2DUPA

Crystal structure of vip36 exoplasmic/lumenal domain, metal-free form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
250
structure length
245
Chain Sequence
EHLKREHSLIKPYQGVGSSSMPLWDFQGSTILTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTIDWTKIEPSVNFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicular integral-membrane protein VIP36
publication title Structural basis for recognition of high mannose type glycoproteins by mammalian transport lectin VIP36
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Protein transport
total genus 56
structure length 245
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dupA01
1GNHA 1C4RA 1SACA 1SLTA 4XJWA 4YG6A 1CVNA 2CL2A 1N3PA 1XQNA 5EXOA 2VW0A 1GSLA 1LGCA 4UW5A 4AGVA 3FLTA 1C57A 4U36A 3IPVA 3ZXEA 4JCKA 2DU0A 1A3KA 1SLCA 1JBCA 5EYYA 5FRAA 1G9CA 2JD4A 2ZGTA 3OY8A 5T5PA 4Y22A 3AFKA 2GALA 2E7TA 2GMEA 2NP0A 4Y1YA 4ISQA 2EAKA 3ZYRA 4M3CB 3RQ0A 1D2SA 1I3HA 3I4IA 4Q8LA 1UAIA 2WSVA 4YZ3A 4XIKA 3WG2A 2DUQA 2SBAA 3ILFA 4YZ1A 1DBNA 4R9AA 5EYXA 2DVBA 4RA0A 4BMEA 1ZA4A 1BXHA 3GALA 3QCWA 5IK7A 1FX5A 3AP6A 3OPZA 1LOFA 5GZGA 3SLIA 3RMXA 4JRAA 1DYPA 1LJ7A 2PHFA 1MR5A 1V6IA 3POSA 1G9BA 1W0OA 5F9TA 1LCLA 5DUVA 3V64A 1DQ1A 4Y1ZA 1FAYA 2SLIA 3ZXLA 1MACA 4XJZA 2A71A 3SH4A 4K1YA 1JYCA 3VKNA 4DPNA 1UMZA 1SBDA 2D6PA 3A4UA 4JC1A 1LOGA 4M00A 3HR9A 3D6EA 2D3SA 3VKMA 2E51A 3W58A 5KXEA 3ZSLA 4M3CE 1IS4A 1AX1A 3WLUA 5T5LA 2NM1A 1LTEA 4YZ2A 4FPEA 2I2SA 1QKQA 4UW4A 3U4XA 5GJ6A 1QOTA 5GM0A 1CONA 5KXBA 2PELA 5JLVA 2A3YA 1RINA 2OUHA 3ATGA 4P9WA 4PCRA 1ENQA 1Z0HA 5JDBA 1IS5A 4FOQA 2R0FA 3WOGA 1C1LA 2NMNA 2A6WA 3MPPG 2ARBA 2W68A 1HQWA 2JECA 3APBA 2P3JA 5T50A 4CZSA 1W6NA 4K21A 3ZSKA 1VALA 1DQ6A 3USUB 2NYYA 1F5FA 1JW6A 5GLVA 2ZGPA 4FPLA 1N1SA 1WBLA 5IK4A 1MZ6A 1IKQA 1YO8A 2VXRA 1AVBA 4XOGA 5JOYA 3WCSA 2OVUA 4FOYA 2AR6A 4ATEA 2ZGOA 1S1AA 1GZCA 2NZ9A 4YGDA 2C5DA 2WNEA 3VKOA 1GYKA 1I1EA 2DUOA 2V73A 2WT2A 2P37A 4XBQA 1WLWA 2D6NA 3AYDA 4FVVA 4FPOB 1VAMA 1U0AA 4YG0A 4AYUA 3OJBA 2WT0A 4ITCA 2ZHMA 1ULCA 1GICA 3KQRA 2ZACA 4PBPA 5GALA 3HMYA 3UK9A 1FV2A 2ZGRA 1D0HA 1WD3A 1W6NB 1AJOA 1W6QB 1FNYA 2ES3A 3BODA 3N3HA 4HANA 3WHUA 4Y1UA 2ZGSA 4ZXKA 2ZBJA 2ZMLA 2AENA 3Q9OA 5H9RA 2P3KA 1OQ1A 1S0IA 3B9CA 3O0VA 2WKKA 1WLCA 5E8AA 5DG1A 1LOBA 2VU9A 2AUYA 4YZ5A 3WZ1A 2DV9A 1S0JA 2P3IA 3UL2A 4FPJA 3WG1A 5IK5A 4BMBA 1H9PA 1YXWA 1N1TA 2EXHA 2GNDA 5E89A 3ZPYA 5GZCA 2VW1A 1V6LA 3AK0A 1WW5A 1YYNA 2D6OX 2D3PA 1CR7A 3ENRA 1A8DA 2A75A 4YW1A 1PZ8A 4NOTA 1FNZA 1LECA 2ENRA 1LULA 2CWSA 4RL7A 1AF9A 1MS9A 1SBEA 3PVEA 3UJQA 4Y1VA 4D69A 5CB7A 3V0BB 2DU1A 3T1MA 1IOAA 1N3QA 2Z42A 1DHKB 2TEPA 1W6OB 1HDKA 1S0CA 1CIWA 4TYSA 1FV3A 3DGTA 4C1WA 5JMCA 2UWBA 4FPKA 5BYNA 2A5ZA 2YV8A 1V00A 1UX6A 3FLRA 2CTVA 4FPGA 2WSUA 4MYEA 5JVVA 2FHRA 4XJ8A 4DRRA 1LOCA 1LHUA 1GNZA 1GV9A 1NLSA 3N35A 4XHXA 4Y24A 5GZEA 3AZVA 1LOAA 5H9QA 1VIWB 3B3QE 2R0HA 2D44A 1SCRA 3TAYA 3AXEA 3AZXA 2R16A 2ZGMA 1S0BA 5SV8A 2DVAA 1W0PA 2R1DA 2WT1A 1H9WA 1MS4A 4Q27A 4YLZA 1QDCA 2EXJA 2R1BA 1LODA 3H0OA 3RG0A 3SH3A 1MS0A 1ULEA 4YGBA 5KXDA 4FPYA 4AVVA 4XJAA 2D3RA 1FATA 1J1TA 1G7YA 3RRDA 5CAZA 1YI7A 2JKBA 2PHRA 2ZA9A 1S0FA 1SLIA 2E7QA 2UU8A 3MW4A 5HCFA 3WDVA 4YG3A 2HYKA 2A3WA 1O4ZA 1ZM1A 4XDQA 3WNXA 4DFSA 2VY0A 3NWKA 5H9SA 3AYEA 5CA6A 3SITA 1JN2P 3USUA 4TZDA 3PVOA 3WV6A 4ZKTB 1LEDA 3B01A 3WG3A 4NO4A 4LBKA 1Q8QA 4GA9A 3I8TA 1MS3A 2KM2A 5IK8A 2ZHLA 3IN9A 4M01A 5AVAA 2DTYA 3QLQA 3ZXFA 4BQ1A 2EALA 4CRQA 1WLDA 4XZPA 1V6MA 5KXCA 4XJUA 3ZSMA 1DQ2A 2YMZA 1ULDA 4GKYA 5F5QA 4AWDA 4YGEA 1CPMA 5T55A 3NV1A 3KM5A 3NV3A 1MS1A 3NV4A 1AXZA 1UPSA 4FOVA 1DIWA 4DQAA 2GNMA 3D5OA 3SNMA 1V6KA 1JUIA 1QOSA 3O5SA 1LEMA 3AJZA 4XE9A 1W6QA 3LSEA 5GZFA 4Q1PA 1DYKA 1LENA 4PF5A 4LBOA 4YFZA 1SBFA 1C1FA 3VKLA 3WCRA 1HQLA 5GLUA 2PHXA 2FMDA 4GKXA 1B09A 3OBTA 1N1YA 3INAA 5GLTA 4FP2A 1CESA 2ZHKA 4FQ4A 3B69A 1UZYA 4XBLA 5LK5A 1Q56A 2CY6A 2NMOA 4Y26A 1W6PB 2R49A 3OYWB 2JJ6A 2H0BA 1DGLA 4ASMB 2YROA 4XMAA 3WDXA 1KITA 1YRZA 2XB6C 1BJQA 1LESA 5FREA 1X50A 3AP9A 4LBNA 5IUQA 2OUJA 4XJ9A 5GLZA 1LHNA 3BIWE 1AX2A 4GWNA 2A6XA 3VV1A 4R9CA 1NXD1 1QGLA 1QDOA 1S0DA 4BOWA 2ZGKA 1O4YA 3FLPA 3V0BA 1OKQA 3LSDA 1V6OA 2ZGQA 2ZAAA 1G8WA 2Q5TA 1SFYA 3RSJA 1G86A 1W6OA 3AZWA 4XXPA 1CQ9A 2PHTA 2WJSA 1KQRA 3A0KA 5T5OA 4YW3A 2DYCA 5DZEA 3AYCA 4YW5A 3POYA 2A6YA 2GMMA 3AP7A 5L73A 3WDWA 4LBJA 3VKFC 1DLLA 1MVQA 4Z8BA 1N3OA 2YZ4A 1CJPA 1CN1A 5HCAA 2D7FA 1DQ0A 1ENRA 2GNTA 3B00A 3DUIA 1AXKA 4YM0A 3ZXJA 4R9BA 1LU1A 1MS5A 3WDUA 3GNEA 1IKPA 2UWCA 1N1VA 3ILRA 3OGGA 3N36A 3PMEA 1Q8PA 1SLAA 4GWMA 4K1ZA 4XIOA 1GKBA 4ATFA 4K20A 3IM0A 1MS8A 4FPCA 4P9YA 3V65A 2JE9A 3TB0A 1BYHA 2AH2A 3ZVXA 4F83A 1ULFA 4WV8A 1VAVA 2ZABA 1YIFA 1DFQA 3MW3A 3A0NA 1BQPA 4Y1XA 4KBBA 2ERFA 1UKGA 2ZGLA 4XMIA 4AGRA 1G9FA 1JYIA 1PZ7A 2W52A 4LBMA 2V5YA 4FP3A 1QOOA 1AXYA 2ZGUA 1AX0A 1QF3A 1Q8VA 3AYAA 3V0AA 2JDZA 3AXDA 3L2YA 2E6VA 1WW7A 1LOFC 2A7AA 2EF6A 1DQ4A 4LBQB 5DUXA 2P34A 2OW4A 1CPNA 1DQ5A 1S0GA 2AREA 3M2MA 5DZGA 3WDTA 4H55A 2E53A 1V6NA 1LU2A 1QU0A 2A6VA 1WW4A 2GN3A 3LCPA 1KRIA 5JOWA 1UL9A 3UJOA 3HN1A 4BLJA 4P9XA 1FYUA 