4AEKA

Structural and biochemical characterization of a novel carbohydrate binding module of endoglucanase cel5a from eubacterium cellulosolvens
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
127
structure length
127
Chain Sequence
GDIVLFSGSKHVEFTDWGGTDWPSAYELQPPYQTMPFDLNKNFEIKVDYSGADIVLIFARWEHGSKPQIWAQISPYYVVDGTAVFTKEQIAKAYGSDDFSDLDYIGVKPLPSADGMTVTKIVASYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding How Non-Catalytic Carbohydrate Binding Modules Can Display Specificity for Xyloglucan.
pubmed doi rcsb
source organism Eubacterium cellulosolvens
molecule tags Hydrolase
molecule keywords ENDOGLUCANASE CEL5A
total genus 23
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18259 CBM65_1 Carbohydrate binding module 65 domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1070 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4aekA00
4AEKA 4AFMA 5AFEA 4BA6A 2YPJA 4AFDA 4AEMA
chains in the Genus database with same CATH superfamily
2CDPA 2XKOA 3SNMA 3MW2A 4XJ9A 4C90A 3WP6A 2FCUA 3RI8A 3WDWA 3H1MA 4DB5A 4GMP0 1L7RA 1MS5A 4XZPA 3IBMA 5GZDA 2LTNA 1SLTA 2ORXA 3J7MA 3P3NA 4I2OA 2HYXA 4LBQA 4FOVA 2RJKA 5JIAA 1VRBA 4B7KA 3NNLA 4HK9A 1KDKA 3USSA 5ACA3 1NCQA 3N4MA 4EWDA 2YXSA 4XAEA 1OF3A 1V6LA 5JDBA 4O9GA 4QDRA 5LA2A 1AJOA 4K8FA 1VLNA 2JG8B 1BK1A 4W6XA 1N1TA 2VO5A 4TWTA 4BOWA 4E9KA 5ABJA 2OQ7A 1YJKA 4QWNA 4YZ2A 4OULA 3OUHA 1LOCA 5JXHA 4P14A 2YU2A 4QHBA 1QJU1 1QQP3 2PAMA 1ASJ3 2JIGA 2A75A 1I3HA 2R071 2RJLA 4H14A 1H8TB 3POJA 5FREA 3VBSA 4COUA 3BKZA 3RFRA 1AR72 1BEV1 3B01A 4HONA 4LO4B 4RHV1 4BCUA 4L2NA 5HCFA 3BPZA 4D7YA 4QX7A 5LB6A 1OLMA 4AAXA 2K9ZA 4A7ZA 1X33A 2WLQA 4OHYA 4LKFA 4XABA 4DNYA 5FOBB 1UY1A 4OI2A 4R8HA 3KQRA 2Q8EA 2O8OA 3ES1A 1JODA 1PMHX 2V4AA 3AC0A 2C6SA 4JKMA 5FZ4A 4DO0A 2FDIA 1H1MA 3KV5A 1KJRA 5G05L 3MDPA 3CHXA 4LKDA 3M7AA 1UMZA 4YM0A 4BH9A 3E6DA 2JDUA 4FTBA 1SBDA 1TMF3 4Y24A 1NCRA 2G9GA 1HJGA 4P08A 5A32A 5JXGA 4MHUA 2W39A 4X8NA 4CDQC 3MFCA 1PIV3 3DXUA 1EY2A 1QEXA 3Q8FA 3RYRA 3WW3A 3LDRA 1TVGA 2ZX4A 1ZA7A 4NJ4A 2JD4A 1Y9MA 3WD5A 1TME3 3A22A 3J26N 2ZX1A 2FDJA 1QNWA 1S0EA 2WFF3 4K20A 4AE2A 4F83A 4DUVA 1BQPA 3E6CC 5C33A 5F39A 4A41A 2XQXA 4GMP1 1YXWA 3I7DA 4G3YC 4LHSA 2A6YA 4XJWA 5FPLA 5FYCA 2B4KA 5T5OA 5JIUA 4D7SA 3DCQA 2WS91 1R091 1W9YA 4LBQD 4YYOA 1IQAA 3POGA 4AFBA 2GN7A 3AM2A 2OZJA 3DGTA 4QQLA 1RUOA 1GZTA 2JDPA 2JECA 1U5YA 2GC3A 3AK0A 2FZ2A 2JX9A 4Q4X1 4LOTA 5FZ1A 3O1TA 1O3SA 4MH0E 4BMEA 2BNNA 3AKRA 3OY8B 4CZSA 2RM22 4Y4RA 3JCIA 4LKSA 1QU0A 4U36A 4AL9A 1AVBA 2DVFA 2ZX0A 3BN6A 5F2SA 5FYYA 1XXNA 4FBFA 5J3UA 4QXHA 1JHJA 1H9WA 3EXUA 1POV3 3AYEA 2WFPA 1AX0A 1GNYA 4LTAA 3S7IA 4B29A 4CP0A 1CX4A 3I3EA 4A6SA 2GNTA 1CJDA 3UETA 4CDQA 5FOJB 5E8AA 5BY5A 1OSGA 4IV1B 1SCSA 1JYWA 2VUDA 4ASKA 1EAH2 3A4UA 2P2KA 1ZA4A 2YFUA 5A7QA 4LBJA 4WV8A 2G1MA 2Q5TA 2R1DA 1UZYA 1LESA 2P3IA 2JG9B 3NNGA 4LEJA 4EN8B 3H0OA 4MXWB 2XWBB 5FCCA 2JENA 1SLIA 5K0UC 2XLAA 5CIRA 5FXZA 4O7XA 1OOPB 3LPFA 4NHKA 3V56A 1S2EA 1RGSA 5IFPA 1FPN2 5HI0A 2VVEA 2D3SA 3MO4A 4IETA 4N90A 3TEXA 4LUKA 4AEJA 5FYIA 4RD7A 4IEUA 1PNGA 3U1XA 4YW3A 2WQ8A 2WDBA 1GQHA 3WHUA 4M4RA 4LQRA 3RGBA 1GZWA 1BBT1 4UFJA 4IW3A 1W2OA 2VZPA 2BTVC 4OUMA 3UJQA 5JZGC 3WCSA 4JRAA 4HKOA 2DVBA 5CFDB 4KWUA 1LHNA 1C1FA 1XNDA 4Y4YA 1UY4A 2HH9A 4WVWA 4EZ4A 1G9BA 3U0ZA 4MGYE 3F2ZA 2JJ6A 2W9XA 4HN1A 4K9SA 3GJAA 1URXA 1JOPA 3MYXA 3I2JA 1QXPA 3O12A 1K3IA 3RI9A 5F37A 3HT1A 1VB2A 2AC1A 1T2XA 2RDNA 3ALQA 3BOPA 1PMJX 4IV3A 4Q2FA 4QQHA 3E6BA 1ZZ9A 3NVCA 5JVVA 3RNSA 5L36A 4KU7A 1AR83 1W9SA 1YHFA 1YUDA 1F35A 2QBXA 2XJVA 4JTNA 4ZU4A 2Q1MA 2WA4A 2WNUC 4RYDA 2YYOA 4GALA 4N43A 4MGTA 4ZHNA 3WQ1A 1XJAA 5EJ1B 1GZ9A 3KT7A 1O8SA 2FBEA 3ZYFA 3I49A 2Q1ZB 3ZYGA 3AYCA 1D4VB 4FQ4A 4FTSA 1RUJ3 1OD5A 2VQAA 1MEC1 4NHXA 3O0WA 3VKOA 2UYAA 4CXXA 3BIEA 4BISA 4NR1A 3O1MA 1UOGA 1CAUA 1PO11 5BNNB 4NVPA 4QU1A 1LGBA 4YVSB 5T54A 4WM7C 3ZSEA 4OFGA 1MZ5A 4XIOA 1QXRA 2OPWA 3WG2A 2HWB1 2G9ZA 4FPHA 2CU5A 2ETEA 4LBOA 4N53C 1O8PA 1WCKA 4XUTA 5HBAA 3SCHA 5I8SA 1BKZA 5BUVA 2BFUS 3GBWA 3THDA 1AXKA 2ZBJA 1Q8OA 1W05A 2A70A 2QJVA 3MICA 4JHTA 1XU2A 3KCYA 1PO23 1GWKA 1WCQA 4AQ2A 3JQXA 4Q27A 1JMUB 4CU6A 3WDVA 3WR0A 5DDJ3 4QQPA 4EQVA 5IATA 2JE9A 4HLTA 4JDMA 5F3EA 3VDDB 1BMV1 1AR81 1IS6A 4DIQA 4FQZA 3PUHA 4NE9A 3BOWA 2BDRA 2UURA 2D3RA 3B02A 4RL7A 4XQDA 1ZBE3 4FPLA 3KGLA 3VBFB 3FUQA 1MS3A 3N9MA 5A7PA 1ZRDA 5H9SA 1FYUA 2RS53 4QKBA 2VOVA 2DFCA 5I91A 3LOIA 4BQ1A 4XFGA 3N7JA 5L7OA 2R041 3D0JA 5LY2A 3OCPA 3GBGA 3HBZA 1OUXA 3W9AA 2RR11 2VU9A 4GH4C 1X7NA 4AHZA 1RYYA 3AYAA 4IEQA 3UGGA 4PF5A 2C5DA 1RUH1 2CGNA 2A73B 3T08A 1OFSA 3ZKYA 5F32A 2DU1A 5FYUA 2E7TA 2ET1A 2DCTA 3ZFFB 2LM3A 2CHHA 1AR93 3N35A 3T2OA 1PK6A 3H42B 5CISA 2Y0IA 1WCUA 1CAXA 1EP0A 2W46A 1G86A 1OXCA 4LO5B 1MS4A 1QJY3 4IGPA 4QPIB 4CU8A 5AC91 4GJZA 4WVVA 1XYPA 2A6VA 2DURA 3UL2A 4KG0A 1PGW1 3ZXKA 5FP7A 3CL1A 1W0NA 4XAAA 3VBHA 3N9LA 3SC7X 1CAWA 1LEMA 3L2YA 5FYZA 3HT2A 1GP5A 2D6MA 1ZYBA 1O3QA 5CKNA 4NIGA 2LRPA 2XHKA 2GH2A 4XACA 1V6OA 1LHUA 2GH8A 1ND3B 2PA7A 1ND3A 2EAKA 2W87A 4E2QA 1Q8QA 4LORA 1G6NA 2QVSB 4AVBA 2MHFA 4IEXA 3GGLA 2JD9A 2VQTA 4IESA 1RUD2 2D93A 