANA 1AR83 1O91A 4JQRA 4BMBA 4QXCA 1AR91 1AR62 1DYPA 2RS33 2JG9B 4QPIB 2R042 4I0AA 4KBBA 4MX3A 4K7JA 4LLFA 5HCBA 4R9DA 1CAUA 4AK3A 4YZ2A 3SH5A 1ND3B 2VZRA 4XAEA 1W2UA 5LA0A 1GNZA 1RYYA 3UESA 2E53A 1DBNA 3RYPA 2JWPA 3B5LB 5FCCA 1QDCA 3OTFA 4XJWA 1HN1A 1RUD1 2BWAA 4BLIA 2V4AA 2WNUB 3H3LA 3BTYA 1JOBA 1DGRA 3CNAA 3PJQA 4LBJA 3FHIB 3HNMA 1C8NA 3WG2A 1ZREA 4YG6A 4AHZA 3S57A 1ULCA 2DCZA 3J7MA 3LCPA 5A6ZA 1PVC2 3DXUA 3O0XA 2DVBA 4UFLA 1PO23 4BU2A 3H8XA 2BGCA 5FFOC 2R043 3VLBB 1IQDC 1DZQA 2PAEA 3QCWA 3HEIA 1FMD2 1WCKA 1CD3G 1GYKA 3I3DA 2VZ1A 2F17A 2RDRA 4P9XA 2A7AA 3X29B 5B2GB 3PVEA 4UOJA 2ZOEB 4PIXA 4OI2A 2V09A 3UNPA 2VU9A 2XWJB 4UW3A 4N9IA 4OHXA 2IC1A 1R083 4X6RB 1W2NA 2YBKA 3J7HA 2E33A 3B7MA 3C7HA 3FLPA 5FP4A 5C3RA 1PO21 4JRLA 1A8DA 4GWMA 3I3MA 5J98B 5IHRA 2FDFA 3RQ0A 1P8JA 4NHXA 2B8MA 1FMD3 1QJU2 1NA1B 4EQVA 4IV1C 2ZGLA 3IIAA 2DBNA 2VH9A 1W6MB 4N43B 4Z92B 1AYM3 5GZGA 1QJY3 1OA4A 5CKMA 1TMF3 3AZXA 3IKWA 1H2LA 1YQ5A 2RHPA 3KT1A 1PGSA 5FZEA 3VZOA 5CFDA 1QQP2 5A7WA 1R081 3VBUA 3QH6A 4AW7A 2KXLA 1WLCA 3CKHA 4YVWA 1HJFA 4JVAA 5FPVA 4S2FA 4L92A 5FZMA 1N1VA 5DAVA 2GNMA 5A7QA 2D5FA 2QCSB 1W9WA 1QJU3 2JD9A 4WZCA 4AVCA 3JZVA 1O4YA 2C24A 2LROA 4DMIA 5FQ0A 3MLLA 3Q9OA 1AYM1 2A6XA 3M3CA 1EYBA 1JW6A 3H8UA 1TMF1 2V72A 4F83A 4R9BA 1YFXA 1CESA 1CAUB 4HL0A 2GAUA 2ARBA 1G6NA 4AEDA 1GLHA 3N9MA 2YFZA 2CAUA 2YDEA 5EWSA 5FP9A 4TTGA 5FK7A 1X36A 2H6CA 3KT7A 3OD0A 3O1OA 5BNPC 4AFMA 1H8VA 3OGVA 3MUZ1 1G7YA 4HANA 4XTPA 5LATA 4BJ0A 1DZTA 2Y64A 2OUJA 3KV4A 4TYSA 3IT8A 5FZ4A 3BKZA 3I2DA 2GALA 3ZVXA 1PZ9A 3U07A 4NE9A 1PM7A 5IVYA 2B5HA 2VQ0A 4M01A 4XBQA 4BYYA 1UY0A 1MS8A 2XLAA 3KD4A 5B4XA 5EJZB 3NSTA 4FFHA 5DXDA 5JR2A 4W8JA 5CB7A 2B42B 3FL7A 3KMHA 1TVGA 1QH6A 1YCIA 1F4AA 2WQZC 2GN7A 4FPFA 3N4MA 5JOXA 5L9BA 5FTTC 5L19A 5LEJA 3SKJE 1HLCA 3MHZA 5F39A 4JX0A 5GZDA 1ULEA 2HWE3 2XJQA 1HV1A 1OC1A 2QFEA 2WNOA 2GSYA 4OZXA 3JB4C 5FYBA 4C1WA 1JMUB 2GU9A 4XBLA 1N1YA 4YPJA 2VZVA 5FRAA 3WLUA 4E4DX 4RSUA 1DDLA 1RL3A 1W6OA 1AR72 1S0BA 4NIGA 4PBOA 4YNIA 5CFDB 4KWUA 5A7WB 5M0TA 2BERA 1W8NA 3EMRA 3VBUB 4IE6A 4AI3A 2JB4A 1Q8SA 5A1LA 1LGNA 4BWOA 1NCQA 2B9UA 4YVWB 1S0EA 1V9U1 2HH9A 3NJVA 4AGVA 4PBPA 1KFUL 3WDWA 2XDVA 2LALA 2OX0A 1AXZA 3ACHA 4HN1A 4MVTA 1LOAA 2ZS6B 3IZOA 4ZXEA 2PMWB 2LS6A 2ZZJA 3ACFA 5FQ0B 3WT3A 1SDWA 3AMNA 4Q4X2 4MGIE 2R6QA 4B4QA 3VZKA 1ZVFA 1SCRA 2VZQA 1E5IA 