4XFCA

Cysteine dioxygenase variant - y157f at ph 6.2 unliganded
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfcA00
3KGZA 3CJXA 4J1XA 1UIJA 4GULA 3U0ZA 5E16A 5LRRA 1Y9QA 3KSCA 3KCCA 3PLQA 3TNPB 1IPJA 5FQ0B 3RYKA 1EPZA 3EBRA 5CADA 4IESA 1UIKA 4R8HA 4XFIA 3GYDA 2GC3A 3CL1A 4I2OA 1HW5A 4ONUA 5KHGA 3OF1A 4D7TA 5I8YA 1J3PA 2H6CA 3E6DA 3MYXA 1DGWA 3D82A 4KL1A 5I0TA 5LEJA 1FT9A 1VP6A 2B9UA 4I09A 4Q0VA 2HJIA 2H0VA 2FMYA 3QACA 3I54A 2XLAA 1J3QA 1X82A 3N4MA 1ZZ6A 1O5LA 5KHIA 5BY5A 1CAUB 1GQHA 2EAAA 2GC2A 2VQAA 4QGMA 2EVXA 1XE7A 3H9AA 3H50A 4OFGA 3SCGA 3NJZA 4IEUA 3SMHA 3S7IA 5AVPA 5FDBA 2Q0AA 2GC1A 4LUKA 2Z69A 4ZU5A 4XF4A 2ET1A 2F4PA 3EQEA 1WGPA 3M70A 3RPQA 1ZRRA 2PHLA 2QVSB 4YSFA 5K8SA 3IBMA 4PJYA 3LA7A 2PAKA 3FFQA 4QM9A 3E5XA 3G7DA 3BU7A 4IEQA 4IEWA 4QX5A 3LAGA 2B5HA 1RL3A 2GZWA 2O8QA 3OTFA 4QGLA 3WW3A 2D5HA 2Q4SA 3R6SA 2ZKLA 1EP0A 2H6BA 2K9ZA 3MPBA 4LLOA 4XF1A 2OZJA 3UKNA 5JSRA 1LR5A 3I59B 2ATFA 1O5UA 1NE6A 1SQ4A 3ROUA 4WZCA 4ZU7A 5HI0A 3NKTA 2XHKA 4HLTA 1CAXB 1YHFA 3DKWA 1H1MA 4XFHA 2CV6A 4MH0E 4IEPA 5LEKA 4H7LA 3SXWA 4LULA 4XFBA 4IEVA 2Z2SB 4L2NA 3O14A 5I91A 1H1IA 4HSLA 3UKTA 4X6QB 1PMIA 3H7YA 4L11A 1YFXA 3PVBB 1I5ZA 2FQPA 4MZUA 4O9EA 3IWZA 1ZRFA 4J1WA 1ZNPA 1ZZ8A 4HN0A 5JSOA 1CAVA 4WVZA 3FJSA 3BALA 3IIAA 3LOIA 2KXLA 3MZHA 3FE5A 4WBBA 1QXJA 1U12A 3UKVA 2OPKA 2IXIA 3B02A 3IDBB 1XE8A 1J59A 4KWJA 2IXLA 3RZZA 3LWCA 2XKPA 1J1LA 1Y3TA 2BEOA 3E97A 4Q29A 4EWDA 4N9HA 3ZDSA 4UXAA 1LRHA 4BYYA 1O3SA 1ZRCA 3SCFA 2OA2A 3FHIB 3IDCB 4FAHA 3WW1A 3E5QA 3H3ZA 2GC0A 2GU9A 2ET7A 3JZVA 1ZREA 2PQQA 2CGPA 1RUNA 1OI6A 5KHJA 3H7JA 1JUHA 5FCCA 4JTNA 4IEXA 4EWAA 2P17A 4ZU4A 2PHDA 1DZRA 4YYOA 4I02A 4HVQA 2EA7A 1CAWA 3H1MA 4JV4A 5FPZA 3U10A 4YRDA 2ZCWA 4BIFA 4AQ6A 5I0UA 3H1WA 2QDRA 4FT8A 2BNNA 5F1RA 5E1RA 2E9QA 5I8TA 4UBHA 2PAEA 3ST7A 5J48A 3S0MA 1V70A 4XF0A 1GQGA 4DINB 3TNQA 4XEZA 2UY8A 4HVOA 1OFNA 5I0RA 5JR7B 2IXJA 3PNAA 4LEJA 4E2SA 4Q0UA 4K8FA 3EHKA 2BNOA 3DL3A 4LUMA 1UW8A 2QCSB 4XFGA 1PM7A 2PFWA 5J7MA 4A2UA 3LA2A 4LA3A 1QXRA 4JTOA 2OYZA 3NSTA 3CF6E 4R52A 4AVAA 3HQXA 3OGJA 4AVBA 3BB6A 2CAVA 4MGIE 4Q0SA 2PA7A 2GAUA 2I45A 1UD1A 4EROA 4RD7A 2BYVE 4KWLA 4FAGA 1QWRA 4YARA 1J3RA 5KBFA 2MHFA 5BXXA 4F8AA 1O3QA 2IXHA 4EWEA 2Q30A 4MGZE 1UCXA 3HIFA 2D40A 5JAXA 1X8MA 3LZZA 4XETA 4LTAA 4MV2A 2BGCA 1YFYA 1Q5OA 4AVCA 1EY2A 1WLTA 2WFPA 4PIZA 1Q43A 1FXZA 4QMAA 3H1YA 1RGSA 4BH9A 5C8WA 2Y0OA 1ZZCA 3NW4A 5FQ0A 4I0AA 4PIXA 3NL1A 4NVPA 3KGLA 1VR3A 2ETEA 4META 3GBFA 1OD5A 1EYBA 3OD0A 1O4TA 3S7EA 4N9IA 3FZ3A 5J3UA 4HVRA 3E5UA 5D1IA 2QNKA 1ZZBA 2XL9A 4P9GA 4HMZA 3H8UA 2UY9A 4HBNA 4KWKA 3WW2A 5EFUA 1YFWA 4XFFA 3E6BA 4JVAA 2VECA 5FLJA 2VPVA 3ES4A 1CAVB 2XLFA 3E6CC 1ZZ7A 4IEYA 1CAUA 1DZTA 3QOPA 4IERA 3ACLA 5FLHA 4E2QA 4BHPA 3HT2A 1ZZ9A 3ES1A 4XFAA 1O3TA 2WC2A 3DV8A 1L3JA 1FI2A 2XKOA 3HT1A 1X8EA 4AQ2A 4QM8A 1CGPA 5FLIA 1NZCA 4I01A 3SCHA 4MUVA 4EV0A 3USSA 1YWKA 3RNSA 3OCPA 5KHHA 3FX3A 1TQ5A 4D7SA 1YLLA 2V09A 3M3IA 5CVRA 2PYTA 5LRSA 3ETQA 5CU1A 4I0BA 2QJVA 2OZ6A 5I93A 4XF9A 4Z82A 4CYDA 2IXKA 4XFCA 1YFUA 1O3RA 3U11A 5BV6A 4MGYE 4UBGA 2IC1A 1OMIA 3ELNA 4B29A 4E2GA 1CAWB 2XLGA 4MGKE 4HN1A 4Q0QA 2PAMA 1CX4A 2B8MA 2MNGA 4KU7A 1LKNA 4TLFA 4IETA 3WW4A 2BNMA 4HZFA 1J58A 2C0ZA 4X6RB 2D93A 4F7ZA 1IPKA 3CLPA 3I59A 1O7FA 4LA2A 5KHKA 1NYWA 1SFNA 1CAXA 4OLLA 1RTVA 3DN7A 3VHRA 3D0JA 1SEFA 4KU8A 2UYBA 3D0SA 3I7DA 1I6XA 3EO6A 5BUVA 1NXMA 3RDIA 5I8SA 4Z07A 3C3VA 3BPZA 4QGNA 5I0SA 4QXKA 4I3PA 4XF3A 1WA4A 1G6NA 3FWEA 1NE4A 3SHRA 1DGRA 2D5FA 2DCTA 5C6CA 4IEZA 2HKXA 3KMHA 2MPFA 1VJ2A 3RYRA 3BCWA 2XGXA 4ORFA 1LB2A 2UYAA 2XL7A 3RYPA 5JSPA 1ZX5A 3LA3A 4O9GA 4YNIA 3L2HA 2CAUA 2IXCA 3MDPA 2PTMA 2K0GA 2N7GA 5FPXA 5T3NA 3H3UA 2O1QA 3CEWA 1QY4A 4HSJA 1RC6A 5BPXA 3EJKA 1X7NA 1ZVFA 1XRUA 1ZRDA 2Q1ZB 4Q0PA 3CO2A 2GH2A 1Q3EA 4MX3A 4IEOA 5EZWA 5JCTA 1RUOA 3NVCA 4AXOA 1UPIA 4PIYA 4FBFA 1YUDA
chains in the Genus database with same CATH superfamily
3KGZA 3MFCA 3VBOB 2RJ2A 4MGSA 5T50A 1UIJA 4K8RB 2RE9A 1US3A 3ITQA 1ND3B 2AENA 3DPRB 3I3EA 3IT8A 3MGUA 4M4PA 3BPSA 4OHWA 4QX3A 5CFCC 5JI9A 4JDMA 1YQ2A 5E16A 3AP4A 1YO8A 2BGOA 3PUSA 4XDOA 2JG9C 3PLQA 4Y1XA 1URXA 4IV1A 3ETPA 5F3GA 3TNPB 4CPBD 2YC0A 1R082 4NRMA 1UL9A 2HBTA 4QPIB 5CB7A 2HWB3 2G9ZA 3GYDA 4YVSB 2DUPA 5FZ6A 1KQRA 2ES3A 2Y6GA 4B1LA 5B2GB 2XJTA 4H14A 3VGIA 1AXYA 1SLTA 1KJRA 4QD2A 4QKFA 3MBWA 4Q4Y3 5IJRA 5A7QA 4D7TA 5FP9A 1U0AA 5I8YA 1J3PA 3MYXA 1UOGA 4M0NA 1OHFA 4BPZA 4FFGA 4FOQA 4L8QA 4QQPA 1JODA 5H9PA 3TRSB 2D43A 1FT9A 1VP6A 2YDEA 2VZSA 2R061 1LGBA 1NCQA 5KXBA 3WDUA 3QACA 4GB33 5FMBA 1NY72 1PK6A 4ATEA 2XLAA 1J3QA 5C9AB 3NMBA 1E57A 1I5PA 5FKCA 1O5LA 3GBGA 5BY5A 5KHIA 4XIKA 2OX0A 1CAUB 1GQHA 2BW8A 1AXKA 4QGMA 1DGRN 1RVF1 4A4AA 1K42A 1WUVA 3AZVA 1IS4A 3K51A 5A3LA 3PVNA 1ZBE1 1DQ4A 2XJRA 1OLME 5CAZA 4D8MA 2W3JA 3H9AA 4K7JA 1JI6A 1A8DA 3LEMA 3FHQA 5IAVA 4CP0A 2QQJA 5CG8A 3POIA 1PNFA 1TEIA 1R1A2 2Y26A 2Q0AA 3TBDA 3ZFGB 3ENRA 4LPLA 1CJPA 5LATA 4LO4B 3ZYFA 1RUG1 1IQAA 1MZEA 4ZU5A 4N8MA 5C8CB 4AW7A 2Y6FA 3C7HA 2ET1A 5DXDA 3MIBA 