4KGQA 1FOD3 3WX5A 2YC0A 1Z0HA 4B4RA 4CDXC 1LOEA 1RUE2 3M3QA 4Y33A 5DUWA 3LSEA 3K4DA 3VLBB 2ES3A 1CAWB 1OH4A 1UNBA 1V9U1 4HG6B 2VVDA 4JRLA 4M00A 4OHXA 3VBHB 5JOWA 1SQ4A 5J1XA 1DF0A 4DUWA 3GJBA 3MHZA 1ALYA 1WKYA 4P9WA 1PGL2 3O1RA 3O1PA 2B7YA 1W6QB 3AKTA 1HN0A 1VBB1 1R1A2 4V2VA 3TOJA 1QJY2 2WUHA 5GM0A 1M06G 3CNAA 3AFGA 1KGYA 1YIFA 1RIRA 3ZFFA 2Y6JA 5C6CA 1JZ6A 4LT5A 1QDCA 5J09A 1DLLA 2W3JA 3K48A 2QZ2A 3S7EA 4D6SA 3VD4A 1VBA3 5FK7A 5FPBA 4D0QA 1Q8SA 2OT7A 1UU5A 5L9BA 5ERLA 1DQ5A 2VW1A 2F4LA 4AVTA 3SKJE 3ECQA 1MS1A 3VD5A 2HWD1 3M4FA 3MLLA 1N3OA 4D69A 5FWEA 5L7OB 2YROA 3IWZA 2RDRA 4B8EA 3NJXA 4FI9A 2HWB2 4LE4A 2BBAA 4HKWA 3WDTA 1JZ3A 1LAJA 1JBCA 3JD73 2VXRA 3KB5A 5F2WA 5HCHA 5JSPA 1C57A 2DBIA 2HBTA 1IG0A 2YFZA 2TNFA 3ZN6A 3AJYA 1C3HA 1UXXX 3DPRC 2JDMA 5JZGA 1CX1A 3NJZA 4HANA 3N9PA 5EQUA 1XE7A 2RVAA 2NZ9A 3THTA 3W5NA 5FPZA 1H8TC 3RYKA 4NIDA 4AI0A 1XNCA 2YHJA 1ULCA 4IEVA 3U4XA 1BEV3 2A1XA 1W2NA 4Q4W3 4ZKTB 4CSWA 2E26A 4DQAA 4OI4A 4ES9A 3RJ2X 4PI2A 5B4XA 3U07A 5BNNC 2I45A 1Y43B 3LKJA 4JC1A 2EXKA 4I3PA 1D4M1 2A3XA 2BOIA 3KF5A 1C8NA 3UYJA 2WYFA 3WUCA 4XDQA 4PQ9A 2BOJA 3H1WA 1EUUA 3ZFEB 1W2AX 2VG9A 1C8M2 5JOZA 3MBWA 4ZONA 3R6SA 2NN8A 2VC9A 1VBE3 1WCDJ 3OF1A 5DUVA 4A7YA 2V72A 5EIYB 2G19A 1X36A 5KHIA 4GAZA 2WS92 3GNEA 3AZVA 5FLHA 1OVSA 1RVF1 4IEOA 1H4HA 2W5FA 1LU2A 1YI9A 4DPNA 1UXZA 2FDGA 1WD3A 5FBZA 1W90A 2RMU2 1U5IA 4AEMA 5C9AC 5EV7A 2FMYA 4DOUA 2ZMNA 3R4DB 1C5HA 1QNYA 3NNMA 2EXHA 5A7OA 1JZ5A 3C7HA 4OUSA 2JDHA 1W9FA 2KD7A 4FAHA 5FZHA 1RUF2 1W8NA 2V4VA 2RM21 1J1TA 3DPRA 4I30A 5C4WA 1NE4A 1ENSA 2SBAA 3MIGA 4XE9A 2QQLA 5FO9B 3I59A 1C28A 1W06A 2UY9A 4X6QB 2PAEA 3H7JA 3P5BA 1VRH1 4QPGB 5ACA2 3R4SA 2ZGSA 4CXYA 5FMOS 1POQA 2NMNA 1BVP1 5LBFA 3QACA 4OYUA 4KWLA 1QJU2 5CFDA 3RPQA 4ES8A 3F95A 2PHRA 1VPHA 4Q0VA 3D6EA 1VAMA 1GU3A 2PHXA 1D2SA 4NMIA 1HRI1 3V65A 1O4TA 3M3IA 3WQBA 3ZSJA 3ZXLA 2BGPA 4QGNA 2IXKA 2D3PA 2ZXQA 4N7UA 4WVMB 5FY1A 1NYWA 5C9AB 4EWEA 5DG2A 1QQP2 1W8ZA 4CP2A 1OMIA 4ZS2A 3ROUA 2WNUB 1UYXA 4N9HA 1LEDA 1AL22 1FPN1 3M70A 4UBGA 2ID4A 2QNKA 3ZM8A 3POIA 5A3UA 3WXPA 1V0AA 3G6JB 3LEIA 2ZS6B 1HX6A 3LWCA 4ITCA 4Q0SA 4Y26A 5KXDA 3V0BB 3S0MA 4R9CA 1UZVA 1MVEA 4QPYA 3PVNA 4IV1A 3ZMNA 3CLPA 4OUEA 4COYA 4K1ZA 3ACHA 5JI9A 1UMHA 1VRH2 4PJYA 5A7NA 1S0GA 1LOBA 1SFNA 3BCWA 4QQOA 2Q8CA 4FFIA 1JYTA 1DZTA 2E63A 3ZMOA 3BTXA 4NAMA 4BQYA 3VBUA 1XE0A 4CDWA 4HPKB 4MGKE 3LSDA 1GZCA 4WM8C 4AYUA 4QMAA 3E5XA 4Q1RA 1XNAA 3V0AA 1AR61 3MUY1 4Y5TA 3I2GA 3VBHC 5ANNA 2GC2A 4XDPA 4XXAA 3VBRA 4RQPB 1NLQA 4XMAA 3S57A 1EV13 1P8JA 3MF6A 3C7OA 1WMDA 1S55A 2ZEXA 4HVOA 4NHLA 1JYVA 1WMXA 3Q8EA 1AL21 3VD7A 3R05A 4DUXA 3H8RA 4R9AA 2WZEA 3JBG3 4YVWB 3T0AA 1UKGA 4DZGA 1W8UA 4W8JA 2QQKA 4XFHA 1AR73 4OQ9A 5C3QA 2H0BA 4EWAA 5KC6A 4S2GA 2RS31 4MADA 2OQ6A 4KU8A 4KGGA 2F6BA 4H7MA 5B4NA 2WYSA 5G04L 3O1VA 1ODNA 3IPVB 1N3QA 3RZZA 1GR3A 2VOWA 2E7QA 2BFUL 4FFGA 3SEPA 2VZ3A 3EMRA 1D7PM 1FPN3 4CTEA 5EFUA 1LNSA 4RQPC 4UW3A 1CONA 1V70A 5DAQA 4B7EA 1OA3A 5E88A 1R092 5DMYA 3AMHA 3MI8A 5C3PA 1QY4A 1VMJA 3VBUC 4CDWC 2ZHLA 2WQZC 2RS52 4A6OA 4D3WA 1IOAA 4BQ5A 4LXLA 4NHYA 4PI0A 3ZYRA 3KCXA 2R49A 1NXMA 4X8PA 3VBSC 2NQYA 4CP9B 2ZGOA 1UQXA 1EV12 4Q0QA 1OA4A 1EPWA 2VMCA 5DDJ1 4P9XA 1X9TA 4PBPA 3WG1A 4B4QA 2WLPA 2VMDA 1EV11 3K51A 3KSCA 4PQQA 5DDJ2 1JZ4A 1OT5A 3B9IA 3OUJA 3SITA 2VVFA 4DXRA 1VAVA 1ND2B 5BXXA 5LA0A 4L97A 2P3JA 2HWD2 4G4FA 2XR4A 4BIOA 5A33B 2DTWA 3IPVA 4KWJA 4IXLA 5JWPA 5SV5A 1UKRA 2D6NA 3ST7A 4HT1T 3LGRA 3LD8A 2ZEZA 1JTZX 4FXKB 2L9LA 5C7GA 4XF3A 4NPLA 1J3QA 4MYEA 2DUQA 3N9OA 4Q4Y1 3OJBA 1XPWA 1CAVA 3HPNA 1VB4A 4JGZB 3MPBA 4M3CE 3PMSA 1FMD2 4Q0UA 1UOJA 2DCZA 1OVPA 2XH6A 3WW2A 2W91A 3VBOC 3VHNA 3M1HA 4LOSA 3ZFEC 2VBBA 2VTFA 2Q8OA 4DEVA 5EPAA 4OQ8A 1LB2A 5IHRA 2A5ZA 3MW3A 3SMHA 3JD72 3PHMA 1VMFA 2JE7A 1QHDA 4QXBA 4BJ0A 3IM0A 4FPJA 1Q3EA 2OA2A 4B1MA 4XF4A 4YM2A 3EJKA 1GSLA 3PMEA 4G9SB 4SLIA 1QJX1 2KA3A 1RUD3 1RITA 4Q5OA 2GP3A 2ZGUA 4Z1VA 1QJX2 4BQ4A 1GBGA 1XNBA 1IGOA 1DGWX 4IV3B 1S0CA 1IKPA 3AFKA 1TQ5A 4JAAA 4BM8A 1D4M2 2VOXA 4Y3OA 3B7MA 3HNYM 5L7OC 4HK8A 5FZIA 5LASA 1RC6A 3O0XA 4ONUA 3GHMA 2OUHA 4CU7A 5LZ6A 4AK3A 1N3PA 1VBC2 4XDOA 1FNZA 4MZUA 4XJ8A 3MGUA 1ZM1A 4AXOA 1FATA 1NA1A 1W0PA 4ASLA 4AFCA 3ENRA 2Y34A 4PDWB 1AXYA 2ZGRA 4AAPA 3PVOA 5JLVA 2QQIA 3WW1A 4CCCA 5C4WC 1RJ7A 3NSTA 4ASMB 4M3CB 1SFPA 5EXOA 4YG3A 5FYHA 5I8TA 2BZDA 2VPVA 1QJZA 3ZPYA 4CCJA 3OPZA 4GH4A 4H55A 2DWRA 1OOPA 3PIJA 2W1QA 1VAKA 2R0FA 5DXDA 1PO21 2VNGA 1BK0A 1PZ7A 4NWWA 3NV2A 3ZSKA 1H1AA 2JICA 5CFCA 4W6WA 1PK6C 2RS32 2VE1A 4DRRA 4RR3B 3RG0A 2R16A 2PLV3 2GP5A 4YRDA 2YB7A 2A6ZA 1OURA 3JXSA 1UOFA 3O0VA 4QPGA 2Y8KA 4CEWA 5JPMB 4UAPA 2J7MA 2VUAA 4XFAA 2R072 1YQ5A 2WAAA 4XHXA 1LGNA 2IXHA 1OH3A 3WV6A 4FPGA 1CPMA 5LBEA 4A2UA 1L7QA 2FCVA 1ODMA 2D5FA 3HBKA 3X29B 1DZQA 3H8OA 2ZACA 1JUIA 1PZ8A 3GALA 4D6RA 4DXZA 1EAH1 2ZPXA 2FD8A 2WZ8A 2IC1A 3MLJA 2XBO2 3FWEA 4XF1A 4HVQA 3NKTA 2XL9A 1E5SA 4O9EA 4DFSA 3TRSB 1XBFA 1PGL1 5BV6A 4UT5A 1UW8A 4NRQA 3S6PA 5E1RA 1DZRA 3FFZA 3LCPA 2BP6A 1RUH3 4BK5A 4EN0A 4AVSA 4LULA 5FMCA 3TAYA 2VZ1A 3NO8A 1UYZA 1WW4A 2Z69A 3U75A 3PNAA 3DEMA 3MIBA 4QDSA 1QDOA 4HVRA 1CAVB 