2DUPA

Crystal structure of vip36 exoplasmic/lumenal domain, metal-free form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
250
structure length
245
Chain Sequence
EHLKREHSLIKPYQGVGSSSMPLWDFQGSTILTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTIDWTKIEPSVNFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vesicular integral-membrane protein VIP36
publication title Structural basis for recognition of high mannose type glycoproteins by mammalian transport lectin VIP36
pubmed doi rcsb
source organism Canis lupus familiaris
total genus 56
structure length 245
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03388 Lectin_leg-like Legume-like lectin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dupA01
1KDKA 4YW5A 3AZVA 3N7LA 2VW0A 1O4ZA 2C5DA 2RHPA 2YMZA 3PVNA 1N1VA 4AGVA 1OQ1A 1GLHA 1UZYA 1G9AA 5L73A 4R9DA 5T54A 1KQRA 2E7QA 3UK9A 1QU0A 1LEDA 1ULGA 1W6OA 1LTEA 3ATGA 3ZXLA 3ILNA 3M2MA 1MS3A 1QDOA 2XB6C 3WUDA 3T2TA 4AGGA 3VKOA 3ZXFA 2AYHA 1N1TA 3AP5A 5E88A 3WG1A 3WLUA 2CWSA 2E51A 1WW7A 3AJZA 2JECA 3RSJA 1W6NA 3FLPA 1WW5A 3W58A 3C2UA 5GZCA 2B7YA 4YW1A 1WUVA 3FUOA 4PBOA 1MS5A 4Y24A 5T52A 1MVQA 3WG3A 1JBCA 3WG4A 4XJAA 1VIWB 4GWNA 5KXEA 1C1LA 4ISQA 2YZ4A 1LHWA 1AX0A 4XMAA 1NLSA 4YZ1A 1LULA 2NP0A 2ZHMA 2CWMA 3R4UA 4XJUA 1LESA 3AYEA 1W0PA 4C1XA 2JD4A 2EAKA 1LGBA 1N47A 3QLQA 1DFQA 4YW2A 3UJOA 2G4IA 1FV2A 3AP6A 3POYA 5GLUA 1Q8SA 2A6XA 2DYCA 4YM2A 3TAYA 3AZWA 3ZYRA 1S0IA 3UJQA 1RITA 4XTPA 1HQWA 1RINA 3SH4A 2A6WA 2D43A 2DVGA 2OUJA 5GM0A 1AX2A 4M3CB 4M01A 3ZSJA 2A6YA 2EALA 1KJLA 2GN7A 2ZGOA 4UW3A 1BJQA 1SCSA 3WZ1A 3RMXA 5DUWA 1SACA 1LHVA 3B9CA 5JVVA 3AP7A 1G8WA 3BTAA 5GLWA 4FP2A 1JXNA 4UW6A 1GZ9A 1Y7BA 2A6ZA 4YLZA 1D2SA 1V6OA 1V00A 3N35A 1LODA 2DWRA 2OUHA 3AP9A 1LHNA 1A3KA 3B69A 1QOOA 4FPFA 5HCBA 2YXSA 2ERFA 3WHUA 3OYWA 1R1ZA 1IS6A 2V5YA 2DVAA 3FBYA 5JMCA 4KBBA 1JYIA 3B00A 5HCAA 3ZXJA 1FNZA 4Y1YA 1IS3A 5DG1A 4YFWA 4SLIA 4YG0A 2R16A 4DRVA 4GA9A 3M3OA 4AGRA 5GLTA 3WDTA 5CB7A 2ZABA 1UL9A 5KXDA 4R9BA 2GNTA 2ZMLA 1CVNA 1OKQA 4Y20B 5E8AA 1ULDA 2D6MA 4YZ3A 4DFSA 1BQPA 1MS1A 3WDUA 4XZPA 1DQ5A 3L2YA 2UURA 2UWCA 4FPLA 2JJ6A 1IS5A 4AVTA 5IK4A 4XJZA 4HANA 1S0DA 4Q26A 2E6VA 1LOFC 4M3CF 2BQPA 1W6PA 3IPVA 1VALA 4YZ4A 4YG6A 2ARXA 3GNEA 1CESA 4P9XA 3NV4A 1YO8A 5DUXA 4BPZA 4LBNA 2WQZC 4LBJA 4F83A 1CONA 2VH9A 3MW3A 3QCWA 2AENA 4FPKA 1S0CA 3DGTA 2VXRA 3A0NA 1ENQA 5DZFA 4FPHA 3FLTA 4Z8BA 2EXHA 3NV3A 3B01A 1HKDA 1XQNA 4LBOA 1QF3A 2DUOA 2JE9A 3MW2A 1N1YA 2GNBA 3AJYA 3FLRA 3FFZA 3OBRA 3O0XA 2D3RA 4NOTA 2DTWA 2UU8A 1AXZA 2OW4A 3SNMA 3V0AA 3VKFC 5IK5A 2P34A 1WD3A 1WLDA 1W0OA 1V6MA 5CBLA 3R4SA 3INAA 2GN3A 1LOGA 4Y26A 4L8QA 1W6MB 4FQ4A 2AREA 2WT0A 4XOGA 1IKQA 2NMNA 2GNDA 4Y22A 5GZFA 3SLIA 2VW1A 5GZEA 1MS4A 1JOJA 1FYUA 1MS8A 3ZSLA 4AYUA 1FAYA 1CR7A 4YZ5A 3N7KA 2ZZJA 1SBFA 4YM1A 1WW6A 2WT2A 1FX5A 3DUIA 1GICA 1BYHA 1C4RA 5IUQA 1O4YA 1QKQA 3Q9OA 4Y1ZA 2R0HA 2ZHKA 4P9WA 4XJWA 1AZDA 1KDMA 2Z42A 1DQ0A 1GZWB 3AXEA 3T1MA 1MR5A 4U36A 4UW4A 1S0GA 4YGEA 4R9CA 1IKPA 1JN2P 4FOWA 2Q5TA 1CN1A 2ZGRA 2NZ9A 5FREA 2KM2A 2WLQA 4K21A 2D6KA 4Q8KA 5BYNA 5GZDA 4AVSA 1UZZA 1QNYA 2DUPA 3AYAA 1QOSA 3ENRA 5DXDA 1EPWA 4CTEA 4XYXA 1SLLA 5JDBA 1SBEA 3AZZA 3RMYA 2GDFA 5GLZA 3ZXEA 3ZVXA 1G9CA 3NV2A 1GYKA 3A0KA 1DHKB 1X50A 2E7TA 2NN8A 2VY0A 4RA0A 1S0FA 3N7MA 1WLWA 2WJSA 1LOAA 1Z78A 1ULCA 3U4XA 1ZM1A 2ZGLA 3AZXA 2WKKA 3ILFA 3OGGA 3POWA 1PZ7A 3AX4A 1A78A 2VW2A 4XJ8A 4Q1PA 3BODA 1AX1A 3USUB 2XG3A 1LU2A 1Q8PA 3I8TA 5H9RA 2TEPA 1SFYA 4YGCA 1CJPA 2R1DA 2GNMA 1YI7A 3FUQA 4PCRA 3WDXA 1BXHA 5H9SA 1W6PB 4LBLA 3A4UA 5T5JA 3KQRA 4M00A 1OFSA 4YM0A 5JLVA 4YG3A 1AJKA 2DURA 4IQPA 3VKLA 4HL0A 1NXD1 2FHRA 4YZ2A 3M1HA 3RG0A 3WV6A 3HN1A 1MZ6A 5H9PA 1DYKA 4CRQA 1SLAA 1JUIA 3AFKA 4BM8A 4YGDA 3SITA 1Q56A 4Y1VA 1V6KA 2V73A 3MPPG 4FPEA 4I30A 4PF5A 3ZXKA 1LJ7A 3PMEA 5JOYA 3V0AB 3PVOA 1WD4A 4UW5A 3W59A 4DPNA 1CPNA 1Q8QA 2LALA 1KRIA 2A7AA 4XDQA 3O12A 3V0BA 1G9BA 2ZAAA 4Y1UA 1G9FA 2ARBA 4JCKA 1V6IA 2ZMKA 2WT1A 4GALA 1VLNA 5DZGA 2PHXA 5F9TA 4H55A 3BIWE 2UWAA 1W6QA 3WNXA 1I3HA 3APBA 4JC1A 3RRDA 1W6OB 3D4KA 4BMBA 4XHXA 3AP4A 1YRZA 2DUQA 5DUVA 3WHTA 2CTVA 1GV9A 4MYEA 2CY6A 4WVWA 2ZGPA 1URXA 4P14A 1DZQA 1G7YA 4M3CA 1CPMA 4ASMB 4DS0A 1VAVA 3ZSKA 1QDCA 3T1LA 5IK8A 3JUUA 2R0FA 4WZFA 1WLCA 4XHBA 5FRAA 1W6NB 4FPOB 3KM5A 3AZYA 1KITA 1N1SA 2WNEA 3SISA 5JOZA 3RQ0A 4BLIA 5GZGA 1HQLA 5GJ6A 3GALA 1LGCA 3V65A 2AGSA 2AR6A 2EF6A 3O5SA 1G9DA 1WCSA 1SBDA 1F5FA 3WOGA 1DGLA 3AK0A 1HLCA 5JOWA 1Z0HA 1B09A 1DLLA 1ENRA 2R1BA 1GNHA 3OY8A 5EYXA 2E53A 1ONAA 1F9KA 3WDVA 4GWMA 3ZPYA 1V6NA 4BLJA 2VU9A 4FQZA 1YYNA 1LHOA 3IM0A 3LCPA 1LCLA 1C1FA 4JRAA 1U0AA 3OJBA 4LBQA 5CA6A 5T5PA 5F5QA 4ISRA 2D44A 2EXIA 1H9PA 1UN1A 2PHRA 5EXOA 3SH5A 2WSUA 5DG2A 3WG2A 3N36A 3MW4A 4FPYA 4GKXA 1DQ1A 1GKBA 1LHUA 1I1EA 1KJRA 1WBFA 3R05A 2GMPA 4C1WA 4K20A 2YROA 2YY1A 4XTMA 4ATEA 4K1ZA 5KXBA 2GMEA 4M3CE 5KXCA 1N3OA 1N3QA 1CQ9A 3ZYPA 2W39A 1S0JA 4XMIA 2LTNA 4YGBA 4TZDA 5AVAA 4XXPA 3VKMA 1FNYA 4AVVA 1G86A 3IN9A 2JE7A 3ZSMA 3LSDA 2D3PA 1SLIA 2ENRA 3WCRA 2DU0A 2VUAA 1LEMA 1V6JA 2GMMA 3HR9A 4XBLA 4WVVA 