2G9GA

Crystal structure of his-tagged mouse pngase c-terminal domain
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
189
Chain Sequence
GRVSGSLAWRRKEILFIPSENEKISKQFHLRYDIVRDRYIRVSDNNTNISGWENGVWKMESIFRKVEKDWNMVYLARKEGSSFAYISWKFECGSAGLKVDTVSIRTSSQSFESGSVRWKLRSETAQVNLLGDKNLRSYNDFSGATEVTLEAELSRGDGDVAWQHTQLFRQSLNDSGENGLEIIITFNDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords peptide N-glycanase
publication title Structural and biochemical studies of the C-terminal domain of mouse peptide-N-glycanase identify it as a mannose-binding module.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 48
structure length 189
sequence length 198
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 2006-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04721 PAW PNGase C-terminal domain, mannose-binding module PAW
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1020 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2g9gA00
2G9FA 2I74A 2G9GA
chains in the Genus database with same CATH superfamily
3X29B 1H30A 4R8HA 1QY4A 2WT2A 4CTEA 2XBO1 5I8SA 1R64A 1Q8OA 3GYDA 2WZ8A 3AKPA 4OZXA 5LBFA 5J96B 1LU1A 3WR0A 1AR82 1W6OA 2ZGRA 2HWD3 3AP9A 4IV3B 2CHHA 2WS93 4YW6A 1BVVA 2BW8A 3C7EA 3N9QA 2WYFA 3TNPB 5ACA3 2RS32 4LO6B 1H8TC 4K3UA 4XQWA 4XFIA 3T4HB 3I49A 2LTNA 3WW2A 5KXCA 1J3RA 1CD3G 3WP3A 3WQBA 2VVFA 5KXEA 1IG0A 2HYKA 5K9YA 1QH6A 1KQRA 2ZEZA 3NRUA 4PBOA 4ASLA 5BNNA 3FX3A 3KZ4C 2VNOA 4IEVA 2OZJA 1NKGA 4FBFA 1WGPA 4Q0QA 4L97A 5IVVA 3EMRA 5C4WA 3ZR5A 1GZ9A 1URXA 2XBO2 2FZ1A 1LOAA 4FO9A 4QQHA 2BRTA 4AR2A 4OMCA 4B4QA 3K4DA 4LA2A 2BQPA 5EWSA 1MS4A 4W8JA 3KWVA 5IK7A 2VZPA 3N9MA 3WF0A 2JJ6A 1H9PA 3LE0A 4OCTA 5CG9A 1HW5A 5DAQA 3C2UA 4ZZ5A 1AL0G 2W1UA 2QKDA 4YGCA 4QB6A 2JXAA 5FPZA 3H8XA 1OOPC 4PDWA 2AREA 5FZOA 3NMBA 2Y33A 4FVVA 5HXVA 2VUJA 2PHTA 2ID4A 1SHWB 3PDQA 1F9KA 4O9GA 4MO3M 4OVEA 2AYHA 1RJ7A 2LM3A 2ZABA 1DLLA 3WD5A 1WWYA 1YFUA 4LLOA 1H8TA 4LBJA 5F5CA 2BWAA 1N1TA 2Q4SA 3SHRA 3DL3A 1ENXA 2ZMLA 3HN1A 4R9BA 4AVBA 5JCTA 1W28A 3AMQA 4HKLA 5T55A 4JTNA 5FZ0A 5FZIA 3CJIC 2XLAA 4AQ6A 3C7OA 2D7FA 2ZX0A 1O5LA 3MIDA 3T2TA 1UYZA 1SLAA 1US3A 3BCWA 3RPQA 4LBLA 5CKMA 3RJ2X 1G86A 4ZU5A 4DXTA 5I8YA 4HSLA 3R4DB 2ZJCA 4YFWA 5DUVA 2R041 1WD3A 4C8DA 5A3NA 3WVJA 4AVAA 4M01A 4COYA 3IZOA 4HL0A 3RI8A 5H9PA 3CL1A 4AXOA 5FXVA 2RS13 2ZKNA 1UD1A 1UX7A 3ZIXA 1RTVA 1SPPB 2QDNA 5C8CA 5C71A 2DUOA 3FHQA 5FP4A 4IERA 5FWEA 5FP9A 1VBE1 2VTXA 3AYAA 1LRHA 3POYA 1X36A 4BQYA 2ET7A 2Y64A 3TRSB 4JHTA 2QVSB 2R073 4KNCA 2ZGKA 1PVC3 4HETA 1NCQC 4CCCA 4CU7A 2ZGOA 4Q0SA 4X8PA 3SKVA 4L99A 4XXAA 3M70A 4YVSB 4AI1A 5GALA 1BJQA 1PMHX 1UNBA 2Y8KA 4ZXKA 2VZ3A 2ZS6B 4JX0A 4MYEA 1LTEA 1Y4WA 4B1MA 1IKPA 2CWSA 4BMEA 4RHV1 4XE9A 4D3WA 5FR3A 2WIIB 3ACFA 4B4PA 4K6BA 3ZKYA 2UWBA 2WBKA 5JXIA 1RUF1 3B7MA 2XLGA 4YRDA 5AVAA 4MV2A 4LO5B 5FJHA 2B42B 4LK6A 4UFKA 4TXWA 1AL23 4A3ZA 3PVNA 2VNGA 1X8EA 2R0HA 2VMGA 2YC2A 3LEMA 3MI8A 5A33A 4CEYC 3USSA 1ODMA 3BN6A 1DYOA 1CAVA 1REEA 1ULFA 1UQXA 1VBE2 2F4PA 4LULA 3VBRC 3V56A 1OC1A 2VUDA 3H42B 4XF4A 2ADDA 1VAKA 2JDAA 5DAPA 4GULA 2WNUA 3MW4A 3NW4A 1W6MA 5FUPA 5IJRA 2ZKLA 4ZZ8A 1DGRA 4Q4W3 3U11A 4EZ4A 1OUSA 2EIDA 1GANA 2Y0OA 4M3CF 5GZGA 2Q30A 4YVWC 1KJRA 4RHV2 4QT6A 1D0GA 1UCXA 3ZXDA 5I91A 1VMFA 4Y5Z0 5IYYA 2ZX2A 4ZONA 1RUF2 2D44A 3ENRA 1HXS3 1J84A 2O8QA 2R30A 4DY5A 1CAXB 1NCQA 2VTXJ 3UETA 1UYXA 4ZXEA 2XHNA 4YZ1A 1PNGA 4BMBA 2R1DA 2CL2A 4QM8A 4UXAA 2XL7A 2VD7A 1J1TA 2VOWA 4HVOA 1YQCA 4IV1C 5KHKA 1GOGA 2ARAA 5LATA 1CGPA 1OQ1A 1YFYA 1QOTA 3B01A 4AGGA 1POV3 2JENA 4GJZA 4KI5M 5FBZA 3O1RA 1QQP1 2BVVA 1WD4A 4FP3A 4M00A 3VL8A 5D8AA 2H0VA 1BMV1 1ENSA 2P3JA 2GN3A 2MEV2 1AHSA 5IT6A 4WVWA 1TMF1 4A7ZA 3RWNA 2ZEXA 2V09A 4Y1VA 1CAWA 1RUC1 5T52A 3VBRA 4HONA 3E1F1 5BNPB 1X9PA 5A3PA 3NO8A 1W3VA 2NMNA 1PO13 5ERLA 5FKBA 3ZYIB 5LA9A 1O3RA 3WUDA 1QJY3 1W9SA 4IEUA 2HKXA 3VBFB 5KC6A 4H14A 4IE4A 2A3YA 1SBDA 4GAZA 4DEVA 4OFGA 4YVWA 4N43C 1GNHA 3M3IA 4GD4A 4XF9A 3ZXGA 3KSCA 4QKFA 4CCOA 1QQP2 3CZJA 3I54A 3JQXA 2IXLA 3AXEA 4QHOA 4QDSA 3ZFEB 3AMMA 3LFIA 1TQ5A 3GF6A 4XC9A 5AFEA 1QJEA 4GWIA 3HBZA 1H2LA 1TMF2 2WWJA 4CCNA 2PFWA 5JXGA 1OUXA 4N7UA 3RMYA 5FYIA 5JMCA 3TEYA 5F3EA 3EYPA 4CDXA 1ENQA 2Q5TA 3DEMA 1W6OB 1ACCA 4TSVA 4Q1PA 1J58A 1UWWA 2V4AA 2DFCA 5AFBA 2VZ1A 2QNKA 4G9SB 2GNBA 1V6OA 2Q0AA 1H1MA 2X8KA 4NWWA 3VHRA 4EV0A 5KHHA 1CJDA 1XYNA 4QPIC 1NCRC 3HWJA 3IT8A 4P9XA 4XEZA 4AE2A 1RXFA 2R063 3GHMA 3IDCB 4J1WA 4OULA 2OPWA 5FZ8A 3O0WA 1Q8QA 1GR3A 4QB2A 4CDQC 4QX2A 1VR3A 4XJ9A 2BNNA 1ASJ1 2ZZQA 3ME2A 3S30A 4RYDA 3AMNA 5BNNB 5L36A 1JYTA 2BNMA 1US2A 3NKGA 3WV6A 4NHYA 1W8TA 4M3CA 2ZA9A 4QWNA 4XURA 1QJX1 1I3HA 1GQPA 4IGOA 3WDWA 5C4WB 4IL7A 4N8MA 3POSA 2BGPA 3NNJA 4FPFA 5GJ6A 2HH9A 5FP3A 1YJLA 1B35C 3PLQA 4ES9A 5CAZA 3B9CA 3SCGA 4CDWB 3MHZA 4MSVA 4OUEA 2WYSA 4LEJA 4DIQA 3O7OA 3U0ZA 1OD3A 4D6SA 1JZ3A 2X10A 1EUTA 3IMMA 2YBKA 3IWZA 2QQPA 1W8WA 4PDWB 2PYTA 5F5QA 4UBHA 2W94A 2YYOA 1BBT3 5FZOB 3DYOA 3ZFGC 5HI0A 5IVFA 2G9GA 3AYEA 4L8QA 1VB4A 1ASJ2 4XUNA 4IEQA 4RL7A 4AEJA 1SBEA 3IBMA 2CGNA 1LOEA 1UIKA 2RJ2A 3AMPA 4JC1A 1LODA 2RM23 1W0PA 4Y22A 3HQRA 2A70A 1H8TB 3N3HA 2IFRA 5FLIA 