4XFCA

Cysteine dioxygenase variant - y157f at ph 6.2 unliganded
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLFSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xfcA00
2O1QA 1OFNA 4WBBA 3NL1A 4KWJA 1ZVFA 4BH9A 3NVCA 5KHGA 4AVCA 2UYAA 2OZ6A 2Z69A 2OYZA 3ST7A 3CO2A 4KU8A 1NYWA 3MYXA 5LEKA 1WA4A 3H3UA 3DN7A 2E9QA 1ZZBA 5K8SA 4LLOA 1ZZ7A 2GC3A 2OPKA 2XKOA 4DINB 2ETEA 1O5LA 4J1XA 2PAMA 2XKPA 1FT9A 1SEFA 3OD0A 4YYOA 4QX5A 4QMAA 5KBFA 5FPZA 3D0JA 3RNSA 2N7GA 3KCCA 4Q0QA 4PIZA 4J1WA 1O7FA 3HQXA 1O3TA 1CAWB 2XLGA 3OGJA 4MGYE 3WW3A 3FFQA 3H3ZA 3SCFA 1X8MA 5FCCA 1ZZ6A 2XGXA 1V70A 3QACA 4JTNA 4XFGA 4HN1A 4IESA 5FLJA 1ZRRA 1HW5A 3FZ3A 1VJ2A 4E2QA 3SHRA 2K0GA 3RDIA 2PTMA 4A2UA 5FQ0B 3NW4A 1RL3A 4META 3HIFA 5F1RA 3IWZA 4XF1A 4ZU4A 1SFNA 2F4PA 4AQ2A 3E6CC 1UIJA 4LA3A 4MUVA 1YFWA 4IEVA 4N9IA 1NE6A 3FJSA 4FAHA 4LEJA 3OF1A 4BYYA 2PHDA 1CGPA 4XF0A 1YWKA 2Q1ZB 1G6NA 3CJXA 3H1MA 4AVBA 5FPXA 4O9EA 4HSJA 2IXCA 3S7EA 5JSPA 4RD7A 5JR7B 4R52A 1UIKA 3KSCA 5I8TA 4JTOA 1JUHA 3EBRA 3ELNA 4HVOA 2BNOA 4AVAA 1X7NA 4IEWA 4UXAA 1NXMA 2XHKA 3KGLA 4IEQA 4YARA 4D7SA 4TLFA 5FDBA 3CLPA 1I6XA 5E16A 2IXHA 3IBMA 3I59B 3L2HA 1EPZA 2H6BA 5BV6A 3EO6A 1XRUA 1I5ZA 3E5QA 1O3RA 3M3IA 4QXKA 4ZU5A 1O5UA 3TNPB 5JCTA 2GC2A 5BUVA 5I0SA 4Z07A 4P9GA 1DZTA 5LRSA 1RUOA 3CL1A 1CAUA 4ZU7A 4E2SA 4AXOA 4IEPA 4XF3A 1ZREA 4HVQA 3E5UA 1NE4A 2CAUA 3H7YA 1LR5A 2VPVA 5C8WA 2PYTA 5JSOA 4I02A 1OMIA 1FI2A 2GAUA 4HMZA 1ZZCA 4FAGA 2D5HA 1QXRA 3BCWA 2Z2SB 4YNIA 4IEUA 1O4TA 3MZHA 2IXIA 1PM7A 5CVRA 2D40A 4D7TA 4XFIA 1U12A 2PAEA 1ZRDA 2P17A 2EVXA 4IEYA 4L2NA 3S7IA 3U0ZA 3UKVA 4X6RB 4EV0A 3G7DA 4HLTA 2FQPA 3C3VA 3H8UA 2V09A 5KHKA 3RPQA 3DL3A 2HKXA 4QGNA 5J3UA 3LAGA 3VHRA 3FHIB 3PLQA 4Q0VA 4PJYA 4K8FA 3FE5A 4JVAA 1QXJA 1EYBA 2IXLA 2UYBA 3HT1A 1UD1A 2XLFA 2Q30A 1J3QA 1J3PA 1EY2A 2WC2A 4L11A 5J48A 3LA2A 3LWCA 3OCPA 4QGLA 1X82A 4EROA 4EWDA 1Y3TA 2H6CA 5EZWA 4X6QB 2IXJA 2XL7A 3KGZA 5EFUA 3KMHA 4F8AA 2PAKA 3UKTA 3CF6E 3QOPA 3NSTA 4QM8A 5KHJA 2MPFA 1LRHA 3WW2A 1OD5A 3M70A 5I93A 5I0RA 2BYVE 2IC1A 2QJVA 3FWEA 1OI6A 3WW1A 3I7DA 1CAVA 4HBNA 4Q0PA 2WFPA 1UPIA 4ONUA 1YFXA 3MPBA 4KWLA 1WLTA 4HZFA 2PHLA 4O9GA 2KXLA 4R8HA 5I8YA 3NJZA 4IEXA 4UBGA 4HN0A 3OTFA 1O3QA 1GQGA 4HVRA 4XEZA 2D93A 1UW8A 3ES4A 1QWRA 3NKTA 3TNQA 2K9ZA 1CAXA 4FBFA 2QDRA 1ZX5A 4HSLA 2D5FA 2EA7A 4XF9A 4LTAA 1J58A 3SXWA 4OFGA 3D0SA 5CADA 3DKWA 4KWKA 2UY8A 1RGSA 4IERA 4QGMA 2ZKLA 1Y9QA 1DGRA 1LKNA 3E6BA 4MH0E 1WGPA 2ET1A 5I0TA 2Q0AA 3BB6A 2GC0A 4XFHA 3WW4A 1ZZ8A 4BHPA 1NZCA 1ZRFA 4H7LA 4I2OA 2B9UA 4XFFA 1YFUA 3UKNA 4LA2A 2MNGA 2BEOA 4CYDA 2QCSB 3MDPA 4AQ6A 2QVSB 3DV8A 3H1YA 3H7JA 1FXZA 1SQ4A 2O8QA 2OZJA 2GU9A 3LZZA 5I91A 3IIAA 2DCTA 2CAVA 3ACLA 4MX3A 1IPKA 4LUKA 2BGCA 5T3NA 3N4MA 4LUMA 3GYDA 1CAWA 4XFCA 3ROUA 5J7MA 3H50A 4XFBA 3FX3A 1YUDA 4I09A 1PMIA 1J59A 3I54A 1YFYA 4JV4A 1O3SA 4Z82A 2BNNA 2FMYA 1X8EA 5HI0A 3H1WA 2B8MA 3EHKA 5FQ0A 1CAUB 3E5XA 2GH2A 1IPJA 3E97A 1EP0A 3RYPA 2HJIA 1Q3EA 4YRDA 2CV6A 4OLLA 1Q43A 5KHIA 2VQAA 3IDCB 3B02A 1VR3A 3O14A 4XETA 5I0UA 2Q4SA 5BXXA 2XLAA 4KU7A 3U10A 2B5HA 5D1IA 3H9AA 4IETA 1DZRA 1RTVA 1RC6A 4PIXA 4LULA 4Q0SA 2MHFA 4B29A 4KL1A 4XF4A 1L3JA 3BPZA 3D82A 4F7ZA 5C6CA 5BY5A 4FT8A 3SMHA 1YLLA 5LRRA 3I59A 5BPXA 1TQ5A 1XE7A 5FLHA 3GBFA 3RYKA 1ZNPA 4I01A 4QM9A 2GC1A 3USSA 4EWEA 3JZVA 3PNAA 2EAAA 3LA7A 5AVPA 4MGKE 2VECA 4UBHA 5JSRA 1RUNA 4ORFA 2PA7A 2GZWA 4MGIE 2BNMA 1XE8A 3SCHA 2QNKA 2ATFA 2UY9A 2CGPA 1J3RA 1UCXA 4XFAA 3LOIA 2PFWA 3EJKA 3IDBB 1LB2A 4MV2A 3E6DA 2PQQA 3LA3A 3HT2A 1Q5OA 2OA2A 4E2GA 2ET7A 4WZCA 4YSFA 3U11A 3PVBB 2Y0OA 4IEOA 1CAVB 1VP6A 4MZUA 1H1IA 2H0VA 2IXKA 4IEZA 4BIFA 3ES1A 3ZDSA 1J1LA 1ZZ9A 3BU7A 4MGZE 1QY4A 4Q29A 3S0MA 5FLIA 3R6SA 1CAXB 1YHFA 4I3PA 3BALA 1CX4A 2ZCWA 4I0AA 5LEJA 3ETQA 5E1RA 2XL9A 1GQHA 5KHHA 4N9HA 4WVZA 4EWAA 5I8SA 3RYRA 1ZRCA 4NVPA 3SCGA 1H1MA 1DGWA 2I45A 3EQEA 4I0BA 3RZZA 3CEWA 2C0ZA 4PIYA 4Q0UA 5CU1A 5JAXA 4GULA
chains in the Genus database with same CATH superfamily
2CGNA 1HN1A 1PNGA 3R0RA 1CZSA 2O1QA 1OFNA 3NL1A 4KWJA 2AEYA 3PTYA 4M4PA 1ZVFA 4OCTA 5C8CB 1AX0A 5FTTC 1ENXA 1HXS2 4AVCA 2Y6FA 2ZGLA 2OZ6A 5LWBA 2P34A 1PMJX 2XVKA 2BBAA 4N43C 5JZGA 3ST7A 1RVF3 4JGYA 3R05A 4CP9A 2W87A 4XABA 3MYXA 1HRI1 4JKLA 4CDXA 4CCNA 2RV9A 2B46X 4Z8BA 2GC3A 3BTYA 4E9KA 1G9FA 3O1TA 2J1EA 4CEWC 2XKPA 1BZWA 4Q2FA 3I4IA 4FTEA 4CSWA 4E4HA 2VE1A 2G9FA 1PO11 4QMAA 4COZA 3D0JA 1ASJ1 1B09A 4E8DA 3KCCA 4Q0QA 2VMHA 1O7FA 2UWCA 1RUJ3 1YYNA 3OY8A 5EV7A 3SISA 5FZHA 2OIIA 1HQWA 4XUTA 1MQTC 2WN2A 1C5IA 1HJGA 3H3ZA 4O61A 4RQPC 5FYMA 1A6CA 5LA0A 4ATFA 1U5YA 5JPNB 2WA3A 1LECA 1KD7A 1R1A3 3AYEA 2RM21 3WDWA 5A33B 4P9LA 3BVCA 3QACA 4RS5A 2W1WA 3R4SA 4NIGA 3WHTA 1W9TA 1WMEA 2VU9A 4HN1A 4JQTA 4TN7A 4QQPA 1KQRA 1VJ2A 4GWJA 3SHRA 1DHKB 2P3YA 2WN3A 4A2UA 1RUI2 3AZVA 3AXDA 4E4ZA 1QOTA 1ZBA3 1NCRA 3IWZA 4CCEA 4XF1A 3ILFA 3PIGA 5KR7A 1DCSA 1U5XA 2F4PA 4C90A 5FZEA 1UIJA 4IGPA 2QQVA 2VTXJ 3Q8AA 3VDAA 1SBEA 3PMSA 4YVSB 1QH6A 4ASMB 2CTVA 2HWB1 3WR0A 3SITA 3VBHA 1POV1 2R071 5FY5A 3CU7A 4XF0A 1REFA 