4AEKA

Structural and biochemical characterization of a novel carbohydrate binding module of endoglucanase cel5a from eubacterium cellulosolvens
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
b'GDIVLFSGSKHVEFTDWGGTDWPSAYELQPPYQTMPFDLNKNFEIKVDYSGADIVLIFARWEHGSKPQIWAQISPYYVVDGTAVFTKEQIAKAYGSDDFSDLDYIGVKPLPSADGMTVTKIVASYTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE CEL5A
publication title Understanding How Non-Catalytic Carbohydrate Binding Modules Can Display Specificity for Xyloglucan.
pubmed doi rcsb
source organism Eubacterium cellulosolvens
molecule tags Hydrolase
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18259 CBM65_1 Carbohydrate binding module 65 domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1070 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aekA00
4AFMA 4BA6A 2YPJA 4AEKA 4AEMA 5AFEA 4AFDA
chains in the Genus database with same CATH superfamily
2R063 4UW3A 2C9AA 1CZVA 1QMJA 3JBG3 4DQAA 3ZXGA 4KL1A 2ZPXA 2Q1ZB 4GH4A 2WABA 5FO9B 4AEJA 3WY6A 4IETA 1RTVA 4LK7A 5KXEA 3O1OA 3LA2A 3K3OA 2WS91 5FY0A 4DPNA 1GSLA 1W90A 1A8DA 4KI5M 1KDMA 1QXJA 2XQXA 3POGA 2VU9A 4JGZC 3H50A 2XJUA 4XABA 1CJPA 2ARAA 1PGSA 2RS53 3N7KA 4FPEA 4L2NA 4OCTA 3ZYPA 5JCTA 2BGCA 3FLPA 4XUOA 1W6MB 4E9KA 3P6BA 1O59A 5F5CA 5CADA 5JOXA 5FP7A 2BOIA 3JB8A 1JHJA 5FPLA 1AZDA 5FWEA 1UOJA 4Z8BA 4BM8A 4IEZA 2BZDA 3OF1A 5A3MA 1OHFA 4B1LA 2FMYA 3E6DA 2RS12 1PK6A 1R081 1QHDA 3D0SA 1GWMA 4HLTA 3TEZA 4NRQA 4IW3A 4GKXA 3HD8B 4LR4A 2JDKA 3IAPA 1FI2A 4YM0A 3VZOA 1V9U1 4QPGB 3DXUA 4QKBA 2RV9A 5DUUA 2ZMNA 3AL5A 2Z4FA 4BQ4A 3EBRA 1DGLA 4YGEA 1W2UA 2HBUA 4A6SA 4JAAA 3J8F1 4QGLA 4YNIA 4AVVA 3RMXA 5FMDA 1OH3A 1JZ4A 1W99A 1Z7S2 5B4NA 2G4IA 2GH8A 1WMDA 3TN91 1IG3A 3CJXA 3MHZA 1YC61 3GZTB 3ZKUA 3WNPA 1QJU2 4Y22A 4BXFA 4HKLA 1O5UA 3U07A 5IVYA 2AUYA 2AENA 2GNDA 4LT5A 3LCPA 1YQ6A 2JXAA 1SLIA 1EY2A 2H6CA 2NLRA 2GMEA 2LS6A 5FZKA 1J1LA 1RUI3 3VDBA 3T09A 2QQKA 2X5IC 2YDEA 2ZAHA 3DECA 4QPGC 4JQRA 4GWMA 1NCQB 1YHFA 2J1AA 1WLCA 4QX2A 1V70A 4NRMA 4NIHA 3I2OA 5G05L 4YFZA 4YZ3A 3TEYA 2EIBA 1RUD3 4MHUA 1TE1B 3I4IA 3ZMOA 3EO6A 1UU5A 2XMLA 4YW2A 4HFSA 1URXA 2XKPA 2DCKA 1QXPA 3OEBA 3RPQA 1S0DA 1UXZA 2AEZA 3HPNA 2OS2A 3R0RA 3JD71 3RS6A 3VDCA 1VE0A 1ZBA3 3MIGA 3CU7A 4ZU4A 4O9EA 4S2DA 4D6RA 1UCXA 2WDBA 1V00A 4MX3A 1UOBA 3M3QA 4CUGA 1YFYA 5BNNC 1ZRDA 2Q5TA 2ZACA 3OBAA 1L3JA 1ND2C 2JIJA 2ZBJA 3HIFA 1RUC1 3OOXA 4QQPA 4AL9A 2B46X 3AZVA 3HQXA 3O1TA 2C26A 4P9IA 3ZYGA 1NCQC 3RYKA 3VHRA 5FP9A 4PF5A 5FZBA 2G19A 3PMSA 1OT5A 4CZSA 3AFKA 3KT7A 5FLHA 1R1A3 2AYHA 3MEPA 5ERLA 1I3HA 4AFMA 2JE9A 2YC4A 2RDSA 4IEQA 1O91A 3A7QA 1S4CA 3A4UA 3OD0A 4BHPA 1S2KA 2O0OA 4CCDA 5JSPA 2RS52 4ARXA 5L9VA 3HJRA 2NMNA 4Q2FA 5DZEA 3VV1A 1US2A 1DZTA 3O1SA 4AVAA 2XJQA 4JC1A 1OQ1A 4M0NA 4QPYA 2BOJA 1OI6A 1OLQA 2JB8A 2V73A 2VTXA 3WX5A 1W6OB 4N43A 3ORJA 5IVCA 1O7FA 2OUJA 2HLEA 3M70A 1VRH2 2KD7A 2WZR3 4COVA 4YGCA 2W91A 4GMP3 5FO8B 1J83A 1JYCA 1RMU3 4LA2A 2RS33 4PDWC 5BY5A 2VO5A 3MIEA 2VTFA 5BNPB 5FMOS 1UYXA 1B35C 1IQAA 2FBEA 2RS11 4NAOA 3VZMA 2IWGB 2VM9A 4BQWA 4EN9B 4HVQA 1JYWA 2VZTA 5CYYA 1ENQA 4N7UA 4OQ8A 5E6HA 4YW1A 4IV3A 2JDHA 1RUE3 1QNYA 1WCKA 4PQ9A 4CU7A 4I30A 4Y4RA 4BWOA 4NIDA 1N1SA 3MPBA 1D4M2 1GV9A 1S0EA 2ZEWA 4IEUA 1VLNA 4C1XA 3A21A 2B42B 1L7LA 4BMBA 1XNDA 5B2GB 3AXEA 5FUIA 1WLWA 2D44A 3FFZA 2VPVA 4MG2A 3N7JA 3WHUA 1H8VA 1Z7S1 3C3VA 4K9SA 3I3QA 2YFZA 4YVWB 2DVBA 4NPRA 3C7FA 1RUI2 2D6OX 1SEFA 4XBLA 2UWAA 3UL2A 5BNPC 1S0CA 1QJU1 5IW0A 3HNMA 5LASA 5A6XA 1LGNA 3BTAA 3VBHC 4HSLA 2J7MA 2WN3A 1HXS3 3RFRA 3E6BA 2GSYA 2HWC2 3VD7A 1KEXA 4CDUB 1RIRA 4I0AA 3VZJA 2QQWA 1BJQA 3IDEA 3WD5A 3SH4A 1WW5A 4N53B 1KQRA 2DDUA 1MR5A 1Q8PA 3KCXA 3H8OA 5BYNA 3WT3A 3BIWE 4FXGB 2D3RA 1OKQA 1TME1 3U75A 1VPHA 1COV2 1LB2A 2IFWA 3ZFGC 1HQLA 1PGL2 3MI8A 3WCSA 2C5DA 3ZSJA 4BYYA 4U2AA 1FXZA 3OBZA 1NXD1 4EROA 2JDPA 4XFFA 4UWDA 5K8SA 3DPRB 3CO2A 2W1SA 5GLZA 1TG7A 4EN6B 4JX0A 4JV4A 5I91A 5FZOA 1O3QA 2CV6A 4N53C 2OA2A 3WV6A 1LENA 3LF7A 5D8AB 2V4VA 5CB7A 3MO4A 3ILNA 1NCRA 1EV13 5LATA 4CCEA 5KXBA 4M3CF 2JE8A 3USUB 1KITA 3APBA 1NXMA 3VBFB 5F3CA 5J37A 5A6QA 2VCAA 4IE5A 2B45X 1U5IA 1LEDA 1U5XA 1XYPA 3RZGA 3EB7A 4AFDA 4YVSA 1DQ6A 1D0HA 3IBMA 2WT0A 4BCUA 1RMU2 2RS32 4EV0A 1DU3D 3W20A 4BDVB 5ABJA 3HOBA 4A3ZA 2FHRA 4FAGA 2GN7A 1NAEA 1EPZA 3CNAA 2E31A 1MZEA 1MS4A 2C9KA 2QQLA 4QDSA 1VRH1 1H8TA 4Q4W3 1AR62 3PUQA 3H7JA 1REEA 3VLBB 1AX1A 3KHCA 3RZMA 5FR3A 1IPSA 2JG8B 3JQWA 3KV5A 4I3PA 1DP0A 4AEKA 1RINA 1X8EA 4AEMA 4CYDA 4DUXA 1BBT3 5I8TA 5IVBA 4UFMA 1ENSA 2VBBA 5HCFA 4EWDA 1V6MA 4AVCA 4RA0A 1GWKA 4LLOA 4S2HA 1NZCA 4MGSA 2QQJA 1ZRFA 1UY1A 1CAUB 1NYWA 2ZX2A 5J1XA 1A8MA 2VZOA 5EXOA 4BIFA 1GNYA 1OPMA 4D3WA 4FAHA 3CDZB 3JCIA 1UPSA 2LUWA 5CFDB 3PNAA 5JSRA 1KJRA 2XJSA 1G9CA 2CGPA 2JICA 1D4M1 1JHNA 1W9FA 2GNBA 3N7LA 3WDTA 1MVEA 1BLZA 4BA6A 4LE3A 5LA1A 2YPJA 1JI6A 3JUUA 2FDIA 3J4UH 3WQ7A 5LK7B 5FPBA 3B00A 2HWB2 2ZMLA 3VD4A 1WCDJ 3PU3A 3T4VA 3UESA 1HXS2 1H2MA 3KF5A 3ZSKA 3WNOA 2J22A 4DY5A 1DQ4A 4L99A 2JG8C 1RUI1 4HG6B 2W52A 1GYKA 2QQOA 5BNOB 1CR7A 4NHXA 5FOJB 1LEMA 2P3KA 3DYOA 1QGLA 2BBAA 2VW0A 3MF6A 