2ZHLA

Crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine dimer (crystal 2)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
142
structure length
142
Chain Sequence
QAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-9
publication title Structural analysis of the recognition mechanism of poly-N-acetyllactosamine by the human galectin-9 N-terminal carbohydrate recognition domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zhlA00
4K1YA 3M3CA 3PMEA 2D3RA 4Q8KA 1W6NB 1HQWA 3AZYA 2ZBJA 1QOSA 2PHXA 1VIWB 2AUYA 1V00A 3AZVA 3DUIA 3VV1A 1Q8OA 3SH5A 1WLDA 2CL2A 1KQRA 1V6KA 4LBLA 2D3SA 1Q8SA 3Q9OA 4WV8A 3V0BA 2P34A 1C57A 1FNZA 1AZDA 1G9FA 5GLZA 1GNZA 1KDKA 1DHKB 2GN7A 1DZQA 2ZGRA 1JBCA 2ERFA 4YW4A 3SITA 4C1WA 1GNHA 1WD3A 1UX6A 2A6VA 3AYEA 4GKYA 4GWNA 2PHRA 4MYEA 1BXHA 2JDZA 4LBKA 4CTEA 3M3OA 4YFZA 1LU1A 1J1TA 1S0IA 3MW4A 2D6NA 1F31A 4XJ8A 1AF9A 4ASMB 4CZSA 2WT1A 1YXWA 4K1ZA 4Y22A 2DYCA 1GANA 1GICA 1V6MA 4K20A 4Q8LA 4BPZA 4FPHA 3HMYA 2R16A 1WD4A 2SLIA 5T54A 4BQ1A 4YGBA 3AK0A 5CA6A 1SACA 2W08A 2R49A 5DZFA 1DYPA 2ZGTA 3VKNA 1QF3A 5DUWA 2E51A 1C1LA 2R0HA 4UW3A 1YI7A 1V6IA 2D43A 3N36A 3NV1A 1W6MB 4XJZA 3WVJA 1I1EA 1BZWA 1WCSA 4GWMA 4BLIA 2YMZA 5T5PA 2A5ZA 2WJSA 4Q2FA 4FQ4A 2GMMA 1H30A 2OVUA 1LHUA 1S0GA 4FP3A 2NM1A 1JHNA 2ENRA 2NZ9A 4YZ2A 4Y1UA 4P14A 2DVFA 4XZPA 1KJLA 1SLAA 2UWBA 3I4IA 2WSVA 1JXNA 3MPPG 3O0XA 3GALA 4YLZA 1AXYA 1G9CA 4XJ9A 1IS4A 1VAVA 5GZFA 1SLLA 2A3YA 2A75A 1LHNA 3WUCA 1S0FA 4LBQA 1DIWA 4WVVA 5DUUA 5IK7A 5KXBA 2LTNA 2JE9A 1GKBA 1ULEA 3ZXFA 2JD4A 3RS6A 1C4RA 4LBQB 2Z42A 4YW2A 1S0BA 2A7AA 3ZYRA 4TZDA 2ZGOA 1HDKA 2E53A 3AP9A 4FPJA 4GA9A 3UL2A 2EIGA 1LOFA 1AX2A 1O4YA 2DVDA 3GNEA 1YIFA 1DQ0A 4HL0A 2GNMA 4I30A 2ZMKA 1YRZA 5EXOA 3UJOA 1Q8PA 2AH2A 3D6EA 1VAMA 1AXZA 1UN1A 1CPMA 1N1SA 