4AEKA

Structural and biochemical characterization of a novel carbohydrate binding module of endoglucanase cel5a from eubacterium cellulosolvens
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
GDIVLFSGSKHVEFTDWGGTDWPSAYELQPPYQTMPFDLNKNFEIKVDYSGADIVLIFARWEHGSKPQIWAQISPYYVVDGTAVFTKEQIAKAYGSDDFSDLDYIGVKPLPSADGMTVTKIVASYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE CEL5A
publication title Understanding How Non-Catalytic Carbohydrate Binding Modules Can Display Specificity for Xyloglucan.
pubmed doi rcsb
source organism Eubacterium cellulosolvens
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18259 CBM65_1 Carbohydrate binding module 65 domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1070 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aekA00
4AFDA 5AFEA 2YPJA 4AEKA 4AFMA 4AEMA 4BA6A
chains in the Genus database with same CATH superfamily
1F5JA 5DN2A 1EAH2 1MS4A 1RUD1 1LOFA 1XB9A 2Y6LA 1EY2A 2BNMA 4K40A 4MGSA 3W59A 1CAUA 5LEKA 3KVAA 4LQRA 4META 2O8OA 4P5HA 1PMJX 1UYPA 1GOFA 1IOAA 5T5PA 3ACLA 5A3OA 3MFCA 1W9FA 3N4MA 3OSDA 2XL9A 2A3YA 2WNVA 3C7FA 4WM8C 2PA7A 2W95A 2WWUA 1JYWA 1W99A 3B9IA 1CAWB 1NXD1 3ETPA 4QX2A 5AFBA 2A70A 2JE7A 4JGYA 5FY7A 5I0RA 2IUWA 5A3NA 2DUPA 1UXXX 1N3OA 2ZABA 4A41A 1ZRCA 1HRI2 4Y1VA 1YYNA 3MIHA 4Q4X1 1RUI3 1QQP1 3FZ3A 1JUIA 2C0ZA 2YG0A 3RYKA 1WA6X 3E6BA 4AHWA 5ANNA 4Y20B 4P9LA 3ZLIA 3ZKUA 3IKWA 2HWD2 2KR2A 2A3WA 2XJQA 4UXAA 3VD3A 3D3AA 3AZXA 1WLCA 1OFNA 5C8CB 3T0DA 1GV9A 2VOKA 2NM1A 4XYXA 3WQ1A 5JXIA 3JB8A 2WAAA 3E5UA 4Q4V2 1GQHA 1XYOA 3GJAA 4GMP3 3LEGA 4LOSA 4PDWB 3MUZ1 1QJX3 3VBSC 3NJVA 1OLMA 1LHWA 2W1UA 3TEYA 4BXFA 1X33A 2P5BA 2OXBA 2MEV2 3LA7A 5EWSA 3I97A 1AL21 1RUF2 3TEZA 2RV9A 1G9BA 2G9GA 3OPZA 1EPWA 2OIIA 3OGVA 2PXJA 1CX4A 1JU3A 1FV3A 2QE3A 1CIYA 2ET7A 1RUJ2 2FBEA 2XUMA 5DUWA 1JTZX 1JZ7A 2J1UA 3WQ0A 2H6CA 1NXMA 5BNOB 2R062 2IFRA 1Z78A 4UWDA 3ME2A 3QCWA 3INAA 3MZHA 1S0FA 4DY3A 1BKZA 3K75B 2WQZC 5KWRA 5FIXA 4EZ4A 5I8TA 2J42A 1HJFA 3RJ2X 4CCLA 2RM21 5FZ9A 1NY72 4BQWA 3BU0A 2Y64A 5HXVA 3E6DA 1AL0G 4E8CA 5FZ1A 4JZRA 3U4SA 3D4KA 3AM2A 4OVEA 4L99A 1O8SA 1L7RA 1W39A 3I2IA 3SCHA 3HVDA 2PLV3 2WLQA 3VZLA 4XUQA 2XJRA 5CAZA 4PBPA 1W28A 1BEV2 3JB4C 5D21A 3B7MA 4UW5A 1NKGA 4F3JA 5HBAA 1QY4A 2QQLA 5EJZB 2DVGA 4W65A 1WKYA 4IEYA 1NA1B 2W5FA 3SC7X 5FZ3A 1V6NA 1J3QA 2DURA 1F9KA 1APNA 1I5PA 2VQ0A 4NHXA 1POV3 1LULA 3RSJA 2C9KA 2WYSA 3CZJA 3AYEA 1POQA 4ITCA 1ZVFA 5BY5A 4OHXA 1RMU2 3OOXA 3NNJA 2WUHA 4LMFA 4J25A 1VBC1 3VDCA 5EZWA 3ECQA 2Q1ZB 1C8M1 4FXKB 3FHAA 1Y9MA 4NWVA 4PQQA 5F3IA 1RUE1 3RJRA 4AQTA 2ZEXA 5FYHA 4HKOA 4JTNA 1PO22 2ERFA 1LKNA 1UY0A 2VD7A 2VMHA 1WCKA 3LSDA 4LKSA 3I2DA 4Y1UA 3VBFB 5DMYA 4Q0PA 5B4XA 3CO2A 1ODNA 1W2UA 1YLLA 1RC6A 3NRUA 4LHNA 2VUAA 3ZXLA 2FD8A 4GD4A 2VZRA 5EHDA 3A0KA 4P00B 3WNLA 4V1PA 4ASKA 3A7QA 1QJY1 4CCEA 4URAA 3OYWB 2V4VA 4MXVA 4YM0A 1FT9A 1J58A 1FNZA 1MZFA 2PQSA 3KV5A 1BMV1 4IE7A 2CWSA 4QPIB 1IKPA 1RJ7A 4XDQA 5T5OA 2XLFA 3MIBA 5FZOB 4WZFA 2D6OX 1OD5A 2ILMA 2RS12 1VBD1 4BE3A 2VXRA 4KWLA 3HD8B 3AL6A 2RG4A 1UQXA 3MIFA 4M3CB 4YW7A 3OD0A 1SBFA 5FZAA 4CUBA 5C8CC 5LK7B 4YW6A 2Y6KA 4AVVA 2FDHA 2JIGA 1VAKA 5FPAA 3CLPA 5FZLA 4QD2A 2Y60A 4PQ9A 2JG9A 2VNOA 1O3QA 4ZS3A 1QHDA 1A78A 1HN0A 2VOWA 2ZHKA 3Q8EA 3I2GA 4OULA 3ZR6A 2OUJA 2PYTA 1H2LA 1W90A 5K0UB 1YFUA 2VOVA 4QU2A 4BM8A 4E4DX 1DF0A 3D5OA 4GZ9A 4QHZA 1E5HA 3ZSJA 4U2AA 2JD4A 5LZ6A 3ZO0B 4B4RA 2R073 4LKFA 1O4YA 3FL7A 2B5HA 1JI6A 1AR82 4Y5TA 5FZGA 3ZN6A 4XIOA 3TN93 1G7YA 1ZRRA 3LAGA 4GKYA 5F6LB 3NV3A 4YG6A 4A42A 5A32B 5JPNB 3CJIB 3OGRA 4K9SA 3LPFA 1W6PB 4JQTA 5DZFA 4YRDA 1D0HA 4MO3M 5A7PA 2XQXA 5FUPA 5BNNB 2ORXA 2KD7A 2XPJA 1W6QA 5GLWA 1OQEA 2R042 2K2SA 4R52A 3ALQA 4IE5A 4LLOA 3VBOB 4DO0A 4WBBA 3VKOA 4ZU7A 3Q8AA 2A5ZA 1DQ6A 2Y8KA 3HJRA 2QQKA 1GOHA 3ILRA 4OQ9A 1DBNA 4HSJA 4GB33 4E4SA 4QHBA 3H7YA 1MZEA 2PHXA 5ABJA 1ULDA 4EN8B 3KD4A 4AHYA 1W6OB 2C4XA 4YYOA 5BYNA 3I4IA 3J8F1 4BPZA 1AJKA 3Q8FA 1JYIA 4NIGA 4CDWA 4LO4B 5IAXA 3ZM8A 5IT6A 1GWLA 1SDDB 2ZGTA 4NRMA 5FXXA 2W94A 1ZZ7A 1VMHA 1XRUA 1SCSA 2V09A 1SLBA 4Z07A 5FZFA 4FPYA 1RUNA 2ZX2A 3HT2A 3VKFC 1G6NA 4H2AA 5LA9A 3RG0A 3M2MA 5GZFA 4AI0A 5IK4A 1RUOA 2ZKNA 3D0JA 3HNYM 2HWF1 3M3EA 4XF3A 2LRPA 3VBFC 1AR62 2ZXQA 2DTWA 3TWIA 3FWEA 4W6WA 2DYCA 2YXSA 4LPLA 3URFA 4I2OA 3CF6E 4LUMA 4BIOA 2Z42A 1ZRDA 1FX5A 1VBA3 5LRRA 1OQDA 1REFA 4N8MA 1Q5OA 1FV2A 3PVOA 3MLKA 3B02A 3OUIA 2GDFA 4GQ7A 1W6MB 4QXCA 1IS5A 2E51A 1FATA 2G4IA 4QPIC 4Y4RA 3OJBA 4CDUB 1Q8VA 1X50A 2DF7A 5IFTA 3T09A 3RDIA 5CYYA 3H1WA 2XJUA 5JMOA 2QDNA 2LROA 2ADEA 1ZZBA 2E7QA 4KQ7A 4N53A 3RWKX 2HWE2 2QVSB 5I0DA 4LORA 4LBJA 2YY1A 1AJOA 3VZKA 4F83A 3S5AA 3VLBB 3OUHA 4ES8A 3P5BA 4HK8A 4YGEA 1FXZA 1RXFA 2A6ZA 5FPZA 5FPXA 2DBNA 2WT2A 4GH4A 2XVLA 3N9NA 1N1SA 1T6BX 3O5SA 3NW4A 2Y34A 2W39A 3WDXA 1RUI1 1UIKA 4QPGA 1DGRN 1S4CA 5K0UC 5IK8A 1HIXA 2ES3A 3MW3A 3PVBB 2PHWA 4QM8A 1JZ5A 4AOCA 1RUH1 5FWEA 4L9BA 1AZDA 3JQWA 4WVMA 5FREA 2GAUA 2XHNA 4IERA 1G9AA 5FP9A 1OD3A 1XSRA 5DG2A 2VMEA 2WSUA 1DYOA 2HYKA 2WFF2 1VBE2 3E97A 5CISA 2XVGA 1AX2A 4RQPB 3U10A 4GMP1 3BTZA 5JR2A 1W03A 4MLOA 2VNVA 3JU9A 