2XVKA 1T6BX 1ULCA 3AM2A 3POIA 4UW5A 1YRZA 1NA1A 3BOPA 2HWC1 4XXPA 4AF9A 2GU9A 2OXBA 2JDZA 3CZUA 1S1AA 5EJ3A 3T0AA 3ZYIB 3AYAA 3GHNA 4BLJA 4DEVA 4EN0A 1VBB1 3I2KA 1SBDA 1IPKA 4BQ3A 5F5QA 1LOFA 1WA4A 4HPKA 4SBVA 2WQ4A 4BQYA 2ID4A 2R072 3E5QA 4XC9A 1PK6C 3HBKA 5F5IA 1UW8A 2BEOA 4CDQB 3ACLA 3GJAA 4QXCA 1PGW2 3KS7A 5A3UA 1CAWB 2QTWB 4ZKTB 1COV1 1VBA3 4JGZA 4NJ4A 4YW6A 2XQRA 5JPMB 2YG0A 2KM2A 2ZHNA 1PGL1 5FZIA 4XZUG 4RS5A 4QMAA 1POV1 4RR3B 2ZKLA 4HBNA 1W0NA 3B69A 3B9IA 2A6WA 1DGRN 4RHV2 3POWA 2Y8KA 5LBEA 5KXDA 2Q8DA 2P5BA 5GZFA 4LBQB 2VQAA 4IESA 1W6PB 1GOHA 1FX5A 3RYRA 5J96B 3VN4A 4Y24A 1EV12 4W8JA 2ZGUA 1DBNA 4IE0A 5JLVA 2JWPA 2HWF2 2J1VA 3IN9A 2GC2A 2RMU3 1DLCA 4ATEA 4BZ4A 1RUJ3 1QQP3 3SC7X 3E6CC 4KBBA 1RUF3 4E2SA 1CD3G 3AVSA 1ONAA 3LQCA 4YW7A 2WQ8A 2OX0A 3MIFA 3QBQA 5C70A 1YQCA 5LRRA 4FSJA 1D2SA 3PUSA 4HL0A 2VZUA 5GALA 2SLIA 5LCWL 4JTOA 4DFSA 1K45A 4J6GA 1W6MA 5K4LA 5J98B 3ZN6B 1OA4A 4RR3C 2QVSB 2RM23 3O0WA 3SCFA 4B3NA 5FBJA 4ISRA 2IXIA 4E8CA 3ZMNA 3OGSA 2R1BA 2JECA 4QWNA 1RHI3 2X09A 1W2TA 1AJKA 5D21A 4YW4A 5T55A 1BBT2 1W0OA 4CEYC 1ZZBA 1WCSA 2B4KA 3DCQA 3ELNA 3EQEA 4GAZA 1YFXA 4UFHA 4AQ6A 3B9CA 4QPIB 1AR61 5FDBA 3LGRA 4IV1B 5FZEA 1VAVA 4OI2A 2QCSB 4LUMA 4HXCA 1V6LA 4P00B 5E88A 1US3A 1WA6X 2WRAA 3NMBA 2X5IA 4FOYA 5FO7B 2Y34A 4QPGA 4LBLA 4A45A 2ES3A 3BIEA 5KBFA 2QQUA 4YARA 3N35A 2YXSA 3K48A 1H9WA 5FP4A 2Q0AA 4XUTA 5JI9A 1JZ3A 2ZGKA 2A3XA 3S6PA 4BH9A 4DXRA 3OGVA 3BUCA 1F8VA 5DDJ3 4HSJA 1ULEA 3LIHA 3GGLA 3ACIA 5E8AA 4QX1A 1JYTA 4WVMB 5C8CC 2XVGA 1V6KA 3QLQA 2MNGA 4QGNA 4CA9A 1Y3TA 4XDQA 2ZGLA 3TRSB 2HWB1 5CIRA 1PVXA 1PZ7A 1X82A 1HXS1 3HNBM 1XNKA 4UI9L 4OFGA 1ND2A 3AP9A 4GIQA 3LSDA 3G7DA 3VHNA 2CL2A 3P5BA 4K3UA 5E16A 4H3WA 1NCQA 4PCRA 4YM2A 1XE7A 2VMHA 1W9YA 3AP6A 3CF6E 4LIUA 3M2MA 5FQ0B 3R6SA 2ZJCA 4YGDA 2JENA 3VDDB 1YJLA 1PHMA 4QHBA 2ZEXA 1VBA2 3WNLA 4A44A 3OCPA 3O0XA 3WDXA 5A6ZA 4UFIA 1X8MA 4URAA 4HVOA 5ACA2 2R071 4QKDA 4FTEA 1OOPB 1QJEA 2Q1MA 4P9WA 2A73B 4JRLA 1PGW1 3OTFA 4DNYA 1XNBA 2UY8A 1Y7BA 3TNPB 5I0TA 4KWLA 2AZ5A 1RUG3 4ZY9A 1PNFA 5FWJA 2P3YA 3OPZA 4B8EA 2WNUB 1MEC2 1LKNA 4NHYA 1REFA 2W1WA 5FYYA 4NUBA 5JDBA 4RHV1 1RUJ2 3OUHA 1KFXL 3ZM8A 2PHWA 4PDWA 4AQSA 1RUF2 3JU9A 3LB9A 5GM0A 2F6BA 5LW9A 5JZGB 4AW7A 1B35A 2IC1A 1UMZA 2HWF1 3VDDC 3LA7A 4KMQA 4DRVA 2CDPA 4LUKA 2Q8EA 3ZXAC 2GMPA 3PTRB 4AFAA 1HV0A 1CAXB 1CJDA 1AYM3 1R092 2DCTA 4J25A 2IXCA 1VJ2A 1XJAA 1ZRIA 1OOPC 2BU9A 2R043 2YGMA 2YYOA 4NMIA 4NAMA 2RM22 1NUKA 3RI9A 3WINE 3SHRA 4Y4YA 5EZWA 1KJLA 2VMEA 4EN7B 2VZPA 1DQ2A 2JG9B 1RHI2 1PZ8A 5AC93 2OQ6A 3BKZA 1E5RA 3IDBB 4HANA 2XHKA 1XU1A 2R32A 5JWPA 4GALA 1I5ZA 1N3QA 2BNOA 2EIEA 2J42A 1NLSA 2WO7A 3C7EA 3MIHA 5A7OA 1ASJ3 3N9LA 5L7OB 3WP4A 4MGTA 5FLIA 1TMF3 1WBLA 3KQRA 1SMVA 3NJYA 4JDNA 5BNPA 3WP5A 3J9SA 1BBT1 1HRV2 3WXPA 5JZGC 4RL7A 4XETA 1GWLA 5C3QA 4FTBA 3S7EA 1J58A 4S2GA 4BB3A 3O1VA 3NAPB 1MQTB 4AYUA 3BB6A 2FQPA 4OZXA 4RFT0 4W50A 5J48A 4HN1A 4C0BA 3MW4A 1BK1A 3LFMA 4LO6B 4KWKA 5CFCB 5A32B 4TXWA 1IG0A 2K2SA 1TVGA 5DDJ2 1BK0A 2TUNA 3K77A 3PJQA 1VBD2 2W5FA 1N1TA 1YI7A 3SCGA 2JG9C 4WZFA 2ARXA 4PBPA 4OVEA 1YQ8A 2CGNA 5E1RA 2XR4A 2JDNA 2CY6A 3ZSLA 3NNGA 3I59A 2IUWA 4X6QB 3RYPA 2HYXA 4EYUA 2FMDA 5CKNA 5L7OC 4Q4Y2 3N36A 2RG4A 5FYUA 1G9BA 4MADA 2VBDA 3SH3A 4FPCA 1WD4A 3BTYA 1P8JA 1QJY3 1W8WA 2D93A 2WNEA 4AHYA 1UYYA 1AUYA 1PIV3 4M4PA 5AVAA 4A6OA 3DEMA 1W9SA 1TNRA 3AK0A 2G1MA 2PHUA 3KZ4C 4CDUA 4O65A 3ZFEC 4J1XA 3TOJA 3U1XA 4OYUA 1XU2A 1ZM1A 4HETA 4QB2A 2D43A 4XF3A 3SNMA 4N53A 1F31A 2ZGRA 3RSJA 4NO4A 3OBTA 5CNAA 5A70A 1H8TC 5K0UC 4PIXA 5CZKA 3AMPA 5GLVA 4GKYA 4IEVA 1LOAA 3GZUC 3LE0A 4LEJA 1Q56A 3ZVXA 2NN8A 1VBA1 1DGRA 4OHYA 3PVOA 2EAKA 4OMDA 1ST8A 3GBGA 2TNFA 4JKKA 5ACA1 3GYDA 4CVUA 3ON7A 4CXYA 2NQYA 2CTVA 4HOOA 1FV2A 3MV01 4XDPA 5C9AB 1UKRA 3DPRA 4BK5A 1XBFA 4E4DX 3BN6A 3N9NA 1KDKA 4QXHA 4R4XA 2WUHA 1I5PA 3PDQA 3PVBB 4JVAA 3QD6A 1MEC1 1JOPA 3BALA 2BWAA 4BQ5A 1RJ8A 3BPZA 2DCYA 4FFGA 4L0PA 4Y1XA 4QQHA 3RNSA 3KVBA 1RUJ1 3VBSB 1LR5A 1H2KA 1O4TA 2VOVA 3NV1A 2A7AA 1AYM2 4NHKA 4W6XA 5IVEA 1W28A 2PHRA 1RUF1 1XPWA 3RWNA 3UGGA 5F37A 2PELA 4CU9A 5FMBA 4F3JA 1WBFA 3JQXA 4Z2AA 5FYTA 4FP2A 2FCUA 3RZZA 4Q8KA 1W8NA 5GZEA 2FDJA 2VUJA 1NE4A 4FQZA 3CL1A 1WLTA 2YBPA 2HBTA 3KT4A 2ZOEB 3WP6A 5AC92 5F5AA 4CTEA 1R091 5A3NA 3ETQA 4C1WA 3DGTA 2RHPA 1F4AA 4LPLA 1QJX3 1R1ZA 1SBEA 4GA9A 4LBKA 1ULPA 1WW6A 2RM21 1QIQA 3IB3A 4LKFA 1ASJ2 1GBGA 2O8OA 3E5XA 1V6JA 4I0BA 4I09A 4LO5B 2VZ1A 3ZXEA 1RHI1 1TMF2 1X7NA 4QB1A 5FZ4A 3OB8A 2W08A 3ZXJA 1OKOA 5A6YA 2VW1A 5DZFA 1GZ9A 1LOFC 2I07B 1XNTA 3C7OA 2RE9A 1DF0A 2HYKA 3THTA 3T2PA 4TYSA 1UL9A 5FYIA 5L73A 2JG8A 4Q5OA 5CBLA 1WZXA 3DL3A 3LEIA 1UO9A 4XMAA 4PJYA 1G8WA 2VMGA 5FCCA 3L2HA 1HRV1 4Z82A 3DYMA 4WM7B 2ET7A 1CESA 4F83A 4RS5C 2WN2A 1ZYBA 5FY8A 2VOTA 3ITQA 2GC1A 1Q8OA 1CAUA 2CDOA 4FP3A 3INAA 2ZGTA 4V1PA 2E7AA 3ZYFA 5A3WA 4A41A 4AOCA 1NQDA 3BI3A 1H4HA 2RJLA 5LBCA 3ABZA 4XAAA 3O1RA 1LU1A 1VBD1 4WZCA 4QB6A 3AX4A 2OZJA 3NQHA 4AI2A 4Y1YA 2AH2A 1F5FA 3M3IA 2GALA 4AI0A 4A3XA 5FPXA 1BZWA 4MGYE 1UZYA 3VL9A 3NKGA 1QJY2 3CZJA 4W6YA 3RQ0A 5J3UA 4DEQA 5A7WB 1H2LA 1PIV2 5FZMA 1DHKB 1MS8A 