3BPZA 2CV6A 3HEIA 3PHMA 1SFPA 1ZZ7A 5CYYA 3K3OA 3DPRC 1RYYA 3POJA 4M3CE 1CVNA 4XQ4A 4E4DX 2VVDA 3O0XA 3AJYA 3KV6A 3VHNA 4V2VA 3ES1A 4OHVA 2RMU1 3AC0A 3E5UA 5KXDA 4YNIA 1OSGA 2YPJA 2WQ8A 3ZXLA 1IS4A 4NIDA 1ZM1A 4H2AA 3R4UA 1JW6A 4RD7A 2XQXA 5APAA 5SV5A 5HCBA 5DZFA 1D0HA 3PUAA 5LCWL 1WCSA 2WFF1 4BPZA 2XJSA 3MW2A 2R49A 2OZ6A 2VMDA 2FMDA 5JWPA 3I2IA 3VBOB 3VD9A 1O4ZA 1WZXA 2VUAA 3E5XA 4W4ZA 5C8CB 2JDMA 4AFCA 4NWVA 1HQLA 3PTRB 2RVAA 5FUIA 5LBCA 2PAEA 1EV13 5DG2A 5FKCA 5I0DA 1WW7A 2EALA 4ASKA 4CEWA 1LHVA 1VIWB 5JSOA 3VDAA 2RMU2 1SEFA 2WS91 4XQDA 5L9BA 1VBD1 2J1TA 1S0DA 3NQHA 4QQ2A 5I0UA 2L9LA 5ACA1 3PJQA 3NL1A 4WZCA 1UX6A 2VMCA 5E88A 1JZ2A 4A2UA 1RUH3 1CIYA 4N53C 3B3QE 3CIHA 2VGDA 1ZRFA 5FZHA 3DPRA 4IEOA 4W6WA 3VD3A 1D4VB 2WFF2 4EWDA 5D1IA 3C7FA 2W91A 1SBFA 3AZYA 1SMVA 1ZZ8A 1FATA 3J7MA 2GH2A 3VD5A 3A21A 4QM9A 3RZJA 4LR4A 5JR7B 2AUYA 3OGSA 4NPRA 2VZVA 5A33B 4R4XA 4Y24A 3WUCA 1CAVB 5B4XA 1ZBE3 2ERFA 2QBXA 2QE3A 3E6BA 4ZS2A 4BM8A 3ZMNA 2GAUA 1OURA 2WS92 3DECA 1VBD2 2HWF3 1ZRIA 4C0HA 4XVHA 2WNUB 2RR13 2DTWA 2NQYA 2OA2A 5ACA2 2Q8DA 3G7DA 5CFDC 1W6MB 3AZWA 3KQ4B 5CFCC 5LW9A 5KXBA 3ZYHA 2XJUA 3PVEA 5FZDA 3RYPA 1UMZA 3N35A 3THTA 5FY0A 4EN0A 3TNQA 3JU9A 4BYYA 4CDUA 1N47A 4M0HA 5CZKA 5C33A 4B1LA 4XFAA 5KHGA 2J1UA 1TME3 3KF5A 4FXKB 5HCFA 1KFUL 2QQNA 1NCQB 5A1AA 1HDKA 4NAOA 4HSJA 3UGFA 1ZX5A 1RB8G 4TTGA 1FV2A 1QXJA 4JRAA 2GP3A 3PUSA 3RFRA 3S0MA 2A5ZA 5GZDA 5C5TA 1Q43A 1W8NA 2JIGA 3IAQA 4JVAA 5EV7A 3OUIA 3POBA 4OHZA 4ISQA 3MFAA 1SZBA 3LB9A 4J1XA 5BPXA 1N1VA 4A7KA 4LBKA 3KGZA 5LRSA 1ND3C 1YRZA 1UXZA 1MQTC 1S55A 4GXLA 5D8AB 3VHOA 2D43A 3AP7A 3TYJA 5FO7B 2JDKA 3WDYA 5FP7A 4GA9A 2MHFA 5IK5A 4M4PA 4EN6B 3VD7A 3V0AA 2VCBA 3VBHC 1XSQA 4ZKTB 4NIGA 4BQ2A 4ET7A 1CAWB 1YXWA 1Y9QA 3OF1A 2FCTA 4YW1A 4A42A 5IK4A 2AEYA 1UAIA 3J7LA 4GMP0 4Q4X3 2W46A 2VZSA 2PN5A 4M0NA 4DRVA 3NAPC 2DWRA 5CFCA 2RS11 1RXGA 2VH9A 1YI7A 4XHBA 5FLJA 3RG0A 1JN2P 4AEKA 2JE9A 3PNAA 1QH7A 2ZHNA 1XNKA 3LPFA 1PVXA 4NRQA 4D7TA 4QX5A 1C1LA 1UKRA 2MPFA 1OLQA 4B4RA 3HNMA 3QBQA 3ZYBA 2C1FA 1RUG3 4AQSA 4FOYA 2P17A 2R071 3BOWA 4XJ8A 3P5BA 2V72A 4LO8A 5I0SA 2VTFA 2YG0A 2Z79A 1UU5A 5DAWA 3EBRA 1OKOA 2WZR3 3AB0A 2G4IA 3LFMA 4K20A 5J98B 5FZ1A 3LD8A 4CDXB 5JPNB 2ETEA 3BGAA 5FREA 1W8HA 4UFJA 2JX9A 1D2QA 4I09A 1XE0A 3N9NA 5FZ4A 1WBFA 5F9TA 2VMEA 4Q8LA 4XJWA 4GH4A 1S0GA 2D6KA 1NQDA 1R1A3 2D3SA 2IXCA 3NV2A 4F7ZA 2GNDA 3GBFA 1W6QA 1AL21 3KVAA 4LMFA 2VY0A 2FDFA 1DF0A 2ADEA 2E32A 3CDZB 2G19A 1KJLA 1V6IA 4BQ3A 4ES8A 3B5LB 2QTWB 3SLIA 3ST7A 2YFZA 4ITCA 4FTBA 2WWUA 3U10A 3IN9A 2R072 1IPSA 4PQ9A 2PMWB 1OFSA 4JKKA 1RHI2 4N7IA 5FMBA 3WF4A 4AVTA 1LB2A 2C0ZA 5A7PA 3HQXA 3M4FA 3NAPA 4XUQA 3TN93 4M3CB 1REDA 5FYMA 2RG4A 1FMD3 2JWPA 4BXSV 4MADA 4Q4W1 5A1FA 3I3MA 4DRRA 1SCRA 2D6OX 4UAPA 2CAUA 1S1AA 1HB1A 1ZRRA 3DXTA 4C1XA 4YG0A 4OQ9A 1MACA 1OD5A 4JQTA 2Y38A 2WO7A 5F37A 2H6CA 2E33A 2ZACA 1HRI3 1HXS1 2B9VA 3ABZA 4GWMA 1M06G 3OSDA 1COV3 4TYSA 4JGZA 4MUVA 2IVJA 1FPN3 2PELA 2VXRA 2W95A 3LWCA 3OEBA 3V64A 1ZVFA 4CXYA 3QACA 2JECA 3GM8A 4FT8A 4D6QA 3K3NA 5EFUA 3LEIA 4QQPA 3U4SA 2XB6C 1POV1 1SG3A 3BU7A 1AR62 4GWNA 4G4FA 2D3PA 4OI0A 1QHDA 4LKSA 4RSUA 2UWCA 4WM8C 1QF3A 4Y22B 4Q4W2 5C6CA 2FDKA 1QNWA 3NNLA 1H9WA 4QPWA 4WM7A 2KM2A 1QMJA 3BOPA 1O7FA 4I0WB 3VZJA 1CESA 2DU1A 3KMHA 4IEXA 1WLWA 1FNYA 3MO4A 4Q5OA 3POWA 1SACA 2NYYA 4DQAA 1PO11 3WZ1A 4FOQA 5AC93 2BBVA 5FZ9A 1LHUA 1HV0A 3FBYA 2ZCWA 2PLV3 2W1SA 3KQRA 2FHRA 4IQPA 5FPBA 3UNPA 1XU1A 4XBNA 1QJY1 1F4HA 2JEMA 1XNCA 5A32A 3BPSA 1W99A 1MS1A 2WO3A 1X8MA 3CQOA 5EP9A 4OLLA 1X82A 1NZIA 4XJZA 2GC0A 1PM4A 4BQ1A 4LNVA 1T6GC 2WFPA 2XJVA 1WW4A 4N9HA 4YG3A 3R05A 4PQQA 3RJRA 5E16A 5JAXA 1V0AA 1HB3A 3BODA 1ULGA 2C9KA 1WMEA 2WLQA 2F17A 5H9QA 4XCBA 3OJBA 2OT7A 2PHLA 4JDMA 3TAYA 5JOZA 1Y43B 1YYNA 2FDJA 4A44A 2Z69A 3OYWA 1N1SA 2VW0A 2YFUA 1KITA 2XXZA 3JZVA 1AZDA 3M1HA 1C28A 4O65A 1PO12 4Q4Y3 4XIOA 4CEWB 2X5IC 1ZNPA 3HIFA 5IWFA 1KGYA 4PIYA 5D2AA 1HRV3 1MEC3 2P34A 4HN1A 4WM8A 2OYZA 1QJY2 3MIEA 2WWSA 3ZX7A 2V5DA 3GZAA 4IE6A 3TEWA 1OI6A 1VAMA 5GKAC 2R061 1LOFC 2KR2A 2RJLA 1G6NA 1UZYA 5E89A 5F6LB 3DPRB 3BIWE 1W2TA 5ABJA 2VOTA 4XPVA 3D82A 2QQUA 5FY8A 3ZVXA 1PK6C 4MGYE 2YV8A 4QGMA 3M2MA 4NIHA 5FZCA 1JZ7A 1DQ4A 5G05L 4N9IA 4HT1T 5AVPA 1S2KA 4F3JA 5B4NA 5HXMA 4AHWA 5FUNA 4IESA 1QOSA 2QZ3A 4ARYA 2FDGA 3R4SA 1GOFA 4PIZA 2XVKA 3OPWA 2JDYA 3FFQA 2E53A 4HOOA 3A0KA 1XNBA 3IMNA 3LIGA 1DP0A 3JQWA 4AI9A 4LKFA 1HN0A 2GZWA 4MXVA 5IVJA 5K7PA 4K8RB 4EROA 4C1WA 3HNBM 4E8DA 1AX2A 3T0BA 1WUVA 2R062 3SH4A 2E7AA 2XVLA 2DCYA 4RQPC 4KQ7A 4UW5A 3POFA 1IOAA 5E6HA 2VPVA 1XU2A 3THPA 2XWJB 5A3UA 3M3EA 4CDUB 3AKQA 3PU3A 1NG0A 2VNRA 3SKJE 1D4M3 1JOBA 2PAKA 1BLZA 3D3AA 2VZRA 3OY8A 4PJYA 3NV4A 3GZUC 1TE1B 2EXIA 4Y1UA 4K8FA 3OEAA 2P1BA 3H7JA 4QX0A 5A7OA 4YM3A 1L7QA 2RM21 5J36A 2JDUA 2ZHMA 3LAGA 5FPLA 3WQ0A 4AHYA 1DGWA 3L2YA 3DN7A 1XJAA 4KU7A 5F39A 2QJVA 1VBB3 5DUXA 1STMA 4R4ZA 3WDUA 1RJ8A 3K48A 5CA6A 5A7SA 4I3PA 3GZEA 4MXWA 1A6CA 3BTZA 3FLTA 5IVYA 4WVZA 5H9RA 4Z92B 5IUQA 2YDEA 1UZ0A 2J42A 5EHDA 5F5AA 3RZGA 5A6QA 5LA2A 3ZDSA 2NZ9A 3TB0A 3VD4A 3RMXA 3V0AB 3VZLA 2NLRA 4YW2A 2W39A 3SCFA 2BYVE 1YWKA 3AP5A 4CP0A 