4XDQA 4CDWC 1AYM2 2VZQA 3OEBA 1S2EA 1WGPA 1ZRRA 1QJY1 4XXAA 4CEWB 3VDDB 4Q8KA 3LFIA 4LQRA 4NN0A 4QM9A 4QB2A 3BU7A 2BVVA 4IEWA 1PX3A 4AHXA 3LAGA 2BOIA 2VVFA 5FZ4A 1RL3A 4S2FA 5FPUA 2A71A 3AP9A 3WW3A 1OBNA 1W04A 5CFCA 4BQ2A 2DFBA 3WDWA 4AFBA 4YGCA 4BK5A 2ARCA 3SEPA 2JG9A 4QQHA 1MZFA 2Q4SA 4AEDB 1S0BA 2ZEWA 2P37A 4PI2A 3CZJA 2WNVC 3U78A 2J1TA 3AJZA 4NIHA 1D0HA 2HEYF 1DQ6A 3OJBA 5JXGA 4XZPA 1PGSA 1ZA7A 2OZJA 1S0EA 2VXJA 5JSRA 1DQ5A 3I59B 1O59A 3PVEA 1DIWA 1VBD2 3K4ZA 1OC1A 2J42A 4CA9A 4MHUA 3N36A 5FUNA 5FZKA 3WG1A 3FMGA 4ZZ5A 1JYTA 1W06A 4IV3B 4N53C 5C7GA 3N9NA 4K40A 4CU6A 4IEPA 3WF3A 1UXZA 2BBAA 4JHZA 4UI9L 2VC9A 3LFMA 4H7LA 5FBJA 5LA9A 4BQ5A 5IVFA 2RS12 4LHSA 2Z2SB 2ZBJA 4BLIA 1H1IA 1OQ1A 2D6MA 1PMIA 3HJRA 1N1TA 1UO9A 4N7IA 4GMP0 3VDAA 2UWCA 3ILNA 3OGSA 3A4UA 3WNNA 4GWIA 4ARYA 4FCAA 5LCWL 3IWZA 5T5OA 3WCRA 2WA4A 4HN0A 3VBHA 3B94A 5BYNA 1KD7A 1KITA 1U5ZA 2QTWB 4U36A 4XJWA 1CAVA 3PL0A 2CHHA 1JH5A 1V00A 4K1YA 4W50A 5FYSA 4UFJA 5KC5A 1OA3A 2V4AA 3RQ0A 2WS92 3BALA 1QJU1 4RHV3 4GD4A 3RS6A 3DYMA 3S5AA 3MZHA 2O14A 1XNTA 2B9VA 4AFCA 4C1XA 5FYMA 2KM2A 2PHWA 1FMD1 2BTVC 5F7UA 3OYWB 1BMV2 3FN9A 4KWJA 2RDNA 5C3OA 3RZZA 2XVLA 3PU3A 4FTBA 2DVFA 3J7MA 4CDWA 2GNBA 1QIQA 1W6NA 2R49A 2R071 5D21A 3ZDSA 1ZRCA 4JGZB 3BU0A 1H9WA 2XJQA 3IDCB 2D44A 3WW1A 3ABZA 4FAHA 1HQLA 4COWA 4LBOA 3AKQA 2WWUA 1QDOA 1Z7S3 4AI0A 1W6PB 2CGPA 3D8CA 3NV1A 4C0HA 2ILMA 5FZ3A 4JTNA 4LNVA 5ANNA 3RVHA 4CEYB 4BJ0A 4NPMA 1SLCA 3RRDA 1OH4A 1DZRA 4QX2A 3UJQA 3HNMA 1DQ0A 2GN3A 5FPZA 3U1XA 3WR0A 2WNVA 4YRDA 3VBOC 5ABJA 4Q5OA 2Y6HA 4AQ6A 1ND3C 1FPN1 3DPRC 3GZTB 5I0UA 3H1WA 3GHMA 3RMYA 3UL2A 3ZN5A 3HNYM 2E9QA 5J98B 5I8TA 5JUVA 5LA0A 2XBO3 2PAEA 4XZUG 3T4VA 3HNBM 3CU7A 4XF0A 1AYN2 1ST8A 1WMEA 4O65A 3I8TA 2QQOA 2VOWA 4P9LA 4DINB 4QPIC 4N53A 2ADEA 2PN5A 3PNAA 4HANA 4YVSC 4D6RA 3Q8CA 1RUI3 2RDSA 5ACA3 1UMZA 3VZLA 4K8FA 4J6GA 2VH9A 3CHXA 4LUMA 1UW8A 1OXCA 1UMHA 5L9BA 2VZVA 4CDUB 3BN6A 4AVVA 1TNFA 4XC9A 1JOPA 1S55A 2P3KA 3SQOA 4AI2A 2EXKA 1H2LA 2G19A 4LA3A 5F32A 1K5MB 1QXRA 4XQDA 3ATGA 5J96B 3DYPA 4DB5A 3CF6E 1MS1A 2VZ3A 4O61A 4XQWA 1Q8OA 4WV8A 4AVBA 5C9AC 1LTEA 2YZ4A 1OH3A 3U37A 4NWWA 4NMIA 3OUJA 4Q4W1 3ZXLA 4Q0SA 2PA7A 5EYXA 3WZ1A 4FSJA 1X33A 3A23A 3DXTA 3AZZA 3ZPOA 1G9CA 4FVVA 4BOWA 4DEVA 3WD5A 1VBB3 3PIGA 5FAXA 5SV5A 1EAH1 4NIAA 2VR4A 1S0IA 1LHUA 5ERLA 1H6XA 1JYVA 3OPZA 1WCUA 1HRV2 1NAEA 4YWAA 4ZZ8A 2VZUA 3ZFGC 1XPWA 2MHFA 4YW3A 2NMOA 2AGSA 1SG3A 1AR61 4UFIA 1OT5A 3K48A 2X10A 3OEAA 5C8CC 5DN2A 4CCJA 1W6MB 2JIGA 4EWEA 2ZGMA 3KVAA 4NIIA 2P6CA 3AXEA 5IK7A 2JE9A 3PU8A 4XE9A 4YZ3A 1UCXA 4DRVA 4QDRA 1XU2A 2D40A 3HIFA 3J9SA 3OPWA 5JMOA 1H0BA 3U14A 1XNBA 3ZYPA 1F8VA 4PCRA 5CKNA 1X8MA 1D4M3 4CEWC 3LZZA 3VDDC 2VGDA 3BOPA 5A7WA 2Q8OA 2VTXA 4LTAA 3SH5A 1HV1A 1KJLA 2UU8A 2BGCA 3IN9A 3OGRA 1GZTA 1UX7A 5IVBA 1AL21 3AP5A 3MF6A 4QAWA 4OZOA 4P9JA 1YCIA 3VBOA 2WQZC 3LSDA 4HT1T 1ND3A 3UK9A 2TEPA 5DABA 3G6JB 1FXZA 1O8PA 2CDPA 4W6XA 4QMAA 4LKDA 2X09A 3VBSB 4BCUA 2RR13 4QPYA 5C8WA 4NE9A 2YPJA 3RZJA 4AEDC 2Z42A 3KQ4B 4I0AA 4PIXA 4QPIA 4IE4A 1YQ6A 2V72A 3N7LA 1KXGA 3PMEA 2OW4A 4YVSA 3POFA 1O4TA 3MIHA 1QXPA 1BEV2 2BQPA 1R092 1BKZA 4G4FA 2Y38A 3KHBA 1UY2A 2ARXA 4HVRA 3E5UA 5IFTA 4AFMA 2PXJA 2YU2A 1LESA 4P9GA 4ISQA 5LZ6A 3TEYA 4I30A 1JTZX 2E32A 1SBDA 1ASJ2 2C26A 2WYFA 4IV3C 4XJ9A 4Z8BA 1OPOA 3VN4A 3H8UA 4XQ4A 4TYSA 5L36A 3AKPA 2WQ8A 1VMFA 2VD7A 1V9U2 5DDJ3 5EYYA 2L9LA 1V6MA 3J8F1 4L9BA 4YW4A 3WW2A 4E8CA 1DFQA 4DUWA 3SKJE 4K6BA 3LKJA 4JCKA 2RVAA 5LASA 4YM1A 5C9AA 1RUE2 3MLJA 1APNA 1NQJA 2ZMKA 1SLAA 2MEV1 3ES4A 1UYZA 3Q8FA 3W9AA 2D6PA 1AR72 2WZEA 4IEYA 4KQ7A 1CAUA 1DQ2A 2GDFA 4E2QA 4BHPA 1UQXA 4ES9A 5FY5A 3HT2A 2P3IA 2CWMA 1XSQA 1L7QA 2XXZA 4OI1A 2HEWF 2EXJA 4XFAA 2JDZA 2V73A 4Y1VA 4XHXA 5DZFA 1L3JA 2XKOA 4MADA 1W8FA 2XMLA 3FC0A 2R063 4LITA 4BWOA 5GJ6A 3ZFGA 1OUSA 4FPGA 3WXPA 1VRBA 4CCOA 1DYKA 1SDWA 2E7TA 3SLIA 2YGLA 3WSOA 4MUVA 4QDQA 4EV0A 3VDBA 1C8M3 2VCMA 3USSA 3WNPA 2OKXA 3GJAA 2RG4A 3FX3A 1RVF3 4BQWA 4UWDA 4D7SA 1ZBE3 3M3IA 4JGZC 3GALA 5EHDA 4NHLA 5CVRA 2XHNA 1GP5A 4LBMA 4PI0A 5EV7A 3TAYA 3VDDA 1LNSA 4CEWA 2WZR1 2PMWB 2Y34A 2ZAAA 2QJVA 3GDBA 1RMU3 1XB9A 5I93A 1POV0 1KFXL 3URFA 2HEVF 1H6YA 1RUJ1 4XW3A 1CZVA 1AR82 2IC1A 5FZCA 1OMIA 4D6QA 5F9TA 2PLV3 4E2GA 1ODMA 3OPTA 5FUIA 2R072 4HN1A 3C7OA 4DY3A 1RUG3 4Q4X1 4WM7A 4CEYC 1HV0A 3WDXA 3U4XA 2P6HA 1O4ZA 3JB4C 4KU7A 3THCA 1F15A 4FOVA 4AEDA 1QJY3 1JZ2A 3HR9A 3WF4A 2WRAA 2W39A 2WDBA 1S1AA 5FPAA 4A41A 2C0ZA 1W2NA 2D93A 1POV1 4CVUA 4F7ZA 5KC6A 4GJYA 1AUYA 3UJOA 1IPSA 1JYXA 1WMXA 3CLPA 3I59A 1COV1 2YBPA 3BGAA 4NHKA 2W9XA 4LA2A 3JBG3 4TXWA 2K46A 3GZUC 5FMDA 4D6SA 2JECA 1NYWA 5GLTA 1GV9A 3INAA 2DCYA 1SFNA 3VD4A 4PT6A 4E27A 4M3CB 1RTVA 2FDHA 3DN7A 3OGVA 5AC92 5FRAA 4OYUA 1SEFA 4P5YA 2DV9A 3LIGA 1QF3A 2UYBA 4QX8A 5CNAA 1E5RA 4CDUC 1GOGA 5A33B 4DO0A 1NXMA 5L73A 5FIXA 5LA2A 3RJRA 2VXRA 5I8SA 4Z07A 1J84A 3N7JA 4QGNA 4Z2WA 4QXKA 3QH7A 4I3PA 1R081 2Z5WA 2OQ7A 2ZGQA 1K5MC 1WA4A 3WINE 4CUCA 4TTGA 2KA3A 5A7SA 3SHRA 2D5FA 3IZOA 4CZSA 4N7UA 5C6CA 