1VBE3 3O5SA 1MZ6A 2Q8CA 4Q4Y1 4YZ5A 2E53A 3KGZA 3SCHA 4CP9B 3RZJA 4WVWA 3NW4A 5BNOA 2VBPA 3KQ4B 4QQOA 4Z92B 1LHOA 1BXHA 2AR6A 3LA3A 4WM7C 4F7ZA 3O1PA 4LBMA 1U0AA 3IMNA 1ND3B 3L9JT 5FZ8A 3VBUB 2OUHA 2YPDA 4R9AA 1AR82 5HBAA 4CSWA 2VQ0A 1JU4A 3U4SA 1RVF2 1JZ7A 1F4HA 2EALA 3HEIA 2ETEA 4JGYB 3AYEA 1ENRA 2RJKA 3POSA 1TQ5A 5BPXA 2YY1A 1BCXA 2CAVA 1F5JA 3D4KA 3KGLA 4WVZA 4A42A 5IFPA 1CAWA 3POJA 5T50A 3ETPA 1RB8G 3KCYA 4XJWA 1EUTA 3CIHA 5FP8A 3RZKA 4D6QA 4H14A 1O5LA 3OSDA 3EJKA 4RR3A 4XUQA 1TZOA 3WQ0A 2W1QA 4A2UA 2YB7A 1YIPA 3I49A 5KHJA 3WG4A 4LBQA 3ILFA 2GN3A 1ODNA 1W6PA 1DLLA 1ND3C 2W9XA 4LQRA 4XILA 5F6KA 3D5OA 2ZX0A 1VMHA 1A78A 4N8MA 4QDRA 5CKMA 4CEWB 4AI8A 4CEYA 4XF1A 4LK6A 3MIBA 5K7PA 3I3MA 3DV8A 3QH6A 1PO22 1I1EA 4BMEA 1N47A 1UAIA 1HB1A 4XBQA 5C4WB 5L9RA 1AYM1 4JGYC 3W9AA 1VBC2 5LB6A 3R4SA 2PHTA 3POBA 5A3LA 1QJX2 3U0ZA 1LHWA 1BQPA 3ALQA 1QU0A 3ZXKA 2DV9A 2HWE3 2R062 1SLTA 3JXSA 2PMWB 4MYEA 3JBG2 5GZDA 3WW1A 1XNCA 2VXJA 4FFIA 4B1MA 4FBFA 4ZHNA 1HW5A 5JR7B 4QXBA 1HB2A 1LGCA 3M3EA 3ZN6A 2E63A 5EYYA 1AJOA 1FATA 2HH9A 1Q43A 1XE0A 2OIIA 3NNJA 2R1DA 1R64A 4A7YA 3R05A 1ASJ1 1W6NA 4D7TA 4JZRA 5CU1A 4OHWA 2ZZJA 4OHVA 4KNCA 5C8CA 3N7MA 2BW8A 1TMF1 2JDAA 4C91A 2WWSA 5LA9A 5GZCA 2PFWA 1FAYA 4OUSA 1ZX5A 4E2QA 1VRBA 4QPIA 3S5QA 4MGKE 4A4AA 2WSVA 3OGRA 5HXVA 1EUUA 4HKWA 2XPJA 2WO2A 2WL1A 4QAWA 2O1QA 3V65A 4BQXA 2NM1A 2B7YA 4LO7A 1Q8SA 5CISA 4IL7A 4P14A 3RWKX 2E6VA 2N7GA 1OA2A 2VOXA 2Y6JA 3N9MA 3U11A 4FPOB 3I54A 5EHDA 3THPA 1VB4A 3SH5A 4PLOA 4ET7A 3NO8A 4MOAA 2VOKA 3OPWA 3ACGA 4LTAA 1IOAA 3I3BA 1MPXA 2XUMA 5A1LA 3D3AA 2D6PA 1O3SA 3ZSEA 4IEOA 4H7LA 1QJY1 1EPWA 1NZIA 3IZOA 3N9QA 4HN0A 4DS0A 1C57A 2O14A 1IPJA 2KA3A 1UZZA 1PIV1 4G4FA 4UXAA 1ULOA 1JOBA 1JTZX 5T5OA 2WZPP 4DUVA 1D7PM 4QXKA 2PHDA 2XWJB 5AFBA 4YZ2A 1CQ9A 5LA2A 4CPBD 1FT9A 1C8M3 5FQ0A 1X36A 3LSEA 5BV6A 4N9HA 2IFRA 2VNVA 3VDDA 1B09A 3ZXLA 1AR81 4AAPA 3BU0A 5FREA 1POV0 3SMHA 4Q1RA 2WO3A 4QX7A 2D98A 2GNTA 2D3SA 2A5ZA 1RVF1 5C3PA 5IYYA 1OOPA 1WMXA 1JS9A 1PO13 5DN2A 5IJRA 1UMHA 1TNFA 2CAUA 5FOBB 1W6QB 2XXZA 5DMYA 2O8QA 1JBCA 2VUAA 4XQDA 1UF2C 1RUD2 2ILMA 3BPSA 2W68A 3EMRA 2H6BA 2V4AA 3FBYA 4Z07A 2R6QA 1JZ2A 2CWMA 5LEKA 5GZGA 1UXXX 2WNUA 3HMYA 3ACHA 3IIIA 3FUQA 5FMOL 1M06G 2EXJA 1W2NA 3Q8FA 2DTYA 3Q8BA 2ZKNA 1ZBA2 3CEWA 1YYNA 2DYCA 5KHIA 4DOUA 1UKGA 5JZGA 3U37A 3KVAA 5H9PA 3H0OA 1J3RA 3PVNA 4FPLA 2HWE2 1OXCA 1PO21 3MZHA 5CG8A 3RDIA 3BOWA 4AQ2A 5I93A 2ZGSA 1UN1A 2BJSA 1SLAA 4FPYA 4HK8A 5DUVA 1VBC1 3DN7A 1YQ5A 1QJX1 5I0RA 2MEV3 1R1A2 2GNMA 1W8HA 4UT5A 2E9QA 1CAVB 3ES1A 3GZAA 4M0HA 4GB33 2JG9A 4XQWA 4CDUC 2R061 5C6CA 3UK9A 3JBG1 1V0AA 3GBWA 1E5IA 1DQ1A 3FFQA 2CWSA 5JXJA 1NE6A 2HWD3 5C71A 2XH6A 4OI1A 5L7OA 3IWZA 2ZGOA 4FT8A 1X50A 4P5YA 2W39A 1X9TA 2E26A 1O8PA 2RS51 2WT1A 5KC6A 2EVXA 2PHXA 2QQIA 2Z2SB 1XSQA 2HJIA 5A3PA 1SDDB 3VB9A 4ES9A 2VXRA 2X29A 5C3RA 4Y1UA 1OLME 2ARBA 2TBVA 2VMFA 2WZR2 3ZYJB 2JD9A 5J36A 3ZFEA 3V0AB 5CFCA 3DPRC 3OYWB 4NIIA 2OYZA 5A32A 4AHWA 4C90A 4F8AA 5DAPA 1F9KA 2ZHLA 4RQPB 3RVHA 4LHSA 5DAVA 1JYNA 2FDKA 3H9AA 3ZYBA 1KFUL 1QJZA 1W8ZA 3GBFA 5H9QA 5K0UA 5J09A 5L36A 2ZA9A 4CCOA 3MUZ1 4E4SA 1AHSA 4OHZA 4AVTA 4OQ9A 2B39A 4E2GA 2I74A 3HAGA 1J1TA 5D8AC 1OF4A 1RUE2 2XVLA 1L7RA 2IVJA 1NKGA 3PUIA 2VZRA 1ULFA 1SG3A 3C7HA 2QFEA 4TZDA 1H9PA 5JIAA 2TEPA 5FZAA 3UYJA 2D6MA 3VBFC 4E4HA 1S0FA 1AR93 5HV0A 4L92A 4ZONA 5DZGA 4JDMA 2RVAA 2WLPA 4NWVA 3ZFFB 3N9OA 1DQ5A 4HZFA 5JOYA 2VVFA 1C8M2 2QUOA 1WLDA 1T2XA 1OVSA 2P6HA 3LD8A 4RD7A 5IT6A 3FMGA 5M0TA 1UD1A 1UNBA 1WUVA 1CIWA 1YEWA 2A6YA 5EP9A 3QCWA 3VDAA 2ARCA 4AI1A 3ME2A 1PO12 3RJ2X 1G9FA 1MS1A 2H0BA 2Q8OA 4KQ7A 1FOD3 2CHHA 3LFIA 5DQ0A 3OGJA 4GWIA 4NVPA 3VD9A 3KLSA 4P08A 3MLLA 3ES4A 2CGOA 5CVRA 1DDLA 3IM0A 1EAH3 4YG0A 1AYN3 2EIGA 1UX6A 4AI3A 1ODMA 3ZR6A 1NLRA 3VZKA 5I0UA 5A80A 1LOEA 1RUD1 5CFDC 1WWYA 4FPFA 2W2IA 2OW4A 3VBOB 4EWEA 4Q27A 5J7MA 4KH9A 2NMOA 3OG2A 1AL0G 2W94A 3ZPOA 5FY1A 3RJRA 3VBSA 1A3KA 3TEWA 1KD7A 1ZBA1 1XB9A 1ZZCA 1W05A 2YHJA 4LBNA 4R9BA 4QPWA 2LALA 4Q0VA 2ADDA 2BWCA 2HWE1 2YC2A 3NV2A 1D0GA 2WSUA 3D8CA 5BNOC 4QQ2A 1S0JA 4ITCA 2UU8A 2XJRA 3WF2A 2W87A 3ZDSA 1JH5A 5C7GA 1NY72 1WW4A 3FE5A 5DPNA 1R1A1 5F2WA 3H8XA 1VR3A 3OJBA 1QH6A 2JEMA 2VZ3A 3MW3A 3MV11 1ZZ8A 2W95A 3GZEA 4Y33A 2NPIA 2DBNA 3X29B 1RYYA 4JDOA 4COYA 1HN0A 4QT6A 2W3JA 4N90A 4CDQC 4XVHA 2YROA 4KU8A 1PVC3 3AZZA 3NNFA 4P5HA 4V2WA 3LAGA 1CWPA 2IXJA 3FC0A 1HKDA 2BNNA 2WC2A 1OPOA 3NKTA 3TWIA 4MO3M 3M7AA 1RC6A 4WM7A 4XHBA 3ST7A 3WW4A 3T0DA 4GWJA 4YLZA 4YWAA 4JKLA 3ZIXA 4LKEA 1ZZ7A 2WA4A 1MVQA 4Q4W2 3SXWA 2WZR1 4TLFA 3TEXA 4GMP1 5A3TA 2F4PA 4AG4A 1OLMA 2Q4SA 1RMU1 4XAEA 2RS31 1HJFA 1UPIA 1JYXA 3S7IA 1QOOA 2PLV3 5FZ3A 2UWBA 4Y5Z0 1V6OA 3ZIWA 1L7QA 2OT7A 3B3QE 5JUVA 4NIAA 4LE4A 3HT1A 2Y6LA 3GNEA 4K21A 1UYZA 2YU2A 3WZ1A 4Z1VA 1KXGA 2GP3A 2MHFA 1RUE1 4QHOA 1ZZ6A 5H9SA 2GMMA 2XLGA 4JTNA 3D82A 4XTMA 1FMD3 3O12A 5FYHA 1DYPA 1UMIA 2FCTA 3O1MA 4LBOA 5F3IA 4UAPA 2PXJA 5F3EA 2X05A 1SPPB 4Q4X3 1FYUA 3W59A 2EICA 4B4RA 3J26N 1W8UA 4YZ4A 1UIJA 1OUSA 2BV4A 4OMCA 1ND3A 2VH9A 3EXUA 1C8M1 5FPVA 3O1UA 2Y6HA 1FOD2 1D2QA 2D5HA 2WKKA 1STMA 3I2HA 4IGQA 