5DZEA 1SLBA 4FOQA 1IOAA 4ATFA 1DIWA 1QMJA 3AXDA 1S0EA 1ULFA 4XJ9A 4TYSA 1C57A 1YXWA 2ZGQA 2NYYA 3V64A 1QGLA 3OYWB 1SLCA 2W68A 2ZGTA 4XBNA 2SLIA 2W08A 1LOFA 3IKWA 2ZHNA 3LSEA 2UWBA 1MS0A 2P3IA 2PHWA 4XBQA 4CZSA 1DQ2A 3PVEA 4FOVA 1S0BA 2DVBA 4YW3A 1JYCA 1DBNA 1SLTA 2DVDA 1RIRA 4FOYA 1LOCA 2HYKA 2ZHLA 2GALA 1QNWA 5LK5A 1PZ9A 4OZXA 2ZBJA 4PBPA 1DQ4A 3V0BB 1H9WA 2WSVA 4ITCA 5JOXA 2A3WA 1AVBA 1W6MA 3CNAA 3M3QA 2ZGSA 3IMNA 1BKZA 3H0OA 1GANA 1N3PA 4PQ9A 5CNAA 1LENA 1UX6A 1W6QB 3I4IA 5IT6A 3ILRA 3IPVB 2DU1A 4FPCA 2CL2A 3O0WA 4XXAA 2D7FA 3WDWA 1AJOA 3VKNA 4YM3A 5T50A 1AF9A 1WBLA 2ZA9A 1GZCA 1Q8VA 5E89A 3AYCA 4D69A 2PELA 4GXLA 2SBAA 4DRRA 5SV8A 4YFZA 2A3XA 5H9QA 5T55A 3WUCA 3BOPA 5IK7A 2ZKNA 1GZWA 2D6PA 1AXKA 5GALA 2CYFA 2EIGA 3WDYA 1FATA 2OVUA 1JHNA 2P3JA 2A5ZA 1BZWA 1S1AA 4W65A 3WVJA 4BMEA 1LU1A 4K1YA 1LGNA 1LOBA 1D0HA 1LOEA 3M3EA 4Q1RA 2D3SA 1Q8OA 3OPZA 1JW6A 1MS9A 1SCRA 1MVEA 3OY8B 1J1TA 1QOTA 5EYYA 5T5OA 2I2SA 4XIOA 4XE9A 2P3KA 1TEIA 2ZGNA 4P9YA 3N7JA 4Q2FA 4U2AA 2R49A 4Y22B 2FMDA 4LBQB 2EXKA 3D5OA 1GNZA 2D6NA 3SH3A 3MEPA 3JU9A 3RS6A 2PHUA 4FVVA 1GSLA 3ASIA 4AWDA 2W52A 4RL7A 1ZA4A 2ZGMA 1DQ6A 4FP3A 1HDKA 5T5LA 5CAZA 2A75A 2H0BA 2PHTA 3VUOA 3D6EA 3USUA 4YW4A 4ZXKA 2AUYA 4Q8LA 2D6OX 3NWKA 4DQAA 2ZACA 4LBQD 3UL2A 2A6VA 3B3QE 3PJQA 5GLVA 4ZKTB 4FPJA 1PZ8A 2P2KA 4XILA 1WW4A 3N3HA 3TB0A 3POSA 2A71A 4GKYA 2D6LX 2JDZA 2NM1A 3AYDA 1CIWA 4NO4A 2DTYA 1AXYA 2ZGUA 2AH2A 4R9AA 1UKGA 1IS4A 1VAMA 2CNAA 2NMOA 4FPGA 4Y1XA 2PHFA 4WV8A 1MACA 2DVFA 2YV8A 1UMZA 4Q27A 5EWSA 2P37A 2C9AA 5DUUA 2A70A 2ZMNA 1GBGA 1A8DA 1F31A 1UAIA 3M3CA 4BQ1A 4LBMA 1ENSA 3VV1A 2DV9A 3O0VA 5HCFA 4BOWA 1MZ5A 1ULEA 2EXJA 1APNA 3NV1A 4LBKA 4Y20A 1FV3A 1UPSA 1YIFA 2A3YA 2JKBA 3WCSA 1H30A 1LECA 2ES3A 4XIKA 1DYPA 3OBTA 2ZGKA 3HMYA 1V6LA
chains in the Genus database with same CATH superfamily
1KDKA 4YW5A 1HRI3 1JS9A 2ZX3A 3AMQA 3AZVA 3N7LA 4CEWA 2C5DA 1HW5A 4A2UA 2PLV3 1N1VA 3VZLA 1GUIA 1W2NA 4WM8A 2E7QA 2QQKA 3LA3A 3O1RA 2KD7A 5GKAC 1OXCA 3OF1A 5FZDA 3IIAA 4JQRA 3ZXLA 4P9IA 2XL7A 4A7YA 3M2MA 1XSQA 1UF2C 4HK9A 3WUDA 2VOVA 4ZPIA 5FJHA 3VHOA 3AP5A 5E88A 5FAXA 4V2VA 3WLUA 2E51A 1RGSA 2ET7A 5KHIA 2JDYA 1ND2C 2LW8A 2ZEXA 1NY72 1W6NA 2QKDA 3D8CA 3C2UA 4LKEA 4J25A 3TEYA 1RB8G 2DCYA 1WUVA 2FDKA 1AR93 2K46A 4QT6A 1RXFA 4PBOA 1MS5A 5FZLA 3WG4A 4XJAA 1PO21 1VIWB 5FFOC 4GWNA 3ZFGB 3BALA 1C1LA 4HT1T 4RR3C 4LLOA 1HXS2 3MICA 4B4QA 2RM21 1W2TA 2XJRA 4HLTA 5C5UA 2WS91 1LULA 2YC2A 5DPNA 1UOFA 4QPYA 4YZ1A 1UWWA 4AVAA 2HWC1 4GWIA 1JYVA 3R4UA 3AYEA 4C1XA 1B35A 3UKVA 4UFLA 3J7HA 2ZEYA 5FZOB 1MQTA 3VHRA 3POYA 5KHJA 2CAVA 5GLUA 1F5JA 5BNNA 2A6XA 4QXCA 4JQTA 4Q4Y1 3GYDA 3ZXGA 4B4RA 3ZYRA 1S0IA 3JQXA 1RUH1 1RINA 3W9AA 4CDQB 4QGNA 2A6WA 4LT5A 1QQP2 4JGYC 5ABJB 4GULA 1GNYA 5A3WA 4CDUB 4RN5A 5DUWA 4N43B 2JDHA 1AL21 1CAVB 1SDDB 3B9CA 4XFHA 5IVCA 4NIDA 5JVVA 5C9AC 3BTAA 5GLWA 3GJBA 1BK1A 2JEMA 3KCCA 5KC6A 3LB9A 1Y7BA 2A6ZA 1V6OA 2FBEA 1V00A 3KLSA 2OUHA 3KV4A 2VOWA 1H4HA 4HPKA 5C5TA 3WHUA 1RVF2 4UYBA 2WWSA 1VBA1 4AXOA 4I01A 4AI2A 5C9AB 2RS53 3OGVA 4XUPA 4Y1YA 1ZBE3 2BGOA 2ET1A 4I02A 3GJAA 4YG0A 3TNPB 3M3OA 1O5LA 4K7JA 4QXHA 4AGRA 1ENXA 1BEV1 2H0VA 2OQ7A 2KR2A 1V9U3 5CB7A 4C0BA 4H7MA 5BNPC 5KXDA 2ZMLA 3FN9A 1W05A 4OLLA 2YFZA 2IUWA 5E8AA 1YWKA 5K4LA 4BIOA 1ULDA 1ND2A 1C8M1 2WZR1 4ORFA 1MS1A 3VBUA 4DFSA 2GC3A 4XZPA 2UURA 4E4DX 4QM9A 1IS5A 1YC61 4HZFA 5IK4A 2WAAA 2WFF3 1COV2 1NCRA 2EIDA 1S0DA 3KV9A 5DAPA 2JENA 1RJ8A 4M3CF 4BK5A 4NHYA 4RR3A 2I74A 1GOGA 4YG6A 2JICA 5BNPB 1TNRA 2ARXA 4JVAA 5DUXA 5ACA3 4BCUA 3AKQA 4NN0A 1R083 2WQZC 2PAMA 2VOKA 1CONA 4XFBA 1W28A 3BKZA 2WWJA 1S0CA 1RUE3 3HIFA 3MF6A 2DF7A 2Y6JA 1YHFA 3IT8A 4JAAA 5LBFA 1HRV1 2OXBA 1UCXA 5IYYA 2EXHA 3NV3A 2Y6GA 5CYYA 5A32A 1J58A 2DUOA 1DGWA 5LRSA 1W8NA 2OIIA 3POGA 2UU8A 1AXZA 2OW4A 3H8XA 1RJ7A 2P34A 4RQPC 4JGYA 1XYPA 1WLDA 2BTVC 5FXXA 1AYM1 1X8MA 2OZ6A 1V6MA 1RYYA 2YG0A 4GAZA 5FV3A 4DEVA 2FZ2A 3RYPA 1Z7S1 3R4SA 5FUNA 3INAA 2VZVA 4DXSA 2RMU3 2HEVF 1QH6A 1W6MB 2VTFA 2NMNA 5AFEA 1C5HA 1W90A 1YQ6A 1YFWA 3ZOIA 3OUJA 3ELNA 3NMBA 3Q8FA 4XF3A 5FUPA 1JOJA 3ZSLA 4Y3OA 1FAYA 3G7DA 4RS5B 3MYXA 3N9PA 3K51A 4KNCA 4QX0A 1BCXA 4AI0A 4YM1A 1UNBA 5JPMB 1GOHA 3DUIA 1GICA 1BYHA 1C4RA 4COWA 4F8AA 2ZHKA 4Q4V1 1F4HA 1UY2A 4N8MA 3RZKA 4O65A 3HT2A 2GC1A 1MR5A 2WQ8A 4UW4A 5F39A 1IKPA 1PVC3 4XF1A 2J1SA 5FP8A 1RUD3 1NUKA 1EAH3 1TNFA 3HQRA 5FREA 4FTBA 2WLQA 4K21A 2BW8A 3MFCA 4L9BA 1ASJ3 3OCPA 5CEHA 4AEMA 5DXDA 1PNGA 3N4MA 4PIZA 5J96B 1NZIA 3T3YA 2W0XA 4RHV2 1ZZ8A 1TVGA 2GDFA 2OS2A 2E31A 5GLZA 4OMCA 5KBFA 5JPNB 3NV2A 2NN8A 3N9OA 2VY0A 1JZ4A 4DXRA 1S0FA 4HETA 3ALQA 1PM4A 2WNVC 1WLWA 1H6YA 3WF1A 2ZZQA 5IATA 1UX7A 1ZM1A 3I3DA 3AZXA 4LORA 3ILFA 3POWA 4XJ8A 1A78A 3ECQA 2V5DA 5F7UA 1SDWA 5APAA 3USUB 4AFMA 1O3TA 2QQIA 3B9IA 2YGLA 1UMHA 5FZ3A 4LTAA 1KFUL 1SFYA 3GCXA 3ZR6A 2EVXA 3KF5A 1NCQC 1YI7A 2Y6FA 3WDXA 3RZLA 1BXHA 3E6BA 2L9LA 1ALYA 5CG8A 3K4DA 2VOTA 2DCJA 2X09A 4LBLA 3ZSEA 3UETA 3OBAA 4CCCA 3PUHA 5T5JA 2HWB1 3V56A 1AR92 4WVMA 3KQRA 4AFCA 1V70A 4C0HA 5EIYB 1JZ3A 1WZXA 2MHFA 2UYBA 3O7OA 1AJKA 3L9JT 3T30A 1RUI2 3VKLA 4HL0A 5FY7A 