3EXUA 3DCQA 5EYYA 4IV3C 2ZEYA 1AJKA 5FPXA 4GH4B 1NXD1 3FLTA 1O91A 1SLTA 3VD9A 5FUPA 3VV1A 3JBG1 5ABJB 2YBSA 1WD3A 5GM0A 4AQTA 1CIYA 1V0AA 2X10A 4M3CE 3AFKA 4A41A 3KM5A 4AI2A 2OQ6A 4JTOA 2FDGA 3LEGA 5CA6A 1AYM3 1D0HA 3OBTA 3VD7A 4AEDA 5JSRA 2F4LA 3ZSEA 4G3YC 4LK6A 1LOCA 1NT0A 2BNOA 4HT1T 4FPCA 4HVOA 4AVAA 4D6RA 4NHXA 2ENRA 2R0FA 3CDZB 3INAA 4UXAA 3POGA 5FP8A 4IEQA 2YGMA 1GBGA 5C4WB 4D7SA 5J98B 1AR73 2JDKA 5JXHA 4K21A 3M3QA 3USUB 1VBC2 1KJLA 1GICA 2H6BA 3C8XA 5BV6A 1WUVA 2VZUA 3MW4A 4IV1C 5JIUA 4BMEA 1H1AA 2VC9A 2HLEA 3EO6A 2WA4A 3MPPG 5A3WA 4B1LA 2W92A 1I5ZA 4BDVB 4ZONA 3UK9A 3M3IA 4QXKA 4D3WA 2WAOA 1YJKA 2GC2A 4YGDA 1G9DA 2X09A 1TNRA 1ND3A 2YMZA 2DFBA 3NAPB 1T6BX 5LRSA 5DMYA 2ZZQA 3UGHA 4YW5A 5BNOC 2RHPA 1UMZA 3OPTA 2RR12 4DXSA 3O0WA 2W9XA 3ILRA 4QDRA 1CAUA 4JKMA 2MEV3 1FOD3 4LO6B 1W0OA 3RQ0A 4IEPA 3ZN5A 3CMGA 4CDQB 3BUCA 3E5UA 2CAUA 1W3XA 3H7YA 4CUBA 3B00A 5DAVA 1MS9A 4MADA 1K12A 4QKDA 1X36A 1H8TC 2PYTA 5F6LB 2E51A 3MI8A 4I02A 1OMIA 4FO9A 4LBLA 2GAUA 3VD5A 3LKJA 4P00B 4B3NA 3GALA 5A1AA 2D5HA 3GJAA 1BKZA 4HKLA 4PLMA 4R9AA 5FJHA 3T2QA 5FBZA 2AREA 5KC6A 2RS31 3T09A 4CEYB 2YUEA 2BGOA 2IXIA 2J1RA 2A6YA 3QH6A 5CVRA 4NHMA 3JUUA 4SBVA 2Q5TA 1ZRDA 1UKRA 1SLLA 2EVXA 2P17A 1XSQA 3VDDA 1GWKA 4L2NA 1XOYA 1QGLA 3PTRB 4GB31 1GYKA 5F2WA 2B9VA 1F4AA 3MIGA 1PVC1 2FQPA 4H2AA 3VBRA 1WCKA 2HWD2 4P9WA 2DTWA 5A70A 3LSDA 4D8MA 3TN91 1A3KA 1YRZA 3P5BA 2Q1MA 3GZEA 3DL3A 5J3UA 1BBT3 2X5IB 3VHRA 3WNXA 4XDOA 4Q0VA 4XJ8A 4WM8B 3VHOA 3AP5A 1SACA 3J26N 3MICA 4JVAA 3ZXDA 1QXJA 4BWOA 2UYBA 4W6WA 5C3QA 2O8OA 2RMU1 2XLFA 1US3A 2HWF2 2P6HA 4L11A 2JXAA 2XXZA 3AMMA 3NRUA 3I2DA 5DZFA 1AXZA 2ZX3A 5L9VA 2B7YA 4IE7A 1RMU1 2KA3A 1MPXA 1IG3A 5FMOS 1RUH3 3UKTA 4EYUA 1SLAA 1LOBA 2JG9B 2P4EA 4ISQA 3NSTA 4Y20A 4E4DX 4M01A 4EN9B 5JR2A 5KHJA 1JOJA 4YM3A 2CWSA 4URAA 3WW2A 4HANA 1UOJA 4NRQA 4QPYA 5I93A 1GNZA 1NOVA 1PX3A 5I0RA 2BYVE 1JHNA 1KJRA 1D4M1 1WMFA 4ZXKA 1MVQA 5ERLA 3RZLA 3I3MA 3WW1A 3K3NA 5FK7A 1ULFA 4DUWA 1R083 3IAPA 1DU3D 5FK8A 3KVAA 1VPHA 1LOFA 2WFPA 5B4NA 1W39A 3AZYA 5T5PA 1PIV1 2ZEXA 1Z7S3 1XYPA 1CQ9A 1O8SA 1S2EA 3IT8A 3OBAA 5CIRA 1S0IA 1WLTA 4HZFA 1PK6B 1JU4A 2PHLA 4YW7A 4BCUA 4BZ4A 2PLV3 1M4WA 1UZVA 3KD4A 4IEXA 3R4UA 3DECA 3OTFA 4HVRA 4X8NA 2WO3A 3ES4A 3MIDA 3OB8A 1R092 2A6VA 2V72A 5B4XA 5F9TA 2EA7A 5D8AC 4XF9A 1TME1 1GMMA 4M00A 3OGRA 1D2SA 4OHWA 2ZKNA 3S6PA 5FMDA 3OPZA 1UZYA 3IPVA 3ZSLA 1QDOA 2OPWA 2Z79A 1I9RA 1ZRIA 3UYJA 4BQ1A 1ULOA 5AC92 2FDFA 1DQ1A 5HXVA 3WOGA 5LB6A 2JDMA 3ZYHA 3IMNA 4M3CA 1LJ7A 3PU8A 1ZBE2 4L8QA 2W91A 2OUJA 3E6BA 1WGPA 3AP4A 1F35A 1RUF2 1PGSA 1QJFA 3BU0A 2GC0A 2Y38A 1S0FA 1CX1A 4BQ2A 3KZ4C 3LEIA 1ZZ8A 2NM1A 3FBYA 4MLOA 1MEC3 2VMCA 1NUKA 2EAKA 4QKNA 5LASA 5JOXA 3OBZA 1NLQA 2VMFA 3AKSA 3N36A 4K1ZA 4UFLA 1F9KA 1SDDB 4OZXA 4JDOA 1ZRFA 2QQNA 3ACFA 1YFUA 3HWJA 2BVBA 2QQPA 2A71A 2XG3A 5AFEA 2MNGA 4UW3A 1NLSA 1T6GC 1WW6A 1VRH2 3ZVXA 4AI8A 2X53S 3HBZA 5K0UB 2CWMA 4BK5A 1BHGA 1XQNA 1G9AA 2HWC2 2Y26A 4ZHNA 5FWJA 3BTXA 4YG3A 1X9TA 2R7EB 1VBB2 3K4DA 1HXS3 1Y4WA 4A42A 3U4SA 2ZX4A 3H1YA 3NKGA 2YG0A 1DP0A 1C1LA 2ZGQA 4CDUC 4X8PA 1HB1A 2O8QA 3MV01 1T2XA 4ITCA 1QJY1 3Q8EA 4Q4X3 1V6LA 2DCTA 3HN3A 2P5BA 5TSWA 2V73A 4XDQA 3LEMA 4Q8KA 4LUKA 3PHMA 3OUJA 4EN7B 3WY6A 5L9RA 1JZ4A 3AVRA 3K3OA 4XFCA 3WVJA 2ZGRA 4AHWA 5F3EA 2A3XA 4AW7A 3FX3A 4K6BA 4XMIA 3VUOA 1YUDA 4XXPA 3T1MA 3V56A 4MOAA 2WFF3 2Z5WA 4I09A 1PMIA 5A33A 4LQRA 3B3QE 2YXSA 3VDCA 2YBPA 3V0AA 3ACIA 1RUC2 4DPNA 2R1DA 3QD6A 2WT2A 3M4FA 4QPGA 3A4UA 2JG8C 5HI0A 1OQ1A 5F37A 3OGGA 2XBO3 1W0NA 3IAQA 1OD3A 2LW8A 3B94A 3FFZA 1PO21 2WWSA 1DIWA 3E97A 4LBQD 4RGAA 5DDJ1 4A4AA 4DEVA 4YRDA 1H8VA 2R061 5FY1A 1BMV1 2VZVA 3MHZA 4QKFA 4R9CA 1W6OA 4YVSA 1RUI3 4ZPIA 4YW1A 2OKXA 1OLQA 3VKNA 3ZXFA 1BLZA 3DXUA 4Q4Y3 4Y1VA 4XCBA 3PUIA 3JD71 5I0DA 5ANNA 3OUIA 4COUA 3B02A 4OZOA 4BQWA 1LESA 2VO5A 4GQ7A 1NX9A 1ZM1A 2WSVA 4GH4A 4XE9A 4XIKA 5FOJB 1PNFA 2XHNA 5ABJA 2TNFA 5BXXA 2B5HA 5FO9B 5T52A 3H9AA 1XXNA 4KBZA 1QJX2 3MLJA 5J1XA 2R041 4FPLA 2ZACA 4D7YA 4Q0SA 2NP0A 2MHFA 4B29A 4KL1A 1QQP1 4XF4A 3RSJA 1F4HA 3S5QA 3WLUA 3N9NA 2ZBJA 4F7ZA 3K46A 5C6CA 2ZGKA 4BU2A 4TSVA 1RXGA 2EALA 5C4WA 1JMUB 2G9GA 5FYVA 5FP4A 2AACA 5E8AA 3UT0A 2RS12 3USUA 4LO5B 3WG3A 1E5HA 4HPKB 1NKGA 1X50A 3B7MA 4I01A 4PT6A 2PHUA 3LFMA 3ORJA 2GC1A 4LJHA 3USSA 5A7SA 3NNGA 1VBC3 1RJ7A 3S57A 3LA7A 3AP6A 3NAPA 3ZMNA 1H4HA 5LBFA 3I3DA 2A6WA 3ZKYA 3KVBA 1ZBA2 4P5HA 5F32A 1EAH1 3N7LA 1W2AX 2DCYA 3VBOC 3O5SA 2A6ZA 4XQDA 2BDRA 4MGTA 1OH4A 3WDUA 1MZ5A 3LOIA 1ULGA 4J25A 2DUOA 2PFWA 2C6SA 4MV2A 1AL21 1HIXA 4QD2A 2RR13 3HT2A 1UF2C 1IGOA 1NZIA 4S2DA 1LGNA 4WZCA 5FZBA 5LATA 4TTGA 4YSFA 3U11A 4LOTA 2HYKA 3I2JA 3LB9A 3BOPA 3AB0A 3JCIA 5GLZA 1LAJA 4HETA 3ASIA 4CEYA 3RJRA 1H9PA 5FO7B 4YGCA 4CPBD 1RUG3 3ZDSA 1J1LA 5DAQA 4ZKTB 1MS0A 5L7OB 2VCAA 1I3HA 1AYM2 4FPKA 2TUNA 2JKBA 4KBBA 4Q29A 1XJAA 2QZ3A 1RUE3 5FYUA 2VMGA 3FL7A 1GZ9A 1NQDA 5HCBA 2AUYA 1GANA 2ZCWA 1AR72 1N3OA 5E1RA 4UF0B 2WYFA 5KHHA 3S5AA 2WNUC 5FV3A 5AFBA 5C3OA 2DU1A 1I1EA 1A34A 2WNVA 4LR4A 5A1LA 3U4XA 