3WDWA 4L9BA 3LZZA 2WINB 5EJ1B 4I02A 3Q8CA 4LKDA 1HV1A 4LULA 4JGYA 1EAH2 4JQTA 1PO11 4QPIC 4LKSA 2ZX4A 3VKNA 4IV1C 3GJBA 4N43B 1U5ZA 1SDWA 2XONA 1GZTA 4Q26A 4AGRA 2FZ1A 5I0DA 3QOPA 2AGSA 3R4UA 3LEGA 1UY3A 1J59A 2ORXA 5FJHA 3THDA 4M01A 5FZ7A 3ZN4A 3AMHA 4XPVA 1OA3A 4XXAA 1ZA4A 3USSA 3WNNA 2A1XA 4ATFA 4CEWA 3K46A 2IZWA 1WCQA 2DVFA 2DVDA 2OQ7A 2WR9A 3KMHA 2E51A 4IV3B 4OI4A 2RDQA 5IAVA 4XCAA 4EQVA 4K40A 3A0KA 4W65A 1V9U3 2J1SA 3H42B 4DY3A 5JSOA 2BUKA 5C4WA 3NNLA 3UKVA 2QZ3A 3I2GA 1O4YA 5FY9A 2MPFA 5EWSA 2JKXA 1JYVA 4LOSA 2NZ9A 3ATGA 4SLIA 3LEMA 3J8F3 2R0FA 4MSVA 5FFOC 4PLNA 4ZXKA 2JJ6A 4D7YA 2HEYF 3Q8EA 4HK9A 2Y64A 2RMU2 3WDVA 2ZX1A 1K12A 2LTNA 2XHNA 4FPHA 1QQP2 3LPFA 1OBNA 3AVRA 1SCSA 5DXDA 1ZRCA 2BFUS 1NY71 4Z2WA 3RG0A 1PM7A 3M8LA 1EV11 1PM4A 1PVC2 1QDCA 2BYVE 4RGGA 1GQPA 4AI9A 2Y26A 1IS6A 1Z0HA 2VMDA 5E89A 4CDWB 2A71A 3ASIA 2W92A 1IGOA 1GU3A 4FVVA 5F7UA 3WVJA 2R30A 1W2AX 5L9BA 1CGPA 1RUH3 3ACFA 3F95A 3MDPA 2WYSA 2WO1A 3AP7A 3CBNA 2Y33A 5HCHA 1W6OA 5FYZA 5T5JA 4ZU5A 1UX7A 2C24A 3MGUA 1OUXA 2VMIA 2WNUC 4UBHA 1LAJA 3TB0A 1PMJX 3H3ZA 2Z79A 4Q4W1 3RRDA 2FCVA 4PHZA 5FLJA 5FMCA 5DAWA 1W8TA 2I2SA 3KV6A 4FXKB 3AJZA 4DZGA 4XJUA 4ASMB 1YI9A 1FMD2 1IS5A 3GCXA 3T1LA 4XF0A 2OPWA 3T2OA 4LXLA 2VE1A 3UV9A 4IXLA 2EAAA 1EYBA 2A3YA 2XG3A 4RN5A 3RZLA 3G6JB 3CKHA 2DCJA 1HN1A 4Q4X2 3H3UA 3I97A 1RUC3 5FYCA 2WJSA 2VNRA 4YVWA 2WIIB 5FKBA 2I45A 4P9YA 4ARYA 5JXGA 1XXNA 2L9LA 4PIYA 3HT2A 4H55A 2ZMKA 3R4DB 4XZPA 1IS3A 5F1RA 1UQXA 3FX3A 3IPVB 4R4ZA 1LOCA 1HB4A 3T4HB 2P4EA 4HVRA 4W4ZA 4D8MA 3WEZA 2NP0A 5FZDA 3MFCA 2BP6A 3FL7A 3D6EA 2DF7A 5FRAA 3KWVA 2RR13 1E5HA 2WBKA 3B7MA 5DAQA 4NROA 1SHWB 5IK8A 3HQUA 4YVSB 1S2EA 1JZ5A 2FDFA 2CU5A 1E5SA 1KGYA 2VNOA 3OD4A 2P37A 4QU2A 2G9ZA 2ZGMA 1UYPA 1MQTC 2XWBB 3NAPC 4KG0A 3IDAA 5F3GA 3GM8A 2WAOA 3VHOA 1SFNA 1GP4A 5CFCC 4XJAA 1CPNA 5FAXA 1J84A 5H9RA 4ZZ8A 4YFWA 4R8HA 3PU8A 5HCAA 2RJ2A 2DVGA 4Y5SA 3SISA 1YNAA 1K5MB 1RJ7A 3MFAA 2VCBA 1PNGA 3T2TA 3JB4C 3MUY1 3LKJA 4NPLA 4AEDB 5IVFA 3BGAA 5FYMA 4QU1A 1RUG2 5EIYB 1IKPA 2A6ZA 4PI0A 5I0SA 1EP0A 2XKOA 4MUVA 2EIDA 4NE9A 3ZLIA 4XQ4A 4TLGA 3T1MA 3T0BA 1MS3A 1VB2A 4NIGA 4P9JA 1W9WA 4MXWB 3HN1A 1O3RA 3Q8AA 3WF1A 1CAVA 5A7SA 4BJ0A 2GC0A 2RMU1 3ZO0B 3LEKA 3URFA 3DYPA 4INDA 4AWDA 1Y9GA 5DAXA 1S0IA 1QQP1 2ZGPA 1RUOA 5D8AA 1W0PA 3H3LA 1QJU3 2R042 3O0VA 2QDNA 1T6GC 1OF3A 2ORZA 5FZ6A 1TEIA 1PVC1 3USUA 1RUH2 5DABA 1SACA 4AEDC 4QX0A 3JZVA 4MGQA 3VBFA 1RUNA 3AMNA 4EZ4A 3IMMA 1W8OA 4JCKA 1O8SA 1SLLA 4UYBA 4XOGA 2E33A 2VMCA 1AX2A 3ZPYA 1W03A 3WW3A 3OY8B 4OUEA 2W0XA 2AREA 3KV4A 2JD4A 3H1YA 5C9AC 3V0AA 4WM8B 1UY0A 3RZHA 4XFBA 5JIUA 3U14A 3WNMA 1G9AA 4RQPA 5IAXA 1TME3 2Y6GA 3KT1A 1UZWA 3M3CA 1W2OA 4G3YC 4TN7A 4CP0A 2F4LA 3ZOIA 2CYFA 5F39A 3VBSC 3SEEA 1YFWA 3T3YA 4P02B 1VMFA 3H1MA 2EA7A 1LULA 1UIKA 4AFBA 1FMD1 2VULA 1PMIA 2Z42A 1KS4A 2R7EB 4RSUA 4FPJA 4BLIA 1UWWA 4P9XA 4OUMA 5FP3A 2OKXA 1W8FA 1H6XA 1PZ9A 4Q4X1 3ZFFA 3ZN5A 2QNKA 5FXVA 5CFDA 3PMEA 5EPAA 3KHBA 4BXSV 3PJYA 5DDJ1 4IEWA 4PQQA 4FTSA 3VKFC 4ZS3A 4FFFA 2RR12 4WM8C 4O7XA 1WMFA 1S2BA 2DWRA 4XTPA 4AHXA 2JDMA 2YFUA 3K51A 4AR2A 1NQJA 4K8RB 2J1TA 1BMV2 4W6WA 2Y38A 3AMMA 3UGFA 3WG2A 2VCCA 2XL7A 4X8NA 5AVPA 3B01A 3Q9OA 2J1UA 3W21A 1YQ2A 2OPKA 3AKQA 4K20A 4QX5A 2LM3A 4META 3MF9A 1DQ0A 3NJXA 3UGHA 4X8PA 5FXZA 2CSGA 3LDBA 4BISA 1K42A 3I7DA 1DCSA 3CQOA 4N7IA 1G9DA 1Y43B 3AKTA 4B4QA 4D7SA 4KU7A 2QDRA 3I2DA 3BTXA 4LIVA 3RGBA 1N1VA 4QQLA 1XYNA 2Q30A 3PLQA 5IK4A 5CKQA 4AK3A 3U78A 4XFCA 2VVDA 3KCCA 2YBKA 4EZHA 1GKBA 1VRH3 4KBZA 4UBGA 4AAXA 3AP4A 4DUWA 4XJZA 3VBOA 1PMHX 1OD3A 2XLAA 3AKSA 3CHXA 1JU3A 5FIXA 5T3NA 1BKZA 3I3DA 3SEPA 2DUPA 1POQA 2PTMA 2X5IB 4M3CB 3H8UA 4CDQA 4L11A 2BVBA 5F6LB 5A7NA 2WNVB 3MW2A 1Y4WA 5FYBA 2ZZQA 5JVVA 4CP2A 2VNGA 4AGVA 1E57A 2BVVA 4Q0UA 4TWTA 4WBBA 1JZ8A 3BODA 4XE9A 1RUG1 1AL23 2WNOA 1SQ4A 2A70A 4CCMA 2A6VA 4XUNA 3MLJA 5BNQA 3J7NA 1LHNA 4PT6A 3VBRB 1D4M3 2GAUA 2XGXA 2A6XA 1C8NA 2VZQA 1UZ0A 4IUGA 4JKMA 1GLHA 1REDA 4HT1T 2IVIB 4CXXA 2E32A 3AL6A 3VBUC 3IAQA 2DCZA 2IXLA 1U12A 4XIOA 4H2AA 2DU1A 1ZNPA 1PX3A 3VD3A 4DB5A 1QDOA 4GXLA 4ASKA 2XOMA 4LBJA 4COWA 2EF6A 2VGDA 4GQ7A 1H2NA 3PVEA 5BNNB 1ND2B 3LDRA 4OLLA 1JMUB 2DBIA 2R041 5F32A 4MHRA 3RMYA 3TNQA 3H8RA 1OD5A 3OBRA 2WNVC 3K3NA 2R0HA 1RUH1 2ZHMA 1ZBE3 1UOFA 1GNZA 2ENRA 1C4RA 2HWC3 5LY2A 1OFSA 5AC91 3M3OA 1TME2 2GP5A 4COZA 2JE7A 1CVNA 3ZKYA 1AVBA 4MV2A 2XBO3 1VBB3 1C1LA 1SZBA 3VBRC 2BNMA 1N3OA 5FBZA 3S57A 4OHXA 4O9GA 2OVUA 4CEWC 3SQOA 1Q3EA 4DRRA 5T52A 5C3SA 1COV3 2YBSA 3QH7A 3P1IA 4ZS2A 3WP3A 3W5NA 4IV1A 5A1FA 2P6CA 5FZLA 3LWCA 4UFKA 5C4WC 1POV3 5EQUA 3WNXA 4CDXB 2YC0A 3C8XA 1CPMA 2WT2A 1DZQA 4PDWB 2VCMA 1AF9A 1YO8A 4K7JA 3FWEA 4LJHA 4NWWA 1SPPA 3AYDA 1Y9MA 1B35B 2UYAA 2WA3A 2YV8A 3AKRA 3ZR5A 3FLTA 1NOVA 2Y0OA 1DGWX 5FZ0A 4ZXEA 5LBFA 5JOZA 1BVVA 1O6UA 2WAAA 1VBE2 2Z69A 4EJRA 2RR11 2JB4A 4WVMA 1YFUA 3GCWA 2VY0A 1YUDA 1BMV1 3OUIA 2BBVA 2DU0A 4K1ZA 3WQBA 2Y6KA 3AZYA 1CX4A 5G04L 4R52A 5EYXA 1GP6A 3B93A 1Q8QA 4X6RB 1LRHA 2QQNA 4XURA 4JRAA 4YW5A 1BYHA 4CDXC 1F2NA 2VL4A 4XACA 4XBNA 3BVCA 3N3HA 5ANQA 1OQDA 4PBOA 3VKMA 5JMOA 3MYXA 4B29A 