1NXD1 3ZR5A 2W1WA 2PXJA 4IERA 3AKRA 5LBBA 4A44A 4EN0A 4L2NA 2X5IC 2XL9A 2ZJCA 1W9WA 4NPMA 1GQHA 3WV6A 3HN1A 2WO7A 5BNQA 1DYKA 2XQXA 5EFUA 4NVPA 1Q56A 4COYA 2CAUA 2V73A 3WW4A 4MV2A 3X29B 5EV7A 3PVOA 2RVAA 4J1WA 3W59A 3CF6E 1CPNA 2XJTA 4CUGA 5A7WB 4EWEA 1KRIA 5IVBA 3O12A 2QJVA 4YW6A 3RNSA 2ZKLA 4AAXA 1RUG1 3BN6A 5FP4A 1V6IA 4ZZ8A 2D5HA 4GALA 1VLNA 3LPFA 2PHXA 1YQCA 5F9TA 1CD3G 1U5ZA 3HD8B 1VBC1 2UWAA 2B46X 1QJU3 1W6QA 5CADA 1I3HA 3APBA 2XWJB 3HT1A 1CZTA 3J4UH 3PJYA 1W6OB 1Q43A 4JC1A 3RZZA 4BMBA 5LWBA 2BV4A 3AP4A 3CJIB 3WF3A 5DUVA 2ILMA 4ZZ5A 2Q8OA 2N7GA 4UBGA 3VD5A 4WVWA 2ZGPA 4FSJA 4P14A 4HMZA 4DS0A 3ZSKA 2PA7A 2XVGA 3JUUA 4WZFA 4QGLA 4XHBA 5FRAA 4OMDA 4OHYA 4FPOB 3AZYA 2FDGA 2OPWA 3SISA 1YLLA 5GJ6A 3ES1A 1LGCA 3GALA 3KV6A 3V65A 2BRTA 2AGSA 1D0GA 2WNVA 2R063 4HN0A 4JX0A 5JOWA 1DZRA 1B09A 4LKSA 2IFRA 3I2FA 3VBOB 2K0GA 3ZIXA 2RS52 1PGL2 1CWPA 2RG4A 1ONAA 4FFFA 4DO0A 2VGDA 4M4RA 4DY3A 1RHI1 1LHOA 2XUEA 1V9U2 4EN6B 5A6XA 1C1FA 2ADDA 5C33A 5BPXA 4LR4A 1H8TA 1NCQA 1WCKA 4ISRA 4PDWB 3SH5A 1ACCA 4FT8A 3LDBA 4FXKB 4LOSA 4Q4W1 5DG2A 3WF0A 3MW4A 5F37A 1LHUA 1I1EA 3HNYM 4GH4A 1WBFA 4XUTA 4K20A 4NHKA 3AL6A 4IE4A 2WFF2 4KI5M 3H7JA 5KXBA 5KXCA 1IPJA 4CCEA 1N3QA 3POJA 3ZYPA 1W8ZA 1DZTA 5C8CB 4XMIA 3K4AA 4YGBA 5AVAA 4QPIB 5ACA2 2Q1FA 1PGW2 2JD9A 1FNYA 3PTRB 4AVVA 1RTVA 1ZRIA 3U75A 3MDPA 3NJVA 2XBO2 5A3MA 4EZ4A 1SLIA 2ENRA 4PIXA 5BNOB 2P4EA 4A6SA 2DU0A 4HVRA 3PIGA 5FO7B 1VBE1 1OF3A 2B5HA 2EICA 3M3IA 1JOBA 3UYJA 5FYCA 1ULFA 4NUBA 1UKRA 4P9GA 3PVBB 1W8FA 5FZ9A 3OYWB 2BP6A 3WP4A 1O7FA 1L3JA 4LITA 4XBNA 2W08A 2C24A 1NA1B 2ID4A 2UWBA 4AVBA 4LK7A 2P3IA 5BUVA 2VTXA 2PHWA 3FZ3A 3NO8A 1PMIA 5DAWA 4AVCA 3GM8A 3VZNA 4CDWB 5C71A 3OEBA 5JZGC 1A8MA 1YNAA 4IEXA 4NHLA 4FOYA 1WCUA 3ORJA 1A34A 3K77A 2W46A 1W8OA 3NKGA 5IHRA 2ZBJA 2FZ1A 1AR62 3V0BB 3GZUC 4COZA 1PO13 2A3WA 4PLMA 2QZ3A 5CFCC 1W2OA 2D5FA 2ZGSA 3H0OA 1GANA 3VDDC 3N9LA 3H50A 1KS5A 2WL1A 4IGPA 2B45X 3AKPA 5FPVA 4IGOA 3Q8AA 4XAAA 2MNGA 2RE9A 3ILRA 1SPPA 3IPVB 3FHIB 4IV1B 4JDOA 3U11A 4NIGA 2CL2A 3C8XA 3KV5A 1XE0A 2JDNA 2QQMA 3SMHA 3VKNA 4FXGB 4CA9A 1AF9A 1D4VB 4GJZA 1GZCA 1TMF2 1ZYBA 1CAWA 2PELA 1UOGA 5SV8A 1AYN3 1R1A3 5IJRA 1PVC2 1TME2 3S6PA 4A3ZA 1UIJA 3BOPA 2YC4A 1H8VA 2ZKNA 1GZWA 2D6PA 1EAH2 2XHNA 1W8WA 2CYFA 5IK7A 3I7DA 5FMOS 5C4WC 4B1MA 2G9GA 5A1AA 1SG3A 2A5ZA 2VBDA 3LWCA 2VBPA 4W65A 3WVJA 5ISLA 1PX4A 2HWF3 2VMHA 1D7PM 3JD72 4KMQA 1KS4A 4GIQA 1JYWA 1D0HA 1LOEA 3ACFA 2Y64A 4CP2A 4CYDA 3OPZA 1YFUA 1JW6A 1MS9A 1BK0A 1MVEA 1SCRA 3OY8B 1FMD1 4XFAA 3DPRB 1QOTA 4NHXA 1XE8A 3S5QA 3ZMOA 5K7PA 1NXMA 2JIJA 3TN92 2XJVA 2YUEA 5F2SA 3UV9A 2ZGNA 4Q2FA 1ZZ9A 4S2FA 3K75B 3BPSA 3HNBM 1CAUA 2R49A 2WRAA 4Y22B 3KGZA 2EXKA 1RL3A 1XE7A 3MEPA 1XNDA 3LDKA 1H2NA 1AR72 4DUXA 5D2AA 2VNGA 2JKXA 2VNRA 1RUJ2 1W8HA 1ZA4A 2W52A 4RL7A 3O1PA 2R7EB 2WNOA 3BTZA 1HDKA 1DGRA 4IEPA 4WM7C 1DLCA 4N53C 2PAEA 4HOOA 3ZYGA 2J42A 2J1AA 4YW4A 2AUYA 1HQNA 5JZGA 1JMUB 3VBRA 5LY1A 1GWLA 4LK6A 2H6BA 4AL9A 4GB31 4QAWA 1EV11 1CX4A 1PZ8A 4XILA 1GQGA 3N3HA 3TB0A 2B42B 4FCAA 3B5LB 4NRQA 3IIIA 4Q4X1 2K9ZA 2QQUA 5FZ8A 2ETEA 1CIWA 2BDRA 3B7MA 2DTYA 2BWAA 2JWPA 2AH2A 2ZGUA 3CEWA 3DKWA 2CNAA 2VQTA 5A6ZA 4HONA 4LPLA 4M0NA 2EAAA 3VDDA 3ZYFA 4I09A 1R091 2PHDA 2BJSA 4JV4A 5L7OA 1OI6A 2DVFA 1UMZA 5I91A 3VBSC 2A70A 4BQ1A 4LBMA 1ENSA 4BOWA 3ACLA 1MZ5A 1APNA 4NIAA 2XQRA 2A3YA 3QBQA 5FBJA 4CDXB 4EE2A 1H30A 3DEMA 3DF0A 4XIKA 2JB8A 3OBTA 1QJU2 3HMYA 2DCZA 4Z92B 1GP5A 2QDNA 2FDIA 1O4ZA 2YMZA 3PVNA 3ZKYA 5FO9B 1I6XA 3ZDVA 1G9AA 5C3OA 1SQ4A 2JG9C 2J1UA 1WCDJ 3DN7A 5L73A 4YPJA 2WZPP 3UK9A 2BERA 1OURA 1QU0A 1TG7A 1ULGA 1OH4A 3ATGA 4KL1A 1DDLA 1RUC1 4OQ9A 4RGKA 1MS3A 4BQ2A 2R30A 2XB6C 5B2GB 4K8FA 1W03A 3VKOA 1UQXA 4YVWA 3QH6A 5FZ4A 1OD3A 2CHHA 3I2GA 4UFHA 5CKQA 3WG1A 3ZYBA 3S5AA 1QJY1 1YJLA 5FQ0B 3AJZA 2RM22 2IWGB 1WW5A 3I54A 3W58A 2WS92 3WNKA 2B7YA 4G9SB 2MEV1 4YW1A 5DQ0A 5J3UA 2HWC2 4Y24A 1RVF3 1MVQA 1OD5A 2OZJA 3OGRA 4XCAA 2AZ5A 5T52A 1ULPA 4QKNA 5L9BA 4BISA 1EUUA 5LZ6A 3VBHC 2A73B 3KT1A 4R52A 5FZGA 1POV0 4CXYA 2WZ8A 3HQUA 4WM7A 2K2SA 4XPVA 1F2NA 4XMAA 5FYMA 3ZFEC 3VZKA 4Q4Y2 5K0UC 2ZHMA 4YVSC 1POQA 2CWMA 1RUH2 3ZFFC 3LZZA 2EAKA 3MIEA 3QLQA 5C7GA 4JTOA 3UJOA 3S57A 3H8OA 3H3LA 4AZZA 3IAQA 5I93A 4W50A 4R4XA 3KB5A 4YM2A 3WNPA 1AL22 3TAYA 1PIV1 4LO7A 1K5JA 1Y9QA 1OMIA 3ZX7A 1W9TA 3UJQA 2FCTA 1RITA 2YB7A 2VMCA 4XTPA 3RZMA 5C3QA 2YFUA 2OUJA 5FZ7A 4LHKA 4D7TA 1AX2A 4M01A 4AI3A 5FPXA 3FWEA 1KJLA 2V4VA 3I3BA 1SCSA 5JUVA 4DZGA 5DDJ1 1SACA 3KF3A 2DBIA 3P6BA 2BOIA 4FP2A 1H1MA 1VBA2 4AEDC 4QX3A 5JIAA 1GZ9A 1VMJA 3N35A 2DWRA 2YPJA 5M0TA 1A3KA 2YXSA 2Q1MA 1R1ZA 1CGPA 3VBFC 5JMCA 1ZRRA 5C70A 4UAPA 2JG9A 3OD0A 1BLZA 3B00A 4CU9A 5I8SA 1C8M2 3PIJA 3JBG1 3DYMA 4YFWA 1OC1A 2XONA 4DRVA 1X7NA 5GLTA 3C7GA 5FY4A 5JI9A 3K46A 1W99A 2ZABA 2VUCA 2GNTA 3ZN6B 5FZ6A 3ZYJB 5HI0A 1JI6A 5CFDA 4QB1A 2RDQA 3MBWA 5FYHA 1K5MB 3L2YA 2WLPA 5JSOA 1LKNA 4MGYE 4AVTA 1DF0A 2QQNA 4HANA 1IPSA 1W0NA 2BGPA 2E6VA 4WM8B 1LOFC 3IDAA 3VBHA 4IGQA 3E6CC 1W6PA 2PN5A 3ETPA 3GNEA 4P9XA 1AYN2 3NV4A 1ND3C 5LCWL 4EN7B 3T09A 4FTEA 1OA3A 3MF9A 4I3GA 5JAXA 1LAJA 