4WZFA 5T54A 2D43A 3BOPA 4LBQD 4XBNA 4XYXA 1WBFA 1Y7BA 5IT6A 4AGGA 3AP5A 2GDFA 4UW6A 3N7LA 4DRVA 2DVGA 2VW2A 3IMNA 1BZWA 3ZXKA 5JOZA 5DUUA 3M3CA 2EXKA 1AZDA 3JU9A 1W6MA 1HLCA 3N7KA 4XXAA 2A3XA 4Y20A 1TEIA 4GXLA 1KDKA 1OFSA 3O0WA 5E88A 3AP4A 1PZ9A 3ILNA 3WVJA 3ZYPA 3V0AB 3D4KA 2CYFA 4PBOA 2W08A 3AJYA 2W39A 3WUDA 3IPVB 4PQ9A 3POWA 1URXA 3M3EA 4Q1RA 4Q2FA 1UN1A 1ENSA 3FFZA 1VLNA 4GALA 2ZMKA 3AZZA 1BKZA 1GBGA 1W6PA 2D6KA 2DVFA 3OYWA 1WW6A 2VUAA 1F31A 3OY8B 4Y22B 2YY1A 2ZGNA 3FUQA 5DXDA 3WHTA 2LTNA 4YM3A 1Q8SA 4ISRA 4AVTA 1Z78A 1KJRA 2A70A 4P14A 2EXIA 4I30A 4C1XA 3FBYA 2EIGA 3O0XA 3BTAA 2CWMA 1W6MB 2ZZJA 3PJQA 2B7YA 3JUUA 2GNBA 4Y20B 1UZZA 2WLQA 4WVWA 5JOXA 2PHUA 4YFWA 2GMPA 3SH5A 4L8QA 2D6MA 3W59A 2D6LX 3AX4A 2ZHNA 1IS6A 3O12A 1LGBA 4YZ4A 5HCBA 1DZQA 1EPWA 5GLWA 3WG4A 1LGNA 4CTEA 2JE7A 1GZWA 1WUVA 2G4IA 2PHWA 1GZ9A 2DWRA 2NN8A 4FQZA 2XG3A 1LHWA 1SCSA 4UW3A 4DS0A 4AVSA 4WVVA 3T2TA 2GN7A 2BQPA 4IQPA 4BM8A 1APNA 4YGCA 1QNWA 5CNAA 1IS3A 4LBLA 3AZYA 3M3QA 2A6ZA 1QMJA 3NV2A 4YW2A 5H9PA 1HKDA 4M3CF 3N7JA 3PVNA 1LHVA 2VH9A 1QNYA 2UURA 5T52A 3R4SA 2UWAA 3FUOA 3N7MA 4Q8KA 3R05A 3ASIA 3SISA 1RITA 5DUWA 2AGSA 3M1HA 2AYHA 3VUOA 2DUPA 1G9AA 2YXSA 1JHNA 1GANA 2LALA 4YW4A 1GZWB 2ARXA 3WDYA 1R1ZA 2C9AA 3ZSJA 1N47A 1ULGA 3RS6A 1LHOA 3CNAA 1ONAA 2WQZC 3IKWA 4R9DA 2ZKNA 4FOWA 1AJKA 3MW2A 4FPFA 1SLBA 4XTPA 3C2UA 5T5JA 2ZMNA 4YM2A 4FPHA 2P2KA 5EWSA 3R4UA 4XILA 1JXNA 1WD4A 5DG2A 4BLIA 3RMYA 1V6JA 2RHPA 1WCSA 1Q8OA 4LBQA 4YM1A 5DZFA 5CBLA 1MVEA 1KJLA 2DURA 3MEPA 4OZXA 5GZDA 1LOEA 3OBRA 1S0EA 4HL0A 4W65A 3WUCA 3T1LA 3M3OA 4XTMA 2CNAA 1KDMA 1RIRA 4XHBA 2DVDA 1G9DA 4M3CA 4SLIA 1F9KA 2DTWA 4BPZA 4Q26A 1H30A 1MZ5A 1JOJA 1A78A 1GLHA 4U2AA 1SLLA
chains in the Genus database with same CATH superfamily
1SACA 3VDCA 1OA2A 1E5RA 1AR82 2WO2A 4CVUA 1CVNA 1N3PA 1VBC3 2FCVA 2IXHA 1UX7A 2VW0A 2PAEA 4Q4X2 3WXPA 4Z1VA 1BK1A 3NKTA 1DGRN 1OH3A 3DKWA 2ZPXA 1YQ6A 1O3QA 1A3KA 4TN7A 1AL22 2PLV1 4I2OA 1OI6A 4GMP0 1G9CA 4S2FA 2JD4A 4N53A 1RVF2 2Y38A 3OG2A 3AL5A 2Z5WA 2XUEA 3BGAA 2NP0A 2YYOA 1W39A 2CGOA 4QXCA 4HLTA 3QOPA 1I3HA 3I4IA 2VOVA 2WSVA 2ZJCA 4E4DX 1Y4WA 5A1LA 2DUQA 1T6GC 1NXMA 1DBNA 2RJKA 5JR7B 5A3LA 3TBDA 1TE1B 1VB2A 5EP9A 4BMEA 1ZA4A 2GC1A 3LPFA 4IERA 2WWSA 3GGLA 5L7OB 5IK7A 1DGWX 1HXS3 4ONUA 3A7QA 3MUY1 1OA3A 2VOKA 3FHIB 4IV3A 1EY2A 2OKXA 3SLIA 4CEYA 2FZ2A 4AEDA 2XL7A 4LO6B 4JRAA 1XRUA 4BXSV 1DYPA 3SKVA 4CPBA 1V6IA 2E7AA 2W87A 4UBGA 1R082 1RXFA 5DUVA 4Y1ZA 5IVVA 1FAYA 4HG6B 2Z69A 5FPUA 1RUOA 5FIXA 4XJZA 5FUIA 1W8TA 5A3TA 4FXGB 1RUF3 1SBDA 3DYMA 3D6EA 4ASKA 3W58A 2OZ6A 1POV1 4DZGA 1O59A 1VBE1 1NX9A 4D7YA 1QJY1 1XNKA 2P17A 1WZXA 5CFCA 3IIAA 4DOUA 4WM8A 1YJLA 4UW4A 1QOTA 3ZKYA 4COZA 2WA3A 4IV3B 4B4QA 1CONA 1LR5A 2ZX1A 1MPXA 2DDUA 3U11A 2XLAA 3N9MA 4LOSA 2VMHA 1Z0HA 4LHKA 5LRRA 3WOGA 4C8DA 4CXXA 3QACA 2A6WA 3MPPG 1E5SA 4QX3A 1VBC2 3ACHA 5CKMA 1HQWA 3WD5A 2P3JA 1XNTA 1W6NA 2GU9A 3KCYA 4K21A 2B9VA 3MV01 4OUSA 4ZY9A 1DQ6A 5FWJA 3RI8A 3USUB 3H50A 1AUYA 3EBRA 3TNQA 3T08A 1IKQA 4NWVA 2VXRA 3O1RA 1MEC2 4QDRA 2AR6A 1PVXA 2VVDA 1LKNA 1AYN1 5EJ3A 4D7SA 1WMEA 5FUPA 2WZEA 1VBA3 2Y6FA 4AI0A 2V73A 3S5AA 2WT2A 2D6NA 2Q1MA 3LFIA 1OPMA 4FVVA 1CD3G 1QJX2 4I09A 1GOGA 5F32A 5IFPA 4NRPA 1HXS2 5GALA 1FV2A 4DY5A 1W6NB 3MLJA 3HNBM 4PT6A 2ES3A 3BODA 1R1A3 2G9GA 3LEIA 3MF9A 2PFWA 2R30A 1HJFA 3WHUA 4Y1UA 4IEWA 2ZBJA 3GXUA 3OF1A 2OT7A 2I45A 4WVZA 4A3XA 4ZXEA 3ZIXA 5BYNA 3B9CA 4JGYC 2C0ZA 3KD4A 5BNNB 2VU9A 1RUF2 2RR13 2V4AA 4YZ5A 4FPJA 3LZZA 3WINE 2OXBA 4AI1A 1RUE1 1DU3D 4OI4A 5GZCA 1ODNA 1V6LA 5D1IA 2HWF3 4WZCA 3PU8A 4NWWA 4IE6A 2VTFA 3ZPOA 3GBFA 4N43C 5D8AB 5HV4A 1AF9A 2YFZA 3LE0A 3NJYA 4UFJA 3UETA 5CB7A 3V0BB 2Z42A 4N9IA 1W6OB 1HDKA 1S0CA 1CIWA 2WC2A 1YQ5A 3DGTA 2RS33 2UWBA 4LNVA 1L7QA 4RR3B 2HWE3 4HMZA 2BEOA 4MYEA 4ZPIA 2WO3A 4FXKB 4CDQB 1GV9A 4XHXA 4XF0A 3C7OA 1BBT1 1V9U2 2JG8C 4EN7B 4XUOA 1WA6X 5DDJ1 1ZREA 2D44A 5CISA 4NHYA 1PMHX 4ZU4A 4EE2A 3HQRA 3TAYA 1XYNA 2OYZA 5JXGA 5IWFA 3AZXA 3FHQA 3I3MA 4FCAA 1LAJA 3P3NA 2ZGMA 1NY71 1VBA2 3PIGA 1FPN2 4HOOA 4CU6A 1QDCA 3RG0A 3WF1A 1MS0A 1ASJ2 4ORFA 4UT5A 2D3RA 4QGMA 1KS5A 2PQSA 4AEJA 1J1TA 1G7YA 2QUOA 1E57A 2PHRA 1SZBA 1R1A2 1ZZCA 2E7QA 3MW4A 1OXCA 1GWMA 1C8NA 5FZDA 5C9AC 4E2SA 3OGSA 2X53S 2BGOA 3ABZA 4OUEA 2QZ2A 5AVPA 2VQUA 2YUEA 3NWKA 5LBEA 5CA6A 2XMLA 1ND3B 1YQ8A 4ZKTB 3J4UH 1LEDA 2FMYA 5EFUA 4LQRA 3WG3A 2KA3A 1NCQC 1X7NA 2RR12 4GA9A 4I0BA 4XQWA 2R042 4KU7A 1MS3A 5IK8A 3IN9A 4M01A 5AVAA 4HVQA 4LLFA 2FDKA 4IEQA 3FX3A 5EV7A 3ZN6B 4AR2A 4CRQA 4XZPA 4W8JA 2BGCA 4JHZA 3MUZ1 4Q4Y2 4XVHA 3THTA 4BK4A 4ET7A 1J83A 2HWF2 3J7MA 1HJGA 4AWDA 4A7ZA 3NV1A 1UU4A 5F1RA 2NQYA 5LA0A 1PIV1 3SNMA 4Z2WA 5HV0A 4XE9A 5F7UA 4Q0SA 2XJRA 5LB6A 5TSWA 1TZOA 5FOJB 4LHLA 2PHXA 5FY8A 5J96B 4GJYA 4Z82A 3GZUC 3OBTA 3SCHA 2HWE2 3FE5A 3HN3A 3INAA 3J8F1 3WNNA 1LB2A 1X33A 3H8UA 4FQ4A 1GQGA 1XSRA 4KG0A 4LO7A 1JZ3A 2Y8KA 4JGZB 5FZOA 3I2KA 2WS92 4BQ3A 1P8JA 5HXMA 2OPKA 4QDQA 2VVFA 2R49A 2LW8A 5FBZA 1ZZ8A 1ZBE3 1JS9A 3D0JA 1DGLA 1ZZ6A 4XMAA 2XQRA 3I3QA 3U10A 1FMD3 3KSCA 4NRQA 1REDA 2OUJA 4E2QA 1AYM3 5FYBA 4G9SB 1K42A 