1ACCA 3I2IA 3IDCB 1AR63 4IERA 3VBHB 5DUWA 2BRTA 4C8DA 3U4XA 2P1BA 4YG6A 4DIQA 4XUPA 2V09A 1AL22 1GP5A 2YZ4A 1SFYA 3FZ3A 1AXKA 1VALA 1C5HA 4LHKA 3V56A 4A7ZA 3UNPA 5LBBA 3V0BB 4DO0A 4YM1A 1NG0A 1QXRA 4MLOA 5A33B 2WWJA 4QM9A 5EFUA 3E97A 4YVWC 3FLRA 1LNSA 1OQEA 4IEYA 4FCAA 1WGPA 3CJIB 1Z78A 2K46A 3I59B 3ZFGB 3HR9A 1H1MA 3DF0A 4BK4A 5IATA 1MS0A 5HXMA 3HWJA 4YW3A 2JKBA 4U36A 3PIGA 4Y20B 1RL3A 2HWB3 3CLPA 3BYWA 4XW3A 3OPTA 2DVAA 4CDWA 1ZBE2 1I9RA 3I2FA 2FDHA 2W1UA 1UU4A 1IZ3A 2GC3A 1CAXA 4GMP0 3LIGA 1MZ5A 2XBO2 2VUDA 3BU7A 1VBB2 4UFLA 2ATFA 2R16A 2WZEA 2XLFA 2PHLA 1AR73 2X53S 1GZWB 1S0BA 4ORFA 4XDOA 1F35A 3MICA 3A23A 3K4AA 1DYOA 2ZGQA 1OMIA 3KB5A 5ISLA 1V6IA 3CJIC 1ZREA 1JODA 4QDQA 1PX4A 1SFPA 2F17A 1AX0A 1HIXA 1O3TA 4Q8LA 2AACA 4LA3A 1H4GA 1IHMA 4FOQA 1OLRA 1Y9QA 3A0NA 2QE3A 2R073 5FK7A 1GNHA 3KD4A 5SV8A 5F8PA 4XJ8A 4BE3A 1HB3A 3HVDA 4FFHA 1JUHA 1DIWA 1YCIA 3SITA 2ZEZA 2IXKA 3NAPA 1MQTA 3C2UA 3FUOA 3AMQA 5HV4A 1OURA 1FNZA 4OZOA 1G86A 2P34A 5FK8A 3MPPG 4PLMA 1FNYA 4GZ9A 5IK7A 4RHV3 4QHZA 4UF0B 4GULA 4NR1A 3VKLA 3AFGA 2A3WA 1XQNA 1LODA 3POEA 4CRQA 3IPVA 1HQNA 3NSTA 4FOVA 2HWF3 2IXHA 4CU6A 1HDKA 5IHRA 2QKDA 4TSVA 4MXVA 4IDZA 5FZ1A 1BEV3 1VBE1 3EYPA 4Y26A 4IE7A 3MLKA 3M4FA 3PIJA 5KR7A 3W5MA 5KHHA 1LOGA 1OFNA 4IE4A 3MIDA 1ENXA 2LRPA 2XJPA 3IT8A 5HCBA 4RYDA 4Y1ZA 3S30A 4LO8A 2GH2A 4NOTA 4GH4B 2P2KA 3WF4A 4YG3A 3NVCA 4K8FA 5IVVA 3TYJA 4B4PA 1QWRA 2W46A 2QZ2A 4LHLA 4MVTA 4CUAA 1QEXA 5AFEA 1A6CA 5CAZA 3TBDA 5IK5A 4V2VA 4A7KA 4DXSA 1GICA 4RQPC 4M3CE 4Y3OA 2WLQA 3HN3A 4FI9A 4RGKA 4E27A 3S5AA 1K5MA 2JX9A 3GDBA 5EJZB 4LLFA 1C5IA 1X9PA 4AEDA 4D94A 1QJFA 2EXHA 4ES8A 1NX9A 1MS5A 1G7YA 4I3GA 1AL21 4XFAA 4CE8A 4HONA 4QGMA 3PTYA 5K9YA 3WUDA 4CXWA 5CA6A 1GANA 3ZFFC 5GLUA 2PQSA 5C9AA 4MXWA 1PK6B 4LNVA 4D0QA 4BIOA 5LEJA 4CPBA 2KXLA 4GH4C 4CCJA 3OGGA 1NLQA 1LCLA 4Q4V3 4Y5TA 3ROUA 5LZ6A 3OUJA 4TTGA 1Q5OA 1RITA 2XDVA 4AVBA 1BVP1 3UKNA 1XYOA 4YGBA 1WD3A 2D7FA 3GF6A 3KM5A 4NHLA 1CIYA 3PURA 4LITA 1DZRA 2MEV2 1AXYA 3WCRA 3U10A 1AR72 4URTA 4QM8A 1N1YA 2PAEA 1CN1A 1ZBE1 4GB32 4XFIA 1MZFA 1XOYA 2DFCA 2LW8A 4AZZA 2QQVA 5JAXA 4UFJA 2XBO1 1RXFA 2VR4A 3PHMA 2HWD2 3AZXA 3OY8A 3PUAA 4Y22B 2BQPA 5ANNA 3ZSMA 2B9UA 4CCLA 4H7MA 1QH7A 3WDUA 4WM8A 4XYXA 5DG1A 2WYFA 4YZ1A 5APAA 3HBZA 1CONA 4PIZA 3VBOC 3VKOA 3QACA 2DUOA 4AGGA 1GOGA 1YXWA 2BGPA 3UJQA 2WFF3 4I01A 2E7QA 4XF9A 1CX1A 4ZU7A 1UOGA 1MS9A 2G9GA 5ACA3 5FZ9A 5FTTC 1FV3A 1LOBA 2PQQA 1W39A 2H0VA 4MH0E 3AZWA 2B5HA 3NNMA 4L97A 2LROA 4CU8A 3GXUA 4CEYB 2ET1A 2C1FA 2QJVA 4Q29A 5T54A 3NL1A 3AKPA 5JPNB 1MEC3 3E1F1 2JDUA 5D1IA 2YMZA 4M00A 1SLCA 1O4ZA 5FY4A 1AXZA 3AYCA 2B9VA 3AJYA 3HNYM 4KWJA 1BEV2 3DKWA 2DTWA 3POYA 4L8QA 3CMGA 3UETA 3O7OA 4KGGA 1UU6A 4AE2A 3VZNA 1CZSA 2XL9A 4N9IA 4XFGA 4QKNA 5EV7A 3SKJE 4I2OA 3AB0A 1AR92 5JOWA 2FDGA 3B5LB 4D6SA 2VTXJ 2UYBA 2VQTA 2A75A 4KG8A 2C0ZA 5A7WA 1LJ7A 5A7PA 1R093 2VW2A 5LK5A 4XF4A 3VHPA 4GJZA 4KGQA 1HRI3 5TSWA 4COUA 3VUOA 4CP9A 1FPN3 4LORA 3WW2A 5JXHA 5A7QA 3T2QA 1VIWB 1W6NB 3K4DA 2EXKA 5C8CB 1LU2A 4GD4A 5FY5A 2VZVA 3VBUA 4CUCA 4DXTA 1GMMA 1HQWA 2Y6FA 1Q8VA 1QF3A 3GALA 2VVEA 5FYSA 1XE8A 5IVJA 4R9CA 5F9TA 5SV5A 2WS93 3WQ1A 4IGPA 1WCUA 1V6NA 3O14A 3NV4A 5T5PA 3VZLA 1UY4A 5HPOA 3WUCA 1DGWA 1J3QA 1AYN2 4M3CA 1HRV3 3DKQA 4ZZ5A 2XJTA 2SBAA 1GOFA 2WNVA 3NJZA 2HKXA 5KHKA 3GHMA 3LDKA 3WR0A 2WWUA 5DUXA 1GUIA 1H0BA 4XMIA 3J7LA 4AVSA 4DXZA 1JN2P 3FHAA 4Q4V2 4E4ZA 1XRUA 1VBD3 2RDRA 4FOWA 3VBRA 4AHZA 3IKWA 1VP6A 3FHIB 4AXOA 1R083 3LOIA 2UWCA 4Y1VA 4IEXA 2OZ6A 2P17A 3HQRA 3WOGA 4B7EA 3A22A 1DFQA 1RXGA 1YIFA 2YU1A 1OH4A 3WF0A 2ZCWA 3NJVA 4MGZE 5CEHA 5C3OA 3FHQA 3MBWA 4AQTA 5BNNA 4Q4Y3 4O61A 4ZPIA 5LA0A 3WNKA 3ZXDA 3ZDVA 3B94A 3EHKA 1W06A 2PAMA 2PHFA 1W3VA 5FXXA 1KRIA 2MEV1 3ZYRA 4N43C 5C8WA 4Q0QA 2QBXA 1AR71 4J1WA 3W58A 1M4WA 3I2JA 2K9ZA 2VJXA 4GB31 2HEWF 4IE6A 4D69A 5C5TA 4OI0A 4G9SB 3TN93 1A34A 1U5YA 1N3PA 2Y60A 5I8YA 5JXIA 2R49A 2D5FA 1J3PA 2V5YA 1HLCA 2WFF2 2ZS6B 3DXTA 1C1FA 2HWD1 3RI8A 2BDRA 5GLTA 4ISQA 4LMFA 3LOBA 1HJGA 1W9TA 1ALYA 2J1EA 5A1AA 3K75B 4BU2A 2ZABA 5T5LA 1GZCA 4R9DA 1JOJA 2QQPA 1H6YA 5F2SA 4IV3C 5FXWA 2XUEA 1XSRA 3J7MA 3NWKA 5FUNA 2ZAAA 5I8SA 4E8DA 1DYKA 4YM3A 5IFTA 2C4XA 4GWNA 4FPGA 5FV3A 5DG2A 1WMEA 2DFBA 5D2AA 1C28A 2PN5A 1KS5A 5FZFA 3UKTA 4CDXA 5JR2A 1W3XA 1H1IA 1LESA 3VD5A 5JI7A 5LRSA 4CUBA 1S0GA 4CCNA 5HI0A 4QX8A 2P3JA 2PLV2 2FD8A 4AFCA 3SKVA 2D6KA 4Q0PA 4QX3A 5FZCA 1X33A 2G9FA 2WFPA 1G6NA 2W47A 3FJSA 5LWBA 4B7KA 5KWRA 5BXXA 3VGIA 3WHTA 3JD73 2VAUA 3ENRA 5KHGA 2ZTNA 3SLIA 2ZHKA 1BEV1 4DINB 1QOTA 1HRI2 1FPN2 4CDWC 3PUHA 3V64A 4S2FA 1AR91 3AP5A 2E7TA 5C5UA 2Z5WA 5FUPA 1H1AA 1NT0A 1LGBA 1XNAA 2RDNA 2YUEA 5FZOB 4C0HA 1QOSA 1YJKA 2YGLA 2BFUL 3ZXFA 4BPZA 1HX6A 1OSGA 4LOTA 1BHGA 1QY4A 3ECQA 1JW6A 1NCRB 2WS92 2VD7A 2ZGNA 1LHVA 3POFA 3ZYHA 4CCCA 5FY7A 2ZX3A 2WZ8A 5KXCA 1D4VB 2UURA 5FPUA 1K5JA 1GFF2 3B02A 3FBMA 4HMZA 3WSOA 4DMIA 4BQ1A 1LTEA 3J7HA 2BPA2 2P3IA 4QKFA 4YPJA 1FOD1 3VBHA 4IEPA 1GQHA 4QD2A 4UW4A 4KWUA 4I0WB 5KC5A 3AXDA 2BERA 4K6BA 4XCBA 4CCKA 2EXIA 1IKQA 3F2ZA 3KV9A 3ZFEB 1EAH1 3VL8A 3IIAA 1AYN1 4EE2A 1SLBA 4JHTA 2D97A 3UJOA 