2X5IA 2P37A 3ZYFA 2X29A 4YW2A 4WVZA 1K3IA 4LHNA 4EWAA 3RYRA 1IS6A 4XACA 2ZX1A 2GP3A 3SCGA 5JDBA 1IQAA 5FZGA 3IM0A 1QMJA 2QE3A 2WRAA 3QH7A 5D21A 5FYBA 2YYOA 3PU3A 4PBOA 1DGWA 3T4HB 2DWRA 4YGBA 3AZXA 3CBNA 4GMP0 1SG3A 1W8ZA 3WDVA 5IYYA 5JAXA 3RZKA 4HK9A 4C91A 2WS91 4QWNA 4CVUA 1FOD2 1IG0A 2XDVA 3ZN6B 5FZ1A 2JG9A 1ND3B 4A6OA 1UAIA 3MEPA 4DIQA 4BH9A 4QPWA 4G4FA 2LROA 4G9SB 4HK8A 1SLBA 1RHI3 3K4AA 4QPIA 5KHGA 3OGVA 2ZGTA 5LZ6A 4WM7C 2VCCA 3I2GA 2ZHKA 2OYZA 1W6PB 5FWEA 4KNCA 2XOMA 4KU8A 1MZ6A 4ZS3A 1XYOA 2QQJA 3KT1A 3H3UA 1W2OA 2P3KA 3FBMA 2ZHLA 4ZZ8A 4DINB 1W8WA 1ZZ7A 3ZSMA 1AR93 5LBEA 4XW3A 1AYN2 2UWAA 2ZGUA 3W59A 4Q4W1 1O5LA 4J1XA 1OPOA 2PAMA 4Q26A 5C5TA 1PK6A 4LIUA 1SEFA 3HQUA 1JZ2A 1NCQB 4QX5A 5A6ZA 1Q8OA 5KBFA 2SBAA 5EQUA 4B8EA 1REEA 4AEMA 4PIZA 1GLHA 1UY2A 4B7KA 1KRIA 1N1YA 1XU1A 4CDWC 4KMQA 2JD9A 2ARBA 4P5YA 1FATA 3DYOA 1G9BA 1CAWB 1KDMA 2XLGA 3VDDB 5T54A 2Y34A 3TEXA 4PF1A 5IK4A 1BBT2 1REDA 1SBFA 2R30A 2UWBA 3FFQA 1X8MA 4GKYA 4Y4RA 3SCFA 1CJDA 1ZZ6A 2XGXA 2BZDA 1R093 4GWIA 3KT4A 3TEWA 1S0JA 2ZJCA 3LPFA 3FHAA 4AGRA 1DDLA 4COWA 5IJRA 1AHSA 4IESA 5FLJA 3ZR5A 1ZRRA 4YZ2A 1HW5A 5DG1A 5EXOA 5FZ9A 1JZ7A 2W5FA 3AJZA 1K45A 1PVC3 3LDRA 2K0GA 4XTMA 2WLQA 3RDIA 1GNYA 2WZ8A 3I2FA 5FQ0B 5A7QA 1W0PA 1TNFA 3WF1A 1RL3A 4META 4QU1A 3DYMA 3UETA 1FNYA 3PUQA 2HEVF 4FP3A 1SFNA 3O1SA 1YIFA 4AQ2A 3WDYA 1JN2P 5FZ3A 1JZ8A 3E6CC 1ZBE3 4LA3A 4COVA 1YFWA 4OMDA 1KGYA 4N9IA 2J22A 1NE6A 3FJSA 4YM0A 4LXLA 3DF0A 2Q8OA 3HVDA 4PBPA 4QXCA 3OF1A 1TMF3 1OH3A 1W3VA 4F83A 1C8M2 5FXVA 4FTBA 5IVBA 2PHWA 1SLIA 2D3PA 1ST8A 5K0UA 1QJU2 1FPN2 4DFSA 3MGUA 1R082 3LDBA 3ZDVA 2ZABA 4LT5A 2PHXA 1FMD3 4LBJA 3OGSA 5FP9A 4HSJA 1QNWA 3S7EA 3ITQA 5JR7B 1XC6A 3MFCA 4XJ9A 2HEYF 1ASJ3 2FDHA 2VJXA 3EBRA 3UGGA 1U0AA 2K2SA 3CJIC 4UFJA 3UNPA 2HWC3 2ZEZA 1UN1A 4GWMA 2BU9A 4XUPA 3CZUA 5IAXA 1VBB3 3V0BB 1MS3A 3J9SA 2YPJA 2XHKA 4YARA 4TLFA 1V00A 3K4ZA 1DLCA 3ZFEC 5E16A 2WJSA 3NV3A 3IBMA 3JQWA 4AAXA 1EPZA 3N9PA 4OMCA 1F5JA 2XH6A 1JODA 3AYDA 2RM23 5D2AA 4PF5A 2DVGA 4C8DA 4DMIA 2TEPA 1LENA 3J4UH 3VD4A 4QQOA 3BIEA 1KITA 1SLCA 3HN1A 1RUD3 2ARCA 2NQYA 2WZR1 4Y24A 1RIRA 4AFMA 1UX6A 2Y60A 5FP7A 1UZWA 3ETPA 3VZLA 3HNMA 2IZWA 2WBKA 4CEWA 4P9GA 3VBFB 3IPVB 1S4CA 1RUOA 1SCRA 1COV1 3VZNA 4BIOA 3ALQA 2FDJA 1Q8QA 1NA1B 2BOJA 3I2IA 2VR4A 4E2SA 4IQPA 1Y9MA 3BI3A 1MEC2 2Q1FA 5A3UA 1LEMA 3MIEA 1RUC3 1NE4A 2GALA 2VZ1A 1SFYA 1XNAA 4HKWA 4MG2A 5C8WA 2C4XA 5LK5A 4FVVA 2W08A 5CFCC 3I2KA 4HMZA 4C1XA 2XWBB 2XB6C 3ZFGB 2LRPA 1HRV1 1AVBA 1OVPA 3JBG3 3OJBA 4FAGA 5BNNC 3NNLA 5H9RA 1IS5A 1QXRA 5DAPA 2Z2SB 3PVNA 4YNIA 4DXZA 4DY3A 4ES8A 3TOJA 5JIAA 4FOQA 5GZGA 1PM7A 5IFPA 3MZHA 2D40A 3M3OA 3N9QA 4BK4A 2VZ3A 5GLWA 3POWA 5F3CA 3TWIA 1MVEA 3BGAA 3S7IA 4XOGA 4AG4A 1S0DA 3U0ZA 1VBD1 4Q4X2 3KWVA 4X6RB 3LEKA 3G7DA 4AR2A 1SBDA 4CP1A 2V09A 1ND2C 2ZMLA 4N8MA 4XHXA 1QJX3 5M0TA 1WCUA 2RJLA 2JKXA 1DBNA 3AMHA 3SNMA 4QGNA 5L19A 4P08A 3VKOA 4RSUA 2CDOA 4W50A 5T5JA 3RS6A 4E4SA 3FHIB 3PLQA 1PGW1 4HPKA 5A80A 1OXCA 1AR81 1BQPA 3POSA 1POV0 1BCXA 2P2KA 3B9CA 3WT3A 2WFF2 1OPMA 4D6QA 1EYBA 1RUF1 2OUHA 3HT1A 1OF4A 3B01A 3PUSA 4GXLA 4LKFA 5EPAA 2WC2A 3ZYRA 2RS13 4JGZB 2QQUA 3LA2A 2VUDA 3LWCA 3ILNA 1EV11 2K46A 2HBUA 2IXJA 2XL7A 3T2PA 1QOOA 2ZGNA 1L7RA 5EFUA 5IWFA 4XXAA 2DV9A 2VOKA 2HWE2 2WO7A 2XBO2 3VBSB 2PAKA 1G7YA 1H2MA 2NZ9A 3ME2A 3CIHA 4QQHA 2C26A 2D44A 3V0AB 2MPFA 4QPGB 2EXIA 1OD5A 1VMJA 3M70A 4OI0A 1ULCA 2YBKA 2EXKA 3HJRA 4CCKA 4Q4Y2 2IC1A 2J1SA 2QJVA 1S0BA 3BN6A 3X29B 1C57A 1LOEA 1OI6A 4LHLA 5F6KA 2JIGA 4CCJA 2JDYA 3DPRB 4Q0PA 1W6OB 2E33A 1HB3A 2A6XA 2JE8A 1W8OA 1UPIA 2WO2A 4GIQA 1YFXA 4ASLA 2XJSA 4KWLA 1UL9A 2O14A 1JOBA 4BISA 3LCPA 3ENRA 3D3AA 4E8CA 2KXLA 3ZSKA 5L7OA 5JZGC 1O3QA 2DVBA 3IKWA 5CFDB 2I2SA 1QWRA 4JGYC 3O1RA 3RZHA 4HKOA 4P9JA 2R6QA 4UI9L 3TNQA 2WT1A 4RR3B 3TN93 3WINE 2QDRA 3KCYA 3WQ1A 1PGL2 3OSDA 2A5ZA 2BBVA 1JYXA 4CDXC 2AR6A 2ZGSA 2WZPP 2A3WA 2GNTA 4UF0A 1NY72 1H8TA 1BVP1 3D0SA 5CADA 1UYYA 2PHFA 4QXBA 1CJPA 1DGRN 4MHRA 3N7KA 2NPIA 3I8TA 4D6SA 4Z2AA 3D8CA 1QF3A 1U5ZA 1A8DA 4MVTA 3RJ2X 3ZYPA 4NE9A 3NQHA 3P1IA 3SH3A 1LU1A 1DGRA 2YC4A 3WXPA 4I30A 2QQIA 1POQA 4YVWB 5K9YA 3AMNA 4DNYA 1W90A 3WW4A 1LGCA 4GA9A 4NO4A 3ZR6A 1C3HA 3VBUB 3ZN6A 4PDWB 1UKGA 1RVF1 1KFXL 2FCTA 2ZGMA 3BODA 4RS5C 2JDHA 4TZDA 3MLLA 4XFFA 4NPLA 1CPNA 3HPNA 4AEKA 4LA2A 1OA2A 4F3JA 3J8F2 3VZJA 2JEMA 4XBQA 1QKQA 2JDUA 1W6PA 4A7YA 5FY4A 4NPRA 4OHZA 1NCRC 2AZ5A 1OUXA 5ACA3 2VQUA 5DN2A 4WVWA 4XC9A 1RUG2 3AJYA 2VXJA 4CXXA 3TEYA 5JUVA 5FXZA 2OZJA 2GU9A 1OKQA 3VL9A 1RUJ1 1NCQA 3RMYA 1N1TA 4Y22B 3T1LA 3HBKA 2VNRA 1GZTA 4LHKA 1RUE2 2CAVA 3ACLA 2W0XA 2VUAA 5DXDA 1AYN3 3VHNA 1H0BA 1IPKA 1JYVA 3JQXA 4WM7B 1R1A1 5T3NA 5T5OA 3VZMA 4Q8LA 4YZ3A 4FQ4A 5F5QA 1CAWA 5J7MA 2VM9A 3H50A 3ZM8A 5GLUA 2ARXA 2RJ2A 4NROA 3N7MA 2B45X 4GJYA 2CNAA 4JAAA 3T0DA 3SKJE 4AEDC 3F95A 3CZJA 5C33A 3HOBA 3RFRA 4K1YA 2YC2A 3I54A 4ISRA 4AK3A 1J59A 4UFHA 4XVHA 2A73B 2IVJA 1FAYA 1UQXA 4N53B 1BEV2 2WNVB 4JV4A 2AGSA 4CCLA 4Q27A 3VB9A 3W58A 1UMHA 2RS52 2ZZJA 4NR1A 4NUBA 2B8MA 