2WLQA 4GXLA 4FPGA 5DG2A 3AXDA 4XJWA 3IKWA 4WZFA 3JU9A 4XXAA 1KRIA 1IS5A 1C1FA 4Y26A 3BOPA 4Y20B 5H9PA 5GLVA 4YZ1A 3BODA 4AGRA 3NV3A 1LODA 2GNDA 2WT0A 5FREA 4FOQA 1F5FA 1UKGA 3M3QA 3ZSLA 3PVOA 4LBQD 4F83A 3M3EA 2P3JA 3N35A 2KM2A 1G9DA 1MS0A 1DQ2A 2W52A 4R9CA 4WVWA 4D69A 3LSEA 2D6KA 5AVAA 4YGEA 2CY6A 1W0OA 2ZKNA 3MW3A 2ZZJA 4XTPA 2PHWA 4Y1ZA 2WT2A 3B9CA 2D6MA 2Q5TA 3R05A 2ZGNA 1RITA 2OUJA 3APBA 3AYDA 4PCRA 2AGSA 4SLIA 5DG1A 1W6QB 5FRAA 5L73A 3ZVXA 3WDWA 4UW6A 2CNAA 2UURA 1UAIA 2D3PA 3KM5A 2V5YA 5CB7A 1XQNA 3ZXJA 2A70A 1D2SA 1O4ZA 1SFYA 3A0NA 3OY8A 3WDTA 3O12A 3H0OA 2VXRA 4XTMA 3WZ1A 3ATGA 1FV2A 3V0AB 1CJPA 1SLCA 2D6PA 3O5SA 3OY8B 5E88A 4CRQA 3V64A 2YV8A 4FOVA 1DQ6A 1IOAA 1KJRA 1Q56A 1UZYA 2XB6C 4XDQA 1QMJA 4XJUA 3UJQA 2R1DA 5GZGA 2C5DA 3WDUA 1ONAA 3N7MA 1JOJA 1DQ5A 1SLIA 1GSLA 5BYNA 5JMCA 5DUXA 1A78A 1LHVA 1KITA 3T2TA 3U4XA 3BIWE 3WDYA 1MS9A 3IM0A 5T52A 5IT6A 5T50A 3V0BB 4YW1A 1SLTA 1WBLA 4FPKA 3WDXA 5KXEA 5HCAA 4L8QA 2FMDA 5H9RA 3HN1A 4K21A 5CNAA 2DUOA 4AYUA 2A6YA 3VKMA 3AP7A 3SH4A 2ZGQA 4PQ9A 5DZEA 3WOGA 1ZA4A 3VKOA 1Q8VA 1F9KA 5GZEA 2D6LX 4P9YA 3B00A 3USUA 2XG3A 4BOWA 3DGTA 1R1ZA 3INAA 1MZ6A 3WG1A 1AJOA 1H9WA 4UW5A 3WG4A 1LOAA 2AREA 1YYNA 4Y22B 1S0EA 3ENRA 4DPNA 2ARBA 2DTWA 1I3HA 4Y1VA 2AR6A 4YM1A 3USUB 2ZGLA 3TAYA 2DWRA 4ATFA 1LHOA 1N3OA 3NWKA 2EXHA 2OUHA 4IQPA 5LK5A 2C9AA 1LOBA 1G8WA 1LOGA 3O0WA 4U36A 4W65A 5JOWA 1V6JA 4XHXA 2ZAAA 4M3CA 1FYUA 3AZWA 4M3CE 5KXDA 1HKDA 2NN8A 1JW6A 2CTVA 4XIKA 5E8AA 3ZSKA 3D5OA 1LECA 2NP0A 1N47A 1WLCA 1NLSA 3IN9A 1LJ7A 1YO8A 3FLPA 4BM8A 1ENRA 5EYYA 4U2AA 1ENQA 2ZMLA 4FOYA 4M01A 1W0PA 2OW4A 1GZWA 1QNWA 3C2UA 4AWDA 3WG2A 1UZZA 1JUIA 4YW5A 1APNA 1GBGA 1GYKA 3AJZA 1VALA 3SNMA 2YY1A 4LBJA 1DQ1A 2CYFA 1D0HA 1V6OA 1UL9A 1FNYA 3FUOA 4YG6A 3NV2A 1GZ9A 1GZWB 1WBFA 1GV9A 