3V0BA 1W6QA 4PF1A 4MZUA 4FQ4A 4P9LA 4WVVA 5ABJB 5A33A 5FZGA 3T08A 2CNAA 2D3PA 1R082 3WDYA 2V72A 3E5UA 5A3OA 1UY2A 3THCA 1APNA 5K0UB 1H8TB 1OVPA 1LECA 3I3EA 1WKYA 3KSCA 3CJIA 2ERFA 2BGOA 4Q4V1 1ZZ9A 3H7YA 4WV8A 3TAYA 2VC9A 4UW6A 3ZFGA 3P3PA 5CG9A 1V9U2 1NCRC 3L2YA 2RS13 2AC1A 2AEYA 4IGOA 3I8TA 3K2OA 1S55A 2PAKA 2GDFA 3K4ZA 4MGIE 2DUQA 2NYYA 4NHMA 4XHXA 1IQDC 4Y20A 3BTZA 3J8F2 3KF3A 2VUCA 2X10A 2ZEYA 5LY1A 5L19A 2V5DA 3H1WA 1SBFA 4RGAA 4YVSC 3WG3A 3WG1A 2DURA 3TN92 4XEZA 3UT0A 3D0JA 3M1HA 4HKOA 5FYVA 4EWAA 4Q0SA 1QKQA 1ULDA 1K3IA 4LBQD 5FPAA 3S0MA 1JZ6A 2VOWA 5ABJC 5FPZA 2VZSA 3AC0A 1ZA7A 1QNWA 4Q1PA 1GZWA 3OEAA 3DUIA 1CZTA 2XJVA 3N9PA 1Z7S3 4CP1A 1IS4A 2D40A 2ZXQA 2UY9A 1OC1A 1YWKA 1AR83 1I6XA 1F15A 1RGSA 2PA7A 2C6SA 1WW7A 3C7GA 2D6NA 2GZWA 4RFRB 3WF3A 2JIGA 2BTVC 2WFF1 3T30A 3WLUA 4OULA 4XIKA 1RVF3 3LPGA 1K5MC 1GQGA 2Y0IA 4YYOA 4EN8B 1UZVA 2B8MA 4FO9A 4UOJA 4NN0A 4YRDA 5IWFA 4ASLA 4YSFA 4FPKA 3ILRA 1NA1B 1C3HA 1ZVFA 2XB6C 4BOWA 2K0GA 4IQPA 4LHNA 2D6LX 2ADEA 1SCRA 4NPMA 1GR3A 4HPKB 2HEVF 3FN9A 4NRPA 4M4RA 2J1RA 2VQUA 3OYWA 4P9GA 4LO4B 4UF0A 5GKAC 5BUVA 3JD72 2PYTA 4XJ9A 1ZRRA 2Q1FA 3P3NA 2VECA 5GJ6A 1YLLA 5C33A 2JDYA 2PLV1 4JGZB 5GLWA 2KR2A 1VMJA 3BCWA 4GJYA 3NRUA 3N4MA 1DG6A 1PO23 4RS5B 2QQMA 1H30A 1RUC2 1VAMA 2X8KA 2VG9A 4PI2A 4BQ2A 5B4XA 1ULGA 3NV3A 1VBC3 1LHUA 4ONUA 1JUIA 1HRI1 5JMCA 1MACA 5FKCA 1FPN1 2WQZC 4JHZA 4K1YA 3PL0A 4XFHA 1XC6A 5FZHA 5IUQA 1VAKA 3ZX7A 2FZ2A 1NA1C 1JYIA 1JXNA 1W04A 5FJKA
chains in the Genus database with same CATH topology
2R063 4UW3A 2C9AA 1QMJA 3JBG3 4DQAA 3ZXGA 4KL1A 2ZPXA 2Q1ZB 4GH4A 5FO9B 4AEJA 3WY6A 4IETA 1RTVA 5KXEA 3LA2A 2WS91 4DPNA 1GSLA 1A8DA 1KDMA 1QXJA 2VU9A 4JGZC 3H50A 2XJUA 1CJPA 1PGSA 2RS53 3N7KA 4FPEA 4L2NA 3ZYPA 5JCTA 2BGCA 3FLPA 1W6MB 4E9KA 5JOXA 5CADA 3JB8A 1AZDA 4Z8BA 4BM8A 4IEZA 3OF1A 5A3MA 1OHFA 2FMYA 3E6DA 2RS12 1PK6A 1R081 1QHDA 3D0SA 4HLTA 4GKXA 3HD8B 4LR4A 1FI2A 4YM0A 3VZOA 1V9U1 4QPGB 5DUUA 2ZMNA 3EBRA 1DGLA 4YGEA 1W2UA 4JAAA 3J8F1 4QGLA 4YNIA 4AVVA 3RMXA 1Z7S2 2G4IA 2GH8A 1WMDA 3TN91 3CJXA 3GZTB 1QJU2 4Y22A 4HKLA 1O5UA 3U07A 4LT5A 2AUYA 2AENA 2GNDA 3LCPA 2JXAA 1SLIA 1EY2A 2H6CA 2NLRA 2GMEA 1J1LA 1RUI3 2ZAHA 2X5IC 2YDEA 4QPGC 4JQRA 4GWMA 1NCQB 1YHFA 1WLCA 1V70A 4YFZA 4YZ3A 1RUD3 1TE1B 3I4IA 3ZMOA 3EO6A 1UU5A 4YW2A 4HFSA 1URXA 2XKPA 2DCKA 1QXPA 3RPQA 1S0DA 3R0RA 3JD71 3RS6A 1ZBA3 3MIGA 3CU7A 4ZU4A 4O9EA 4S2DA 1UCXA 1V00A 4MX3A 3M3QA 1YFYA 5BNNC 1ZRDA 2Q5TA 2ZACA 1L3JA 1ND2C 2ZBJA 3HIFA 1RUC1 4QQPA 2B46X 3AZVA 3HQXA 4P9IA 3ZYGA 1NCQC 3RYKA 3VHRA 4PF5A 3PMSA 4CZSA 3AFKA 3KT7A 5FLHA 1R1A3 2AYHA 3MEPA 4AFMA 1I3HA 2JE9A 4IEQA 1O91A 3A4UA 3OD0A 4BHPA 1S2KA 2O0OA 5JSPA 2RS52 2NMNA 4Q2FA 5DZEA 3VV1A 1DZTA 4AVAA 2XJQA 4JC1A 1OQ1A 4M0NA 4QPYA 1OI6A 1OLQA 2V73A 3WX5A 1W6OB 4N43A 1O7FA 2OUJA 3M70A 1VRH2 2WZR3 4COVA 4YGCA 4GMP3 5FO8B 1JYCA 1RMU3 4LA2A 2RS33 4PDWC 5BY5A 3MIEA 5BNPB 5FMOS 1B35C 1IQAA 2FBEA 2RS11 3VZMA 4EN9B 2IWGB 4HVQA 1ENQA 4N7UA 4YW1A 4IV3A 1RUE3 1QNYA 1WCKA 4PQ9A 4I30A 4BWOA 1N1SA 3MPBA 1D4M2 1GV9A 1S0EA 4IEUA 1VLNA 4C1XA 4BMBA 2B42B 1XNDA 5B2GB 3AXEA 1WLWA 2D44A 3FFZA 2VPVA 3N7JA 3WHUA 1H8VA 1Z7S1 3C3VA 4K9SA 2DVBA 4NPRA 1RUI2 2D6OX 1SEFA 4XBLA 2UWAA 3UL2A 5BNPC 1S0CA 1QJU1 1LGNA 3BTAA 3VBHC 4HSLA 1HXS3 3E6BA 2GSYA 2HWC2 4CDUB 1RIRA 4I0AA 3VZJA 1BJQA 3IDEA 3WD5A 3SH4A 1WW5A 4N53B 1KQRA 1MR5A 1Q8PA 3KCXA 5BYNA 3WT3A 3BIWE 4FXGB 2D3RA 1OKQA 1TME1 1COV2 1LB2A 2IFWA 3ZFGC 1HQLA 1PGL2 3MI8A 3WCSA 2C5DA 3ZSJA 4BYYA 4U2AA 1FXZA 1NXD1 4EROA 4XFFA 5K8SA 3DPRB 3CO2A 5GLZA 4EN6B 4JV4A 5I91A 1O3QA 2CV6A 4N53C 2OA2A 3WV6A 1LENA 5D8AB 5CB7A 3ILNA 1NCRA 1EV13 5KXBA 4M3CF 3USUB 1KITA 3APBA 1NXMA 3VBFB 5J37A 2B45X 1U5IA 1LEDA 1U5XA 1XYPA 4AFDA 4YVSA 1DQ6A 1D0HA 3IBMA 2WT0A 4BCUA 1RMU2 2RS32 4EV0A 1DU3D 5ABJA 2FHRA 4FAGA 2GN7A 3CNAA 1EPZA 1MZEA 1MS4A 1VRH1 1H8TA 4Q4W3 1AR62 3H7JA 1REEA 3VLBB 1AX1A 2JG8B 3JQWA 4I3PA 4AEKA 5I8TA 1RINA 1X8EA 4AEMA 4CYDA 1BBT3 1ENSA 5HCFA 4EWDA 1V6MA 4AVCA 4RA0A 4LLOA 4S2HA 1NZCA 1ZRFA 2ZX2A 1CAUB 1NYWA 1A8MA 5EXOA 4BIFA 4FAHA 5CFDB 1OPMA 4D3WA 3JCIA 1UPSA 2LUWA 3PNAA 5JSRA 1KJRA 2XJSA 1G9CA 2CGPA 2JICA 1D4M1 1JHNA 2GNBA 3N7LA 3WDTA 1MVEA 4BA6A 4LE3A 2YPJA 3JUUA 3J4UH 3WQ7A 5LK7B 3B00A 2HWB2 2ZMLA 1WCDJ 1HXS2 1H2MA 3ZSKA 4DY5A 1DQ4A 4L99A 2JG8C 1RUI1 2W52A 1GYKA 5BNOB 1CR7A 5FOJB 1LEMA 2P3KA 1QGLA 2VW0A 3MF6A 2XVKA 3AM2A 1ULCA 4UW5A 1YRZA 1NA1A 3BOPA 2HWC1 4XXPA 4AF9A 2GU9A 5EJ3A 2JDZA 1S1AA 3ZYIB 3AYAA 3GHNA 4BLJA 4EN0A 1VBB1 1SBDA 1IPKA 5F5QA 1LOFA 1WA4A 4HPKA 4SBVA 2WQ4A 2R072 3E5QA 1PK6C 1UW8A 2BEOA 4CDQB 3ACLA 1PGW2 3KS7A 1CAWB 4ZKTB 1COV1 1VBA3 4JGZA 5JPMB 2KM2A 2ZHNA 1PGL1 4RS5A 4QMAA 1POV1 4RR3B 2ZKLA 4HBNA 3B69A 3B9IA 2A6WA 1DGRN 4RHV2 3POWA 5GZFA 4LBQB 2VQAA 4IESA 1W6PB 1FX5A 3RYRA 5J96B 3VN4A 4Y24A 1EV12 5JLVA 2ZGUA 1DBNA 3IN9A 2HWF2 2GC2A 2RMU3 4ATEA 4BZ4A 1RUJ3 1QQP3 3E6CC 4KBBA 1RUF3 4E2SA 1CD3G 1ONAA 3MIFA 3QBQA 5LRRA 4FSJA 1D2SA 4HL0A 5GALA 2SLIA 4JTOA 4DFSA 4J6GA 1W6MA 5J98B 3ZN6B 1OA4A 4RR3C 2QVSB 2RM23 3O0WA 3SCFA 4B3NA 4ISRA 2IXIA 3ZMNA 2R1BA 2JECA 1RHI3 1AJKA 4YW4A 5T55A 4CEYC 