5J37A 4FP2A 2B39A 1TG7A 4XOGA 2XQRA 4CCEA 2H0BA 2ZGLA 3J7NA 2VU9A 4DINB 5IVEA 3MLKA 1JMUB 4RFRB 2A6WA 1SDDB 4UF0A 3VKLA 4P5HA 4QPGC 2BOIA 2P3KA 4RS5C 4IE7A 5CFCB 5JDBA 3H8RA 3W58A 3PUIA 3ZXEA 4RQPA 2CGOA 2QUOA 3ZSLA 3FJSA 4C0BA 3GXUA 1JHJA 5LB6A 1EV11 3JD71 1N3OA 2Q8CA 3NVCA 2WN2A 4FPEA 1JOJA 4NN0A 2FCVA 2JG9C 4LUMA 4EQVA 4DUVA 1LHNA 4AFAA 1WW6A 4L2NA 2XJRA 1O59A 5T5LA 5SV8A 3VGIA 2JB8A 5ISLA 2MNGA 3CBNA 3IIAA 1DZRA 1IPKA 3HNYM 1RUH1 3MIHA 3P3NA 3Q8EA 1BCXA 4XDQA 3THDA 3OB8A 1VMJA 2ZAAA 3SEPA 3IB3A 1JBCA 2VBBA 5GZCA 2DV9A 4GH4B 3B94A 5IVCA 1OOPA 2ZTNA 1RUJ3 5T5OA 1TEIA 5LA0A 1W6QB 2RJKA 5F5IA 4NRMA 4S2DA 3LSEA 4M4RA 1Y3TA 3KGLA 3HQUA 5HCHA 2VM9A 1JZ4A 1EV12 3JD72 5FZEA 2V73A 1QGLA 1ZBE1 2XJQA 4HLTA 4D8MA 2WA4A 4Q27A 2BVBA 2W68A 3WCSA 5LK5A 3APBA 3MEPA 1YQ8A 1LGCA 2XH6A 2HWF1 3A7QA 1ND2B 1J3PA 4XF3A 5EQUA 2RR11 4YZ2A 4WVMA 1E5RA 4RS5A 4YARA 2QQVA 1YQ2A 5FPUA 1RUH2 4FAGA 1FNZA 2R042 1YLLA 4K21A 3WW4A 1LGBA 3D6EA 1QIQA 3SH5A 4QX7A 1VMHA 1UY1A 3VKMA 4NROA 3CJIA 4BK4A 2UURA 4X6QB 3WNOA 3W20A 3ECQA 1QXRA 1TME1 2JG9A 5LBEA 2C26A 3CLPA 2B46X 5F6KA 3M3OA 2J1RA 3UL2A 2ARXA 4HMZA 4JGZB 1V6KA 1K3IA 2VOKA 3MF6A 2UY8A 2Y34A 2J1EA 1ZBE2 2VULA 4DOUA 5LEKA 2GDFA 1OQEA 3J4UH 2B4KA 1DLCA 2HWF2 2WSUA 5GLTA 1C57A 1XE8A 4NO4A 1BKZA 2RR12 3LSDA 4QXHA 4CCKA 4FAHA 4LIUA 1V9U3 4A7YA 3QH6A 1JXNA 2IVIB 5CU1A 2HBTA 1UN1A 1IKQA 5K4LA 4DY3A 1EPWA 1YFWA 4WM7B 1MVQA 2BU9A 3PTYA 1E57A 4HANA 5FZLA 1H2MA 3HMYA 4F83A 1XYPA 1E5SA 1PHMA 1LNSA 1S4CA 3HAGA 4XXPA 4DFSA 4MG2A 4KGQA 5FIXA 4D7SA 4Q4X1 4HG6B 1NXMA 5I0RA 2HEVF 3FUOA 4P00B 2E51A 1LHOA 2PQSA 4PF1A 3N7JA 1J1LA 2BGCA 1YUDA 1VPHA 4YWAA 5DABA 3ILFA 5JSPA 5A32B 3SC7X 3BVCA 4A3XA 4BCUA 4S2FA 4LA3A 3LKJA 3WG3A 3ZYJB 2ARCA 4LKEA 3RGBA 1QNYA 1NA1C 4Y1YA 1F31A 5IAVA 2A73B 2QQKA 1ZRDA 1UIJA 1RUG1 3RSJA 1BK0A 5DUWA 4X8NA 4D0QA 1RUI1 4CEYA 1WA6X 2RHPA 4EJRA 1I5ZA 1ZA7A 1AR93 3K51A 1H0BA 1JUHA 4RR3C 1O4YA 3O1MA 5JMOA 1EPZA 1YIPA 2WZR1 3OYWB 2W52A 2JG8C 1HIXA 3OD4A 2EIEA 3FE5A 4QHBA 5DUUA 5FXWA 3UYJA 3ZPOA 4PBPA 4PCRA 1S0IA 4Q4X2 4Y4YA 3VBUC 4L9BA 1XB9A 4LITA 1ULEA 5K0UC 1S2EA 4MGIE 3RRDA 5BNOC 1W90A 3A22A 3B69A 3C8XA 4IEWA 5A7WA 1R1A1 1SDWA 1DQ5A 2K0GA 4GMP3 1W8UA 1YO8A 1C1FA 2AH2A 1W05A 2R0FA 4IXLA 1W6PB 4B7EA 1QDCA 4G3YC 4UI9L 3OTFA 5ABJB 2IUWA 1RUG2 1N1YA 2D5HA 2ZEYA 3D0JA 5F3GA 1BMV2 3KB5A 1RUI2 2GSYA 3AKTA 1O3SA 4NHLA 1LCLA 3AJZA 3CZUA 4NAMA 1RUC2 4IV1A 1FMD1 4GB31 3T4VA 1B09A 5FYSA 5FY1A 2WZR2 2DURA 2VMIA 4KH9A 4W65A 4CUCA 5IAXA 3AP6A 3J9SA 2GALA 2A71A 2J7MA 3VZKA 3MF9A 1A8DA 3RZMA 3LF7A 3BUCA 2EIGA 2HWC3 2JDNA 2ZHLA 1NA1A 3KLSA 5IVBA 5FFOC 3DF0A 2QQMA 2VO5A 4UBGA 4CUAA 3KS7A 3WNLA 1HRI1 4YSFA 1R1A2 2VG9A 4JTOA 3USUA 4CU9A 4OI1A 4Q8KA 4DS0A 3DXUA 1COV1 1X33A 1RVF3 4YW3A 3URFA 3ZXKA 1RIRA 1UPIA 2PQQA 2ZGUA 3I8TA 4AI3A 4AVSA 4FI9A 1FPN1 3I3DA 4RR3A 2VZQA 3IDBB 3WX5A 2D6NA 4YZ3A 5FYVA 4HKWA 5G04L 5T54A 2JG8A 2VW1A 5EJ1B 1UY0A 3RS6A 5FWJA 1RC6A 1DQ6A 1ZA4A 2OX0A 5FYZA 5LY2A 3OY8B 2XHKA 3WY6A 1JZ5A 2X53S 4CP1A 1OKQA 3O12A 4Q0UA 1Q8SA 1CWPA 5L9RA 2YUEA 5L9VA 1FMD2 2QCSB 2RS33 2YB7A 4GB32 4QDQA 3VDCA 2WUHA 4DO0A 1UOBA 4N43A 4YZ5A 2VNVA 3W9AA 1NLRA 2DCTA 3O5SA 3VB9A 3PMSA 1W9TA 4FTSA 3WF3A 2FQPA 1AYM3 4XAEA 1ULOA 3EQEA 4NMIA 1DIWA 1HRI2 1LU2A 2YU2A 1NUKA 5JZGC 3HT1A 5HPOA 3N9PA 3U1XA 2EA7A 3T1MA 4AK3A 4DXRA 1YQ6A 2PLV1 5A3LA 1QEXA 2RS53 3IM0A 3MYXA 2SBAA 3J26N 1OBNA 3SITA 1YEWA 1QU0A 3K46A 2QQWA 1AXYA 2JE7A 2P6CA 4NHMA 2GMPA 1O4TA 4GKYA 3WNMA 2BZDA 2GMEA 1W9WA 2NM1A 1QJX2 1FV3A 1W2AX 3T1LA 4P02B 1A3KA 5A70A 4QPIA 1NCRA 2ZGTA 4UF0B 2VMHA 1W8FA 3K77A 2P6HA 3MZHA 2PHWA 4CDQA 1S0EA 4RQPB 1H2NA 2W2IA 1MS5A 4MVTA 4QKBA 4UWDA 1SLBA 3ZXAC 1GNZA 1NOVA 4P9LA 3ZSJA 5F3CA 1GLHA 1S0BA 1SQ4A 3H8UA 1LOGA 4Q4Y1 5FZBA 4AAXA 1I1EA 4TZDA 1JYCA 1D7PM 5FYTA 3U78A 3TEZA 2WINB 4AHZA 2AGSA 1HRV1 1MEC1 4YGBA 4PLNA 2VBPA 1HQWA 3ACGA 4KGGA 1LEMA 2ZGPA 1B35A 1V6LA 1F2NA 1RUE1 1JYXA 3ACLA 2BFUS 3KCXA 1UW8A 4MGSA 1S0FA 2VE1A 4XILA 4R9CA 3T2OA 1MS9A 1IZ3A 3WDVA 1ZBA3 5FOBB 2D6PA 1EUUA 3C7HA 1YC61 2VW2A 3SEEA 5JZGA 2BP6A 4LKDA 1YCIA 2RDQA 4OMDA 1OOPB 2K46A 4K7JA 3MV11 3D0SA 3KT1A 1LENA 2WT1A 4OQ8A 3ZFGA 5JVVA 3EHKA 3W5NA 2WABA 3ZN4A 2YC0A 1GZCA 2QZ2A 1Q3EA 4Y5SA 4JKMA 2GP5A 4O9EA 4B8EA 2HWD1 1IQAA 2J1VA 1H2KA 3AL5A 1M4WA 2XWBB 3HBKA 1U5XA 4Q4Y2 5A7NA 5T5JA 4AAPA 4IV3C 4EN7B 5BUVA 3I2KA 5JOXA 2A3WA 1HRV2 1MEC2 4YGEA 5JSRA 2P4EA 3JB4C 2UWAA 2HWB3 1CJPA 1UOFA 2C6SA 2YC4A 4O61A 4WVMB 4RS5B 1UOJA 2PHFA 4FFGA 1RUE2 1K5JA 1VRH3 3FL7A 5FP8A 4E2QA 3ZR6A 3VUOA 2AENA 5DQ0A 3KHBA 1GSLA 4Y1XA 4DUWA 3CJIB 2D98A 4OHXA 5FQ0A 1LAJA 1GKBA 4QU1A 1D4M1 2TEPA 5KBFA 2CU5A 2Z5WA 4LTAA 3BIEA 2JG9B 4H55A 3K2OA 2Y0IA 1RGSA 2JB4A 2N7GA 5FY5A 3FFZA 2GN7A 5CADA 2FDHA 2A7AA 2VR4A 5FO9B 2HWD2 1F8VA 2KA3A 3BU0A 4ONUA 1VBB1 1PM7A 1XNAA 2VAUA 3EXUA 3H50A 2TBVA 1YFXA 4AFBA 1KS4A 1PX3A 4XF0A 1NLSA 1K5MC 3ZYRA 1GZWA 3FHIB 3N7MA 3NJYA 5DZGA 5FPXA 3P6BA 4Q1RA 2W0XA 3MICA 1ZZCA 4RFT0 2RDNA 2Q8EA 3IDEA 3BTAA 1W2UA 2BFUL 2DYCA 2DVDA 1VBE3 2ZMKA 2YBSA 4OZOA 2Q8OA 1D4M2 3GJAA 3MDPA 5DDJ3 2I74A 1GU3A 1I6XA 1UY4A 4LHNA 1E5HA 4QHZA 4ZY9A 2NN8A 3JXSA 3JBG3 4PLMA 5C70A 