1OVPA 2WO3A 4UW5A 3J8F2 3VBFC 2GC0A 3HBZA 1IPJA 4KMQA 2I07B 4DINB 3BTXA 4Q4V3 1RUH2 2BRTA 4AEDB 3KVBA 4QM9A 4A41A 3I2HA 3N9OA 4COVA 3BOPA 4Y1VA 3R05A 2HWB3 4QT6A 4YFWA 4ATEA 4XCAA 3FLRA 4URTA 1PIV2 1ZRCA 2WWSA 4MGQA 4C0BA 4LBOA 1UMZA 4I01A 1XXNA 2OVUA 3KCCA 4XC9A 5FIXA 5FZLA 2WAAA 4HK8A 4OMCA 2Q1MA 4Q4X3 3RWNA 1DGRN 4HSJA 1ZBA1 1BBT3 5FZOA 4ARYA 4H7MA 3JBG1 1PGL2 2X5IA 5DAWA 3ETPA 1ST8A 3J8F3 3O12A 2FDJA 5FY9A 4QD2A 4LE4A 1ASJ1 2PHDA 2DCKA 5FY5A 4AVAA 4BDVB 4OUEA 4YW4A 5DUWA 3BI3A 5D1IA 5B4NA 5CU1A 4XW3A 3I3BA 4Q0QA 3POWA 1UOGA 4GD4A 2WSVA 2QQJA 3OUIA 4RD7A 2YMZA 2DU0A 1GWLA 2W47A 2YC2A 3ZYJB 5GLTA 5FMCA 3MV11 5A7OA 4CUAA 1GQPA 4RHV2 3T1MA 2BW8A 1BBT1 2XJSA 1DQ0A 1YJLA 3FE5A 4GJYA 4MHRA 1LU2A 4LNVA 4E2SA 3RZLA 2W5FA 1I1EA 4CCKA 1O4TA 1H1MA 2MNGA 4GQ7A 1A34A 2CGOA 1JUHA 3NW4A 5L7OC 3RI9A 4RGGA 2V5YA 2ZAAA 2VAUA 4CDWA 3K4AA 1W6OB 2VECA 1O7FA 1QY4A 2XQRA 4E8DA 4XDOA 3LD8A 4YVSC 5JXGA 3KT4A 3H42B 2DUPA 1S0IA 2Y26A 1O3SA 4DY3A 1NCQB 4KBZA 2OXBA 4QU1A 1BMV2 3CDZB 3LDKA 1KGYA 2JG8A 1PNFA 3CJIC 3I8TA 3UGHA 1DLCA 2W52A 3WX5A 2V73A 2Q5TA 5FYHA 3RPQA 5JPMB 2ZGQA 5GLWA 2DUQA 4JDNA 3UKTA 1G86A 1U5IA 3MGUA 2VUDA 1BVVA 4GZ9A 1U5ZA 1WLTA 3EHKA 3MW4A 5FYZA 2VTFA 3OY8A 1GWKA 3ZSMA 2VCBA 3W5NA 2VMCA 2VCMA 5J3UA 4E8CA 1PNGA 1HXS2 3LA2A 1IKQA 2VNGA 3IDAA 5KXDA 4AG4A 3WP6A 1OBNA 4OI1A 4P9JA 4EV0A 2D3RA 5EXOA 5IATA 1JH5A 5D8AC 1Y7BA 5ANQA 3OPZA 2ZACA 2UYAA 4FAGA 4RR3C 4YZ1A 1VBB1 5FZOB 4B29A 2VOKA 3VGIA 5T5OA 2X5IB 5I0SA 1EAH1 1BVP1 2ORZA 1MS9A 4HVOA 1LOEA 5FY1A 5EJ3A 4RYDA 3SEPA 4R4ZA 2R062 3RMYA 4BLJA 3RMXA 4DRVA 4EN0A 3BPSA 1LOFC 1SPPA 2XJVA 4JGYC 1EUTA 4QXHA 3WUDA 4FQ4A 4F8AA 3CZJA 4ZONA 5LK7B 4Q4Y2 4N53A 1S2EA 1JZ3A 1CAXA 1SLIA 1DP0A 2A3YA 1IOAA 1R1A2 2RS52 1WD3A 2R1BA 1XYOA 3WXPA 1D4M1 3V56A 4LBQD 3TEWA 3UYJA 3I3QA 3IDEA 3PMSA 2WZ8A 1AYN2 1WW6A 2KM2A 4NRMA 1V6JA 2BDRA 2Q8EA 4PDWC 1W6NA 5C4WC 3R0RA 1Q8PA 4CDWB 1LRHA 2WT2A 2D3PA 3DYOA 4NPMA 3AJYA 3AVRA 4PJYA 4QGLA 4YZ4A 3OCPA 5E89A 2GC1A 3KHCA 3BTZA 4NR1A 5FO8B 1VBA3 1MVEA 1RB8G 4WM8A 1GP5A 1XNDA 4O9GA 4HVRA 4EN6B 1MS0A 4M4RA 4X8NA 1FNYA 1H2MA 5IK5A 3AM2A 4GMP3 3C7GA 2R073 2F4LA 2JG8B 3LPFA 2VW0A 4YW1A 1ZNPA 3WZ1A 3JD72 2QQIA 1LHVA 1CZVA 2R7EB 3M3EA 4UYBA 2D6PA 5T5LA 4NIIA 2WS92 3W9AA 3N9QA 3S0MA 3VHNA 2CL2A 4XFHA 2R0FA 1DIWA 3ZSJA 3OY8B 2ARCA 3ZXEA 2XHNA 4BQ1A 1GNYA 4Y33A 1TNFA 2JB8A 1FYUA 3O0VA 1XBFA 3BCWA 5C8CA 1JHNA 1YQCA 4ITCA 4GMP1 3GBFA 3ROUA 1LU1A 5A33A 4GULA 3LOBA 2WNVC 1SLBA 2E6VA 3JD73 4XYXA 3ILNA 3QLQA 3VBSC 1S2KA 3DECA 3W58A 1JYVA 1PMHX 2RM22 4B4RA 3KV5A 4RQPC 3MPPG 5C3SA 3OUHA 3WHUA 1DQ2A 5ANNA 1QWRA 3KLSA 4XE9A 4YGBA 4Y4RA 4NVPA