5FQ0A 1NLRA 1N47A 5FZ8A 3RI9A 1S2BA 2VCMA 3NJYA 4KQ7A 5LW9A 3ZN4A 2JDNA 4H55A 4LBMA 1GV9A 5IK7A 2CV6A 4OLLA 3SH4A 1IS3A 2D6NA 4TYSA 3GCXA 1HV1A 4Y1ZA 1RHI2 4WVMB 3D5OA 2WO1A 1VAKA 4OULA 3HQRA 4Y5Z0 3ACHA 2VZSA 3O14A 4RHV3 2VTXA 2QBXA 4PQ9A 1WA6X 1OA3A 1WW7A 2W1QA 5L73A 2XJTA 4QPIB 4W65A 2JX9A 4K40A 4KU7A 1AR92 2WNOA 2VW1A 3TRSB 1AR61 4QAWA 1C8M3 3M2MA 4LITA 1QJU3 1AR71 1FPN3 3DUIA 4DRVA 1GUIA 1BVVA 1QH7A 1VIWB 2UURA 4NMIA 3BPZA 1E5RA 3WP3A 5KC5A 1IKQA 3VZOA 3V0BA 2W1UA 3JB4C 2D6MA 2GH8A 2AEZA 1SCSA 3AL6A 2OQ7A 4AFDA 2XJRA 3GXUA 5EYXA 3T30A 5LRRA 5JPMB 1CZTA 1LHUA 1XE7A 3IB3A 4CXYA 1IQDC 3ECQA 5IW0A 3RYKA 2W39A 5F5CA 2VNVA 4IXLA 5KWRA 1B35B 5DUWA 1GR3A 4YLZA 3U1XA 4COYA 5F5AA 4EWEA 4S2FA 3JZVA 4P9XA 2MEV1 3VBRC 2W2IA 1YCIA 2WT0A 1VB4A 1NQJA 3H8XA 1PVC2 3J7LA 1UXXX 4MGKE 1GSLA 1UMIA 2V5DA 4LKEA 3VBFA 5A6XA 1K5MB 4DRRA 1PO23 2VECA 5DDJ3 4AI3A 2EF6A 3ZFFB 5BYNA 1YJLA 5FO8B 1V6KA 2Y6KA 5G04L 2PA7A 2GZWA 5FY7A 1RUNA 3CQOA 2R063 5FYTA 4V1PA 5DQ0A 3WG4A 1NA1A 1W8HA 2QNKA 2ATFA 2UY9A 4BLIA 1J3RA 1QEXA 1UCXA 1L7QA 2FDIA 1W6NB 2EXJA 5EP9A 3ZPOA 1JTZX 3EJKA 1S0EA 4A45A 2PQQA 1OFSA 5CEHA 3EYPA 2AYHA 1Q5OA 1UYPA 1TMF2 4B4QA 4E2GA 1PMHX 2RDQA 2CGOA 1HRI2 3HNYM 1JYWA 1UU6A 5FMCA 3ZFGA 2Y0OA 1D7PM 1APNA 1CAVB 3MUY1 5FPVA 4AEJA 1VP6A 4QB6A 4CU8A 1FMD2 4YG6A 3J7NA 2YC0A 3Q8BA 4L9BA 1CVNA 3VDBA 3WQBA 2D6OX 1ZZ9A 2VH9A 3BU7A 4LORA 1PO12 1S1AA 1LOGA 1IKPA 4FFGA 1ASJ2 3VD3A 4QX3A 1TZOA 4DB5A 2YHJA 3C7HA 1AX2A 2GN3A 4FPJA 4XTPA 4MXVA 3GCWA 4I3PA 1ZYBA 1HN0A 1JYCA 2O0OA 5LEJA 1LOFC 2XL9A 4R9BA 3WHUA 3M7AA 4KWUA 4A3ZA 4N9HA 1V9U1 2HH9A 4Q4V1 2RM22 1HV0A 2WABA 1Y43B 3GZUC 4CCOA 1RUD2 3VHPA 5I8SA 3VLBB 2VZRA 3J7MA 1WW4A 1AUYA 1RUH1 2E26A 1SPPB 4N43B 4ES9A 5BNPC 3D4KA 3JU9A 2ZGPA 2VOVA 4JGZA 3UL2A 2DCJA 5EJ3A 1OLRA 2C0ZA 1EAH3 5KXEA 4GULA 4D94A 5DUVA 5JXGA 1QOSA 2JDAA 2Y6LA 3VBSA 2QFEA 4WBBA 3WP5A 5DABA 3W21A 4CEWB 5C3RA 1BJQA 2HWB2 2C1FA 1OKOA 5DG2A 3NNFA 2FBEA 1YQ2A 3A7QA 3T08A 2R072 2UYAA 3D6EA 3POBA 3AKPA 1WLCA 4P02B 1FV3A 2HWE3 4YZ4A 2I74A 4KGGA 3ZPYA 1Z7S1 2DYCA 3CO2A 3MIBA 4B7EA 3JBG2 4M4RA 1OOPC 5LEKA 1WA4A 3DN7A 2PLV1 1ZZBA 3MUZ1 3DPRA 4QX2A 2W68A 4LLOA 2ZOEB 1YI9A 5FKBA 1MQTB 1QJEA 4NIAA 4RQPB 1MZFA 1QDCA 3RG0A 1G8WA 5C8CC 1F15A 1DYKA 3H42B 1FT9A 1C8NA 3RWKX 1VMFA 4ATEA 3P3PA 1UX7A 2RVAA 3RNSA 2N7GA 3C7GA 3LDKA 3PJQA 4LK7A 4NHLA 1W2NA 3WNKA 5IVCA 5CFDA 4J1WA 1VAMA 2BW8A 2P3JA 1HQLA 1QU0A 4RR3A 3WZ1A 3APBA 3HQXA 5HXMA 4FI9A 3GM8A 2ADEA 5T50A 1O3TA 3OGJA 4BMBA 4GD4A 3PVOA 3RZMA 2IFRA 1VBE3 4I0WB 4BJ0A 5F3IA 2ZAHA 4D69A 3ZIWA 1ODNA 4JTNA 4YGEA 1HX6A 4BLJA 1VE0A 2E53A 3WUCA 2XPJA 3G6JB 3QLQA 2GDFA 4E2QA 1AX1A 4IV3B 2PTMA 4J6GA 4S2HA 2W3JA 5FZMA 3ZIXA 1JOPA 4YVWA 1A8MA 5FUNA 5HBAA 1JYIA 4BQ5A 3I49A 1BK0A 5C5UA 1FV2A 2B42B 2XJVA 1TG7A 4DEQA 4ZXEA 4MUVA 3VBUA 2J42A 4PDWA 1Y9GA 3AMQA 1W04A 4IEVA 4PLNA 2R32A 2WZEA 4LEJA 3I3BA 4XHBA 2PHDA 1CGPA 1HXS1 3OBRA 3CJXA 4LHSA 2RS32 1D4VB 1AL0G 1UOGA 5A3LA 2XR4A 4AVBA 2D6LX 4B1MA 3B5LB 3WCSA 2WQZC 2BFUS 4Q4W3 1W9FA 4SLIA 3FLRA 4O9EA 2BERA 4OI1A 1W9YA 4ZZ5A 5JOWA 1O59A 2IXCA 1KDKA 2JD4A 1OSGA 2V4AA 4IV1B 1SHWB 4RD7A 1PM4A 3J8F3 3KSCA 4R52A 2DURA 3WQ0A 4UFIA 4YVSC 4JC1A 3HR9A 4GB32 1UY3A 2VW0A 4FPOB 3LQCA 4IE5A 4IDZA 5E89A 5FY9A 4GMP3 5GKAC 1X7NA 1H9WA 1UY4A 4IEWA 4Y22A 3Q8FA 4K7JA 1Z0HA 4DXTA 1J1TA 1LHNA 1GP5A 3TN92 3ZYBA 4PHZA 1WMDA 4GH4C 4AHXA 5BNOB 5FDBA 2WFF1 1VBA3 1I6XA 4WM7A 1W03A 5ABJC 2IXHA 3I59B 3L2HA 1CWPA 1I5PA 1GNHA 4BQYA 5F5IA 4XDPA 2KM2A 1N1VA 2VL4A 4OUEA 1GU3A 3AZZA 5FAXA 2RMU2 3E5QA 1O3RA 4ZU5A 3PIJA 5IFTA 3TNPB 4E27A 4DY5A 2WIIB 5I0SA 1H8TB 4Z07A 4QDSA 1RMU2 3R4DB 4N53A 1DZTA 5C4WC 2VULA 4HXCA 1RUI1 5GZDA 3ABZA 1KEXA 4BOWA 1C4RA 1WCSA 4NJ4A 4AXOA 2BOIA 5CNAA 5FXXA 4QHZA 1W9SA 1BEV3 1WWYA 2D43A 1F5FA 4Y1YA 2WR9A 2VBDA 4AFCA 1D4M2 3UJQA 1X9PA 4W6XA 2RS53 1QIQA 2VGDA 4AL9A 4CCMA 1WD4A 4WVMA 5JSOA 1FI2A 3NAPC 4L92A 1ZZCA 1XNTA 1HJFA 2E7QA 1PIV2 4PLOA 4IEUA 2R0HA 1O4TA 4U36A 4ET7A 5ACA2 5HPOA 1DQ5A 3I3EA 4EN6B 1JZ6A 3WCRA 3K51A 4D7TA 3THTA 3W5MA 4CDQC 1GWMA 4UW4A 4XFIA 2PAEA 4JZRA 4WZFA 5G05L 2VBPA 4IEYA 2UU8A 2VAUA 2VVDA 4XQ4A 3HAGA 4Z92B 4L97A 1GP6A 1BXHA 5A3TA 1YI7A 2YPDA 3C3VA 3VKMA 3SLIA 3AK0A 2VMIA 4CEYC 5KHKA 4QT6A 3RPQA 3RI8A 2HKXA 3LAGA 2VZOA 2W94A 1VBC1 2DCZA 2QUOA 2VNOA 3KCXA 1N1SA 4IGQA 3OYWB 4BQ4A 4CCCA 5CYYA 5J09A 5FXWA 2CY6A 2YU2A 4FCAA 4NAMA 1DQ4A 1LHVA 3SC7X 1UD1A 1N3QA 4AQSA 4IGOA 1B35A 4NAOA 5LA2A 2Q30A 1J3PA 1EY2A 3W20A 1JYNA 5J48A 2WDBA 4FQZA 1COV3 3OCPA 2ZPXA 4B4PA 5J36A 1X82A 3THCA 4EROA 2H6CA 4MGSA 4X6QB 5JLVA 2BWCA 1MR5A 4F8AA 1K5MA 1WLDA 3ZFFA 4BE3A 2RR11 3ATGA 1PZ8A 3CF6E 3QOPA 3NWKA 1NG0A 4FP2A 4JRAA 1V6OA 4QM8A 1WBLA 1ACCA 4LPLA 1J84A 4WM8C 4XJZA 1JW6A 1W6NA 5CKQA 2ZMNA 1LRHA 1W99A 1F8VA 1OHFA 1QNYA 5GLVA 1NAEA 4NWWA 4CUCA 1SMVA 3UV9A 2DVDA 2D3SA 4AVTA 3FWEA 2DU0A 3VKFC 2J1TA 3B9IA 4QX7A 4XYXA 4RHV2 5HV4A 2CYFA 1CD3G 3P3NA 5D8AB 3O1OA 2ADDA 1CAVA 1JS9A 2OX0A 4BB3A 4CZSA 3FUQA 4PI2A 1UPSA 5CZKA 2GMMA 2J1UA 3WNOA 2JG9C 2NMOA 3MPBA 4OHVA 1MS8A 