3PUHA 5FYIA 5IJRA 2ORZA 4BU2A 2FMYA 4DS0A 2W92A 3POJA 1GP6A 2ARXA 3EBRA 4HL0A 1S0JA 1FOD2 3HN1A 4WVWA 1O4ZA 3ENRA 4QXHA 5FBJA 1CAVB 1ASJ2 3KZ4C 1QH7A 3EHKA 3AKTA 4LBQB 2X05A 1U5YA 3VBOC 4AWDA 1C1FA 4AQ6A 2FDGA 4I0WB 4CPBA 2A6VA 2FCVA 3OPWA 3WUCA 3I59A 2YFZA 3R4SA 1IPJA 1R083 2EF6A 4Q4W2 3VKMA 5B2GB 3LDRA 1TMF1 3ZKYA 3SXWA 1BBT3 4P9WA 5JI7A 3PUSA 4XJUA 1GZWB 3TNQA 3AP4A 3S7EA 2DDUA 1CZVA 4NE9A 4XAEA 3BODA 1FNYA 3BN6A 4EWDA 3TRSB 1RVF1 1SDWA 4X8PA 5IUQA 4CA9A 1QKQA 2G1MA 1Z0HA 1UW8A 2X10A 1ZM1A 2BFUS 2YPDA 2PLV1 1UYZA 3K4AA 4M01A 5DZEA 5FMDA 4V2WA 5FYUA 3T2OA 3VHRA 2XL7A 3ZXDA 4CCDA 4QGNA 4XJAA 2JD9A 4N90A 2ZHLA 3AFKA 4A7KA 1OA3A 2EIEA 5F5CA 2Q1MA 5HCAA 1RTVA 3JBG1 4GWJA 3U14A 2DVBA 1D4M2 2DVAA 1MVEA 1GQPA 1PVC3 2GSYA 2WR9A 3AKPA 5FZ4A 2Q8EA 4NMIA 4G4FA 1K12A 1GANA 1Q8SA 1W05A 3NMBA 1RITA 1VR3A 3PUIA 2V4AA 4TLGA 4LBMA 4IV1B 2VVEA 4CDUC 2PHFA 3KQRA 1HQWA 2X29A 4YGDA 5FP8A 4ZXEA 1V6LA 1WLWA 3JXSA 4QPYA 4AVTA 4EZHA 1UOFA 4JDMA 3GHNA 2CGOA 2PAKA 3K51A 5ACA3 1SPPB 1CIWA 1ULPA 3ABZA 3FFZA 5F6KA 5C8WA 5C9AA 2P34A 1ENRA 2YU1A 2LW8A 1L7QA 1COV3 4I0AA 5KC5A 1HXS3 2Q0AA 4OFGA 2JDYA 2Q8CA 2W1QA 2CDPA 4IV3B 4NIIA 3T0BA 3SCFA 4JGZB 3MF9A 1RUC3 1ND2B 1PX4A 1U5XA 3KF3A 5JZGA 3G6JB 3KGZA 2VQAA 3M3QA 3MUY1 4XURA 1DGWA 3HQUA 3CEWA 5FP3A 2DUQA 4H55A 1AYN2 4NRPA 3H1MA 1HB2A 1AXYA 1WMXA 1N1YA 4HK9A 2YUEA 5FYCA 1JUHA 1AYM3 2CGPA 1QIQA 1BQPA 3RYPA 1S0BA 4Y5Z0 1YQ2A 1W0OA 5A70A 4BHPA 2RS32 1W2AX 3DECA 2FZ1A 4RQPC 4KWUA 2VC9A 3OG2A 3CMGA 2BNOA 1PIV2 2Z79A 3LIGA 4AAXA 4FPHA 4P9YA 1JZ6A 3I3MA 2VMFA 2JXAA 2KM2A 1PNGA 4Q0VA 3ZSKA 3WW4A 1MEC3 5C4WB 3RZJA 3C2UA 3N35A 4AEMA 2YFUA 3UNPA 2LTNA 2ZGPA 4XUPA 5FMOS 2A3XA 1KGYA 3PIJA 5LBFA 2R071 1H9WA 2EXIA 3DN7A 3H50A 5EV7A 5JOXA 3WINE 1KS5A 4M3CF 5IYYA 3TN91 2ZGUA 3AXDA 4E9KA 1ZZ8A 3DEMA 3B3QE 4NPMA 1ODMA 2JEMA 2WS92 3WDTA 4OLLA 3CKHA 2ZBJA 5E88A 4K1ZA 5IVYA 3WP3A 4ZY9A 1H0BA 1JZ2A 1XU1A 2XHKA 4RFRB 3VBRA 4XFFA 2WABA 5L73A 3WDWA 3MHZA 5CFCB 4QQLA 1ZRFA 3T2QA 1S1AA 4XVHA 2D6MA 3MIGA 2C26A 2WNVB 2FCTA 1UKGA 4OMCA 4DINB 2RR12 5LBCA 3BOPA 1LESA 2GH8A 1Z7S2 2W46A 3MLJA 1S0IA 1FPN2 5LA0A 2R0HA 4AI2A 2IXIA 4LBOA 1JZ4A 1GNHA 2IVIB 2WNOA 4GB31 3DXUA 2XJPA 4LIUA 3IBMA 4AFCA 2CTVA 4Y22A 5JXHA 1REDA 4FTEA 1S55A 2K9ZA 4BLIA 4XQ4A 5LW9A 2WZEA 3H9AA 4D7SA 5AC92 4JCKA 4IV1C 4Y5SA 5I8YA 4NRQA 4FOQA 2QQWA 2RM23 1HKDA 5BUVA 4YW4A 2JWPA 2BERA 3FJSA 4OHWA 1QDCA 4IV3C 2Y38A 3WD5A 5FPBA 2VULA 1HB3A 3DF0A 1ND2C 1VBA1 2VZSA 4XW3A 1ZRIA 4H14A 5GLVA 4B7KA 2HWB3 2GU9A 1W8TA 2QZ3A 4FFIA 5AFEA 1NQJA 4E2QA 1Q56A 2W1SA 4IEXA 4UYBA 3IIAA 2OVUA 1VIWB 4CEWB 3P1IA 3R4UA 2VZOA 3J9SA 1ZNPA 3QH6A 1PMIA 2NLRA 2X5IA 1V9U1 3WNXA 3TYJA 4ARYA 1FMD1 2QZ2A 3THTA 3VHPA 2J1AA 1XYPA 3KMHA 3ZPYA 4BWOA 1US3A 4A3XA 4KU8A 3VZMA 4OHVA 4CP2A 1Y9QA 4XJZA 1K42A 3SISA 3ZMOA 4AI8A 3PMEA 4UFKA 3KCXA 3VV1A 5FY0A 2XXZA 1VBB3 5DDJ2 4DXTA 3W5NA 3K4ZA 4CSWA 5C4WC 2B9VA 1S2BA 2QDRA 3ACFA 4QMAA 1RINA 4Q4Y1 3BPZA 2BOIA 1KD7A 3ZXKA 1C57A 3L9JT 3PNAA 5EJ3A 1WCDJ 3ZSEA 2BPA2 3L2HA 1J83A 5LA1A 4Y33A 4YW3A 1NG0A 1ZZ9A 1RUF3 4AZZA 1BK1A 4EV0A 1EUTA 4YARA 4TXWA 2P3JA 1PZ9A 1RIRA 2J22A 4PIYA 2G9ZA 5HV4A 5JSPA 4Q2FA 3A4UA 5JIAA 2R7EB 3AKQA 2EIBA 1HRV3 3QACA 3RVHA 4JC1A 5CFCC 1WLDA 1PHMA 1XOYA 5K8SA 1UZWA 4FTBA 1O7FA 2WNVC 1HN1A 2D97A 2F4LA 2BWCA 4TZDA 1OMIA 1E5RA 1W3XA 3AX4A 4XMAA 1YNAA 3DPRA 1R081 5KC6A 1JS9A 3FLRA 4AGVA 2XLGA 2YROA 5F5IA 3ZFFA 4B4QA 1BBT1 5JDBA 3POBA 5J96B 3OEBA 3PVNA 2R30A 3SNMA 4RN5A 1F4AA 3AMHA 2K0GA 4NJ4A 1OUXA 2F17A 4W4ZA 5CG8A 2PMWB 2AYHA 2O14A 2P6CA 2VCAA 1RUD2 3VBSB 1JYVA 3W5MA 1VAVA 2AR6A 2J1SA 5FP4A 1YO8A 3WF4A 2D93A 1WCSA 4C90A 4OQ8A 3B5LB 5LY2A 2JG9B 3GZTB 4MUVA 1AX0A 3TEXA 1LOGA 2XBO3 4R9BA 3OY8A 4UAPA 4G9SB 3MEPA 4FFHA 2VW0A 1LHVA 1QJU3 4S2GA 5ANQA 4OHZA 3LFMA 1PVC1 4QKBA 4CU9A 5FXZA 3U78A 1EV11 5T52A 1W8UA 5FR3A 1UZZA 4MX3A 3T4VA 5A1FA 2UY9A 2YC2A 4EE2A 4G3YC 4HKLA 3WEZA 4TYSA 4AR2A 4RGKA 4KH9A 4AEDA 3IPVB 4XTMA 2FZ2A 1CAXA 3H7JA 4FP2A 2RS53 3ZXFA 4CEWC 1O3RA 3WG3A 1PVXA 4Q4X2 1JHNA 1QQP2 4CU6A 2VZVA 4XILA 4RS5A 5ACA1 3BVCA 4YVSB 2BDRA 3CL1A 2JIJA 3C7HA 1V00A 4KBBA 2TEPA 4YZ5A 5LRSA 3KV4A 1HXS1 3PL0A 3O1VA 4QXKA 1IZ3A 3GGLA 4QQOA 1RUC1 5T3NA 5KR7A 2HWF3 1GNYA 2HEWF 2W1WA 3AZYA 3ZIXA 5D2AA 1U5IA 4LO7A 1C4RA 1UOGA 2J1TA 3MV11 4K21A 5FLIA 1GWKA 3I2OA 2C1FA 1HV1A 3NSTA 4EYUA 2B7YA 1CWPA 3T2PA 5I0TA 1AYM1 1UIJA 5ABJB 1XNKA 4Q26A 1C3HA 3ZYFA 4FBFA 2WC2A 4NWWA 3VD4A 1Y3TA 2CAVA 3P6BA 4YWAA 1IHMA 4QPWA 4HETA 1PM4A 4AW7A 4GAZA 3CJXA 1OA2A 1VMFA 2BNNA 3N9QA 3CU7A 4N9HA 1GU3A 1B35B 1YJLA 1MQTA 1NYWA 3WDYA 2V5YA 4JAAA 4TTGA 1WUVA 4Q1RA 4CXYA 1GR3A 4GWMA 3HNMA 2F4PA 4GXLA 2WN2A 4AQSA 1MEC1 4FPLA 4RA0A 4N7IA 2NYYA 4RL7A 4XZUG 5CB7A 1WW6A 3FHIB 3WDVA 1QJEA 2JICA 4FXGB 3V0AA 3CNAA 3ACHA 3C7OA 4J1WA 2VUJA 4BA6A 2DCZA 2NMOA 1RHI3 1LJ7A 2W9XA 4MXWB 3V64A 2RVAA 3LFIA 4DRVA 4AE2A 4A44A 1RUH3 2QKDA 2VE1A 3SITA 3WF1A 1GLHA 2HWC1 1V70A 4K7JA 4Z8BA 1LEMA 4NIHA 1OI6A 3TOJA 1S0DA 2HBTA 1VAMA 3RZZA 4JHZA 3NKGA 1DQ2A 3GBFA 2YU2A 2OPWA 5C3OA 4BMEA 1K5JA 3BKZA 5JOZA 3O1TA 1Y43B 1VBC2 4FPEA 4XBNA 4LT5A 4KGQA 1C8M2 2JG9C 1O6UA 