2GMPA 3AYCA 3ASIA 4UW4A 1FV3A 1HQLA 2UWAA 1ZM1A 2NMNA 3T1LA 1Z0HA 2A71A 3W59A 2ZGSA 1MR5A 5GLTA 1JYIA 2HYKA 1WW5A 3SLIA 4YM0A 5DZGA 4YFWA 2DVAA 3WDVA 4FP2A 3UK9A 1BYHA 3RQ0A 4AVVA 4R9BA 3OBTA 3AYAA 3WNXA 1H9PA 1QOTA 3VKLA 3AP5A 2CWSA 1ULGA 1CR7A 3LCPA 5EWSA 2P3IA 5DXDA 1CIWA 1UMZA 4PBOA 3I8TA 3SISA 3LSDA 4ATEA 1Z78A 2JKBA 3IMNA 2AENA 1SCSA 2PHFA 3AP4A 1VLNA 3AJYA 1S0DA 2I2SA 1Y7BA 5JVVA 2GMEA 4M00A 4Q1PA 3WUDA 3POSA 3M1HA 4GKXA 1LOFC 2VW0A 3RMYA 1LOCA 2VU9A 1MZ5A 5JOZA 2VW2A 2DU0A 2A3XA 2ZHNA 3QLQA 4FOWA 4R9AA 3SH3A 5JOYA 2W68A 4XMIA 2A6WA 4HANA 3RRDA 5GZDA 1LGBA 3MW2A 3CNAA 1AX0A 2A3WA 4TYSA 4YZ5A 1RIRA 1LEMA 2UU8A 4YGDA 1MS8A 4FPOB 2R0FA 4JC1A 1CQ9A 2D6OX 4XIOA 3OYWA 1LGCA 4JRAA 3AP6A 5IK4A 1LEDA 4XXPA 2VW1A 3WCRA 3WCSA 1MS3A 4NO4A 4DQAA 3M2MA 3KQRA 4XILA 1OKQA 1LOEA 1S1AA 4ZKTB 3OYWB 2G4IA 1ULDA 5GALA 3W58A 1ULCA 2V73A 3D4KA 4XOGA 3FUQA 3N7LA 4YM3A 5T5OA 1QU0A 3AZZA 1DLLA 5T5LA 5IK5A 3OGGA 2E6VA 5KXCA 2JJ6A 4R9DA 4DRRA 1NXD1 2TEPA 1ULFA 1G86A 4FPFA 4XJAA 5HCBA 2VY0A 2ZA9A 4XMAA 1IKQA 2AYHA 2LALA 4XHBA 3AXEA 5GLUA 2PHUA 2CWMA 2YZ4A 3POYA 4P9XA 3VUOA 2WNEA 3ZSJA 3BTAA 4KBBA 1GZCA 1PZ9A 4DRVA 4XBQA 2JECA 3AZXA 3RSJA 1BQPA 3B3QE 2DURA 1N3PA 1N3QA 1MVEA 1DQ4A 3WV6A 4BLJA 3OPZA 1MACA 2WKKA 2DVGA 4Y1XA 2EXJA 4BMBA 2W39A 1S0JA 4RA0A 4PF5A 2R1BA 2ZGMA 4ISRA 3OBRA 5F9TA 1G9BA 2SBAA 2GN3A 2VH9A 1QDOA 1V6NA 1S0CA 4YGCA 1LESA 3ZSMA 3N7KA 4AGVA 1MVQA 1AX1A 4ISQA 4DFSA 1KDMA 3T1MA 1LGNA 2RHPA 2P3KA 1WLWA 1LU2A 2ZHKA 3NV4A 1SBEA 2D7FA 2P2KA 4FPLA 1AXKA 5T5JA 2ZHMA 5GLWA 5JOXA 1SCRA 3N7JA 2EALA 3PJQA 1G7YA 1W6MA 4H55A 4XBNA 4AGGA 4M3CB 3WHTA 1OFSA 2E7QA 1LENA 1WW4A 1BKZA 2A6XA 3N3HA 2UWCA 3JUUA 3AFKA 1DFQA 3ZPYA 4Q1RA 2ZGUA 3RMXA 4DS0A 3MEPA 2DU1A 4P9WA 1WUVA 1MS4A 1SLBA 3ZXLA 1UPSA 2WSUA 4AVSA 4AVTA 1G9AA 