1AX2A 3KT7A 4AEMA 5JCTA 4PIYA 5IW0A 2ZEXA 2VCAA 3FMGA 3OB8A 1RUC1 3VHOA 4HPKA 1QGLA 1QDOA 2YGMA 4PIZA 3H8OA 1O4YA 1K12A 1EP0A 1VRH1 2MEV3 3E1F1 1OF4A 2JDPA 2ZAAA 2J1TA 4XFFA 3RYPA 3H8XA 3TWIA 1BK0A 4LUKA 3SCFA 4AF9A 1CQ9A 2PHTA 1VBD2 5C4WC 2VUDA 1CZSA 1JODA 1JU3A 3CO2A 3KV6A 5T5OA 1GR3A 5DAVA 4YW3A 3AYCA 2VGDA 4KH9A 4YW5A 3T30A 1YFYA 4QD2A 4HN1A 5IFTA 1DLLA 1MVQA 3WW2A 2IXCA 4JKMA 2AACA 2RMU1 4Z8BA 3GHNA 4RGGA 5EJ1B 4FSJA 1YI9A 2CAVA 2O0OA 2RM21 4QGLA 3VDDB 4IEZA 3NVCA 4FAHA 4IE5A 1W8HA 1UIJA 3OGVA 4CP9A 3B00A 4YM0A 4KBZA 4R9BA 1JH5A 4HPKB 2Q8DA 1IKPA 4L99A 1N1VA 3N36A 1UKRA 2DCYA 1Q8PA 2JG9C 4BIOA 2EIDA 3MV11 1K5JA 4COWA 3HD8B 4MH0E 4UF0B 4JGYA 4P9YA 4CCLA 1RUI3 2IWGB 2GSYA 3V65A 3TB0A 1B35B 2AH2A 3T4VA 1WMDA 3ZVXA 4F83A 3KB5A 4QPIB 3ETQA 1OVSA 3F2ZA 1YIFA 3AKTA 1GOFA 2XHNA 3A0NA 3BOWA 5ISLA 2PYTA 4B8EA 5FXWA 4AGRA 1PZ7A 3ZFEB 1QOOA 3PURA 4HT1T 3U75A 1AX0A 3AYAA 2NLRA 4N43A 3ZYBA 4CP9B 3AXDA 3L2YA 4XC9A 1AHSA 3ZFGC 1LOFC 1SDDB 2A7AA 3BALA 1DQ4A 4LBQB 1ZBE2 4QX2A 4RS5C 5CZKA 5F39A 5KHGA 2OW4A 3AM2A 5F5AA 2Y6LA 1H6YA 2AREA 3B5LB 4PJYA 5DZGA 3S7IA 1FMD2 2E53A 3WDTA 4CUGA 1NAEA 1UYYA 1WW4A 4COYA 5IVYA 1OPOA 3HN1A 1HRV1 4RD7A 2VNVA 2VPVA 3BOPA 4GQ7A 4EN0A 5IT6A 1WBFA 5F2WA 4IV1B 2O8OA 1XJAA 4P9GA 3MIFA 2VW2A 1UZ0A 3IMNA 5JOZA 2C24A 2XL9A 4KWKA 3RJRA 2JG8A 5A7WB 4IW3A 2EXKA 1AZDA 3N7KA 1E5IA 1OLME 1AR62 1TNRA 1T6BX 2VULA 1KDKA 1OOPC 3W5MA 2D5HA 1YQ2A 2XVLA 4N43B 4LE4A 1QJZA 2W08A 3AJYA 5FYZA 4H14A 5I8YA 1U5XA 3AKSA 2OQ6A 1QY4A 2X5IC 3M3EA 1OLRA 4MHUA 3ZM8A 2QQJA 3AZZA 1QEXA 1OF3A 2AZ5A 2VUAA 4Y22B 2BFUS 3U14A 4Q4W3 4IUGA 2ZGNA 1XU1A 3FUQA 3IAQA 2VZOA 2JIGA 4OHVA 4ISRA 2RVAA 1Z78A 1KJRA 1Z7S1 3AC0A 5C9AA 1YLLA 2EXIA 4EWAA 5CKNA 5EPAA 2EIGA 3O0XA 5KC6A 3KMHA 5HI0A 2VCCA 3HEIA 1VMHA 3JUUA 4YVWC 1ZRDA 2MHFA 4CUCA 1NCQA 4JTNA 3SC7X 3MO4A 1H8TC 3SH5A 1HN1A 1H1IA 1EAH1 1GMMA 4JDMA 3DECA 3RWKX 3MIDA 1QJU2 1UOJA 2ZHNA 3O12A 1BLZA 1CZTA 5DAPA 4OHZA 4CTEA 1XC6A 3ZMNA 3VZLA 4A45A 4BQ4A 2YDEA 2G1MA 1ENXA 2NN8A 3ITQA 5FO8B 2QQPA 3HOBA 2XG3A 1LHWA 5JI7A 2J1SA 3H7JA 2GN7A 3JBG2 3SCGA 4LO8A 1K5MB 4OMDA 4UFLA 5CNAA 5L9RA 2VECA 5ABJB 3C8XA 5KHKA 1NQDA 3MFCA 1XE8A 3LB9A 3ACLA 4YW2A 5E16A 4AHWA 2GC2A 1VRBA 2YGLA 5C3PA 2VH9A 2UURA 3R6SA 5AC93 4QQHA 3OSDA 3FUOA 4IEXA 4AFBA 3M8LA 2GC3A 3WP6A 4LKEA 4QT6A 3DCQA 5DUWA 3SISA 2DFCA 4LOTA 3CJIC 1ZRCA 3K4ZA 4W6XA 2K0GA 1UIKA 1NOVA 2J1EA 4LHNA 2HH9A 2Q8OA 1ULGA 1NA1B 2UY8A 3RS6A 5IAVA 3IKWA 3CNAA 1ONAA 4R9DA 2OA2A 1VBB1 2W46A 4CEWC 3MW2A 1D4M1 3IBMA 4OULA 3ZXGA 4XTPA 3HAGA 5LASA 2ZMNA 4YM2A 1WGPA 2OZJA 5EWSA 4QM9A 5L7OC 5FWEA 4LR4A 1FOD1 3ALQA 4GAZA 5DG2A 4P02B 1V6JA 2RHPA 2ZEYA 2W94A 4LT5A 5CBLA 2ZAHA 1RUJ1 1EV11 3NRUA 5C4WA 4Q5OA 1W2NA 1C5HA 3WUCA 3M7AA 3T1LA 4OVEA 1QQP3 2CNAA 3HIFA 4QHBA 4V1PA 2RS11 3ZX7A 4QU1A 2DVDA 2VZPA 4M3CA 5A6YA 3VDAA 4RGKA 4COUA 5LA9A 1F9KA 4BPZA 1H30A 4YVSC 1JOJA 3NNFA 4QB6A 1SLLA 4KMQA 4XJWA 3AMMA 5L9VA 2JKXA 3A22A 4YG6A 4DXRA 2CL2A 2VBBA 5EXOA 4AVBA 1GSLA 4AVAA 4NHLA 1H2NA 3EJKA 1A6CA 2J1VA 3FLTA 3IPVA 4U36A 4JCKA 2DU0A 4DXTA 3ZXAC 2JG9A 1SLCA 1JBCA 3BYWA 2Z4FA 2BP6A 5EYYA 5C3SA 3QH7A 5IVBA 4A42A 5C4WB 4A6SA 3UNPA 1O91A 3B9IA 1W28A 3UT0A 3AFKA 1IG3A 3R0RA 4LULA 2VUJA 4D6QA 1IHMA 3BPZA 4ISQA 4M3CB 1RUG2 4LK6A 2VCMA 1UAIA 4QXBA 3THDA 5LW9A 2BWCA 1JOBA 2FCTA 3GJAA 3N9QA 5IATA 5AC92 1XE0A 1HRI1 2DVBA 5EYXA 3TEYA 4P00B 1VBE3 3I97A 1QJY3 5FLIA 3ZFGA 1LOFA 4XFIA 3VZJA 2WL1A 4RS5A 1UO9A 5GZGA 1MQTB 1XNAA 2ZOEB 3DPRC 5FYMA 4Y3OA 3PUSA 4I0WB 1LJ7A 4OMCA 4GB31 1JMUB 1WCKA 1Y9GA 4UAPA 2YBPA 5A32A 5CIRA 1AR93 5DQ0A 3SH4A 1AR73 4K1YA 1JYCA 5J48A 4QHZA 1NZIA 3A4UA 4JC1A 1LOGA 4NJ4A 2Q8EA 2D3SA 4OQ8A 2RS53 3Q8AA 2IC1A 1W9YA 5A6XA 1UPIA 4N90A 1OOPA 2JENA 2CU5A 1LTEA 1ZYBA 4EZ4A 2TUNA 4FPEA 1CAUB 5I8SA 1H2MA 2VNGA 3U4XA 2JDMA 4HETA 5DAQA 5GJ6A 3ZFGB 1R091 1AR83 2X5IA 4MHRA 5FZ3A 5GM0A 4HVRA 3VB9A 3WF4A 4AL9A 3DN7A 5BNNC 1NYWA 1UY3A 4BH9A 5KXBA 2V09A 1XXNA 5JLVA 2XJTA 4C90A 5FK8A 4HSJA 4PCRA 2P1BA 1A34A 3LA2A 5HPOA 5IJRA 4IE4A 1UXXX 1PGW1 4DXSA 1VMJA 2ARBA 5EIYB 1ZBA1 4XQDA 3LOIA 5FLJA 5T50A 4CPBD 1REEA 1RVF3 4CZSA 3JZVA 5JSOA 3BU7A 2R061 4RYDA 2BERA 2ZKLA 1F5FA 1JW6A 5D8AC 5GLVA 2G9FA 4YVWA 1N1SA 5IK4A 5K7PA 5FJKA 1DGRA 3WP5A 5JOYA 2D97A 1D0GA 1H8TA 2W95A 2XVGA 2OVUA 3I2IA 4FOYA 4V2VA 4ATEA 4BA6A 2ZGOA 4J25A 3PJYA 2I74A 4YGDA 2ZCWA 3UV9A 5A7SA 4CP0A 4BQWA 1F4HA 2QQUA 4RR3C 1RHI1 2E32A 1I1EA 4EN8B 2P37A 4XBQA 3O1UA 3ACIA 4DEVA 2RV9A 4FPOB 4CDQC 1U0AA 2O1QA 5FLHA 1RUE3 2R071 4AYUA 4KWUA 1VBE2 2YG0A 1GICA 3KQRA 2ZACA 4RFRB 1QJY2 2BW8A 2B4KA 3HMYA 3UK9A 4MZUA 2ZGRA 4GZ9A 1AJOA 1FNYA 1H2KA 3ETPA 3TNPB 1UZVA 3OCPA 3N3HA 4HANA 2PTMA 3POEA 2ZGSA 4FFGA 4NUBA 2AENA 2N7GA 3DXTA 5CFDB 4E27A 1W99A 1AR92 3GCXA 3THCA 2JDYA 1FT9A 3O0VA 3JD71 3I59A 4XDPA 5E8AA 5A6ZA 1LOBA 2AUYA 3CJIA 4O9EA 4OCTA 4ZHNA 1CAVA 4ZS3A 1H9PA 5E89A 1HW5A 3ZPYA 2O8QA 2ORZA 5FYUA 3AK0A 3SMHA 1YYNA 4CEWA 2D3PA 3J9SA 1BBT3 4MGSA 1NCRB 4FAGA 3ENRA 1ND3C 2HEYF 1HB2A 1LECA 3ZO0B 4JKLA 5L7OA 1S2BA 1MS9A 1SBEA 5FZ1A 4B29A 4Y1VA 1PGL2 5BY5A 2XWBB 4KG8A 1IZ3A 2VOWA 3T1MA 