5JIUA 4LBKA 2DBIA 2ZGPA 1CN1A 2ORZA 2YFUA 5G04L 3AL6A 1QOTA 2RDQA 1PHMA 2YY1A 1N3QA 1CIWA 3BCWA 3TN92 2HLEA 5JDBA 1W9FA 2JJ6A 1SHWB 4X8PA 2UYAA 2OXBA 5A3OA 2OPWA 3I2DA 4YNIA 1ZA4A 2DYCA 4M0HA 3PURA 4QPGB 4RGAA 4XVHA 4YGEA 2D6OX 2DTYA 2X5IB 1ZM1A 1V0AA 3AL5A 3MDPA 2VW1A 2PTMA 2WLPA 3AYEA 1R1ZA 2OS2A 3OYWA 5F3IA 5FY8A 4A42A 1G7YA 3WQ7A 4NJ4A 5FO7B 1YC61 2B45X 1ULCA 2WR9A 2XB6C 1QY4A 1NY71 5K9YA 4HSJA 2FCVA 5BPXA 1X7NA 4JGZA 4XILA 5EJ1B 4AQSA 1TNRA 2GSYA 3WF2A 4XBLA 2NYYA 1H30A 4MX3A 1QJU3 2RS53 1W6PA 5IFPA 3M2MA 1SZBA 5C3RA 2GNDA 2JWPA 3W5MA 2D6NA 4JQTA 5FO9B 3D5OA 2UWAA 3WUDA 1FMD3 4CEYA 3RWKX 3CJXA 1QOSA 1R1A1 1US2A 2PELA 3U0ZA 2C24A 5FZ0A 1MACA 2R6QA 1HQNA 3VKLA 2DVDA 4XUOA 3KCCA 1S2KA 2EIDA 5DQ0A 1AYM1 2V5YA 3AFKA 3EBRA 4V2VA 1XJAA 4CCEA 1W9SA 4JX0A 2R1DA 4GZ9A 1VPHA 1WD4A 2HH9A 3M3QA 4R8HA 2GC3A 3PUAA 4XFIA 4LBLA 5FYYA 1OLQA 5EWSA 1STMA 4OI2A 3OUIA 3POBA 1AJOA 1AR92 1LHNA 1RHI2 2Q1FA 3OF1A 1GBGA 5AFBA 1KEXA 3S57A 2X8KA 1BCXA 1U5IA 1HRI2 1BLZA 1DGWA 4JGYB 2B39A 4OI4A 2I07B 3W58A 4CDUA 5I0TA 4QWNA 3N3HA 1UKGA 4NOTA 5FBZA 4PQQA 4NO4A 5J1XA 2O0OA 2RS31 3VUOA 4FPFA 4DS0A 1K5MA 3I54A 4NROA 3LOBA 1UZ0A 2J1UA 1WCDJ 3PUHA 3SKVA 2VNRA 1ONAA 1H2KA 3O1OA 3UESA 1JU3A 2RM22 4BQXA 2E26A 1W90A 2EAAA 3JD71 3UNPA 1H2MA 4NHMA 1WLCA 1VBD1 1QKQA 1UOJA 2EVXA 3LGRA 4WM8B 2EICA 5ANQA 4HG6B 5HV4A 4QKDA 1WCSA 5L7OB 4OFGA 3SCGA 1IHMA 1E5SA 3NJZA 3NQHA 4IEUA 2B42B 2XG3A 2IWGB 3SMHA 5AVPA 1N3PA 2JICA 1FX5A 4CSWA 1HB4A 2J1RA 3C7FA 2RS11 1JBCA 2GMEA 4W6WA 3GM8A 4JDOA 2WNOA 4TWTA 1RITA 1DLLA 1QEXA 3TYJA 5GM0A 3EYPA 1JYCA 1OOPB 4HPKB 2F4PA 5FK7A 1DGWX 2YHJA 2WNUB 3EQEA 3KF3A 3M70A 3O0VA 3POWA 1SDDB 3VBFB 2LTNA 2E31A 4Q4W3 1W6MA 4QT6A 4QB1A 1W6OB 3LA7A 2DU0A 3LSEA 1Y9GA 3FFQA 4AYUA 2HWF2 3N9PA 5DUXA 2WS91 3ZYBA 3SEEA 4XAEA 2ADDA 4QX5A 1PZ7A 1EAH3 2XH6A 3K2OA 2B5HA 1Z78A 1HXS2 3CNAA 1H8VA 2XJVA 2ZXQA 1CQ9A 3DCQA 3QBQA 4PBPA 4U2AA 4ASMB 3RMXA 1X36A 4A7ZA 1BMV1 2D5HA 1XSRA 2W1SA 3Q8BA 1AR63 4URTA 2A6YA 2Z4FA 1H9PA 4HFSA 4YW7A 4CPBA 3UGGA 1DCSA 2J1SA 2H6BA 3IMNA 5A3MA 3VBSA 4YW2A 2K9ZA 2HWC2 3M7AA 1QNYA 3MPBA 4LLOA 1DYOA 4Q1PA 4QQ2A 2BUKA 4FFFA 4AL9A 4EN8B 3BI3A 1LR5A 2BU9A 1O5UA 2WT1A 1NE6A 2YUEA 3AMMA 4QB6A 3ROUA 4WZCA 4ZU7A 2IVJA 4FP2A 5FMOL 4BU2A 2JEMA 2NLRA 1QQP2 2VE1A 4EN6B 2XVKA 2XHKA 4LJHA 1CAXB 2EALA 4QQOA 1GZCA 1H1MA 1DYPA 5IAXA 2ZMLA 4AGVA 2VW0A 2VO5A 3GZEA 4XJAA 5LEKA 3CDZB 5CEHA 5EJZB 2XJSA 3KCXA 4LULA 4XURA 1FNZA 2YROA 1DZQA 3VD3A 4L0PA 3NWKA 1MS5A 2QFEA 4H2AA 3POEA 5FR3A 1W0NA 5I91A 4ZY9A 4HSLA 4XYXA 3WDTA 2JB4A 3H3LA 2NZ9A 3CKHA 4RQPB 1YFXA 3PVBB 1QOOA 1I5ZA 3RWNA 2D6KA 2VUCA 2FQPA 2J1EA 4MXWB 2EIGA 3HBZA 4LBQB 1ZNPA 5JXHA 2ZZQA 1MQTB 4Y4RA 1H1AA 1PO12 1ENSA 1AYN1 2FDKA 3SITA 1REFA 3QD6A 3FJSA 5FREA 4LKEA 2OVUA 2VZOA 3HVDA 3MIFA 1VRH2 2BP6A 2HWD1 4HKLA 4DXZA 3IDEA 3VHNA 2VM9A 4CU7A 4WBBA 4MHRA 2A3YA 1IG3A 3FLPA 2VCAA 5IYYA 2IXIA 4GWNA 4ITCA 4EQVA 4QDSA 3AM2A 5FZMA 4E9KA 1RB8G 4KNCA 3O1TA 3UYJA 4NHXA 2XKPA 1BVP1 3BKZA 4QPGC 1SFPA 1YJKA 1C8NA 4ZS3A 2X5IC 3ZSKA 4UXAA 4AF9A 1LRHA 4BYYA 4CCLA 4EJRA 1QU0A 3V65A 1O3SA 1GU3A 2MEV3 1ULOA 2BWCA 3FHIB 4MGTA 2W95A 3H3ZA 4AAPA 5IVCA 2KR2A 3ZYJB 1PGL2 5A70A 1IKQA 3H7JA 5L9VA 3NV4A 5FCCA 4J25A 4EWAA 2XUEA 1GP4A 1EV13 1Y7BA 5DG2A 4YLZA 2VW2A 3GBWA 2RHPA 1QHDA 4JV4A 3SH3A 1LOBA 4YFWA 3U10A 4PF1A 1HRV1 1NCRB 3HQRA 3OBRA 2ZCWA 1HKDA 2SLIA 5DAQA 4MG2A 2ZX4A 3OB8A 3LEGA 2VMHA 2QDRA 1YQ8A 3DECA 2PHTA 3FLRA 4QX7A 1GYKA 1O91A 2WQ4A 4Y5TA 4E4HA 5A1FA 2WZR3 4KMQA 2D6LX 3O12A 3S0MA 2R042 3ZSJA 1GQGA 1W99A 3TNQA 3ZDVA 2UY8A 2B46X 4NIGA 1RUJ3 1W6QA 1YEWA 1YQCA 4H3WA 4Q0UA 4A3XA 2JXAA 5FZIA 2BNOA 1PMJX 1GNZA 4Q4X3 2QCSB 4M3CA 2PFWA 3ALQA 4MYEA 2VMIA 2F4LA 4B4RA 4I3GA 2W1QA 3KF5A 3J4UH 4JGYC 3M3CA 4A2UA 3LA2A 2A1XA 4RHV2 4CRQA 4E4ZA 1F4AA 1VB4A 4PLNA 5A33A 1QJZA 4UFLA 1POV3 5EIYB 2DUQA 5LW9A 1VBC2 1RUH3 3L2YA 4BE3A 1COV3 3JB8A 5HCFA 3UV9A 3ZXKA 1IS6A 2YC4A 5LB6A 2QQNA 1LU2A 3EXUA 3ORJA 2WSVA 3ZFFB 3ZXGA 4ASKA 1BEV1 4YM3A 2GNMA 1R091 1VE0A 2GAUA 5FXZA 1WCKA 4CU8A 4NRQA 2I45A 1F4HA 1UD1A 4B3NA 1G9AA 4IXLA 2D97A 2QUOA 4WM8C 5FZGA 2RS32 4Q2FA 2BYVE 1WMDA 1ASJ1 5DPNA 3HBKA 5L7OC 5F6KA 4FAGA 1AHSA 1QWRA 1LENA 2ZTNA 2WL1A 4QPGA 5FZ8A 2X5IA 4GIQA 3T30A 2ZS6B 5IVYA 2VOKA 4I0WB 1QH7A 1WKYA 3I4IA 1V9U1 1R083 2ZHMA 3JD72 4OUSA 4PLOA 5BXXA 2FD8A 1A78A 1SACA 4NUBA 1RUE1 1YYNA 1OOPC 5DAXA 1AR71 3IDAA 1CJDA 1SPPB 2QQWA 2WNUC 1JYIA 2CTVA 3N9QA 4ZHNA 3LEKA 3VBFC 2AREA 4Y24A 3AMQA 3MV11 2YG0A 2VJXA 4AEKA 3WG4A 4LO6B 1Q8QA 5FZ9A 3O1RA 2ZGKA 2ZHKA 2CY6A 2OIIA 2W52A 1AXZA 2W5FA 3KD4A 4ZS2A 5F5AA 2CSGA 1W3VA 2VUAA 2YBKA 4COUA 4AVCA 1EY2A 3AP7A 3NJVA 4RSUA 5A6YA 3FBYA 4YW5A 3O1PA 3NO8A 4PIZA 3V0BB 1UYPA 3J7NA 1T6BX 4YG3A 3F2ZA 4K21A 4A3ZA 3KZ4C 3H1YA 3THPA 5FZLA 4BH9A 2D3RA 3TWIA 3ZXJA 5G05L 1N3OA 3ZSLA 4Y20B 3TB0A 4Q4V2 2DURA 2KD7A 1MVQA 1IG0A 2CGNA 2XR4A 4BIOA 5F2SA 3GBFA 1EYBA 5CBLA 1RUC1 3THDA 3S7EA 4N9IA 3FZ3A 1ZRIA 2A6VA 4UT5A 5D1IA 4JRAA 2QNKA 4Q8LA 1UZYA 3HN1A 1HB3A 2W1WA 2JE8A 1AR81 3LEIA 4KG0A 