chains in the Genus database with same CATH topology
3WDTA 1ENQA 4AGRA 1FPN3 5CNAA 5IK7A 2ZX3A 2GDFA 4I30A 1SLAA 4QXKA 4XXAA 3VV1A 3WW3A 1JOJA 4YSFA 3AJZA 1RUI2 3WQ0A 1GICA 3MF9A 1COV1 1H8TA 4N53B 1CAXB 1DQ5A 4DY5A 3SMHA 4LBMA 4N9HA 2ZHKA 3VDDC 3WW1A 4SLIA 3JB8A 1J58A 3D8CA 1KS4A 1V6NA 5SV8A 2QJVA 4S2HA 3ZX7A 3NV1A 4MXWA 1AUYA 3QBQA 3URFA 1W6NB 1HQNA 3V65A 2D7FA 1PZ8A 4W6WA 3NAPA 4V1PA 3G7DA 1HV0A 3JQXA 1CPNA 2UWCA 5K0UA 4WM8B 4BA6A 1V6KA 1W6QA 3USUA 2A75A 1LECA 4NWWA 1PO11 1UN1A 3N7JA 1G9FA 5DDJ1 4LTAA 2IXJA 3ZXFA 2VG9A 2ZMNA 3VBRC 5JLVA 2GZWA 4Y1ZA 1NZCA 1ZYBA 2HWD2 4XFBA 2WA4A 4DS0A 4COWA 3NJZA 3VUOA 1H4GA 3J4UH 1DQ4A 4CEYC 1RC6A 3GF6A 5C8CB 3OD4A 2VULA 3MDPA 4MXVA 5A33B 4QMAA 3KSCA 3SISA 1CPMA 3JUUA 4MGYE 2O8OA 2ZMLA 4J1WA 3ATGA 3T1LA 2TUNA 2PLV2 1POV0 1TME2 3AFGA 1ZX5A 3MIHA 3WV6A 4XPVA 2OZJA 4IEYA 4E4ZA 5F1RA 1H8TB 3BTAA 3OGJA 1IGOA 3BALA 1LGBA 1H4HA 1RHI3 3PNAA 2BNOA 4Z82A 3S6PA 3HT2A 1ND2A 2EXKA 3AB0A 4YFZA 1R092 5HCFA 2PLV3 2WC2A 5CVRA 1ZZ8A 4MXWB 4YYOA 1VRH2 4KU7A 5KXEA 1QMJA 2MEV3 2WZR2 5JDBA 1L3JA 5LRSA 3NAPB 4KWKA 1ULFA 4XETA 3RDIA 2DFCA 4QM8A 1QDOA 5K0UB 1NCRC 2HEWF 1S0GA 2ZMKA 1W6QB 1S2BA 4CDXA 3USUB 4PLOA 2YGMA 2YGLA 1H9PA 5EFUA 1AZDA 2NYYA 3DUIA 1CJPA 4AEJA 3KZ4C 1PHMA 1R093 1UU4A 5E16A 2VPVA 1D2SA 4HSLA 5HXVA 2YZ4A 4ATFA 4Q1RA 5F9TA 2ERFA 2XGXA 1Y9QA 1AL21 4AHYA 2XLGA 2R49A 2X29A 1Z7S2 1OMIA 1OD5A 1SFNA 3OBRA 5F5QA 5FLIA 1YO8A 3BODA 3AMPA 3VBHC 2PTMA 2ZBJA 4Y26A 2XKOA 5JPNB 1RVF2 1RUF3 4UXAA 1MACA 5KC5A 1LESA 3UK9A 3L2YA 2SBAA 1J3QA 1OOPC 1JYIA 3AZVA 5FMOL 5J36A 1S1AA 4M0HA 4FPYA 2Y38A 3OF1A 4DZGA 2P37A 4E9KA 2XBO1 4YM2A 3AP7A 3ZXJA 4QPIC 4XF1A 1ND2B 2WIIB 5GKAC 5E8AA 2LM3A 3UKVA 3MPBA 1ND3C 4E27A 1CAWA 5FO9B 3HWJA 4YGEA 4PLNA 4K3UA 2PA7A 2YHJA 2Z79A 1EV13 4FOWA 4RFT0 3M1HA 4S2GA 1QJX2 2WNUC 1MR5A 1TNRA 4FOQA 4AI0A 3ZN5A 4CDXB 2LUWA 3I4IA 2RJLA 1C28A 1XRUA 3DV8A 4YGCA 3KQRA 1RUD2 3V0BA 2AH2A 1I3HA 2CGNA 3HIFA 2ZGOA 1AR82 2WQ4A 3D6EA 1RMU1 2AYHA 1AR93 1HW5A 5EZWA 1C4RA 2NMOA 1EV11 4GIQA 1LGCA 3MIBA 2AGSA 1NQJA 1B35A 4HLTA 1ZM1A 1ZRDA 