3QCWA 2HBTA 3C7EA 4H2AA 1Y4WA 2Y34A 1BMV1 4QHOA 4Z8BA 1AYM2 5F3CA 3H1WA 1XQNA 2WUHA 4BU2A 2GP3A 2VVFA 2VCCA 3FE5A 2GNBA 2XOMA 1Z7S2 3FLRA 3EYPA 2VZ1A 3FFZA 3O0XA 4A42A 5IAXA 2HEWF 1OUXA 3SNMA 3MV01 4QKFA 1ZRFA 3V0AA 1P8JA 5IK5A 1OA2A 4RHV3 3ZLIA 5AC91 1UY3A 1WD3A 4UFKA 3DV8A 5FY9A 2VMGA 4BQ5A 2TBVA 1UY4A 2LRPA 3NL1A 4CUBA 2GN3A 1Q3EA 2XH6A 4Y26A 4AFDA 2JE8A 4L97A 1EUTA 2WT0A 4CUCA 5GZFA 5L9RA 2RS11 5GZEA 1MS4A 2RR11 4QB6A 5BNNB 1XBFA 4Q4V2 1C3HA 1NLRA 3J7NA 1UD1A 4IE7A 5FLJA 2VOXA 3ZFGC 4AYUA 3MO4A 1J84A 3N7KA 2ZZJA 3VBFA 2IXCA 3HWJA 1S55A 1SBFA 1QWRA 4O9EA 1O5UA 4TXWA 5FYTA 4OI1A 4BZ4A 4D7YA 4AFBA 1CZVA 3LD8A 3GXUA 3HJRA 2J1EA 5LW9A 1O4YA 1ZREA 5FMDA 1W06A 2ZTNA 1QXJA 3LE0A 3RJRA 1MZEA 3PTYA 4K9SA 4LKFA 2XGXA 3NKTA 1S0GA 4YGEA 1RUI3 4IV3A 1JN2P 4FOWA 4XABA 1CN1A 2Z69A 3SXWA 2Z2SB 3JB4C 2KM2A 4FFIA 5CG9A 1O59A 3VDCA 4CDQC 4Q8KA 4A7ZA 5BYNA 1UZZA 3GHMA 1QNYA 2DUPA 5ABJC 1SFNA 3QOPA 1EPWA 4CDUC 3GZTB 1O8PA 2R073 4N43C 3E5UA 1W9SA 5I0TA 2FD8A 1OT5A 3AMPA 3AZZA 3HEIA 3TBDA 1Y43B 3ZVXA 5JSPA 1PMJX 1ND3A 4QPGB 1RMU3 2XLGA 3A0KA 5BV6A 2JX9A 4LOTA 3WD5A 1NE6A 1G9CA 3O1UA 1H0BA 4RA0A 3M7AA 1GZTA 3MIFA 1C8NA 2WJSA 5FWEA 3UGGA 2W9XA 3U4XA 2ZGLA 1QHDA 3SHRA 1SMVA 2WKKA 3VBUB 2VW2A 2HWB2 2GU9A 2XG3A 1RUF1 4RD7A 1XSRA 1LU2A 5IFTA 1Q8PA 2TEPA 1NCRB 4N7UA 4LEJA 1UYYA 2GNMA 2R1DA 4PCRA 3THTA 1SFPA 1VR3A 3OGJA 2C4XA 3MLKA 4BQXA 5HPOA 1QEXA 2HWD3 2CDPA 1EY2A 1R64A 5BXXA 2BNNA 1X82A 1JH5A 4YM0A 5JLVA 2OX0A 4YG3A 2DURA 4D0QA 3CZUA 1GU3A 3WY6A 2HWE1 2BNOA 2HKXA 2VQAA 4HSLA 1AR83 4FO9A 4EV0A 1RUG2 3ZFGA 5H9PA 4AHZA 1J83A 4NE9A 4CRQA 4DINB 3RZHA 4PT6A 2VQUA 1V6KA 1VBC2 4PF5A 3WX5A 1POV3 5A7QA 3WW1A 3CQOA 1ZZ7A 3HAGA 1Q8QA 2LALA 3UNPA 1OHFA 1G9BA 2ZAAA 3OG2A 4LE4A 4Y1UA 3BB6A 4JCKA 5A1FA 4UFJA 5IW0A 4H55A 3BIWE 4XUQA 5FYZA 4TLGA 3H42B 2IFWA 3FFQA 4CXWA 2P5BA 1BBT3 4BDVB 1ZBA1 5HV4A 1UY0A 1YRZA 3J8F1 5D8AB 2CTVA 2HYXA 2XBO3 4KBZA 1DCSA 1URXA 4NR1A 4X8NA 4ASMB 2W1UA 1US3A 2HEYF 2ZCWA 3MFAA 4HKOA 2R0FA 3T1LA 4CCNA 1WLCA 4V1PA 4CDUA 4L0PA 4N43A 4XFFA 2IXKA 2W1QA 1CAVA 4ZU7A 3LF7A 1N1SA 1O8SA 5FZHA 5JOZA 5CKNA 4KWJA 4OI2A 1WLTA 2E32A 4IEUA 2E26A 4QXKA 3GDBA 2EF6A 2OT7A 4AFAA 1IQDC 1DGLA 3AK0A 5FPBA 1WA6X 1Z0HA 3CZJA 4DNYA 4RS5C 5LBCA 4Q4W2 3VDBA 5F3EA 4BYYA 1JODA 3EJKA 1F9KA 2WNUB 3WDVA 3B93A 1V6NA 4GMP1 3ZKUA 1OLMA 2J1VA 2XKOA 3LCPA 5C9AA 1HV1A 4TSVA 3JCIA 4YSFA 1U0AA 2RS31 3USSA 5F5QA 2EXIA 1AR63 4KG0A 2WSUA 3O1VA 3VD7A 3WG2A 3N36A 1FT9A 1VBB1 1DQ1A 2RDSA 1KJRA 5FPUA 1W3XA 3THPA 2GMPA 4YWAA 4C1WA 4DY5A 4XTMA 3MIBA 1ZA7A 4Q5OA 3MLLA 5LRRA 4K1ZA 4M3CE 1N3OA 2CU5A 1VBE2 4K6BA 1CQ9A 5DN2A 1VBD1 3RGBA 3DXUA 4XXPA 4AHXA 1KGYA 1TMF3 5A3LA 2BFUL 5A33A 3ZSMA 3VZMA 2D3PA 5IAVA 3IAPA 3MIDA 3WCRA 5BNPA 1V6JA 1TME3 3HR9A 4XBLA 1D4M1 1UXXX 5DZEA 4MXVA 4D8MA 2HH9A 2WA4A 3AXDA 5CISA 5J98B 1S0EA 3TYJA 4XJ9A 3AMNA 4MADA 4IEYA 4JDMA 3JD73 3V64A 3KHBA 1STMA 2GC0A 3IKWA 1HN0A 5FLHA 2NPIA 4LQRA 4K3UA 2OKXA 4CZSA 5KHHA 1DQ2A 3TWIA 4BXFA 3PVEA 4ES9A 5JWPA 2ZEZA 3TN93 2DVBA 3VZJA 2F17A 1JYCA 2LM3A 1DBNA 1SLTA 3VN4A 1MEC3 2CGNA 4ZU4A 2HYKA 2ZHLA 3PNAA 1PZ9A 4HKLA 1V0AA 4PBPA 3PDQA 4N90A 1AR73 2Y8KA 2VZSA 2J1TA 1H9WA 2VECA 5JOXA 1RUJ3 3TRSB 1AVBA 1W6MA 3QD6A 3IMNA 1BKZA 3AM2A 4PQ9A 3DECA 5E16A 1HXS1 2J7MA 1UX6A 1WGPA 1W6QB 4LIVA 3I4IA 4O7XA 5IT6A 5J48A 4RQPA 4FPCA 2D7FA 4XCBA 2BYVE 4YM3A 2ORXA 4RYDA 4OYUA 5LATA 2CGOA 2ZPXA 3AVSA 3NNFA 2XVLA 2SBAA 4P08A 5KR7A 4BB3A 1OSGA 1FXZA 4AAPA 1OVSA 1FOD1 2A3XA 3OGSA 1PK6B 2VZRA 1FMD2 2PMWB 1UU5A 1IGOA 2OVUA 5CU1A 2Z5WA 1JHNA 3CKHA 4CU7A 4LULA 3CO2A 4FFGA 4W8JA 4E4ZA 3LKJA 1QQP1 3CJIC 2FDFA 1DGRN 4P5YA 4Q1RA 5FIXA 2R072 1W3VA 5EJZB 5FK7A 4BHPA 1CJDA 2UY8A 3I2DA 3KVBA 4MHUA 1RMU2 5FPZA 2VZUA 2XJQA 5T5OA 4XE9A 4B7EA 1K12A 3LEMA 4DB5A 4P9YA 4U2AA 3N7JA 5J09A 2RR13 3DYPA 3JZVA 5IVJA 2HBUA 2GZWA 3MZHA 4P00B 3JU9A 1FPN1 2WABA 3WXPA 3ASIA 3C7HA 4GH4B 5A3PA 2PFWA 1EV12 3ACHA 2Q30A 4FP3A 3VBOC 3E5QA 4IEWA 4N7IA 4W6XA 3UT0A 4D3WA 5KWRA 1NLQA 1ZVFA 3RZGA 4IEVA 3D6EA 2W95A 3USUA 4Q8LA 4RGAA 1PO23 2D6OX 4W6WA 1AHSA 2ZACA 4LBQD 2HWD2 2A6VA 3I2JA 3PJQA 5GLVA 2ATFA 4E2SA 1ZZBA 4NIHA 2RM23 2P2KA 3BPZA 4LUKA 4PDWC 4A3XA 1R092 2QUOA 2WS93 3CU7A 1VRBA 2QQWA 3N9MA 2HWC3 1AR82 3GBGA 3AYDA 3R0RA 1AXYA 1COV1 4R9AA 1UKGA 1IS4A 2ARCA 4FPGA 1XJAA 3PUIA 5C8CC 4QQHA 2PHFA 4WV8A 4QX2A 4Q4Y3 1MACA 4QPIC 1QJX1 3EBRA 3D0JA 3ST7A 2JDAA 2P37A 5A3OA 3U37A 1XU2A 1RUH3 1GBGA 1F31A 1UAIA 1CAXB 3VV1A 4JGZB 2DV9A 3O0VA 5BNOC 4Y20A 5EJ1B 4LBKA 5LY2A 3WCSA 1FV3A 1SEFA 2RDNA 1E57A 2WN3A 3ACIA 2AEZA 1LECA 2W2IA 3FC0A 4LA3A 3I2OA 5LA1A 5FBZA 1AL23 1V6LA 1ZZ6A 1VJ2A 1BBT2 1X9PA 4CEYB 2X5IA 4N9HA 3I3QA 5J37A 3OEAA 4KU8A 1OQ1A 1GLHA 2X10A 2IVIB 4JRLA 1QJY2 4R9DA 3KGLA 4YW7A 1NA1C 4URAA 2BBAA 4Q0PA 5F5AA 1LEDA 1W6OA 1K45A 1LTEA 4CDWC 5HV0A 1T2XA 3CJIA 2MEV2 3A7QA 3ILNA 1VRH1 1QDOA 4CU8A 1SPPB 3ZXFA 2AYHA 1N1TA 1ZX5A 5ANQA 4QMAA 1VBA3 1Y9MA 1GWKA 1CAWB 1WW7A 4ZXEA 3H3UA 1OPOA 3FLPA 5GZCA 2B8MA 4N9IA 1BEV3 3WG3A 2KA3A 2R041 3T4HB 2VJXA 3RPQA 4OZOA 5KXEA 1YCIA 3WQ0A 1C8M3 2WZR3 4IV1C 4AK3A 2Q8EA 1LHWA 1AX0A 3VBOA 2A1XA 4CP0A 