3ZKUA 5KWRA 2QQMA 3IIIA 3AX4A 4PQ9A 1HJFA 4Y1YA 4JGYA 4CTEA 4QHBA 5CA6A 5IK8A 1OA2A 4LHNA 3AK0A 1CPMA 3I2KA 4YGDA 3WNOA 4C91A 5JR2A 5JXIA 1A34A 4KWKA 1AYM3 3ZYRA 2CYFA 5FZOB 5IATA 2WO7A 3I97A 1YFWA 4XTPA 3B5LB 4XFFA 1XQNA 2BV4A 2XWJB 2VAUA 2ZAHA 4YM0A 5K4LA 4IGQA 3AKTA 4RQPC 1NLRA 2J7MA 1HB1A 5FLJA 2PHUA 4LLFA 4D0QA 3E6CC 1ZZ7A 4DXRA 3QOPA 1OLRA 4P9IA 3C2UA 3CMGA 3VD7A 3TEWA 1BXHA 2P3YA 1MQTC 4WM8A 1OF4A 3C7EA 1NUKA 2NMNA 3VZMA 4DOUA 5A6QA 3IAQA 1ZZ9A 3ES1A 2O8OA 5L7OA 5GLUA 3SISA 1O8SA 1OF3A 4OZXA 1Q56A 4LE4A 4AQ2A 5AC91 5FO8B 3NNJA 1CGPA 4JAAA 2VZRA 4D94A 5J37A 5JOZA 3FBMA 4LOSA 5FLIA 4GQ7A 4AHZA 3K77A 4ATFA 2CU5A 1VLNA 4XJ8A 3N35A 3ZO0B 4HKOA 2VBBA 3K3NA 3WQ1A 1YWKA 1CWPA 1DLCA 1OOPA 2QBXA 3OCPA 4HPKA 4YW1A 1QJEA 1YXWA 1VBD3 2WNUA 3QLQA 2HWD2 4CCNA 3VBFA 1MS4A 2PYTA 2YPDA 3O5SA 4E8DA 3WF0A 1XOYA 2LM3A 1W6OA 4YFZA 3TN91 2ZABA 3ZN6A 3R0RA 4CP2A 1W28A 4Z82A 1GZWB 1PZ8A 3AMNA 4CYDA 5J09A 3KT4A 1PNGA 3WQBA 1FYUA 3KV9A 4B4QA 4UBGA 1O3RA 5GLWA 2RS13 2JDUA 2LS6A 3HEIA 3LD8A 2FDFA 3NJYA 3HOBA 2ZZJA 4CUBA 2DFCA 1S0GA 1CX4A 2B8MA 1QDCA 2MNGA 2FDIA 3ACIA 4H55A 2TBVA 4TLFA 3OY8B 1HB2A 5FY1A 5K0UB 1QJX2 2Y8KA 3WW4A 5FJHA 4AI1A 3MV01 1NCRC 4OHZA 4PF5A 3VBUB 2VBDA 1SBFA 4X6RB 3WNXA 1G9DA 1IPKA 4IL7A 4AQTA 1MZ6A 2WS93 3N9MA 1JW6A 2BPA2 5F5IA 2WFF2 4R9AA 1RUD3 2W94A 2BBVA 1CPNA 5KHKA 4KH9A 5HBAA 1E5IA 1XNKA 5IVJA 1ZBA1 1CAXA 3ZYHA 1W03A 1JZ5A 2ARAA 3ZLIA 1IGOA 1GLHA 3AP6A 1GWKA 1HN0A 3WT3A 5JOWA 4QPWA 5FUPA 3D0SA 4O7XA 2EF6A 3I2JA 3NJXA 3V64A 3EO6A 1JMUB 3ACFA 5D2AA 3RDIA 4RQPA 3BPZA 5A3PA 1POQA 4XF3A 3R4SA 3SC7X 1G6NA 1G9FA 2DCTA 4MXWA 4EE2A 1LJ7A 4LBQA 1MQTA 2MPFA 1VJ2A 3VHPA 1QJFA 1C8M2 4RGKA 3RYRA 3VD5A 1AR91 1PIV2 5FKBA 1LEDA 1RHI1 3MO4A 4ORFA 2NP0A 3ACHA 1JS9A 3GCXA 3ZFFC 4COVA 3DPRA 1HRI1 1UAIA 3LA3A 4O9GA 1O6UA 1D0GA 3L2HA 3LE0A 2WZPP 5F39A 5GZDA 1RMU2 2K0GA 3OD4A 3UETA 1JZ4A 2WO2A 2A75A 1GKBA 1D7PM 3M8LA 4NRPA 3HAGA 4YM2A 3N7KA 1LGNA 2B4KA 4LKFA 5JPNB 3CQOA 2XDVA 1A6CA 1D2SA 1AYN3 3BUCA 3ZR5A 1ZRDA 2RM21 3I49A 3WG3A 4EYUA 2A6XA 2GH2A 5C33A 2W08A 4IEOA 5JCTA 1RUOA 5FP8A 4EN7B 5FZFA 2V4VA 5KR7A 1JZ7A 2ZGOA 2EIEA 4HK8A 4S2HA 4YG6A 4FXKB 1TME1 4BA6A 1W2OA 4LIUA 4J1XA 5CKQA 5A7OA 3AXDA 3B93A 3FUOA 4XCAA 2QZ2A 4GULA 3ZIXA 2RMU2 3RZHA 4QHZA 2Y33A 3JBG2 4P14A 1WLWA 3T4HB 5A1LA 3NNFA 5JVVA 1I1EA 1NCRA 4G9SB 1AX1A 4LBQD 5FQ0B 4AHYA 1EPZA 2D7FA 2WJSA 4MGQA 1MZ5A 4GJZA 4IESA 5FYHA 1UIKA 3ZR6A 3AKRA 5CADA 2XWBB 4HOOA 5DG1A 3K4DA 1UY4A 2FCUA 2BFUL 1HW5A 1ACCA 3H42B 2HWF1 1LOEA 4ONUA 1B35B 5T52A 3GJBA 5CFDB 1W8NA 2ZX2A 5DZEA 4Z1VA 4LK7A 4DEQA 5LA1A 1SLLA 3IAPA 2H6CA 1HXS1 3D82A 4KL1A 5F6LB 1CR7A 5C8CA 3BTAA 1GUIA 1WMFA 1W0PA 2B9UA 4N43B 4W6YA 4I09A 1LGCA 1W8HA 1YI9A 2HJIA 2H0VA 3ZOIA 1RXGA 2FZ2A 2VVDA 3AJYA 4HL0A 1GZ9A 5BNPB 3HQUA 5M0TA 1CONA 2I74A 1X82A 3FLTA 2HWC1 1RUC2 3BOWA 3VB9A 1OQDA 5F5QA 4TN7A 3EB7A 2QQKA 3WP4A 1S0DA 2VQAA 4LO8A 4GXLA 1LEMA 4ZXEA 3QCWA 5DAVA 2W68A 3MF9A 1XNDA 1JYWA 3O7OA 1QQP1 3ZFFA 1LOFC 1QNWA 1XE7A 3H50A 2GP3A 2R1BA 2VNGA 3VZKA 1IOAA 4AEJA 1V6IA 2YFZA 2QQVA 2NM1A 2RS52 3KT1A 2OUHA 3B7MA 4C1WA 2Z69A 3PIJA 2ZKNA 3D6EA 1W2TA 2P5BA 4NR1A 4AGGA 3ZM8A 1UXXX 1YNAA 3GXUA 5LY1A 3T09A 3AZYA 1MEC2 3W5NA 1ENQA 1PO22 4M01A 4YSFA 3RPQA 1G9BA 2PHLA 2QVSB 4RN5A 1BK0A 3LQCA 3T2TA 3H8OA 3B9CA 5K8SA 5IWFA 3IBMA 1BEV3 4AI8A 1PO11 1UYYA 4IV3A 2Q1MA 3ME2A 2PAKA 4COZA 5BNNB 1SPPA 5EJ3A 3JCIA 4BB3A 1OKQA 4S2GA 4TLGA 2F17A 1VRH1 3MFAA 4B7EA 2GN7A 3I2FA 2W1UA 1Q8VA 2VVEA 2BFUS 4AFAA 1Y43B 4Y33A 1U5XA 1XNCA 1BBT2 2Q8CA 2ZA9A 3OTFA 4MVTA 5APAA 3WOGA 4BMEA 2WT2A 5LK7B 2ZGSA 1V9U3 5FXVA 4RS5B 1V6NA 1PVC2 1OA4A 4AOCA 2Y64A 4LXLA 3V0BA 1ODNA 3HD8B 4AR2A 1RUE3 1MS8A 2GNTA 5FWEA 3EMRA 4ISRA 4TSVA 1XU1A 4QKBA 5B4XA 2D3PA 1XYNA 2HWE2 3NV3A 3AMHA 4XF1A 1AR73 4AFDA 4OHYA 1LULA 4UW5A 1HX6A 1WLDA 4Y20A 1N1VA 4JKMA 4DXSA 5K0UC 1PGL1 1SQ4A 3RI9A 3VBUC 5HI0A 3NKTA 1LCLA 3MW3A 5DUVA 2RJKA 1W8OA 5C5TA 2WAOA 1F31A 4HLTA 1YHFA 3B00A 3DKWA 3KV4A 5FJKA 3BYWA 3O0WA 3T08A 3GGLA 4MH0E 4LO7A 1BK1A 4XMIA 4OI0A 2ZX1A 5FZAA 4XFBA 5L19A 2YV8A 2A6ZA 3FUQA 3O14A 2R0HA 2WABA 3UKTA 4UW6A 3H7YA 2ZHLA 1H8TB 1NA1B 3OUHA 5FZOA 2I2SA 2VTXJ 3VBRB 4MZUA 3H8XA 1ZRFA 4FPJA 2ORXA 2XONA 3KVBA 4J1WA 3O0XA 4LKSA 1ULDA 1ZBA2 3AVSA 5FPBA 2R041 3RI8A 1LOFA 4WVZA 1GWLA 3AYDA 3ECQA 4IE7A 1RUF2 4FQ4A 1CZTA 4INDA 3WHTA 2VUJA 1AR83 3LOIA 1C1FA 2KXLA 4K3UA 3FE5A 2R073 2VQTA 2W46A 1QXJA 1U12A 2OPKA 3CJIB 3MUZ1 3IDBB 1HIXA 3WP6A 1XE8A 1TMF2 2XJUA 3PMSA 5F3EA 1J59A 2AACA 2ENRA 2SBAA 3LWCA 3NRUA 4RHV1 3LF7A 1M06G 1Y3TA 2BEOA 3E97A 2A7AA 3ZXEA 4N9HA 4EWDA 1AF9A 2OT7A 1HLCA 4Y4YA 3SCFA 2OA2A 3VD9A 1YRZA 1VBC1 4RA0A 4OHXA 3KV6A 3LDBA 2GU9A 1ZREA 5FYBA 1IS5A 1FOD2 3T2QA 1RUNA 3ILRA 4AI9A 2C9AA 3DUIA 1VBA2 3VBHB 4H7MA 1CESA 5IW0A 2XPJA 5JIAA 4GAZA 3Q8EA 4IQPA 1FPN3 1F35A 1GZWA 2VZPA 4ZU4A 1FNYA 2YXSA 5EPAA 1N47A 1GSLA 4YYOA 2JDMA 4G3YC 4I02A 4E4SA 3H1MA 5A3WA 4K20A 4XACA 3VKNA 1GANA 3BIEA 2AZ5A 1A8MA 5J36A 2CWSA 3WUCA 4CXXA 1DF0A 4ZONA 3OY8A 3ZXDA 2D3SA 5K0UA 3D4KA 