3LEKA 3ZYIB 1I9RA 3WCRA 1KQRA 4QX3A 4WM7A 1CN1A 2XB6C 2XGXA 3POEA 2A7AA 3PUQA 4FPJA 4LJHA 4LO5B 1UPSA 2OZ6A 4RR3A 4B1LA 3T3YA 1OXCA 2JDUA 3GDBA 2ZX3A 4D6QA 3H42B 4XHXA 4YW2A 2OQ6A 1R64A 4CPBD 2ZHNA 1N1TA 1TMF3 2ARBA 1LU1A 3JUUA 4IE6A 4ISQA 4WVMB 4XDOA 3R6SA 3WNPA 2DCTA 1QJY2 2JDHA 5FK7A 2P3KA 5CZKA 3DV8A 2H0BA 3GCXA 4RHV1 1H4GA 2VG9A 3NO8A 2HYXA 4YVSC 1E5IA 3DYOA 1RVF3 4FQZA 4JQRA 4K6BA 4UW3A 1EAH1 5H9RA 4LKDA 3N3HA 1DCSA 4PHZA 5KHKA 1VBD2 4NPRA 1ENXA 4CP0A 4XF0A 5DAVA 3R05A 4OI0A 3FFQA 2XWJB 3OBZA 2FDIA 1ENQA 2ZHMA 5H9QA 2HWB1 5DUUA 4NHYA 4TWTA 3MPBA 4SBVA 3JBG3 1W8OA 1AR73 3EMRA 2A6XA 3I59B 4MADA 1H4HA 1IG3A 2WNUA 1IQAA 2RMU3 1DIWA 5DAXA 5I8SA 4CP9A 5BV6A 3WHUA 1LTEA 1GBGA 5F5AA 4Z82A 1V6JA 5ABJC 3JD73 5BPXA 4QX5A 2LALA 1HRI1 1GFF2 2BRTA 1GMMA 3MICA 3PHMA 5JWPA 3NNFA 4D69A 3SCGA 3DGTA 5B4NA 1PGL1 2AEYA 1B35C 2C6SA 1A34A 3NAPA 3NVCA 2OZJA 2QJVA 1UZYA 4AEKA 5FUNA 4HKWA 1NCQA 2HWD1 1VBB1 3R4DB 1BK0A 4ZPIA 4IGPA 4MGYE 4YM3A 1SCRA 1PO13 1SZBA 1J1LA 1OH3A 3CDZB 1AHSA 1DGLA 5C3RA 2VL4A 5KHIA 4HONA 1BHGA 1ZA7A 3NV4A 3MW2A 1QOSA 4MH0E 1HB1A 1JN2P 1LNSA 2MEV1 1RUF1 2CU5A 1GP4A 1P8JA 1WD3A 4PIXA 5J7MA 5C6CA 5LK5A 5FO9B 4WM8A 3RPQA 2Q30A 4BZ4A 3WLUA 5BNPA 4HPKA 4YGBA 1RUJ1 4IL7A 2WZR3 4GULA 3WVJA 2XQRA 3IAQA 3Q8CA 5E8AA 5CFDB 3U4XA 3IMMA 4Q4W3 1HRV1 5C9AB 4UFIA 3J8F2 2XLAA 4COVA 4PCRA 5C71A 1H2MA 1OF4A 1STMA 5CNAA 4OI4A 5GKAC 5JZGB 3QH7A 3M3IA 1SEFA 2GNTA 4KU7A 3S30A 3WNKA 1NY71 2HLEA 4WVVA 3ZFEA 1JYNA 3ETQA 5GALA 4UFHA 2JE8A 4QPGC 1QNWA 4WVZA 4ZXKA 2DCJA 4MYEA 1VALA 2JB4A 4OI1A 1GQGA 2VAUA 4YVWA 5CBLA 3SHRA 4TSVA 5F9TA 2E26A 2VJXA 1W8FA 1BEV1 1LENA 2W91A 4IEPA 4LLFA 4CDXA 1B09A 3SLIA 2D44A 1D4M3 3LQCA 4A45A 3ES1A 3GHMA 3TNPB 4D7YA 5FOBB 2J1EA 4XACA 4ZU4A 4PF1A 3BGAA 1V0AA 4GALA 4XPVA 1SFPA 1KS4A 4FI9A 3SMHA 1LGCA 1D4VB 5FPVA 2XBO1 5JAXA 3ZYGA 2W3JA 2BGCA 3IAPA 2ZGNA 1MS9A 1QJU1 2YC0A 3RZGA 4BJ0A 5A7QA 2XJTA 3GZAA 1TME3 4XAAA 2XR4A 5A3UA 1OPOA 4LKEA 4ZONA 4AYUA 2E7TA 3NV2A 1TEIA 2WL1A 5A80A 1BVP1 3WF0A 2RS51 3O0XA 4QKNA 2F6BA 4XJ9A 1R1A2 4I01A 1RUI2 5EYXA 2OPKA 1IKQA 1Q43A 4HBNA 4CCOA 3R0RA 2LS6A 3KT1A 2GC0A 2WA3A 1DQ4A 5IVFA 2YC4A 1YEWA 2R32A 3DYPA 3UYJA 5F37A 2UY8A 1LGNA 1XSQA 5ERLA 5AVPA 3C3VA 2WJSA 5FYSA 3OEAA 2WO3A 3I7DA 2JG8B 3I8TA 1ZBA3 2H0VA 5L7OA 1YUDA 5FZ6A 3DUIA 1XBFA 4EJRA 4DFSA 1NLQA 1QJX2 1OT5A 4O7XA 3KLSA 5JI9A 1CGPA 5FZCA 3BUCA 1LOAA 1DZQA 4ET7A 4NHLA 4BMBA 5JSOA 4AXOA 3BTYA 2VOXA 4OZXA 3DKWA 3D82A 5IVJA 4Y4YA 4Y22B 1GYKA 1ALYA 4W6YA 5KHGA 3MI8A 3AJZA 4RD7A 5JCTA 4XQDA 4EWAA 1YCIA 2B8MA 1UOBA 3AKRA 1V9U3 2HBUA 1SLTA 1X82A 2PHRA 1FMD3 2VPVA 1QU0A 2A73B 1G8WA 1WWYA 2GNBA 3RWNA 2YZ4A 5CFDC 1J3PA 5T54A 4CDQB 3RFRA 5FYZA 5C9AC 2VQUA 3WF2A 4X6QB 2EVXA 1AR93 4CZSA 2ARCA 1WZXA 4CRQA 4NR1A 3LEIA 1DQ5A 2CL2A 5EYYA 1OSGA 2UWBA 5CIRA 2OKXA 5JZGC 4RYDA 1PZ7A 1RHI1 1UY2A 1ZA4A 3AMPA 2PLV2 4ZU5A 3CQOA 4KG0A 5FYYA 3ST7A 1PGW2 4Y1XA 4Q4Y3 3PLQA 3LOIA 2RJKA 4LBNA 1K5MB 1IPSA 5C8CA 3Q8BA 4QKDA 3GZEA 3TB0A 4LULA 1QXJA 3WW1A 5FZ0A 5G04L 2ZMNA 3J26N 1PK6B 2GZWA 4PDWA 2X5IB 4LHKA 4PLMA 1F35A 1YQ6A 4YZ3A 3H8UA 3U75A 1UAIA 3VL8A 4L0PA 3LB9A 4CEYA 3AK0A 2J7MA 4KL1A 1NE6A 1DYPA 4HSLA 5FY9A 2WO2A 2A75A 3A0NA 2XVKA 3O14A 3VDDB 4K8RB 2VZTA 4MGKE 4JRAA 4AQ2A 3F2ZA 5BNOA 3ZN5A 4FAGA 1PGSA 5A7OA 1Y4WA 1TNFA 2RJ2A 3ZN4A 3SEPA 1ZZ6A 4E27A 3OB8A 2P4EA 3VZOA 1UN1A 2KA3A 3SH4A 1OQ1A 3A23A 1W2NA 2L9LA 1AR61 1PX3A 1MS5A 4WV8A 3E5XA 1H30A 3O1UA 5FYVA 4XBQA 3BCWA 4YGCA 3THCA 3U1XA 1GNZA 3OGJA 1N3QA 4K3UA 3SQOA 2PHLA 3RNSA 1U5ZA 4I02A 1N1VA 4N43A 3VL9A 3VDAA 4S2FA 4Q8KA 5A1AA 1L3JA 1HQNA 2VTFA 4JKKA 4PIZA 4Y24A 5D8AB 1GZ9A 2WZ8A 5LB6A 3ZDSA 2ZGLA 1V6OA 3QD6A 2RHPA 5T55A 1X7NA 1H1IA 3UKNA 3FMGA 1Y9GA 1NA1A 1X9PA 5FMCA 1G86A 1YFYA 5EQUA 4CCCA 5JXJA 3K77A 1W8ZA 2VU9A 2JG8C 5FV3A 3T0AA 4DUVA 5J09A 4XFGA 1KXGA 5JSRA 3GBWA 4M0HA 2HWE1 3LE0A 1AR71 5GZEA 5F7UA 5AVAA 4B1MA 2YGMA 2VBBA 3DPRB 2RMU1 3J7LA 1EV13 1R1ZA 4UFMA 4BYYA 3BTXA 4AFBA 2Y6HA 3HT1A 1FI2A 3JD71 4E2GA 4KNCA 2JDKA 4LNVA 3UV9A 5JOYA 1NCRA 1POV0 2R0FA 4CXXA 3PMSA 3WZ1A 4N7UA 2R072 3KHBA 5JMCA 5A6YA 1E57A 1DDLA 1BYHA 3TN92 1KDMA 1QXRA 1UYXA 4HFSA 3JQXA 5DUVA 5F32A 4QQ2A 3K2OA 4L97A 1ZYBA 5K4LA 3ZVXA 1OUSA 2E33A 4AL9A 4CDQC 1JXNA 1WW7A 4MGQA 3ATGA 4XUOA 3WOGA 4YSFA 4BQ2A 2C9AA 3I2KA 3K3OA 1PO11 2B4KA 1DLLA 3GM8A 1H8TA 3OY8B 1W6NB 3UJQA 4FQ4A 4DB5A 1K3IA 5FZOA 1O3TA 3C8XA 2ZMLA 4XFIA 1UX6A 1XU2A 2JKXA 4L92A 3IB3A 1OFSA 2UYAA 2XMLA 1H2NA 4IGOA 4M3CA 1K5MC 4EN7B 3H8RA 4AGRA 4FPCA 2A1XA 3N7MA 3OUJA 5FZ7A 4OUEA 2PFWA 3OBRA 4GB32 3ZPOA 1PK6C 2WZR1 1YQCA 1US2A 2X5IC 4IEZA 4RS5B 4DPNA 5I93A 5HI0A 4Q4W1 5FQ0A 2V5DA 4DOUA 3WW3A 2BFUL 3RMXA 4YPJA 4W8JA 3N7JA 2OYZA 3H3ZA 3VD7A 1PM7A 5KHHA 4FAHA 3WQ7A 3ZDVA 2UWAA 3LEMA 3WP6A 1AX1A 1MR5A 4AK3A 4B7EA 2RJLA 1JHJA 3VDDC 3UK9A 3VD5A 1OHFA 4K8FA 5FYMA 3MW4A 1OURA 3TAYA 5IVBA 3VHOA 5A32A 3CJIA 2IFWA 2YGLA 2CSGA 2BWAA 2ET1A 5JR7B 3LCPA 5FDBA 1OF3A 4YG0A 1MS8A 1HDKA 1VBA2 2QBXA 5HXMA 1UU5A 4MHRA 3S57A 3WX5A 3ZSMA 3W21A 1CAUB 1ST8A 2HWC3 1RUG3 4BIFA 1Q8QA 5J98B 3UL2A 1D4M1 3KT7A 2Y6GA 3O1OA 1H9PA 2VMCA 1VRH3 3BB6A 1JODA 