1BBT2 1W0OA 1ZZBA 1WCSA 3ELNA 3EQEA 1YFXA 4AQ6A 3B9CA 4QPIB 1AR61 5FDBA 3LGRA 4IV1B 1VAVA 4OI2A 2QCSB 4LUMA 1V6LA 5E88A 5FO7B 2X5IA 4FOYA 4QPGA 4LBLA 2ES3A 5KBFA 4YARA 3N35A 2YXSA 3K48A 1H9WA 2Q0AA 5JI9A 2ZGKA 2A3XA 3S6PA 4BH9A 1F8VA 5DDJ3 4HSJA 1ULEA 5E8AA 4WVMB 5C8CC 2XVGA 1V6KA 3QLQA 2MNGA 4QGNA 1Y3TA 4XDQA 2ZGLA 3TRSB 2HWB1 5CIRA 1PVXA 1PZ7A 1X82A 1HXS1 1XNKA 4OFGA 1ND2A 3AP9A 4GIQA 3LSDA 3G7DA 3VHNA 2CL2A 4K3UA 5E16A 4H3WA 1NCQA 4PCRA 4YM2A 1XE7A 2VMHA 3AP6A 3CF6E 3M2MA 5FQ0B 3R6SA 2ZJCA 4YGDA 2JENA 3VDDB 1YJLA 1PHMA 4QHBA 1VBA2 3OCPA 3O0XA 3WDXA 1X8MA 4HVOA 5ACA2 2R071 4FTEA 1OOPB 2Q1MA 4P9WA 2A73B 4JRLA 1PGW1 3OTFA 4DNYA 1XNBA 2UY8A 1Y7BA 3TNPB 5I0TA 4KWLA 2AZ5A 1RUG3 1PNFA 3OPZA 4B8EA 2WNUB 1MEC2 1LKNA 1REFA 5JDBA 4RHV1 1RUJ2 1KFXL 2PHWA 4PDWA 4AQSA 1RUF2 3JU9A 3LB9A 5GM0A 2F6BA 5JZGB 4AW7A 1B35A 2IC1A 1UMZA 2HWF1 3VDDC 3LA7A 4DRVA 4LUKA 3ZXAC 2GMPA 4AFAA 1HV0A 1CAXB 1CJDA 1AYM3 1R092 2DCTA 2IXCA 1VJ2A 2YGMA 2R043 1OOPC 2YYOA 3RI9A 2RM22 3WINE 3SHRA 4Y4YA 5EZWA 1KJLA 4EN7B 1DQ2A 2JG9B 1RHI2 1PZ8A 5AC93 3IDBB 4HANA 2XHKA 1XU1A 2R32A 5JWPA 4GALA 1I5ZA 1N3QA 2BNOA 3MIHA 1NLSA 1ASJ3 5L7OB 3WP4A 5FLIA 1TMF3 1WBLA 3KQRA 1SMVA 4JDNA 5BNPA 3WP5A 3J9SA 1BBT1 1HRV2 3WXPA 5JZGC 4RL7A 4XETA 4FTBA 3S7EA 1J58A 4S2GA 3NAPB 1MQTB 4AYUA 3BB6A 2FQPA 4OZXA 4RFT0 5J48A 4HN1A 4C0BA 3MW4A 1BK1A 4LO6B 4KWKA 5CFCB 5A32B 2K2SA 5DDJ2 2TUNA 3PJQA 1VBD2 1N1TA 1YI7A 3SCGA 2JG9C 4WZFA 2ARXA 4PBPA 4OVEA 2CGNA 5E1RA 2CY6A 3ZSLA 3I59A 4X6QB 3RYPA 2FMDA 5L7OC 4Q4Y2 3N36A 1G9BA 3SH3A 4FPCA 1WD4A 1QJY3 2D93A 2WNEA 4AHYA 1AUYA 1PIV3 5AVAA 1TNRA 3AK0A 2PHUA 3KZ4C 4CDUA 3ZFEC 4J1XA 3TOJA 1XU2A 1ZM1A 4HETA 4XF3A 2D43A 3SNMA 4N53A 1F31A 2ZGRA 3RSJA 4NO4A 3OBTA 5CNAA 5K0UC 1H8TC 4PIXA 5GLVA 3AMPA 4GKYA 4IEVA 1LOAA 3GZUC 4LEJA 1Q56A 3ZVXA 2NN8A 1VBA1 1DGRA 4OHYA 3PVOA 2EAKA 3GBGA 2TNFA 5ACA1 3GYDA 2NQYA 2CTVA 1FV2A 5C9AB 1UKRA 3DPRA 4E4DX 1KDKA 4R4XA 3PVBB 4JVAA 3QD6A 1MEC1 3BALA 2BWAA 1RJ8A 3BPZA 2DCYA 4Y1XA 4QQHA 3RNSA 1RUJ1 3VBSB 1LR5A 1H2KA 1O4TA 2VOVA 3NV1A 2A7AA 1AYM2 4NHKA 4W6XA 2PHRA 1RUF1 3RWNA 2PELA 4F3JA 1WBFA 3JQXA 4FP2A 3RZZA 4Q8KA 5GZEA 2VUJA 1NE4A 4FQZA 3CL1A 1WLTA 3KT4A 3WP6A 2ZOEB 5AC92 4CTEA 1R091 3ETQA 4C1WA 3DGTA 2RHPA 1QJX3 1R1ZA 1SBEA 4GA9A 4LBKA 1WW6A 2RM21 1ASJ2 1GBGA 2O8OA 3E5XA 1V6JA 4I0BA 4I09A 4LO5B 3ZXEA 1RHI1 1TMF2 1X7NA 2W08A 3ZXJA 2VW1A 5DZFA 1GZ9A 1LOFC 2I07B 2RE9A 1DF0A 2HYKA 3THTA 4TYSA 1UL9A 5L73A 2JG8A 5CBLA 3DL3A 4XMAA 4PJYA 1G8WA 2VMGA 5FCCA 3L2HA 1HRV1 4Z82A 4WM7B 2ET7A 1CESA 4F83A 4RS5C 1ZYBA 1Q8OA 1CAUA 2GC1A 4FP3A 4V1PA 3INAA 2ZGTA 2E7AA 1NQDA 1H4HA 2RJLA 1LU1A 1VBD1 4WZCA 3AX4A 2OZJA 4AI2A 4Y1YA 2AH2A 1F5FA 3M3IA 2GALA 4AI0A 4A3XA 5FPXA 1BZWA 4MGYE 1UZYA 3VL9A 3NKGA 1QJY2 3RQ0A 4W6YA 5J3UA 1H2LA 1PIV2 1DHKB 1MS8A 1VBE3 3O5SA 1MZ6A 4YZ5A 4Q4Y1 2E53A 3KGZA 3SCHA 4WVWA 3NW4A 5BNOA 4QQOA 4Z92B 1LHOA 1BXHA 2AR6A 3LA3A 4WM7C 4F7ZA 4LBMA 1U0AA 3IMNA 1ND3B 3L9JT 3VBUB 2OUHA 4R9AA 1AR82 5HBAA 2VQ0A 1RVF2 2EALA 2ETEA 4JGYB 3AYEA 1ENRA 2RJKA 3POSA 1TQ5A 5BPXA 2YY1A 1BCXA 2CAVA 1F5JA 3D4KA 3KGLA 4WVZA 1CAWA 5T50A 3KCYA 4XJWA 4H14A 1O5LA 3EJKA 4RR3A 3WQ0A 4A2UA 1YIPA 5KHJA 3WG4A 4LBQA 3ILFA 2GN3A 4XILA 1W6PA 1DLLA 1ND3C 4OI1A 5F6KA 3D5OA 2ZX0A 4CEYA 1A78A 4CEWB 4AI8A 4XF1A 3MIBA 5K7PA 3DV8A 3QH6A 1PO22 1I1EA 4BMEA 1N47A 1UAIA 4XBQA 5C4WB 1AYM1 4JGYC 3W9AA 1VBC2 5A3LA 3R4SA 2PHTA 1QJX2 3U0ZA 1LHWA 1BQPA 3ALQA 1QU0A 3ZXKA 2DV9A 2HWE3 2R062 1SLTA 5GZDA 4MYEA 3WW1A 3JBG2 1XNCA 4FBFA 1HW5A 5JR7B 1LGCA 3M3EA 3ZN6A 2E63A 5EYYA 1AJOA 1FATA 1Q43A 2OIIA 2R1DA 4A7YA 3R05A 1ASJ1 1W6NA 4D7TA 5CU1A 4OHWA 2ZZJA 4OHVA 4KNCA 5C8CA 3N7MA 2BW8A 1TMF1 4C91A 2WWSA 5GZCA 2PFWA 1FAYA 4OUSA 1ZX5A 4E2QA 4QPIA 4MGKE 2WSVA 5HXVA 4HKWA 2XPJA 2WL1A 3V65A 2O1QA 2NM1A 2B7YA 4LO7A 1Q8SA 4IL7A 4P14A 3U11A 2E6VA 2N7GA 1OA2A 2VOXA 4FPOB 3I54A 3THPA 1VB4A 3SH5A 4PLOA 3NO8A 2VOKA 4LTAA 1IOAA 2XUMA 2D6PA 1O3SA 3ZSEA 4IEOA 4H7LA 1QJY1 1EPWA 4HN0A 4DS0A 1C57A 4UXAA 1IPJA 2KA3A 1UZZA 1PIV1 4G4FA 4YVWB 5T5OA 1JTZX 2WZPP 4QXKA 2PHDA 2XWJB 5AFBA 4YZ2A 1CQ9A 1FT9A 1C8M3 5FQ0A 1X36A 3LSEA 5BV6A 4N9HA 2IFRA 3VDDA 1B09A 3ZXLA 1AR81 5FREA 1POV0 3SMHA 4Q1RA 2D98A 2GNTA 2D3SA 2A5ZA 1RVF1 1OOPA 5FOBB 1PO13 1TNFA 2CAUA 1W6QB 2O8QA 1JBCA 2VUAA 4XQDA 1UF2C 1RUD2 2ILMA 3FBYA 2W68A 4Z07A 2H6BA 5KXDA 2R6QA 2CWMA 5LEKA 5GZGA 2WNUA 3HMYA 3FUQA 5FMOL 1M06G 2EXJA 2DTYA 2ZKNA 1ZBA2 3CEWA 1YYNA 2DYCA 5KHIA 4DOUA 1UKGA 5JZGA 5H9PA 3H0OA 1J3RA 3PVNA 4FPLA 2HWE2 1PO21 3MZHA 5CG8A 3RDIA 3BOWA 4AQ2A 5I93A 2ZGSA 1UN1A 4HK8A 1SLAA 4FPYA 5DUVA 1VBC1 3DN7A 1QJX1 5I0RA 2MEV3 1R1A2 2GNMA 2E9QA 1CAVB 3ES1A 3GZAA 4M0HA 4GB33 2JG9A 4XQWA 4CDUC 2R061 5C6CA 3UK9A 3JBG1 3GBWA 1DQ1A 3FFQA 2CWSA 1NE6A 2HWD3 2XH6A 5L7OA 3IWZA 2ZGOA 4FT8A 1X50A 2W39A 2WT1A 2RS51 5KC6A 2EVXA 2PHXA 2Z2SB 2HJIA 4ES9A 2VXRA 2X29A 4Y1UA 2ARBA 2WZR2 2TBVA 3ZYJB 5J36A 3ZFEA 3V0AB 5CFCA 3DPRC 3OYWB 2OYZA 5A32A 4AHWA 4C90A 4F8AA 1F9KA 2ZHLA 4RQPB 3H9AA 1KFUL 1QJZA 3GBFA 5H9QA 5K0UA 5J09A 5L36A 2ZA9A 4E4SA 1AHSA 4OHZA 4AVTA 2B39A 4E2GA 2I74A 3HAGA 1J1TA 5D8AC 1RUE2 2XVLA 1ULFA 2QFEA 