1IOAA 4AI3A 1N3QA 3MF6A 3S30A 3E5UA 2TEPA 4AHYA 5A3UA 1HN0A 2Z2SB 2Q4SA 2AEZA 2CDOA 3G6JB 1FV3A 1S55A 2C6SA 2HWD1 4CDWB 2IXIA 1I5PA 2IFRA 2Q1FA 1MEC3 2P3YA 3I59B 4GJZA 4IXLA 4OHXA 3VLBB 1V00A 1C3HA 3CJIB 4FPGA 2WSUA 5FAXA 5JVVA 3FC0A 4FTSA 3ON7A 1CAVB 2C4XA 2GH8A 4RSUA 4XJ8A 4G4FA 3N35A 1NLSA 4YVSA 1JHJA 2VMCA 2IXJA 3IIIA 5H9QA 3HQXA 4PDWC 3OTFA 2R0HA 4CEWB 3U37A 5FXZA 4BYYA 4EWEA 1GU3A 1DGWA 1XYPA 2WZR1 5FPXA 1QJX3 4AG4A 5A3WA 4DXZA 3DKQA 3MIBA 1IG0A 1Q43A 1UY1A 2DVAA 5SV8A 4LHSA 3KT1A 1IQDC 3I2OA 2VMDA 1H9WA 1MS4A 4Q27A 4AAPA 2R1BA 3SH3A 4FT8A 4JGZC 3MLKA 4XF3A 1RUE2 1ULEA 2EA7A 4BZ4A 4XJAA 1GUIA 2E26A 2WFPA 1FATA 4CE8A 4FBFA 5CAZA 3H9AA 2P6CA 3RYKA 3K4DA 3LD8A 4YG3A 5FXXA 1QIQA 4A4AA 1QWRA 2VMGA 3LDRA 1UW8A 3I3EA 4N8MA 4XDQA 4YVSB 2VY0A 5H9SA 3SHRA 3USUA 4UXAA 4TZDA 4AOCA 3VN4A 4RQPC 1HV1A 1ST8A 2VNRA 3VZNA 3WV6A 1COV1 2O14A 3FZ3A 5C6CA 4LBKA 4DNYA 1Q8QA 1VJ2A 2KM2A 2C26A 1W8NA 1JUHA 3QLQA 3DPRA 3VHNA 3VZOA 2EALA 5DAXA 4TLFA 4K3UA 5FMOL 4TXWA 4JRLA 4HSLA 4XJUA 3UGHA 1KD7A 4X6QB 5FPVA 4O65A 4IDZA 1BBT2 4QX8A 3GZTB 5DDJ2 5FPZA 5J3UA 1OC1A 1PX4A 2VZ3A 1PVC1 1UPSA 2PAKA 4C0HA 5FYIA 1DIWA 1SQ4A 2JWPA 5J37A 3D5OA 4S2DA 1V6KA 1QOSA 1I6XA 1Y9QA 3S6PA 3VDDC 3IDBB 5GZFA 2W2IA 1JZ6A 4Q1PA 1NY72 4LBOA 4GH4B 1WCQA 1GWLA 4XUQA 1HQLA 5GLUA 1RUC3 1RMU1 1V9U3 2FMDA 3MIHA 4FP2A 3VBUB 3NJVA 1RUD3 2ZHKA 5F6LB 1W3VA 3WW1A 2GC0A 2ETEA 4MSVA 4UFHA 3DPRB 5LK5A 2HEVF 1B35C 2NMOA 5BNNA 4JQRA 4QPIC 1W6PB 3J7NA 5C33A 4DUVA 5I0SA 1GP4A 2HBTA 1FPN3 2YROA 4UFMA 3MGUA 2QQWA 4KQ7A 1KITA 2XB6C 5HXVA 3KCXA 5FREA 5FY0A 2BWAA 3BIEA 1X50A 3AP9A 1ASJ3 5IUQA 4UWDA 5GLZA 3CLPA 3ZFEC 3ZIWA 1OUXA 2H6BA 1H1AA 2XJUA 2R6QA 1UD1A 3E97A 2BUKA 3B94A 5D8AA 5FZKA 3TN91 1NXD1 3B93A 3L9JT 4CU7A 3FLPA 4PLNA 1IQAA 2LM3A 3V0BA 1BMV1 3LSDA 5FZGA 3I54A 1SFYA 1MZFA 2B42B 1G86A 1W6OA 2VZRA 3ZLIA 3ZSEA 4AK3A 5C3RA 5FOBB 5LWBA 1XNBA 5IVCA 2VE1A 2B45X 3I3DA 4FFIA 1XSQA 4RR3A 1PK6B 3ZFFB 5KHHA 2DYCA 2R043 3PNAA 2GMMA 3T2PA 4IV1C 4JKKA 1JZ7A 4CDQA 2FDHA 5BUVA 4LBJA 1W2AX 5FP8A 4AFAA 4Q4Y3 1XE7A 3WQ1A 1N3OA 2WN2A 1CJPA 5BNPB 5HCAA 2BFUL 1RJ7A 1TMF1 2D7FA 2OX0A 2ZZQA 2RJLA 3J8F2 5A7NA 2VL4A 4B4RA 1MS5A 3CZUA 4LKSA 4MGKE 3WDUA 3PLQA 2UY9A 2RDNA 2WQ8A 2UWCA 4AI2A 2PMWB 4XUNA 4GWMA 2K2SA 2DCKA 3IM0A 1MS8A 2JE9A 3CHXA 1F5JA 4Z07A 4WV8A 1JYWA 2WFF1 5FMCA 2ZABA 1JYNA 4HKLA 2EIBA 1ULPA 3R4DB 1DFQA 3T09A 1R081 5C5UA 2HEWF 4E9KA 1BQPA 2JIJA 1QH7A 2Y60A 1O8PA 2ZGLA 4O7XA 1G9FA 1GFF2 2WS93 2WIIB 1RUC2 3MFAA 2V5YA 4LBMA 3GDBA 5G04L 1UMIA 1IPKA 4QPGB 1YFWA 1ND3A 2FDGA 2ZGUA 1UOGA 4LE3A 1QF3A 3V0AA 1RUD2 1ZX5A 2QQMA 4OYUA 5FUNA 4QGNA 1H6XA 4S2HA 2E6VA 1WW7A 2EF6A 3ES1A 4UFKA 1F4AA 3CJXA 5DUXA 3D3AA 3M2MA 1CPNA 1DQ5A 2UYBA 4IL7A 4LKFA 2QQIA 5LATA 2P6HA 3ZN6A 3RZMA 3H8RA 1V6NA 1QU0A 2A6VA 2GN3A 3LCPA 3D8CA 3W20A 1RL3A 5JOWA 4CXWA 1PGSA 4BLJA 4P9XA 1STMA 5FY4A 2UYAA 5T54A 2D43A 4LBQD 5FYHA 1OUSA 2KR2A 2XGXA 2VQ0A 5F2SA 2RM22 1VBD3 2GDFA 4UW6A 3WNOA 3BKZA 5J1XA 3J7HA 3DYOA 5DUUA 1K5MC 3NMBA 2XJVA 4PDWA 5HCHA 1Z7S3 4IEYA 3CL1A 5ABJC 1WA4A 2A3XA 4Y20A 3WVJA 2AEYA 3ILNA 1PZ9A 3KZ4C 3PMSA 3V0AB 4D7TA 3CU7A 1VPHA 2CYFA 2W47A 4IE0A 1HX6A 4QX7A 2W1UA 2W39A 3WUDA 3VD9A 4E8DA 4Q2FA 5CYYA 4ES9A 1UN1A 4BJ0A 1EAH3 4JGZA 1IPSA 2MPFA 2ZMKA 3VL8A 3BTYA 2A73B 1BKZA 2D6KA 2C1FA 2QDRA 1C28A 1WW6A 3CKHA 3OY8B 3WT3A 4BQ5A 1S2KA 3FN9A 4M4RA 5DXDA 2Q1ZB 3GF6A 2LTNA 3WHTA 3OGJA 1NA1C 4G3YC 3NNLA 5FZEA 4I30A 2E33A 5LBCA 4QB1A 4PDWB 2W1QA 1IPJA 3V56A 2B7YA 2GP5A 1HXS1 4RQPA 1OD5A 4Y20B 1UZZA 1PO21 2WLQA 3KV9A 4QPWA 4WVWA 3C7HA 1XNCA 4D6SA 5HBAA 2JB8A 3T4HB 3WEZA 1HRV2 1WLTA 1LGBA 2DF7A 1KFUL 4YZ4A 5HCBA 1EPWA 2PA7A 4BDVB 1GZWA 2F17A 5F3IA 5FK7A 3U78A 1GZ9A 2JICA 1RUF1 2DWRA 5SV5A 4ARYA 5FR3A 4HXCA 2VZQA 3BTXA 4PHZA 4UW3A 3ECQA 4HKOA 3LDKA 4OI0A 4TTGA 1APNA 3Q8EA 3VDDA 1QNWA 4YARA 5JAXA 1D4M3 4PLMA 3AZYA 2W9XA 4QB2A 3ZYIB 3N4MA 1QMJA 3NV2A 5CG8A 1HKDA 1VP6A 4RQPB 2XBO3 5FDBA 3VD4A 5T52A 3IMMA 3R4SA 1AR63 3AKPA 2WNOA 3I2JA 5ANQA 1WCUA 3N7MA 4UF0A 1KFXL 1RUJ3 1EV13 5CADA 2VZUA 3KLSA 1B35A 1V0AA 2LRPA 4JVAA 4C91A 4EQVA 3I49A 2AYHA 4QPIA 1G9AA 2YXSA 3WP3A 1GANA 4BQXA 4FFHA 2LALA 1Z7S2 1GZWB 2NPIA 3WDYA 1X82A 1R1ZA 3M70A 4QM8A 5FPBA 4XF9A 2C9AA 1N47A 2VQAA 4JTOA 4PIXA 4FOWA 1UY4A 1W90A 1AJKA 2PHLA 2WAAA 4KU8A 3ZFEA 4E4ZA 2WAOA 5T5JA 4XUTA 3R4UA 4FO9A 1EAH2 3ZOIA 4DINB 2RDQA 1UZWA 5DMYA 3MPBA 4BLIA 4ZONA 1WCSA 4LBQA 4YM1A 5DZFA 3P3PA 1MVEA 1MQTC 1KJLA 5GZDA 4H2AA 3OBRA 1O3RA 1W9SA 4HL0A 3ACGA 5L19A 4XTMA 1NE6A 1OVPA 3VD3A 1CIYA 3DL3A 3EHKA 4EN9B 1G9DA 3O1MA 4IV1A 4FI9A 1QJU3 4BE3A 3LEGA 3T0AA 1CX4A 2PAMA 4HKWA 4Y4RA 5A7WA 1R1A1 2RE9A 1DF0A 4LBNA 4MGTA 1GNHA 1C4RA 1SLTA 2WBKA 5AFEA 3K51A 2XONA 3NO8A 5G05L 2W91A 5B4XA 1HRI3 4ZU7A 1LGCA 3JBG3 3ST7A 4QX5A 2HLEA 2WN3A 5FY7A 3OBZA 1UXZA 4EYUA 1BCXA 1ULOA 2RR11 5FRAA 3VBRB 4QX0A 2ZGTA 3ACFA 1SMVA 3JCIA 4Y22A 1PO11 1UY0A 2GALA 2E7TA 4NMIA 1RB8G 2VOTA 5IVFA 4PF1A 2WINB 4Y1YA 1D4M2 2TNFA 3POIA 3S7EA 1D2SA 1ND2B 4Q8LA 2XBO2 4YZ3A 1FOD2 3WG2A 2SBAA 4YZ1A 4R9AA 4CCNA 5LBFA 1RUJ2 3RPQA 1BVP1 1EV12 3QCWA 5BNOB 1PNFA 1FX5A 