4JGZA 4F3JA 3KM5A 1HLCA 4IDZA 1YWKA 5DQ0A 5ACA1 1X82A 1XE8A 2V09A 5FZEA 1RUC2 2QDRA 2VNOA 3WUDA 1Y7BA 4I3GA 1F9KA 1Z7S3 4CE8A 3SEEA 1PNFA 3Q8AA 1IS5A 2BVVA 5KBFA 4Q1PA 3UKTA 3CJXA 3AZWA 2GC1A 2ZJCA 3I2DA 3ZDSA 4MG2A 1J3RA 2EXJA 2UWBA 1VBA2 4IEZA 1NCRB 2XJSA 2P34A 3FUOA 1K42A 2QUOA 3HMYA 1HXS2 3LB9A 1QQP1 1OQ1A 3HAGA 3PU8A 4FPOB 1MS8A 3B69A 1PO13 2DVGA 3FE5A 5C5UA 1KFUL 4QGMA 4Y1YA 5AVPA 1RVF3 5HV4A 1AXZA 5GLZA 1RL3A 4ZZ5A 1V9U3 4UYBA 3NAPC 5J7MA 3WQ7A 4ZPIA 4MO3M 2HWB3 4JX0A 1NCQC 2XQRA 1W6OA 4YZ5A 4OMDA 4FPCA 4QKNA 5CEHA 2YMZA 5FPXA 4JDNA 1V00A 1XU1A 2XWJB 1N1SA 3PUIA 2WO2A 3VZLA 4KMQA 2I07B 5LA1A 3J9SA 2ET7A 2WO1A 1GQPA 1OQDA 4OHZA 3VBSB 4ATEA 3I3MA 4UBHA 1FOD1 1NUKA 3DF0A 3P6BA 4QQ2A 5ABJB 3OGVA 1CR7A 1KJLA 3NL1A 3P3PA 3WF4A 5ISLA 2JG8A 2D97A 2RG4A 2VMGA 1XSQA 3CO2A 3Q9OA 5FKCA 1W28A 1H6XA 3OD0A 4YVWA 5TSWA 4CCEA 5LK7B 3SLIA 1IS3A 1NCQB 3ZXEA 3PTRB 2B5HA 3ZYBA 2VBPA 1Y9QA 3T4VA 2JKBA 4XJUA 1FXZA 3B5LB 5I93A 3VBOB 4YW2A 2HWF1 1KFXL 1TMF1 3VBRB 4MX3A 4BDVB 3K3OA 5EWSA 4MOAA 4XCAA 4Q4W1 3FBYA 3UK9A 2DVAA 3EO6A 5APAA 1WCSA 2JG9C 3AMNA 3V0AB 1UPIA 2WNEA 1QJEA 2WJSA 4BK4A 4BE3A 2W52A 1GOFA 3POSA 4CPBD 2Z4FA 5IK5A 4Q4X3 3LEKA 2VUJA 3DV8A 3POYA 1XYOA 5F8PA 3ZN5A 2G4IA 4YGDA 4XMIA 1CPNA 4EN7B 4HZFA 4XEZA 4QGLA 3AL6A 2DDUA 4S2HA 3OBZA 2R073 4QU2A 3SKVA 4LLOA 4DXTA 2BW8A 3E5UA 4QKFA 4OVEA 1ZZ7A 5FUPA 1IPKA 1REEA 3NQHA 3OUIA 5K4LA 2FMDA 4UXAA 1UY3A 3A0NA 3ACIA 4C91A 1POV1 2VTXA 3CJIB 3VUOA 3DYMA 4U2AA 1DHKB 3RQ0A 2WABA 1C8M3 3IIAA 4XBLA 4AHXA 2IXIA 2JWPA 3I97A 4Q0PA 1FV2A 1O6UA 4EZHA 4XYXA 3IZOA 2ZGNA 4YFWA 3RMYA 2RS12 3I3DA 1WW7A 5IAVA 1PO22 3HJRA 1NT0A 1X9PA 2ZGPA 2BGCA 1TME2 3J7HA 3A21A 4QX1A 5CKQA 1Y3TA 2YBSA 2A71A 2VL4A 4S2DA 4RR3C 2ARCA 4OMCA 1PIV1 4BU2A 3ZR5A 2SLIA 3HEIA 4FPEA 2ZEWA 1IHMA 4R9DA 3ZFFC 1HRV1 3ZSLA 3GZTB 3K4ZA 1G9DA 3ASIA 1ZBE2 1PHMA 1R082 1RUC3 3N9QA 1YJLA 1NLRA 1O4YA 2YUEA 4FP2A 4H7LA 2CYFA 5FYMA 2Q0AA 4L99A 1O59A 1RMU2 4CCDA 2VJXA 4GWJA 2HWC3 1FI2A 2WZPP 1NOVA 2XLGA 4BLIA 4JQRA 4Y22B 3OBRA 2ZX2A 1H2NA 4QB1A 2W47A 4L8QA 1IG3A 3THPA 1NKGA 3NV4A 3KVBA 4JKLA 4DMIA 5EHDA 3MFAA 4GWIA 2BWCA 2RM23 1HRV3 1UYPA 1DQ2A 2VXJA 4YG6A 5GKAC 1TE1B 5A7WA 2R1BA 4CEYA 3VB9A 4QT6A 2RS13 2KR2A 3LQCA 5IK8A 1TNRA 3DECA 4N43C 4XFCA 3LZZA 5F5IA 3ETQA 1MACA 1IPJA 1RUNA 4QXKA 2PHTA 1A34A 1W9WA 4CU9A 4EE2A 1YQCA 2QQMA 3H3LA 4OI0A 2NM1A 2PTMA 1OF4A 5H9PA 1LHVA 3IAQA 5LK5A 3CZJA 5GZFA 2KM2A 2DFBA 4LHLA 1RB8G 1CAUB 4ARXA 1LOAA 3J4UH 1HB2A 4F7ZA 3SXWA 3A0KA 1QOTA 1ULDA 1OC1A 1Q56A 3MV01 1RMU1 4QKDA 1RUJ2 4RR3A 4UW6A 1GV9A 4FCAA 1LCLA 1I5ZA 4DY3A 2DUPA 4Q29A 3E97A 5A3OA 4AEKA 4UOJA 5FZKA 4MGQA 2F4PA 3WNPA 1HN1A 2YY1A 4LO7A 1I9RA 4N43B 3DL3A 4PHZA 2LW8A 4GH4B 1RJ8A 4KL1A 4XETA 4QX0A 2WNUA 2AGSA 5E16A 3ZFGA 1OHFA 5JCTA 4M3CA 3AVSA 5HXMA 4RN5A 1QH6A 3RZHA 4XF9A 3S5QA 1QH7A 4ISQA 2TUNA 2X5IA 1K12A 4LITA 4E27A 4Z82A 4AF9A 3I2OA 3WNOA 1SDDB 3ZYPA 4K40A 4WVMA 1WW6A 1GICA 3ZLIA 3T30A 2K2SA 2LUWA 4YW7A 4CVUA 3VKLA 4CDUC 1SLAA 1VJ2A 1ZZBA 3KVAA 4LA3A 5A1LA 2R061 3I2IA 3PURA 5AFBA 2AEYA 3I2FA 5FJKA 3MIHA 1A8DA 1RUI2 5FV3A 1QMJA 2X05A 4AQ6A 1YFWA 1ZX5A 2QDNA 1EYBA 3JBG1 5BNOC 3JB8A 3LAGA 1GZWB 5IVBA 2O0OA 2ILMA 1W8WA 1DFQA 1D0HA 2RHPA 1D2QA 2P6HA 3DPRB 2WNVC 4OCTA 4X6RB 2WWSA 1HB3A 2E31A 2JXAA 3L9JT 4I0BA 3ORJA 1UZZA 3TEZA 3ZFGB 4XOGA 1W2UA 1E5RA 4C1WA 4QB2A 5CFDC 3POEA 4RFRB 2OVUA 3WG3A 3WF3A 3BU0A 5H9RA 1VRH3 1Y4WA 4NOTA 5GLTA 4DY5A 1K5MB 3ME2A 4XF0A 3VDDC 2AUYA 2VZOA 5FY7A 5A1FA 1KDMA 1BYHA 1CZVA 1S4CA 3JUUA 3I3QA 3WSOA 1PX3A 2B9VA 4XILA 1V6KA 2E53A 2UWCA 1C5IA 5I0TA 3V64A 4HBNA 1IQDC 3LA2A 3ZFEA 4AQTA 3HWJA 1TME1 2B39A 5FK8A 5A6YA 1DBNA 4Y1UA 5IVFA 2B9UA 2PAKA 4OLLA 2RDQA 1Q5OA 2VCMA 4WBBA 1SMVA 2N7GA 2WFF1 4J6GA 2WBKA 2MEV1 1OI6A 2Y33A 4LBKA 3IMNA 5FYVA 5A33A 4DEQA 1ZBA1 1AYN2 2BJSA 1HJFA 1YCIA 5LEJA 3K4AA 1ND2A 3T2QA 4Y1XA 1STMA 5FXVA 3W59A 2BV4A 2QQVA 5FR3A 4QX3A 4XFIA 5A3WA 3RZJA 4HSJA 3R4UA 1G9AA 4Z2WA 4CP9A 1GKBA 1PVC1 4GB31 4QPIA 2E51A 4GD4A 5DAXA 1RXFA 4M0HA 1RUG2 2YBKA 2VNRA 1PVC2 1QOOA 1VBE2 5LATA 5J37A 4FT8A 1H9PA 1PK6B 3ZXFA 1HV0A 5M0TA 2DBNA 5A70A 4IEWA 3T1LA 1BBT2 2WN3A 2AR6A 2DF7A 2HBUA 4XXPA 3IDBB 3UJOA 1WLTA 2JDYA 4RFT0 5CFCC 4M01A 3IDCB 5J36A 4YVSC 4I09A 3IB3A 5FY8A 1CD3G 1DQ1A 4KNCA 4GQ7A 5DUUA 4FAGA 1QJX3 4L11A 1K45A 1ND3C 3M8LA 1U12A 1NAEA 4IL7A 2FDKA 1XRUA 2X8KA 1IS4A 3ILFA 1W8OA 1ONAA 2E6VA 3U14A 1ZBA2 3MF9A 3O1OA 2RE9A 1ZRIA 5DABA 3M2MA 2A3YA 3RZGA 2C4XA 3I4IA 1SPPB 5CAZA 3N7LA 4NAOA 1Z7S2 1CZSA 1DYOA 2EF6A 2RV9A 4JVAA 4LKEA 3EB7A 1S0FA 5FPUA 1VBC3 1YI7A 2CY6A 2P3YA 2PN5A 1NX9A 1J58A 1LODA 3JB4C 4GWNA 5FZ3A 2RS33 4WM7A 3OTFA 4Q4V1 3WY6A 2ZZQA 3AZYA 4PF1A 3UGHA 4KBBA 3RZLA 1A6CA 1RUG1 1JYNA 4RQPA 2YGLA 3N3HA 1QJY1 4CUGA 4GB33 5K8SA 1KRIA 3VL9A 3POWA 2CSGA 2P1BA 3E5QA 1DIWA 4META 1RUF1 1F15A 2O14A 4N7IA 2XPJA 1K5JA 4AFDA 1DU3D 1WLCA 3JZVA 5FZCA 3ZXAC 4V1PA 4NROA 3BIWE 4E8DA 5FXWA 3TNQA 4GXLA 4D6QA 5A7SA 1YQ2A 2ORZA 3KCCA 4UFLA 1X50A 2GMEA 3OBAA 2UU8A 1RUI3 3OPTA 4NUBA 4YVSA 5KXCA 1EAH3 5AC93 2BU9A 2EIDA 3H7YA 3LFMA 1H6YA 2HLEA 4CUCA 5BNNA 4KWKA 4BYYA 5L9VA 4CYDA 3CJIC 1SFYA 2W2IA 