3VZOA 2C24A 3INAA 4N53A 2ORZA 4AEMA 2CY6A 3T08A 1VBB2 2Y26A 3LQCA 2RV9A 4TLGA 1YIFA 1RITA 4O7XA 2WNEA 3N4MA 4AL9A 3S7IA 4JZRA 3I7DA 2IXKA 5FCCA 4CCLA 1RUF3 3J7HA 3GJBA 4ZU7A 1BQPA 4FOVA 4UFHA 3AK0A 1KDKA 4DPNA 3AZXA 4CEYB 4CP9A 4HXCA 2PA7A 4LO7A 5A7QA 2W87A 1POV0 2ZOEB 3VBRB 2A1XA 3I2OA 2QQIA 5A6YA 5CFDA 1LULA 5FZ3A 2C5DA 3ZIWA 1K5MA 2WQZC 2YXSA 5FJKA 1W0NA 1QXPA 4AG4A 4CYDA 1SFYA 1LHWA 1F35A 2PHUA 4UW4A 5LASA 5A7WB 1HV1A 1PZ9A 3GBWA 4QGLA 4CSWA 1RUJ1 2KXLA 2MEV3 2OQ6A 4Z82A 2ORXA 1AXZA 4YVWB 1UZZA 4GALA 1AX0A 2Y6LA 2ZX3A 3OPZA 3AM2A 3B02A 2DDUA 4E4HA 4AW7A 5KWRA 3VKNA 4OI4A 1LOBA 4QMAA 1GOHA 2JKBA 4QQLA 2NP0A 1PVC1 4V2WA 3OUJA 4Y1ZA 1NQJA 3MFCA 1RUD3 4B3NA 2WZPP 4YVSC 2RDSA 1CONA 1UMHA 4IV1B 4LLFA 1O8PA 4AOCA 1LECA 3WNXA 4BLJA 2WNOA 4IETA 3ORJA 1PO23 1UPSA 3CJXA 4CUBA 4NIAA 1NLQA 1ND3A 3LDBA 4A41A 1MQTA 3POEA 1QQP3 1C5HA 4YW5A 1S0JA 3WP6A 2RS12 4CCMA 2ZX1A 2AACA 3FZ3A 4BE3A 3USUB 2GMMA 1G9CA 1RUJ2 2VZTA 3U75A 4XZUG 1TMF3 2O14A 5EJ3A 1IPJA 4LOSA 4MHRA 4RN5A 3VBHA 4P9IA 1I5PA 4KBBA 4RR3B 3ZYPA 2OW4A 4NHXA 4IEYA 1OF4A 2AZ5A 4UYBA 1PVC2 1REFA 1OQDA 1DU3D 2BJSA 2K9ZA 4JDNA 2G9ZA 5KR7A 4AFMA 4YM1A 2BNOA 3VLBB 3G6JB 4P9YA 1V9U1 3U37A 2LALA 3B9IA 5BY5A 3FHAA 3J8F3 4N43B 4QXKA 3QOPA 4XJAA 4UOJA 2F4LA 1QDOA 3AXDA 3WINE 3WOGA 3ZOIA 3A4UA 4QX3A 1R083 4COVA 3WNKA 2OIIA 5LWBA 3TEXA 4EWAA 2WN3A 1AL22 3SCHA 1G9FA 1KEXA 3ZPYA 3D4KA 1ZZ9A 1CR7A 2A6YA 4Z07A 4BIOA 5IHRA 2XKPA 1DYKA 1JYVA 3ZDVA 1HB4A 1WKYA 5T5PA 3I4IA 1G9BA 2ZAHA 4L11A 1W03A 2DVBA 1NE6A 2E7TA 2CGPA 2ZX4A 4Q0VA 1JU4A 3MIGA 4Q4V3 4XFCA 4BZ4A 3OBAA 3I2JA 4LJHA 1QOOA 4E8CA 3WDTA 5C3PA 1V9U2 4LBQA 2HWE3 4MX3A 3PL0A 4RGKA 4QPIB 1NCRB 4AI2A 3WP5A 1AR91 4BU2A 2G1MA 1MS3A 4FXGB 1DGWX 4K40A 1MVEA 3GCWA 1W6NA 2BEOA 4QDRA 5LBBA 4CDQB 1HLCA 1Q56A 2CNAA 4KG0A 5FRAA 4MOAA 2D40A 4AI8A 1HXS2 5BNPC 2DVFA 3ELNA 5DG1A 2IWGB 1H6XA 3GDBA 2ZGQA 3HPNA 1JU3A 1ZREA 1R1ZA 4PI2A 3H7YA 5GLVA 4A4AA 3WHTA 1EAH3 5B2GB 2CTVA 3IKWA 3AMHA 4XDOA 3VBFC 4GMP1 1B35B 1KXGA 5JOYA 5IK8A 2ES3A 3Q9OA 1OA3A 3WEZA 2BDRA 3NNGA 2IC1A 4LXLA 3MPPG 3MGUA 1JYWA 1WBLA 1V6JA 5JZGB 3BYWA 1N3PA 4ARXA 3PU8A 1U0AA 1W9FA 1H6YA 4P5YA 1AR92 1GICA 2ZBJA 3OG2A 4MGTA 2B45X 3ZFGB 5FLHA 5CEHA 3WW1A 2OUJA 4WV8A 2NPIA 4Y33A 3POGA 4Q0PA 4DB5A 5LY1A 5F3IA 4AEDC 1VBA3 1SFNA 2WO1A 1HJFA 3H3UA 4Z1VA 1ST8A 2HWC1 3H1YA 4DMIA 3UK9A 4MLOA 4S2HA 3HVDA 5KC5A 5DN2A 1SCSA 3L9JT 3MUY1 1Z0HA 2WO2A 3ZKUA 3WW3A 3ZFFC 1DZQA 1FI2A 2Y6FA 4QB1A 3ZYGA 5DAXA 1POQA 1O8SA 1RVF1 4JRLA 1CPNA 2E9QA 2XL9A 3PJYA 3IDAA 1N3QA 3KM5A 3LA2A 1CZSA 3O1UA 4JKLA 2E7QA 1PZ7A 2UY9A 3PUHA 5C8WA 5FQ0B 3K75B 1DYPA 3I2GA 2VZUA 4ZS3A 5FY4A 4ASMB 5BNNC 3O1OA 3UKVA 1W3XA 2GC2A 2JKXA 4GJYA 4AGVA 1TNRA 4SLIA 2UYAA 2FBEA 1W06A 1UYYA 1W2OA 3MBWA 3WQ1A 5C4WC 1KS5A 2C9AA 4IE0A 1W2NA 1JTZX 4B29A 3GCXA 1HN1A 2Y6KA 4CDWC 2HWC2 1J83A 4E4ZA 3H3ZA 5J3UA 2WFF3 1AYM1 5BNQA 1UY2A 4XCAA 2BGOA 2B7YA 1OLMA 1GZWB 5JUVA 3NJXA 1K12A 3ATGA 4OYUA 2YU1A 1JOPA 1MS0A 1RVF2 5FYHA 4HVQA 4C91A 3VZNA 1BBT1 2RS51 2Y6GA 4PDWC 1OHFA 2DCKA 3AL6A 3N7LA 3MUZ1 4EE2A 2EAKA 1GP6A 5FZFA 1I9RA 3UJOA 4AEDA 1Y7BA 5I8TA 2X5IA 3ACIA 2LROA 1W39A 2HEYF 3I2FA 5FYYA 1VBD3 3VHPA 2PXJA 4NVPA 1PMJX 3A0NA 4K9SA 5FPAA 3ZFFA 3I2DA 3D8CA 3HJRA 4HZFA 3LDKA 1LOFA 4N53B 4AWDA 1Y9GA 1XPWA 5FZAA 3IIIA 4Y3OA 1Z7S3 5L19A 1XOYA 1NZCA 3I3BA 4IW3A 4CPBA 1O3QA 4LOTA 3ZN6A 1PK6A 1AYM2 4PT6A 4EYUA 4LT5A 1X7NA 4LK7A 2ET1A 1AR73 1UF2C 1UOGA 3OGRA 2HYXA 4BWOA 1BVP1 3O1PA 4FPOB 3AZVA 5J09A 5JR2A 1OPOA 3QCWA 3V0BA 3FUQA 4QPYA 1K42A 1BBT2 2RS52 4CP9B 2QQLA 1YHFA 3JCIA 1QJFA 5E8AA 1OLME 1AVBA 1LKNA 3W5MA 1J3QA 4CDWA 4FPYA 4S2GA 2P5BA 1Q8VA 5BV6A 3O1SA 2WZEA 4IGPA 3KD4A 4QD2A 3ZSKA 1ZBA1 2B9UA 2RM22 4LHLA 4OI2A 3ZM8A 3VBSC 4Z2WA 2DBNA 5CFDB 3NSTA 1K5MB 2RDRA 5C3RA 3FLRA 3VDDC 1O5UA 4BIFA 3VBOC 1JUIA 4CVUA 4XFBA 4NRPA 5GZFA 1U5YA 3I2HA 3UESA 3WSOA 1JZ6A 5C8CC 1IG3A 3PVBB 2VZOA 2A75A 2W1WA 2WA3A 3I97A 5FTTC 2HEWF 3UKNA 3ZXJA 3C7GA 3HR9A 3Q8CA 3OUHA 5DZEA 1VBC3 1PIV3 2GNMA 3WP4A 3WQ7A 2QQJA 5C9AC 2CDOA 1CX1A 1APNA 3H1MA 1XXNA 1LGNA 3C3VA 4U2AA 4CZSA 4XMAA 5FOJB 1JHNA 4QXCA 2LS6A 1UZWA 4I2OA 2HWB1 2YMZA 2Q1MA 4KWJA 2D5FA 3NJVA 4QXBA 5FBJA 5BXXA 3P3PA 2DTYA 1VRH1 4BA6A 2GC3A 1FOD3 1H1IA 1EP0A 1GFF2 3FLPA 2EXKA 2VL4A 5H9SA 3UKTA 1ZBA2 1ND3B 3AKSA 1UO9A 3VZMA 1MQTB 5JXJA 2E31A 3HOBA 3THCA 3RZLA 2WDBA 2DVGA 3B00A 1RMU3 2VECA 2X09A 1UYPA 2ZGSA 3KV5A 4PLOA 4FFIA 4AYUA 2OXBA 3VBHB 3I3QA 3ETPA 5DAVA 2EF6A 1MR5A 5A6XA 3FWEA 1WLTA 4IUGA 3BALA 4E9KA 1GQGA 4GIQA 1DZTA 2EXHA 3AVSA 3VBSA 1C8M3 3NAPB 2ZEWA 1J59A 2WNUC 1PZ8A 4QPGA 2HWB2 1C4RA 2D97A 2OS2A 3VDDA 3LGRA 3VBOA 4COWA 4CA9A 1GP4A 1VRH2 4NUBA 4R9DA 5EXOA 5LEJA 1FAYA 4E4SA 1AYN3 4CE8A 3QLQA 2D3RA 4RA0A 4BQ4A 2FZ2A 3M3QA 3AFGA 2OQ7A 3OPTA 1Q5OA 4SBVA 5C9AA 2V4VA 5A80A 4NOTA 4N90A 5DDJ1 2E63A 2B8MA 4L0PA 3SMHA 1RHI3 1A78A 5IFTA 4BHPA 4CU6A 1DDLA 3JBG1 3LIHA 2X29A 1DFQA 5CB7A 4CXWA 3R6SA 1DBNA 2WLPA 4NPMA 2W47A 3MLJA 1G9DA 1CIWA 2FDIA 1T6BX 4LBQD 1ULCA 2HJIA 3UGGA 4P9WA 3MV01 3POIA 4ZPIA 3TOJA 1XC6A 3AKRA 2IFWA 3LA7A 3PIJA 5FZKA 5D8AC 5JIAA 1UY3A 4LBQB 1UU6A 3DGTA 4YZ4A 1P8JA 4LIVA 1SLIA 5I93A 2I2SA 