1RUE1 2ZHNA 3LPGA 4JDNA 4FOYA 1F31A 4K20A 1QJY2 4O9GA 1HRI3 3IIIA 4HOOA 1VBD3 4CU6A 5I8YA 3NJZA 5FYSA 4QHOA 5CB7A 3NV2A 4HN0A 4C1WA 4QU2A 4XEZA 2D93A 4XCAA 4OQ9A 3NKTA 5C9AC 1OBNA 4FBFA 3ZYJB 2E31A 3OEBA 4HSLA 1PO13 1V6IA 2Y64A 2HWD1 4LTAA 1JI6A 1J58A 4QXHA 4IUGA 3SXWA 2VD7A 3C7FA 2VVFA 3AKTA 5FOBB 5CG9A 1PK6C 2ZXQA 4HONA 3DKWA 4KWKA 4QB2A 3U14A 5A3PA 5SV5A 4V2WA 2UY8A 4MXWB 3WF3A 3RMXA 4PCRA 1EV13 5DAXA 2ZKLA 1Y9QA 2VUCA 2VQTA 3BYWA 5JOYA 1SPPA 4N43A 5EIYB 2YDEA 3TAYA 1LKNA 1W6QB 3BKZA 1ALYA 2HWF1 2V4VA 4MH0E 1WBFA 5CG8A 2OS2A 2Q0AA 1DGLA 5A1FA 2JB4A 3BB6A 1PO22 3O7OA 4YPJA 5DDJ2 5JVVA 1RHI1 3WF4A 2JIJA 1U5IA 5F39A 2R062 5A7WA 1BMV2 5CKMA 1GKBA 3T3YA 2C9KA 3WG1A 3ZMOA 4CDUB 1OQEA 2Y8KA 4H7LA 3AM2A 4I2OA 3JD72 4OQ8A 1JZ3A 1OT5A 3FN9A 4DQAA 1Y7BA 4AI0A 3PUAA 3IMMA 3WNPA 3ZYGA 4BXFA 1AR91 2QCSB 5H9PA 1XPWA 3FC0A 5F2SA 4TXWA 1P8JA 4XILA 2JICA 5FFOC 2VZPA 4CUGA 2QVSB 2XJUA 3GBWA 2HWB3 2PXJA 4A7ZA 1KXGA 1POV3 2R073 3DV8A 1E57A 3MW3A 1V6JA 4W6YA 4CA9A 1S2KA 2XWJB 3KT7A 2R042 4XJWA 1MQTA 5JI7A 3H7JA 4RQPA 3VN4A 1FXZA 1SQ4A 1YQ5A 2JECA 3E1F1 3KS7A 1W2TA 1QQP2 3FUOA 3HMYA 4ZY9A 3O0VA 2KD7A 5FYCA 2XQRA 1KFUL 2CU5A 2FHRA 3ZX7A 4AF9A 5HCHA 3GJBA 5K0UC 2ID4A 4MX3A 5FZOB 4DOUA 2JJ6A 2JG8B 1R091 4BPZA 3N4MA 4LBQB 1JXNA 3ON7A 5IVYA 1A78A 4MHUA 1ZA4A 4UW6A 3URFA 5FPLA 3AKRA 1PZ9A 3GZAA 4CU9A 2D98A 4AYUA 4EN8B 3THDA 1EUUA 4AZZA 1PVXA 1K5JA 4FPHA 5AC91 2ZTNA 4RFT0 1YFYA 1O8PA 4U2AA 3LGRA 2W1SA 1HB2A 2LTNA 5CISA 5IVVA 1ZBE1 4IV3A 1W8UA 3H1WA 1EAH2 3CNAA 3E5XA 4V2VA 2GH2A 1IPJA 1VRBA 5A32B 2LALA 2QKDA 1TMF1 2VMEA 3RYPA 2HJIA 4DO0A 1AL22 2SLIA 1Q3EA 2Z4FA 3A21A 2WQ8A 5LBBA 5FR3A 5FMBA 2DVFA 3RZJA 3U07A 4NHKA 5LBCA 1H2NA 1H6XA 5HV0A 1RB8G 1FMD1 5KHIA 1WKYA 3PJYA 2BJSA 1FX5A 4DUXA 1VR3A 2YY1A 4LBNA 5DAWA 2J1VA 3MW2A 1VRH1 4LKDA 5I0UA 2EICA 4FOWA 3WDXA 1DG6A 1QXPA 2HWC1 3U10A 5LY2A 5D1IA 1VBB1 2GSYA 2QQOA 4IV1A 4BHPA 1HKDA 4IETA 1DZRA 2VY0A 2RS33 4AWDA 4PIXA 2NYYA 4YW6A 1SDWA 2RG4A 2A7AA 1SZBA 4UFMA 3V64A 2B39A 4R4XA 3DEMA 1L3JA 2IUWA 4M0NA 3ZOIA 1QHDA 1YXWA 3SMHA 1IZ3A 4OHYA 3BOWA 1RUD1 5BNOA 2C9AA 4GB33 5J37A 4MSVA 2EIBA 3I59A 5BPXA 1TQ5A 3VBOB 3ZO0B 3GBFA 4LMFA 3O1VA 4GJZA 1VBE2 1GFF2 4BM8A 1W06A 3RWNA 3SH5A 2XJQA 4Q5OA 4QM9A 4EN0A 1GZWB 4BQXA 1EPWA 3S30A 4AVVA 4LE4A 3C7OA 5LY1A 2ZX2A 1CR7A 1DFQA 2WS92 5AVPA 4ZS2A 1RUC1 3AVSA 4UBHA 2RMU3 2EIDA 3ZKUA 2QZ2A 1JU3A 1OQDA 1UO9A 2BNMA 4QX1A 3LIHA 2CGPA 3EB7A 4LBKA 4XFAA 3GZTB 5A7PA 4YFZA 1RMU3 4YM2A 2WQ4A 3IDBB 4INDA 1LULA 5CAZA 1WW5A 3TB0A 2QQKA 2ZGOA 3I97A 3LA3A 5IUQA 4C0HA 1UWWA 1W6MB 2ET7A 1SFPA 2DDUA 4AI9A 2ZHMA 3J7HA 1KS4A 2BVVA 4IEOA 2WUHA 1GZCA 4MYEA 2DBIA 1D4M3 4QDQA 1H1IA 1AR63 2WNUB 4Q4W2 2IXKA 2WWJA 4IEZA 4UFKA 2VZQA 3ES1A 4BIFA 1EUTA 2H0BA 2Y6JA 5FZAA 5JXJA 2QQLA 4UOJA 5ISLA 5E88A 3WF0A 2BTVC 2EXHA 3H8OA 2W46A 1QJX1 1PIV3 3R6SA 1WCQA 3C7EA 1CAXB 4L99A 1YHFA 1LHWA 3A23A 3MBWA 2P1BA 3BALA 1CX4A 4NIDA 4HG6B 3ETQA 4LLFA 4XBLA 1UYXA 5FY8A 3VKLA 4IE4A 2LS6A 1VBA2 2IVIB 4NPMA 1IS4A 5H9QA 2AENA 1H2KA 3AMPA 3VBHC 4IW3A 3ZXGA 4YZ5A 2RS11 5FKCA 3VZKA 5L7OC 4CU7A 3OYWA 5GZEA 4ARYA 1TME3 3UESA 3QBQA 2OXBA 2KR2A 3HD8B 1ZRCA 3OD4A 3V65A 2VBBA 2FMDA 4OI2A 1GQPA 3PMEA 4AE2A 1OUSA 1CPMA 4LO4B 4W8JA 1PHMA 1IHMA 3EQEA 4W4ZA 4I0BA 3AP7A 2GMPA 3CEWA 3KV6A 4Q0UA 2PELA 5CU1A 3T0AA 5CBLA 5LCWL 4AHYA 4KGQA 2CHHA 3IDAA 4YZ1A 2R16A 2VOWA 3WD5A 5L36A 4TWTA 1ZBA1 4B4RA 1ENSA 2ZAAA 3MIHA 3LSEA 4NRPA 1KS5A 1F2NA 3NVCA 4FFIA 5T5LA 2Y6GA 3SKVA 2AH2A 5IVEA 1DYOA 2QQWA 2Z69A 4QHBA 5F7UA 4Y1UA 3GF6A 2XJPA 4ARXA 4JHZA 2ZMKA 3AYCA 3U75A 4EZHA 1NYWA 4CDWB 2NLRA 5T55A 3VL8A 2E9QA 1LCLA 2NMNA 3WDTA 4CCDA 5D8AA 1L7LA 2WKKA 5K8SA 4MO3M 1W9WA 1RYYA 2XKOA 2OPKA 1OURA 4XUOA 1ND3C 2ETEA 2C24A 3AZWA 3OD0A 4YYOA 4Y3OA 5GLTA 1V6MA 4RFRB 5FPZA 4CUAA 2DUPA 1AYM1 2D6PA 3M3EA 4O65A 1LNSA 1HLCA 2B4KA 3KV5A 5FZ7A 2CL2A 4GWNA 2FZ1A 2A70A 1V9U3 1QJY3 4Q4V3 2YFUA 5JMOA 4MGYE 5LK7B 2VCBA 5K4LA 2BP6A 3WW3A 1OC1A 5FCCA 2GP5A 4OI4A 2WZR2 3ZXAC 1W28A 1NCQC 1V70A 1DF0A 1MS5A 3K75B 4FOVA 4FXKB 4MXWA 4A7KA 4XFGA 1JUIA 4UAPA 4MGQA 3FZ3A 4UT5A 4Y1XA 4URTA 5EWSA 3GBGA 1COV2 1W2UA 4AFBA 1RINA 1MS4A 1W6QA 4CP2A 4IE0A 2J7MA 3VDDC 5KXDA 2GNDA 3NW4A 3PURA 1UOBA 3HIFA 5F1RA 1D0GA 3OUHA 4ZU4A 4DUVA 1G86A 5C9AB 1XNCA 4QKBA 2ERFA 1LODA 2PHTA 1FOD1 4S2GA 3WP4A 1HB4A 1US2A 4UYBA 4A44A 3ZYIB 4CDUA 1AJOA 3CJIB 3DGTA 2OVUA 3THPA 2E32A 4RL7A 4FAHA 1G9CA 3WNMA 2WWUA 1HRV2 1TVGA 4XJAA 4BYYA 1STMA 1YWKA 2Q1ZB 1ZA7A 1G6NA 3MV11 3H1MA 1R64A 1OA4A 3POFA 1UU5A 4DZGA 4YFWA 1GWLA 3ZFEB 2WNEA 3TBDA 2ZX0A 3JD73 1PZ7A 3BTZA 5BNPA 5A7NA 5FPUA 1ENQA 2LUWA 4LE3A 1Q8PA 3GHNA 5APAA 3TEZA 1UIKA 1LTEA 2WLPA 1GOGA 3OPWA 5KXCA 5I8TA 1AYN1 1UZZA 4JRLA 1JUHA 1VBD2 1JHJA 4LIVA 3ELNA 3ZXJA 3KHBA 3LF7A 2QQMA 3N35A 4XUQA 5FZKA 5GZCA 1NXMA 3KGLA 2R043 5FZOA 5FJKA 3CLPA 2E7TA 4YW4A 2DVAA 1QQP3 2ES3A 2JG8A 3IZOA 4OUSA 1PGW2 3POIA 4N7UA 1AR82 3M1HA 3KV4A 3OOXA 4LBQA 5FZ6A 3WNNA 3AXEA 1W8TA 1BBT1 1XRUA 3KQRA 1OOPA 2DTYA 1CN1A 1CZVA 4P9YA 2BV4A 1O5UA 3O12A 4H7MA 3AP9A 