3DUIA 1R1A3 3MPPG 4JKKA 4C0HA 3PJQA 1AL0G 3AP9A 3GF6A 5AVAA 3AYDA 4RS5C 4CCLA 1UY0A 2ZA9A 3ZO0B 3ZXDA 4CRQA 1YFYA 4LPLA 1V6JA 2OXBA 1GMMA 1PGW2 4PLNA 2QTWB 3K3NA 3VDCA 4YPJA 4CCMA 5LEKA 1SBFA 4NO4A 4I02A 2HWE1 2WT1A 3EHKA 1ZRCA 1LRHA 2WZR3 4L9BA 3ZYIB 3B93A 4RSUA 2ARBA 3HN1A 5JOXA 1S0DA 5LBBA 5C9AA 1A3KA 3T09A 4CUAA 3I54A 3OSDA 1PIV2 5SV8A 4Z2AA 4RGAA 1JZ2A 4BHPA 5HPOA 2W94A 1OFNA 3U37A 1XSRA 5BYNA 5FYTA 1UU6A 2XHNA 1RHI1 3KLSA 4AW7A 4MGSA 2VCCA 5L19A 2ENRA 5BNOB 3JBG2 1ZZCA 1JYCA 2LROA 2AH2A 4XHBA 1ULFA 4BB3A 3GCXA 4IE7A 2FDHA 1FX5A 1QGLA 4XTMA 5GALA 4AHYA 1W6OB 1V9U2 5E89A 5IUQA 1SZBA 3I59B 4LIVA 3WF0A 3ZYJB 3APBA 1MPXA 3ETPA 3FHAA 1XOYA 4XJZA 4YLZA 1MS9A 2IFWA 3LFIA 2D98A 5AFEA 2XBO1 2CWSA 2Y6KA 1LULA 4MSVA 5DZEA 1E57A 2R32A 1HQLA 5FTTC 3PUAA 4QDQA 3HQRA 5FZ0A 5FUIA 4S2FA 3ZIWA 2JEMA 1AJKA 1AYM1 1GQGA 2HWD3 1D0GA 2XJRA 3WQ0A 3ZX7A 2EIBA 3C7EA 4MUVA 1DYKA 2QQWA 5IVVA 1GNZA 3IDEA 1M4WA 3AVRA 2JG9A 2ZEYA 4K8RB 2ARAA 1VBD1 1WBFA 3NV1A 5FO7B 3VZNA 2YBPA 2WZR1 1RXGA 4YVWC 2AACA 1G9FA 2RR13 3ZOIA 2VW0A 2CNAA 2EIGA 1G7YA 1S0JA 3T0BA 2DUOA 5KHHA 3RWKX 3VV1A 4XQ4A 5C3OA 3MZHA 1VP6A 2WWUA 3IN9A 3CQOA 1NE6A 1WMEA 3NNJA 1JU3A 3CDZB 2WO7A 4RHV2 4ZS3A 1WBLA 1FMD1 2WNOA 3ZSMA 3R0RA 1RUH2 5HV0A 1BCXA 1SBEA 3SISA 2CV6A 4N53A 5FZOA 3VDBA 3BI3A 3AX4A 1XC6A 2JIJA 2RMU3 5FZ8A 2GDFA 3TBDA 2PXJA 2ADDA 4M4PA 1FNYA 5A7WB 4CEYB 1C1LA 1MQTA 2CDOA 2IZWA 4KH9A 4XW3A 5F3IA 2NMOA 4E2SA 5A1AA 4K3UA 1NLSA 5IYYA 4TSVA 2EVXA 3ZN6B 2I2SA 2K46A 4OZXA 4C0BA 4AI2A 5K9YA 4YM1A 1XQNA 4JHZA 2Z42A 3IT8A 4BQ3A 4IQPA 1F4HA 2PELA 2PMWB 4W6YA 3JQWA 1JS9A 1CIWA 4D94A 2DCJA 2BQPA 3ZXGA 3NMBA 3SQOA 3M3CA 4EROA 2BEOA 3WF2A 4CEWB 2AEZA 2BGOA 2UWAA 1ACCA 3VKMA 1DGWA 2Q8DA 2A7AA 1HXS3 5F1RA 3GHNA 5LA9A 4BA6A 3WW4A 2FHRA 1YQ6A 3OBTA 5KR7A 2YU1A 4TYSA 4A44A 3TEWA 1BLZA 5CYYA 4FPKA 5GJ6A 2GNBA 4P5HA 5A32B 5KWRA 5A6QA 5DG1A 2V5DA 2PQQA 2XKPA 1SCRA 2DCKA 4XUQA 2WSVA 2IXCA 4Y1VA 1UL9A 5FXXA 2B45X 4AEDB 4BWOA 1F31A 3ZXJA 2X09A 1YRZA 5A80A 4A7KA 4GJYA 4DRVA 5FKBA 2NLRA 2EALA 2JDKA 2C9KA 5F5QA 2AENA 4COVA 1B35A 4Y1ZA 4LJHA 2ZHKA 4OHVA 2H0VA 1R093 4COZA 1HRI3 3J7LA 3EYPA 1PO12 1V6NA 1W3VA 2RDSA 1RMU3 3K46A 3QBQA 3LA7A 4Y5Z0 5FMOL 2QQPA 2VZSA 5FY0A 4CDQB 5DZFA 1LHWA 5KHJA 3WINE 1KITA 1LENA 4JQTA 1OQEA 1W8HA 4QD2A 3K2OA 2FDFA 2ZCWA 4N9IA 3URFA 1FV3A 5CZKA 3O1SA 4Z92B 3DXTA 3DYOA 5T5JA 2Y60A 2HKXA 2WS93 2PHWA 5C71A 1KD7A 1US2A 5C5TA 5JPNB 2GN3A 4M3CF 1L7LA 5EYXA 1US3A 5T5LA 2B46X 2ZGKA 2XUEA 4IE4A 4LHNA 2HWF2 2Y38A 4UI9L 3WNLA 4JV4A 2QFEA 1OKOA 2OPKA 5IK4A 3KHCA 5DN2A 1G8WA 3VKFC 5CG8A 3VBOA 1AUYA 2HWC2 4QX8A 1KS4A 4BXFA 2JE8A 2ZABA 4AWDA 4QX2A 3D8CA 1CAXB 2HWC1 3DKQA 4Z8BA 5JI7A 3HD8B 4AI8A 3AMMA 3HQUA 2JG8C 1MEC2 2HWE2 1DQ6A 4COWA 1SEFA 5DPNA 4FOWA 2WC2A 3CKHA 5D8AA 1LHOA 2JDNA 4YZ3A 5A6XA 5CFCB 4FVVA 1ULGA 3J8F1 5IVJA 4TTGA 2DVDA 3POFA 1UN1A 4NPMA 4WM8B 3ILRA 2FQPA 2VMEA 3KD4A 2R6QA 1W04A 4URAA 1JZ8A 1DQ0A 5C8CC 4FTEA 2Y26A 3IKWA 4Q4Y2 4AQSA 2VZRA 3TNPB 3VZKA 2R30A 1I1EA 2YGMA 1H30A 3C3VA 4QHZA 3CIHA 5BNQA 1XNTA 2Y6LA 3NKGA 2O1QA 4JCKA 2BNOA 1CJPA 3KT4A 4PBOA 1HDKA 4R52A 2XJQA 3ZKUA 1NQDA 3LDKA 3H3ZA 2WT0A 2DU0A 5GZEA 3VDDA 2RS11 3ZR6A 4NIHA 5FPAA 3OG2A 5FY5A 4E8CA 1F8VA 1XB9A 4C1XA 3SCGA 4CCNA 2K0GA 5K7PA 4YGBA 2WNVA 1JOJA 3PUQA 4Q4W2 2Z79A 4H3WA 5FZAA 1H8TA 2WWJA 5ANQA 2WZR2 3J8F2 3GZUC 3GZEA 5FIXA 1O3RA 5F5AA 3VHRA 2D44A 3BTYA 3AMQA 1T6BX 3VZJA 2HEVF 1C8M1 4IGOA 4CXWA 4JGYC 3WNKA 2VTXJ 3LDBA 2WN2A 2ZTNA 3C7GA 2CWMA 4Q4Y3 3WZ1A 3RS6A 1B35B 4AVAA 1UAIA 3KHBA 4E2GA 2B8MA 3GYDA 1NY71 3KF3A 2NP0A 3AZXA 2VECA 2W0XA 3D5OA 4P5YA 4ZU5A 4HL0A 4F8AA 2NYYA 1UWWA 3O1UA 2BNMA 3LEGA 1WUVA 3KV6A 2IUWA 5FAXA 3WG4A 1ENRA 3FHIB 3USUA 4MLOA 2ZAAA 2Z5WA 5FZGA 3GZAA 4MHRA 4Q4X2 4A45A 3MEPA 1ENQA 1ND2C 1KQRA 2J1AA 1GLHA 2VOKA 2VCBA 5FUNA 4IE5A 4IERA 4TLGA 3AXDA 4GULA 3LOBA 2Y6HA 5T50A 5I0DA 1VBC1 2RR12 4UW4A 5FQ0A 3NAPB 2JDZA 1RUJ1 4GIQA 2JDAA 4JGZC 1OD3A 1WGPA 1MQTC 3KMHA 3WHTA 1LECA 1NQJA 1RUG3 4UFKA 1O4ZA 3GDBA 2RJ2A 3C7FA 4OHWA 4KQ7A 3FLPA 4A3XA 3POBA 1V6IA 1RVF2 1DP0A 2LS6A 3M3OA 1MZEA 2CGOA 4YSFA 4IUGA 2VULA 4Q26A 4YARA 2XONA 3WP3A 2W1SA 3BB6A 3IIIA 2A6XA 2ADEA 2XJUA 4NPRA 4E4SA 5BPXA 2WINB 1AR82 1UYYA 3WVJA 2EICA 2VZQA 4N53B 5FZOB 5KC5A 4LK7A 5A3MA 2IWGB 2WR9A 3WDXA 3OPWA 4PT6A 1FT9A 2PHUA 1ZRFA 2ERFA 2WA3A 2D6KA 1DLCA 5CKMA 5EYYA 5IW0A 5HCAA 4FOYA 4XTPA 2PLV2 3NWKA 3VBFC 2HWE3 1LJ7A 1V6MA 4AVCA 1PMIA 1DGLA 1W6PA 3PUSA 4FPYA 1LKNA 1PVC3 4UWDA 1W6NA 3PLQA 3WT3A 3B00A 5T3NA 4YZ4A 2OZ6A 4NWVA 3ZDVA 4CUBA 4JZRA 3HIFA 5FLIA 4R9BA 5JMCA 4E4HA 2X5IC 1AZDA 1HV1A 4I0AA 3C8XA 1RUE1 5C4WB 4YWAA 2HEWF 1J59A 5DAWA 1N47A 3Q8CA 5LWBA 2ZGTA 3K77A 2YZ4A 1W8TA 4B3NA 5KHGA 4YW5A 4A42A 4KG8A 1JZ7A 3VD9A 2GNDA 2YV8A 4K7JA 3T1MA 1VBB2 2R063 2VH9A 2QQNA 3ON7A 5EP9A 2XMLA 4W50A 1PX4A 3AL5A 3UGFA 3ATGA 1ZZ8A 3CU7A 1TNFA 3QH7A 4UFIA 5F3CA 3AKPA 3SH5A 3ACLA 2XUMA 4LNVA 4Q8KA 2DCYA 3LIHA 3GM8A 2D43A 3B94A 4RS5A 4FSJA 3MW4A 1WLWA 2E7AA 3ELNA 3S30A 1HRV2 5HCBA 5JSOA 3ABZA 1H8VA 4H2AA 1OKQA 1QJFA 3KQ4B 3LPGA 5T52A 4B4PA 2C1FA 4LBMA 2PQSA 3PJYA 1LOGA 1XNKA 1Z7S1 1SG3A 2LALA 1JOBA 