3LPGA 1VB2A 1W6NB 4LBOA 2NMOA 5JPMB 1TME2 4KL1A 5DDJ2 3MLLA 1OF3A 1WCKA 4BB3A 4XFHA 2VCMA 5IFPA 1HX6A 1AR63 2YHJA 5L73A 1WMDA 3JBG2 4KU8A 2AEZA 3OBRA 3WNNA 3ACHA 2MEV1 1KFXL 4XACA 4AQTA 4LE3A 2A6ZA 1SLTA 3WF2A 1PX4A 2FMYA 4MGQA 5EYXA 5FV3A 3BKZA 2R7EB 4FTEA 3PIGA 4BQWA 4XZPA 2ATFA 4I30A 1C5IA 1PGW1 2XG3A 2BWCA 2H6BA 3CU7A 1H1AA 2A3XA 4W50A 5F8PA 2JDPA 1FT9A 1RUD1 1U5IA 3Q8FA 1BEV3 4YLZA 4AVCA 2ZHKA 2WNVC 4KMQA 3LZZA 4Y4RA 5CISA 4HVRA 5FZGA 2WL1A 4JV4A 2O8OA 4ORFA 5KHJA 5T50A 4LHSA 5BYNA 1PO21 4Q29A 4CDXC 4XTMA 3AFKA 3CHXA 1DQ0A 3OGGA 4K1YA 5HV4A 2EAAA 2BTVC 4FOWA 2OUHA 1S2BA 4WM8B 4I01A 4OHWA 2ZPXA 2XJTA 2XUMA 3NV1A 3KVBA 3SNMA 2VCCA 3MW3A 4UFLA 5A3WA 3I59A 3SQOA 2JD4A 3UJQA 3T2QA 1U5ZA 1OVPA 1L7RA 4QX1A 5J48A 3LOIA 3GBGA 4DXSA 1DG6A 3ES4A 4YM0A 1XE7A 1YJKA 2PAMA 4Y26A 1PGW2 1V70A 5F2SA 1R093 4IEZA 3LOBA 4XIKA 1IS3A 3JB8A 3S5QA 3TN91 1RUD2 1Q8PA 1C8NA 2CSGA 3K4AA 3M8LA 1OVSA 2XMLA 4BLIA 1KRIA 2P37A 3T30A 1AUYA 3VDBA 4KWUA 2DUQA 3KCCA 3J8F1 1PO22 2R32A 1H4GA 1WMXA 1A34A 5FXXA 4XF1A 4QAWA 1R081 1JZ8A 4P08A 5J7MA 4QU2A 1VJ2A 2JDZA 4BQXA 3LEGA 5IW0A 4H3WA 2WQ4A 2IXHA 4FFFA 1QJU3 5FAXA 3DKQA 3EO6A 3ILRA 1NXD1 2WNVA 4I0AA 4YFZA 3ASIA 1W04A 5A6ZA 1AR83 3DUIA 4AEDB 4LO4B 3FBMA 3VBUA 1PMIA 2X5IB 3T2PA 3PUQA 2W9XA 5K0UA 4Q4V1 1RL3A 4IDZA 5EYYA 1GUIA 3TN92 3RVHA 5BNOA 4JGYC 1VP6A 5LK7B 2YGLA 5FDBA 3ZFFB 2HWE1 3H1WA 4CPBD 5L7OC 4EN8B 2W1QA 4AF9A 4ATEA 4XFFA 1WW5A 1OH3A 2VMFA 3J8F2 3ZO0B 2A6VA 3KF3A 3CMGA 2AR6A 1R082 3OBTA 3PMEA 3ZN6B 1PK6B 3N36A 4MXWB 4NPLA 1JH5A 4HPKA 3T3YA 4J6GA 2ZMNA 5AC91 1COV2 3LDRA 2JD9A 2P2KA 1XNDA 1FPN2 2W92A 1EAH1 2PTMA 3V0BB 2XBO3 4XYXA 2DBIA 4XTPA 5FPVA 3S57A 5FYBA 2QFEA 4GKXA 4K1ZA 2XLFA 4D94A 3T0DA 4MGKE 4QKDA 1GWLA 1IHMA 3K4ZA 2FCUA 3OGJA 4IE5A 5C3QA 5CG8A 1XSRA 3D5OA 4I0BA 4Q4V2 3GGLA 1AX1A 4AI0A 4Q26A 4RGAA 4XJUA 1TZOA 3F95A 3ZN5A 1F4AA 1MS8A 2HWE2 1UKGA 3AP4A 2D93A 1OA4A 4D69A 1VLNA 4FCAA 1QKQA 3RYKA 1GMMA 3P1IA 4H7LA 4JDOA 1W8ZA 4FPJA 2WT0A 4OUMA 4OUSA 1XRUA 4LQRA 2W3JA 2QDRA 5FY9A 5TSWA 3ZYFA 1F5FA 3LA3A 1VBA1 4PF5A 4F8AA 5C3SA 1JYIA 1GNYA 4DXZA 2J22A 3N9OA 5AC92 2VC9A 4CEWC 5FO8B 2PLV2 4META 4CRQA 2VQ0A 1C3HA 1X9TA 3R0RA 1ULPA 4JGYA 1EAH2 4MHUA 4MGZE 3OGVA 4X6RB 3S7EA 3E6CC 2ENRA 5L7OA 1DQ1A 1OXCA 3VKFC 4XW3A 3KHCA 4FPLA 1SLLA 3UGHA 2IZWA 4XUPA 1GWKA 3ZLIA 2BV4A 5GLUA 3T09A 3AYDA 3SISA 1O3TA 2DVAA 2G9FA 3RNSA 3TWIA 5CIRA 1WMFA 1RUNA 2VVEA 2XVGA 2TNFA 3H3LA 4BXFA 3OOXA 1W0OA 2A6XA 2XR4A 3MIBA 3WG1A 3DV8A 1BZWA 5JOWA 1V6MA 3DCQA 4U36A 2I45A 1T2XA 1VBA2 1X50A 2W08A 2Y6JA 2BOJA 1VAVA 3WCRA 3GALA 4V1PA 4COUA 3VBSB 4FSJA 1IGOA 4UFMA 3CEWA 5A3TA 2K2SA 4XUTA 5T3NA 3VDDB 4QPGB 2O0OA 1V6NA 4QX8A 1HB2A 4E27A 3KT4A 2B5HA 1GZTA 3PVOA 2JIJA 4INDA 2PHRA 3IPVA 1OH4A 1WCDJ 5EJZB 3JD73 4CDUC 2RE9A 1GV9A 2DU0A 4URTA 4WVVA 3ROUA 3NNMA 4B7KA 2EXJA 2TUNA 3BTYA 1F5JA 2YZ4A 2GC1A 1KDMA 1NYWA 1AJOA 2XJPA 3M7AA 1AF9A 3NJZA 2R6QA 1AXKA 3H0OA 5C9AB 2YROA 2EIBA 3T0AA 1QJZA 5JLVA 3IAPA 2JICA 2Y60A 2OPKA 3FMGA 1TNFA 2YBPA 3RI9A 5FXZA 3E5QA 5C7GA 1IS6A 2R043 4EWEA 1Z7S1 1MZ6A 4PIXA 2Q1ZB 1NX9A 4HN0A 5HV0A 4GQ7A 5FMOS 4YW4A 4YGDA 4BISA 2XPJA 4NR1A 1MZEA 1CAUA 1AR71 1XYOA 3L2HA 2LUWA 3W59A 2DCJA 4Y20A 4XDPA 5JI7A 4YPJA 5CKNA 1IS5A 3HT2A 1ZYBA 2VUCA 2P3IA 5F1RA 4IV3A 3BI3A 2KD7A 2ARBA 1XNTA 5FK7A 2Z42A 3WG4A 4BDVB 1YNAA 4YG6A 3H8OA 1FXZA 4NE9A 3MPBA 4DZGA 3AZZA 4E2GA 2VBDA 2XUEA 2WRAA 3GNEA 1Z7S2 4EZHA 2EVXA 1LR5A 5M0TA 4RHV3 4BOWA 1OFNA 5K8SA 3WXPA 1HKDA 1FX5A 1AR72 1OLRA 1W8OA 4FPGA 4R52A 2HLEA 4HKOA 1OPMA 1PIV1 1VBC1 2HBUA 2W5FA 3WHUA 4KBZA 2BBAA 2J1AA 4Q2FA 5F7UA 3RYRA 5JXHA 4NHKA 3S6PA 2ILMA 4LE4A 2VQUA 4JAAA 5CKQA 1FOD1 3TBDA 5ANNA 2JE8A 2VOXA 3ON7A 1G8WA 3OBZA 3SXWA 1A8MA 4DUXA 3NKTA 3V65A 1KD7A 1E5IA 2YGMA 4FQ4A 4GH4C 4FPCA 2X05A 3WG2A 3WNPA 3O1TA 4UT5A 1MZ5A 2V5YA 1RMU1 2ZZJA 3AX4A 3AYCA 3I59B 3JUUA 2LW8A 3NV3A 4UW3A 4YYOA 4OHYA 2WC2A 2LRPA 1F15A 4QQOA 4E2SA 1UXXX 2XONA 1AJKA 3LCPA 3E6DA 5JI9A 1JI6A 2DFBA 2XDVA 4P14A 5FMOL 5CNAA 1VBC2 1PIV2 3CO2A 4P9GA 5ANQA 2OKXA 1Z78A 2DUPA 1S0CA 1PGSA 3NNFA 4FFHA 5J1XA 3HD8B 3ZMOA 2Z2SB 1CQ9A 4GZ9A 3MIFA 1C8M1 4RGGA 1ND2C 2Q1FA 1NAEA 3VKOA 3WDXA 4DNYA 4AZZA 1CN1A 1OMIA 1UZVA 1GQHA 4HBNA 5FYCA 5A3MA 3EB7A 2JDHA 3O1VA 1BYHA 3DYPA 1LESA 1LOCA 4ISRA 5DMYA 4COZA 2DCZA 1FOD2 4PI0A 5F32A 1AYN1 4R9AA 3QH7A 3U4XA 3FN9A 1NA1B 1WCQA 4BJ0A 3CKHA 4H7MA 4P9JA 4WBBA 4Z8BA 2VQTA 2ZXQA 4LBNA 1LEDA 3CF6E 5E1RA 1RMU2 1RUI3 2I07B 2ZGNA 3S5AA 5FMDA 1W9YA 1RHI1 1NE4A 3ITQA 3PURA 4JGZC 4JQRA 5I0TA 3RZZA 3RQ0A 5A3OA 4XFGA 2WNVB 1RUC3 2UU8A 3KCYA 5FZMA 4AGRA 1CZVA 1UL9A 2JG8B 1JODA 4I3GA 1DCSA 4HK9A 4QKNA 5GLZA 3ZXFA 1L3JA 3VBUB 4HFSA 3DKWA 4AHXA 4HK8A 3E97A 2BPA2 4IEPA 4LBMA 5K0UB 1C8M2 5BNOB 5KHIA 1UMIA 1VE0A 2R1BA 2YPDA 4MZUA 2WJSA 1SPPA 3O0VA 1GWMA 4ZU4A 5FY7A 5LRRA 1BXHA 3O14A 1DQ2A 1WLCA 3I3EA 3M3CA 4CCJA 4GWJA 3U14A 4QGNA 4ATFA 1AYN2 1H4HA 3ALQA 3OD0A 1L7LA 4WM7C 3WF1A 5LA1A 2XGXA 1YI9A 4J25A 1NT0A 4AQ2A 4CXXA 4XABA 2O1QA 2UYBA 3ILNA 1RINA 5EPAA 2D6MA 5GZEA 4AVVA 2D6LX 2GU9A 2PHXA 4HPKB 3UT0A 1ONAA 3UV9A 3RZHA 3KT7A 1ND2A 2R16A 3RDIA 4YVSA 1AR61 1ZZ6A 2PHDA 3SH3A 4ZHNA 1O6UA 