4PF5A 2ZJCA 3SEEA 1MQTB 3VBOA 5D8AC 1KRIA 2EXKA 2GALA 5KXEA 5EPAA 2DVFA 2W08A 3AYDA 2VOTA 4EQVA 3HR9A 1NUKA 2AEZA 1WLTA 4NAMA 3O1MA 1R093 1ULEA 1I6XA 1S0EA 1W8NA 3Q9OA 1TME1 3LWCA 3POYA 4FPFA 4JGYB 3V65A 3ASIA 3ZR5A 1W6OA 5IVEA 1DFQA 3FX3A 3V0AB 3VBUA 2D43A 2FMDA 1QGLA 2O0OA 5FOJB 1NOVA 3LPGA 5BXXA 1DGWX 1W9WA 3VKLA 2QQOA 3DPRC 4R8HA 2OQ7A 2E7AA 2ZEYA 3ZFFC 2BJSA 3A22A 2TNFA 1ZBE3 5DAQA 1D2QA 3IMNA 1F8VA 3W9AA 2W68A 2Y0OA 2I74A 1F15A 5FFOC 2GC1A 1LOEA 1CJDA 2ZX1A 3UETA 3UT0A 3VUOA 2CYFA 4RHV3 5APAA 2VUDA 5I0SA 5LEJA 5IAVA 5LBEA 5CKNA 4LUKA 1LHUA 2YPJA 1EAH3 4AI3A 1UD1A 1ZBA1 2FHRA 1GUIA 1LR5A 3EYPA 3I3DA 4PLOA 3NL1A 1EUUA 2ZX0A 4QDRA 4RGAA 5FMOL 3LGRA 4CDUA 5HCFA 3HEIA 5CKMA 4CXWA 3E6CC 1TG7A 4HVQA 1KEXA 2A6YA 2YBKA 3ITQA 3AB0A 3I2JA 4FCAA 5FY4A 5LWBA 4BK5A 4EROA 1MACA 2IXCA 2BBAA 4BQXA 4DMIA 4NHKA 1R082 2DFCA 3CZUA 3GALA 4JKMA 3OTFA 1HRI3 1HJGA 4A6SA 3W20A 4GJYA 4IXLA 1BBT2 1AXKA 4ASLA 4MGTA 4Z92B 4RS5C 3LDBA 4ZZ8A 1AUYA 3ZFGA 4QHOA 1AR91 2C5DA 2NMNA 2EA7A 3OGSA 1W0NA 4JVAA 2AUYA 2GN3A 4R9AA 5DPNA 1IS3A 4XMIA 1JMUB 3B00A 5FUIA 1UU6A 2HWD3 3PTRB 2DTYA 4UBGA 3U37A 2HH9A 4XF4A 1IG0A 2ZEZA 3NKTA 3E1F1 1W06A 5GJ6A 1W2OA 1QOTA 3PJQA 4XUNA 4D3WA 5DUXA 3CIHA 2DCKA 4Q4V3 3AP9A 1DQ0A 2WNUB 1X8EA 3KCCA 4OYUA 2MEV3 1PVC2 4BH9A 3AMNA 2VMIA 1LOFC 1Q8OA 2EICA 4IESA 2P3YA 4QU1A 1VMJA 1W9SA 3WNMA 4FPOB 1JU4A 3O0WA 3WHTA 4F8AA 1LEDA 1UO9A 2GN7A 1A8MA 2VW2A 1RUJ3 1C1LA 1CPNA 2VO5A 1VB2A 3HBKA 1SBEA 4LITA 1MQTC 1JW6A 1JYCA 1DQ1A 2OW4A 2VCMA 1ULFA 2R063 3GF6A 4R4XA 1NCQB 3LOBA 2C24A 1LODA 2R1BA 3QLQA 4OCTA 4J6GA 4XETA 3N7KA 1F2NA 2AC1A 1UMIA 1VLNA 1COV2 4JGYC 1HXS2 3KF5A 5G05L 1QEXA 1PNFA 5CEHA 4AHZA 3ZXJA 5GM0A 3HQXA 2EAKA 3NJYA 2GC2A 2NZ9A 5FRAA 3GZUC 1F5FA 5FP7A 4AVCA 1YRZA 2Q1FA 3RQ0A 5DAPA 3N9OA 1OKQA 3ACGA 3I3EA 1BCXA 1BEV3 5GZDA 2CNAA 3WF3A 4B29A 4YM1A 3UKTA 3K3NA 1FAYA 1CD3G 4COUA 1UZ0A 3LSEA 5BNPB 1AYM2 5I0UA 1KJRA 4MGIE 4OZOA 2WT1A 2ATFA 4CCJA 2WAOA 5A7SA 2I2SA 3M70A 4LE4A 3AZZA 2BUKA 1RMU3 1TE1B 2VY0A 4MV2A 4FTSA 1H2KA 3M3OA 2WFPA 3ZFEB 1W3VA 2ZTNA 4IV1A 4PI2A 2BV4A 1I1EA 1PO23 1MEC2 2Q8DA 4HZFA 1SMVA 1PMHX 3AVSA 3IN9A 3UKVA 1C5HA 1SQ4A 5DDJ1 4YVWB 4IEWA 1GICA 1IS4A 3ZN6B 4CDXB 2AREA 3DCQA 5FLHA 1AF9A 1SLLA 4A6OA 1UOJA 3ACIA 1VPHA 4WZCA 1QWRA 2BVBA 4IV3A 5JPMB 4NROA 1OPMA 4DUXA 4JGZA 5KHJA 2UU8A 2OA2A 1ND2A 1XXNA 2JDMA 4HVRA 2J1VA 4CUGA 3WDUA 1OOPA 2VCBA 1ND3A 1A8DA 1GZCA 2R16A 4LK7A 2XDVA 1W6QB 3D8CA 4QM9A 2CAUA 3HOBA 5A1LA 4I30A 3QBQA 3AL5A 1X9TA 2OS2A 2RS13 4QQPA 4O65A 1CQ9A 2ZAAA 3K46A 4GIQA 4XJWA 5A6ZA 5CVRA 1J84A 5IW0A 4BISA 5J1XA 2YYOA 1ZZCA 3LA2A 3ZSLA 1O3SA 2QQVA 2JE9A 1AL22 2NPIA 3T1MA 3ZYJB 2WNUC 5ISLA 3VN4A 3HAGA 1O8PA 2PHDA 1WW5A 3O0VA 3FUOA 2FDKA 1UKRA 5FYTA 2D6KA 1CR7A 4CDWB 1KFXL 4E2SA 5A6QA 2MHFA 2WWJA 5C4WA 4NIAA 2PHUA 1W9TA 1OVPA 4HN1A 4DXZA 2E9QA 4QX7A 3M7AA 1TQ5A 1AR83 3VBHA 3NAPC 5CKQA 4DEQA 3ZXAC 3USSA 1JH5A 1W9YA 4JX0A 1OLRA 1GSLA 5FJKA 2D3SA 3NV1A 1NCQC 2P17A 4FP3A 2JDNA 2RM22 4IUGA 4MG2A 2JECA 4HANA 4LA2A 1HV0A 4GKXA 2UWCA 4M3CE 1OC1A 5FZHA 4COYA 3OCPA 3MYXA 3H0OA 2ZOEB 5TSWA 4LHLA 4CCMA 3N9MA 4LIVA 1XNDA 2R043 2OUHA 4BDVB 5HPOA 2HWB2 1RUG1 2RDSA 3FLPA 5CFCA 4BCUA 4KWKA 4P08A 4AGGA 5KXBA 3VB9A 1VRH1 1WA4A 2EIGA 3LZZA 2HJIA 5LATA 2VECA 4KBZA 4N9IA 3PJYA 4N53B 5BNPC 2ARAA 4ORFA 2YMZA 3F95A 5T5LA 5CG9A 3I2FA 5A3WA 2WLPA 2YBSA 2J1RA 2E6VA 3WV6A 5JVVA 4B4PA 5F3GA 4FT8A 3PVEA 1R1A3 2VQTA 5EIYB 4R9DA 1R091 4GH4B 4KG8A 3N7LA 3UGGA 4JTOA 1PGL2 1RUE2 2VUCA 1QF3A 1I5ZA 5GLUA 2XKPA 4OMDA 1VE0A 3ZMNA 4C91A 3IWZA 4HLTA 2ENRA 4QPGB 4H3WA 3ZFEC 3S0MA 1CZTA 1VBB2 4YW1A 2QFEA 1UCXA 3I2HA 4DY5A 2ZCWA 2W47A 1ZBE1 4GWIA 4YZ4A 1AR63 2ZEWA 2B46X 4AEJA 4YVWC 2W2IA 1BJQA 1HB4A 4LO6B 4CDXC 2DWRA 1U12A 1WBLA 4P9IA 3BU7A 3NNMA 4CUCA 3JZVA 3D6EA 1UYYA 1UWWA 2WO1A 1DU3D 3ORJA 1BMV2 1ULOA 2PHTA 1GWMA 3BPSA 4CEYB 2X8KA 4SLIA 3O7OA 4LK6A 2RDNA 4QDQA 5D1IA 4Z2WA 2YHJA 3FHQA 1UX7A 4XXPA 1W2TA 3WG1A 3BYWA 2H6BA 2D98A 2JENA 1IQDC 4CEWA 1HRV2 2JDAA 4BB3A 1LB2A 1WMDA 4NPLA 2HWE3 5JIUA 2QQMA 5FK8A 1HQLA 4AFMA 3WG2A 4BQ1A 4JRLA 2WINB 1LECA 3S7IA 3O12A 5SV8A 1H1AA 1YWKA 4XIKA 4CCKA 3POSA 2G19A 3KB5A 5E6HA 4P9JA 4FVVA 3MIEA 5EXOA 4XFCA 4E8DA 3M4FA 3PU8A 1YHFA 1SFYA 4N43B 4DQAA 3NNLA 4FPGA 4CDWC 3ZYHA 1OBNA 2BVVA 1LU2A 4MSVA 5BNNA 4CU8A 1J3RA 4B8EA 4LXLA 2E31A 4FOYA 1SLCA 2LM3A 2NQYA 3WXPA 4AHXA 4Y26A 5L7OC 3THPA 1URXA 2WFF3 1VBE3 4Q4V1 2GP5A 1BZWA 4K20A 3HMYA 2XBO2 3O1SA 1JYTA 2AGSA 1QJU2 1YIFA 1FOD3 5FZIA 4C0BA 5DAWA 4IEQA 4BQYA 1JOJA 3ILFA 5J48A 1NZCA 2BTVC 1NCRB 4HMZA 1ASJ3 3H3LA 4QB6A 3N36A 1V6KA 2EALA 3DL3A 3AP6A 2A6WA 4DEVA 3NJXA 2RS52 3WCSA 4N53C 3VD9A 3MDPA 4S2HA 3KT4A 2R061 2ZGRA 2DFBA 1ENSA 4HVOA 3H8OA 2ETEA 3W58A 1JZ3A 1VB4A 5F3CA 3VZNA 2Z4FA 2Y0IA 1XNCA 1O5UA 4GH4C 4A3ZA 1NAEA 1JBCA 1O59A 3USUA 1H8TB 1SLAA 2N7GA 1YJKA 2ZA9A 4YFWA 4W50A 2W87A 3SH5A 4BQ5A 1MS3A 2XONA 3RS6A 2VGDA 3RYRA 4UW4A 2D6LX 1XNAA 3IDBB 3H3UA 2HWF2 3OPTA 4X6RB 3I3QA 4XFAA 3VDBA 2SBAA 1C28A 1CJPA 4XABA 3T1LA 3VBSA 4C1XA 1YC61 3WY6A 4Y3OA 3U07A 2QCSB 1BVVA 1MPXA 2WN3A 1RL3A 2WQ4A 3KVBA 3M1HA 4PDWC 4XCBA 1RGSA 