5JCTA 3KV9A 4N90A 1CONA 5BUVA 1EV12 3HEIA 3N7JA 2VUJA 3ZSJA 5CFCB 1UOFA 1XNDA 5FBJA 5C8CA 4M3CF 3ZLIA 1MACA 4FTSA 1J83A 4ASKA 5BNNB 5A7OA 2I07B 4BQ3A 5C70A 2Z42A 4R4ZA 3I2OA 3CL1A 5L9BA 2Y0IA 1AF9A 4GALA 5FMOL 4ZU7A 2JB8A 2W52A 5A32A 3U78A 3AX4A 1Q56A 4KH9A 3KHCA 4OUMA 4XF3A 5B2GB 5HCFA 5A3OA 4HVQA 5A3MA 1ZREA 4RHV1 3SEEA 1JYTA 1LR5A 2J1AA 1XU2A 2VPVA 3LD8A 3NJXA 4C0BA 5DZGA 3SEPA 3NNMA 2GMEA 5IK5A 5A7WB 1RJ8A 3VBFC 1BK1A 2ZS6B 1AL23 1C8M1 1H4GA 1ND2B 2FZ2A 2CDPA 2G4IA 3BCWA 1QJU1 1FPN1 3GNEA 3NO8A 1NA1C 4K9SA 1R081 4KG8A 3VGIA 3WQ7A 1DQ0A 1E5IA 2W95A 4JQRA 1UNBA 2WL1A 1U12A 3MIFA 3RZGA 1RXFA 3L2YA 3MF9A 2HEWF 3O1PA 3UKVA 4EV0A 1E5SA 3LFIA 4HLTA 3ZFGC 5FZFA 3H8UA 4N7IA 2ORZA 5C7GA 3O1MA 4Y33A 3RVHA 4TLGA 2XQXA 3T0BA 4Q1PA 1YQ6A 3T2TA 2L9LA 3VBOA 4QX8A 5FRAA 3A0NA 4PJYA 4K8FA 2BQPA 1LGBA 2JE7A 3FE5A 3KF5A 2Q8DA 4K8RB 1XYNA 1LU2A 2R1BA 2IXLA 3K77A 2D6KA 1GOHA 3N9OA 3POJA 4NN0A 2VOTA 1GZWA 2DF7A 2X8KA 2TBVA 1J3QA 4OYUA 3ACGA 1URXA 4GAZA 3K2OA 4QGLA 1VAVA 3CHXA 4EWDA 1Y3TA 1TE1B 2JDZA 5EZWA 3KGZA 2CSGA 1DQ6A 3KMHA 1VLNA 4R9DA 4KG0A 3FMGA 3WNLA 1RVF2 4CPBA 5JSPA 2YFZA 3KB5A 4FXGB 2YROA 1H30A 3B93A 4RGGA 3UGFA 1MEC1 2D97A 1W8FA 2VQ0A 2WS93 1M06G 3GHMA 4NOTA 3QCWA 4XAEA 5JZGB 5F8PA 1JH5A 4JGZC 2XUMA 1YQ8A 4JGYB 4LO8A 3GGLA 4AGVA 4CP9B 1W6MA 2ORXA 4CE8A 3I7DA 4EQVA 5C71A 2HBTA 2XVGA 2ZA9A 4UW5A 1YIPA 4HBNA 3VBSC 4CDXB 1PX4A 4CXWA 3BPSA 2FCVA 4AVSA 2D7FA 4ONUA 5IAVA 3LOBA 2WNUA 5FIXA 5A6QA 2YV8A 4WV8A 4Y5SA 2RE9A 1VALA 1WMXA 4JCKA 1K42A 1RUJ2 3BIWE 4QPGC 4YWAA 1IPSA 4R8HA 1XNBA 5FYZA 3O0XA 1XBFA 4UBGA 2LM3A 3AKQA 3C2UA 5FYHA 2FCUA 1LOAA 1GQGA 3MF6A 4Q1RA 1UW8A 1ULDA 3B69A 3HNBM 1FYUA 2K9ZA 4CTEA 1CAXA 1R1A2 4H14A 4PQQA 4Q4X1 4EZ4A 1ZX5A 3AYAA 1GOFA 1O4YA 2D5FA 3OY8B 3DPRC 3LIGA 4YG0A 5J96B 4LOSA 4XAAA 5EJZB 1DQ2A 3DYPA 4OFGA 4PI0A 3KLSA 3WX5A 1YNAA 4FFHA 4FPFA 1UZ0A 2D3RA 1RGSA 4IERA 5GALA 4RS5B 2Q8CA 3SQOA 3T4VA 3WUDA 5JWPA 5C3SA 4QGMA 4HL0A 5FP3A 5FYYA 5CFDC 5IHRA 5JI9A 5FZCA 2V5YA 4RR3C 2WINB 1YEWA 4CDQA 1AXYA 5ACA1 1AXKA 2ET1A 5FPAA 5I0TA 2FD8A 4LNVA 1C5HA 1NCRB 4A6SA 3NV4A 3POYA 4QQ2A 4XFHA 2E7AA 2X05A 4DS0A 1C1FA 4RN5A 3Q8CA 4XIOA 2HWE1 2QDNA 2XBO1 1NZCA 5IATA 2WAAA 4YM1A 3O1UA 1IOAA 4IE6A 2VG9A 5BNQA 2B9UA 4CRQA 4AOCA 3MLKA 3NMBA 3OEAA 3UKNA 2OW4A 4XMAA 1WLWA 1H2LA 3VBHB 2QTWB 1YQCA 1XNKA 1D2QA 1WCDJ 1OLME 1Z78A 2BEOA 3M8LA 3N9LA 4CYDA 3MDPA 4GKXA 4Q4Y1 3LE0A 1RITA 4NIIA 4AQ6A 4YVWC 5F3GA 5FZDA 1UY0A 4CDWA 4BXSV 1WZXA 2A3YA 1N3PA 5E6HA 1AR62 5JXIA 1LEDA 5AVAA 3VBUC 4PDWC 5IK8A 1W8NA 4AEDB 1QJZA 3LZZA 5I91A 3IIAA 1S0CA 3I2HA 2BPA2 4NHYA 1ONAA 2IWGB 2C5DA 2Y6HA 4O7XA 1UYZA 2HWD3 3OG2A 1VBE1 4WM8A 2YB7A 5LA1A 3IDEA 2BGCA 1PGL1 5DUUA 4LUMA 3GYDA 3ROUA 2P3IA 4XFBA 2A1XA 5FYIA 4Z2WA 5DUXA 4Z1VA 5JMCA 1NY71 4XBNA 3W5NA 4RGKA 2NN8A 1FNZA 1X33A 2OT7A 2YGLA 4LKSA 2EIGA 1TME2 2Q8EA 2DCKA 2PHRA 2MEV2 5KXBA 4UWDA 3N3HA 2BGPA 2HWF3 3PL0A 2RJKA 2VVEA 1O3SA 1HDKA 4Z82A 4AGGA 2BNNA 3A0KA 2FMYA 4JX0A 1X8EA 3A22A 2VZTA 4M0HA 5FUIA 2WZR3 3L9JT 3EHKA 1CAUB 3H0OA 4XJUA 2VXRA 2F6BA 5LA9A 1EP0A 3CKHA 3RGBA 4FPGA 2XONA 1H6YA 3POEA 5C9AA 1CIWA 4FSJA 2JENA 2RDRA 1VB2A 4LO7A 2BFUL 5DPNA 5FZ4A 4Y4YA 2FDKA 1Q43A 2RDNA 3CJIA 1R1ZA 2VQAA 3IDCB 1MZEA 4N53C 2WNVC 5IVFA 1W05A 2X5IC 3FLPA 3DKQA 3J8F1 4HFSA 3NNJA 3PUHA 4XETA 4NRMA 4OHXA 1XSRA 3ZXEA 2Q4SA 3WP6A 4BA6A 3JXSA 4FFFA 3ZFEA 4H3WA 4QB1A 2G19A 2XLAA 1VMHA 3WV6A 4GMP1 2BUKA 4XZUG 3I3QA 1HRV3 5JOZA 5SV8A 2Y33A 5GZFA 2IFWA 5CKNA 1RTVA 1RUG1 2JE9A 1RC6A 4LULA 4QX0A 1VBA1 1ENRA 3MFAA 5FZ0A 4KI5M 4EJRA 3DXTA 3WSOA 1UY1A 3WEZA 3VBRB 5HCAA 1HQNA 5A3NA 3D82A 3BTAA 3WG2A 5BY5A 4FT8A 2YZ4A 1YLLA 2XVLA 1V9U2 4QPIC 1O6UA 4Q4V2 5IVJA 1XB9A 1YO8A 4JKKA 4L0PA 1DYPA 4IL7A 4AFAA 2DBNA 4WVVA 5FLHA 2ZEWA 4D0QA 3TYJA 1ZNPA 3NJVA 3PDQA 5H9SA 4XURA 5AC93 2RDSA 1RUH2 3KF3A 4A3XA 5C3PA 4QQLA 2VOXA 1C28A 2F17A 4CP0A 3FHQA 3IN9A 1XE0A 3PNAA 1ULPA 1AR83 2EAAA 4I3GA 2AC1A 3W9AA 5CFCA 2YU1A 1BEV1 1RUF3 4EE2A 4JDMA 5FZLA 5BNNA 4ORFA 2RS51 4MGIE 2WYSA 4Y20B 3SCHA 1XE8A 1UU4A 4RYDA 2ILMA 1Q8SA 2XMLA 4XPVA 4YW3A 2BRTA 1DZQA 3MO4A 1LB2A 2GNMA 3M3CA 3E6DA 4AI1A 2HYXA 1B35C 3N9MA 4Y26A 2W47A 5EHDA 1Z7S2 2R49A 1JZ5A 3RRDA 2OA2A 1O4ZA 1VRH3 5FPBA 2GN7A 2JDPA 2JWPA 5K7PA 2PLV2 3PVBB 1UXZA 2VTFA 3T2OA 1K5MC 4XZPA 3ZFFC 1ND2A 3H3LA 4K3UA 3AFGA 2G9ZA 3K48A 4MZUA 4XQWA 2H0VA 1LHOA 3AC0A 4DXRA 2VMDA 3P6BA 2PMWB 4P14A 3ZXLA 4GZ9A 4LBOA 2GNBA 1OVSA 4AAPA 1DGWX 4Y5TA 2ARAA 2WSUA 3U37A 2E6VA 1GP4A 4MGZE 1QY4A 1CESA 5IT6A 3S0MA 4FPEA 5ANQA 3KQ4B 1S0GA 5FLIA 3ZXKA 5EJ1B 4NWVA 2BWAA 2DFCA 1ODMA 1MS1A 1YC61 5GJ6A 5BNPB 4NIHA 5DZEA 4I0AA 1JBCA 4JHTA 2VW2A 2E63A 2PN5A 1GQHA 4P9IA 5A6YA 2EIEA 1BYHA 1OLMA 3H8RA 5FREA 1V6NA 2P6CA 2PQSA 3NV1A 3JB8A 2A75A 1S55A 5FZIA 1DLLA 3GDBA 4NVPA 3EMRA 1AZDA 1Q8VA 4OVEA 3UJOA 1OF3A 4M3CB 4XUNA 3AL5A 5FY0A 3Q9OA 2DUQA 3PVEA 1H1MA 4AHZA 2I45A 2VNGA 4RA0A 3WF2A 3F2ZA 3RZZA 4PIYA 1ULEA 2XUEA 1OOPB 2G1MA 1TEIA 4FPYA
chains in the Genus database with same CATH topology