1PNFA 1FYUA 5FZ7A 4XAAA 4YM2A 4XBQA 4GB33 1LJ7A 4IGQA 2E6VA 2CYFA 4FPHA 4UW6A 4A6SA 4BK5A 4Z2AA 4D6RA 5F2WA 1K45A 1V00A 2VXJA 1EY2A 2IXIA 5GM0A 3EJKA 1GBGA 2IXJA 4CCDA 4XHXA 5DXDA 1WLDA 2AC1A 4A45A 1D2SA 4NIIA 3LEKA 5CVRA 4CP2A 1H8VA 3ZSEA 5LZ6A 5A1LA 4TWTA 1BEV1 1HQNA 1G7YA 1NY71 1BK1A 3Q8AA 2F6BA 3W21A 3FC0A 1WCUA 2WKKA 2VCAA 1ASJ3 4BH9A 3RZKA 2BUKA 3AVRA 5JIUA 2C4XA 3BB6A 4LUKA 2XKOA 1CX4A 5CBLA 1MZFA 3B93A 4CUGA 4YW7A 1JYNA 4KWKA 3KV9A 4JGYB 1QJX3 3BTXA 3RWKX 1VALA 3GZTB 5L7OB 5HBAA 5C3OA 4LPLA 5HCAA 1O91A 4XUOA 4KWLA 4JHZA 2P3YA 2WAAA 3ZFEC 2E26A 2GNTA 3N7KA 1XBFA 2DF7A 2WAOA 5ABJC 1ZZBA 1CAXA 2ZGMA 3HN3A 1TVGA 5FYUA 1R091 4NJ4A 4KG8A 3Q8BA 1EYBA 5C5UA 3VN4A 3KV4A 2QQOA 1MPXA 2VOVA 4LHKA 1BEV2 5FMCA 1NY72 4W6XA 2Z4FA 4D7YA 1HJGA 2CAVA 2YY1A 4UFIA 1Y9MA 2Y6HA 1PGL1 2FD8A 3DYMA 5FK8A 1G9AA 1YQ5A 5EZWA 3GHNA 4XBLA 4FQZA 1QWRA 2J1SA 1ALYA 3F2ZA 3NWKA 4TLFA 4EN9B 2GH8A 1ULDA 1OA2A 3OCPA 4XETA 1ENRA 1OT5A 2CWMA 2WSVA 5IATA 1DGRN 1DHKB 1QJU1 1SLCA 2XOMA 4URAA 4TN7A 3WT3A 1RUOA 1ZRCA 3IPVB 3CNAA 1CZTA 3VV1A 5BNPA 4W6YA 5GLWA 1AR81 1R092 3ZSMA 5EIYB 1IQDC 1GP5A 1ODNA 2VQAA 3WLUA 2RMU3 4BQ5A 1WA4A 1XQNA 4PHZA 2SLIA 2RS31 4CU8A 4LORA 3VBFA 4C90A 5FZ6A 4Y5TA 1PGL2 3N9LA 4I02A 3U07A 2OVUA 1BHGA 4L92A 3A23A 1U12A 1RUE3 5DPNA 3H9AA 2CDPA 3QD6A 2BERA 1VRBA 4JCKA 3ZFEA 1W6PA 3VL9A 4DEQA 1UU4A 1DGLA 2VJXA 1CPMA 4WZFA 3ETQA 4XMIA 4AFDA 1CAUB 4FPKA 4A6OA 4MH0E 2WR9A 5D21A 1JS9A 2EICA 1QJU2 1GYKA 4Y20B
chains in the Genus database with same CATH topology
3X29B 1H30A 4R8HA 1QY4A 2WT2A 4CTEA 2XBO1 5I8SA 1Q8OA 3GYDA 4OZXA 3AKPA 5J96B 1LU1A 3WR0A 1AR82 1W6OA 2ZGRA 2HWD3 3AP9A 4IV3B 2WS93 1BVVA 2BW8A 3TNPB 5ACA3 2RS32 4LO6B 1H8TC 4K3UA 4XQWA 4XFIA 2LTNA 3WW2A 5KXCA 1J3RA 1CD3G 3WP3A 2VVFA 5KXEA 2HYKA 5K9YA 1QH6A 1KQRA 4PBOA 4ASLA 5BNNA 3FX3A 3KZ4C 2VNOA 4IEVA 2OZJA 4FBFA 1WGPA 4Q0QA 4L97A 5C4WA 1GZ9A 1URXA 2XBO2 2FZ1A 1LOAA 4FO9A 4QQHA 4B4QA 4LA2A 2BQPA 5EWSA 1MS4A 5IK7A 2JJ6A 1H9PA 5CG9A 1HW5A 3C2UA 1AL0G 2QKDA 4YGCA 2JXAA 5FPZA 1OOPC 4PDWA 2AREA 4FVVA 5HXVA 2VUJA 2PHTA 1F9KA 4O9GA 4OVEA 2AYHA 1RJ7A 2LM3A 2ZABA 1DLLA 3WD5A 1YFUA 4LLOA 1H8TA 4LBJA 2BWAA 1N1TA 2Q4SA 3SHRA 3DL3A 1ENXA 2ZMLA 3HN1A 4R9BA 4AVBA 5JCTA 3AMQA 4HKLA 5T55A 4JTNA 3CJIC 2XLAA 4AQ6A 2D7FA 2ZX0A 1O5LA 3MIDA 3T2TA 1SLAA 3BCWA 3RPQA 4LBLA 3RJ2X 1G86A 4ZU5A 5I8YA 4HSLA 3R4DB 2ZJCA 4YFWA 5DUVA 2R041 1WD3A 3WVJA 4AVAA 4M01A 4COYA 4HL0A 3RI8A 5H9PA 3CL1A 4AXOA 2RS13 2ZKNA 1UD1A 3ZIXA 1RTVA 2QDNA 5C8CA 2DUOA 4IERA 1VBE1 3AYAA 1LRHA 3POYA 1X36A 2ET7A 3TRSB 2QVSB 2R073 4KNCA 2ZGKA 1PVC3 4HETA 1NCQC 2ZGOA 4Q0SA 4X8PA 4L99A 4XXAA 3M70A 4YVSB 4AI1A 5GALA 1BJQA 4ZXKA 2ZS6B 4MYEA 1LTEA 1IKPA 2CWSA 4BMEA 4RHV1 4XE9A 4D3WA 2WIIB 4B4PA 4K6BA 2UWBA 1RUF1 3B7MA 2XLGA 4YRDA 5AVAA 4MV2A 4LO5B 2B42B 1AL23 3PVNA 2VNGA 1X8EA 2R0HA 2VMGA 4CEYC 5A33A 3MI8A 3USSA 1CAVA 1REEA 1ULFA 1VBE2 2F4PA 4LULA 3VBRC 3V56A 4XF4A 1VAKA 4GULA 2WNUA 3MW4A 3NW4A 1W6MA 2ZKLA 1DGRA 4Q4W3 3U11A 1GANA 2Y0OA 4M3CF 5GZGA 2Q30A 4YVWC 1KJRA 4RHV2 4QT6A 1D0GA 1UCXA 3ZXDA 5I91A 4Y5Z0 2ZX2A 1RUF2 2D44A 3ENRA 1HXS3 2O8QA 2R30A 4DY5A 1CAXB 1NCQA 4YZ1A 1PNGA 4BMBA 2R1DA 2CL2A 4QM8A 4UXAA 2XL7A 1J1TA 2VOWA 4HVOA 4IV1C 5KHKA 1CGPA 1OQ1A 1YFYA 1QOTA 3B01A 4AGGA 1POV3 2JENA 5FBZA 1QQP1 2BVVA 1WD4A 4FP3A 4M00A 3VL8A 5D8AA 2H0VA 1BMV1 1ENSA 2P3JA 2GN3A 2MEV2 1AHSA 5IT6A 4WVWA 1TMF1 4A7ZA 3RWNA 2V09A 4Y1VA 1CAWA 1RUC1 5T52A 3VBRA 5BNPB 3NO8A 2NMNA 1PO13 3ZYIB 1O3RA 3WUDA 1QJY3 4IEUA 2HKXA 3VBFB 5KC6A 4H14A 2A3YA 1SBDA 4OFGA 4YVWA 4N43C 1GNHA 3M3IA 4XF9A 3ZXGA 3KSCA 1QQP2 3I54A 3JQXA 3ZFEB 2IXLA 3AXEA 3AMMA 1TQ5A 3GF6A 5AFEA 3HBZA 1H2LA 1TMF2 2PFWA 4N7UA 3RMYA 5JMCA 4CDXA 1ENQA 2Q5TA 1W6OB 4TSVA 4Q1PA 1J58A 2DFCA 5AFBA 2QNKA 4G9SB 2GNBA 1V6OA 2Q0AA 1H1MA 2X8KA 4NWWA 3VHRA 4EV0A 5KHHA 1CJDA 1XYNA 4QPIC 1NCRC 3HWJA 3IT8A 4P9XA 4XEZA 4AE2A 2R063 3GHMA 3IDCB 4J1WA 4OULA 3O0WA 1Q8QA 1GR3A 4CDQC 1VR3A 4XJ9A 2BNNA 1ASJ1 2ZZQA 3ME2A 3S30A 3AMNA 5BNNB 5L36A 2BNMA 3NKGA 3WV6A 4M3CA 2ZA9A 5C4WB 1QJX1 1I3HA 3WDWA 4IL7A 3POSA 4FPFA 5GJ6A 4ES9A 1YJLA 1B35C 3PLQA 5CAZA 3B9CA 3SCGA 4CDWB 4MSVA 4LEJA 3O7OA 3U0ZA 3IWZA 2QQPA 4PDWB 2PYTA 5F5QA 4UBHA 2YYOA 1BBT3 3ZFGC 5HI0A 2G9GA 3AYEA 4L8QA 1VB4A 1ASJ2 4IEQA 4RL7A 4AEJA 1SBEA 3IBMA 2CGNA 1LOEA 1UIKA 3AMPA 4JC1A 1LODA 2RM23 1W0PA 4Y22A 2A70A 1H8TB 3N3HA 2IFRA 5FLIA 3BPZA 2CV6A 3PHMA 1ZZ7A 4M3CE 3DPRC 1CVNA 4XQ4A 4E4DX 2VVDA 3O0XA 3AJYA 3VHNA 3ES1A 4OHVA 2RMU1 3E5UA 5KXDA 4YNIA 1OSGA 2YPJA 3ZXLA 1IS4A 1ZM1A 3R4UA 1JW6A 4RD7A 5SV5A 5HCBA 5DZFA 1D0HA 1WCSA 2WFF1 4BPZA 2XJSA 3MW2A 2R49A 2OZ6A 2FMDA 5JWPA 3VBOB 1O4ZA 2VUAA 3E5XA 5C8CB 4AFCA 4NWVA 1HQLA 2PAEA 1EV13 5DG2A 1WW7A 2EALA 4CEWA 1LHVA 1VIWB 5JSOA 2RMU2 1SEFA 2WS91 4XQDA 1VBD1 1S0DA 4QQ2A 5I0UA 5ACA1 3PJQA 3NL1A 4WZCA 1UX6A 5E88A 4A2UA 1RUH3 4N53C 3B3QE 2VGDA 1ZRFA 3DPRA 4IEOA 4W6WA 1D4VB 2WFF2 4EWDA 5D1IA 1SBFA 3AZYA 1SMVA 1ZZ8A 1FATA 2GH2A 4QM9A 4LR4A 5JR7B 2AUYA 4NPRA 5A33B 4R4XA 4Y24A 3WUCA 1CAVB 1ZBE3 2ERFA 2QE3A 3E6BA 4BM8A 3ZMNA 2GAUA 2WS92 1VBD2 2HWF3 4C0HA 2WNUB 2RR13 2NQYA 2DTWA 2OA2A 5ACA2 5CFDC 3G7DA 1W6MB 3AZWA 5CFCC 