5CU1A 4CDXB 3N7KA 1WLDA 3AJZA 1Q43A 5GZGA 1O7FA 2D6OX 1OPMA 1NZIA 3RRDA 5F5CA 1ULPA 3FL7A 4AEDC 5JZGB 4XC9A 1UPSA 1ASJ1 2OS2A 4EYUA 5IK7A 3TN93 3HOBA 2RMU1 1UU4A 1EPZA 3FHQA 3T0DA 4ATFA 2J1UA 2FZ1A 1AHSA 4QB6A 2QZ3A 2ZKNA 1H2MA 4GKXA 4QPWA 5FP8A 4E4DX 3VHPA 1Y9GA 5D2AA 1SACA 4P9GA 2J22A 1ZBA3 4AFAA 1H0BA 4R4XA 5J98B 5C8CA 5CB7A 4YZ1A 5FYSA 1UCXA 1E5HA 3KZ4C 2OKXA 3U4SA 1CVNA 2A6WA 2D6PA 1SLLA 3UKNA 5FZ7A 4AI1A 4EJRA 1RUI1 2ARXA 5F6LB 5FZLA 1HB1A 2JB4A 1UX7A 2GMPA 1SLBA 3VZOA 1I6XA 1VIWB 4QX5A 2XVKA 4AR2A 1CGPA 4QAWA 2VW2A 5FBJA 2VY0A 1S0BA 1PVXA 1XYNA 2VOTA 1JN2P 3AKQA 3L2HA 3O5SA 4HOOA 3T3YA 3KWVA 5CBLA 3FC0A 1NCRC 1UIJA 2QE3A 4NIIA 1BVVA 1AYN1 3P1IA 5FZFA 3J7NA 2BERA 1WD4A 4WZCA 1NY72 1CESA 4XUPA 4AZZA 2RS51 1G9CA 3H8UA 4K1YA 2ZX3A 2J1RA 4TLFA 2HEYF 3Q8BA 1PZ9A 4LBQB 3TN92 4P9LA 4Q4V2 5A6ZA 1GP4A 1VBE1 3VD3A 2VMIA 4Y20B 2YC2A 3FZ3A 2XG3A 4DINB 1DYPA 1GOHA 3WDYA 3FLTA 4J25A 1DGRA 4JGYA 4WM7B 2P37A 3WOGA 3KT1A 4PLMA 3U78A 4CCKA 2VCAA 4QM8A 2ZMKA 1WMFA 1J3PA 2VR4A 5FLJA 1LOFC 1WW5A 1YO8A 4XQWA 1UOBA 4HPKA 3VBUB 4HKLA 4CDWB 5I0RA 2BBVA 5EJ3A 1ULEA 4EN9B 3JU9A 5C8CB 1UY2A 2VM9A 2BVBA 2WKKA 1QJU3 3WLUA 1H4GA 1X8MA 4LMFA 3WF1A 4A3ZA 5I0SA 2Q1FA 3OD4A 5J48A 2V73A 2CL2A 4PIYA 4FFHA 3RSJA 1C4RA 2C26A 4BMBA 2AYHA 2CAUA 4ORFA 4UFHA 4XURA 1ZVFA 3CMGA 2GMMA 3V0BA 2VD7A 1AYM2 4WZFA 2P3KA 1S1AA 2C24A 1Q8VA 2Q30A 4YGEA 2EAAA 1DGRN 4RGGA 1QF3A 1MQTB 4IEPA 4PDWC 4YFZA 4YM3A 3EBRA 1N1VA 3NW4A 1VBD3 1S0IA 2E32A 3TYJA 1UF2C 3I2HA 5KXEA 2H6CA 2Z2SB 2XL7A 4JTOA 4UF0B 4NIAA 2XXZA 3ZFGC 3ACFA 1JW6A 2W08A 4XPVA 4YW6A 3LEMA 1QIQA 5IWFA 2PHFA 3WP5A 3SH4A 1DDLA 3PU3A 5FZ6A 2YC4A 4JDOA 2ZHMA 2KXLA 2W1WA 4C8DA 2CTVA 4CDUA 3AP5A 5CG9A 3H3UA 1YLLA 4XFFA 1BBT3 1B35C 3OGSA 3LIGA 3SH3A 2BPA2 4LR4A 3RMXA 2CGPA 4GA9A 1IZ3A 1GANA 2VQ0A 2IFRA 4BXSV 1QOSA 1F5JA 3UV9A 4MVTA 3JD71 4GMP3 1K5MA 5EZWA 1A78A 2DYCA 4FFFA 5FFOC 1ASJ2 3E1F1 3PL0A 4PCRA 1W8FA 3RDIA 1W6MB 1MZ6A 1ZNPA 3UKVA 3RJRA 2C9AA 4LE3A 3HR9A 2P6CA 3AP4A 2EIEA 2WQ4A 5JMOA 1VBD2 3CZUA 3FMGA 3U11A 3VDAA 2MNGA 4ZY9A 1APNA 4D8MA 3QLQA 3ZVXA 2WSUA 5I8YA 1SLCA 4QXCA 4AG4A 5F3GA 5BNPC 1VE0A 1NXD1 5IAXA 4GKYA 3T4HB 3INAA 5JR2A 5KXBA 3WDUA 1REDA 4ZXEA 1S2BA 3FFQA 4LIUA 3AB0A 1ULOA 3OYWA 1AX1A 4AOCA 3WEZA 1YFXA 2AZ5A 1TZOA 1JH5A 4AI9A 2WO3A 3OEBA 1WA4A 1UZ0A 4YW1A 5LY1A 4UF0A 1POV0 2XJPA 2VZTA 3UESA 2GAUA 4AHWA 5A3LA 3FJSA 3QD6A 1H2KA 1R64A 3HVDA 4XBNA 1NZCA 3GCWA 4BQ2A 2EXIA 2UY8A 3H50A 2QQJA 5FMBA 4RHV3 2VGDA 4AVVA 4D7TA 4UFMA 5IVEA 5IFTA 2YG0A 3N36A 1K5MC 1MR5A 3O14A 2GNMA 2BWAA 3BALA 2ZGMA 2OW4A 2P17A 1J83A 3DN7A 1YNAA 5FY9A 4QPIC 4ET7A 3OYWB 1J1LA 4QPGC 1HB4A 3NAPA 3ILNA 4K21A 3WNXA 5A3TA 1JYXA 3PIGA 3RZKA 1NG0A 4YGCA 3OB8A 2J1TA 1OLRA 1DCSA 5B2GB 4J1WA 5DAPA 2MEV3 2JB8A 4GZ9A 1HKDA 3AZZA 3ZYHA 1ZBE1 1LR5A 2B42B 4LA2A 5BNPA 3W5MA 4EV0A 3BGAA 1BXHA 1R1ZA 1JUHA 1AR63 2PFWA 1U5XA 4LBLA 3LA3A 2J1SA 2QKDA 3CEWA 4CA9A 2ZHNA 2VBDA 2YPDA 1W2TA 4LLFA 4GB32 1W6MA 2VAUA 2Y0OA 4A4AA 1PM7A 5J96B 3NV3A 3UT0A 2D40A 1AF9A 1W6QA 4WVZA 1S2KA 4XZUG 4MXWA 3OGJA 3I8TA 1GWLA 4K6BA 4LBNA 4ZU7A 5C70A 2UYBA 1VALA 2Y6FA 3AMPA 3C2UA 4INDA 1GOGA 4I01A 1SPPA 3FN9A 4RGKA 2WIIB 4TZDA 5IT6A 4P9IA 4CDUB 1T6GC 3A7QA 4LK6A 1LGCA 4Y5SA 1MVQA 1BHGA 3TEYA 1QWRA 2WFF2 3OGGA 3VZMA 5LW9A 3I3BA 3S5AA 1RUC1 2E9QA 3DYPA 1KS5A 4Z07A 1HW5A 1RUD1 1N1YA 1ZRRA 2WAOA 5GLVA 2W95A 5FP4A 2BRTA 2WRAA 2MPFA 3WP4A 4PIXA 3NNFA 5CVRA 3ITQA 3W20A 2WNVB 5FZDA 4CPBA 1CWPA 3PTYA 3IDAA 1OLME 4FOQA 1TG7A 5C8WA 1AR62 3H9AA 4DXSA 1HIXA 2D6LX 2ZGLA 4YG0A 3N9NA 3TWIA 1MEC3 2Q4SA 1PM4A 5CADA 2J42A 4MXVA 3VGIA 5FPVA 3PVBB 3QH6A 2ATFA 3OOXA 4HSLA 3MIFA 2O8QA 1X8EA 5FYBA 2PHLA 1SHWB 3ACGA 3CJIA 4IV1C 3VN4A 1GFF2 4URTA 2HJIA 5AC92 3RZMA 2YPJA 2XVGA 1ST8A 4FP3A 3HNMA 4O65A 2R7EB 2PYTA 4IE6A 2HYKA 1AL23 1JHNA 4CDXA 5JXIA 2DTYA 5DUXA 1B09A 3LE0A 2QQUA 5FZMA 5T5PA 1OA2A 5L9RA 1FAYA 4DS0A 5A3PA 5C3SA 3NJYA 4ARYA 1RUE3 2OIIA 2GZWA 4XVHA 5LCWL 1O3TA 3MIDA 3RWNA 2VZVA 4KI5M 4WM8A 4FXGB 4BQXA 5D1IA 4TXWA 4E4ZA 2OUJA 3AKSA 2GC0A 2WT2A 4P9YA 2PHDA 2X29A 2ZKLA 4Q8LA 5D8AB 3G7DA 3KS7A 2J1EA 4FO9A 4OI1A 3N7MA 5A3NA 2ZOEB 3BVCA 1YFUA 4HMZA 2CAVA 2F17A 4ISRA 4QHOA 4GWMA 1F2NA 1ZZ6A 4IV3C 3CF6E 1L3JA 1E5IA 4Y20A 3VBFA 3VL8A 1A8MA 4NRPA 3OGRA 4AGRA 4N8MA 2DV9A 3KV4A 3B3QE 5FRAA 4XFBA 2QQOA 3D3AA 4HFSA 2X53S 4CCOA 2IVIB 3J8F3 5CNAA 1JXNA 4BIFA 1W3XA 3TN91 5LRRA 1BMV2 1YYNA 3MIEA 4HN0A 4FPFA 3DKWA 2IVJA 3RYPA 1DQ4A 5FJHA 1U0AA 1UO9A 1JI6A 4B1LA 3MV11 3PVEA 1W03A 2ZGQA 1ZREA 2V5YA 1OPOA 2QCSB 2ZAHA 5BNPB 1W9TA 5JOYA 2G9FA 3UNPA 4LO8A 1R081 5JXJA 4V2WA 2C0ZA 1OLQA 1RHI2 4Q4V3 4NHMA 1W6NB 1YC61 3GXUA 2MEV2 4RA0A 4ZXKA 1HRI2 5CA6A 1W6PB 4AGGA 3ZN4A 5DAVA 5HXVA 4BQWA 5FO8B 2XB6C 4XUOA 3KGZA 2VMHA 1O5LA 1WWYA 1VMHA 4ZZ8A 2X5IB 2D7FA 2XOMA 3QOPA 3W58A 4EN6B 4AEDA 5F6KA 1R1A1 3NJVA 2XDVA 5LBCA 5FP9A 3BU7A 2OX0A 1YIPA 5IVYA 1PGSA 1BZWA 3LF7A 2GALA 1I5PA 1U5ZA 1O91A 1DG6A 3WNNA 2Y64A 1HQWA 2IXLA 3O7OA 3BUCA 1UZWA 4I0WB 4IGQA 4LO6B 5JSRA 2ZMLA 3WCRA 2PLV1 3D82A 2ZZJA 4P00B 4BLJA 2VUCA 3M3EA 3KV9A 4BZ4A 3W21A 4RS5B 3ES4A 2EA7A 3H8XA 2XJTA 3H1YA 4XUNA 4M0NA 5I0UA 