3KHCA 3AP6A 3OPZA 2ZEZA 2F4LA 1VB4A 3RI9A 2RS31 2VZSA 1W8OA 3RMXA 2HWE1 2RS12 1MR5A 4MG2A 3POSA 1JU4A 4AZZA 1LCLA 5F9TA 4J1WA 1UY2A 1DQ1A 4DEQA 1MACA 3FL7A 2JB4A 2A71A 2GZWA 4Y5SA 3KV4A 1UMZA 1F8VA 3TYJA 2XUMA 1H1MA 4NROA 5KHIA 1K5MA 1TNFA 2E63A 3ORJA 2E51A 1NG0A 2QZ3A 1NZCA 4BQ2A 3ZSLA 5ABJA 5KXEA 1NLQA 4LUMA 5FZLA 1ZZBA 4L2NA 4B4PA 1AX1A 2R063 3WLUA 2Q8CA 3SEPA 2NM1A 4MLOA 2DCTA 1QXJA 5CFDC 5FO7B 3VBSB 5LA2A 3JB8A 5K9YA 1REFA 1W9WA 1ZRRA 3GBWA 3LEKA 2FQPA 1F2NA 2HWC1 3E6DA 5FQ0B 2HWB3 3ZKUA 2PELA 1L3JA 2V5DA 2W5FA 2A3YA 3H1MA 5E1RA 1JYXA 3ATGA 4GWJA 2ADDA 1RHI3 1X36A 1C1LA 1DZTA 3T3YA 1OSGA 2NMNA 1NA1A 5K0UB 2W68A 1HRI2 1H8VA 2J1RA 2VD7A 3NNGA 4AAXA 2BVVA 1NCRC 3KT4A 1VALA 2XKOA 3WR0A 3GBGA 2NYYA 3PDQA 5FZMA 4FPLA 1WBLA 1RUG3 1MZ6A 2W92A 5KC5A 1W03A 2XKPA 4K8FA 2WO1A 4XOGA 3WCSA 3WNKA 5AFBA 4UYBA 3E6CC 1S1AA 2EIEA 2VO5A 2NZ9A 3P6BA 2WZPP 5CG9A 1A8MA 1ZZ9A 2WNEA 5F5CA 3RDIA 3VKOA 4CDWC 2XH6A 1GQHA 2DUOA 3LPGA 5F5IA 1RJ8A 2VVEA 4OZOA 1Y3TA 4XDOA 3TRSB 3AYDA 3VBOB 3ZMOA 3JQXA 3LIGA 3PTYA 3OJBA 2WT0A 2ZHMA 3GYDA 3GJBA 2BDRA 5K4LA 4AXOA 1W6QB 3H42B 2XJPA 3N9PA 3NW4A 4BIFA 4ASLA 4XPVA 1RUNA 1R092 4ZXKA 1LRHA 2ARCA 3M4FA 2P3KA 4GMP1 5FZBA 1S0IA 3C7EA 1X8MA 2CHHA 1XPWA 2WNVB 3LA7A 4DY3A 1U5IA 1EUTA 3BU0A 1W8ZA 2PLV3 3MBWA 5A33B 1PGW2 3WZ1A 1S0JA 2P3IA 2X8KA 3THPA 3WG1A 4E8CA 1FMD1 1ZBA2 4LO5B 1I9RA 4BMBA 5J36A 3RZJA 5JI9A 1Y9MA 1N1TA 1YXWA 2F4PA 2GNDA 1AYM1 2R062 4I0AA 4W4ZA 3JB4C 5J7MA 4CSWA 1JI6A 4HN0A 2HBUA 3LA3A 2D6OX 4NN0A 4EJRA 1CR7A 4XABA 4Q4V1 1A8DA 2A75A 4YW1A 4NOTA 2MEV1 1LULA 2CWSA 3MDPA 4RL7A 1OT5A 2HWB2 3ZDVA 4CDUB 4D69A 4UFIA 2KXLA 2DU1A 1RHI2 1MQTA 5FZIA 2PN5A 3N9LA 2XLFA 4C1WA 2Y34A 4FPKA 2A5ZA 4AFDA 2E31A 2ILMA 2R072 2YV8A 3FLRA 2CTVA 2FHRA 4E4HA 2YC4A 2B9UA 4Q0QA 3H3ZA 1ACCA 1LHUA 1GNZA 1QJEA 4CYDA 1CAXB 4LJHA 4NIGA 3VHRA 3KV5A 1BEV1 3AZVA 1D2QA 2WNUB 1U5ZA 1YNAA 3B3QE 1DG6A 1PX3A 4GH4C 1CJDA 1SCRA 2BOJA 4QKNA 2VR4A 3DF0A 2BRTA 1POV3 2A1XA 2QNKA 3E5QA 4MADA 1XB9A 3KWVA 3RZGA 4LO4B 2R16A 3D82A 1CAUA 1COV3 3IDCB 5JZGB 3BPSA 4N7UA 3ZYFA 3VBUC 1W0PA 4LK7A 1RUI1 2ORXA 4W50A 4AE2A 2WT1A 5JOXA 2BNOA 3KVAA 1LODA 4A7KA 4CDXB 3RZZA 4E2GA 4J6GA 4FPYA 1UNBA 1OURA 5FZ0A 4AVVA 3PVBB 4QQ2A 5I0DA 1VMFA 3OUIA 2JKBA 2ZA9A 3WDVA 1S0FA 1SLIA 1YIPA 2K9ZA 2PXJA 4GD4A 4N9HA 4FTBA 4NPRA 1J84A 1D4VB 2VXJA 2A3WA 1O4ZA 1ZM1A 4XEZA 2BNMA 5BPXA 4PI2A 3WNXA 3ZR5A 4DFSA 3AYEA 1G6NA 1JN2P 1CGPA 5C7GA 1OFNA 4A7YA 1RXGA 2PLV2 3BCWA 2FCUA 3I8TA 3MYXA 3MLLA 4Q0PA 2HWD2 4OQ9A 1W8UA 2ADEA 4BQ1A 2ARAA 3ZXFA 3NL1A 3C7FA 1NT0A 1W8FA 4B1MA 1V6MA 1AYN3 1PK6C 1UWWA 3ZFFC 3EXUA 4A44A 2YMZA 5FZ8A 1O3SA 3VBFC 1ZRIA 4YGEA 4YRDA 3PUAA 5T55A 3KM5A 1MS1A 4E4SA 1AXZA 4FOVA 2WZR2 4YW7A 5BNPC 5FFOC 4TSVA 3BN6A 1JUIA 4UBHA 3O5SA 4XUPA 1LEMA 3AJZA 3MIEA 4R4XA 3LSEA 3WF2A 3P5BA 1YWKA 1DYKA 1C1FA 2H6CA 4ZZ8A 5EQUA 1V70A 4GKXA 4NHXA 5CFDA 1DDLA 5C8CB 1N1YA 2YC2A 2RJ2A 3RVHA 1CESA 5FTTC 3B69A 1UZYA 4D6RA 1Q56A 4Q4W1 3K2OA 2EAAA 2XJSA 4Y33A 3OYWB 2J7MA 5FYVA 2XHKA 4RFT0 4MXVA 5JSPA 2JXAA 5DABA 4LIUA 3BI3A 5T3NA 2JDNA 1GP5A 2BBVA 4K6BA 4XJ9A 1COV2 1LHNA 1NCRA 3BIWE 4QPGC 1JTZX 5A7OA 4ES8A 3NAPC 2A6XA 4AQ2A 5C3OA 4AFCA 5LA1A 3VV1A 5I93A 1M06G 4R9CA 2CSGA 1UOBA 4NPLA 5FO9B 2YU2A 1TG7A 3WW3A 4MGYE 2TBVA 5LEKA 1OKQA 2ZGQA 1G8WA 2Q5TA 2YBKA 3T0DA 3RSJA 3WNLA 3OPTA 1NUKA 1HB3A 4QQOA 1KQRA 4CDWA 1H4GA 5EJZB 1KXGA 1U5YA 4IE7A 4BISA 3PIJA 3OUJA 1OLMA 5DZEA 4XURA 2VMEA 3U07A 2WFF3 5IYYA 2ZX4A 1TME1 2A6YA 3AP7A 3O1TA 2DBNA 3P1IA 1WWYA 5D21A 2BGPA 5FXVA 3WDWA 1US2A 4BQYA 4I3GA 3DV8A 2QTWB 5F3GA 2YZ4A 1HIXA 1CN1A 1ENRA 2BTVC 5LRSA 1RMU2 2GNTA 2Q30A 3H7YA 1AXKA 3OUHA 4MVTA 2VBPA 5DDJ3 5FZ6A 3VD7A 4EV0A 1LU1A 5AC91 3LWCA 1AYN2 2JD9A 1LNSA 3OGGA 3ILRA 1O6UA 2XDVA 1GKBA 2VJXA 3WNMA 4K20A 4RHV1 2WLPA 4FPCA 5K8SA 1OHFA 3HQUA 1BYHA 1OQDA 5FP3A 3UYJA 1ULFA 5BV6A 1ZA7A 1VAVA 3K77A 3VBHB 1RUH1 2VZ1A 1OD3A 3GZAA 2BVBA 4YPJA 3T2QA 4DIQA 5LY2A 4KBBA 3CMGA 4RGAA 1JZ2A 3HT1A 2W0XA 1RTVA 2W52A 4LTAA 3TN92 3H1WA 2YBSA 4FP3A 4ARXA 3HT2A 1BMV2 3HBKA 4W6YA 5FZCA 1Q8VA 2JDZA 1F15A 3WY6A 5ACA1 1BHGA 2WDBA 1H4HA 4IGQA 4IEVA 1KGYA 3VD5A 1S0GA 1QQP1 1KRIA 4WVMB 2GH2A 1OMIA 1UL9A 3UJOA 2VTXJ 3OPWA 4XBNA 4P5HA 1Y7BA 3O1SA 4AGGA 4NPMA 1TMF2 5CEHA 3N7LA 4DRVA 1UF2C 2DVGA 4P9IA 3SKJE 1O5UA 3GZEA 1J3QA 2WYFA 4CUBA 3JU9A 1W6MA 2BZDA 3AMQA 4P5YA 1PIV3 1TEIA 4GH4A 4GXLA 3WQ7A 2DCZA 3AP4A 2BBAA 5FZAA 1PM4A 1SEFA 3D4KA 4QMAA 4ZZ5A 3NNMA 4PBOA 1ZNPA 1PO23 2GP3A 1MZEA 4PQ9A 3VBUA 3VZKA 3POWA 4Q1RA 2WFF2 1JZ8A 4MOAA 4AQ6A 4OI1A 3J8F3 2ZEWA 4GALA 5J98B 4LA2A 5LBBA 1UU5A 4N53B 2DVFA 1W6PA 4AGVA 2JDAA 4MO3M 4Y4YA 1PMJX 4AI9A 3UKTA 2Y6HA 4JDNA 4AVTA 2A70A 4P14A 1YUDA 3K3OA 4C1XA 3WQ0A 3O1OA 3K48A 1W9TA 4QPYA 4R4ZA 5A1FA 2CWMA 1W6MB 2IFWA 3DYPA 2GNBA 2XXZA 3VDBA 4NIHA 2V72A 4MV2A 5A3OA 2PHUA 1C8M1 2GMPA 2D6MA 3W59A 2D6LX 3CEWA 3AX4A 1VRH3 4CEYB 1UCXA 4AEDB 2WWUA 5GLWA 1AR91 1PK6A 1W2UA 3ES4A 3SQOA 4NVPA 2IVIB 4QQPA 1AR71 1WUVA 3ZFFA 5FCCA 3VBFA 5JMOA 1WMXA 2BOIA 2GAUA 3IWZA 4FFFA 3FJSA 1SCSA 2RS51 5FMDA 1QXPA 3FFQA 4Z92B 4WVVA 2XJQA 3ME2A 1ODMA 1DP0A 