5KXBA 2XJUA 3PVEA 3RYPA 1UMZA 3N35A 3THTA 4EN0A 3TNQA 3JU9A 4BYYA 4CDUA 1N47A 4M0HA 5C33A 4XFAA 5KHGA 1TME3 4FXKB 5HCFA 1KFUL 1NCQB 1HDKA 4HSJA 1ZX5A 1RB8G 1FV2A 1QXJA 4JRAA 3S0MA 2A5ZA 5GZDA 1Q43A 4JVAA 5EV7A 4OHZA 4ISQA 3MFAA 3LB9A 4J1XA 5BPXA 1N1VA 4A7KA 4LBKA 3KGZA 5LRSA 1ND3C 1YRZA 1MQTC 1S55A 4GXLA 5D8AB 3VHOA 2D43A 3AP7A 3TYJA 5FO7B 3WDYA 4GA9A 2MHFA 5IK5A 4EN6B 3V0AA 3VBHC 4ZKTB 1CAWB 1YXWA 1Y9QA 3OF1A 4YW1A 5IK4A 1UAIA 4Q4X3 4GMP0 2PN5A 4M0NA 4DRVA 3NAPC 2DWRA 5CFCA 2RS11 2VH9A 1YI7A 4XHBA 5FLJA 3RG0A 1JN2P 4AEKA 2JE9A 3PNAA 1QH7A 2ZHNA 1XNKA 1PVXA 4D7TA 4QX5A 1C1LA 1UKRA 2MPFA 1OLQA 4B4RA 3QBQA 2C1FA 1RUG3 4AQSA 4FOYA 2P17A 2R071 3BOWA 4XJ8A 4LO8A 5I0SA 2Z79A 1UU5A 3EBRA 2WZR3 3AB0A 2G4IA 5J98B 4K20A 4CDXB 5JPNB 2ETEA 5FREA 2JX9A 1D2QA 4I09A 1WBFA 5F9TA 4Q8LA 4XJWA 4GH4A 1S0GA 2D6KA 1NQDA 1R1A3 2D3SA 2IXCA 3NV2A 4F7ZA 2GNDA 3GBFA 1W6QA 1AL21 2VY0A 1DF0A 1KJLA 1V6IA 4ES8A 3B5LB 3SLIA 3ST7A 4FTBA 4ITCA 3U10A 3IN9A 2R072 4PQ9A 1OFSA 1LB2A 1RHI2 4N7IA 4AVTA 2C0ZA 3HQXA 3M4FA 3NAPA 3TN93 4M3CB 1REDA 1FMD3 4Q4W1 4DRRA 1SCRA 2D6OX 2CAUA 1S1AA 1ZRRA 4C1XA 4YG0A 1MACA 1OD5A 2Y38A 2H6CA 2ZACA 1HRI3 1HXS1 4GWMA 1M06G 1COV3 4TYSA 4JGZA 4MUVA 1FPN3 2PELA 2VXRA 3LWCA 3V64A 1ZVFA 3QACA 2JECA 4FT8A 5EFUA 4QQPA 2XB6C 1POV1 3BU7A 1AR62 4GWNA 4G4FA 2D3PA 4OI0A 1QHDA 4RSUA 2UWCA 4WM8C 1QF3A 4Y22B 4Q4W2 5C6CA 1QNWA 1H9WA 4WM7A 3VZJA 2KM2A 1QMJA 3BOPA 1O7FA 4I0WB 1CESA 2DU1A 3KMHA 4IEXA 1WLWA 1FNYA 3POWA 1SACA 2NYYA 4DQAA 1PO11 3WZ1A 4FOQA 5AC93 2BBVA 1LHUA 1HV0A 3FBYA 2ZCWA 2PLV3 4IQPA 3KQRA 2FHRA 1XU1A 4XBNA 1QJY1 2JEMA 1XNCA 5A32A 1MS1A 1X8MA 4OLLA 1X82A 4XJZA 2GC0A 4BQ1A 4LNVA 1T6GC 2WFPA 2XJVA 1WW4A 4N9HA 4YG3A 3R05A 3RJRA 5E16A 5JAXA 3BODA 1ULGA 1WMEA 2WLQA 5H9QA 3OJBA 2PHLA 3TAYA 4JDMA 5JOZA 1Y43B 1YYNA 2Z69A 3OYWA 1N1SA 2VW0A 1KITA 3M1HA 3JZVA 1AZDA 4Q4Y3 1C28A 4XIOA 1PO12 4CEWB 2X5IC 1ZNPA 3HIFA 4PIYA 1HRV3 1MEC3 2P34A 4HN1A 4WM8A 2OYZA 1QJY2 3MIEA 2WWSA 3ZX7A 3GZAA 1OI6A 1VAMA 5GKAC 2R061 1LOFC 2RJLA 1G6NA 1UZYA 5E89A 5F6LB 3DPRB 3BIWE 5ABJA 4XPVA 3D82A 3ZVXA 1PK6C 4MGYE 2YV8A 4QGMA 3M2MA 1DQ4A 4N9IA 4HT1T 5AVPA 1S2KA 4F3JA 4AHWA 4IESA 1QOSA 2QZ3A 3R4SA 4PIZA 2XVKA 3FFQA 2E53A 3A0KA 1XNBA 3IMNA 3JQWA 4MXVA 2GZWA 5K7PA 4EROA 4C1WA 1AX2A 1WUVA 2R062 3SH4A 2E7AA 2XVLA 2DCYA 4RQPC 4KQ7A 4UW5A 1IOAA 2VPVA 1XU2A 3THPA 2XWJB 3M3EA 4CDUB 3AKQA 1NG0A 2VNRA 1D4M3 2PAKA 3OY8A 4PJYA 3NV4A 3GZUC 1TE1B 2EXIA 4Y1UA 4K8FA 4YM3A 3H7JA 2RM21 5J36A 2ZHMA 3LAGA 3WQ0A 4AHYA 1DGWA 3L2YA 3DN7A 4KU7A 2QJVA 1VBB3 5DUXA 4R4ZA 3WDUA 1RJ8A 3K48A 5CA6A 4I3PA 4MXWA 1A6CA 3FLTA 4WVZA 5H9RA 4Z92B 5IUQA 2YDEA 3ZDSA 2NZ9A 3TB0A 3RMXA 3V0AB 3VZLA 2NLRA 4YW2A 2W39A 3SCFA 2BYVE 1YWKA 3AP5A 4CP0A 5J37A 4FP2A 2B39A 4XOGA 2H0BA 2ZGLA 2VU9A 4DINB 3MLKA 2A6WA 3VKLA 4P5HA 4QPGC 2P3KA 4RS5C 5CFCB 5JDBA 3W58A 3ZXEA 4RQPA 2CGOA 2QUOA 3ZSLA 3FJSA 4C0BA 1EV11 3JD71 1N3OA 3NVCA 4FPEA 1JOJA 4NN0A 2JG9C 4LUMA 1LHNA 4AFAA 1WW6A 4L2NA 2XJRA 5T5LA 5SV8A 3VGIA 2MNGA 3IIAA 3MIHA 1DZRA 1IPKA 4YG6A 1RUH1 3P3NA 1BCXA 4XDQA 2ZAAA 1JBCA 5GZCA 2DV9A 4GH4B 3B94A 1OOPA 2ZTNA 1RUJ3 5T5OA 1TEIA 1W6QB 2RJKA 4S2DA 3LSEA 1Y3TA 3KGLA 1EV12 3JD72 2V73A 1QGLA 1ZBE1 2XJQA 4HLTA 2WA4A 4Q27A 2BVBA 2W68A 3WCSA 5LK5A 3APBA 3MEPA 4XF3A 1LGCA 2XH6A 2HWF1 1ND2B 1J3PA 2RR11 4YZ2A 4WVMA 4RS5A 4YARA 1RUH2 4FAGA 1FNZA 2R042 1YLLA 4K21A 3WW4A 1LGBA 3D6EA 3SH5A 3VKMA 3CJIA 2UURA 4X6QB 3ECQA 1QXRA 1TME1 2JG9A 3CLPA 2B46X 5F6KA 3M3OA 3UL2A 2ARXA 4HMZA 4JGZB 2VOKA 1V6KA 3MF6A 2UY8A 1ZBE2 2VULA 4DOUA 5LEKA 2GDFA 1OQEA 3J4UH 2HWF2 2WSUA 5GLTA 1C57A 1XE8A 4NO4A 1BKZA 2RR12 3LSDA 4FAHA 1V9U3 4A7YA 3QH6A 1JXNA 5CU1A 1UN1A 1IKQA 4DY3A 1EPWA 1YFWA 4WM7B 1MVQA 3PTYA 1E57A 4HANA 1H2MA 3HMYA 4F83A 1XYPA 1PHMA 3HAGA 4XXPA 4DFSA 4KGQA 4D7SA 4Q4X1 1NXMA 5I0RA 2HEVF 3FUOA 2E51A 1LHOA 3N7JA 1J1LA 2BGCA 1YUDA 5JSPA 3ILFA 5A32B 4A3XA 4BCUA 4S2FA 4LA3A 3LKJA 3WG3A 3ZYJB 1QNYA 1NA1C 4Y1YA 1F31A 2A73B 1ZRDA 1UIJA 1RUG1 3RSJA 5DUWA 4X8NA 1RUI1 4CEYA 2RHPA 4EJRA 1I5ZA 1AR93 3K51A 1H0BA 1JUHA 4RR3C 1O4YA 1EPZA 1YIPA 2WZR1 3OYWB 2W52A 2JG8C 1HIXA 3OD4A 3FE5A 4QHBA 5DUUA 4PBPA 4PCRA 1S0IA 4Q4X2 4Y4YA 3VBUC 4L9BA 1ULEA 5K0UC 4MGIE 3RRDA 5BNOC 3B69A 4IEWA 1R1A1 1SDWA 1DQ5A 2K0GA 4GMP3 1YO8A 1C1FA 2AH2A 2R0FA 4IXLA 1W6PB 4B7EA 1QDCA 4G3YC 3OTFA 5ABJB 1RUG2 1N1YA 2D5HA 3D0JA 1BMV2 3KB5A 1RUI2 2GSYA 3AKTA 1O3SA 4NHLA 1LCLA 3AJZA 1RUC2 4IV1A 1FMD1 4GB31 1B09A 2WZR2 2DURA 2VMIA 4KH9A 4W65A 3AP6A 3J9SA 2GALA 2A71A 3VZKA 3MF9A 1A8DA 2EIGA 2HWC3 2ZHLA 1NA1A 3KLSA 5FFOC 3DF0A 4UBGA 3KS7A 1HRI1 4YSFA 1R1A2 2VG9A 4JTOA 3USUA 4OI1A 4Q8KA 4DS0A 1COV1 1X33A 1RVF3 4YW3A 3URFA 3ZXKA 1RIRA 1UPIA 2PQQA 2ZGUA 3I8TA 4AI3A 4AVSA 1FPN1 4RR3A 3IDBB 3WX5A 2D6NA 4YZ3A 4HKWA 5T54A 2JG8A 2VW1A 3RS6A 1RC6A 1DQ6A 1ZA4A 3OY8B 2XHKA 3WY6A 2X53S 4CP1A 1OKQA 3O12A 4Q0UA 1Q8SA 2YUEA 1FMD2 2QCSB 2RS33 4GB32 4YZ5A 4N43A 3W9AA 1NLRA 2DCTA 3O5SA 3PMSA 4FTSA 2FQPA 1AYM3 3EQEA 1DIWA 1HRI2 1LU2A 5JZGC 3HT1A 2EA7A 3T1MA 4AK3A 2PLV1 5A3LA 2RS53 3IM0A 3MYXA 2SBAA 3J26N 3SITA 1QU0A 1AXYA 2JE7A 4NHMA 2GMPA 1O4TA 4GKYA 2GMEA 2NM1A 1QJX2 1FV3A 3T1LA 1A3KA 