4XTMA 2IXCA 4E2QA 1OQDA 1SBEA 1LULA 1OA3A 4JGZA 5I93A 1QOTA 1GZWA 1NA1C 2ILMA 1CGPA 5KHJA 5LEKA 1AX2A 4W6XA 4AI1A 1MVQA 1PO22 4M3CF 1Q3EA 4NN0A 2NMNA 3RJ2X 1RGSA 1YHFA 2MHFA 1KXGA 2ZA9A 2G4IA 5GJ6A 3MIEA 2QVSB 4ORFA 2B45X 2XVGA 1F5JA 1V00A 4AVVA 3FMGA 1R082 4LHKA 4S2DA 2BYVE 5C9AA 3WP4A 4LT5A 1S0JA 1UW8A 4Z8BA 3LA7A 3M3QA 3MIDA 4Q0VA 2EXHA 1CAWB 1YNAA 2CV6A 1DF0A 1RIRA 3TAYA 3D0JA 1AYM2 2DFBA 1QJY2 2VMHA 1HX6A 4ONUA 5BPXA 1TMF2 4Y24A 1O5UA 3E5UA 2Y0OA 1BCXA 1REDA 3H3ZA 2WNEA 3POYA 3NV2A 2D6KA 3TWIA 1WMEA 1Y43B 4LBNA 4LEJA 3ACLA 4JAAA 3AK0A 3TB0A 3B69A 5CFCA 2VXRA 3SH4A 3V0BB 1CN1A 1F9KA 1GKBA 4I3PA 5BXXA 2XJTA 4E4SA 2Z2SB 3FBMA 1GBGA 1UU6A 1B35B 2ZABA 3ENRA 3BOWA 3O7OA 2GNTA 2Q0AA 2DYCA 5FMOS 2DCYA 2UURA 3ZMNA 2PHXA 2XHKA 4I02A 4JGZB 4U36A 3B3QE 1ENSA 3GZUC 4IEZA 1GZWB 4MH0E 2H0VA 3GZAA 1NXD1 1RUG1 2R1DA 2BQPA 2E51A 3H1WA 1ENRA 5JSRA 1RTVA 1C5HA 2CYFA 3ZYGA 1RUJ3 3LA3A 1E57A 1H1AA 4LBQA 1JN2P 1HQLA 5CFDC 2QZ3A 4H14A 3MZHA 2BVVA 2P17A 3AYEA 3C3VA 5JZGA 4YVWC 3DN7A 4C90A 2VGDA 1PVC1 1VAKA 1RJ7A 2NPIA 1AL0G 4GWNA 4PF5A 3DGTA 1HRI3 3JQWA 2R32A 5C9AB 2GN3A 1PMIA 1BYHA 1SLCA 3CF6E 2QUOA 3P3PA 1RUJ1 4COUA 4UBHA 4OHYA 2ZGPA 2GMPA 2HWE2 1YWKA 4AEDC 1LB2A 3O5SA 3E6CC 3POSA 4OVEA 3VBOA 3VHOA 2OPKA 3O0WA 4Y4YA 4JTOA 3AKPA 4KWLA 1ONAA 2JE9A 3SXWA 4X6QB 1HRI1 5J7MA 2DF7A 3FJSA 4XQ4A 4XF3A 1V9U3 2UYBA 3AP5A 5CFCB 2Q8OA 4CDQA 3ZPYA 1QQP1 1UCXA 2Y0IA 1QNYA 2IXLA 5IUQA 3QACA 1ZBA2 3ZFFA 2FMDA 1VIWB 4XJ8A 1YXWA 4FAHA 4GB33 1YUDA 4Q4V2 4Z1VA 3B01A 5GLZA 5JSOA 3MLKA 1GV9A 1AJOA 1I5ZA 2HWB2 2VMGA 4I0WB 2BBVA 2I45A 2VNOA 2Q1ZB 5AC93 4KQ7A 4FCAA 1R1ZA 1ZBA3 1BBT2 2ZX2A 4R8HA 1LENA 3JBG3 4LBQB 1G8WA 4QQLA 2NLRA 4GB31 3AP4A 1ASJ3 4NHMA 3W59A 3R4DB 5JZGB 1NCQC 1V6MA 3FZ3A 4CEWA 1KS5A 2WFF3 3WG3A 2QQPA 1I6XA 4QQ2A 5AC91 4YG3A 2VVEA 1NOVA 1O3RA 2HWC3 2RMU3 5BNNC 1XNKA 3DPRA 1WBLA 1REEA 2EALA 3TYJA 1IQAA 4YGDA 3ZSKA 2BWCA 1LOCA 1LKNA 3VBOB 5C33A 3RS6A 1IS3A 2VQAA 4QPYA 4GH4A 2WFF1 4L2NA 1WCDJ 4MV2A 2ET1A 2A6ZA 2IWGB 2X5IC 3E6DA 4D3WA 4HN0A 4B3NA 1C8M3 1UU5A 2HWC1 2JICA 2RMU1 3N35A 4KL1A 5BNOA 5JOWA 1OPMA 3WDVA 2EA7A 3B02A 4CDQB 3VKFC 4HKOA 4BH9A 4E2GA 3KS7A 4K20A 3MFCA 3ZFFB 3VL8A 3SITA 1EPZA 1TEIA 1EAH2 3PJYA 2BEOA 4L9BA 4XXPA 1LR5A 1SQ4A 3AZZA 2K9ZA 3EXUA 1NLSA 3ELNA 2B7YA 1WW5A 1OQEA 4FPGA 2DUOA 5ACA3 4OHVA 1D0GA 1D0HA 1XE8A 2JX9A 2OA2A 