2CGNA 1PNGA 3R0RA 2O1QA 1OFNA 3NL1A 4KWJA 3PTYA 1ZVFA 5C8CB 1AX0A 5FTTC 1ENXA 1HXS2 4AVCA 2ZGLA 2OZ6A 2P34A 4N43C 2XVKA 5JZGA 3ST7A 1RVF3 4JGYA 3R05A 3MYXA 1HRI1 4CDXA 2B46X 4Z8BA 2GC3A 4E9KA 1G9FA 4CEWC 2XKPA 1BZWA 4Q2FA 3I4IA 4FTEA 2G9FA 1PO11 4QMAA 4COZA 3D0JA 1ASJ1 1B09A 3KCCA 4Q0QA 2VMHA 1O7FA 2UWCA 1RUJ3 1YYNA 3OY8A 5EV7A 3SISA 2OIIA 1HQWA 1MQTC 1C5IA 3H3ZA 4RQPC 1A6CA 4ATFA 1U5YA 5JPNB 2WA3A 1LECA 1KD7A 1R1A3 3AYEA 2RM21 3WDWA 5A33B 4P9LA 3QACA 4RS5A 3R4SA 3WHTA 1WMEA 2VU9A 4HN1A 4QQPA 1KQRA 1VJ2A 3SHRA 1DHKB 4A2UA 1RUI2 3AZVA 3AXDA 4E4ZA 1QOTA 1ZBA3 1NCRA 3IWZA 4XF1A 3ILFA 1U5XA 2F4PA 4C90A 1UIJA 1SBEA 3PMSA 4YVSB 1QH6A 4ASMB 2CTVA 2HWB1 3WR0A 3SITA 3VBHA 1POV1 2R071 3CU7A 4XF0A 1REFA 3EXUA 5EYYA 4IV3C 1AJKA 5FPXA 4GH4B 1NXD1 3FLTA 1O91A 1SLTA 3VV1A 3JBG1 5ABJB 1WD3A 5GM0A 4AQTA 4M3CE 3AFKA 3KM5A 4AI2A 4JTOA 5CA6A 1AYM3 1D0HA 3OBTA 4AEDA 3ZSEA 4G3YC 1LOCA 2BNOA 4HT1T 4HVOA 4FPCA 4AVAA 2ENRA 2R0FA 3INAA 4UXAA 4IEQA 2YGMA 1GBGA 5C4WB 4D7SA 5J98B 1AR73 4K21A 3M3QA 3USUB 1VBC2 1KJLA 1GICA 2H6BA 5BV6A 1WUVA 3MW4A 4IV1C 5JIUA 4BMEA 1H1AA 3EO6A 2WA4A 3MPPG 1I5ZA 4D3WA 3UK9A 3M3IA 4QXKA 1YJKA 2GC2A 4YGDA 1G9DA 1TNRA 1ND3A 2YMZA 2DFBA 3NAPB 5LRSA 2ZZQA 4YW5A 5BNOC 2RHPA 1UMZA 2RR12 3O0WA 3ILRA 1CAUA 2MEV3 1FOD3 4LO6B 1W0OA 3RQ0A 4IEPA 3ZN5A 4CDQB 3E5UA 2CAUA 3H7YA 3B00A 1MS9A 1X36A 1H8TC 2PYTA 5F6LB 2E51A 3MI8A 4I02A 1OMIA 4FO9A 4LBLA 2GAUA 4B3NA 3LKJA 3GALA 2D5HA 1BKZA 4HKLA 4PLMA 4R9AA 5FBZA 2AREA 5KC6A 2RS31 4CEYB 2YUEA 2IXIA 2A6YA 3QH6A 5CVRA 4NHMA 3JUUA 4SBVA 2Q5TA 1ZRDA 1UKRA 1SLLA 2EVXA 2P17A 3VDDA 4L2NA 1QGLA 4GB31 1GYKA 3MIGA 1PVC1 2FQPA 3VBRA 1WCKA 2HWD2 4P9WA 2DTWA 3LSDA 3TN91 1A3KA 1YRZA 2Q1MA 3DL3A 5J3UA 1BBT3 2X5IB 3VHRA 3WNXA 4XJ8A 4Q0VA 4WM8B 3VHOA 3AP5A 1SACA 3J26N 3MICA 4JVAA 3ZXDA 1QXJA 4BWOA 2UYBA 4W6WA 2O8OA 2RMU1 2XLFA 2HWF2 4L11A 2JXAA 3AMMA 3I2DA 5DZFA 1AXZA 2ZX3A 2B7YA 1RMU1 2KA3A 5FMOS 1RUH3 3UKTA 1SLAA 1LOBA 2JG9B 4Y20A 4ISQA 3NSTA 4E4DX 4M01A 4EN9B 5KHJA 1JOJA 4YM3A 2CWSA 3WW2A 4HANA 4QPYA 5I93A 1GNZA 1NOVA 5I0RA 2BYVE 1JHNA 1KJRA 1D4M1 1WMFA 4ZXKA 1MVQA 3WW1A 1ULFA 1R083 1DU3D 1LOFA 2WFPA 1W39A 3AZYA 5T5PA 1PIV1 5ACA1 1XYPA 1CQ9A 1Z7S3 3IT8A 5CIRA 1S0IA 1WLTA 4HZFA 1PK6B 2PHLA 4BCUA 4BZ4A 2PLV3 1M4WA 3KD4A 4IEXA 3R4UA 3OTFA 4HVRA 4X8NA 3ES4A 3MIDA 1R092 2A6VA 5F9TA 2EA7A 5D8AC 4XF9A 1TME1 4M00A 1D2SA 4OHWA 2ZKNA 3S6PA 3OPZA 1UZYA 3IPVA 3ZSLA 1QDOA 2Z79A 1I9RA 4BQ1A 5AC92 1DQ1A 5HXVA 3WOGA 3IMNA 4M3CA 1LJ7A 1ZBE2 4L8QA 2OUJA 3E6BA 1WGPA 3AP4A 1RUF2 1PGSA 2GC0A 2Y38A 1S0FA 3KZ4C 1ZZ8A 2NM1A 3FBYA 4MLOA 1MEC3 4BHPA 2EAKA 5JOXA 3AKSA 3N36A 4K1ZA 1F9KA 4OZXA 4JDOA 1ZRFA 1YFUA 3HWJA 2BVBA 2QQPA 2A71A 2XG3A 5AFEA 2MNGA 4UW3A 1NLSA 1T6GC 1WW6A 1VRH2 3ZVXA 4AI8A 2X53S 3HBZA 5K0UB 2CWMA 1XQNA 1G9AA 2HWC2 2Y26A 4YG3A 1VBB2 1HXS3 2ZX4A 3H1YA 3NKGA 1C1LA 2ZGQA 4CDUC 4X8PA 2O8QA 4ITCA 1QJY1 4Q4X3 1V6LA 2DCTA 5TSWA 2V73A 4XDQA 4Q8KA 4LUKA 3PHMA 4EN7B 3WY6A 4XFCA 3WVJA 2ZGRA 4AHWA 2A3XA 4AW7A 3FX3A 4K6BA 4XMIA 3VUOA 1YUDA 4XXPA 3T1MA 3V56A 2WFF3 2Z5WA 4I09A 1PMIA 5A33A 3B3QE 2YXSA 3V0AA 1RUC2 4DPNA 2R1DA 3QD6A 2WT2A 3M4FA 4QPGA 3A4UA 2JG8C 5HI0A 1OQ1A 3OGGA 2XBO3 3B94A 3FFZA 4RGAA 1PO21 2WWSA 1DIWA 3E97A 4LBQD 5DDJ1 4YRDA 1H8VA 2R061 1BMV1 4R9CA 1W6OA 4YVSA 1RUI3 4YW1A 3ZXFA 1OLQA 3VKNA 4Q4Y3 4Y1VA 3JD71 4COUA 3B02A 1LESA 4GQ7A 4XIKA 1ZM1A 2WSVA 4GH4A 4XE9A 5FOJB 1PNFA 5ABJA 2TNFA 5BXXA 2B5HA 5FO9B 5T52A 3H9AA 1XXNA 1QJX2 3MLJA 2R041 4FPLA 2ZACA 4D7YA 4Q0SA 2NP0A 2MHFA 4B29A 4KL1A 1QQP1 4XF4A 3RSJA 3WLUA 2ZBJA 4F7ZA 5C6CA 2ZGKA 4TSVA 2EALA 5C4WA 2G9GA 5E8AA 2RS12 3USUA 4LO5B 3WG3A 4HPKB 1X50A 3B7MA 4I01A 2PHUA 2GC1A 3USSA 1VBC3 1RJ7A 3LA7A 3AP6A 3NAPA 3ZMNA 1H4HA 2A6WA 1ZBA2 4P5HA 1EAH1 3N7LA 3VBOC 2DCYA 3O5SA 2A6ZA 4XQDA 3WDUA 1MZ5A 3LOIA 1ULGA 2DUOA 2PFWA 4MV2A 1AL21 1HIXA 4QD2A 2RR13 3HT2A 1UF2C 1IGOA 4S2DA 1LGNA 4WZCA 4YSFA 3U11A 2HYKA 3LB9A 3BOPA 3AB0A 3JCIA 5GLZA 4HETA 3ASIA 4CEYA 3RJRA 1H9PA 5FO7B 4YGCA 1RUG3 3ZDSA 1J1LA 4ZKTB 1MS0A 5L7OB 1I3HA 1AYM2 4FPKA 2TUNA 2JKBA 4KBBA 4Q29A 2QZ3A 1RUE3 2VMGA 1GZ9A 1NQDA 5HCBA 2AUYA 1GANA 2ZCWA 1AR72 1N3OA 5E1RA 5KHHA 2WNUC 5AFBA 1I1EA 2DU1A 2WNVA 4LR4A 3U4XA 2X5IA 2P37A 2X29A 4YW2A 4WVZA 4LHNA 4EWAA 3RYRA 1IS6A 2ZX1A 3SCGA 5JDBA 1IQAA 3IM0A 1QMJA 2QE3A 3QH7A 2YYOA 4PBOA 1DGWA 2DWRA 4YGBA 3AZXA 3WDVA 4GMP0 5JAXA 4HK9A 4C91A 2WS91 1FOD2 3ZN6B 2JG9A 1ND3B 1UAIA 3MEPA 4BH9A 4G4FA 4G9SB 4HK8A 1SLBA 1RHI3 4QPIA 5KHGA 2ZGTA 4WM7C 2OYZA 2ZHKA 1W6PB 4KNCA 4KU8A 1MZ6A 1XYOA 3KT1A 3H3UA 2P3KA 3FBMA 2ZHLA 4DINB 1ZZ7A 3ZSMA 1AR93 4XW3A 1AYN2 2UWAA 2ZGUA 3W59A 4Q4W1 1O5LA 4J1XA 1OPOA 2PAMA 4Q26A 1PK6A 1SEFA 1NCQB 4QX5A 5KBFA 1Q8OA 2SBAA 4B8EA 1REEA 4AEMA 4PIZA 1GLHA 4B7KA 1KRIA 1N1YA 1XU1A 4CDWC 2ARBA 1FATA 1G9BA 1CAWB 1KDMA 2XLGA 3VDDB 5T54A 5IK4A 1BBT2 1REDA 1SBFA 2R30A 2UWBA 3FFQA 1X8MA 4GKYA 3SCFA 1CJDA 1ZZ6A 2XGXA 1R093 3KT4A 1S0JA 2ZJCA 4AGRA 1DDLA 4COWA 1AHSA 4IESA 5FLJA 1ZRRA 4YZ2A 1HW5A 5DG1A 5EXOA 3AJZA 1PVC3 4XTMA 2K0GA 3RDIA 2WLQA 5FQ0B 1W0PA 1TNFA 1RL3A 4META 