1KS4A 2BQPA 4BM8A 4CU9A 4F3JA 5BNPA 3ZXDA 1O8SA 1XNDA 1IS3A 2EVXA 5A1AA 4META 2X29A 2RMU3 4N7IA 1O3TA 3M3QA 3JXSA 5H9PA 2RM23 3KF5A 3H3UA 1AR81 2C9KA 2Y0IA 5CFCB 4YW6A 3USSA 1NLRA 4WM8B 1QNYA 5LK7B 3IDAA 4KL1A 3RYRA 4Q4X1 4UOJA 3DXUA 3VBRC 3X29B 3T2OA 1PGL1 3R05A 3UESA 1W04A 4D8MA 2AGSA 2IVJA 1AL21 2VZVA 1F35A 3VUOA 1JHNA 4XAEA 4YW4A 4DO0A 2JE8A 1O5LA 2JDUA 3VL9A 2IUWA 3ELNA 3VBFB 1PIV2 1RVF1 3ZSJA 4KWJA 1ND2C 1LHOA 4QXKA 2WQZC 3K3NA 5F3EA 3TEWA 4FPFA 1PO22 1SLBA 4QPGA 3C2UA 3EYPA 3NAPA 4HBNA 3LKJA 4K9SA 4XILA 1JXNA 5BNOC 1CZVA 1SDWA 2OIIA 1IGOA 3HNMA 1WD4A 5JWPA 2D40A 3K46A 2V4VA 3Q8BA 1OH4A 1Q8OA 2Y33A 1SG3A 2EICA 2YB7A 2DURA 1SPPA 2VMFA 2ET1A 3MEPA 4TLGA 4CCDA 3H3LA 3HWJA 5JIAA 1Q5OA 3U4SA 3M3OA 4QKDA 1KDMA 1RIRA 4XHBA 2YC0A 4L92A 4AQTA 4XFHA 1PO13 1W8WA 3RZLA 1HRV3 2DTWA 3Q8FA 3E5XA 4LA3A 4Q26A 5JXJA 5BNQA 4L9BA 1A78A 1GLHA 3TOJA 4U2AA 2QBXA 4NIIA 4AHXA 4HK9A 1WCDJ 2ZXQA 1RC6A 1VRH2 1XQNA 3NAPB 2DFBA 1S2EA 1QHDA 4UW5A 5FP7A 4LIVA 4XCAA 5FP4A 3BB6A 3VBSC 1C57A 3ZXEA 1YFUA 5JPMB 2Y6JA 1VR3A 5A7PA 3BTZA 3PHMA 1SPPB 3POFA 4XCBA 3PUHA 1HB1A 3OY8A 5T5PA 3ROUA 5FZ4A 2ZTNA 1K45A 2GMEA 3JQWA 3MIGA 4D3WA 3MZHA 3K75B 3NSTA 3ZR6A 2RMU2 2EAKA 3ZYRA 2W1SA 2HKXA 3RNSA 5K0UC 4X8NA 3UKNA 2WWJA 2J1AA 4QKBA 5IHRA 1SFPA 1UYPA 2VAUA 4JV4A 4XIKA 1VBC1 4XZUG 3ILFA 4XETA 5CU1A 4HK8A 4RA0A 3M3IA 4CCCA 3GALA 1BXHA 2Y6KA 4Y5Z0 3I2FA 4BU2A 1UYXA 4Q29A 3OGRA 3AL6A 3MICA 3IT8A 1DZRA 3C3VA 3IDEA 4JQTA 5IVEA 4JHTA 1MEC1 2YFUA 1YFXA 2K46A 2PHFA 2Y0OA 2AC1A 4MUVA 2HWC3 1W0OA 1G9BA 2X09A 3B7MA 2VOXA 5KWRA 1JZ4A 3V64A 4CCJA 2SLIA 2BV4A 3KGZA 3ZXLA 1POQA 3POJA 4CA9A 4HVOA 1UU6A 3VBOC 2QQOA 3VKNA 1CAWA 5KR7A 4DPNA 2D6PA 1WMFA 3S5QA 2BNNA 4M00A 3HR9A 3VKMA 3F95A 1QJX1 3RZKA 3WNPA 4M3CE 1IS4A 1M4WA 4O61A 5T5LA 2PQQA 4LPLA 4AEKA 4YZ2A 4KI5M 2JDHA 2L9LA 2WABA 1RYYA 1QKQA 2I2SA 4MGZE 4X8PA 3NJXA 4CP2A 1PO12 4CP1A 2WNVC 1E5HA 3OD0A 4B3NA 1L7RA 4HONA 5FYSA 4P08A 1RINA 2OUHA 4P9WA 3U0ZA 3HVDA 1ENQA 3HNYM 3PL0A 3KVBA 4JZRA 1IS5A 3AFGA 4FOQA 2R0FA 5JDBA 3S0MA 3LAGA 4WM7C 3EO6A 1CAWB 2JECA 3APBA 3PTRB 3NJZA 3ZSKA 5KHJA 1W2TA 2J22A 3RGBA 1VBB3 3OOXA 5FKCA 1J58A 2ZGPA 1POV0 2R7EB 5F37A 1X9PA 3ZYGA 2RS32 4CDUC 1YO8A 1AVBA 4NAMA 4QXHA 4CCKA 1FOD3 2XOMA 1GZCA 5A70A 3NKGA 4GMP3 4DMIA 2C5DA 3G7DA 3VGIA 1PMIA 3WF0A 4QAWA 2W3JA 2W1WA 3IB3A 3AVSA 3OD4A 1GYKA 4B7KA 4QDSA 4TWTA 1WLWA 4URTA 1DCSA 4MX3A 1OQEA 1ZRFA 1VAMA 3WW4A 4SBVA 4YG0A 1YEWA 2RS13 1O4TA 2Z79A 4NAOA 3LF7A 4ITCA 4XFAA 2LS6A 1ULCA 5DAWA 4M0HA 2WNUC 3RFRA 4PBPA 3RJ2X 3EQEA 4JX0A 1QJFA 2XQXA 1JZ5A 1D0HA 1WD3A 3K4AA 1V9U1 4Q4V3 3O14A 1ZZ7A 3A23A 3E6BA 4J1XA 5FYTA 2HWC2 2ZMLA 5JZGC 3GHMA 1HB4A 1RUD1 3Q9OA 5ERLA 2B8MA 5H9RA 1OQ1A 1W3XA 3VBRA 1VBA1 1WLCA 2WKKA 5DG1A 4CDXC 5FMBA 5FZOB 1FPN1 2P4EA 5IK5A 1O7FA 1XU2A 2DV9A 2JEMA 3UL2A 3WX5A 1PHMA 2CGPA 2ZS6B 4BHPA 1ASJ1 3D0SA 2EXHA 3KS7A 5APAA 1ND2A 2VW1A 1WW5A 3HJRA 1S4CA 4LORA 1BEV3 4URAA 5GKAC 1PZ8A 1DYOA 4NRMA 5FMOS 1FNZA 2ENRA 5FPLA 4QQLA 4RN5A 3KF3A 3TEZA 5BNOA 3LIHA 3UJQA 3PVEA 1CWPA 5JIUA 1CX1A 4LKDA 4QKFA 4F7ZA 3LDBA 2CAUA 1DHKB 3W9AA 4PQQA 4TYSA 4C0BA 5FYYA 5JMCA 2R041 4OUMA 2IZWA 4GB33 1UX6A 2Q0AA 3AMPA 1QH6A 3GM8A 3W21A 2CGNA 2YU1A 4DRRA 1LOCA 4Q4Y1 4YNIA 1VBB2 4MGQA 4NHMA 5DPNA 3BVCA 2X05A 5GZEA 4Y24A 2HWF1 3LQCA 4I02A 2WRAA 1LOAA 4Q0UA 1VIWB 4YYOA 1GP6A 2RG4A 4AW7A 3U1XA 4NE9A 3CIHA 1VAKA 2I07B 3AXEA 2J42A 3WQBA 3I7DA 3T0BA 1S0BA 3VBSA 5C8CC 4X6RB 4LLOA 5L9BA 2VTXA 1YC61 4AI8A 3RWNA 2R1DA 4YLZA 5FQ0A 4PLOA 2EXJA 2WZ8A 3H0OA 3KCCA 4IGPA 2QE3A 2XLGA 4JGYB 5FY1A 4YGBA 1R093 5KXDA 3N9OA 1AYM2 3RZHA 5FV3A 1JOPA 2IXKA 4CCMA 4JDOA 2WS91 3RRDA 1YI7A 4LMFA 5HCFA 4CUAA 2UU8A 5C70A 4H7LA 5B4NA 4Q4V2 5K0UA 5I0RA 2D98A 2HYKA 3FHAA 2MEV2 3WSOA 1YCIA 1AL0G 1ZBA3 4QWNA 3SITA 1RGSA 1GZTA 1Q3EA 2DCJA 2VQTA 3LFMA 3PVOA 1GNYA 4OLLA 4ZU5A 1NQJA 1HV0A 3B01A 1OLQA 2OS2A 3J26N 4NO4A 4XF1A 4A41A 3WF3A 2ZHLA 2OPWA 4KGQA 2DTYA 2LROA 4OFGA 4QU2A 2FDIA 1WLDA 1J59A 5KXCA 4Q0VA 3ZSMA 1DQ2A 2P5BA 2YPJA 3CBNA 5F8PA 1VBD1 1ULDA 4GKYA 5F5QA 5FY5A 3PU3A 1BEV2 3N9NA 3VZMA 3VBOA 2E9QA 5FP9A 3I2HA 1CPMA 5A3NA 3NV3A 5FZ7A 3NV4A 1JYVA 5LY1A 2ZX0A 3O7OA 3SXWA 2GNMA 2X10A 3ZN4A 4DQAA 2JG8B 4KNCA 2R073 2BPA2 1W6QA 2ET7A 4XACA 4IGOA 5I91A 4DUWA 1LENA 2OQ7A 4PF5A 4IEOA 4YFZA 3C7GA 4S2GA 1SBFA 2D93A 1RUI2 1T2XA 3MI8A 3VKLA 3WCRA 1W9FA 4L97A 4P9LA 3VHPA 1B09A 5GLTA 4I01A 4COVA 4GB32 2WR9A 5JPNB 1JYTA 4EWDA 3AVRA 2ZX3A 2WNVA 2WA4A 4XBLA 1K3IA 4B7EA 2FBEA 2CY6A 4Y26A 4LXLA 5A33A 4MXWA 3VBHC 3KGLA 2VBDA 2JJ6A 2H0BA 3JD73 4PI0A 1GWKA 4ASMB 1I5ZA 4XF4A 5FZFA 3WDXA 3I2DA 4WM7A 1YRZA 3AB0A 1BJQA 1TME3 1LESA 5BXXA 2F6BA 4W6WA 2B39A 4P9JA 3Q8CA 5C9AB 4I3PA 2QJVA 3AKRA 3ZN5A 4GWNA 1L7LA 2MNGA 1SHWB 4XFGA 1GOHA 4M0NA 2XR4A 5FZ9A 4CDUA 2PHDA 1S0DA 1ALYA 2H0VA 2QQNA 1NCQB 2ZGKA 3MHZA 4IEUA 5F6KA 4BOWA 5LEJA 1V6OA 2WO7A 3CF6E 4L0PA 2YPDA 2XPJA 3AZWA 4O9GA 4XXPA 3ZYJB 2WJSA 4A2UA 3A0KA 4RHV3 1ZBE1 1YQCA 1ZVFA 2VMIA 2XWJB 2HWD3 4MXWB 3POYA 3UKVA 5C3QA 1RUH3 1SFNA 5L73A 1CAXA 2QVSB 4AFMA 5F3CA 3VKFC 2LUWA 4WM7B 2WNUA 3URFA 3L2HA 2CV6A 1TQ5A 1DQ0A 4AQSA 