1WZXA 4MV2A 1RHI3 5E6HA 2TEPA 3CBNA 3FX3A 2I74A 4O61A 1R083 1REFA 1YQ8A 1W39A 3BPSA 3ZPOA 4AGVA 4QM9A 5IVCA 3ZIXA 1GNHA 4LUMA 2W92A 1LU1A 4TN7A 5GLWA 1CQ9A 1VBA1 4AI3A 5FY4A 2E33A 1HQNA 1RUF3 3AP6A 2VNVA 2VMFA 1Z78A 2Y6GA 1CIYA 1HXS1 3PDQA 1GWMA 2XLFA 5H9QA 3USUB 1RTVA 2NPIA 2XBO3 5FZBA 4CEYC 1Q8PA 1O5UA 1QXJA 4J1XA 3MUZ1 2XVLA 2W68A 3FLRA 3OEAA 1TMF2 1LTEA 1QKQA 4L0PA 4L92A 2GSYA 3SHRA 5JUVA 1YEWA 1AYM3 2H6BA 4Y22A 3IAPA 5K0UA 5GZCA 3TB0A 1UX6A 2GU9A 1IKQA 5F9TA 1GP6A 1OBNA 4PLOA 3RVHA 2XGXA 4XCBA 4LHKA 2R043 3FBMA 5T55A 4YNIA 1CN1A 1JU4A 2W1UA 4XBQA 1MZFA 3I2KA 4IEYA 1F4AA 2BYVE 3HN3A 2AREA 2FCTA 2WL1A 5GLUA 4CEWC 3THCA 1NA1C 2JKXA 4YW4A 4NN0A 1ENXA 2VZUA 4CP1A 2TBVA 1IPSA 3VKNA 4P9JA 1AX2A 4BPZA 1D4M3 1AR92 1COV1 4W65A 3VHOA 4IE0A 1UIKA 1AYN3 5JR7B 3K75B 3HQXA 1AR91 1COV2 5DZGA 5FMDA 3GBFA 1KEXA 5K0UB 2BUKA 1H1IA 3EQEA 4MGZE 4P02B 3OY8A 1J84A 4AFMA 1OOPC 2X10A 4PIZA 1CZTA 4W4ZA 3AP7A 1LOFA 1W0OA 2IXJA 4HETA 4XIKA 3BYWA 5D21A 4HXCA 4UW5A 5JAXA 3HNBM 4XJAA 4OZOA 5L73A 2R0HA 4PDWA 5ABJC 3U10A 2P4EA 1MS0A 1GYKA 4NRMA 1NA1B 2J1VA 4MGIE 1H2LA 3NRUA 2A3WA 3QCWA 1EUTA 1UD1A 5EJZB 3BODA 3BTAA 1GUIA 1FMD3 3IMMA 3T2TA 3BTZA 5KHKA 1TEIA 2R042 5BNOA 3D0SA 1VBB3 2R062 4R4ZA 3SCFA 3B9CA 3MLKA 5FQ0B 2OYZA 2D5HA 2HWF3 1FOD2 5C3RA 2P5BA 4SBVA 1BJQA 3WNMA 5FDBA 1OUSA 1W99A 1F5FA 3VBRC 1KXGA 1VR3A 3D4KA 2VQUA 5D8AC 5F7UA 5FP3A 5LRSA 4KBZA 1SDWA 5FZ9A 3T2PA 1UMIA 3AXEA 1AR71 1BEV2 2YDEA 1COV3 1WA6X 1JYIA 4JGYB 5IJRA 1RINA 3A23A 5FWJA
chains in the Genus database with same CATH topology
2XKOA 3SNMA 3MW2A 4XJ9A 4C90A 3WP6A 3RI8A 3WDWA 3H1MA 4DB5A 4GMP0 1MS5A 4XZPA 3IBMA 5GZDA 2LTNA 1SLTA 3P3NA 4I2OA 4LBQA 4FOVA 2RJKA 5JIAA 4B7KA 4HK9A 1KDKA 3USSA 5ACA3 1NCQA 3N4MA 4EWDA 2YXSA 1V6LA 5JDBA 4O9GA 1AJOA 4K8FA 1VLNA 2JG8B 1BK1A 4W6XA 1N1TA 4TWTA 4BOWA 4E9KA 5ABJA 1YJKA 4YZ2A 4OULA 1LOCA 4P14A 4QHBA 1QJU1 1QQP3 2PAMA 1ASJ3 2A75A 1I3HA 2R071 2RJLA 4H14A 1H8TB 5FREA 3VBSA 4COUA 1AR72 1BEV1 3B01A 4LO4B 4RHV1 4BCUA 4L2NA 5HCFA 3BPZA 4D7YA 2K9ZA 1X33A 2WLQA 4OHYA 4DNYA 5FOBB 4OI2A 4R8HA 3KQRA 2O8OA 3ES1A 1H1MA 1KJRA 3MDPA 3M7AA 1UMZA 4YM0A 4BH9A 3E6DA 4FTBA 1SBDA 1TMF3 4Y24A 1NCRA 2G9GA 5A32A 2W39A 4X8NA 4CDQC 3MFCA 1PIV3 1EY2A 3RYRA 3WW3A 2ZX4A 2JD4A 3WD5A 1TME3 3J26N 2ZX1A 1QNWA 1S0EA 2WFF3 4K20A 4AE2A 4F83A 1BQPA 3E6CC 5C33A 4GMP1 1YXWA 3I7DA 4G3YC 2A6YA 4XJWA 5T5OA 5JIUA 4D7SA 2WS91 1R091 4LBQD 4YYOA 1IQAA 4AFBA 2GN7A 3AM2A 2OZJA 3DGTA 4QQLA 1RUOA 2JECA 1U5YA 2GC3A 3AK0A 2FZ2A 2JX9A 4Q4X1 1O3SA 4MH0E 4BMEA 2BNNA 3AKRA 3OY8B 4CZSA 2RM22 3JCIA 1QU0A 4U36A 1AVBA 2DVFA 2ZX0A 4FBFA 1XXNA 5J3UA 1H9WA 3EXUA 1POV3 3AYEA 2WFPA 1AX0A 4LTAA 3S7IA 4B29A 4CP0A 1CX4A 5FOJB 2GNTA 1CJDA 4CDQA 5E8AA 5BY5A 1OSGA 4IV1B 1SCSA 1EAH2 3A4UA 2P2KA 1ZA4A 4LBJA 4WV8A 2Q5TA 2R1DA 4LEJA 1UZYA 1LESA 2P3IA 2JG9B 4EN8B 3H0OA 4MXWB 2XWBB 5FCCA 2JENA 1SLIA 5K0UC 2XLAA 5CIRA 1OOPB 4NHKA 3V56A 1RGSA 1FPN2 5HI0A 2VVEA 2D3SA 4N90A 4IETA 4LUKA 4AEJA 4RD7A 4IEUA 1PNGA 4YW3A 1GQHA 3WHUA 1GZWA 1BBT1 2BTVC 4OUMA 3UJQA 5JZGC 3WCSA 4JRAA 4HKOA 2DVBA 5CFDB 1LHNA 1C1FA 1XNDA 4Y4YA 4WVWA 1G9BA 3U0ZA 4MGYE 2JJ6A 4HN1A 4K9SA 1URXA 3MYXA 1QXPA 3O12A 3RI9A 3HT1A 1VB2A 4IV3A 3ALQA 4Q2FA 4QQHA 3BOPA 3E6BA 1ZZ9A 3NVCA 5JVVA 3RNSA 5L36A 4KU7A 1AR83 1YHFA 1YUDA 2XJVA 4JTNA 4ZU4A 2Q1MA 2WA4A 2WNUC 2YYOA 4GALA 4N43A 3WQ1A 1GZ9A 3KT7A 2FBEA 2Q1ZB 3ZYGA 3AYCA 1D4VB 4FQ4A 4FTSA 1RUJ3 1OD5A 2VQAA 1MEC1 3VKOA 3O0WA 2UYAA 4NR1A 1CAUA 1PO11 5BNNB 4NVPA 1LGBA 4YVSB 5T54A 4WM7C 3ZSEA 4OFGA 1MZ5A 4XIOA 1QXRA 3WG2A 2HWB1 4FPHA 2ETEA 4LBOA 4N53C 5HBAA 1WCKA 3SCHA 5I8SA 1BKZA 5BUVA 2BFUS 3GBWA 1AXKA 2ZBJA 1Q8OA 2QJVA 2A70A 3MICA 1XU2A 3KCYA 1PO23 4AQ2A 3JQXA 4Q27A 3WDVA 3WR0A 5DDJ3 4QQPA 2JE9A 4HLTA 4JDMA 3VDDB 1AR81 1IS6A 4FQZA 4RL7A 4XQDA 3BOWA 3B02A 2UURA 2D3RA 1ZBE3 4FPLA 3KGLA 3VBFB 3FUQA 1MS3A 1ZRDA 5H9SA 1FYUA 2RS53 2VOVA 2DFCA 5I91A 3LOIA 4BQ1A 4XFGA 3N7JA 5L7OA 2R041 3D0JA 3OCPA 3GBGA 3HBZA 3W9AA 2RR11 2VU9A 4GH4C 1X7NA 4AHZA 3AYAA 4IEQA 4PF5A 2C5DA 1RUH1 2CGNA 2A73B 1OFSA 2DU1A 2E7TA 2ET1A 2DCTA 3ZFFB 2LM3A 1AR93 3N35A 1PK6A 2Y0IA 1CAXA 1EP0A 1G86A 4LO5B 1MS4A 1QJY3 4QPIB 5AC91 4WVVA 1XYPA 2A6VA 2DURA 3UL2A 4KG0A 1PGW1 3ZXKA 3CL1A 3VBHA 1CAWA 1LEMA 3L2YA 3HT2A 2D6MA 1ZYBA 1O3QA 2XHKA 2GH2A 1V6OA 1LHUA 2GH8A 1ND3B 2PA7A 1ND3A 2EAKA 4E2QA 1Q8QA 1G6NA 2QVSB 4AVBA 2MHFA 4IEXA 4IESA 1RUD2 2D93A 4KGQA 1FOD3 3WX5A 2YC0A 1Z0HA 4B4RA 4CDXC 1LOEA 1RUE2 3M3QA 5DUWA 3LSEA 3VLBB 1CAWB 1V9U1 2ES3A 4JRLA 2VVDA 4M00A 4OHXA 3VBHB 5JOWA 1SQ4A 1DF0A 1ALYA 4P9WA 1PGL2 2B7YA 1W6QB 3AKTA 3TOJA 1VBB1 1R1A2 1QJY2 5GM0A 1M06G 3CNAA 3AFGA 1YIFA 3ZFFA 1RIRA 5C6CA 4LT5A 1QDCA 5J09A 1DLLA 3K48A 3S7EA 2QZ2A 1VBA3 1Q8SA 1UU5A 1DQ5A 2VW1A 4AVTA 3ECQA 1MS1A 2HWD1 3M4FA 3MLLA 1N3OA 4D69A 5L7OB 2YROA 3IWZA 4B8EA 2HWB2 4LE4A 4HKWA 3WDTA 1JBCA 3JD73 2VXRA 3KB5A 5JSPA 1C57A 2TNFA 3ZN6A 3AJYA 1C3HA 3DPRC 5JZGA 3NJZA 4HANA 1XE7A 2NZ9A 3THTA 5FPZA 1H8TC 3RYKA 4AI0A 1XNCA 2YHJA 1ULCA 4IEVA 3U4XA 1BEV3 4Q4W3 4ZKTB 4DQAA 4OI4A 4ES9A 3RJ2X 3U07A 5BNNC 2I45A 1Y43B 3LKJA 4JC1A 2EXKA 4I3PA 1D4M1 2A3XA 3WUCA 