4E8DA 1NLSA 4ZONA 2OA2A 1PIV2 4LNVA 2NP0A 4S2GA 3VGIA 4YYOA 2P17A 5FKCA 4F7ZA 4XJUA 4XFGA 1LESA 4RFT0 1WMXA 3CMGA 1LGBA 1N47A 1VPHA 2V72A 1DFQA 4YW2A 3NNMA 2ZEWA 4X8PA 1FV2A 4PDWA 2W3JA 4MUVA 2QQOA 2XJPA 4P5HA 5BY5A 2VVEA 4LHSA 3T0BA 4BJ0A 4BIFA 3VD4A 4J6GA 2YU1A 2XKPA 4D94A 2D43A 1X33A 1YUDA 2DVGA 1HRV3 3AKTA 4R8HA 4M3CB 1REFA 3ZM8A 3ZSJA 2GN7A 2RDRA 5C8CA 2ZGOA 3DPRC 2H6CA 3E6DA 4IEQA 4QPIA 1LHVA 2QFEA 2BZDA 3CLPA 1HRI1 1UIKA 1W9YA 3VBRB 4JTNA 1G8WA 4JKKA 1KFXL 2PLV1 4QX7A 1VMHA 1JXNA 3ABZA 3E5XA 2FDJA 1U5XA 1AYM3 5E1RA 3JBG2 1YQ8A 3S30A 2QQPA 1D2SA 1Z7S3 3FJSA 3AP9A 4UF0A 1LHNA 4BQWA 1QOOA 4CP9B 4EROA 5HCBA 1E5IA 2LS6A 3OYWA 2VMIA 2V5YA 2W91A 2RS33 2DVAA 3FBYA 4XEZA 4KBBA 3UGHA 1JYIA 4GWJA 1JZ5A 1DYOA 1MEC2 3ZXJA 2P1BA 3NNLA 1RC6A 4CDWA 2VVDA 2VZPA 4Z2WA 2DFBA 2D97A 4P02B 4SLIA 5L7OB 4GA9A 1Q5OA 2W94A 2D40A 2XLAA 4CCJA 1GR3A 2VC9A 3DYOA 2X8KA 5SV5A 1PX3A 2FQPA 2WN2A 4R9BA 1CVNA 1OKQA 1UXZA 4AE2A 3I59B 4DXTA 1RXGA 2D6MA 2XR4A 4YZ3A 3WDUA 3IDCB 2P6CA 2Z79A 3IB3A 4Q4V3 1DQ5A 4NRMA 5A6QA 2UWCA 4AI1A 1KD7A 1F15A 2JJ6A 3AMHA 1O3RA 1K42A 1QJFA 4OCTA 4BQ4A 5C3SA 1NX9A 1T6GC 4XJZA 4Z07A 1S2EA 1GP4A 4Q26A 4QXBA 4YNIA 2BQPA 4IV1A 2Q8CA 1WMEA 3IPVA 2VZTA 1BMV2 3O1OA 3W5NA 1CESA 2J1RA 2BGCA 1X9TA 1YO8A 3LFIA 4BPZA 4LBNA 4QX5A 5JR2A 2Q4SA 3LEGA 3MV11 1T6BX 4MGQA 4CDXC 5L9VA 4NAOA 4F83A 4FPKA 4YVWB 2AENA 1O4TA 2AEYA 3A0NA 4UFMA 2TUNA 2WINB 3M8LA 4KG8A 3H3ZA 3ES4A 4MXWB 1HKDA 2C9KA 4LBOA 1VE0A 1N1YA 5JXJA 3AJYA 5JMOA 2D3RA 4HK8A 3NJXA 5T3NA 2VL4A 2Q1ZB 3AC0A 1OOPB 4Q0QA 5FXZA 4Y5SA 1UY1A 1QXRA 4I0BA 4ASLA 1REDA 1W0OA 2RR12 3DPRA 4E4SA 1HJGA 3U10A 4PLNA 1UPIA 5EP9A 3WP6A 3K4ZA 1LOGA 5C4WA 2JG8B 4CVUA 5FXWA 4IE6A 2AREA 4Y22A 3SLIA 1IKQA 1IG0A 1W8TA 4QQPA 3J7MA 5FZAA 4YRDA 1S4CA 2HWB3 2VUDA 4NWWA 2RS51 4ZS3A 1OQEA 1ZBE1 1LNSA 1RUNA 3WQ1A 2J22A 1PO22 3KHCA 1XC6A 4IE0A 1V9U1 2WWUA 1WW6A 2WT2A 4AI9A 1FX5A 3SKVA 1QKQA 3Q9OA 2F4LA 2R0HA 4XJWA 1PVXA 1DQ0A 4KWKA 3SCGA 3T1MA 3B02A 4EWDA 1UU4A 4FTSA 4R9CA 2WFF1 2TNFA 3RJ2X 1HIXA 4IUGA 2Q5TA 4B7KA 3UGFA 4DIQA 1RUG3 4N53A 3BVCA 2D6KA 2NLRA 2RJLA 2QE3A 3AL5A 4CE8A 5ACA1 4OUMA 1R081 1VBC3 3AYAA 1UYPA 1JU3A 4B4PA 4XYXA 3P5BA 1Y3TA 1SLLA 1RUE1 5JDBA 5JXIA 5EQUA 5FYYA 3ZXEA 3WW3A 1KXGA 2X05A 4EQVA 1RUF2 2OPKA 1GYKA 3THCA 3R4DB 1DHKB 3EQEA 4H14A 3N7MA 3GF6A 4Y5Z0 3ME2A 4AQ2A 1Z78A 4AQ6A 2OYZA 1O6UA 4A7KA 5CFDB 2PAKA 1PZ7A 3AX4A 3CL1A 3U1XA 5G04L 4L11A 1AX1A 3NAPB 3WP5A 3VBSA 4CCLA 1S2KA 3BTYA 5H9RA 4S2DA 2GH2A 5A6YA 4YGCA 2RMU1 1CJPA 4HBNA 4KQ7A 3H8RA 3FUQA 2HWE2 4DXZA 3PU8A 5H9SA 1W6PB 5CIRA 3I2HA 4DOUA 3A4UA 5LEKA 1XOYA 1DP0A 1BEV2 1RHI3 4M00A 3P3PA 2VMDA 4KWUA 3OTFA 4GZ9A 5AVPA 3VDAA 1K5MC 2WZR2 4Q4W3 5FZBA 2FHRA 3MLJA 3PLQA 3MGUA 4YZ2A 4OI4A 3M1HA 3RG0A 4E2GA 5K8SA 3GZEA 2I07B 1MZ6A 4WM8C 4BM8A 1JUIA 3AFKA 4YGDA 3SITA 4FPEA 3GCWA 3MPPG 4I30A 3ZXKA 4AQSA 1LJ7A 1Y9GA 4URTA 3V0AB 1O3QA 1F35A 5I0RA 4DPNA 1UOBA 1OQDA 2YGMA 1ZBA2 3C7OA 4XDQA 1PVC1 3UESA 1K3IA 3LDRA 1RUD1 1WMDA 2ARBA 1EAH1 2ZMKA 4CEWB 1XXNA 2WT1A 3LQCA 5FR3A 5DZGA 1ASJ1 4BE3A 3CDZB 3KWVA 1JYTA 3GBFA 2IXIA 3WNXA 4BXSV 1VBE3 4LJHA 1HB3A 1HRV2 1M4WA 4PLOA 4XQDA 3VZOA 3RRDA 1H6XA 4MGTA 3ZFEA 5JIUA 5K0UA 4AR2A 4YVSA 5LK7B 5FZ1A 3LAGA 2GSYA 1DZQA 1G7YA 3ZFFA 5LA9A 1VAVA 3U07A 1QXPA 4XF9A 1H1IA 3H1MA 4IEZA 1W6NB 2FCVA 4NJ4A 5FOJB 4Z82A 3AFGA 5GZGA 1UO9A 4MH0E 2XXZA 4MLOA 4EN9B 2BOJA 1G9DA 3O1TA 5J36A 5C6CA 2RS32 2WO3A 3WOGA 2EA7A 1HLCA 3POBA 4IV3B 5BNNC 2C26A 5IVEA 1DLLA 4ZY9A 2R1BA 2Q0AA 2LROA 1NE4A 2QQVA 4A4AA 1VBB2 2WO1A 3ZPYA 1IQAA 4GWMA 3ETQA 2VU9A 3AMMA 4FQZA 4K40A 5A1LA 1YYNA 2WDBA 2VNVA 1B35B 1I5ZA 1SZBA 4LBQA 4LIUA 4G3YC 4AEDA 1VBD2 2WR9A 2D44A 3U14A 1H9PA 1MQTB 2PHRA 5EXOA 5FPLA 1F8VA 4GKXA 1GKBA 3SKJE 3ZO0B 5FUIA 5I0DA 1GP6A 3B94A 2ADEA 2YY1A 2F6BA 5F2WA 2GMEA 2VQ0A 3CJXA 1D4M2 5EZWA 1NG0A 2W39A 2WO2A 2UY9A 4JHZA 2ZXQA 2LTNA 1ULOA 1REEA 5KC5A 4XDOA 3RWNA 4TLFA 4UWDA 4V2WA 1OFNA 4WZCA 3VHPA 5L19A 3LSDA 4QDSA 2CDOA 2CGPA 3S7IA 3EXUA 2VUAA 3Q8EA 1LEMA 2GMMA 4QPGC 1QJU1 4WVVA 1FMD3 1SLBA 4FOQA 1IOAA 3OB8A 4MZUA 3DKQA 5ANNA 5FYSA 5C3PA 4HFSA 1DIWA 1QMJA 3NNJA 4TYSA 1QIQA 5FZIA 1C57A 4QU1A 4MGSA 2ZGQA 2NYYA 4HPKB 2VR4A 4UT5A 4RFRB 3FBMA 1QGLA 3EB7A 1NQDA 5FP9A 3VBUC 1YQ2A 2SLIA 1LOFA 3LSEA 4XUOA 1MS0A 3L2HA 2Z4FA 4CCMA 5FYUA 4M4PA 4I0WB 4XFIA 1L7LA 1S0BA 5EJ3A 4YARA 5EPAA 4YW3A 3VL8A 1NCRC 3ON7A 1OVPA 2O8QA 4BQYA 3A23A 3BOWA 1LOCA 3MIGA 4NHMA 2GALA 3M4FA 3T0AA 3D82A 4D6SA 2R061 1ND2B 2C0ZA 4MSVA 4ARXA 2EIEA 3HVDA 2BUKA 3K2OA 4HN1A 4CCDA 3GGLA 5FYVA 2Y6HA 2WSVA 4GB33 4ITCA 3WNNA 4CSWA 1EV13 3POIA 5LA2A 3M3QA 2XPJA 1AL0G 1N3PA 2YPDA 1W8UA 1YI9A 3ZXDA 1FOD2 5A80A 4NIIA 4RR3B 4Y4RA 3TEWA 4Q4X3 2DU1A 3O0WA 4XXAA 2YDEA 3WDWA 3C3VA 4QDQA 2O14A 5T50A 1WBLA 4OI0A 2ZA9A 2AC1A 1Q8VA 3RDIA 1R093 3LIGA 3AYCA 4D69A 1NKGA 1QH7A 2VO5A 4DRRA 4WVZA 4QQOA 3NJZA 2VZQA 5F1RA 5H9QA 1J1LA 5T55A 3WUCA 5FPAA 1HB4A 3N9NA 2WYFA 5A32B 2G9FA 5GALA 4OQ8A 3WDYA 5JR7B 4XURA 2P3JA 1S1AA 4UI9L 1LR5A 4LE3A 2XWBB 1LGNA 1LOBA 5D8AC 3EO6A 3NQHA 1CIYA 4ONUA 4JGYB 1O3SA 1J1TA 3PU3A 5FMOL 1FPN2 3GHNA 1E5RA 1H2KA 2O1QA 