5A80A 3ZN4A 4LOTA 4MOAA 3VBUA 4UBHA 2W0XA 4IGPA 3CBNA 3ST7A 3WEZA 4OQ8A 1I3HA 1TME2 1V6KA 3TN93 2W91A 3T0DA 5FP7A 1OFNA 5I0RA 2IXJA 2JIJA 3MPPG 4X8NA 4CUGA 1TVGA 4FO9A 4FI9A 2BZDA 3EHKA 4DNYA 1YIPA 1B35C 1VBE2 1PM7A 5CFDC 1K3IA 5J7MA 3P6BA 4Z2AA 1UPSA 1SLIA 4FPOB 2E33A 1CIYA 3LPGA 1G86A 1X50A 1UY0A 2YMZA 4IW3A 5E8AA 2OYZA 2W87A 2FDGA 2J1AA 5ABJB 5FYTA 4N43C 4AVAA 3RZGA 1LAJA 1PVXA 3HQXA 4Q4V1 4BQ4A 3AKSA 3OGJA 5FMCA 5TSWA 5BNPC 5H9SA 3NNGA 3BB6A 2CAVA 3VKOA 2FHRA 4CCKA 4YZ4A 2HWB2 1RYYA 3WV6A 3UGHA 4XDPA 5LBFA 1LODA 4Z92B 2ZACA 4Q4Y2 3ZMOA 4S2DA 4RD7A 5F8PA 3A22A 4KGQA 2Q5TA 3VDCA 2EAKA 1J3RA 2QQUA 4SLIA 4UFMA 4AGRA 3I2OA 1EV12 5KBFA 2OQ6A 4IE5A 1AX2A 3A0NA 5EXOA 3L9JT 5B4NA 5C3QA 1JYNA 2OUJA 2VULA 3POYA 1O3QA 4GB32 4K9SA 4V2WA 3DEMA 2IXHA 3S30A 3T1MA 1UU4A 4MGZE 4WZFA 1Y4WA 2DBNA 1D4VB 1AL23 3RSJA 5JAXA 1WW7A 1RHI3 3POJA 4XMAA 5DAPA 1JHNA 1WW5A 3P3NA 4XCBA 3VBSC 1M4WA 4HETA 1HRI3 2WT0A 1K45A 4OHVA 4XPVA 1UOBA 5BNNC 4UYBA 2V5DA 4JQRA 1HN1A 1Q5OA 2DWRA 1WLTA 1WCQA 3ON7A 4FPKA 4E4DX 1ND2B 4NPRA 3OBAA 1DG6A 2WAAA 4FP3A 4QXBA 3TEZA 1RGSA 4RS5C 4HKWA 3IMMA 2RM23 4XOGA 2DVGA 3NW4A 5FQ0A 4HK9A 4NHYA 4NVPA 1UY3A 3KGLA 5GKAC 1EUUA 2XQXA 3AYCA 4META 1PGW2 1OUXA 2NPIA 3ZYGA 2E53A 2LW8A 4P02B 2JDKA 4IDZA 1DU3D 3FHAA 4QX1A 1B35A 1QGLA 5J3UA 3O1UA 5CFDA 3J8F3 1PZ9A 2W2IA 2ZX0A 2ZEXA 1ZZBA 2XL9A 4B4PA 5HXMA 5JMCA 1KS4A 3ZXAC 4Q27A 3KS7A 3JU9A 2JDYA 4UF0B 1JZ3A 2P2KA 2ZMNA 4P9XA 3KWVA 3KLSA 1NOVA 4HBNA 3I3QA 3W21A 4N43A 1QJX1 4ES8A 5BNPA 4K1ZA 1XYOA 3IPVB 4JVAA 1XYPA 3MICA 4OMDA 5SV8A 3T0AA 4DUVA 4RL7A 1H8TC 1NA1C 1REEA 1OPMA 1WWYA 2AEYA 2HWF3 2VPVA 2XLFA 4M3CE 3VBRC 2DUOA 1JXNA 4Y1ZA 1DZTA 5FMOS 4KGGA 3BVCA 4FOWA 4IERA 3ACLA 3B3QE 5DDJ1 4AE2A 2WFF1 4AVTA 3NNMA 3R4DB 3A0KA 2BJSA 4AI3A 1HXS3 1UF2C 4CP1A 1UNBA 2A6WA 4FPEA 1R64A 4RFRB 1BVVA 4GA9A 2WC2A 3S5QA 1V6LA 1RJ7A 3HT1A 1J83A 1SCRA 1X8EA 3GZAA 3JQWA 4QM8A 1C4RA 1LOAA 2FBEA 5FZ7A 1UMIA 2ZOEB 1HJGA 3MLKA 3CJIC 1NZCA 2HWC3 4Q26A 5AVAA 4EZHA 4FTSA 4ET7A 3U75A 3MW2A 2JG8B 2WN2A 3I3BA 2BRTA 4R4ZA 1XXNA 2LRPA 4D7YA 3PUQA 1YLLA 5H9RA 2V09A 4P00B 2WBKA 1QQP3 1X9TA 2XJPA 3WHUA 4ZPIA 5CU1A 4I0BA 1KS5A 4AG4A 1C8M1 2OZ6A 4CE8A 4LT5A 4XF9A 5BNNA 1PIV1 1C5IA 3RGBA 2WLQA 1YFUA 3P5BA 4LK6A 4RFT0 5FTTC 5IUQA 3VBHC 1S0CA 1LOGA 3ELNA 4B29A 3ZXFA 1CAWB 2VQUA 5T5JA 3WNKA 4ARXA 4Q0QA 4B1MA 2FMDA 5FYUA 1RMU1 2RJLA 3CIHA 3JQXA 5FZBA 5LY2A 5F3CA 3I2IA 5KXEA 4RS5A 4FFHA 2NQYA 4R4XA 5C3SA 2WYSA 4FTEA 1LKNA 4BZ4A 2JDAA 4IETA 5C70A 1VAVA 1OSGA 5C71A 3KV5A 1AZDA 3RZLA 2PLV1 2YC2A 3AZWA 1GICA 2BNMA 4AEMA 2VBPA 1PO13 1WZXA 3AMPA 2AR6A 5K7PA 2C4XA 1S4CA 2WKKA 1VRH3 1Z7S2 4YG0A 3RFRA 5A3NA 2R0FA 3TOJA 2GALA 2VL4A 1O7FA 4QHOA 3LCPA 1C1LA 5C3PA 4OLLA 2X53S 1JOJA 1LHWA 1W39A 2ZGTA 3VHRA 4C90A 5BNOB 4KU8A 1VALA 2RMU1 3I7DA 3JBG1 1OLMA 4FPHA 2PQSA 5FXXA 5FYIA 5BUVA 4WM7B 3USUB 3KM5A 4KWUA 1B09A 3ZVXA 5I0SA 1VB2A 1H8TA 1NA1A 1VAMA 2VMCA 3VBRA 1N1YA 1TE1B 3FWEA 1NE4A 3OBTA 4PDWB 1DGRA 4COYA 3T0BA 5ABJC 4IEZA 2HKXA 3KMHA 1VIWB 2XBO2 3WQ0A 4IUGA 2H0BA 1EPWA 2XGXA 1CX1A 1LB2A 1JOBA 2WSUA 4XUPA 5IVEA 4PLMA 3RYPA 1CVNA 1GWMA 5JSPA 3AC0A 1RUI2 4JDNA 1ZX5A 5ACA2 3UGFA 1W9WA 3UT0A 2CAUA 4FXGB 2IXCA 4OULA 3CJIA 5IK5A 2HYXA 2N7GA 5FPXA 4Y3OA 2X29A 5E89A 2WINB 5A3TA 5JXJA 3H3UA 2C6SA 3VV1A 5FY0A 3AVRA 5IHRA 1DQ1A 4D69A 4LE3A 1UU5A 1W9YA 2Y6JA 4WVWA 2R043 1XRUA 5FZ1A 2CGOA 4B7KA 2DTWA 1YI7A 3CO2A 1Q3EA 2BERA 1R1A3 4DPNA 5EZWA 4A44A 3NVCA 4DRRA 4P9YA 3MHZA 4JC1A 1GOFA 1WW4A 5CG9A 3PTYA 1UPIA 5DUWA 2YYOA 5FOJB 4PIYA 1MS0A 5E6HA 4FBFA 3I3MA 4YZ5A 5KXCA 4MSVA 4HONA 1PM4A 1MR5A 2RS51 2Y60A 1VBB2 3MI8A 2NN8A 5E88A 1L7LA 1OQEA 1RUD2 4M3CF 4EN9B 5LRRA 1WW6A 1Y9QA 4NAOA 1GMMA 3KSCA 3H8RA 4QXCA 5FZDA 1VBC3 4GMP1 1V6JA 1IPJA 4CDQB 1W8WA 1ND2C 1MEC1 2VMDA 1PO21 1S2BA 3MEPA 4QXHA 3RYKA 5D8AB 2ID4A 1NLSA 3U07A 4BXFA 1GP6A 1VMJA 3CL1A 1WA6X 2R32A 4XUQA 3BTXA 4I2OA 1U5YA 4WVVA 4Y22B 5KHGA 1BHGA 2QZ3A 5F37A 2RS33 3WF1A 3AB0A 2VOXA 1D4M2 4KI5M 3E6DA 4Y5Z0 1KDKA 1BBT1 2WO3A 5FY7A 3M3EA 2C5DA 2AYHA 2QDNA 3OGGA 2WIIB 5LEJA 2DDUA 3JD73 3O1VA 4BDVB 2WA3A 1PVC1 4OMCA 5DZGA 4Q0VA 3WX5A 2FMYA 1MVEA 2DCZA 2VMEA 1EUTA 4F83A 2HWE1 3N4MA 1ZZ6A 3FFZA 2RR12 4URAA 3F95A 3V0AB 2GC2A 3A21A 1DDLA 3WG2A 1GNYA 2E7QA 1OVPA 4QKNA 1OFSA 2D98A 4CUAA 2EXHA 1MPXA 1AX0A 2P34A 4XHBA 5EQUA 3S7IA 3B01A 5F2WA 5FDBA 3LIHA 1LHOA 2XOMA 2VTFA 2GC1A 3T1LA 4LUKA 3VZJA 3R4UA 5FZEA 2JD9A 3IM0A 4LBJA 2W92A 3N7MA 2YBSA 3MIEA 4XF4A 2DCJA 1PX4A 4Q4V3 5DDJ2 3VZOA 4UOJA 4KG8A 3ZX7A 1QMJA 3NNLA 2JG8C 1NXD1 4PJYA 3THTA 3M1HA 2WO1A 1RUF1 3E5XA 4GKXA 3G7DA 4R9CA 4IEQA 1GOHA 2ZGNA 4BM8A 1UZZA 1KDMA 4A45A 3P1IA 2GZWA 2O8QA 4QGLA 1RJ8A 2FDJA 3OOXA 5CISA 1Y9MA 5FY9A 4DY5A 5GZCA 3J26N 1TMF1 3WNLA 3VHOA 2W47A 3R6SA 2R062 2ZKLA 3K3OA 2E51A 1ND2A 4L92A 1EP0A 4RR3B 2A3XA 2ZGLA 3MW4A 4BK4A 3BTYA 4AHWA 2P3JA 1ULEA 3T2PA 1UZVA 1W05A 4XTMA 3APBA 4P5HA 3UKNA 3FL7A 4A6OA 1JN2P 2A5ZA 1REDA 3KQRA 1RVF2 2ATFA 1FOD1 5FPLA 4JRLA 5JOXA 4NWVA 1Z0HA 3NAPB 3ZYIB 5DAWA 1ZBE2 3CZUA 1VBA1 2IVIB 