3IDEA 5H9PA 4AFAA 1MZ5A 5L36A 4MOAA 5FZKA 4FSJA 3EXUA 3KCYA 3BTAA 5FQ0B 4ES9A 4UFLA 4Q8LA 4QGMA 4CEYC 5C3SA 2YB7A 3AVRA 3AYAA 3WP4A 5HV0A 2BBVA 1W8HA 5IVVA 2P1BA 3TEWA 1RMU1 2IC1A 2FCUA 2DU0A 4CTEA 2ZGKA 1CPMA 1LCLA 5A33A 1DZTA 2QUOA 3AMQA 3N9PA 3IPVA 3RZKA 2R6QA 3GNEA 5BNOC 1PO21 1F4HA 4IGQA 1NX9A 3OF1A 4L2NA 3VHNA 2UYBA 1J1TA 4NVPA 5F2SA 5JLVA 4AG4A 3AP7A 2QQPA 1XPWA 4YVSA 3EJKA 4MVTA 1QNYA 4CUAA 3KHCA 1O91A 1KJLA 1RHI2 2LUWA 3LIHA 2QQJA 1VJ2A 1LRHA 2MNGA 3KWVA 2B9UA 1S0CA 5IWFA 3POFA 3FBYA 1RUH2 3B69A 1AYN3 3L2YA 4NAOA 4N43C 4GA9A 4URTA 5FZMA 3VBRB 3AKSA 3OGGA 3WG4A 1N3PA 2AH2A 3BI3A 1N47A 4LHSA 1UMHA 5L9RA 4ASMB 3PURA 5A7WA 1W04A 2BZDA 5F39A 4BK4A 1GP5A 1SFNA 1U0AA 3V0BA 3P3NA 2RS11 4UF0A 1NA1C 2B39A 2QQNA 4IDZA 4YLZA 5LA2A 5DXDA 1UY1A 4IE4A 5DZGA 1S2EA 1Q8PA 2XOMA 3APBA 4EN6B 1HW5A 3VBUB 5K9YA 2RS33 3AMMA 5JUVA 2I45A 1LHNA 3B01A 4P14A 2O8QA 2PELA 1PIV3 3MBWA 4JDNA 5EFUA 3ZXGA 4EWEA 1B35A 3HPNA 2A71A 3LA3A 2ZAHA 3GBGA 4V2VA 4HG6B 2JJ6A 2PAEA 2WWSA 3MLLA 4LTAA 3MFAA 1NCRC 3RZHA 4DNYA 5FWJA 1TMF2 1CAWA 5HCHA 5J3UA 1Q3EA 5IFPA 3C7EA 3I3BA 1AR81 3KQ4B 1EP0A 2E63A 4ARXA 5A3TA 1XE8A 2WS93 2Y33A 4MXWA 5E1RA 5BNQA 4HN0A 2ZZJA 2Z5WA 1RVF2 1Y7BA 2V73A 4I3PA 4Q0UA 3GCWA 4Y20A 2EAAA 4NIDA 1UF2C 2X09A 1WGPA 1H8TC 5A6XA 1G9CA 2GP3A 4UBHA 2HKXA 2JDPA 4L8QA 4D7TA 2R041 3UGFA 3IDCB 2D3RA 3AZWA 4PBOA 3ROUA 2RR13 5FKBA 3JBG2 1AR72 3B9CA 3MF6A 4ATEA 4A4AA 1Z7S3 5A3PA 2RMU2 4R9CA 2R49A 1FPN3 3DKQA 1UU4A 3KGLA 3ON7A 3J7HA 1KITA 3JD72 4P9GA 3FBMA 5FBZA 3BIEA 3N9LA 5A3MA 2AENA 3ZFGB 1R1A1 4LA3A 1UZVA 3WT3A 2D5HA 4GMP0 4Y1ZA 4LBQD 1AVBA 2WO7A 1OKOA 2JX9A 5DG1A 5AC93 3ZOIA 5F1RA 2VZ1A 1SG3A 2OT7A 3EB7A 1JOBA 1H6YA 2VH9A 1PZ8A 1X8MA 3J4UH 2YBPA 3J7NA 4HOOA 5FPUA 3IM0A 1PO12 3OD4A 2JDZA 4JHTA 2JKBA 2IXHA 3NJZA 3CJIC 1DYKA 5FLJA 5FAXA 2VNGA 4FFGA 3RRDA 1M4WA 4O9EA 1CZSA 4XCAA 1QJX1 5FY8A 4AF9A 1EYBA 4IQPA 1H8VA 3ZIWA 3D0SA 2VTXA 1XE0A 2VW1A 3B94A 2AACA 1MZ6A 4YG3A 1TZOA 4GJZA 4I0BA 5GLTA 3VBRC 1J59A 4IEOA 2IWGB 2PTMA 2Z69A 2O1QA 2BEOA 2WZR2 4JKLA 4QDSA 4FOWA 3WQBA 4ZS2A 3BIWE 2I07B 5IVCA 3ILNA 2ZGSA 4UW6A 3IZOA 2KXLA 1T2XA 2E53A 2VBDA 2VR4A 3O1RA 2WDBA 2Q4SA 4IETA 2YDEA 3AYCA 1NZIA 3VBUC 1IS6A 4XJ8A 3ZYBA 5J37A 4UT5A 3EO6A 3FLTA 2D6NA 1OLME 2HEVF 3ZFFB 5LBBA 2D5FA 5DDJ3 1UNBA 5FYBA 1SLIA 2VCCA 1CX1A 3VBFA 3WNNA 3U0ZA 3DYMA 4HXCA 5LCWL 4Q29A 1PGW1 3K4DA 5FZEA 1G9FA 2VMGA 2XUEA 1C5IA 2CWMA 4I09A 2ZMKA 5IATA 1ULCA 1YFWA 4CE8A 5GZGA 1YIPA 4U36A 4XZPA 4XQWA 1UXZA 3LDKA 4A7YA 3ZX7A 3OYWA 4XUTA 2Y26A 3KS7A 3SH3A 3G7DA 4CYDA 3AC0A 3HQRA 1E5SA 1POV1 1REEA 1VBE1 1WMFA 2WFF1 3H1YA 1DZRA 4QPIA 5FY1A 1QMJA 2D7FA 4L11A 1LAJA 1YFXA 3T08A 5C3PA 2DV9A 5M0TA 1OH4A 4XC9A 5JXGA 2RE9A 2DUOA 4A2UA 1SACA 2GMPA 3CHXA 1F31A 1FOD1 2XJVA 2VVDA 1EPZA 4XFHA 1TME2 4CU7A 1V6MA 4QQHA 2BOJA 5CFDA 2VVFA 4AEDB 4E4HA 4ONUA 1CAXB 1ASJ1 1L7LA 3HIFA 3AFGA 2VM9A 2IXKA 4FFFA 4J1XA 4ZKTB 1GZTA 4DUWA 4XXAA 2Q8OA 2ZGQA 2FQPA 4S2DA 3X29B 3PTYA 1XJAA 2ZS6B 4Q0SA 5SV5A 2BQPA 4INDA 2IVJA 3WR0A 3AXEA 3KV9A 4QB2A 4QB1A 3WP5A 4DXRA 5K0UA 1OOPB 5F8PA 1ND3B 1S0GA 2DBIA 1QJFA 2R1DA 3SKJE 3NWKA 3ZFGC 4XHBA 4OHYA 2VZQA 4C0HA 2D3PA 2IXLA 4FOVA 1JOPA 4ISRA 1MS0A 2HEYF 3BOWA 4OUMA 4LO8A 5GZCA 1RUD3 4IE0A 1ZBA2 4IW3A 1YI9A 4XF9A 2VZ3A 3AP5A 1W6PA 1ZREA 4XFBA 1ACCA 1CVNA 1XNBA 4H7MA 5H9SA 3QOPA 5FZBA 2XJSA 4B3NA 4UI9L 3T4HB 5DQ0A 4AVBA 4YFZA 4D8MA 1W8WA 1ZX5A 3UJOA 2WRAA 2B42B 1BXHA 5T5JA 4D6RA 4QT6A 3PIGA 4JDOA 1C8NA 1K45A 4Q1PA 3OBTA 4YNIA 5F5QA 5C5TA 3KM5A 1I3HA 1V9U2 3POGA 3IDAA 2VNRA 1FMD2 4P02B 3VBHB 2WYFA 1RYYA 4IEUA 4P5YA 3THDA 4Q4X3 2OX0A 1QQP3 3GJBA 2ZX4A 4Z1VA 2W0XA 3ES4A 2BP6A 1TVGA 5L9BA 1T6GC 1AR92 5FCCA 2GH2A 4O9GA 2DVDA 2PQQA 5C33A 1WMEA 5FPLA 4COZA 3PUAA 1W0PA 2XG3A 1DP0A 3JCIA 3P3PA 1DGRA 1WCUA 4Q4Y2 4C1WA 4D94A 1S2KA 4YZ2A 1AYN1 2VMDA 4CP1A 2JG8A 1UL9A 5L19A 2VXJA 2Q5TA 4QXBA 4XEZA 4Z2AA 4QX8A 2P3IA 5A3LA 2K46A 1AL23 5CA6A 1QDOA 3WW2A 4QAWA 2JB8A 4NO4A 1QJZA 2ZPXA 4BQ3A 4BXSV 1YI7A 4OI2A 1XC6A 3S5QA 2W52A 5CU1A 3I54A 1VRBA 2QTWB 1OVSA 2EIDA 2XH6A 1D7PM 1G9DA 5C5UA 1MVQA 3UESA 1HLCA 5IK7A 1W6MA 4MGZE 2P2KA 2RS31 3E5QA 4M0NA 4XBLA 2B45X 4WM7B 3S6PA 1QOOA 5L9VA 2XKOA 1PIV1 2E32A 3PDQA 4LOTA 4OUSA 4RR3B 2WKKA 3J7MA 4EN9B 1YQ8A 1LGBA 4C8DA 3U11A 3IT8A 4RSUA 4Q5OA 2IXJA 4W6XA 2ZKLA 4CDQA 4AEDC 3FE5A 2WT0A 4QWNA 4TN7A 2CDOA 1RJ8A 1GKBA 1M06G 3OBAA 3RZLA 2P6HA 1H1MA 4PT6A 2ZACA 4AVSA 1CONA 4JGZC 2EXJA 2Y6FA 1IGOA 3I49A 1AXZA 1A6CA 1X36A 2WS91 1O5LA 1DHKB 1OOPC 4RFT0 1ND3C 4Y1YA 3O1PA 1SHWB 4FPKA 1K5MA 4NUBA 2FDFA 4XOGA 1DLCA 4H7LA 2FDJA 1D0GA 5FY5A 1WCQA 3RZMA 1PK6A 5FZ8A 1OA4A 5FXWA 4DZGA 1HX6A 3RI8A 3RMYA 4RQPA 2RR11 4CP9B 2ID4A 1O4TA 1VBC3 2P37A 4PI0A 1Z7S1 1C8M3 4XDPA 4HT1T 4AFDA 1NLRA 1RUE3 1EV12 2GNDA 1FPN1 4K1YA 3NNGA 2WSVA 1NQDA 4E4ZA 5C7GA 2GMEA 3VDDA 4LBKA 4JV4A 3MPPG 3VKNA 1CAVA 4LBQA 5LASA 2CV6A 4LR4A 4KMQA 3T2TA 5EP9A 3NAPB 1XE7A 4Q27A 2PAMA 1LHOA 4YM2A 4BOWA 1WBFA 5FKCA 5JOWA 3M8LA 5ACA2 3MV01 1KDKA 1V6IA 2D6PA 3VBHC 1QJY3 1XQNA 5AC91 4DRRA 2ZGOA 3RGBA 3PU3A 4NOTA 4XE9A 1LOBA 2BGOA 4DXSA 3T30A 2CHHA 4LE3A 2DU1A 4M4RA 4ATFA 3M3CA 