1FNYA 2HEVF 4FP3A 1SFNA 1YIFA 4AQ2A 3WDYA 1JN2P 3E6CC 1ZBE3 4LA3A 4COVA 1YFWA 4N9IA 1NE6A 3FJSA 4YM0A 3DF0A 2Q8OA 4PBPA 4F83A 3OF1A 1TMF3 1C8M2 4FTBA 2PHWA 1SLIA 2D3PA 5K0UA 1QJU2 1FPN2 4DFSA 3MGUA 1R082 2ZABA 4LT5A 2PHXA 1FMD3 4LBJA 4HSJA 1QNWA 3S7EA 5JR7B 3MFCA 4XJ9A 2HEYF 1ASJ3 3EBRA 1U0AA 2K2SA 3CJIC 2HWC3 1UN1A 4GWMA 1VBB3 3V0BB 1MS3A 3J9SA 2YPJA 2XHKA 4YARA 4TLFA 1V00A 3ZFEC 5E16A 2WJSA 3NV3A 3IBMA 3JQWA 1EPZA 1F5JA 2XH6A 3AYDA 2RM23 4PF5A 2DVGA 4DMIA 2TEPA 1LENA 3J4UH 4QQOA 1KITA 1SLCA 3HN1A 1RUD3 2NQYA 2WZR1 4Y24A 1RIRA 4AFMA 1UX6A 3VZLA 2IZWA 4CEWA 4P9GA 3VBFB 3IPVB 1RUOA 1SCRA 1COV1 3VZNA 4BIOA 3ALQA 1Q8QA 1NA1B 4E2SA 4IQPA 1MEC2 1LEMA 3MIEA 1RUC3 1NE4A 2GALA 1SFYA 4HKWA 5C8WA 5LK5A 4FVVA 2W08A 5CFCC 4HMZA 4C1XA 2XWBB 2XB6C 3ZFGB 1HRV1 1AVBA 3JBG3 3OJBA 4FAGA 5BNNC 5H9RA 1IS5A 1QXRA 4ES8A 2Z2SB 3PVNA 4YNIA 4DXZA 4DY3A 3TOJA 5JIAA 4FOQA 5GZGA 1PM7A 3MZHA 2D40A 3M3OA 5GLWA 3POWA 3TWIA 1MVEA 3S7IA 4XOGA 4AG4A 1S0DA 3U0ZA 1VBD1 4Q4X2 4X6RB 3G7DA 1SBDA 4CP1A 2V09A 1ND2C 2ZMLA 4XHXA 1QJX3 2RJLA 3AMHA 1DBNA 3SNMA 5L19A 4QGNA 3VKOA 4E4SA 4RSUA 3RS6A 5T5JA 3FHIB 3PLQA 1PGW1 4HPKA 1AR81 1BQPA 3POSA 1POV0 1BCXA 2P2KA 3B9CA 3WT3A 2WFF2 1OPMA 1EYBA 1RUF1 2OUHA 3HT1A 3B01A 4GXLA 3ZYRA 2WC2A 2RS13 4JGZB 3LA2A 3LWCA 3ILNA 1EV11 2IXJA 2XL7A 1QOOA 2ZGNA 5EFUA 4XXAA 2DV9A 2VOKA 2HWE2 2XBO2 3VBSB 2PAKA 1G7YA 1H2MA 2NZ9A 3ME2A 4QQHA 2D44A 3V0AB 2MPFA 4QPGB 2EXIA 1OD5A 3M70A 4OI0A 1ULCA 2EXKA 4Q4Y2 2IC1A 2QJVA 1S0BA 3X29B 1C57A 1LOEA 1OI6A 4LHLA 5F6KA 3DPRB 4Q0PA 1W6OB 2A6XA 4GIQA 1UPIA 4ASLA 1YFXA 2XJSA 4KWLA 1UL9A 3LCPA 3ENRA 2KXLA 3ZSKA 5L7OA 5JZGC 1O3QA 2DVBA 3IKWA 5CFDB 2I2SA 1QWRA 4JGYC 4HKOA 4P9JA 2R6QA 3TNQA 3WINE 2WT1A 4RR3B 3TN93 1PGL2 2QDRA 3KCYA 3WQ1A 2A5ZA 2BBVA 4CDXC 2AR6A 2ZGSA 2WZPP 2A3WA 2GNTA 1NY72 1H8TA 1BVP1 3D0SA 5CADA 2PHFA 1CJPA 1DGRN 3N7KA 2NPIA 3I8TA 3D8CA 1QF3A 1U5ZA 1A8DA 4MVTA 3RJ2X 3ZYPA 3SH3A 1LU1A 1DGRA 3WXPA 4I30A 4YVWB 5K9YA 3AMNA 4DNYA 3WW4A 1LGCA 4GA9A 4NO4A 1C3HA 3VBUB 3ZN6A 4PDWB 1UKGA 1RVF1 1KFXL 2ZGMA 3BODA 4RS5C 4TZDA 3MLLA 4XFFA 1CPNA 4AEKA 4LA2A 1OA2A 4F3JA 3J8F2 3VZJA 2JEMA 4XBQA 1QKQA 1W6PA 4A7YA 4NPRA 4OHZA 1NCRC 2AZ5A 5ACA3 4WVWA 1RUG2 3AJYA 2OZJA 2GU9A 1OKQA 3VL9A 1RUJ1 1NCQA 3RMYA 1N1TA 4Y22B 3T1LA 2VNRA 4LHKA 1RUE2 2CAVA 3ACLA 2W0XA 2VUAA 5DXDA 1AYN3 3VHNA 1H0BA 1IPKA 3JQXA 4WM7B 1R1A1 5T3NA 5T5OA 3VZMA 4Q8LA 4YZ3A 4FQ4A 5F5QA 1CAWA 5J7MA 3H50A 5GLUA 2ARXA 3N7MA 2B45X 4JAAA 2CNAA 4AEDC 5C33A 4K1YA 1J59A 3I54A 4ISRA 4AK3A 2A73B 1FAYA 4N53B 1BEV2 2WNVB 4JV4A 2AGSA 4Q27A 3W58A 2RS52 2ZZJA 4NR1A 2B8MA 5FQ0A 1NLRA 1N47A 3RI9A 1S2BA 4KQ7A 3ZN4A 4H55A 4LBMA 1GV9A 5IK7A 2CV6A 4OLLA 3SH4A 1IS3A 2D6NA 4TYSA 1HV1A 4Y1ZA 1RHI2 4WVMB 3D5OA 1VAKA 4OULA 4Y5Z0 3O14A 4RHV3 4PQ9A 1OA3A 1WW7A 5L73A 2XJTA 4QPIB 4W65A 2JX9A 4K40A 4KU7A 1AR92 2VW1A 3TRSB 1AR61 1C8M3 3M2MA 4DRVA 1QJU3 1AR71 1FPN3 3DUIA 1BVVA 1QH7A 1VIWB 2UURA 3BPZA 3WP3A 5KC5A 1IKQA 3VZOA 3V0BA 3JB4C 2D6MA 2GH8A 1SCSA 4AFDA 2XJRA 5EYXA 5LRRA 5JPMB 1LHUA 1XE7A 3ECQA 3RYKA 2W39A 4IXLA 5KWRA 1B35B 5DUWA 1GR3A 4YLZA 4COYA 4EWEA 4S2FA 3JZVA 4P9XA 2MEV1 3VBRC 1YCIA 2WT0A 1VB4A 1NQJA 1PVC2 4MGKE 1GSLA 3VBFA 1K5MB 4DRRA 1PO23 2VECA 5DDJ3 4AI3A 2EF6A 3ZFFB 5BYNA 1YJLA 5FO8B 1V6KA 5JSRA 1RUNA 2PA7A 2GZWA 2R063 3WG4A 4V1PA 1NA1A 4BLIA 2QNKA 2ATFA 2UY9A 1J3RA 1UCXA 1W6NB 2EXJA 1JTZX 3EJKA 1S0EA 2PQQA 1OFSA 2AYHA 1Q5OA 4B4QA 1TMF2 4E2GA 2CGOA 1HRI2 1UU6A 3ZFGA 2Y0OA 1APNA 1CAVB 4AEJA 1VP6A 1FMD2 4YG6A 2YC0A 4L9BA 1CVNA 2D6OX 1ZZ9A 2VH9A 3BU7A 1PO12 1S1AA 1LOGA 1IKPA 1ASJ2 4DB5A 2YHJA 1AX2A 2GN3A 4FPJA 4XTPA 4MXVA 4I3PA 1ZYBA 1JYCA 2O0OA 5LEJA 1LOFC 2XL9A 4R9BA 3WHUA 3M7AA 4N9HA 1V9U1 4Q4V1 2RM22 1HV0A 1Y43B 3GZUC 1RUD2 3VHPA 5I8SA 3VLBB 1WW4A 1AUYA 1RUH1 4N43B 4ES9A 5BNPC 3D4KA 3JU9A 2ZGPA 2VOVA 4JGZA 3UL2A 2DCJA 5EJ3A 1OLRA 2C0ZA 1EAH3 5KXEA 4GULA 4D94A 5DUVA 1QOSA 3VBSA 2QFEA 4WBBA 3WP5A 4CEWB 1BJQA 2HWB2 2C1FA 5DG2A 2FBEA 2R072 2UYAA 3D6EA 3AKPA 1WLCA 4YZ4A 1FV3A 2HWE3 2I74A 4KGGA 3ZPYA 1Z7S1 2DYCA 3CO2A 3MIBA 4B7EA 3JBG2 1OOPC 5LEKA 1WA4A 3DN7A 2PLV1 1ZZBA 3DPRA 2W68A 4LLOA 2ZOEB 1YI9A 1MQTB 4RQPB 1MZFA 1QDCA 3RG0A 1G8WA 5C8CC 1DYKA 1FT9A 1C8NA 4ATEA 3P3PA 3RNSA 2N7GA 3PJQA 4NHLA 5CFDA 4J1WA 1VAMA 2BW8A 2P3JA 1HQLA 1QU0A 4RR3A 3WZ1A 3APBA 3HQXA 5T50A 1O3TA 3OGJA 4BMBA 3PVOA 2IFRA 1VBE3 4I0WB 2ZAHA 4D69A 3ZIWA 4JTNA 4YGEA 1HX6A 4BLJA 2E53A 3WUCA 2XPJA 3G6JB 3QLQA 2GDFA 4E2QA 1AX1A 4IV3B 2PTMA 4J6GA 4S2HA 3ZIXA 1JYIA 4YVWA 1A8MA 5HBAA 1FV2A 2B42B 2XJVA 4MUVA 3VBUA 4PDWA 3AMQA 4IEVA 4PLNA 2R32A 4LEJA 4XHBA 2PHDA 1CGPA 1HXS1 3OBRA 3CJXA 2RS32 1D4VB 1AL0G 5A3LA 4AVBA 2D6LX 3B5LB 3WCSA 2WQZC 2BFUS 4Q4W3 4SLIA 3FLRA 4O9EA 4OI1A 5JOWA 2IXCA 1KDKA 2JD4A 1OSGA 4RD7A 4IV1B 5JSPA 3J8F3 3KSCA 4R52A 3WQ0A 2DURA 4YVSC 4JC1A 3HR9A 4GB32 2VW0A 4FPOB 5E89A 4GMP3 5GKAC 1X7NA 1H9WA 4Y22A 4IEWA 4K7JA 1Z0HA 1J1TA 1LHNA 3TN92 1WMDA 4GH4C 5BNOB 5FDBA 2WFF1 1VBA3 1I6XA 4WM7A 5ABJC 2IXHA 3I59B 3L2HA 1GNHA 2KM2A 1N1VA 3AZZA 5FAXA 2RMU2 3E5QA 1O3RA