3KHCA 5JWPA 2C1FA 3T3YA 1G8WA 1UZWA 2VNVA 4XFHA 2JX9A 2CV6A 4CCDA 4W65A 4CU9A 1ENRA 1NQDA 3JXSA 2E7AA 2QKDA 4LR4A 5A32B 3SXWA 4MO3M 4IEVA 1RIRA 4FPYA 1UU6A 2PLV2 5C4WB 4L2NA 4UF0A 3GF6A 1RUG2 1X9PA 4P9WA 4X6QB 4XBNA 5BNOC 5IT6A 3O1MA 1JU4A 2IUWA 3KT7A 4L11A 3WY6A 3ASIA 2AEZA 2AC1A 3RJ2X 4CDXB 2HWD3 3SH4A 5T5LA 4O9EA 2RDRA 3J7LA 5FWJA 1QJY2 4WM7C 5JSOA 1ZZ8A 2C9KA 3IPVA 5GALA 3T2OA 4OCTA 2BVBA 5JZGB 2X05A 3GNEA 4PDWC 3IIAA 1XBFA 1NX9A 2FZ1A 1YIFA 4YGBA 5LBCA 2VNOA 2EXIA 2TUNA 3LPFA 5HCHA 4UW3A 4BISA 1W3XA 2ARBA 5JOYA 5GZGA 3M3OA 3UKVA 1VBE1 3I2GA 3B02A 3K4AA 1C3HA 2XQRA 4AVSA 1UYXA 3IKWA 2IXLA 4YVWB 1QJX3 4WVMB 1J1LA 1E5HA 4QU2A 5FXWA 4Q29A 2AH2A 4Y26A 3I3DA 5T55A 5GLZA 3PHMA 3MIGA 4M00A 1Q8PA 2DU1A 3N9OA 3WDVA 2JG8A 3E5QA 1RINA 2GC0A 2ET7A 3AYAA 3JZVA 4GH4B 1ALYA 2PQQA 1UX6A 2WFF3 4PHZA 4BXSV 2YB7A 1OI6A 5KHJA 2HWB1 2GMMA 2WUHA 3PTRB 1JUHA 4XUTA 1S0FA 1HRV3 1GFF2 4IEXA 4NPLA 3ZFEB 2E6VA 1F5FA 4YPJA 4CP9B 4DMIA 4EN0A 4A7YA 5JLVA 3ACGA 2P17A 4JHTA 1JZ8A 1H4HA 1L7RA 3N9LA 4Q4Y1 1IZ3A 3DGTA 2PHDA 4A7KA 3S6PA 4HVQA 4LBNA 2EA7A 1CAWA 1FATA 3M4FA 3ZSMA 4A6SA 1KGYA 4IV1B 1EV11 5T5PA 4BIFA 4CCCA 1NZIA 2WWJA 4FT8A 2BNNA 4GB31 5F1RA 5E1RA 3DXUA 4QU1A 4XIOA 1SBEA 2ZEZA 2RV9A 3BIWE 3PVOA 4CDQC 5J48A 1V6OA 2VU9A 1V70A 2BWAA 5CZKA 3H0OA 3JUUA 1PIV3 5D8AC 2QE3A 3VKFC 2JE7A 4XEZA 2ZPXA 4HVOA 2WN3A 4W8JA 5JR7B 1A3KA 3WLUA 1QJU2 4LEJA 4E2SA 3C8XA 5FPVA 5JPMB 3WVJA 1W2UA 1C57A 3DL3A 2DF7A 4XFGA 1UOFA 5FYZA 2BGPA 1DP0A 5FV3A 1FMD2 5FYCA 4MXVA 5BNOA 4OUEA 5FFOC 2EIBA 1NCQB 1W8UA 2Y6LA 4UAPA 1YJLA 1BQPA 1PK6B 3DKQA 4JTOA 1K5JA 1R093 3A7QA 3NSTA 5L9RA 3USUA 4R52A 3OBZA 3WNMA 1DHKB 4F3JA 1XC6A 3B9IA 3HN3A 2JKBA 1BZWA 4PDWA 4MGIE 1ASJ3 4YW6A 1PGW1 1I9RA 4DQAA 2JDHA 3BODA 2P1BA 3LDRA 5C5UA 2FCTA 4JKKA 1RUH1 5A7PA 3VL9A 2VMFA 2G9FA 1LHVA 1W6QB 2RMU3 4EROA 2P4EA 2VCCA 1H4GA 1YQ5A 4KWLA 2A70A 1F9KA 1UN1A 2K2SA 4FPLA 4OQ9A 4YARA 4PBOA 2HBUA 2CNAA 1OD3A 3MLLA 1HQWA 2BOJA 4GKYA 5LBEA 1C5HA 1FPN2 4UFKA 4F8AA 5HXVA 3NKGA 2ZX3A 4YZ2A 1AVBA 3PDQA 2R16A 1MS3A 2Q30A 1CZSA 2VZTA 1W2AX 4KBZA 4QX0A 1IKPA 2PHXA 4R9BA 5FY4A 1LECA 5F5CA 5LK5A 3RG0A 3AFGA 4XETA 5FZHA 2A3WA 5FOBB 1F5JA 1D2QA 3NV2A 4MV2A 5IK4A 2GP5A 3O1SA 2QQPA 5CFCB 3WP5A 4DZGA 1YFYA 3IB3A 1GQPA 3ILFA 1OKOA 2JG9B 2ZHNA 5BNQA 2VQ0A 1C28A 2IFRA 2WFPA 3C7GA 1RXFA 4BLJA 1Q43A 3HWJA 2R7EB 2PHRA 3LB9A 1RUC3 3WCSA 3ZPYA 1PMHX 2HYKA 1K12A 2Y0OA 1ZZCA 4CDQA 4RR3C 1DGLA 5HPOA 5D8AA 3NL1A 1IS3A 5FP3A 1VR3A 5HCBA 2ETEA 5A7NA 1QH6A 1OD5A 1W9TA 2LUWA 2YU1A 3OD0A 4Q4W2 1ULGA 4QQLA 4Y5SA 3TEXA 3X29B 2BDRA 2VCBA 4BMBA 4Y22A 3W59A 4RYDA 3NAPC 3POGA 2GH8A 2IFWA 4FOYA 4B8EA 1NKGA 5LWBA 1Q8SA 3VLBB 4HMZA 4XABA 3ZKYA 1EAH2 5GZFA 1ENXA 4R9DA 2Q8DA 4C0BA 1TG7A 1WBFA 3U4SA 3DYOA 2UY9A 4GMP3 1KFUL 1UY1A 1MEC3 2UWBA 1PO23 2VMGA 3MUY1 4XJUA 5EFUA 3WDYA 1AR62 5A3UA 5C4WC 1OURA 3E6BA 5JI7A 1XNAA 4ASLA 4IE6A 2VECA 4CDXC 1CAVB 2LALA 2IZWA 2Y6KA 5HCAA 3V0AA 5AC93 5ISLA 4AAXA 2JENA 1Z7S1 3WP3A 5FLHA 1JZ6A 2B7YA 5H9QA 2JB8A 4DFSA 4XUNA 3BTZA 3PUIA 3K46A 1GR3A 2JKXA 4FPCA 5JZGC 1BBT3 4GALA 2PHFA 2UURA 2VOVA 2ZGUA 2GMPA 1O3TA 3DV8A 3ZMNA 1UKRA 4BQYA 5KXDA 1NG0A 1AL22 1FI2A 1T6GC 4XJZA 3ZIWA 4OUMA 1PVC3 4LHKA 3K75B 4Y1UA 1IQDC 3DF0A 1MS9A 1AJKA 4CDWB 5ACA1 2DCKA 4ZKTB 3POSA 2ZJCA 1H2NA 1W6NB 4I01A 3SCHA 2HWE3 3I2HA 2DVBA 2ERFA 1AL0G 5CKMA 3VZNA 4YVWC 4UW4A 3RNSA 5KHHA 2CL2A 1NT0A 3OG2A 1TQ5A 4W4ZA 4IE0A 5GZEA 1W8ZA 5EP9A 4MLOA 4UFHA 2AUYA 5AFEA 2J1VA 1P8JA 2VY0A 3OSDA 4CCMA 4LORA 2ZGRA 3GHNA 2YGMA 4LMFA 5LRSA 3ETQA 2XBO1 4IGOA 2LROA 4GH4C 1T2XA 5LBBA 3V56A 2WWSA 3Q8AA 5DUUA 2IXKA 4XFCA 4ZXKA 4GWMA 4OVEA 3U11A 3SNMA 4MGYE 3P3PA 1RUI1 1N1SA 5BV6A 1SCSA 5I0DA 2XLGA 4MGKE 2Q8EA 3VL8A 3ZFEC 4HXCA 4FFIA 4LIVA 4RGGA 1W0OA 2WNVB 4TZDA 1UWWA 4LO5B 3GCWA 2PAMA 1ULPA 4SBVA 4EZ4A 1BYHA 3J8F2 1OVSA 4RR3A 4NAMA 1FAYA 4AK3A 1LU1A 1JUIA 2DVAA 2JDNA 3MIDA 3LDKA 4IV1C 4HZFA 1ZBA3 1J58A 1ZYBA 3J7HA 1F2NA 2MEV2 2J22A 2QQIA 1RUF3 3KCYA 2A73B 4GWJA 1SLBA 3PJQA 4N53B 2QQLA 2VZ1A 4AWDA 3RZKA 3NAPA 4LHLA 4CXWA 2XVGA 3AZXA 1NLQA 5CIRA 2F6BA 3R05A 4Q1RA 3ZN6B 1TMF3 5HV0A 3D0JA 2WZ8A 4D3WA 1TZOA 1VBB1 5A32A 4NIDA 3B69A 2ZEYA 1RUD1 3D3AA 3QH6A 4BQ3A 5CYYA 2G4IA 2XUMA 5C4WA 3HPNA 1I6XA 4DIQA 5A6XA 1S0JA 5T54A 2TNFA 1DBNA 3PJYA 1CD3G 3C3VA 3E1F1 1AR93 1NCQC 5FK8A 1WBLA 4CDXA 4FQZA 1FOD3 1PK6C 4L97A 4XBQA 5IVVA 4JZRA 4YZ1A 1SMVA 1VBA3 5JZGA 1ULFA 4DUXA 2WZR2 1GNHA 2Z79A 1O4YA 4L99A 4M4RA 2VG9A 2XL7A 3HMYA 1RUJ2 1D4M1 2Y0IA 1HDKA 2E63A 3Q9OA 2VOTA 1BJQA 1VMHA 4Q4X2 3KB5A 4N90A 2JD4A 5FYVA 5GLVA 4C8DA 4DXTA 1KRIA 3W20A 4YVWA 1WD3A 5T3NA 4XAAA 1FV2A 2O1QA 3CEWA 2WNEA 4KBBA 4WVMA 4P08A 5FP4A 2VUDA 1RC6A 3VKMA 3EJKA 5A1AA 5DMYA 1ZVFA 1TME3 2RR11 2Q1ZB 1VAKA 2G1MA 4Q0PA 4XXPA 3RZMA 1RUH2 4BQ1A 1COV2 4GH4A 4JKLA 4V1PA 2R30A 1J1TA 1JHJA 1FV3A 2G9GA 5A7WB 5A6ZA 4AZZA 2CDOA 2JDPA 4CXYA 3ZSEA 1VBE3 4AXOA 1LOCA 1XE0A 3ZFEA 4CP9A 1SFYA 1YUDA 1W8TA
chains in the Genus database with same CATH topology