4FPLA 3WW4A 4A3XA 3AKTA 1C8M1 3ETQA 3WQ7A 3ZXLA 1Q5OA 2XL7A 4C91A 1RUH1 4FP3A 3HD8B 1LJ7A 1LEDA 4EN8B 3AP9A 4CDWC 2VMIA 1VBB3 2PHWA 2RJKA 2ZHMA 1EAH3 1KJRA 4XIOA 1YFWA 1QXPA 2O8QA 3IBMA 4Q8LA 3OYWA 4AFAA 4HT1T 4CEWB 5ACA1 1SBFA 5JSPA 3AX4A 5KHGA 5F6KA 1QGLA 3I54A 4K6BA 1H9WA 4DPNA 4R52A 1BKZA 2ZX4A 2HWF1 3IM0A 4MSVA 4OULA 5A3MA 3E97A 1D4M3 1U5YA 1O3TA 5FDBA 3CL1A 3DPRB 5J48A 1VR3A 4EWDA 4P9LA 4FOYA 1CONA 3RYRA 4RHV1 2OYZA 1RITA 4H7LA 4DXZA 4LUKA 3I7DA 1LOFA 4AXOA 3SCHA 1WMDA 4GH4B 3EQEA 4I2OA 1VBA2 4Q0UA 1LODA 2JECA 3ZFEA 4FPCA 4PQ9A 4M3CA 5BNOB 2R072 1A8MA 2VY0A 5FO7B 4ZU4A 4AQTA 3D82A 3OBTA 2R0HA 1IKPA 1BXHA 3K51A 1YIPA 4CZSA 1QXRA 5C4WA 2D98A 2FBEA 3LWCA 4M0NA 1BMV1 4N53C 2R30A 1LHNA 1UIJA 1Q8QA 4FPHA 2D44A 1RUE3 2K2SA 5F6LB 1UIKA 2WL1A 4IETA 3ILRA 1ULGA 3CJXA 1COV2 3U10A 2AREA 3CLPA 1FX5A 5JI7A 1WBFA 1W39A 1N3PA 2EF6A 1VBC3 1HXS1 3AYCA 4MZUA 1PK6C 2Q4SA 4LBKA 4R9CA 3VN4A 4WM8C 1XU2A 2WLQA 4Q26A 3OYWB 4J6GA 2D43A 1FPN2 1RUE1 2P34A 4MUVA 3MYXA 4MGKE 5I8SA 3ZXKA 3AMHA 1MQTA 3ZXGA 1G9DA 1COV3 3APBA 4Z07A 1SACA 3WVJA 3H9AA 3WQ1A 2QDNA 1LTEA 2D3SA 4IQPA 5DG2A 1PO12 4FPEA 1VBC1 5DDJ2 1D2QA 2VOXA 4Q4Y1 4RQPA 2CAVA 4P9GA 4COZA 2ZAHA 1HIXA 1LCLA 5I8TA 5KWRA 1R1A1 5C8CC 4AI2A 4K21A 5I0RA 4CDUA 3T2TA 2VUJA 2DTWA 4XJAA 1N1TA 3BU7A 3H0OA 4WVZA 1AYN1 4Q2FA 2QDRA 4EN9B 4XFFA 1PGW1 3ZFEB 4WV8A 1PO13 5BNQA 4M3CB 5DDJ3 1U12A 4BM8A 5IK4A 2ZGTA 2ZCWA 3ZXAC 1RUOA 3M70A 4KG8A 5C4WB 3IDBB 5FOBB 4ZKTB 3S7EA 5C6CA 2GH8A 3AXEA 4XF4A 1H8TC 4ES9A 3IWZA 4IV3A 4BOWA 3ES4A 2A71A 5CG9A 1EP0A 5FPZA 1UKGA 2A3XA 4XQWA 4G4FA 1QXJA 1VP6A 4BIFA 4Q4W3 3M7AA 2ZHLA 4XF9A 2FQPA 3MW3A 4AVSA 1JBCA 5JCTA 3NAPC 2WLPA 5EYYA 3H1YA 2RS13 1ZBE1 3ME2A 3EJKA 1GNHA 3M8LA 4XFIA 4LLOA 4AVBA 4IEQA 4K1YA 4I3GA 3VKNA 1FOD3 4BCUA 1MQTB 2RM21 2X53S 2ZGSA 1X8MA 4NWVA 4GKYA 5ABJA 4Q4W1 1GZCA 4XILA 1VAVA 2A6WA 2DCJA 4MLOA 4DNYA 3VZLA 1RHI2 5KHIA 5KBFA 2G9FA 2RS11 1I9RA 4N7IA 2IFWA 1VAMA 4RQPB 4CP0A 4XJUA 1C57A 4XFAA 1GQHA 1SLTA 3N7MA 2MEV2 3TN91 1FOD1 4CDUB 2FHRA 1WLWA 4WVWA 3U11A 2JDZA 5EV7A 3A0NA 3GYDA 2YY1A 4Q1PA 3FBYA 1NY71 2DVFA 4G3YC 2FZ1A 4JV4A 1O4ZA 1WD4A 1IS4A 2P3IA 2PQQA 3INAA 4ES8A 2IXIA 1A3KA 1M06G 2XL9A 3ST7A 4DQAA 1OLRA 3ZIXA 1V70A 4ISRA 1X82A 3B9IA 5DUVA 2WFPA 4NO4A 1BEV1 2WKKA 1AL23 4IV3B 3E6BA 4IESA 3FFZA 4NHLA 1DG6A 3ES1A 1ND2C 3AKQA 3ZFGC 3SH3A 4BE3A 1AXYA 