3SEEA 2V4AA 2AACA 5FZOA 1TEIA 1RUC3 5F6LB 3WSOA 3HPNA 3D5OA 4QPGA 2D6NA 3SH3A 3W21A 4EJRA 4IE5A 4CDQA 1QJY3 1OA4A 3PMSA 4ZS2A 5DAQA 1X8EA 2XVKA 2ZGMA 3SCFA 3CIHA 5ABJA 5T5LA 2MEV3 2A75A 2VCAA 2OQ6A 3ZYHA 1CX1A 2WNUC 4C8DA 3SEPA 3VUOA 3EMRA 2IXLA 2VZ3A 4O9GA 2VMFA 3URFA 3MHZA 3NWKA 3T4VA 2W5FA 1D2QA 3UL2A 4DQAA 4Q0SA 3B3QE 3OBZA 4ZKTB 1PO11 1RHI2 1NT0A 5A33B 3KQ4B 1WW4A 3OD4A 1QJX2 4ZU5A 4X6RB 2VCMA 3POSA 2A71A 2D6LX 1RUOA 2W87A 2F4PA 3HQXA 3ZIWA 4LO4B 4OUSA 4DUWA 2JDZA 2NM1A 4OFGA 1GOFA 1BHGA 3ZPOA 5FDBA 4CXXA 1VAMA 2JDPA 1PNFA 4Y1XA 2HLEA 3FMGA 3RYKA 1PIV3 4ZHNA 1ZRDA 1IHMA 1AYN1 2ARAA 3ZN4A 1L7QA 1R1A1 3I49A 2ZMNA 1WMFA 4JKLA 5F32A 4PI2A 3M3CA 4CCKA 2X29A 4MHRA 1YJKA 1ULEA 3U4SA 4HG6B 1YIFA 1UPSA 2JKBA 2QCSB 4WBBA 4XC9A 2BU9A 1U5YA 3SC7X 2ES3A 1ZRCA 1DYPA 1AUYA 2HWF1 2ZGKA 3N9QA 1VRH2 4MX3A 5DDJ3 5FYBA 1NYWA 2VW0A 4OHZA 2RHPA 4MGIE 4FAGA 1CZSA 4AGVA 1OLRA 1U12A 1UZYA 3C7FA 5T54A 1KQRA 1JU4A 5F3IA 5DABA 4RSUA 2ZOEB 3NNGA 1JYNA 5D8AA 4OVEA 4RQPB 2IZWA 2O8OA 2R042 1IPKA 4GMP0 4EWAA 3T2TA 5CKMA 4AGGA 2PYTA 4E8CA 2XMLA 1NQJA 4TTGA 2CWSA 1VMFA 4QD2A 4WVMB 1JYXA 4FI9A 4E9KA 2JECA 2VM9A 3JBG3 3RSJA 4CPBD 1JZ2A 2QQLA 4XF0A 4ES8A 5LBEA 4AEJA 3FUOA 3OUIA 4QU2A 4Q0VA 1EYBA 3S7EA 4H3WA 5K9YA 1JBCA 5FZMA 3KMHA 4ISQA 4XQWA 1ODMA 2YZ4A 1ZZCA 2X53S 1G6NA 1XU1A 2KXLA 3LA7A 1NY71 1UZVA 3VB9A 1XYNA 1VAKA 1US2A 2WNUA 4JKMA 2R6QA 1ODNA 4XQ4A 2JDKA 1U5IA 1X36A 1W0PA 1YEWA 2JD4A 2LUWA 5A7NA 5A3UA 4EYUA 1L7RA 1WKYA 3POFA 1PK6C 1HV0A 2G4IA 3AP6A 2Y0OA 3IDEA 1Q8SA 1HJFA 1OUSA 2QTWB 2DYCA 1J3QA 3IWZA 2E33A 4RS5A 2PQQA 3BU0A 3AZWA 1HRI2 3HNMA 1HB2A 1W04A 2W92A 2VAUA 2PLV2 1HQWA 3T2PA 1LB2A 3SH4A 3WEZA 1XNCA 4FAHA 2RV9A 4XAEA 2WQ4A 1PM7A 5EHDA 5GM0A 3W20A 4PJYA 3WR0A 2A6YA 2EALA 4UW3A 3WZ1A 1BJQA 3O1SA 1W2AX 3RMXA 4AQTA 1H2MA 1J3RA 2O0OA 3PHMA 3AP7A 2YU2A 4MOAA 3MUY1 4LKDA 4P9LA 5D21A 3KT4A 3LOIA 5DAXA 4B29A 5AC93 3BIEA 2HJIA 1H8TC 1PGSA 4UW6A 2WNVB 4AEKA 3AVRA 5FY1A 2I45A 4JHTA 4YLZA 3LGRA 3NVCA 1LODA 4GH4C 3B69A 4FPFA 4KGGA 1HB1A 5G05L 2ERFA 1IS6A 3DCQA 3U78A 5HCAA 3WQBA 1NZCA 2RS13 4INDA 4OULA 1FNZA 3WW2A 4LXLA 4MG2A 1NOVA 3PL0A 1IS3A 1H8TB 1GWMA 4Q0UA 5DG1A 1NCQB 4I0AA 2R16A 5FZEA 3WDTA 3ZMNA 3ZN5A 2D98A 5C8WA 3KCXA 1RVF1 4GB32 1UL9A 4NWVA 4QB2A 5JXGA 4Y20B 3T0DA 4QM8A 3RI9A 4I3PA 4XF4A 5FLIA 4MGZE 1BQPA 2XUMA 3AB0A 5A3NA 4BK4A 4FPLA 2MPFA 3KS7A 2EIBA 4Q4X2 1GMMA 4LHLA 2X5IB 1PMHX 4HSJA 4TN7A 2DBNA 5B4XA 3BUCA 4G4FA 5J1XA 1JZ6A 1E5HA 2XDVA 2VG9A 2QQJA 1DG6A 1VALA 3GBWA 4QHZA 4KH9A 4YZ4A 5L36A 1XNKA 4JGZC 2JXAA 2NQYA 4CP1A 2G19A 1S2BA 3HOBA 1O91A 4LBJA 3F95A 1TQ5A 2VH9A 3MW3A 2P6HA 1WWYA 1XPWA 2ZS6B 4W4ZA 5JCTA 3DGTA 3IBMA 2VXRA 2XLFA 1ENQA 1PK6A 5DZFA 4FPHA 3FLTA 4QWNA 4XZUG 4QKDA 4CEYC 1HX6A 3B01A 1QF3A 2JE9A 3MW2A 3S0MA 4Y4YA 3OBRA 3ZDSA 5B4NA 4NOTA 2DTWA 3T2OA 4D7SA 3NW4A 5FJKA 4JZRA 1UZ0A 4HKWA 3VKFC 1W2UA 4RGGA 5FY5A 4CUAA 4E2QA 5A7WA 3BTXA 3OUHA 1RUC2 3KT7A 2Y0IA 5IVVA 1A6CA 2Y33A 1RUF3 4IW3A 1ZBE2 2ORZA 3TEXA 5CBLA 5CFCA 3I3EA 3K3OA 3F2ZA 2Y38A 5FMCA 1SHWB 3I2KA 3LIHA 4COUA 1OF4A 3HBZA 2BVBA 3OPTA 4L8QA 2BPA2 4FQ4A 4UFIA 3T2QA 4F3JA 4XOGA 4B3NA 5C3RA 2GNDA 4KWLA 2VW1A 3SCHA 5A70A 2PHLA 3J26N 4OHVA 4BQ3A 2GC2A 1KEXA 3PUSA 1FYUA 1MS8A 4KGQA 2DFCA 1CR7A 4YZ5A 1QY4A 2BWCA 4XW3A 2VD7A 2JDMA 1JZ8A 2HWE3 4HXCA 4R4ZA 3P1IA 5IUQA 3THDA 4Y1ZA 4P9WA 5FTTC 1NAEA 1R082 1AZDA 1KDMA 1XNBA 2Z42A 1GZWB 3AXEA 3CHXA 4E27A 5HXMA 4NPLA 4U36A 4A41A 4JDNA 3FL7A 5HBAA 1WA4A 5FOBB 5DMYA 1RUE2 2DDUA 2ZGRA 3WINE 2NZ9A 3O1MA 2BVVA 2WC2A 3SQOA 1JHJA 5TSWA 1UYXA 2WFPA 2VZOA 3H9AA 5GZDA 4UF0B 3P3NA 2JIGA 4AVSA 2B9UA 4B1LA 4DEQA 1QOSA 3ENRA 2P3YA 5F6KA 4QDRA 2E9QA 4CTEA 1I9RA 2WBKA 4LLFA 1ZBA3 2B39A 4PQQA 5D1IA 3J8F3 1SBEA 5A3TA 3BU7A 1CAUB 3RMYA 1CAXA 5DDJ2 3VBRC 1BVP1 2PTMA 4JGZA 4BH9A 2DCKA 1X50A 2E7TA 3LEKA 4PHZA 3LPGA 4PF1A 2YYOA 1LOAA 2RMU2 4EN8B 1ULCA 2QNKA 5A7PA 5I8TA 4QPWA 4O61A 3OGGA 3VD3A 3A21A 3A22A 3POEA 4RHV1 4D6RA 4MVTA 3D0SA 4CEYA 4Q1PA 1XYOA 5AFBA 2FCUA 5FWJA 3BODA 3WF2A 3UKTA 5JZGB 2YHJA 3I8TA 5BNOA 5FO8B 3NJYA 5L7OC 3E1F1 5FZFA 5FCCA 1EPZA 3TNQA 1DGWX 4OHXA 3I97A 3W5MA 3PUQA 4GMP3 4QQ2A 4QGMA 1OFSA 2G1MA 5CFCB 1NA1A 4IQPA 1FI2A 3VDDB 5F5CA 4LHNA 4A45A 1VBB3 5JXHA 3JXSA 1RUD2 5CVRA 2GP5A 4GJYA 4QKBA 1AR91 4AOCA 1SLAA 1ASJ2 5JSRA 2VE1A 4Y1VA 1H2LA 5JOYA 3PMEA 2ZX0A 3RI8A 1VBD3 2V09A 4H7LA 1WD4A 2BEOA 2ZX4A 4UW5A 1RUI1 2VXJA 3RYRA 2A7AA 3ITQA 3V0BA 5FMBA 5HCHA 1G9FA 4YVWC 5KHGA 4XDPA 1H1AA 3G6JB 4QX8A 1IZ3A 3WNOA 1ZNPA 3PUAA 2B9VA 2DCTA 3VD9A 2C1FA 5C4WB 1D4M3 1UW8A 2IC1A 2JDUA 3KCYA 1MPXA 4DMIA 3WT3A 3D4KA 4XHXA 4AG4A 2R071 4AI8A 1WCQA 4S2HA 1EP0A 2DUQA 3VL9A 3WHTA 1OOPC 4P9JA 1GV9A 4MYEA 3U0ZA 2VBBA 3I2IA 4AW7A 2CY6A 3M70A 3RWKX 1RMU1 2JB4A 2Y6KA 2Y60A 4A6OA 1JZ7A 4M3CA 1CPMA 2CV6A 4E4HA 1QDCA 4L99A 5AC92 5IK8A 3RZJA 5I0UA 4OHWA 4UBHA 1QJEA 3ZXAC 3Q8BA 2YBKA 3KM5A 3QACA 1KITA 2WNEA 4SBVA 4QX1A 5IFPA 2JG8C 3RQ0A 4BLIA 1HQLA 4NRPA 3UKNA 5IVYA 2VCBA 1VB4A 2AR6A 3O5SA 3WQ7A 1WCSA 2WYSA 1SBDA 1PHMA 1YIPA 3H1YA 1F5FA 4IESA 4Y33A 4GD4A 2RS12 1JOPA 4WM7B 4MGKE 1ENRA 3OY8A 1GNHA 5EYXA 4CP9A 3ZYIB 