3KGZA 3MFCA 3VBOB 5T50A 1UIJA 2RE9A 1ND3B 2AENA 3DPRB 3MGUA 3IT8A 4OHWA 3WQ0A 5JI9A 5CFCC 4JDMA 5E16A 3AP4A 1YO8A 2JG9C 3PLQA 4Y1XA 1URXA 4IV1A 3TNPB 2YC0A 1R082 1UL9A 4QPIB 5CB7A 2HWB3 3GYDA 4YVSB 2DUPA 1KQRA 2ES3A 5B2GB 2XJTA 4H14A 3VGIA 1AXYA 1SLTA 1KJRA 4QD2A 4Q4Y3 4D7TA 1U0AA 5I8YA 1J3PA 3MYXA 4M0NA 1OHFA 4BPZA 4FOQA 4L8QA 4QQPA 5H9PA 3TRSB 2D43A 1FT9A 1VP6A 2YDEA 5KXBA 2R061 1LGBA 1NCQA 3WDUA 3QACA 4GB33 1NY72 1PK6A 4ATEA 2XLAA 1J3QA 5C9AB 1E57A 1O5LA 3GBGA 5BY5A 5KHIA 4XIKA 1CAUB 1GQHA 2BW8A 1AXKA 4QGMA 1DGRN 1RVF1 1WUVA 3AZVA 1IS4A 3K51A 5A3LA 3PVNA 1ZBE1 1DQ4A 2XJRA 5CAZA 3H9AA 4K7JA 1A8DA 4CP0A 5CG8A 1PNFA 1TEIA 1R1A2 2Y26A 2Q0AA 3TBDA 3ZFGB 3ENRA 1CJPA 4LO4B 1RUG1 1IQAA 1MZEA 4ZU5A 5C8CB 4AW7A 2ET1A 5DXDA 3MIBA 4XDQA 4CDWC 1AYM2 1WGPA 1ZRRA 1QJY1 4XXAA 4CEWB 3VDDB 4Q8KA 4NN0A 4QM9A 3BU7A 2BVVA 4IEWA 4AHXA 3LAGA 2VVFA 1RL3A 4S2FA 2A71A 3AP9A 3WW3A 5CFCA 2DFBA 3WDWA 4AFBA 4YGCA 2JG9A 4QQHA 1MZFA 2Q4SA 4AEDB 1S0BA 2P37A 2WNVC 3AJZA 1D0HA 2HEYF 1DQ6A 3OJBA 4XZPA 1PGSA 2OZJA 1S0EA 5JSRA 1DQ5A 3I59B 3PVEA 1DIWA 1VBD2 3N36A 3WG1A 3FMGA 4IV3B 4N53C 4K40A 4IEPA 4H7LA 2RS12 2Z2SB 2ZBJA 4BLIA 1H1IA 1OQ1A 2D6MA 1PMIA 1N1TA 4N7IA 4GMP0 2UWCA 3ILNA 3A4UA 4FCAA 3IWZA 5T5OA 3WCRA 2WA4A 4HN0A 3VBHA 3B94A 5BYNA 1KD7A 1KITA 1U5ZA 4U36A 4XJWA 1CAVA 1JH5A 1V00A 4K1YA 5KC5A 1OA3A 3RQ0A 2WS92 3BALA 1QJU1 4RHV3 3RS6A 3MZHA 4C1XA 2KM2A 2PHWA 1FMD1 2BTVC 3OYWB 1BMV2 4KWJA 3RZZA 2XVLA 4FTBA 2DVFA 4CDWA 2GNBA 2R49A 1W6NA 3ZDSA 2R071 1ZRCA 4JGZB 1H9WA 2XJQA 3IDCB 2D44A 3WW1A 4FAHA 1HQLA 4COWA 4LBOA 3AKQA 4AI0A 1QDOA 1Z7S3 1W6PB 2CGPA 3D8CA 3NV1A 4C0HA 2ILMA 4JTNA 4LNVA 4CEYB 1SLCA 3RRDA 1DZRA 3UJQA 1DQ0A 2GN3A 5FPZA 3WR0A 2WNVA 4YRDA 3VBOC 5ABJA 4AQ6A 1ND3C 1FPN1 3DPRC 3GZTB 5I0UA 3H1WA 3GHMA 3RMYA 3UL2A 3ZN5A 2E9QA 5J98B 5I8TA 2XBO3 2PAEA 3CU7A 4XF0A 1AYN2 1WMEA 4P9LA 3I8TA 2VOWA 4DINB 4QPIC 4N53A 2PN5A 3PNAA 4HANA 4YVSC 1RUI3 5ACA3 1UMZA 3VZLA 4K8FA 4J6GA 2VH9A 4LUMA 1UW8A 4CDUB 4AVVA 1TNFA 1S55A 2P3KA 4AI2A 2EXKA 1H2LA 4LA3A 1K5MB 1QXRA 4XQDA 3ATGA 5J96B 4DB5A 3CF6E 1MS1A 4XQWA 1Q8OA 4WV8A 4AVBA 5C9AC 1LTEA 2YZ4A 4NWWA 4Q4W1 3ZXLA 4Q0SA 2PA7A 5EYXA 3WZ1A 4FSJA 1X33A 3AZZA 1G9CA 4FVVA 4BOWA 3WD5A 1VBB3 5FAXA 5SV5A 1EAH1 1S0IA 1LHUA 3OPZA 1HRV2 3ZFGC 2MHFA 4YW3A 2NMOA 2AGSA 1AR61 3K48A 5C8CC 1W6MB 4EWEA 2ZGMA 3AXEA 5IK7A 2JE9A 4XE9A 4YZ3A 1UCXA 4DRVA 1XU2A 2D40A 3HIFA 3J9SA 1H0BA 1XNBA 3ZYPA 1F8VA 4PCRA 4CEWC 1X8MA 1D4M3 3LZZA 3VDDC 2VGDA 3BOPA 2Q8OA 4LTAA 3SH5A 1HV1A 1KJLA 2UU8A 2BGCA 3IN9A 1AL21 3AP5A 3MF6A 4P9JA 1YCIA 3VBOA 2WQZC 3LSDA 4HT1T 1ND3A 3UK9A 2TEPA 3G6JB 1FXZA 4W6XA 4QMAA 3VBSB 4BCUA 2RR13 4QPYA 5C8WA 2YPJA 4AEDC 2Z42A 4I0AA 4PIXA 4QPIA 3N7LA 1KXGA 3PMEA 2OW4A 4YVSA 1O4TA 3MIHA 1QXPA 1BEV2 2BQPA 1R092 1BKZA 4G4FA 2Y38A 2ARXA 4HVRA 3E5UA 4AFMA 1LESA 4P9GA 4ISQA 4I30A 1JTZX 4XJ9A 1SBDA 1ASJ2 4IV3C 4Z8BA 1OPOA 3VN4A 3H8UA 4XQ4A 4TYSA 5L36A 3AKPA 5DDJ3 1V9U2 5EYYA 4L9BA 1V6MA 3J8F1 4YW4A 3WW2A 1DFQA 4K6BA 3LKJA 4JCKA 5C9AA 4YM1A 1RUE2 3MLJA 1APNA 1NQJA 2ZMKA 1SLAA 2MEV1 3ES4A 3W9AA 2D6PA 1AR72 4IEYA 4KQ7A 1CAUA 1DQ2A 2GDFA 4E2QA 4BHPA 4ES9A 3HT2A 2P3IA 2CWMA 4OI1A 2HEWF 2EXJA 4XFAA 2JDZA 2V73A 4Y1VA 4XHXA 5DZFA 1L3JA 2XKOA 3FC0A 2R063 4BWOA 5GJ6A 3ZFGA 4FPGA 3WXPA 1DYKA 1SDWA 2E7TA 3SLIA 2YGLA 4MUVA 4EV0A 1C8M3 3USSA 3FX3A 1RVF3 4D7SA 1ZBE3 3M3IA 4JGZC 3GALA 4NHLA 5CVRA 4LBMA 5EV7A 4CEWA 3TAYA 3VDDA 2WZR1 2ZAAA 2QJVA 1RMU3 5I93A 1POV0 1KFXL 3URFA 2HEVF 1RUJ1 4XW3A 1AR82 2IC1A 5F9TA 1OMIA 2PLV3 4E2GA 2R072 4HN1A 4DY3A 1RUG3 4Q4X1 4WM7A 4CEYC 1HV0A 3WDXA 3U4XA 1O4ZA 3JB4C 4KU7A 4FOVA 4AEDA 1QJY3 3HR9A 2W39A 1S1AA 2C0ZA 2D93A 1POV1 4F7ZA 5KC6A 1AUYA 3UJOA 3CLPA 3I59A 1COV1 4NHKA 4LA2A 3JBG3 3GZUC 2JECA 1NYWA 5GLTA 1GV9A 3INAA 2DCYA 1SFNA 4M3CB 1RTVA 3DN7A 5AC92 5FRAA 1SEFA 5CNAA 2DV9A 1QF3A 2UYBA 4CDUC 5A33B 1NXMA 5L73A 3RJRA 2VXRA 5I8SA 4Z07A 4Z2WA 3N7JA 4QGNA 4QXKA 3QH7A 4I3PA 1R081 2Z5WA 3WINE 2ZGQA 1K5MC 1WA4A 2KA3A 3SHRA 5JIUA 2D5FA 4CZSA 5C6CA 4N7UA 4LBKA 2ZGPA 1CN1A 1QOTA 1PHMA 2YY1A 1N3QA 1CIWA 3BCWA 3TN92 5JDBA 2JJ6A 4X8PA 2UYAA 3I2DA 4YNIA 1ZA4A 2DYCA 4M0HA 4QPGB 4RGAA 4YGEA 2D6OX 2DTYA 2X5IB 1ZM1A 3MDPA 4E27A 2VW1A 2PTMA 2WLPA 3AYEA 1R1ZA 3OYWA 1G7YA 3WQ7A 5FO7B 2B45X 1ULCA 5K9YA 2XB6C 1QY4A 1NY71 4HSJA 5BPXA 1X7NA 4JGZA 4XILA 4AQSA 1TNRA 2GSYA 4XBLA 2NYYA 1H30A 4MX3A 1QJU3 2RS53 1W6PA 3M2MA 2GNDA 2D6NA 5FO9B 3D5OA 2UWAA 3WUDA 1FMD3 4CEYA 3CJXA 1QOSA 1R1A1 2PELA 3U0ZA 1MACA 2R6QA 1HQNA 3VKLA 2DVDA 3KCCA 1S2KA 1AYM1 2V5YA 3AFKA 3EBRA 2R1DA 3VBSC 1WD4A 3M3QA 4R8HA 4XFIA 2GC3A 4LBLA 1OLQA 5EWSA 4OI2A 1AJOA 1AR92 1LHNA 1RHI2 3OF1A 5AFBA 1GBGA 2X8KA 1BCXA 1U5IA 1HRI2 1DGWA 4JGYB 2B39A 4OI4A 2I07B 3W58A 4CDUA 5I0TA 3N3HA 1UKGA 4NOTA 5FBZA 4NO4A 2O0OA 2RS31 3VUOA 4FPFA 4DS0A 1K5MA 3I54A 3LOBA 1WCDJ 2VNRA 1ONAA 1H2KA 2RM22 2EAAA 3JD71 1H2MA 4NHMA 1WLCA 1VBD1 1QKQA 2EVXA 3LGRA 4WM8B 1WCSA 5L7OB 4OFGA 3SCGA 1IHMA 3NJZA 4IEUA 3SMHA 2B42B 2XG3A 2IWGB 5AVPA 1N3PA 2JICA 1FX5A 2RS11 1JBCA 2GMEA 4W6WA 4JDOA 4TWTA 1RITA 1DLLA 3TYJA 5GM0A 