1G9CA 4R4XA 2K0GA 2DV9A 1CVNA 4GA9A 4EROA 2JEMA 1RUF2 1YFYA 4RS5A 2D6LX 2XVKA 5TSWA 3WCSA 2A6VA 5LRRA 2E7AA 3HAGA 1W0PA 2D6NA 1X33A 2OIIA 1BQPA 1PZ7A 5T50A 4CDXC 1V6LA 2YV8A 1VBE3 3EBRA 2EXJA 2AENA 4FVVA 3KCXA 4M00A 3ZIWA 1V6IA 5BY5A 5ABJB 1J59A 1DU3D 3J26N 1G9AA 3NO8A 2XBO3 1KITA 2XUMA 4FPKA 4QPGA 5KHKA 2UY8A 3BPZA 4IEWA 1TE1B 1J3PA 3U0ZA 1VBE1 2GC2A 3V64A 1O3QA 1J3RA 4OFGA 1OKQA 4WM7A 1EV12 1C5IA 1DZRA 4JTNA 1U5XA 5J37A 3BIWE 1UZZA 4LO4B 1APNA 4BZ4A 3R4UA 1WLDA 2D5HA 1VRH1 2JG9C 3A0KA 2RR13 3L9JT 4X8PA 2ZZQA 2WJSA 1Q56A 3B00A 1XQNA 2B39A 3ZN4A 2R16A 1T6GC 1RMU3 2PHUA 4HMZA 1AR92 4K40A 1AXKA 4Y5Z0 1Y3TA 4PLMA 1YYNA 4AFCA 2WT0A 2ZGRA 3DF0A 4AF9A 1FATA 1OLQA 4HKLA 4QQHA 2CNAA 4META 2RR11 1MZ6A 2Z5WA 1QH7A 1QKQA 5L36A 4ASMB 1RUC1 4D7TA 1XNBA 3FLTA 1NE6A 1QOSA 2HEVF 3JCIA 5C8WA 4RS5B 4AVTA 4FT8A 4LR4A 1HQWA 2DVGA 4K9SA 4LA2A 1K5MA 1DLLA 1LHOA 3K48A 2A6YA 4HVQA 4R9AA 3WOGA 3PVBB 5J96B 4IEOA 1OA2A 4Z2WA 2DU1A 1EPWA 2GNDA 1IHMA 5BV6A 3AKSA 3M3OA 1SEFA 3WP5A 2E9QA 3FUQA 1QJZA 2TEPA 1AF9A 5GLUA 2CY6A 3MW2A 2B46X 2D6OX 4XJZA 5AVAA 1FNZA 4JCKA 3HR9A 1VBD3 1RINA 3MF6A 1XYPA 4N43C 2ET7A 1HRV3 1S0FA 2HKXA 5JIAA 4QPGB 1B35C 4TLFA 5L73A 5DZGA 1CX4A 1UPSA 2GMMA 3GALA 4QU2A 1CJDA 4B4PA 3U4XA 1O5LA 4I0BA 2UWAA 4JGZC 2D93A 2BFUL 2VOVA 4WM7B 2GNBA 2CWMA 5I91A 4BIOA 5E88A 1MEC3 3MFAA 2CTVA 1VBD1 1OPOA 4K8FA 4OUMA 4D7YA 3GHMA 3WDXA 4LHLA 4QQPA 3DKWA 4P9YA 1HRV1 5I0TA 1GR3A 2ZGMA 1ZRRA 3ZN6A 1QJX1 3B94A 1RUG2 3M2MA 2YYOA 2SLIA 2ENRA 4Q0SA 5JIUA 4YM1A 1POV1 4OLLA 1KFXL 1MEC1 3WDUA 4FTEA 3KGZA 2C5DA 5C9AC 1AR81 2PFWA 1CIWA 2UY9A 1MZFA 3GHNA 3FWEA 1AR63 2RS31 1IPKA 2C1FA 5JI9A 4YW2A 4A7ZA 4AHWA 2X8KA 1YJKA 4HPKA 1RUG3 4AQ2A 4CTEA 1K5MB 2PAKA 3TNPB 4IV1A 1RUJ2 4LA3A 4FBFA 3VL9A 4P14A 1S55A 3CEWA 2E63A 3WR0A 1NG0A 2ZPXA 1AR61 1PVC3 3B93A 4N7UA 4OUSA 1F8VA 5CFCC 3IN9A 1U0AA 2R041 3WP3A 1MS5A 3S7IA 4TWTA 4XFCA 2BUKA 1HRI2 3H1MA 3H7YA 5CIRA 1H2NA 4UW4A 4Q27A 3TOJA 2MPFA 1OSGA 4H55A 3VBUC 1Z78A 1DGLA 1YI9A 2W08A 3QOPA 2A5ZA 2ZKLA 4Y22A 1ENXA 1LOBA 5JWPA 1BZWA 4Y1UA 2PYTA 2XVLA 4G9SB 3MI8A 5BNPA 1FMD1 3LZZA 4KGQA 3WHTA 1H30A 3PHMA 1MZ5A 1QJY1 1V9U2 2Z42A 2UU8A 3ZN6B 1NE4A 5JZGC 1QQP3 5AFEA 3WCRA 3R6SA 2EAKA 3AXDA 2NQYA 2W39A 4GB32 1QJU1 4B7EA 4ZXKA 3H50A 4YRDA 4NOTA 5K8SA 3ZYIB 2XWBB 1LEMA 4HPKB 1ZA4A 4KG0A 4WZFA 2UWBA 4AWDA 5H9RA 3FC0A 5AC92 