3UGHA 1GZWA 3AZVA 1FYUA 3NQHA 5E16A 5DABA 1QXPA 1CESA 1RUC2 1YQ5A 4AI1A 1YXWA 3IIIA 5T50A 5D8AA 1VBD3 3VGIA 3MGUA 1UPIA 2WA4A 3WSOA 5K7PA 2BW8A 2QQIA 4O61A 4TLFA 5IK5A 2AZ5A 4XF1A 4D0QA 3GYDA 2RDRA 5FMBA 4WM8B 2NP0A 4IEVA 4KWJA 1NT0A 4HPKB 3ZYPA 2GNMA 2TBVA 2BYVE 3HBZA 4QX0A 1VP6A 2DCYA 5GLZA 1D2SA 1JZ8A 1JYXA 3LF7A 2GC3A 4I3GA 4D6SA 1UMZA 3HNBM 1ONAA 4M4PA 3FN9A 4QX1A 3POIA 4M00A 2SLIA 4CVUA 2NN8A 2QNKA 3K48A 4R4ZA 5KBFA 4P9XA 2VTXJ 3FUQA 2CY6A 2CGNA 1NLSA 1RXGA 2EXHA 2YV8A 1QH6A 3USUB 1IPKA 4ZHNA 4YZ1A 4F7ZA 4PLNA 4UOJA 4A7ZA 2IZWA 4WM7C 3TBDA 2Z2SB 3KSCA 3ZYRA 3FC0A 4KGGA 5CADA 4RR3C 3SKVA 5C3QA 4NN0A 1SPPA 2VZUA 4BLJA 4BQ4A 5FXVA 3CBNA 2BGPA 4QGLA 1XYNA 5HCBA 1BLZA 3VZJA 4FO9A 4GWNA 4XTPA 5I91A 1RB8G 2BU9A 1WW4A 2Y6JA 4X8NA 1SBDA 2RDQA 2MPFA 4Q0QA 5A7NA 3MIDA 1OLQA 1W6NA 2HWC2 1RUG2 5FO8B 2PN5A 1ULGA 1LOCA 3WNOA 4KI5M 5EJ1B 5KXDA 3RI9A 3C7GA 1VRH2 5LY1A 3HWJA 2VZPA 2V72A 5F2WA 4QKFA 2X53S 5F3EA 3ZXEA 4AAPA 5A33B 2TUNA 5KXCA 1TNRA 1KFUL 3ELNA 2G9FA 2VBPA 4LEJA 4AVAA 2GMMA 3EQEA 3LKJA 3J8F3 1R092 5E89A 2ZZQA 1NE4A 1UY3A 3POWA 4YW5A 3AJYA 1DG6A 3DXTA 3GXUA 5FZDA 4EN0A 3KV6A 2WZPP 4CCNA 4COWA 4MHUA 1COV1 3B93A 3BALA 5FTTC 3V56A 3HN3A 4MZUA 2XWBB 1UY4A 1H6XA 2D40A 5C70A 4NHMA 4PJYA 4ZZ5A 3LD8A 3MO4A 2WNEA 1ZBE2 1MS1A 2ADDA 2ZGMA 3WUDA 2QQUA 3A21A 5IHRA 4RGGA 2WIIB 5FO7B 5BNNC 1GOGA 1A3KA 5A7WB 1XNTA 5J36A 2WQ8A 4DIQA 3H8XA 2WBKA 4RHV2 3V0BB 2UURA 1WD4A 4AI9A 5L7OB 4LBLA 4UF0B 5FJHA 4UFJA
chains in the Genus database with same CATH topology
1F5JA 1EAH2 1MS4A 1RUD1 1LOFA 4K40A 1EY2A 2BNMA 3W59A 1CAUA 5LEKA 4META 4P5HA 2O8OA 1IOAA 5T5PA 3ACLA 3MFCA 3N4MA 2XL9A 2A3YA 2WNVA 4WM8C 2PA7A 3B9IA 1CAWB 1NXD1 5AFBA 5I0RA 2A70A 2JE7A 4JGYA 2DUPA 2ZABA 1N3OA 1ZRCA 1HRI2 4Y1VA 1YYNA 3MIHA 4Q4X1 1RUI3 1QQP1 3FZ3A 1JUIA 2C0ZA 3RYKA 3E6BA 4AHWA 4Y20B 4P9LA 3IKWA 2HWD2 2A3WA 2XJQA 4UXAA 3AZXA 1WLCA 1OFNA 5C8CB 1GV9A 2VOKA 2NM1A 4XYXA 3WQ1A 3JB8A 3E5UA 4Q4V2 1GQHA 1XYOA 4GMP3 3VBSC 3ZX7A 4PDWB 1QJX3 1LHWA 1X33A 2MEV2 3LA7A 5EWSA 1AL21 1RUF2 1G9BA 2G9GA 3OPZA 1EPWA 2OIIA 1CX4A 1FV3A 2QE3A 2ET7A 1RUJ2 2FBEA 2XUMA 5DUWA 1JTZX 3WQ0A 2H6CA 1NXMA 5BNOB 2R062 2IFRA 1Z78A 3ME2A 3QCWA 3INAA 3MZHA 1S0FA 4DY3A 1BKZA 2WQZC 5KWRA 5I8TA 3RJ2X 2RM21 1NY72 5HXVA 3E6DA 1AL0G 3D4KA 3AM2A 4OVEA 4L99A 1W39A 3SCHA 2PLV3 2WLQA 3VZLA 2XJRA 5CAZA 4PBPA 1BEV2 3JB4C 3B7MA 4UW5A 4F3JA 5HBAA 1QY4A 2DVGA 4W65A 4IEYA 1NA1B 1V6NA 1J3QA 2DURA 1F9KA 1APNA 2VQ0A 1POV3 1LULA 3RSJA 3AYEA 4ITCA 1ZVFA 5BY5A 4OHXA 1RMU2 1VBC1 5EZWA 3ECQA 2Q1ZB 1C8M1 4FXKB 3RJRA 4NWVA 1RUE1 4AQTA 4HKOA 4JTNA 1PO22 2ERFA 1LKNA 2VMHA 5KHKA 1WCKA 3LSDA 3I2DA 4Y1UA 3VBFB 4Q0PA 3CO2A 1W2UA 1YLLA 1RC6A 3ZXLA 4LHNA 2VUAA 3A0KA 4V1PA 1QJY1 3OYWB 4MXVA 4YM0A 1FT9A 1J58A 1FNZA 1MZFA 1BMV1 2CWSA 4QPIB 1IKPA 1RJ7A 4XDQA 5T5OA 2XLFA 3MIBA 4WZFA 2D6OX 1OD5A 2ILMA 2RS12 1VBD1 4BE3A 2VXRA 4KWLA 3HD8B 3MIFA 4M3CB 3OD0A 1SBFA 5C8CC 5LK7B 1VAKA 3CLPA 4QD2A 4PQ9A 2JG9A 2VNOA 1O3QA 1QHDA 1A78A 2ZHKA 2VOWA 4OULA 2OUJA 2PYTA 1H2LA 5K0UB 1YFUA 2VOVA 4QU2A 4BM8A 4E4DX 1DF0A 3D5OA 3ZSJA 4U2AA 2JD4A 3ZO0B 4B4RA 2R073 1O4YA 2B5HA 1AR82 3ZN6A 4XIOA 3TN93 1G7YA 1ZRRA 3LAGA 4GKYA 5F6LB 3NV3A 4YG6A 5A32B 5JPNB 3CJIB 4K9SA 1W6PB 5DZFA 4YRDA 1D0HA 2XPJA 1W6QA 5GLWA 1OQEA 2R042 2K2SA 4R52A 3ALQA 4LLOA 3VBOB 4WBBA 3VKOA 4ZU7A 2A5ZA 1DQ6A 3ILRA 1DBNA 4HSJA 4GB33 4E4SA 4QHBA 3H7YA 1MZEA 2PHXA 5ABJA 1ULDA 4EN8B 3KD4A 4AHYA 1W6OB 4YYOA 5BYNA 3I4IA 3J8F1 4BPZA 1AJKA 1JYIA 4CDWA 4LO4B 5IT6A 2ZGTA 1ZZ7A 1XRUA 1SCSA 2V09A 1SLBA 4Z07A 4FPYA 1RUNA 2ZX2A 3HT2A 3VKFC 1G6NA 1RUOA 3RG0A 4AI0A 3M2MA 5GZFA 5IK4A 2ZKNA 3D0JA 3VBFC 2HWF1 3M3EA 4XF3A 1AR62 3TWIA 2DTWA 3FWEA 4W6WA 2DYCA 2YXSA 3URFA 4I2OA 3CF6E 4LUMA 4BIOA 2Z42A 1ZRDA 1FX5A 1VBA3 5LRRA 1OQDA 1REFA 1Q5OA 1FV2A 3PVOA 3MLKA 3B02A 2GDFA 4GQ7A 1W6MB 1IS5A 2E51A 1FATA 2G4IA 4QPIC 4CDUB 3OJBA 1Q8VA 1X50A 2DF7A 3RDIA 3H1WA 2XJUA 2QDNA 4KQ7A 1ZZBA 2E7QA 4N53A 2HWE2 2QVSB 4LBJA 2YY1A 1AJOA 3VZKA 4F83A 3VLBB 4ES8A 4HK8A 4YGEA 1FXZA 5FPZA 2A6ZA 5FPXA 2WT2A 4GH4A 2XVLA 1N1SA 3O5SA 3NW4A 2W39A 3WDXA 1RUI1 1UIKA 4QPGA 1DGRN 5K0UC 5IK8A 1HIXA 2ES3A 3MW3A 3PVBB 2PHWA 4QM8A 1RUH1 4L9BA 1AZDA 3JQWA 4WVMA 5FREA 2GAUA 4IERA 1G9AA 5DG2A 2WSUA 2HYKA 2WFF2 1VBE2 3E97A 2XVGA 1AX2A 4RQPB 3U10A 4GMP1 4MLOA 3JU9A 2FMYA 4DS0A 2ARXA 3EBRA 4HL0A 1S0JA 1FOD2 3HN1A 4WVWA 1O4ZA 3ENRA 1CAVB 1ASJ2 3KZ4C 1QH7A 3EHKA 3AKTA 4LBQB 3VBOC 1U5YA 4AWDA 4AVVA 1C1FA 4AQ6A 4I0WB 2A6VA 3WUCA 3I59A 3R4SA 1IPJA 1R083 2EF6A 4Q4W2 3VKMA 5B2GB 1TMF1 3SXWA 1BBT3 4P9WA 5JI7A 4XJUA 1GZWB 3TNQA 3AP4A 3S7EA 3BODA 1FNYA 4EWDA 3TRSB 1RVF1 1SDWA 4X8PA 5IUQA 1QKQA 1Z0HA 1UW8A 5DZEA 1ZM1A 2BFUS 2PLV1 4M01A 3VHRA 3ZXDA 2XL7A 4QGNA 4XJAA 4A7KA 4N90A 2ZHLA 3AFKA 1OA3A 2Q1MA 5HCAA 1RTVA 3JBG1 2DVBA 1D4M2 2DVAA 1MVEA 1PVC3 2GSYA 3AKPA 4G4FA 1GANA 1Q8SA 1RITA 1VR3A 4LBMA 4IV1B 2VVEA 4CDUC 2PHFA 3KQRA 1HQWA 2X29A 4YGDA 1V6LA 1WLWA 4QPYA 4AVTA 4JDMA 3GHNA 2CGOA 2PAKA 3K51A 5ACA3 3FFZA 1CIWA 5F6KA 5C8WA 5C9AA 2P34A 1ENRA 5KC5A 1COV3 4I0AA 1HXS3 2Q0AA 4OFGA 4IV3B 3SCFA 4JGZB 3MF9A 1RUC3 1ND2B 1U5XA 