4HPKB 1JYCA 1OOPB 2F4PA 1DGWX 2YHJA 2WNUB 3EQEA 3M70A 3O0VA 3POWA 3VBFB 2LTNA 4Q4W3 1W6MA 4QT6A 1W6OB 3LA7A 2DU0A 3LSEA 3FFQA 4AYUA 2HWF2 5DUXA 2WS91 4QX5A 1PZ7A 1EAH3 2XH6A 2B5HA 1Z78A 1HXS2 3CNAA 1H8VA 2XJVA 4PBPA 1CQ9A 3QBQA 4ASMB 4U2AA 3RMXA 1X36A 4A7ZA 1BMV1 2D5HA 1AR63 4URTA 2A6YA 1H9PA 4HFSA 2H6BA 3IMNA 5A3MA 3VBSA 4YW2A 2K9ZA 2HWC2 3M7AA 1QNYA 3MPBA 4LLOA 4Q1PA 4QQ2A 4EN8B 2BUKA 1LR5A 1O5UA 2WT1A 1NE6A 2YUEA 3AMMA 3ROUA 4WZCA 4ZU7A 4FP2A 5FMOL 2JEMA 2NLRA 1QQP2 4EN6B 2XVKA 2XHKA 1CAXB 2EALA 4QQOA 1GZCA 1H1MA 1DYPA 2ZMLA 4AGVA 2VW0A 4XJAA 5LEKA 2XJSA 3KCXA 4LULA 1FNZA 2YROA 1DZQA 3NWKA 1MS5A 2QFEA 5I91A 4HSLA 4XYXA 3WDTA 2NZ9A 4RQPB 1YFXA 3PVBB 1QOOA 1I5ZA 3RWNA 2D6KA 2FQPA 4MXWB 2EIGA 3HBZA 4LBQB 1ZNPA 2ZZQA 1MQTB 1H1AA 1PO12 1ENSA 1AYN1 3SITA 1REFA 3QD6A 3FJSA 5FREA 2OVUA 3MIFA 1VRH2 4HKLA 2HWD1 4DXZA 3IDEA 3VHNA 4WBBA 2A3YA 3FLPA 2IXIA 4GWNA 4ITCA 3AM2A 4E9KA 1RB8G 4KNCA 2XKPA 1BVP1 4QPGC 1YJKA 1C8NA 2X5IC 3ZSKA 4UXAA 4AF9A 1LRHA 4BYYA 4EJRA 1O3SA 1QU0A 3V65A 3FHIB 2MEV3 2BWCA 3H3ZA 3ZYJB 1PGL2 1IKQA 3H7JA 3NV4A 5FCCA 4EWAA 1EV13 1Y7BA 5DG2A 4YLZA 2VW2A 3GBWA 2RHPA 1QHDA 4JV4A 3SH3A 1LOBA 4YFWA 3U10A 1HRV1 1NCRB 3OBRA 2ZCWA 1HKDA 2SLIA 2ZX4A 2VMHA 2QDRA 2PHTA 3FLRA 1GYKA 1O91A 2WQ4A 2WZR3 2D6LX 3O12A 3S0MA 2R042 3ZSJA 1GQGA 3TNQA 2UY8A 2B46X 1RUJ3 1W6QA 4H3WA 4Q0UA 4A3XA 2JXAA 2BNOA 1GNZA 4Q4X3 2QCSB 4M3CA 2PFWA 3ALQA 4MYEA 2VMIA 4B4RA 4I3GA 3J4UH 4JGYC 3M3CA 4A2UA 3LA2A 4RHV2 4CRQA 4E4ZA 1VB4A 4PLNA 5A33A 1QJZA 1POV3 2DUQA 1VBC2 1RUH3 3L2YA 4BE3A 1COV3 3JB8A 5HCFA 3UV9A 3ZXKA 1IS6A 1LU2A 3EXUA 2WSVA 3ZFFB 3ZXGA 4YM3A 1BEV1 2GNMA 1R091 2GAUA 1WCKA 2I45A 1UD1A 4B3NA 1G9AA 4IXLA 2D97A 2QUOA 4WM8C 2RS32 4Q2FA 2BYVE 1WMDA 1ASJ1 5L7OC 5F6KA 4FAGA 1AHSA 1QWRA 1LENA 2ZTNA 2WL1A 4QPGA 2X5IA 4GIQA 2ZS6B 2VOKA 4I0WB 1QH7A 3I4IA 1V9U1 1R083 2ZHMA 3JD72 4OUSA 4PLOA 5BXXA 1A78A 1SACA 1RUE1 1YYNA 1OOPC 1AR71 1CJDA 2WNUC 2CTVA 1JYIA 3VBFC 2AREA 4Y24A 3AMQA 4AEKA 3WG4A 4LO6B 1Q8QA 2ZGKA 2ZHKA 2CY6A 2OIIA 2W52A 1AXZA 3KD4A 2VUAA 4COUA 4AVCA 1EY2A 3AP7A 4RSUA 3FBYA 4YW5A 3NO8A 4PIZA 3V0BB 4YG3A 4K21A 3KZ4C 3H1YA 3THPA 4BH9A 2D3RA 3TWIA 3ZXJA 1N3OA 3ZSLA 4Y20B 3TB0A 4Q4V2 2DURA 1MVQA 2CGNA 4BIOA 3GBFA 1EYBA 5CBLA 1RUC1 3S7EA 4N9IA 3FZ3A 2A6VA 5D1IA 4JRAA 2QNKA 4Q8LA 1UZYA 3HN1A 4KG0A 1AR81 5KWRA 3AX4A 4PQ9A 4Y1YA 4CTEA 4JGYA 5CA6A 4QHBA 5IK8A 1OA2A 4LHNA 3AK0A 1CPMA 4YGDA 4C91A 4KWKA 1AYM3 3ZYRA 2CYFA 1YFWA 4XTPA 3B5LB 4XFFA 1XQNA 2XWJB 2ZAHA 4YM0A 3AKTA 4RQPC 1NLRA 5FLJA 2PHUA 4LLFA 3E6CC 1ZZ7A 3QOPA 1OLRA 4P9IA 3C2UA 1BXHA 1MQTC 4WM8A 2NMNA 3VZMA 4DOUA 1ZZ9A 3ES1A 2O8OA 5L7OA 5GLUA 3SISA 4OZXA 1Q56A 4LE4A 4AQ2A 5AC91 5FO8B 1CGPA 4JAAA 4D94A 5J37A 5JOZA 3FBMA 5FLIA 4GQ7A 4AHZA 4ATFA 1VLNA 4XJ8A 3N35A 3ZO0B 4HKOA 3WQ1A 1YWKA 3OCPA 1OOPA 4HPKA 4YW1A 1YXWA 1VBD3 2WNUA 3QLQA 2HWD2 3VBFA 1MS4A 2PYTA 3O5SA 2LM3A 1W6OA 4YFZA 3TN91 2ZABA 3ZN6A 3R0RA 4CP2A 4Z82A 1GZWB 1PZ8A 3AMNA 4CYDA 5J09A 3KT4A 1PNGA 1O3RA 1FYUA 4B4QA 4UBGA 5GLWA 2RS13 2ZZJA 2DFCA 1S0GA 1CX4A 2B8MA 1QDCA 2MNGA 4H55A 2TBVA 4TLFA 3OY8B 5K0UB 1QJX2 3WW4A 4AI1A 1NCRC 4OHZA 4PF5A 3VBUB 1SBFA 4X6RB 3WNXA 1G9DA 1IPKA 4IL7A 4AQTA 1MZ6A 2WS93 1JW6A 2BPA2 2WFF2 4R9AA 1RUD3 2BBVA 1CPNA 5KHKA 4KH9A 5HBAA 1XNKA 1ZBA1 1CAXA 1IGOA 1GLHA 3AP6A 3WT3A 5JOWA 3D0SA 2EF6A 3V64A 3EO6A 3RDIA 4RQPA 3BPZA 4XF3A 3R4SA 1G6NA 1G9FA 2DCTA 4MXWA 1LJ7A 4LBQA 1MQTA 2MPFA 1VJ2A 3VHPA 1C8M2 3RYRA 1AR91 1PIV2 1LEDA 1RHI1 4ORFA 2NP0A 3ZFFC 4COVA 3DPRA 1HRI1 1UAIA 3LA3A 4O9GA 1D0GA 3L2HA 2WZPP 5GZDA 1RMU2 2K0GA 3OD4A 2A75A 1GKBA 3M8LA 3HAGA 4YM2A 3N7KA 1LGNA 5JPNB 1A6CA 1D2SA 1AYN3 1ZRDA 2RM21 3WG3A 2A6XA 2GH2A 5C33A 2W08A 4IEOA 5JCTA 1RUOA 4EN7B 2ZGOA 4HK8A 4S2HA 4YG6A 4FXKB 1TME1 4BA6A 4J1XA 3AXDA 3B93A 3FUOA 3ZIXA 2QZ2A 4GULA 2RMU2 3JBG2 4P14A 1WLWA 5JVVA 1I1EA 1NCRA 4G9SB 1AX1A 4LBQD 5FQ0B 4AHYA 1EPZA 2D7FA 2WJSA 5CADA 1MZ5A 4IESA 1UIKA 3AKRA 2XWBB 5DG1A 2BFUL 1HW5A 2HWF1 1LOEA 4ONUA 1B35B 5T52A 5CFDB 2ZX2A 5DZEA 4Z1VA 1SLLA 2H6CA 1HXS1 3D82A 4KL1A 5F6LB 1CR7A 5C8CA 3BTAA 1WMFA 1W0PA 2B9UA 4N43B 4W6YA 4I09A 1LGCA 2HJIA 1YI9A 2FZ2A 2H0VA 2VVDA 3AJYA 4HL0A 1GZ9A 5BNPB 1CONA 2I74A 1X82A 3FLTA 2HWC1 1RUC2 3BOWA 1OQDA 5F5QA 3WP4A 1S0DA 2VQAA 4LO8A 4GXLA 1LEMA 3QCWA 2W68A 3MF9A 1XNDA 3O7OA 1QQP1 3ZFFA 1LOFC 1QNWA 1XE7A 3H50A 2R1BA 2VNGA 3VZKA 1IOAA 4AEJA 1V6IA 2NM1A 2RS52 3KT1A 2OUHA 3B7MA 4C1WA 2Z69A 2ZKNA 3D6EA 4AGGA 4NR1A 1YNAA 3AZYA 1MEC2 1ENQA 1PO22 4M01A 4YSFA 3RPQA 1G9BA 2PHLA 2QVSB 3T2TA 3B9CA 5K8SA 3IBMA 1BEV3 4AI8A 1PO11 4IV3A 2Q1MA 3ME2A 2PAKA 4COZA 5BNNB 5EJ3A 3JCIA 1OKQA 4S2GA 1VRH1 3MFAA 4B7EA 2GN7A 1Q8VA 2VVEA 2BFUS 4AFAA 1Y43B 1U5XA 1XNCA 1BBT2 2ZA9A 3OTFA 4MVTA 3WOGA 4BMEA 2WT2A 5LK7B 2ZGSA 1V9U3 4RS5B 1V6NA 1PVC2 1OA4A 3V0BA 3HD8B 1RUE3 1MS8A 2GNTA 4ISRA 4TSVA 1XU1A 4AFCA 2D3PA 1XYNA 2HWE2 3NV3A 3AMHA 4XF1A 1AR73 4AFDA 4OHYA 1LULA 4UW5A 1HX6A 1WLDA 4Y20A 1N1VA 5K0UC 1PGL1 1SQ4A 3RI9A 3VBUC 5HI0A 3NKTA 1LCLA 3MW3A 5DUVA 2RJKA 1F31A 4HLTA 1YHFA 3B00A 3DKWA