2XJPA 1YLLA 3VBOC 3KB5A 4IV1B 3ILFA 5CG8A 3JBG2 3RZZA 1X8EA 2BFUS 1Q8OA 3E5QA 1ASJ2 5H9SA 1BK1A 5GZFA 3VZJA 5T54A 1NLRA 1NYWA 3V0AA 4HK9A 2QNKA 4FXKB 4A7KA 4OHWA 1HDKA 2ARXA 2C9AA 1WUVA 4CDQC 1N1SA 2WFF2 4Y1YA 1FT9A 2ZX0A 1C3HA 2BPA2 2DCTA 2FMYA 3ZFFC 5DZEA 3N3HA 4LO6B 2CGPA 2HWC2 2RMU2 1YFUA 1X7NA 3VBFA 1PVXA 2BVBA 2C0ZA 3GZTB 4XOGA 4GMP0 1OQ1A 4Y22B 4C1XA 2W68A 3VZNA 5FREA 1SCSA 1UKRA 5BNPB 4KNCA 2HWE1 2NM1A 1ZZCA 5CBLA 1X50A 2FZ2A 2ZKNA 4AFDA 4RL7A 4LUMA 3UKNA 1GSLA 1C8M2 3VKLA 2WINB 1AR73 4LBLA 4WBBA 2EAAA 5BNNA 2CWSA 2F4PA 4CEWC 2ATFA 2BTVC 5JVVA 1S0DA 1IS6A 5DZFA 5J09A 4AGGA 4DB5A 1WCSA 4QQOA 1AHSA 1CAVA 2JE7A 2EIGA 4O9EA 3PLQA 3NL1A 5ACA2 1SBDA 3M3IA 4M3CE 2ZHNA 4ZU7A 3DPRC 5H9QA 2ZGKA 5DUUA 5CAZA 4QX5A 1XNCA 2F6BA 1C1LA 1AR71 4KGGA 5I8YA 2D40A 1C1FA 3AYDA 2HWF2 4YG0A 1RUH3 4Q4V1 4PIYA 2TBVA 1MZEA 5T5JA 4YW5A 1VBB2 2HWB1 4AQSA 5L7OA 5I0UA 4GH4C 3HT1A 1PIV3 3JU9A 4FPJA 3LOIA 3NKGA 1HKDA 4YM3A 4AHXA 5FBZA 3V0AB 4BPZA 4XFGA 4P5HA 1UL9A 1FXZA 4MYEA 4YVSA 4Q4X1 4LHNA 5BNOC 3I59A 2PHTA 4ISQA 4EWEA 3J8F1 2IXKA 5FAXA 1ZZ6A 2HWF3 1VALA 3CJIA 4FPOB 3ZXDA 3RG0A 1AVBA 2NZ9A 1D4M2 4IERA 2XLFA 3AZWA 2GC3A 5JMCA 3VBFB 1PIV1 4IEPA 1GQGA 1KQRA 4XHBA 2AUYA 1H2KA 3WUCA 5GZEA 3TBDA 4RHV3 3D5OA 3D4KA 1PGL1 2JG8C 4SBVA 4WVVA 1SFYA 4CP2A 3AP6A 3QH7A 1RJ8A 4XF0A 4W6YA 1F5FA 1RUNA 1ZZBA 5D8AA 2HYKA 2D97A 3ALQA 2HJIA 4RR3A 5IT6A 1Q43A 2WA3A 1OFSA 5BNNB 3MLJA 1W6PA 2VVDA 5T52A 5E1RA 5BUVA 1DHKB 4XQDA 5GALA 4YARA 1ALYA 4QGNA 5CA6A 1MS1A 2AR6A 1N3OA 3HMYA 4JGYA 4TSVA 1H0BA 2D6MA 5KC6A 4MGZE 1CAVB 2YPJA 4CP1A 3B9CA 1LHUA 3QD6A 4IXLA 3SHRA 5HI0A 2ZGNA 3DL3A 2LTNA 1RUE2 1YIFA 4KU8A 1Z0HA 2DVDA 1UZYA 4AYUA 2EXIA 4NPRA 1YI7A 2Q30A 3OJBA 5FPXA 2G9GA 2JD4A 3HQXA 2JENA 3UJOA 5L7OB 2IXHA 3J9SA 1HXS3 1VBC2 4PDWA 1ZZ7A 4EWAA 4XJ9A 1XYNA 4Q29A 2ES3A 1ZRFA 2IFRA 4XMAA 3SLIA 4L99A 4A7YA 3ZFEC 1N3QA 3ZMOA 4YVSB 4AFBA 3I59B 4GALA 5DUXA 2XJRA 4I09A 1QF3A 1D4VB 4K1ZA 4L97A 4COYA 3ZDSA 3N36A 2R063 5SV5A 3CJIB 2QZ2A 1PGW2 2Z69A 2HEYF 4AI8A 4GKXA 1UD1A 2W0XA 3RJRA 4Q4Y3 2PN5A 2XKPA 1PK6A 2RE9A 4RA0A 3CO2A 3EO6A 5T3NA 3AMQA 4DFSA 3UJQA 1R1A3 1S0CA 2PELA 2RS53 3SCGA 4HETA 1DQ1A 4XDQA 3ZYRA 2PHFA 3RSJA 4CYDA 3GBGA 3R4SA 3HN1A 2BNMA 2PHLA 1AYN3 2R061 2XB6C 3D0SA 4IEVA 5D8AB 4LULA 2WNVA 1YRZA 4U2AA 4ZU5A 3VHRA 2A73B 4RR3B 3VBSA 3NV3A 2VVFA 1BJQA 1LOGA 1W6PB 