5JZGA 3G6JB 3KGZA 2VQAA 3M3QA 1DGWA 3CEWA 2DUQA 4H55A 1AYN2 3H1MA 1AXYA 1N1YA 4HK9A 2YUEA 1JUHA 1AYM3 2CGPA 1BQPA 3RYPA 1S0BA 4Y5Z0 1W0OA 4BHPA 2RS32 2FZ1A 4RQPC 2BNOA 1PIV2 2Z79A 4FPHA 4P9YA 2JXAA 2KM2A 1PNGA 4Q0VA 3ZSKA 3WW4A 1MEC3 5C4WB 3C2UA 3N35A 4AEMA 2LTNA 2ZGPA 5FMOS 2A3XA 2R071 1H9WA 2EXIA 3DN7A 3H50A 5EV7A 5JOXA 3WINE 1KS5A 4M3CF 3TN91 2ZGUA 3AXDA 4E9KA 1ZZ8A 3B3QE 2WS92 2JEMA 3WDTA 4OLLA 2ZBJA 5E88A 4K1ZA 3WP3A 1H0BA 1XU1A 2XHKA 3VBRA 4XFFA 5L73A 5CFCB 4QQLA 1ZRFA 1S1AA 2D6MA 3MIGA 2WNVB 4DINB 1UKGA 2RR12 3BOPA 1LESA 2GH8A 1Z7S2 3MLJA 1S0IA 1FPN2 2R0HA 4AI2A 2IXIA 4LBOA 1GNHA 4GB31 2XJPA 3IBMA 4AFCA 2CTVA 4Y22A 1REDA 4FTEA 1S55A 2K9ZA 4BLIA 4XQ4A 3H9AA 4D7SA 5AC92 4JCKA 4IV1C 5I8YA 4FOQA 2RM23 1HKDA 4YW4A 3FJSA 4OHWA 1QDCA 4IV3C 2Y38A 3WD5A 2VULA 3DF0A 1ND2C 1VBA1 4XW3A 4H14A 5GLVA 4B7KA 2HWB3 2GU9A 2QZ3A 5AFEA 1NQJA 4E2QA 1Q56A 4IEXA 3IIAA 2OVUA 1VIWB 4CEWB 3R4UA 3QH6A 3J9SA 1ZNPA 1PMIA 2NLRA 2X5IA 1V9U1 3WNXA 3TYJA 1FMD1 2QZ2A 3THTA 3VHPA 1XYPA 3KMHA 3ZPYA 4BWOA 4A3XA 4KU8A 3VZMA 4OHVA 4CP2A 1Y9QA 4XJZA 3SISA 3ZMOA 4AI8A 3PMEA 3KCXA 3VV1A 1VBB3 5DDJ2 5C4WC 1S2BA 2QDRA 4QMAA 1RINA 4Q4Y1 3BPZA 1KD7A 3ZXKA 1C57A 3L9JT 3PNAA 5EJ3A 1WCDJ 3ZSEA 2BPA2 3L2HA 4YW3A 1NG0A 1ZZ9A 1RUF3 1BK1A 4EV0A 2P3JA 1PZ9A 1RIRA 4PIYA 5JSPA 4Q2FA 3A4UA 5JIAA 3AKQA 3QACA 1HRV3 4JC1A 5CFCC 1WLDA 1PHMA 5K8SA 4FTBA 1O7FA 2WNVC 2D97A 2BWCA 4TZDA 1OMIA 3AX4A 4XMAA 1YNAA 3DPRA 1R081 5KC6A 4AGVA 3FLRA 2XLGA 2YROA 3ZFFA 4B4QA 1BBT1 5JDBA 5J96B 3PVNA 2R30A 3SNMA 3AMHA 2K0GA 5CG8A 2AYHA 1RUD2 3VBSB 1VAVA 2AR6A 1YO8A 2D93A 1WCSA 4C90A 3B5LB 2JG9B 3GZTB 4MUVA 1AX0A 1LOGA 2XBO3 4R9BA 3OY8A 4G9SB 3MEPA 4S2GA 2VW0A 1LHVA 1QJU3 4OHZA 1PVC1 1EV11 5T52A 1UZZA 4MX3A 2UY9A 4G3YC 4HKLA 4TYSA 4KH9A 4AEDA 3IPVB 4XTMA 2FZ2A 1CAXA 3H7JA 4FP2A 2RS53 3ZXFA 4CEWC 1O3RA 3WG3A 1PVXA 4Q4X2 1JHNA 1QQP2 4XILA 4RS5A 5ACA1 4YVSB 3CL1A 1V00A 4KBBA 2TEPA 4YZ5A 5LRSA 1HXS1 4QXKA 1IZ3A 4QQOA 1RUC1 5T3NA 2HWF3 2HEWF 3AZYA 3ZIXA 1U5IA 4LO7A 1C4RA 4K21A 5FLIA 2C1FA 1HV1A 3NSTA 2B7YA 5I0TA 1AYM1 1UIJA 5ABJB 1XNKA 4Q26A 1C3HA 4FBFA 2WC2A 4NWWA 1Y3TA 2CAVA 1IHMA 4AW7A 4HETA 3CJXA 1OA2A 2BNNA 3CU7A 4N9HA 1B35B 1YJLA 1MQTA 1NYWA 3WDYA 2V5YA 4JAAA 1WUVA 4Q1RA 1GR3A 4GWMA 2F4PA 4GXLA 4AQSA 1MEC1 4FPLA 4RA0A 4N7IA 2NYYA 4RL7A 5CB7A 3WDVA 1WW6A 3FHIB 2JICA 4FXGB 3V0AA 3CNAA 4J1WA 2VUJA 4BA6A 2DCZA 2NMOA 1RHI3 1LJ7A 4MXWB 3V64A 4DRVA 4AE2A 1RUH3 2QKDA 3SITA 1GLHA 2HWC1 1V70A 4K7JA 4Z8BA 1LEMA 1OI6A 3TOJA 1S0DA 3RZZA 1VAMA 3NKGA 1DQ2A 3GBFA 4BMEA 5JOZA 1Y43B 1VBC2 4FPEA 4XBNA 4LT5A 4KGQA 1C8M2 2JG9C 3ZYIB 1I9RA 3WCRA 1KQRA 4WM7A 1CN1A 2XB6C 2XGXA 4FPJA 2A7AA 4DXZA 4LO5B 4RR3A 1UPSA 2OZ6A 2ZX3A 4XHXA 4YW2A 2ZHNA 1N1TA 1TMF3 2ARBA 1LU1A 3JUUA 4ISQA 4WVMB 3R6SA 4BZ4A 2DCTA 1QJY2 2P3KA 3DV8A 2H0BA 4RHV1 1H4GA 2VG9A 3NO8A 4YVSC 1RVF3 4FQZA 4JQRA 4K6BA 4UW3A 1EAH1 5H9RA 3N3HA 1VBD2 4NPRA 1ENXA 4CP0A 4XF0A 3R05A 4OI0A 3FFQA 2XWJB 1ENQA 2ZHMA 5H9QA 2HWB1 5DUUA 4TWTA 3MPBA 4SBVA 3JBG3 1AR73 2A6XA 3I59B 1H4HA 2WNUA 1IQAA 2RMU3 1DIWA 5I8SA 5BV6A 3WHUA 1LTEA 1GBGA 4Z82A 1V6JA 5ABJC 3JD73 5BPXA 4QX5A 2LALA 1HRI1 1GFF2 3MICA 3PHMA 5JWPA 4D69A 3SCGA 3DGTA 1PGL1 1B35C 3NAPA 3NVCA 2OZJA 2QJVA 1UZYA 4AEKA 4HKWA 1NCQA 2HWD1 1VBB1 3R4DB 4MGYE 4YM3A 1SCRA 1PO13 1J1LA 1AHSA 1DGLA 5KHIA 3NV4A 3MW2A 1QOSA 4MH0E 1JN2P 2MEV1 1RUF1 1WD3A 4PIXA 5J7MA 5C6CA 5LK5A 5FO9B 4WM8A 3RPQA 2Q30A 3WLUA 5BNPA 4HPKA 4YGBA 1RUJ1 4IL7A 2WZR3 4GULA 3WVJA 3U4XA 5E8AA 5CFDB 4Q4W3 5C9AB 1HRV1 3J8F2 2XLAA 4COVA 4PCRA 1H2MA 5CNAA 4OI4A 5GKAC 5JZGB 3QH7A 3M3IA 1SEFA 2GNTA 4KU7A 3S30A 1NY71 4WVVA 3ZFEA 3ETQA 5GALA 4QPGC 1QNWA 4WVZA 4ZXKA 2DCJA 4MYEA 1VALA 4OI1A 1GQGA 4YVWA 5CBLA 3SHRA 4TSVA 5F9TA 4IEPA 1LENA 1BEV1 4LLFA 4CDXA 1B09A 3SLIA 2D44A 1D4M3 3ES1A 3GHMA 3TNPB 4D7YA 5FOBB 4ZU4A 4GALA 4XPVA 1KS4A 3SMHA 1LGCA 1D4VB 2XBO1 5JAXA 3ZYGA 2BGCA 2ZGNA 2YC0A 1MS9A 1QJU1 2XJTA 3GZAA 1TME3 1OPOA 4AYUA 2E7TA 3NV2A 1TEIA 2WL1A 1BVP1 2RS51 3O0XA 2F6BA 4XJ9A 1R1A2 4I01A 1RUI2 5EYXA 2OPKA 1IKQA 1Q43A 4HBNA 3R0RA 3KT1A 2GC0A 2WA3A 1DQ4A 2R32A 2UY8A 1LGNA 5AVPA 3C3VA 2WJSA 3I7DA 2JG8B 3I8TA 1ZBA3 2H0VA 5L7OA 1YUDA 3DUIA 4EJRA 4DFSA 1QJX2 3KLSA 5JI9A 1CGPA 1LOAA 1DZQA 4NHLA 4BMBA 5JSOA 4AXOA 2VOXA 4OZXA 3DKWA 3D82A 4Y4YA 4Y22B 1GYKA 1ALYA 4W6YA 5KHGA 3MI8A 3AJZA 4RD7A 5JCTA 4XQDA 4EWAA 1YCIA 2B8MA 3AKRA 1V9U3 1SLTA 1X82A 2PHRA 1FMD3 2VPVA 1QU0A 2A73B 1G8WA 2GNBA 3RWNA 2YZ4A 5CFDC 1J3PA 5T54A 4CDQB 5C9AC 4X6QB 2EVXA 1AR93 4CZSA 4CRQA 4NR1A 1DQ5A 2CL2A 5EYYA 1OSGA 2UWBA 5CIRA 5JZGC 1PZ7A 1RHI1 1ZA4A 3AMPA 2PLV2 4ZU5A 4KG0A 3ST7A 1PGW2 4Y1XA 4Q4Y3 3PLQA 3LOIA 2RJKA 4LBNA 1K5MB 5C8CA 3TB0A 4LULA 1QXJA 3WW1A 2ZMNA 3J26N 1PK6B 2GZWA 4PDWA 2X5IB 4LHKA 4PLMA 4YZ3A 4AVCA 4YARA 3H8UA 1UAIA 3VL8A 3LB9A 4CEYA 3AK0A 4KL1A 1NE6A 1DYPA 4HSLA 2A75A 3A0NA 2XVKA 3O14A 3VDDB 4MGKE 4JRAA 4AQ2A 5BNOA 3ZN5A 4FAGA 1PGSA 1TNFA 3ZN4A 1ZZ6A 4E27A 3VZOA 1UN1A 2KA3A 3SH4A 1OQ1A 1AR61 1MS5A 4WV8A 3E5XA 1H30A 4XBQA 3BCWA 4YGCA 1GNZA 3OGJA 1N3QA 4K3UA 2PHLA 3RNSA 1U5ZA 4I02A 1N1VA 4N43A 3VL9A 4Q8KA 4S2FA 1L3JA 1HQNA 4Y24A 4PIZA 