4QPIA 1NCRA 2ZGTA 2VMHA 3MZHA 2PHWA 4CDQA 1S0EA 4RQPB 1H2NA 1MS5A 4MVTA 1SLBA 3ZXAC 1GNZA 1NOVA 4P9LA 3ZSJA 1GLHA 1S0BA 1SQ4A 3H8UA 1LOGA 4Q4Y1 1I1EA 4TZDA 1JYCA 2WINB 4AHZA 2AGSA 1HRV1 1MEC1 4YGBA 4PLNA 1HQWA 4KGGA 1LEMA 2ZGPA 1B35A 1V6LA 1F2NA 1RUE1 3ACLA 2BFUS 3KCXA 1UW8A 4XILA 1S0FA 4R9CA 1MS9A 1IZ3A 3WDVA 1ZBA3 5FOBB 2D6PA 2VW2A 5JZGA 1YCIA 1OOPB 4K7JA 3D0SA 3KT1A 1LENA 2WT1A 3ZFGA 5JVVA 3EHKA 3ZN4A 2YC0A 1GZCA 2QZ2A 1Q3EA 4O9EA 4B8EA 2HWD1 1IQAA 4Q4Y2 1H2KA 3WW1A 1M4WA 2XWBB 1U5XA 4EN7B 5T5JA 5BUVA 4IV3C 5JOXA 2A3WA 1HRV2 1MEC2 4YGEA 5JSRA 3JB4C 2UWAA 2HWB3 1CJPA 4WVMB 4RS5B 2PHFA 1RUE2 4E2QA 1VRH3 3VUOA 2AENA 1GSLA 4Y1XA 3CJIB 2D98A 4OHXA 5FQ0A 1GKBA 1D4M1 2TEPA 5KBFA 2Z5WA 4LTAA 2JG9B 4H55A 2Y0IA 1RGSA 2N7GA 3FFZA 2GN7A 5CADA 2A7AA 5FO9B 2HWD2 1F8VA 2KA3A 4ONUA 1VBB1 1PM7A 3EXUA 3H50A 2TBVA 1YFXA 4AFBA 1KS4A 4XF0A 1NLSA 1K5MC 3ZYRA 1GZWA 3FHIB 3N7MA 5DZGA 5FPXA 4Q1RA 2W0XA 3MICA 1ZZCA 4RFT0 3IDEA 3BTAA 1W2UA 2BFUL 2DYCA 2DVDA 1VBE3 2ZMKA 2Q8OA 1D4M2 3MDPA 5DDJ3 2I74A 1I6XA 4LHNA 2NN8A 3JBG3 4PLMA 3VZOA 3INAA 4N53A 4AEMA 2CY6A 1VBB2 2Y26A 1YIFA 1RITA 2WNEA 3N4MA 3S7IA 3I7DA 2IXKA 5FCCA 1RUF3 4ZU7A 1BQPA 4FOVA 3AK0A 1KDKA 4DPNA 3AZXA 4CEYB 2PA7A 4LO7A 1POV0 2ZOEB 3VBRB 5CFDA 1LULA 2C5DA 3ZIWA 1K5MA 2WQZC 2YXSA 1QXPA 4AG4A 4CYDA 1SFYA 1LHWA 2PHUA 4UW4A 1HV1A 1PZ9A 3GBWA 4QGLA 1RUJ1 2KXLA 2MEV3 4Z82A 1AXZA 4YVWB 1UZZA 4GALA 1AX0A 2ZX3A 3OPZA 3AM2A 3B02A 4AW7A 5KWRA 3VKNA 4OI4A 1LOBA 4QMAA 2JKBA 4QQLA 2NP0A 1PVC1 4Y1ZA 1NQJA 3MFCA 1RUD3 4B3NA 2WZPP 4YVSC 1CONA 4IV1B 4LLFA 1LECA 3WNXA 4BLJA 4IETA 1PO23 1UPSA 3CJXA 1ND3A 1MQTA 1QQP3 1C5HA 4YW5A 1S0JA 3WP6A 2RS12 2ZX1A 3FZ3A 4BE3A 3USUB 2GMMA 1G9CA 1RUJ2 1TMF3 5EJ3A 1IPJA 3VBHA 4P9IA 4KBBA 4RR3B 3ZYPA 2OW4A 4IEYA 2AZ5A 1PVC2 1REFA 1OQDA 1DU3D 4JDNA 2K9ZA 4AFMA 4YM1A 2BNOA 3VLBB 3G6JB 4P9YA 1V9U1 2LALA 3B9IA 5BY5A 3J8F3 4N43B 4QXKA 3QOPA 4XJAA 1QDOA 3AXDA 3WINE 3WOGA 3A4UA 1R083 4COVA 2OIIA 4EWAA 1AL22 3SCHA 1G9FA 3ZPYA 3D4KA 1ZZ9A 1CR7A 2A6YA 4Z07A 4BIOA 2XKPA 1DYKA 5T5PA 3I4IA 1G9BA 2ZAHA 4L11A 2DVBA 1NE6A 2E7TA 2CGPA 2ZX4A 4Q0VA 3MIGA 4Q4V3 4XFCA 4BZ4A 1QOOA 3WDTA 1V9U2 4LBQA 2HWE3 4MX3A 4QPIB 1NCRB 4AI2A 3WP5A 1AR91 4FXGB 1MS3A 1DGWX 4K40A 1MVEA 4CDQB 1W6NA 2BEOA 1HLCA 1Q56A 2CNAA 4KG0A 5FRAA 2D40A 4AI8A 1HXS2 5BNPC 2DVFA 3ELNA 5DG1A 2IWGB 2ZGQA 1ZREA 1R1ZA 3H7YA 5GLVA 3WHTA 1EAH3 5B2GB 2CTVA 3IKWA 3AMHA 3VBFC 4GMP1 1B35B 1KXGA 5JOYA 5IK8A 2ES3A 3Q9OA 1OA3A 2IC1A 3MPPG 3MGUA 1WBLA 1V6JA 5JZGB 1N3PA 1U0AA 1AR92 1GICA 2ZBJA 2B45X 3ZFGB 5FLHA 2OUJA 4WV8A 2NPIA 4Q0PA 4DB5A 4AEDC 1VBA3 1SFNA 3H3UA 4Z1VA 2HWC1 3H1YA 4DMIA 3UK9A 4MLOA 4S2HA 5KC5A 1SCSA 3L9JT 1Z0HA 3WW3A 3ZFFC 1DZQA 1FI2A 3ZYGA 4JRLA 1RVF1 1CPNA 2E9QA 2XL9A 3PJYA 1N3QA 3KM5A 3LA2A 2E7QA 1PZ7A 2UY9A 5C8WA 5FQ0B 1DYPA 4ASMB 5BNNC 3UKVA 2GC2A 4AGVA 1TNRA 4SLIA 2UYAA 2FBEA 3WQ1A 5C4WC 1KS5A 2C9AA 1JTZX 4B29A 4CDWC 2HWC2 4E4ZA 3H3ZA 5J3UA 2WFF3 1AYM1 5BNQA 2B7YA 1GZWB 3ATGA 1MS0A 1RVF2 4HVQA 4C91A 3VZNA 1BBT1 2RS51 4PDWC 1OHFA 2DCKA 3N7LA 2EAKA 4AEDA 1I9RA 3UJOA 1Y7BA 5I8TA 2X5IA 1W39A 2HEYF 1VBD3 3VHPA 4NVPA 3A0NA 4K9SA 3ZFFA 3I2DA 3D8CA 4HZFA 1LOFA 4N53B 4AWDA 5L19A 1Z7S3 1NZCA 1O3QA 3ZN6A 1PK6A 1AYM2 4LT5A 1X7NA 2ET1A 1AR73 1UF2C 4BWOA 1BVP1 4FPOB 3AZVA 5J09A 1OPOA 3QCWA 3V0BA 3FUQA 4QPYA 1BBT2 2RS52 1YHFA 3JCIA 5E8AA 1AVBA 1LKNA 1J3QA 4CDWA 4FPYA 4S2GA 5BV6A 1Q8VA 3KD4A 4QD2A 3ZSKA 1ZBA1 2B9UA 2RM22 4LHLA 4OI2A 4Z2WA 3VBSC 5CFDB 3NSTA 1K5MB 3FLRA 3VDDC 1O5UA 4BIFA 3VBOC 1JUIA 4XFBA 5GZFA 1U5YA 5C8CC 3PVBB 2A75A 2WA3A 5FTTC 2HEWF 3UKNA 3ZXJA 3HR9A 5DZEA 1VBC3 1PIV3 2GNMA 3WP4A 3WQ7A 5C9AC 1APNA 3H1MA 1XXNA 1LGNA 3C3VA 4U2AA 4CZSA 4XMAA 5FOJB 1JHNA 4I2OA 2HWB1 2YMZA 2Q1MA 4KWJA 2D5FA 5BXXA 3P3PA 2DTYA 1VRH1 4BA6A 2GC3A 1FOD3 1H1IA 1EP0A 1GFF2 3FLPA 2EXKA 3UKTA 5H9SA 1ZBA2 1ND3B 3AKSA 3VZMA 1MQTB 2DVGA 3B00A 1RMU3 2VECA 2ZGSA 4PLOA 4AYUA 3VBHB 1MR5A 2EF6A 3FWEA 1WLTA 4E9KA 3BALA 1GQGA 4GIQA 1DZTA 2EXHA 3VBSA 1C8M3 3NAPB 1J59A 2WNUC 1PZ8A 4QPGA 2HWB2 1C4RA 2D97A 3VDDA 3LGRA 3VBOA 4COWA 1VRH2 4R9DA 5EXOA 5LEJA 1FAYA 4E4SA 1AYN3 3QLQA 2D3RA 4RA0A 2FZ2A 3M3QA 3AFGA 1Q5OA 4SBVA 5C9AA 4NOTA 4N90A 5DDJ1 2E63A 2B8MA 3SMHA 1RHI3 1A78A 4BHPA 1DDLA 3JBG1 2X29A 1DFQA 5CB7A 3R6SA 1DBNA 2WLPA 3MLJA 1G9DA 1CIWA 4LBQD 1ULCA 2HJIA 4P9WA 3TOJA 3AKRA 2IFWA 3LA7A 5D8AC 5JIAA 4LBQB 1UU6A 3DGTA 4YZ4A 1SLIA 5I93A 2I2SA 1VB2A 1W6NB 4LBOA 2NMOA 5JPMB 1TME2 4KL1A 5DDJ2 3MLLA 1WCKA 4XFHA 1HX6A 1AR63 2YHJA 5L73A 1WMDA 3JBG2 4KU8A 3OBRA 2MEV1 1KFXL 4AQTA 4LE3A 2A6ZA 1SLTA 2FMYA 5EYXA 4FTEA 4XZPA 2ATFA 4I30A 1C5IA 1PGW1 2XG3A 2BWCA 2H6BA 3CU7A 1H1AA 2A3XA 1FT9A 1RUD1 1U5IA 1BEV3 4YLZA 4AVCA 2ZHKA 2WNVC 3LZZA 4HVRA 2WL1A 4JV4A 2O8OA 4ORFA 5KHJA 5T50A 5BYNA 1PO21 4Q29A 4CDXC 4XTMA 3AFKA 1DQ0A 3OGGA 4K1YA 2EAAA 2BTVC 4FOWA 2OUHA 1S2BA 4WM8B 4I01A 4OHWA 2ZPXA 2XJTA 2XUMA 3NV1A 3SNMA 3MW3A 3I59A 2JD4A 3UJQA 1U5ZA 5J48A 3LOIA 3GBGA 1DG6A 3ES4A 4YM0A 1XE7A 1YJKA 2PAMA 4Y26A 1PGW2 1V70A 3LOBA 1R093 4IEZA 4XIKA 1IS3A 3JB8A 3TN91 1RUD2 1Q8PA 1C8NA 3M8LA 4BLIA 1KRIA 2P37A 1AUYA 2DUQA 3KCCA 3J8F1 1PO22 2R32A 1H4GA 4XF1A 1R081