2NP0A 1F2NA 1VBA1 2XG3A 4P9WA 5KXBA 2DVAA 2RS51 2WZPP 2GMEA 1MQTC 4FTBA 1WW7A 1ZBE2 3O14A 3LB9A 4JGYB 4W65A 3WD5A 2R071 1KJLA 1CR7A 1AJKA 1FV3A 1VB4A 4AE2A 2A3WA 1GFF2 3VDDA 2WS93 1KDKA 4JDOA 4Q4W2 1VJ2A 1DFQA 5BYNA 1JYCA 5T5PA 4TZDA 4LE3A 2XJUA 1SLLA 3MEPA 4YZ5A 2JKBA 2JXAA 4CDUC 5IK8A 4PDWB 2RS12 1ZBE3 1AX0A 2ETEA 3A4UA 1URXA 4Y20A 1JUIA 4JC1A 2YC0A 4YM0A 1V6OA 3E5XA 3JD71 4LO8A 5FLJA 3WG4A 3TN92 1FOD2 2I74A 4YZ3A 4ASLA 2RM23 1TQ5A 2WS91 3ECQA 5HCAA 1NY72 2O0OA 5K9YA 3THPA 3VBRA 3WY6A 1FPN1 4AEKA 3ZO0B 4BMEA 2JJ6A 4IV3C 4D7SA 5GLVA 1RUI3 3GBWA 5K0UC 1SMVA 1PK6B 4D69A 2VOWA 1OI6A 3AZYA 1WMFA 5KHHA 3TN93 4F3JA 4HBNA 4CEYA 2BNNA 2DTYA 3ZSEA 1BEV2 4IEXA 1KRIA 2ZTNA 4EN7B 4AQ6A 3IMNA 3ZYPA 2QE3A 4JDMA 4FSJA 1FAYA 4LO5B 2WNVB 1CQ9A 1KD7A 4EJRA 3VBSB 1QNWA 3IPVA 1RUI1 3LGRA 1DYKA 4XBNA 4QHBA 1DGWA 4HZFA 3OGGA 1QOOA 4GXLA 4B8EA 3SCFA 3RI8A 4XMIA 5ABJC 1A6CA 1BEV3 4DRRA 3PTYA 1AL22 5GM0A 1QHDA 4HKWA 1WW4A 2ZJCA 2KA3A 2DURA 3NKTA 2AZ5A 5EYXA 1VB2A 3RNSA 3VKOA 3THTA 3VDDB 4XHXA 2HWD3 4YLZA 4P9IA 3RRDA 3N7LA 3WNXA 1IZ3A 1VLNA 4H3WA 1NXMA 3MIFA 2I2SA 3LKJA 3UL2A 1MS4A 2O1QA 3GNEA 3KCYA 3MIGA 1AX1A 1QU0A 3NV4A 1WGPA 4Y20B 1ULDA 2P3KA 1VBE2 5T55A 2OZ6A 1NCRA 2VNRA 3UV9A 2HWD1 3PMEA 4L11A 3ZFGA 4Q8KA 2E7QA 3C2UA 5FLHA 3TRSB 3VZMA 3N7KA 4PCRA 2E7TA 2XBO2 2NN8A 1TME3 3VBRB 4UBGA 3FUOA 3L2HA 5JAXA 1F31A 4FO9A 2YROA 1KDMA 1N47A 3G6JB 4F7ZA 4DOUA 3TNQA 1UX6A 3CU7A 4IEUA 2PAMA 4Q0PA 1LHWA 4LO7A 1RHI1 2VW2A 3M4FA 4CEYB 5DG1A 2GH2A 4Y1XA 5LK5A 4OHZA 4L8QA 3VBHA 1OHFA 5AFBA 4RS5C 2PLV1 1DGWX 4NHKA 5H9PA 1Q8VA 1VRH3 1TME1 2RR12 1M4WA 2MEV1 2P2KA 2WZR3 1W0OA 1B09A 3IPVB 1RUC2 2WT1A 2OW4A 5AVPA 4FXGB 4RGAA 2VUAA 5GZCA 1RMU2 1J1LA 3AKRA 2TNFA 5HBAA 5A32A 3AMMA 4A2UA 1OOPA 3S30A 1MS3A 5CADA 4WVMA 1R091 3WINE 4HFSA 4N90A 3MICA 3LSEA 5A3LA 1J1TA 2QKDA 1FI2A 3BB6A 4QPGC 2JG9A 2WZR1 3IDCB 4QPIA 4OI0A 1RUC3 2ZX1A 2EVXA 4D94A 5KXCA 1UAIA 4OI4A 1G9BA 4YW3A 2YUEA 4J1XA 1FV2A 1Z7S3 1DQ6A 4WM7C 1H1IA 1ND3A 1JTZX 1REFA 3P3NA 3USSA 4INDA 4UW6A 1OFNA 3NVCA 4FTSA 4XIKA 2WNUA 1RVF3 3NWKA 1RUF1 3FFQA 1NCRB 1A78A 3KGLA 2ZGUA 3ZFGB 1XE7A 4C0HA 1WA4A 4AEMA 3RYKA 3WW2A 1VBD2 4JRAA 1UPIA 1Z7S1 3PVOA 4CRQA 2IZWA 2XPJA 1HRV2 3FX3A 3KM5A 2P3JA 3H3UA 3ASIA 3H7JA 4PIZA 5JOZA 2H0BA 3WDYA 3VKMA 5K7PA 1RVF1 3SNMA 1GZ9A 1MEC2 2H6BA 3VBHB 2XH6A 2VW1A 1ZZ9A 1XU1A 2PHRA 1UF2C