4TZDA 1H9PA 5JIAA 2TEPA 2D6MA 3VBFC 1S0FA 1AR93 4L92A 5DZGA 4JDMA 2WLPA 4NWVA 3ZFFB 1DQ5A 4HZFA 5JOYA 2VVFA 1C8M2 2QUOA 1WLDA 5IT6A 4RD7A 3FMGA 1UD1A 1WUVA 1CIWA 2A6YA 3QCWA 4AI1A 3ME2A 1PO12 3RJ2X 1G9FA 1MS1A 2H0BA 2Q8OA 4KQ7A 1FOD3 3OGJA 4NVPA 3KLSA 3MLLA 3ES4A 2CGOA 5CVRA 1DDLA 3IM0A 1EAH3 4YG0A 1AYN3 2EIGA 1UX6A 4AI3A 1NLRA 3VZKA 5I0UA 1LOEA 1RUD1 5CFDC 4FPFA 2OW4A 3VBOB 4EWEA 4Q27A 5J7MA 4KH9A 2NMOA 1AL0G 3RJRA 3VBSA 1A3KA 1KD7A 1ZBA1 1ZZCA 2YHJA 4LBNA 4R9BA 2LALA 4Q0VA 2BWCA 2HWE1 3NV2A 1D0GA 2WSUA 3D8CA 5BNOC 4QQ2A 1S0JA 4ITCA 2UU8A 2XJRA 3ZDSA 1JH5A 1NY72 1WW4A 3FE5A 1R1A1 1VR3A 3OJBA 1QH6A 2JEMA 3MW3A 1ZZ8A 2NPIA 3X29B 4JDOA 4COYA 4QT6A 4N90A 4CDQC 2YROA 4KU8A 1PVC3 3AZZA 4P5HA 3LAGA 2IXJA 3FC0A 1HKDA 2BNNA 2WC2A 1OPOA 3NKTA 3TWIA 3ST7A 3M7AA 1RC6A 4WM7A 4XHBA 3WW4A 4YLZA 3ZIXA 1ZZ7A 2WA4A 1MVQA 4Q4W2 3SXWA 2WZR1 4TLFA 4GMP1 2F4PA 4AG4A 2Q4SA 1RMU1 2RS31 1UPIA 3S7IA 1QOOA 2PLV3 2UWBA 4Y5Z0 1V6OA 3ZIWA 3B3QE 4LE4A 3HT1A 3GNEA 4K21A 3WZ1A 4Z1VA 1KXGA 2MHFA 1RUE1 1ZZ6A 5H9SA 2GMMA 2XLGA 4JTNA 3D82A 4XTMA 1FMD3 3O12A 1DYPA 4LBOA 4Q4X3 3W59A 1FYUA 4B4RA 3J26N 4YZ4A 1UIJA 1ND3A 2VH9A 3EXUA 1C8M1 1FOD2 1D2QA 2D5HA 2WKKA 3WDWA 4L9BA 3LZZA 2WINB 4I02A 1HV1A 4LULA 4JGYA 1EAH2 1PO11 4QPIC 2ZX4A 3VKNA 4IV1C 4N43B 1U5ZA 1SDWA 4Q26A 4AGRA 2FZ1A 3QOPA 2AGSA 3R4UA 1J59A 4M01A 3ZN4A 3AMHA 4XPVA 1OA3A 4XXAA 1ZA4A 3USSA 4ATFA 4CEWA 2IZWA 2DVFA 2DVDA 4OI4A 3KMHA 2E51A 4IV3B 4K40A 3A0KA 4W65A 1V9U3 4DY3A 5JSOA 2BUKA 5C4WA 3UKVA 2QZ3A 1O4YA 2MPFA 5EWSA 2NZ9A 3ATGA 4SLIA 3J8F3 2R0FA 4MSVA 5FFOC 4PLNA 4ZXKA 2JJ6A 4D7YA 2HEYF 4HK9A 2RMU2 3WDVA 2ZX1A 2LTNA 4FPHA 1QQP2 1SCSA 5DXDA 1ZRCA 2BFUS 1NY71 4Z2WA 3RG0A 1PM7A 3M8LA 1EV11 1PVC2 4RGGA 1QDCA 2BYVE 2Y26A 1IS6A 1Z0HA 5E89A 4CDWB 2A71A 3ASIA 1IGOA 4FVVA 3WVJA 2R30A 1CGPA 1RUH3 3MDPA 3AP7A 1W6OA 5T5JA 4ZU5A 3MGUA 2VMIA 2WNUC 4UBHA 3TB0A 3H3ZA 2Z79A 4Q4W1 3RRDA 5FLJA 2I2SA 4FXKB 3AJZA 4DZGA 4XJUA 4ASMB 1YI9A 1FMD2 1IS5A 3T1LA 4XF0A 3UV9A 4IXLA 2EAAA 1EYBA 2A3YA 2XG3A 3G6JB 2DCJA 4Q4X2 3H3UA 1RUC3 2WJSA 2VNRA 4YVWA 2WIIB 2I45A 4P9YA 1XXNA 4PIYA 3HT2A 4H55A 2ZMKA 3R4DB 4XZPA 1IS3A 5F1RA 3IPVB 3FX3A 4R4ZA 1LOCA 4HVRA 2NP0A 3MFCA 3D6EA 2DF7A 5FRAA 2RR13 3B7MA 5IK8A 4YVSB 2VNOA 3OD4A 2P37A 4QU2A 4KG0A 2ZGMA 2XWBB 1MQTC 3NAPC 3VHOA 1SFNA 5CFCC 4XJAA 1CPNA 5FAXA 5H9RA 4YFWA 4R8HA 5HCAA 2DVGA 3SISA 1YNAA 1K5MB 1RJ7A 3MFAA 1PNGA 3T2TA 3JB4C 3LKJA 4AEDB 1RUG2 1IKPA 2A6ZA 5I0SA 1EP0A 2XKOA 4MUVA 4XQ4A 3T1MA 1MS3A 1VB2A 4P9JA 4MXWB 3HN1A 1O3RA 1CAVA 2GC0A 2RMU1 3ZO0B 4AWDA 3URFA 4INDA 1S0IA 1QQP1 2ZGPA 1RUOA 5D8AA 1W0PA 1QJU3 2R042 3O0VA 2QDNA 1T6GC 1TEIA 1PVC1 3USUA 1RUH2 1SACA 4AEDC 3JZVA 3VBFA 1RUNA 3AMNA 4JCKA 1SLLA 3ZPYA 4XOGA 1AX2A 3WW3A 3OY8B 2W0XA 2AREA 2JD4A 3H1YA 5C9AC 3V0AA 4WM8B 4XFBA 5JIUA 1G9AA 4RQPA 1TME3 3KT1A 3M3CA 4G3YC 4CP0A 2CYFA 3VBSC 1YFWA 3H1MA 2EA7A 1LULA 1UIKA 4AFBA 1FMD1 2VULA 1PMIA 2Z42A 1KS4A 4RSUA 4FPJA 4BLIA 4P9XA 4OUMA 1PZ9A 4Q4X1 3ZFFA 3ZN5A 2QNKA 5CFDA 3PMEA 3PJYA 5DDJ1 4IEWA 4FTSA 3VKFC 2RR12 4WM8C 1WMFA 1S2BA 2DWRA 4XTPA 4AHXA 3K51A 1NQJA 1BMV2 4W6WA 2Y38A 3AMMA 3WG2A 2XL7A 4X8NA 5AVPA 3B01A 3Q9OA 2OPKA 3AKQA 4QX5A 4K20A 2LM3A 4META 3MF9A 1DQ0A 4X8PA 3I7DA 4N7IA 1G9DA 1Y43B 3AKTA 4B4QA 4D7SA 4KU7A 2QDRA 3I2DA 1N1VA 4QQLA 1XYNA 2Q30A 3PLQA 5IK4A 4AK3A 4XFCA 2VVDA 3KCCA 1GKBA 1VRH3 4UBGA 3AP4A 4XJZA 3VBOA 2XLAA 3AKSA 5T3NA 1BKZA 2DUPA 2X5IB 2PTMA 4M3CB 3H8UA 4CDQA 4L11A 2BVBA 5F6LB 2WNVB 3MW2A 2ZZQA 5JVVA 4CP2A 2VNGA 4AGVA 1E57A 2BVVA 4Q0UA 4TWTA 4WBBA 3BODA 4XE9A 1RUG1 1AL23 1SQ4A 2A70A 2A6VA 3MLJA 5BNQA 1LHNA 3VBRB 1D4M3 2GAUA 2XGXA 2A6XA 1C8NA 1GLHA 1REDA 4HT1T 3VBUC 2DCZA 2IXLA 1U12A 4XIOA 2DU1A 1ZNPA 4DB5A 1QDOA 4GXLA 4COWA 4LBJA 5BNNB 2EF6A 2VGDA 4GQ7A 1H2NA 3PVEA 1ND2B 4OLLA 2R041 3RMYA 3TNQA 1OD5A 3OBRA 2WNVC 2R0HA 1RUH1 2ZHMA 1ZBE3 1GNZA 2ENRA 1C4RA 2HWC3 1OFSA 5AC91 3M3OA 1TME2 4COZA 2JE7A 1CVNA 1AVBA 4MV2A 2XBO3 1VBB3 1C1LA 3VBRC 2BNMA 1N3OA 5FBZA 4OHXA 4O9GA 2OVUA 4CEWC 1Q3EA 4DRRA 5T52A 1COV3 3QH7A 3WP3A 4IV1A 3LWCA 5C4WC 1POV3 3WNXA 4CDXB 2YC0A 1CPMA 2WT2A 1DZQA 4PDWB 1AF9A 1YO8A 4K7JA 3FWEA 4NWWA 3AYDA 1B35B 2UYAA 2WA3A 2YV8A 3AKRA 3FLTA 1NOVA 2Y0OA 1DGWX 5JOZA 1BVVA 2Z69A 1VBE2 4EJRA 2RR11 4WVMA 1YFUA 2VY0A 1YUDA 1BMV1 2BBVA 2DU0A 4K1ZA 3AZYA 1CX4A 4R52A 5EYXA 3B93A 1Q8QA 4X6RB 1LRHA 4JRAA 4YW5A 1BYHA 4CDXC 1F2NA 4XBNA 3N3HA 1OQDA 4PBOA 3VKMA 3MYXA 4B29A 3IDCB 1AR63 4IERA 3VBHB 5DUWA 3U4XA 4YG6A 2V09A 1AL22 2YZ4A 1SFYA 3FZ3A 1AXKA 1VALA 1C5HA 4LHKA 3V56A 4A7ZA 3V0BB 4YM1A 1NG0A 1QXRA 4MLOA 5A33B 4QM9A 5EFUA 3E97A 4YVWC 3FLRA 1OQEA 4IEYA 4FCAA 1WGPA 3CJIB 1Z78A 3I59B 3ZFGB 3HR9A 1H1MA 3DF0A 1MS0A 3HWJA 4YW3A 2JKBA 4U36A 4Y20B 1RL3A 2HWB3 3CLPA 4XW3A 2DVAA 4CDWA 1ZBE2 1I9RA 1UU4A 1IZ3A 2GC3A 1CAXA 4GMP0 1MZ5A 2XBO2 3BU7A 1VBB2 2ATFA 2R16A 2XLFA 2PHLA 1AR73 2X53S 1GZWB 1S0BA 4ORFA 3MICA 2ZGQA 1OMIA 3KB5A 1ZREA 1V6IA 3CJIC 1AX0A 1HIXA 1O3TA 4Q8LA 4LA3A 1H4GA 1IHMA 4FOQA 1OLRA 1Y9QA 3A0NA 2QE3A 2R073 1GNHA 3KD4A 5SV8A 4BE3A 4XJ8A 1JUHA 1DIWA 1YCIA 3SITA 2IXKA 3NAPA 1MQTA 3C2UA 3FUOA 3AMQA 1FNZA 1G86A 2P34A <