1C8NA 4XDQA 4PQ9A 3H1WA 3ZFEB 2VG9A 1C8M2 5JOZA 3R6SA 2NN8A 1VBE3 1WCDJ 3OF1A 5DUVA 4A7YA 1X36A 5KHIA 2WS92 3GNEA 3AZVA 5FLHA 1RVF1 4IEOA 1H4HA 1LU2A 1YI9A 4DPNA 1WD3A 5FBZA 2RMU2 1U5IA 4AEMA 5C9AC 5EV7A 2FMYA 4DOUA 2ZMNA 3R4DB 1C5HA 1QNYA 2EXHA 4OUSA 4FAHA 1RUF2 4I30A 5C4WA 3DPRA 2RM21 1J1TA 1NE4A 1ENSA 2SBAA 3MIGA 4XE9A 5FO9B 3I59A 1C28A 2UY9A 4X6QB 2PAEA 3H7JA 4QPGB 1VRH1 5ACA2 3R4SA 2ZGSA 5FMOS 2NMNA 1BVP1 3QACA 4KWLA 1QJU2 5CFDA 3RPQA 4ES8A 2PHRA 4Q0VA 3D6EA 1VAMA 2PHXA 3ZSJA 1D2SA 5CFCB 1HRI1 3V65A 1O4TA 3M3IA 3ZXLA 4QGNA 2D3PA 2IXKA 4N7UA 4WVMB 1NYWA 5C9AB 4EWEA 5DG2A 1QQP2 4CP2A 1OMIA 3ROUA 2WNUB 4N9HA 1LEDA 1AL22 1FPN1 3M70A 4UBGA 2QNKA 3WXPA 3G6JB 4ITCA 3LWCA 2ZS6B 1HX6A 4Q0SA 5KXDA 3V0BB 4Y26A 1BMV1 3S0MA 4R9CA 1MVEA 4QPYA 3PVNA 4IV1A 3ZMNA 3CLPA 4COYA 4K1ZA 5JI9A 1VRH2 4PJYA 1S0GA 3BCWA 1LOBA 1SFNA 4QQOA 1DZTA 2E63A 3ZMOA 3VBUA 4CDWA 4HPKB 4MGKE 3LSDA 1GZCA 4WM8C 4AYUA 4QMAA 3E5XA 4Q1RA 3V0AA 1AR61 3VBHC 2GC2A 4XXAA 3VBRA 4RQPB 4XMAA 1EV13 3MF6A 4NHLA 1WMDA 1S55A 4HVOA 1AL21 3R05A 4R9AA 3JBG3 4YVWB 1UKGA 4DZGA 4XFHA 1AR73 5KC6A 2H0BA 4EWAA 4S2GA 2RS31 4KU8A 4KGGA 2F6BA 4H7MA 3IPVB 1N3QA 3RZZA 1GR3A 2VOWA 2E7QA 2BFUL 1FPN3 4CTEA 5EFUA 4RQPC 4UW3A 1CONA 1V70A 4B7EA 1OA3A 5E88A 1R092 3AMHA 3MI8A 1QY4A 3VBUC 4CDWC 2ZHLA 2WQZC 2RS52 4D3WA 1IOAA 3ZYRA 3KCXA 2R49A 1NXMA 4X8PA 3VBSC 2NQYA 2ZGOA 1EV12 4Q0QA 1OA4A 1EPWA 5DDJ1 3WG1A 4P9XA 4B4QA 4PBPA 2WLPA 1EV11 3K51A 3KSCA 5DDJ2 5IK8A 3SITA 3B9IA 2VVFA 1VAVA 1ND2B 5BXXA 4L97A 2P3JA 2HWD2 4G4FA 4BIOA 5A33B 2DTWA 3IPVA 4KWJA 4IXLA 5JWPA 5SV5A 1UKRA 2D6NA 3ST7A 4HT1T 3LGRA 4FXKB 1JTZX 4XF3A 1J3QA 4MYEA 2DUQA 4Q4Y1 3OJBA 4M3CE 1CAVA 4JGZB 1VB4A 4Q0UA 3MPBA 3PMSA 1FMD2 2DCZA 2XH6A 3WW2A 3VBOC 3VHNA 3M1HA 3ZFEC 2Q8OA 1LB2A 2A5ZA 3MW3A 3SMHA 3JD72 3PHMA 2JE7A 1QHDA 3IM0A 4FPJA 1Q3EA 2OA2A 4XF4A 4YM2A 3EJKA 1GSLA 3PMEA 4G9SB 4SLIA 1QJX1 2KA3A 1RUD3 1RITA 4Z1VA 2ZGUA 1QJX2 1GBGA 1XNBA 1IGOA 1DGWX 4IV3B 1S0CA 1IKPA 3AFKA 1TQ5A 4JAAA 4BM8A 1D4M2 2VOXA 3B7MA 5L7OC 4HK8A 1RC6A 3O0XA 4ONUA 3GHMA 2OUHA 4AK3A 1N3PA 1VBC2 1FNZA 4MZUA 4XJ8A 3MGUA 1ZM1A 4AXOA 1FATA 1NA1A 1W0PA 4ASLA 4AFCA 3ENRA 4PDWB 1AXYA 2ZGRA 3PVOA 5JLVA 3WW1A 5C4WC 1RJ7A 3NSTA 4ASMB 4M3CB 5EXOA 4YG3A 5I8TA 2VPVA 1QJZA 3ZPYA 3OPZA 4GH4A 4H55A 2DWRA 1OOPA 1VAKA 2R0FA 5DXDA 1PO21 2VNGA 1PZ7A 4NWWA 3NV2A 3ZSKA 1H1AA 2JICA 5CFCA 4W6WA 1PK6C 2RS32 4DRRA 4RR3B 3RG0A 2R16A 2PLV3 4YRDA 2A6ZA 3O0VA 4QPGA 4CEWA 5JPMB 2VUAA 4XFAA 2R072 4XHXA 1LGNA 2IXHA 3WV6A 4FPGA 1CPMA 4A2UA 2D5FA 3X29B 1DZQA 2ZACA 1JUIA 1PZ8A 3GALA 4DXZA 1EAH1 2ZPXA 2IC1A 3MLJA 2XBO2 3FWEA 4XF1A 4HVQA 3NKTA 2XL9A 4O9EA 4DFSA 3TRSB 1PGL1 5BV6A 1UW8A 3S6PA 5E1RA 1DZRA 3FFZA 3LCPA 4EN0A 1RUH3 4AVSA 4LULA 3TAYA 3NO8A 1WW4A 2Z69A 3PNAA 3MIBA 1QDOA 4HVRA 1CAVB 4JGZA 4F3JA 3KM5A 1HLCA 1YWKA 5ACA1 1X82A 1XE8A 2V09A 1RUC2 2QDRA 2VNOA 3WUDA 1Y7BA 4I3GA 1F9KA 1Z7S3 1PNFA 1IS5A 2BVVA 5KBFA 4Q1PA 3UKTA 3CJXA 3AZWA 2GC1A 2ZJCA 3I2DA 3ZDSA 1J3RA 2EXJA 2UWBA 1VBA2 4IEZA 1NCRB 2XJSA 2P34A 3FUOA 2QUOA 3HMYA 1HXS2 3LB9A 1QQP1 1OQ1A 3HAGA 4FPOB 1MS8A 3B69A 1PO13 2DVGA 3FE5A 1KFUL 4QGMA 4Y1YA 5AVPA 1RVF3 1AXZA 5GLZA 1RL3A 1V9U3 3NAPC 5J7MA 3WQ7A 4YZ5A 2HWB3 1NCQC 1W6OA 4FPCA 2YMZA 5FPXA 4JDNA 1V00A 1XU1A 2XWJB 1N1SA 3VZLA 2I07B 3J9SA 2ET7A 4OHZA 3VBSB 1OQDA 4ATEA 4UBHA 1FOD1 3DF0A 4QQ2A 5ABJB 1CR7A 1KJLA 3NL1A 3P3PA 2JG8A 2D97A 2VMGA 3CO2A 3Q9OA 3OD0A 5TSWA 4YVWA 5LK7B 3SLIA 1IS3A 1NCQB 3ZXEA 2B5HA 1Y9QA 2JKBA 4XJUA 1FXZA 3B5LB 5I93A 3VBOB 4YW2A 2HWF1 1KFXL 1TMF1 3VBRB 4MX3A 5EWSA 4Q4W1 3FBYA 3UK9A 2DVAA 3EO6A 1WCSA 2JG9C 3AMNA 3V0AB 1UPIA 2WNEA 2WJSA 4BE3A 2W52A 3POSA 5IK5A 4Q4X3 3ZN5A 2VUJA 3DV8A 3POYA 1XYOA 2G4IA 4YGDA 4XMIA 1CPNA 4EN7B 4HZFA 4XEZA 4QGLA 4S2HA 2R073 4QU2A 4LLOA 2BW8A 3E5UA 4OVEA 1ZZ7A 1IPKA 1REEA 2FMDA 4UXAA 3A0NA 4C91A 1POV1 3CJIB 4U2AA 1DHKB 3RQ0A 1C8M3 3IIAA 4XBLA 4AHXA 2IXIA 4Q0PA 1FV2A 4XYXA 2ZGNA 4YFWA 3RMYA 2RS12 1WW7A 1PO22 2ZGPA 2BGCA 1TME2 1Y3TA 2A71A 4S2DA 4RR3C 1PIV1 2SLIA 4FPEA 4R9DA 1IHMA 3ZFFC 1HRV1 3ZSLA 3GZTB 1G9DA 3ASIA 1ZBE2 1PHMA 1R082 1RUC3 4FP2A 1YJLA 1NLRA 1O4YA 2YUEA 4H7LA 2CYFA 2Q0AA 4L99A 1RMU2 2HWC3 1FI2A 2WZPP 1NOVA 2XLGA 4BLIA 4JQRA 4Y22B 3OBRA 2ZX2A 1H2NA 3THPA 4L8QA 3NV4A 4DMIA 3MFAA 2BWCA 2RM23 1HRV3 4YG6A 1DQ2A 5GKAC 4CEYA 1TE1B 2R1BA 4QT6A 2RS13 1TNRA 4N43C 4XFCA 3LZZA 3ETQA 1MACA 1IPJA 1RUNA 4QXKA 2PHTA 4OI0A 2NM1A 2PTMA 5H9PA 1LHVA 5LK5A 5GZFA 2KM2A 2DFBA 4LHLA 1RB8G 1CAUB 1LOAA 3J4UH 4F7ZA 3SXWA 3A0KA 1QOTA 1ULDA 1Q56A 1RMU1 1RUJ2 4RR3A 4UW6A 1GV9A 4FCAA 1LCLA 1I5ZA 4DY3A 2DUPA 4Q29A 3E97A 4AEKA 2F4PA 2YY1A 4LO7A 1I9RA 4N43B 3DL3A 4GH4B 1RJ8A 4KL1A 4XETA 2WNUA 2AGSA 5E16A 3ZFGA 1OHFA 5JCTA 4M3CA 1QH6A 4XF9A 1QH7A 4ISQA 2TUNA 2X5IA 4E27A 4Z82A 4AF9A 3ZYPA 4K40A 4WVMA 1WW6A 1GICA 2K2SA 2LUWA 3VKLA 4CDUC 1SLAA 1VJ2A 1ZZBA 4LA3A 2R061 5AFBA 3MIHA 1A8DA 1RUI2 4AQ6A 1QMJA 4A7ZA 5BNOC 1YFWA 1ZX5A 2QDNA 1EYBA 3JBG1 3JB8A 3LAGA 1GZWB 2O0OA 2ILMA 3DPRB 1DFQA 1D0HA 2RHPA 1D2QA 4X6RB 2WNVC 2WWSA 2JXAA 3L9JT 4I0BA 1UZZA 3ZFGB 4XOGA 1W2UA 4C1WA 5CFDC 2OVUA 3WG3A 5H9RA 1VRH3 4NOTA 5GLTA 4DY5A 