1OH3A 2E53A 4N53B 1VB2A 1H4GA 2ZX1A 4BLJA 2HWD1 1I5PA 2VUJA 3J7LA 3RVHA 3TEZA 5I0SA 2D93A 1HXS3 5E6HA 3IM0A 1UZWA 2IXJA 2GAUA 1LCLA 2WIIB 4ET7A 3FHQA 2CSGA 4JRAA 3OJBA 2WAOA 3FX3A 5T5PA 5CA6A 4HVOA 1UN1A 1PGL1 1JUHA 2QVSB 5FK8A 3KD4A 2C6SA 4FPYA 2IVJA 4Q29A 4HVQA 5LA0A 1AR81 3O14A 4PIYA 3R05A 1C5IA 3I59A 2YROA 4XFCA 1IG3A 2BFUS 1FOD3 4ATEA 3VHNA 4AHYA 4COVA 5F5IA 1POV1 2VPVA 5J7MA 4KU7A 1S0JA 4L92A 4TZDA 2QBXA 3VKMA 3LOBA 3JQWA 4CU6A 1G86A 3H7YA 3IN9A 1QQP3 2FMYA 2VTXJ 3VBSB 2JE7A 4META 3GZAA 5LASA 4LO6B 4ASKA 4X6QB 4BWOA 3KZ4C 4K8RB 2BNMA 2B4KA 2UYAA 4ATFA 3OPWA 1BBT1 2ZX2A 2FDHA 2YBPA 3ACGA 2VULA 1PGW1 1YXWA 2W47A 2YC0A 4DUVA 2XBO1 4Y5TA 5CFDC 1OLME 4B8EA 1SLCA 2W68A 2JG9B 2ZGTA 1C28A 3CBNA 2R062 4MXWA 1W9FA 2ZHNA 4C90A 1XNTA 4IEOA 3NAPC 2VMEA 5ERLA 1FPN3 4IETA 4LUMA 3KSCA 4XBQA 4FOVA 5FZCA 4UXAA 1OOPA 2IXHA 1TE1B 1TZOA 4CDXA 4EZHA 2DVDA 1RIRA 3MI8A 1JTZX 2PQSA 5FYIA 1QNWA 1VP6A 4UOJA 4QHBA 3QH7A 5LB6A 5LK5A 4BA6A 3T08A 4OZXA 4OUEA 3Q8CA 3FHAA 5FY0A 1DQ4A 3LEIA 5FZKA 4LO8A 4MO3M 4CPBA 5I8YA 1GFF2 2JG8A 1YQ5A 3CNAA 1OPMA 1QJZA 5CNAA 5LEJA 1LENA 1OBNA 3OSDA 5KHKA 3DL3A 3VBHB 4ARYA 2YBSA 1M06G 3WNMA 2WZEA 3ZFEB 1AJOA 1AR61 1XNAA 1E5SA 4IXLA 3RFRA 3ROUA 1COV3 1ST8A 2RJ2A 5K0UB 4YVSB 3BCWA 3BYWA 5FQ0A 5E89A 3IDBB 3K3NA 4GXLA 1UOJA 2XJUA 1QJX3 3OOXA 3ZFFB 3NRUA 4FFHA 1OKOA 4YFZA 5F8PA 4CEWC 5DAVA 2E7AA 3JB8A 3R6SA 3IZOA 1AXKA 5FXVA 2EIGA 1FATA 2WA3A 1W39A 4TWTA 1BZWA 1TMF1 3HBKA 2VNOA 4QQLA 5FP3A 4BMEA 2Y26A 1LU1A 1UMIA 4K1YA 4W6YA 3EHKA 5F3GA 5FY8A 4LA2A 3M3EA 2Y6LA 2D3SA 1Q8OA 4AF9A 1TME1 4J1XA 1DU3D 3J8F2 4PI0A 3TOJA 5EYYA 2XHKA 2I2SA 4NPRA 4XIOA 1MZFA 3J9SA 2P3KA 5A7SA 1UYZA 5FZ0A 1BVVA 1VRH3 3JD71 5HXVA 2Q8DA 4AEDB 2BBVA 2RJKA 2FMDA 4LBQB 1J59A 1GNZA 3MIHA 1XRUA 3WNLA 3E97A 1XB9A 3RS6A 2PHUA 3H8UA 1GSLA 4FVVA 4NMIA 5IWFA 4AWDA 1PO12 1YFYA 2QZ2A 1J3PA 4IV3C 4LO5B 5FKBA 5JI7A 1DQ6A 3TN91 3BGAA 1LRHA 3WF4A 5CAZA 1MEC1 5FP7A 3VBFB 5IVFA 2H0BA 4XETA 2PHTA 1UU6A 2XJSA 2R043 5A7OA 2QDRA 3NAPA 4ZXKA 4I2OA 3BI3A 2W1SA 4C91A 4XUNA 1AR71 2ZAHA 1B35C 1F4AA 2G9ZA 3MPBA 4M0HA 1RUJ1 3PURA 4FPJA 4IL7A 3AKSA 1OLQA 1MQTC 4GQ7A 2E63A 3K48A 3LA2A 4FBFA 4Z2AA 4LMFA 1R1A2 3LFMA 3NSTA 4IDZA 4D6QA 4GKYA 1GQPA 3DXTA 5CZKA 3IMMA 4NO4A 3WP3A 2NMOA 2HWF2 2YV8A 4Q27A 5EWSA 2C9AA 3I3MA 4XVHA 4XACA 5DUUA 4CCOA 1A8DA 3D3AA 1ND3B 5HCFA 2GH8A 2EXJA 3NV1A 3ZN6A 4AHWA 3VLBB 4NROA 3HN3A 2R32A 4NAMA 3MUZ1 3KVAA 1YFXA 1K5MA 1HN1A 4Z1VA
chains in the Genus database with same CATH topology
1KDKA 4YW5A 1HRI3 2ZX3A 3AMQA 3AZVA 3N7LA 4CEWA 2C5DA 1HW5A 4A2UA 2PLV3 1N1VA 3VZLA 4WM8A 2E7QA 3LA3A 5GKAC 3OF1A 3ZXLA 3IIAA 4JQRA 4P9IA 2XL7A 4A7YA 3M2MA 1UF2C 4HK9A 3WUDA 2VOVA 3VHOA 3AP5A 5E88A 5FAXA 3WLUA 2E51A 1RGSA 2ET7A 5KHIA 1ND2C 1NY72 1W6NA 2QKDA 3D8CA 3C2UA 1RB8G 2DCYA 1WUVA 1AR93 4QT6A 4PBOA 1MS5A 3WG4A 4XJAA 1PO21 1VIWB 5FFOC 4GWNA 3ZFGB 3BALA 1C1LA 4HT1T 4RR3C 4LLOA 1HXS2 3MICA 4B4QA 2RM21 2XJRA 4HLTA 2WS91 1LULA 4YZ1A 4QPYA 4AVAA 2HWC1 3R4UA 3AYEA 4C1XA 1B35A 3UKVA 1MQTA 3VHRA 3POYA 5KHJA 2CAVA 5GLUA 1F5JA 5BNNA 2A6XA 4Q4Y1 3GYDA 3ZXGA 4B4RA 3ZYRA 1S0IA 3JQXA 1RUH1 1RINA 3W9AA 4CDQB 4QGNA 2A6WA 4LT5A 1QQP2 4JGYC 5ABJB 4GULA 4CDUB 5DUWA 4N43B 1AL21 1CAVB 4XFHA 3B9CA 5JVVA 5C9AC 3BTAA 5GLWA 1BK1A 2JEMA 3KCCA 5KC6A 3LB9A 1Y7BA 2A6ZA 1V6OA 2FBEA 1V00A 3KLSA 2OUHA 2VOWA 1H4HA 4HPKA 3WHUA 1RVF2 2WWSA 1VBA1 4AXOA 4I01A 4AI2A 5C9AB 2RS53 4Y1YA 1ZBE3 4I02A 2ET1A 4YG0A 3TNPB 3M3OA 1O5LA 4K7JA 4AGRA 1ENXA 1BEV1 2H0VA 1V9U3 5CB7A 4C0BA 4H7MA 5BNPC 5KXDA 2ZMLA 4OLLA 5E8AA 1YWKA 4BIOA 1ULDA 1ND2A 1C8M1 2WZR1 4ORFA 1MS1A 3VBUA 4DFSA 2GC3A 4XZPA 2UURA 4E4DX 4QM9A 1IS5A 4HZFA 5IK4A 2WFF3 1COV2 1NCRA 1S0DA 2JENA 1RJ8A 4M3CF 4RR3A 2I74A 4YG6A 2JICA 5BNPB 1TNRA 2ARXA 4JVAA 5DUXA 5ACA3 4BCUA 3AKQA 4NN0A 1R083 2WQZC 2PAMA 2VOKA 1CONA 4XFBA 1S0CA 1RUE3 3HIFA 3MF6A 2DF7A 1YHFA 3IT8A 4JAAA 1HRV1 1UCXA 2EXHA 3NV3A 5A32A 1J58A 2DUOA 1DGWA 5LRSA 2OIIA 2UU8A 1AXZA 2OW4A 1RJ7A 2P34A 4RQPC 4JGYA 1XYPA 1WLDA 2BTVC 1AYM1 1X8MA 2OZ6A 1V6MA 2FZ2A 3RYPA 1Z7S1 3R4SA 3INAA 2RMU3 2HEVF 1QH6A 1W6MB 2NMNA 5AFEA 1C5HA 1YFWA 3ELNA 4XF3A 1JOJA 3ZSLA 1FAYA 3G7DA 4RS5B 3MYXA 3K51A 4KNCA 1BCXA 4AI0A 4YM1A 5JPMB 3DUIA 1GICA 1BYHA 1C4RA 4COWA 4F8AA 2ZHKA 4Q4V1 3HT2A 2GC1A 1MR5A 4UW4A 1IKPA 1PVC3 4XF1A 1RUD3 1TNFA 1EAH3 5FREA 4FTBA 2WLQA 4K21A 2BW8A 3MFCA 4L9BA 1ASJ3 3OCPA 4AEMA 5DXDA 1PNGA 3N4MA 4PIZA 5J96B 2W0XA 4RHV2 1ZZ8A 2GDFA 5GLZA 5KBFA 5JPNB 3NV2A 2NN8A 2VY0A 1S0FA 4HETA 3ALQA 2WNVC 1WLWA 2ZZQA 1ZM1A 3AZXA 3ILFA 3POWA 4XJ8A 1A78A 3ECQA 1SDWA 3USUB 4AFMA 1O3TA 3B9IA 2YGLA 4LTAA 1KFUL 1SFYA 2EVXA 1NCQC 1YI7A 3WDXA 1BXHA 3E6BA 1ALYA 5CG8A 4LBLA 3ZSEA 2DCJA 5T5JA 2HWB1 3V56A 1AR92 4WVMA 3KQRA 4AFCA 1V70A 4C0HA 2MHFA 2UYBA 3O7OA 1AJKA 3L9JT 1RUI2 3VKLA 4HL0A 1NXD1 4IERA 3AKRA 4EN0A 4L2NA 2X5IC 2XL9A 2ZJCA 1GQHA 3WV6A 3HN1A 5BNQA 1DYKA 5EFUA 4NVPA 1Q56A 4COYA 2CAUA 2V73A 3WW4A 4MV2A 3X29B 5EV7A 3PVOA 4J1WA 3W59A 3CF6E 1CPNA 2XJTA 4EWEA 1KRIA 3O12A 2QJVA 3RNSA 2ZKLA 1RUG1 1V6IA 2D5HA 4GALA 1VLNA 2PHXA 5F9TA 1CD3G 1U5ZA 3HD8B 1VBC1 2UWAA 2B46X 