4BWOA 3B02A 2XBO1 1QXRA 2VNOA 3CDZB 3LGRA 3DUIA 3FWEA 5I0UA 3ZXJA 5L36A 3EB7A 5J09A 3BUCA 4NHKA 4EROA 1AR61 4H7MA 2WZR3 3A21A 4GIQA 3GNEA 5JZGA 1W05A 4CXYA 5ACA3 4Q4W2 3PMEA 4XIOA 1SLAA 4K1ZA 2WYSA 4ATFA 4IESA 2G19A 2HYXA 4CDXA 4N53C 4NIAA 5M0TA 5EHDA 1J3PA 1OBNA 2FDJA 2WUHA 3IAPA 3MW3A 4AVCA 4YWAA 4NR1A 4Y1XA 2G9ZA 5C8WA 2ERFA 2QQKA 1UKGA 2VG9A 4XMIA 3QD6A 1JYIA 3QBQA 1NE4A 1US3A 4LITA 4EZHA 1AXYA 5C71A 4B1LA 2J1UA 5FPAA 1WKYA 1Y43B 5FY9A 3CZJA 2QQLA 1H2LA 5JSRA 2BYVE 3JD72 4EN6B 4IV3C 2P34A 4CEYC 3LEMA 4AEDC 3O1PA 4H55A 4Z2AA 1PM7A 1LU2A 1TME2 3SEEA 2VC9A 1QJU1 1FYUA 4WZFA 4DUXA 1HQNA 2Y64A 3O1VA 1FI2A 1BVVA 4XYXA 4XFCA 5JXHA 4HFSA 3AP5A 2R32A 2JX9A 3HPNA 2JDKA 4JAAA 3ZXKA 1BZWA 4D0QA 3KHBA 3NQHA 3M3CA 5DN2A 2B46X 4IEPA 4XXAA 4D94A 1HLCA 1PVC3 1EUUA 4R8HA 1NKGA 4AHZA 1OFSA 3JBG1 3O0WA 3POBA 5E88A 1XOYA 2VUCA 3ZYPA 1UOFA 2IXLA 3AMHA 3OBAA 4RHV2 1UYZA 4CU8A 4OI2A 4WBBA 5C8CA 4WM8C 5CFCC 5IVJA 3IPVB 4BK5A 4FTEA 1C8M3 4Y5TA 1FXZA 5D2AA 5LZ6A 1URXA 1RMU3 2JG9B 2Y6GA 4XQ4A 1ENSA 1RUH2 3FFZA 4UI9L 1VLNA 5JR2A 1GBGA 3OYWA 3RQ0A 2VZTA 1F31A 1W06A 1GQPA 2YY1A 3HBZA 3OEBA 4XW3A 2ID4A 4CCOA 4QX1A 3PUIA 2ATFA 4YM3A 3S57A 5A80A 1Q8SA 2VCBA 2FDFA 4BCUA 5CVRA 2YHJA 4A3ZA 3FBYA 3KQ4B 4HZFA 2BJSA 5FYCA 4YSFA 1C5IA 5ACA2 1UQXA 3BTAA 3TEXA 2QDNA 2ZZJA 3PJQA 5A3MA 4L11A 4LEJA 1XBFA 3WP4A 4GWIA 2XVKA 1QQP2 4YFWA 3TN93 4L8QA 4KGGA 4F8AA 1YJKA 4RS5B 5KBFA 3I3BA 3NNJA 5LCWL 3DEMA 5C5TA 1IS6A 4Q4X3 2CDPA 5FJHA 1DZQA 3WG4A 1LGNA 2VM9A 2JE7A 3ZYHA 5JXIA 2ZX2A 2G4IA 2PHWA 5A32B 1YHFA 1AL23 4M4PA 4OHWA 5FZHA 5E6HA 2FD8A 2Y26A 1J3RA 1TVGA 2WQ4A 4FQZA 4DB5A 5I8TA 4INDA 2QFEA 1J1LA 4KWLA 2BU9A 4AVSA 4DS0A 4XFBA 1XYOA 3T2TA 2D5FA 4IQPA 5FKBA 3I2GA 4YGCA 2FZ1A 2RDRA 4LBLA 4K40A 3GCWA 2A6ZA 1OOPB 1TMF3 3PUQA 4M3CF 4K7JA 3N7JA 3PVNA 3IZOA 2QCSB 2B5HA 1DLCA 2QKDA 1LHVA 2HWB1 3AMNA 2UWAA 4XAAA 2X5IB 1EYBA 1X8EA 4Q8KA 5IAXA 4K8RB 3ASIA 4BB3A 1RITA 3ZDSA 3CQOA 3M1HA 3POGA 2DUPA 3AKQA 3VBHA 5ANNA 1R64A 1KEXA 2QQVA 4GULA 4A6OA 3LOBA 1PVC2 2ARXA 5EZWA 4R52A 1W0NA 3UGFA 1U12A 4CCEA 1R083 2ZKNA 4H3WA 3H1YA 3QH6A 1RUG1 5B2GB 4QHOA 1D7PM 1C8M2 4FPHA 2P2KA 1OKOA 1EPZA 4YVWB 4BXFA 4NIDA 4ZS2A 3RMYA 4OHYA 1H8TB 2DBIA 2KD7A 3UGGA 5FBJA 4IETA 4OZXA 5A3PA 1AR72 1OA4A 1LOEA 5CKQA 3EMRA 1X9TA 1S0EA 2HJIA 4WVMA 4W65A 2RDSA 5JUVA 1PNGA 4MGIE 2RS52 1W2OA 3OEAA 5A7QA 3W5NA 1UMHA 4SLIA 1H0BA 3J7LA 1MZ5A 5I0TA 4V2WA 3FBMA 1VE0A 5A6QA
chains in the Genus database with same CATH topology
1SACA 1OA2A 1AR82 1CVNA 1N3PA 1VBC3 2IXHA 2VW0A 2PAEA 4Q4X2 3WXPA 4Z1VA 1BK1A 3NKTA 1DGRN 3DKWA 2ZPXA 1O3QA 1A3KA 4I2OA 1AL22 2PLV1 1OI6A 4GMP0 1G9CA 4S2FA 2JD4A 4N53A 1RVF2 2Y38A 2Z5WA 2NP0A 2YYOA 1W39A 2CGOA 4HLTA 3QOPA 1I3HA 3I4IA 2VOVA 2WSVA 2ZJCA 4E4DX 2DUQA 1T6GC 1NXMA 1DBNA 2RJKA 5JR7B 5A3LA 3TBDA 1TE1B 1VB2A 4BMEA 1ZA4A 2GC1A 4IERA 5L7OB 2WWSA 5IK7A 1DGWX 1HXS3 4ONUA 1OA3A 2VOKA 3FHIB 4IV3A 1EY2A 3SLIA 4CEYA 2FZ2A 4AEDA 2XL7A 4LO6B 4JRAA 1XRUA 1DYPA 1V6IA 2E7AA 4UBGA 1R082 5DUVA 4Y1ZA 1FAYA 2Z69A 1RUOA 4XJZA 4FXGB 1RUF3 1SBDA 3D6EA 3W58A 2OZ6A 1POV1 4DZGA 1VBE1 4D7YA 1QJY1 1XNKA 2P17A 5CFCA 3IIAA 4DOUA 4WM8A 1YJLA 4UW4A 1QOTA 4COZA 2WA3A 4IV3B 4B4QA 1CONA 1LR5A 2ZX1A 3U11A 2XLAA 2VMHA 1Z0HA 4LHKA 5LRRA 3WOGA 3QACA 2A6WA 3MPPG 1VBC2 1HQWA 3WD5A 2P3JA 1W6NA 2GU9A 3KCYA 4K21A 4OUSA 1DQ6A 3RI8A 3USUB 3H50A 1AUYA 3EBRA 3TNQA 1IKQA 4NWVA 2VXRA 1MEC2 2AR6A 1PVXA 2VVDA 1LKNA 1AYN1 5EJ3A 4D7SA 1WMEA 1VBA3 4AI0A 2V73A 2WT2A 2D6NA 2Q1MA 1OPMA 4FVVA 1CD3G 1QJX2 4I09A 1HXS2 5GALA 1FV2A 4DY5A 1W6NB 3MLJA 2ES3A 3BODA 1R1A3 2G9GA 3MF9A 2PFWA 2R30A 3WHUA 4Y1UA 4IEWA 2ZBJA 3OF1A 2I45A 4WVZA 4A3XA 3ZIXA 3B9CA 4JGYC 2C0ZA 3KD4A 5BNNB 2VU9A 1RUF2 2RR13 4YZ5A 4FPJA 3LZZA 3WINE 4AI1A 1RUE1 1DU3D 4OI4A 5GZCA 1V6LA 5D1IA 2HWF3 4WZCA 4NWWA 3GBFA 4N43C 5D8AB 1AF9A 5CB7A 3V0BB 2Z42A 4N9IA 1W6OB 1HDKA 1S0CA 1CIWA 2WC2A 3DGTA 4LNVA 2RS33 2UWBA 4RR3B 2HWE3 4HMZA 2BEOA 4MYEA 4FXKB 4CDQB 1GV9A 4XHXA 4XF0A 1BBT1 1V9U2 2JG8C 4EN7B 5DDJ1 1ZREA 2D44A 4ZU4A 3TAYA 1XYNA 2OYZA 3AZXA 4FCAA 3P3NA 2ZGMA 1NY71 1VBA2 1FPN2 1QDCA 3RG0A 1MS0A 1ASJ2 4ORFA 2D3RA 4QGMA 1KS5A 4AEJA 1J1TA 1G7YA 2QUOA 1E57A 2PHRA 1R1A2 1ZZCA 2E7QA 3MW4A 1C8NA 5C9AC 4E2SA 2X53S 2QZ2A 5AVPA 3NWKA 2YUEA 5CA6A 1ND3B 4ZKTB 3J4UH 1LEDA 2FMYA 5EFUA 3WG3A 2KA3A 1NCQC 1X7NA 2RR12 4GA9A 4I0BA 4XQWA 2R042 4KU7A 1MS3A 5IK8A 3IN9A 4M01A 5AVAA 4HVQA 4LLFA 4IEQA 3FX3A 5EV7A 3ZN6B 4CRQA 4XZPA 2BGCA 3THTA 4Q4Y2 2HWF2 4AWDA 4A7ZA 3NV1A 1UU4A 5F1RA 2NQYA 1PIV1 3SNMA 4Z2WA 4XE9A 4Q0SA 2XJRA 5TSWA 5FOJB 4LHLA 2PHXA 5J96B 4Z82A 3GZUC 3OBTA 3SCHA 2HWE2 3FE5A 3INAA 3J8F1 1LB2A 1X33A 3H8UA 4FQ4A 1GQGA 4KG0A 4LO7A 4JGZB 2WS92 2OPKA 2VVFA 2R49A 5FBZA 1ZZ8A 1ZBE3 3D0JA 1DGLA 1ZZ6A 4XMAA 3U10A 1FMD3 3KSCA 1REDA 2OUJA 4E2QA 1AYM3 4G9SB 1AX2A 3KT7A 4AEMA 5JCTA 4PIYA 3FMGA 3VHOA 1RUC1 4HPKA 1QGLA 1QDOA 2YGMA 4PIZA 1O4YA 1EP0A 1VRH1 2MEV3 4XFFA 2ZAAA 3RYPA 3TWIA 4LUKA 3SCFA 4AF9A 1CQ9A 2PHTA 1VBD2 5C4WC 3CO2A 5T5OA 1GR3A 4YW3A 3AYCA 2VGDA 4KH9A 4YW5A 1YFYA 4QD2A 4HN1A 1DLLA 1MVQA 3WW2A 2IXCA 2RMU1 4Z8BA 3GHNA 4RGGA 