1K5MB 3ME2A 4XF0A 3VDDC 2AUYA 1KDMA 1BYHA 3VUOA 3JUUA 4XILA 1V6KA 2E53A 2UWCA 1C5IA 5I0TA 3V64A 4HBNA 3LA2A 3ZFEA 4AQTA 3HWJA 1TME1 2B39A 1DBNA 4Y1UA 2B9UA 2PAKA 4OLLA 1Q5OA 4WBBA 1SMVA 2N7GA 2WFF1 4J6GA 2MEV1 1OI6A 4LBKA 3IMNA 5A33A 5LEJA 1YCIA 1AYN2 1ZBA1 1ND2A 3W59A 4Y1XA 4XFIA 4HSJA 3R4UA 1G9AA 4Z2WA 1GKBA 1PVC1 4GB31 4QPIA 2E51A 4M0HA 1RUG2 2VNRA 1PVC2 1QOOA 1VBE2 5J37A 4FT8A 1H9PA 1PK6B 3ZXFA 1HV0A 4IEWA 3T1LA 1BBT2 2AR6A 2DF7A 4XXPA 3IDBB 3UJOA 1WLTA 5CFCC 4RFT0 5J36A 4M01A 3IDCB 4YVSC 4I09A 1CD3G 1DQ1A 4KNCA 4GQ7A 5DUUA 4FAGA 1QJX3 4L11A 1ND3C 3M8LA 1U12A 4IL7A 1XRUA 2X8KA 1IS4A 3ILFA 1ONAA 2E6VA 1ZBA2 3MF9A 2RE9A 3M2MA 2A3YA 3I4IA 5CAZA 3N7LA 1Z7S2 2EF6A 4JVAA 1S0FA 1VBC3 1YI7A 2CY6A 2PN5A 4GWNA 1J58A 1LODA 3JB4C 3WY6A 2RS33 4WM7A 3OTFA 4Q4V1 2ZZQA 3AZYA 4KBBA 1A6CA 1RUG1 4RQPA 2YGLA 3N3HA 1QJY1 4GB33 5K8SA 1KRIA 3VL9A 3POWA 3E5QA 1DIWA 4META 1RUF1 4N7IA 2XPJA 4AFDA 1DU3D 1WLCA 3JZVA 3ZXAC 4V1PA 3BIWE 3TNQA 4GXLA 3KCCA 1X50A 2GMEA 2UU8A 1RUI3 4YVSA 5KXCA 1EAH3 5AC93 3H7YA 5BNNA 4KWKA 4BYYA 4CYDA 3CJIC 1SFYA 3DUIA 3MPPG 1R1A3 4C0HA 3PJQA 1AL0G 3AP9A 3GF6A 5AVAA 3AYDA 4RS5C 2ZA9A 3ZO0B 3ZXDA 4CRQA 1YFYA 1V6JA 4PLNA 1PGW2 5LEKA 1SBFA 4NO4A 4I02A 2HWE1 2WT1A 3EHKA 1ZRCA 1LRHA 2WZR3 4L9BA 3ZYIB 3B93A 4RSUA 2ARBA 3HN1A 5JOXA 1S0DA 5C9AA 1A3KA 3I54A 1PIV2 5SV8A 4RGAA 4BHPA 1OFNA 5BYNA 1UU6A 1RHI1 3KLSA 4AW7A 5L19A 2ENRA 5BNOB 3JBG2 1ZZCA 1JYCA 2AH2A 4XHBA 1ULFA 1FX5A 1QGLA 4XTMA 5GALA 4AHYA 1W6OB 1V9U2 5E89A 5IUQA 3I59B 3ZYJB 3APBA 4XJZA 4YLZA 1MS9A 2IFWA 2D98A 5AFEA 2XBO1 2CWSA 4MSVA 1LULA 5DZEA 1E57A 2R32A 1HQLA 5FTTC 4S2FA 3ZIWA 2JEMA 1AJKA 1AYM1 1GQGA 2HWD3 1D0GA 2XJRA 3WQ0A 3ZX7A 4MUVA 1DYKA 1GNZA 3IDEA 1M4WA 2JG9A 1VBD1 1WBFA 3NV1A 5FO7B 3VZNA 2WZR1 4YVWC 1G9FA 2RR13 2VW0A 2CNAA 2EIGA 1G7YA 1S0JA 2DUOA 5KHHA 3VV1A 4XQ4A 3MZHA 1VP6A 3IN9A 1NE6A 1WMEA 4RHV2 1WBLA 1FMD1 3ZSMA 3R0RA 1RUH2 1BCXA 1SBEA 3SISA 2CV6A 4N53A 3AX4A 2RMU3 2GDFA 3TBDA 4CEYB 1FNYA 1C1LA 1MQTA 2IZWA 4XW3A 4KH9A 2NMOA 4E2SA 4K3UA 1NLSA 4TSVA 2EVXA 3ZN6B 2I2SA 4OZXA 4C0BA 4AI2A 5K9YA 4YM1A 1XQNA 2Z42A 3IT8A 4IQPA 2PELA 4W6YA 3JQWA 1CIWA 4D94A 2DCJA 2BQPA 3ZXGA 3M3CA 4EROA 2BEOA 4CEWB 2UWAA 3VKMA 1DGWA 2A7AA 1HXS3 5F1RA 3GHNA 4BA6A 3WW4A 2FHRA 3OBTA 4TYSA 4FPKA 5GJ6A 2GNBA 4P5HA 5A32B 5KWRA 5DG1A 2PQQA 2XKPA 1SCRA 2DCKA 2WSVA 2IXCA 4Y1VA 1UL9A 2B45X 4AEDB 4BWOA 1F31A 3ZXJA 1YRZA 4A7KA 4DRVA 2NLRA 2EALA 5F5QA 2AENA 4COVA 1B35A 4Y1ZA 2ZHKA 4OHVA 2H0VA 1R093 4COZA 1HRI3 1PO12 1V6NA 1RMU3 3QBQA 4Y5Z0 3LA7A 2QQPA 5FMOL 4CDQB 5DZFA 1LHWA 5KHJA 3WINE 1KITA 1LENA 1OQEA 4QD2A 2ZCWA 4N9IA 3URFA 1FV3A 4Z92B 5T5JA 2HKXA 2WS93 2PHWA 1KD7A 5JPNB 2GN3A 4M3CF 5EYXA 5T5LA 2B46X 2ZGKA 4LHNA 2HWF2 2Y38A 4JV4A 2QFEA 2OPKA 5IK4A 5CG8A 1G8WA 3VKFC 3VBOA 1AUYA 2HWC2 1KS4A 2ZABA 4AWDA 3D8CA 1CAXB 2HWC1 4Z8BA 5JI7A 3HD8B 4AI8A 3AMMA 2JG8C 1MEC2 2HWE2 1DQ6A 4COWA 1SEFA 4FOWA 2WC2A 5D8AA 1LHOA 4YZ3A 4FVVA 1ULGA 3J8F1 2DVDA 4WM8B 1UN1A 3ILRA 2FQPA 3KD4A 2R6QA 1DQ0A 5C8CC 4FTEA 2Y26A 3IKWA 4Q4Y2 4AQSA 3TNPB 3VZKA 2R30A 1I1EA 2YGMA 1H30A 3C3VA 5BNQA 4JCKA 3NKGA 2O1QA 2BNOA 1CJPA 3KT4A 4PBOA 1HDKA 4R52A 2XJQA 1NQDA 3H3ZA 2WT0A 2DU0A 5GZEA 3VDDA 2RS11 1F8VA 4C1XA 3SCGA 5K7PA 2K0GA 4YGBA 2WNVA 1JOJA 4Q4W2 2Z79A 4H3WA 1H8TA 2WZR2 3J8F2 3GZUC 1O3RA 3VHRA 2D44A 3AMQA 3VZJA 2HEVF 1C8M1 4JGYC 2ZTNA 2CWMA 4Q4Y3 3WZ1A 3RS6A 1B35B 4AVAA 1UAIA 4E2GA 2B8MA 3GYDA 1NY71 2NP0A 3AZXA 2VECA 2W0XA 3D5OA 4ZU5A 4HL0A 4F8AA 2NYYA 2BNMA 1WUVA 5FAXA 3WG4A 1ENRA 3FHIB 3USUA 4MLOA 2ZAAA 2Z5WA 3GZAA 4Q4X2 3MEPA 1ENQA 1ND2C 1KQRA 1GLHA 2VOKA 4IERA 3LOBA 3AXDA 4GULA 5T50A 1VBC1 2RR12 4UW4A 5FQ0A 3NAPB 2JDZA 1RUJ1 4GIQA 4JGZC 1WGPA 1MQTC 3KMHA 3WHTA 1LECA 1NQJA 1RUG3 1O4ZA 4OHWA 4KQ7A 3FLPA 4A3XA 1V6IA 1RVF2 3M3OA 1MZEA 2CGOA 4YSFA 2VULA 4Q26A 4YARA 3WP3A 3BB6A 2A6XA 2XJUA 4NPRA 4E4SA 5BPXA 2WINB 1AR82 3WVJA 4N53B 5KC5A 5A3MA 2IWGB 3WDXA 1FT9A 2PHUA 1ZRFA 2ERFA 2WA3A 2D6KA 5EYYA 5HCAA 4FOYA 4XTPA 2PLV2 3NWKA 3VBFC 2HWE3 1LJ7A 1V6MA 4AVCA 1PMIA 1DGLA 1W6PA 4FPYA 1LKNA 1PVC3 1W6NA 3PLQA 3WT3A 3B00A 5T3NA 4YZ4A 2OZ6A 4NWVA 3HIFA 5FLIA 4R9BA 5JMCA 2X5IC 1AZDA 1HV1A 4I0AA 1RUE1 5C4WB 2HEWF 1J59A 1N47A 2ZGTA 2YZ4A 4B3NA 5KHGA 4YW5A 4KG8A 2GNDA 2YV8A 4K7JA 3T1MA 1VBB2 2R063 2VH9A 3ATGA 1ZZ8A 3CU7A 1TNFA 3QH7A 3AKPA 3SH5A 3ACLA 2XUMA 4LNVA 4Q8KA 2DCYA 2D43A 3B94A 4RS5A 4FSJA 3MW4A 1WLWA 2E7AA 3ELNA 3S30A 1HRV2 5HCBA 5JSOA 1H8VA 1OKQA 5T52A 4B4PA 2C1FA 4LBMA 3PJYA 1LOGA 1XNKA 1Z7S1 2LALA 5CU1A 4CDXB 3N7KA 1WLDA 3AJZA 1Q43A 5GZGA 1O7FA 2D6OX 1OPMA 3RRDA 5JZGB 4AEDC 1UPSA 1ASJ1 5IK7A 3TN93 2RMU1 1UU4A 1EPZA 4ATFA 2FZ1A 1AHSA 2QZ3A 2ZKNA 1H2MA 4GKXA 4E4DX 3VHPA 1SACA 4P9GA 1ZBA3 4AFAA 1H0BA 4R4XA 5J98B 5C8CA 5CB7A 4YZ1A 1UCXA 3KZ4C 1CVNA 2A6WA 2D6PA 1SLLA 3UKNA 4EJRA 4AI1A 1RUI1 2ARXA 5F6LB 2GMPA 1SLBA 3VZOA 1I6XA 1VIWB 4QX5A 2XVKA 1CGPA 2VW2A 2VY0A 1S0BA 1PVXA 1XYNA 1JN2P 3AKQA 3L2HA 3O5SA 5CBLA 3FC0A 1NCRC 1UIJA 2QE3A 1BVVA 1AYN1 1WD4A 4WZCA 1NY72 1CESA 2RS51 1G9CA 3H8UA 4K1YA 2ZX3A 4TLFA 2HEYF 3TN92 1PZ9A 4LBQB 4P9LA 4Q4V2 1VBE1 2VMIA 4Y20B 3FZ3A 2XG3A 4DINB 1DYPA 3WDYA