5D8AB 1GZ9A 3ZDSA 2ZGLA 1V6OA 3QD6A 2RHPA 5T55A 1X7NA 1H1IA 3UKNA 3FMGA 1NA1A 1G86A 1YFYA 2VU9A 2JG8C 5J09A 4XFGA 1KXGA 5JSRA 3GBWA 4M0HA 2HWE1 1AR71 5GZEA 5AVAA 2YGMA 3DPRB 2RMU1 1EV13 1R1ZA 4BYYA 4AFBA 3HT1A 1FI2A 3JD71 4E2GA 4KNCA 4LNVA 3UV9A 5JOYA 1NCRA 1POV0 2R0FA 3PMSA 3WZ1A 4N7UA 2R072 5JMCA 1DDLA 1E57A 1BYHA 3TN92 1KDMA 1QXRA 4HFSA 3JQXA 5DUVA 4QQ2A 4L97A 1ZYBA 3ZVXA 4YSFA 4CDQC 1JXNA 1WW7A 3ATGA 3WOGA 2C9AA 1PO11 1DLLA 1H8TA 3OY8B 1W6NB 3UJQA 4FQ4A 4DB5A 1O3TA 2ZMLA 4XFIA 1UX6A 1XU2A 4L92A 1OFSA 2UYAA 1H2NA 4M3CA 4EN7B 1K5MC 4AGRA 4FPCA 3N7MA 2PFWA 3OBRA 4GB32 1PK6C 2WZR1 2X5IC 4IEZA 4RS5B 4DPNA 5I93A 5HI0A 4Q4W1 5FQ0A 4DOUA 3WW3A 2BFUL 3RMXA 3N7JA 2OYZA 3H3ZA 1PM7A 5KHHA 3WQ7A 2UWAA 3WP6A 1AX1A 1MR5A 4AK3A 4B7EA 2RJLA 3VDDC 3UK9A 1OHFA 4K8FA 3MW4A 3TAYA 3VHOA 5A32A 3CJIA 2IFWA 2YGLA 2BWAA 2ET1A 5JR7B 3LCPA 5FDBA 4YG0A 1MS8A 1HDKA 1VBA2 1UU5A 3WX5A 3ZSMA 1CAUB 2HWC3 1RUG3 4BIFA 1Q8QA 5J98B 3UL2A 1D4M1 3KT7A 1H9PA 1VRH3 3BB6A 4PF5A 2ZJCA 3VBOA 1MQTB 5D8AC 1KRIA 2EXKA 2GALA 5KXEA 2DVFA 2W08A 3AYDA 3HR9A 1WLTA 1R093 1ULEA 1I6XA 1S0EA 3Q9OA 4JGYB 1TME1 3LWCA 3POYA 4FPFA 3V65A 3ASIA 3V0AB 1W6OA 1DFQA 3FX3A 3VBUA 2D43A 2FMDA 1QGLA 2O0OA 5FOJB 1NOVA 5BXXA 1DGWX 3VKLA 3DPRC 4R8HA 2E7AA 3ZFFC 2TNFA 1ZBE3 1D2QA 3IMNA 1F8VA 3W9AA 2W68A 2Y0OA 2I74A 5FFOC 2GC1A 1LOEA 1CJDA 2ZX1A 3VUOA 2CYFA 4RHV3 5I0SA 5LEJA 4LUKA 1LHUA 2YPJA 1EAH3 4AI3A 1UD1A 1ZBA1 2FHRA 1LR5A 4PLOA 3NL1A 2ZX0A 5FMOL 4RGAA 3LGRA 4CDUA 5HCFA 3E6CC 4HVQA 2A6YA 3AB0A 4FCAA 4EROA 1MACA 2IXCA 4DMIA 4NHKA 1R082 2DFCA 3GALA 3OTFA 1HRI3 4IXLA 1BBT2 1AXKA 4ASLA 4Z92B 4RS5C 1AUYA 3ZFGA 1AR91 2C5DA 2NMNA 2EA7A 4JVAA 4R9AA 2AUYA 2GN3A 1IS3A 4XMIA 3B00A 1UU6A 2HWD3 4UBGA 2DTYA 4XF4A 3NKTA 5GJ6A 1QOTA 3PJQA 4D3WA 5DUXA 2DCKA 4Q4V3 3AP9A 1DQ0A 2WNUB 1X8EA 3KCCA 2MEV3 1PVC2 4BH9A 3AMNA 2VMIA 1LOFC 1Q8OA 4IESA 4FPOB 3O0WA 3WHTA 4F8AA 1LEDA 2GN7A 1A8MA 2VW2A 1RUJ3 1C1LA 1CPNA 1VB2A 1SBEA 1MQTC 1JW6A 1JYCA 1DQ1A 2OW4A 1ULFA 2R063 3GF6A 4R4XA 1NCQB 3LOBA 2R1BA 1LODA 3QLQA 4J6GA 4XETA 3N7KA 1F2NA 1VLNA 1COV2 4JGYC 1HXS2 1PNFA 4AHZA 3ZXJA 5GM0A 3HQXA 2EAKA 2GC2A 2NZ9A 5FRAA 3GZUC 1F5FA 1YRZA 3RQ0A 1OKQA 1BCXA 1BEV3 5GZDA 2CNAA 4B29A 4YM1A 3UKTA 1FAYA 1CD3G 4COUA 3LSEA 5BNPB 1AYM2 5I0UA 1KJRA 4MGIE 2WT1A 2ATFA 2I2SA 3M70A 4LE4A 3AZZA 2BUKA 1RMU3 1TE1B 2VY0A 4MV2A 4FTSA 1H2KA 3M3OA 2WFPA 3ZFEB 2ZTNA 4IV1A 1I1EA 1PO23 1MEC2 4HZFA 1SMVA 3IN9A 3UKVA 1C5HA 1SQ4A 5DDJ1 4YVWB 4IEWA 1GICA 1IS4A 3ZN6B 4CDXB 2AREA 5FLHA 1AF9A 1SLLA 4WZCA 1QWRA 2BVBA 4IV3A 5JPMB 5KHJA 1OPMA 4JGZA 2UU8A 2OA2A 1ND2A 1XXNA 4HVRA 3WDUA 1OOPA 1ND3A 1A8DA 1GZCA 2R16A 1W6QB 3D8CA 4QM9A 2CAUA 4I30A 3QBQA 2RS13 4QQPA 1CQ9A 2ZAAA 4GIQA 4XJWA 5CVRA 2YYOA 1ZZCA 3LA2A 3ZSLA 1O3SA 2JE9A 1AL22 2NPIA 3T1MA 3ZYJB 2WNUC 3VN4A 3HAGA 2PHDA 1WW5A 3O0VA 3FUOA 1UKRA 2D6KA 1CR7A 4CDWB 1KFXL 4E2SA 2MHFA 5C4WA 2PHUA 4HN1A 2E9QA 3M7AA 1TQ5A 1AR83 3VBHA 3NAPC 3ZXAC 3USSA 1JH5A 1OLRA 1GSLA 2D3SA 3NV1A 1NCQC 2P17A 4FP3A 2RM22 2JECA 4HANA 4LA2A 1HV0A 4GKXA 2UWCA 4M3CE 4COYA 3OCPA 3MYXA 3H0OA 2ZOEB 5TSWA 4LHLA 1XNDA 2R043 2OUHA 2HWB2 1RUG1 3FLPA 5CFCA 4BCUA 4KWKA 4AGGA 5KXBA 1VRH1 1WA4A 2EIGA 3LZZA 2HJIA 2VECA 4N9IA 3PJYA 4N53B 5BNPC 4ORFA 2YMZA 5CG9A 5T5LA 2WLPA 2E6VA 3WV6A 5JVVA 4B4PA 4FT8A 3PVEA 1R1A3 4R9DA 1R091 4GH4B 4KG8A 3N7LA 4JTOA 1PGL2 1RUE2 1QF3A 1I5ZA 5GLUA 2XKPA 3ZMNA 4C91A 3IWZA 4HLTA 2ENRA 4QPGB 4H3WA 3ZFEC 3S0MA 1VBB2 4YW1A 2QFEA 1UCXA 4DY5A 2ZCWA 1ZBE1 4YZ4A 1AR63 2B46X 4AEJA 4YVWC 1BJQA 4LO6B 4CDXC 2DWRA 1U12A 1WBLA 4P9IA 3BU7A 3JZVA 3D6EA 1DU3D 1BMV2 2PHTA 4CEYB 2X8KA 4SLIA 3O7OA 5D1IA 4Z2WA 2YHJA 4XXPA 3WG1A 2H6BA 2D98A 2JENA 4CEWA 1HRV2 1LB2A 1WMDA 2HWE3 5JIUA 1HQLA 4AFMA 3WG2A 4BQ1A 4JRLA 2WINB 1LECA 3S7IA 3O12A 5SV8A 1H1AA 1YWKA 4XIKA 3POSA 3KB5A 4P9JA 4FVVA 3MIEA 5EXOA 4XFCA 3M4FA 1YHFA 1SFYA 4N43B 4DQAA 4FPGA 4CDWC 2BVVA 5BNNA 1LU2A 4MSVA 1J3RA 4B8EA 4FOYA 1SLCA 2LM3A 2NQYA 3WXPA 4AHXA 4Y26A 5L7OC 3THPA 1URXA 2WFF3 1VBE3 4Q4V1 1BZWA 4K20A 3HMYA 2XBO2 2AGSA 1QJU2 1YIFA 1FOD3 4C0BA 4IEQA 1JOJA 3ILFA 5J48A 1NZCA 2BTVC 1NCRB 4HMZA 1ASJ3 3N36A 1V6KA 2EALA 3DL3A 3AP6A 2A6WA 2RS52 3WCSA 4N53C 3MDPA 4S2HA 3KT4A 2R061 2ZGRA 2DFBA 1ENSA 4HVOA 2ETEA 3W58A 1VB4A 3VZNA 2Y0IA 1XNCA 1O5UA 4GH4C 1JBCA 3USUA 1H8TB 1SLAA 2N7GA 1YJKA 2ZA9A 4YFWA 3SH5A 5BUVA 1MS3A 3RS6A 2VGDA 3RYRA 4UW4A 2D6LX 3IDBB 3H3UA 2HWF2 4X6RB 4XFAA 2SBAA 1C28A 1CJPA 3T1LA 3VBSA 4C1XA 3WY6A 3U07A 2QCSB 1BVVA 2WQ4A 3M1HA 1RL3A 4PDWC 3WDWA 4AFAA 1RGSA 3IDEA 5H9PA 1MZ5A 5L36A 4FSJA 3EXUA 3KCYA 3BTAA 5FQ0B 4ES9A 4Q8LA 4QGMA 4CEYC 3WP4A 3AYAA 2BBVA 1RMU1 2IC1A 2DU0A 4CTEA 2ZGKA 1CPMA 1LCLA 5A33A 1DZTA 2QUOA 3AMQA 3IPVA 2R6QA 3GNEA 5BNOC 1PO21 4L2NA 3VHNA 3OF1A 2UYBA 1J1TA 4NVPA 5JLVA 4AG4A 3AP7A 2QQPA 4YVSA 3EJKA 4MVTA 1QNYA 1O91A 1KJLA 1RHI2 2LUWA 1VJ2A 1LRHA 2MNGA 2B9UA 1S0CA 3FBYA 1RUH2 3B69A 1AYN3 3L2YA 4N43C 4GA9A 4URTA 3VBRB 3AKSA 3OGGA 3WG4A 1N3PA 2AH2A 1N47A 4ASMB 1SFNA 1U0AA 3V0BA 3P3NA 2RS11 1NA1C 2B39A 4YLZA 5DXDA 5DZGA 1Q8PA 4EN6B 3APBA 5K9YA 1HW5A 3VBUB 2RS33 3AMMA 2I45A 1LHNA 3B01A 4P14A 2O8QA