4FSJA 2O0OA 1YI9A 2RM21 2CAVA 4QGLA 3VDDB 4IEZA 3NVCA 4FAHA 1UIJA 3B00A 4YM0A 4R9BA 1JH5A 4HPKB 1IKPA 4L99A 1N1VA 3N36A 1UKRA 2DCYA 1Q8PA 2JG9C 4BIOA 4COWA 3HD8B 4MH0E 4JGYA 4P9YA 1RUI3 2IWGB 2GSYA 3V65A 3TB0A 1B35B 2AH2A 3ZVXA 1WMDA 4F83A 3KB5A 4QPIB 3ETQA 1YIFA 3AKTA 3A0NA 3BOWA 2PYTA 4B8EA 4AGRA 1PZ7A 3ZFEB 1QOOA 4HT1T 1AX0A 3AYAA 2NLRA 4N43A 3AXDA 3L2YA 1AHSA 3ZFGC 1LOFC 2A7AA 3BALA 1DQ4A 4LBQB 1ZBE2 4RS5C 5KHGA 2OW4A 3AM2A 3B5LB 2AREA 4PJYA 5DZGA 3S7IA 3WDTA 1FMD2 2E53A 1WW4A 4COYA 1OPOA 3HN1A 1HRV1 4RD7A 2VPVA 3BOPA 4GQ7A 4EN0A 5IT6A 1WBFA 4IV1B 2O8OA 4P9GA 3MIFA 2VW2A 3IMNA 5JOZA 2XL9A 4KWKA 3RJRA 2JG8A 2EXKA 1AZDA 3N7KA 1AR62 1TNRA 2VULA 1KDKA 1OOPC 2D5HA 2XVLA 4N43B 4LE4A 1QJZA 2W08A 3AJYA 4H14A 5I8YA 1U5XA 3AKSA 1QY4A 2X5IC 3M3EA 1OLRA 3AZZA 2AZ5A 2VUAA 4Y22B 2BFUS 4Q4W3 2ZGNA 1XU1A 3FUQA 4OHVA 4ISRA 1Z78A 1KJRA 1Z7S1 5C9AA 1YLLA 2EXIA 4EWAA 2EIGA 3O0XA 5KC6A 3KMHA 5HI0A 3JUUA 4YVWC 1ZRDA 2MHFA 1NCQA 4JTNA 1H8TC 3SH5A 1H1IA 1EAH1 4JDMA 3MIDA 1QJU2 2ZHNA 3O12A 4OHZA 4CTEA 3ZMNA 3VZLA 2YDEA 1ENXA 2NN8A 5FO8B 2QQPA 2XG3A 1LHWA 5JI7A 3H7JA 2GN7A 3JBG2 3SCGA 4LO8A 1K5MB 5CNAA 2VECA 5ABJB 5KHKA 1NQDA 3MFCA 1XE8A 3LB9A 3ACLA 4YW2A 5E16A 4AHWA 2GC2A 2YGLA 2VH9A 2UURA 3R6SA 5AC93 4QQHA 3FUOA 4IEXA 4AFBA 3M8LA 2GC3A 3WP6A 4QT6A 5DUWA 3SISA 2DFCA 3CJIC 1ZRCA 4W6XA 2K0GA 1UIKA 1NOVA 4LHNA 2Q8OA 1ULGA 1NA1B 2UY8A 3RS6A 3IKWA 3CNAA 1ONAA 4R9DA 2OA2A 1VBB1 4CEWC 3MW2A 1D4M1 3IBMA 4OULA 3ZXGA 4XTPA 3HAGA 2ZMNA 4YM2A 1WGPA 2OZJA 5EWSA 4QM9A 5L7OC 4LR4A 1FOD1 3ALQA 5DG2A 1V6JA 2RHPA 4LT5A 5CBLA 2ZAHA 1RUJ1 1EV11 5C4WA 1C5HA 3WUCA 3M7AA 3T1LA 4OVEA 1QQP3 2CNAA 3HIFA 4QHBA 4V1PA 2RS11 3ZX7A 2DVDA 4M3CA 4COUA 1F9KA 4BPZA 1H30A 4YVSC 1JOJA 1SLLA 4XJWA 3AMMA 4YG6A 2CL2A 5EXOA 4AVBA 1GSLA 4AVAA 4NHLA 1H2NA 3EJKA 1A6CA 3FLTA 4U36A 3IPVA 4JCKA 2DU0A 3ZXAC 2JG9A 1SLCA 1JBCA 5EYYA 3QH7A 5C4WB 1O91A 3B9IA 3AFKA 3R0RA 4LULA 2VUJA 1IHMA 3BPZA 4ISQA 4M3CB 1RUG2 1UAIA 2BWCA 5AC92 1HRI1 2DVBA 5EYXA 1VBE3 1QJY3 5FLIA 3ZFGA 1LOFA 4XFIA 3VZJA 2WL1A 4RS5A 5GZGA 1MQTB 2ZOEB 3DPRC 4I0WB 1LJ7A 4GB31 1WCKA 5A32A 5CIRA 1AR93 3SH4A 1AR73 4K1YA 1JYCA 5J48A 3A4UA 4JC1A 1LOGA 2D3SA 2RS53 2IC1A 1UPIA 4N90A 1OOPA 2JENA 1LTEA 1ZYBA 2TUNA 4FPEA 1CAUB 5I8SA 1H2MA 2VNGA 3U4XA 5GJ6A 4HETA 3ZFGB 1R091 1AR83 2X5IA 5GM0A 4HVRA 5BNNC 3DN7A 1NYWA 4BH9A 5KXBA 2V09A 1XXNA 5JLVA 2XJTA 4C90A 4HSJA 4PCRA 3LA2A 1PGW1 2ARBA 1ZBA1 4XQDA 3LOIA 5FLJA 5T50A 1REEA 1RVF3 4CZSA 3JZVA 5JSOA 3BU7A 2R061 2ZKLA 1F5FA 1JW6A 5D8AC 5GLVA 2G9FA 4YVWA 1N1SA 5IK4A 5K7PA 1DGRA 3WP5A 5JOYA 2D97A 1D0GA 1H8TA 2XVGA 2OVUA 4FOYA 4ATEA 4BA6A 2ZGOA 3PJYA 2I74A 4YGDA 2ZCWA 3UV9A 4CP0A 4RR3C 1RHI1 1I1EA 4EN8B 2P37A 4XBQA 4FPOB 4CDQC 1U0AA 2O1QA 5FLHA 1RUE3 2R071 4AYUA 1VBE2 1GICA 3KQRA 2ZACA 1QJY2 2BW8A 3HMYA 3UK9A 4MZUA 2ZGRA 1AJOA 1FNYA 1H2KA 3TNPB 3OCPA 3N3HA 4HANA 2PTMA 2ZGSA 2AENA 2N7GA 5CFDB 4E27A 1AR92 1FT9A 3O0VA 3JD71 3I59A 5E8AA 1LOBA 2AUYA 3CJIA 4O9EA 1CAVA 1H9PA 5E89A 1HW5A 3ZPYA 2O8QA 3AK0A 3SMHA 1YYNA 4CEWA 2D3PA 3J9SA 1BBT3 1NCRB 4FAGA 3ENRA 1ND3C 2HEYF 1LECA 3ZO0B 5L7OA 1S2BA 1MS9A 1SBEA 4B29A 4Y1VA 1PGL2 5BY5A 2XWBB 4KG8A 1IZ3A 2VOWA 3T1MA 1IOAA 4AI3A 1N3QA 3MF6A 3S30A 3E5UA 2TEPA 4AHYA 2Z2SB 2Q4SA 3G6JB 1FV3A 1S55A 4CDWB 2HWD1 2IXIA 2IFRA 3VLBB 3I59B 1MEC3 5BYNA 4IXLA 4OHXA 1V00A 1C3HA 3CJIB 4FPGA 2WSUA 5FAXA 5JVVA 3FC0A 4FTSA 1CAVB 2GH8A 4RSUA 4XJ8A 4G4FA 3N35A 1NLSA 4YVSA 2IXJA 5H9QA 3HQXA 4PDWC 3OTFA 2R0HA 4CEWB 4BYYA 4EWEA 1DGWA 1XYPA 2WZR1 5FPXA 1QJX3 4AG4A 4DXZA 3MIBA 1Q43A 2DVAA 5SV8A 3KT1A 1H9WA 1MS4A 4Q27A 2R1BA 3SH3A 4FT8A 4JGZC 3MLKA 4XF3A 1RUE2 1ULEA 2EA7A 4BZ4A 4XJAA 2WFPA 1FATA 4FBFA 5CAZA 3H9AA 3RYKA 4YG3A 1QWRA 2VMGA 4XDQA 1UW8A 4YVSB 2VY0A 5H9SA 3SHRA 3USUA 4UXAA 4TZDA 3VN4A 4RQPC 1HV1A 2VNRA 3VZNA 3WV6A 1COV1 3FZ3A 5C6CA 4LBKA 4DNYA 1Q8QA 1VJ2A 2KM2A 1JUHA 3QLQA 3DPRA 3VHNA 3VZOA 2EALA 4TLFA 4K3UA 5FMOL 4JRLA 4HSLA 4XJUA 1KD7A 4X6QB 1BBT2 3GZTB 5DDJ2 5FPZA 5J3UA 1PVC1 1UPSA 2PAKA 4C0HA 5J37A 1DIWA 1SQ4A 3D5OA 4S2DA 1V6KA 1QOSA 1I6XA 1Y9QA 3S6PA 3VDDC 3IDBB 5GZFA 4Q1PA 1NY72 4LBOA 4GH4B 1HQLA 5GLUA 1RUC3 1RMU1 1V9U3 2FMDA 3MIHA 4FP2A 3VBUB 1RUD3 2ZHKA 5F6LB 3WW1A 2GC0A 2ETEA 4MSVA 5BNNA 3DPRB 5LK5A 2HEVF 1B35C 2NMOA 4JQRA 4QPIC 1W6PB 5C33A 5I0SA 1FPN3 2YROA 3MGUA 4KQ7A 1KITA 2XB6C 5HXVA 3KCXA 5FREA 2BWAA 1X50A 3AP9A 1ASJ3 5IUQA 5GLZA 3CLPA 3ZFEC 3ZIWA 2H6BA 1H1AA 2XJUA 2R6QA 1UD1A 3E97A 2BUKA 3B94A 5D8AA 3TN91 1NXD1 3B93A 3L9JT 3FLPA 4PLNA 1IQAA 2LM3A 3V0BA 1BMV1 3LSDA 3I54A 1SFYA 1MZFA 2B42B 1G86A 1W6OA 3ZSEA 4AK3A 5FOBB 1XNBA 2B45X 4RR3A 1PK6B 3ZFFB 5KHHA 2DYCA 2R043 3PNAA 2GMMA 4IV1C 4CDQA 5BUVA 4LBJA 4AFAA 4Q4Y3 1XE7A 3WQ1A 1N3OA 5BNPB 1CJPA 5HCAA 2BFUL 1RJ7A 1TMF1 2D7FA 2ZZQA 2RJLA 3J8F2 4B4RA 1MS5A 4MGKE 3WDUA 3PLQA 2UY9A 4AI2A 2UWCA 4GWMA 2K2SA 2DCKA 3IM0A 1MS8A 2JE9A 1F5JA 4Z07A 4WV8A 2WFF1 2ZABA 4HKLA 3R4DB 1DFQA 1R081 2HEWF 4E9KA 1BQPA 1QH7A 2ZGLA 1G9FA 1GFF2 2WS93 2WIIB 1RUC2 3MFAA 2V5YA 4LBMA 1IPKA 4QPGB 1YFWA 1ND3A 2ZGUA 4LE3A 1QF3A 3V0AA 1RUD2 1ZX5A 4QGNA 4S2HA 2E6VA 1WW7A 2EF6A</