1QJU3 1W6QA 5CADA 1I3HA 3APBA 2XWJB 3HT1A 3J4UH 3PJYA 4JC1A 1W6OB 1Q43A 3RZZA 4BMBA 3AP4A 3CJIB 5DUVA 2ILMA 2Q8OA 2N7GA 4UBGA 4WVWA 2ZGPA 4FSJA 4P14A 4HMZA 4DS0A 3ZSKA 2PA7A 2XVGA 3JUUA 4WZFA 4QGLA 4XHBA 5FRAA 4OHYA 4FPOB 3AZYA 3SISA 1YLLA 5GJ6A 3ES1A 1LGCA 3GALA 3V65A 2AGSA 1D0GA 2WNVA 2R063 4HN0A 5JOWA 1DZRA 1B09A 3VBOB 2IFRA 3ZIXA 1PGL2 2K0GA 2RS52 1ONAA 2VGDA 4DY3A 1RHI1 1LHOA 4EN6B 1V9U2 5C33A 1C1FA 5BPXA 4LR4A 1H8TA 1NCQA 1WCKA 4ISRA 4PDWB 3SH5A 4FT8A 4FXKB 4Q4W1 5DG2A 3MW4A 1I1EA 1LHUA 4GH4A 1WBFA 4K20A 4NHKA 2WFF2 5KXBA 3H7JA 5KXCA 1IPJA 1N3QA 3ZYPA 1DZTA 5C8CB 4XMIA 4YGBA 5AVAA 4QPIB 5ACA2 1PGW2 1FNYA 4AVVA 1RTVA 5A3MA 3MDPA 2XBO2 1SLIA 2ENRA 4PIXA 5BNOB 2DU0A 4HVRA 5FO7B 1VBE1 2B5HA 3M3IA 1ULFA 1UKRA 4P9GA 3PVBB 3OYWB 3WP4A 1O7FA 1L3JA 4XBNA 2W08A 1NA1B 5BUVA 2UWBA 4AVBA 2P3IA 3FZ3A 2PHWA 3NO8A 1PMIA 4CDWB 4AVCA 3VZNA 5JZGC 1A8MA 1YNAA 4IEXA 4NHLA 4FOYA 3NKGA 2ZBJA 2FZ1A 1AR62 3V0BB 3GZUC 4COZA 1PO13 2A3WA 4PLMA 2QZ3A 5CFCC 2ZGSA 2D5FA 3H0OA 1GANA 3VDDC 3H50A 1KS5A 2WL1A 2B45X 3AKPA 2MNGA 2RE9A 3ILRA 4IV1B 3IPVB 3FHIB 4JDOA 3U11A 2CL2A 3SMHA 3VKNA 4FXGB 1AF9A 1D4VB 1GZCA 1TMF2 1ZYBA 1CAWA 2PELA 5SV8A 1AYN3 1R1A3 1PVC2 1TME2 3S6PA 1UIJA 3BOPA 5IK7A 1H8VA 2ZKNA 1GZWA 2D6PA 1EAH2 1CGPA 2CYFA 3I7DA 5FMOS 5C4WC 2G9GA 2A5ZA 3LWCA 4W65A 3WVJA 2HWF3 2VMHA 3JD72 1KS4A 4GIQA 1D0HA 1LOEA 4CP2A 4CYDA 3OPZA 1YFUA 1JW6A 1MS9A 1SCRA 1MVEA 3OY8B 4XFAA 1FMD1 4AFDA 3DPRB 1QOTA 1XE8A 3ZMOA 5K7PA 1NXMA 3TN92 2XJVA 2YUEA 3UV9A 2ZGNA 4Q2FA 1ZZ9A 4S2FA 1CAUA 2R49A 4Y22B 3KGZA 2EXKA 1RL3A 1XE7A 3MEPA 1XNDA 1H2NA 1AR72 2VNGA 2VNRA 2W52A 1RUJ2 1ZA4A 4RL7A 1HDKA 1DGRA 4IEPA 4WM7C 4N53C 2PAEA 3ZYGA 4YW4A 2AUYA 1HQNA 5JZGA 3VBRA 2H6BA 4GB31 1EV11 1CX4A 1PZ8A 4XILA 1GQGA 3N3HA 3TB0A 2B42B 4FCAA 3B5LB 4Q4X1 2K9ZA 2ETEA 1CIWA 3B7MA 2DTYA 2BWAA 2ZGUA 2AH2A 3DKWA 3CEWA 5CFCA 2CNAA 4M0NA 3VDDA 2EAAA 4I09A 1R091 2PHDA 4JV4A 5L7OA 1OI6A 2DVFA 1UMZA 5I91A 3VBSC 2A70A 4BQ1A 4LBMA 1ENSA 4BOWA 3ACLA 1MZ5A 1APNA 2A3YA 3QBQA 4CDXB 1H30A 3DF0A 4XIKA 3OBTA 1QJU2 3HMYA 2DCZA 4Z92B 2QDNA 1O4ZA 2YMZA 3PVNA 5FO9B 1I6XA 1G9AA 1SQ4A 2JG9C 3DN7A 1WCDJ 5L73A 3UK9A 2WZPP 1QU0A 1ULGA 3ATGA 4KL1A 1DDLA 1RUC1 1MS3A 2R30A 2XB6C 5B2GB 4K8FA 3VKOA 4YVWA 3QH6A 3WG1A 1QJY1 1YJLA 5FQ0B 3AJZA 2RM22 2IWGB 1WW5A 3I54A 3W58A 2WS92 2B7YA 4G9SB 2MEV1 4YW1A 5J3UA 2HWC2 4Y24A 1RVF3 1MVQA 1OD5A 2OZJA 5T52A 2AZ5A 3VBHC 2A73B 3KT1A 4R52A 1POV0 4WM7A 2K2SA 4XPVA 1F2NA 4XMAA 3ZFEC 3VZKA 4Q4Y2 5K0UC 2ZHMA 4YVSC 2CWMA 1RUH2 3ZFFC 3LZZA 2EAKA 3MIEA 3QLQA 4JTOA 3UJOA 5I93A 4R4XA 3KB5A 4YM2A 1AL22 3TAYA 1PIV1 4LO7A 1Y9QA 1OMIA 3ZX7A 3UJQA 1RITA 4XTPA 2OUJA 4D7TA 4LHKA 1AX2A 4M01A 4AI3A 5FPXA 3FWEA 1KJLA 1SCSA 4DZGA 5DDJ1 1SACA 4FP2A 1H1MA 1VBA2 4AEDC 5JIAA 1GZ9A 3N35A 2DWRA 2YPJA 1A3KA 2YXSA 2Q1MA 1R1ZA 3VBFC 5JMCA 1ZRRA 2JG9A 3OD0A 3B00A 5I8SA 1C8M2 3JBG1 4YFWA 4DRVA 1X7NA 5GLTA 5JI9A 2ZABA 2GNTA 3ZN6B 5HI0A 3ZYJB 5CFDA 1K5MB 3L2YA 2WLPA 5JSOA 1LKNA 4MGYE 4AVTA 1DF0A 4HANA 2E6VA 4WM8B 1LOFC 3VBHA 3E6CC 1W6PA 2PN5A 3GNEA 4P9XA 1AYN2 3NV4A 1ND3C 4EN7B 4FTEA 1OA3A 3MF9A 4I3GA 5JAXA 3QCWA 1BMV1 4Z8BA 1AYM2 3H1WA 1XQNA 2VVFA 3FE5A 2GNBA 3FLRA 1Z7S2 3FFZA 3O0XA 2HEWF 3SNMA 1ZRFA 3V0AA 5IK5A 1OA2A 4RHV3 5AC91 1WD3A 3DV8A 2VMGA 2TBVA 3NL1A 2GN3A 1Q3EA 2XH6A 4Y26A 4L97A 2WT0A 5GZFA 2RS11 5GZEA 1MS4A 2RR11 5BNNB 4Q4V2 4AYUA 1C3HA 1NLRA 1UD1A 5FLJA 3ZFGC 2VOXA 3N7KA 2ZZJA 3VBFA 2IXCA 3HWJA 1S55A 1SBFA 1QWRA 4O9EA 1O5UA 4OI1A 4D7YA 4BZ4A 4AFBA 1O4YA 1ZREA 2ZTNA 1QXJA 3RJRA 1MZEA 3PTYA 4K9SA 2XGXA 3NKTA 1S0GA 4YGEA 1RUI3 4IV3A 1JN2P 4FOWA 1CN1A 2Z69A 3SXWA 2Z2SB 3JB4C 2KM2A 5CG9A 4CDQC 4Q8KA 4A7ZA 5BYNA 1UZZA 3GHMA 1QNYA 2DUPA 5ABJC 1SFNA 3QOPA 1EPWA 4CDUC 3GZTB 2R073 4N43C 3E5UA 5I0TA 3AMPA 5JSPA 3AZZA 3TBDA 1Y43B 3ZVXA 1ND3A 4QPGB 1RMU3 2XLGA 3A0KA 5BV6A 2JX9A 1G9CA 3WD5A 1NE6A 1H0BA 4RA0A 3M7AA 3MIFA 1C8NA 2WJSA 3U4XA 2ZGLA 1QHDA 3SHRA 1SMVA 2WKKA 3VBUB 2VW2A 2HWB2 2GU9A 2XG3A 1RUF1 4RD7A 1LU2A 1Q8PA 2TEPA 1NCRB 4N7UA 4LEJA 2R1DA 2GNMA 3THTA 4PCRA 1VR3A 3OGJA 3MLKA 2HWD3 1EY2A 5BXXA 2BNNA 1X82A 1JH5A 4YM0A 5JLVA 4YG3A 2DURA 3WY6A 2HWE1 2BNOA 2HKXA 2VQAA 4HSLA 1AR83 4FO9A 4EV0A 1RUG2 3ZFGA 5H9PA 4AHZA 4CRQA 4DINB 1V6KA 1VBC2 4PF5A 3WX5A 1POV3 3WW1A 1ZZ7A 3HAGA 1Q8QA 2LALA 1OHFA 1G9BA 2ZAAA 4Y1UA 4LE4A 3BB6A 4JCKA 4H55A 3BIWE 2IFWA 3FFQA 1BBT3 1ZBA1 1YRZA 3J8F1 5D8AB 2CTVA 2XBO3 1URXA 4NR1A 4X8NA 4ASMB 2HEYF 2ZCWA 3MFAA 4HKOA 2R0FA 3T1LA 4CDUA 1WLCA 4V1PA 4N43A 4XFFA 2IXKA 4ZU7A 1CAVA 1N1SA 5JOZA 4KWJA 4OI2A 1WLTA 4IEUA 4QXKA 2EF6A 4AFAA 1DGLA 3AK0A 4DNYA 1Z0HA 4RS5C 4Q4W2 4BYYA 3EJKA 1F9KA 2WNUB 3WDVA 3B93A 1V6NA 4GMP1 2XKOA 3LCPA 5C9AA 1HV1A 4TSVA 3JCIA 4YSFA 1U0AA 2RS31 3USSA 5F5QA 2EXIA 1AR63 4KG0A 2WSUA 3WG2A 3N36A 1FT9A 1VBB1 1DQ1A 1KJRA 3THPA 2GMPA 4C1WA 4DY5A 4XTMA 3MIBA 3MLLA 5LRRA 4K1ZA 4M3CE 1N3OA 1VBE2 4K6BA 1CQ9A 1VBD1 4XXPA 4AHXA 1TMF3 5A3LA 2BFUL 5A33A 3ZSMA 3VZMA 2D3PA 5BNPA 3MIDA 3WCRA 1V6JA 1TME3 3HR9A 4XBLA 1D4M1 5DZEA 4MXVA 2WA4A 3AXDA 5J98B 1S0EA 3TYJA 4XJ9A 3AMNA 4IEYA 4JDMA 3JD73 3V64A 2GC0A 3IKWA 5FLHA 2NPIA </