4FPYA 5GZCA 3FBYA 2EAKA 1IKPA 1QKQA 1RINA 1ENSA 2DUQA 4XE9A 4XYXA 1PZ8A 4LBNA 5H9SA 2D44A 2GNTA 3FLTA 4FVVA 2ZGKA 1QDCA 2A6ZA 4FQZA 4XBLA 5HCFA 4BMEA 5CAZA 3PVNA 5E89A 1W6PA 1U0AA 5EYXA 1CVNA 2JE7A 2EXIA 3PVEA 1QOOA 1V6LA 2DV9A 5JLVA 4Z8BA 1PZ7A 5F5QA 4YZ4A 3WHUA 1Q8QA 1IS3A 4Y24A 4NOTA 1HLCA 1LTEA 1W6PB 4YG0A 1QGLA 2VUAA 3V65A 4JCKA 3VKFC 3AX4A 1B09A 1MS5A 4OZXA 4FPCA 3RG0A 4PBPA 1SBFA 3HR9A 3FFZA 3ILFA 1DYKA 2YXSA 3A0KA 5IUQA 3TB0A 2GALA 1WW7A 2DVBA 2DUPA 4M3CF 2PHTA 5SV8A 2P37A 3B69A 4Y20A 1LULA 2GNBA 4YW3A 3IPVA 1LCLA 3QCWA 3V0AA 2FHRA 3ILRA 1FX5A 4YG3A 3R4SA 1A8DA 1AJKA 3POWA 2YROA 1LHWA 1A3KA 1IS6A 3OJBA 3ZYPA 2ZGPA 3IPVB 2EF6A 1URXA 4ITCA 2BQPA 2E7TA 1OQ1A 4LBMA 2NMOA 4Q27A 1AVBA 2B7YA 3FLRA 4RL7A 2GDFA 5JDBA 2ZACA 2ZABA 3A4UA 1CESA 3O0VA 5H9QA 1CPNA 1WW6A 1W6OA 1W6QA 3WLUA 4LBOA 2ES3A 1TEIA 4C1XA 1FAYA 2NYYA 1DBNA 2EXKA 1CONA 4GALA 1X50A 1CN1A 1FATA 1W6OB 1GLHA 3ZXEA 1N1YA 3R4UA 3ZXKA 1BJQA 3B01A 1JYCA 1DGLA 1QNYA 2ZMNA 3L2YA 5GM0A 1EPWA 2DTYA 4YM2A 5DUVA 2WQZC 4ZXKA 1MS1A 1N1VA 2ARXA 3ILNA 5T55A 1N1TA 1W6NA 2ZHLA 5GJ6A 4Q26A 1JN2P 2PELA 4YZ3A 5CBLA 2H0BA 5IK8A 4Y1YA 3WG3A 4FPEA 1SBDA
chains in the Genus database with same CATH superfamily
4LUKA 3J26N 1RUH2 2ARAA 1ZRDA 5EV7A 3VBHA 3BIEA 1W6NB 3I2JA 5JZGC 2Z79A 3I2KA 5L7OB 5CFDC 3WNKA 4DNYA 3H3LA 1QOSA 2Y6KA 3LEMA 4PI0A 1JYWA 2AUYA 2JG9C 2G19A 3VV1A 4QWNA 1XJAA 2R071 3T0AA 1WLDA 2YDEA 3LA2A 1V6KA 5LA9A 1VRBA 3SCFA 3VBUA 4WV8A 4NMIA 4CDXB 4LT5A 4LKFA 5GLZA 3DPRA 4AI9A 1GNZA 4BQXA 1DHKB 1DZQA 1J3QA 3CJIB 4HXCA 1UZVA 2UY8A 2CU5A 2RE9A 3DKWA 4C1WA 1GNHA 1VBB3 2A6VA 2I74A 5FYIA 5LWBA 2PHRA 4GIQA 4BQ5A 2JDZA 4LBKA 4LO8A 1R64A 3M3OA 4Q4V3 4V2WA 5JIAA 4CCCA 1LU1A 3RYPA 3LIHA 3NRUA 3WF0A 3U10A 4B4RA 1AR71 1MQTB 3BN6A 4N43B 1VAKA 3UETA 4I0WB 4CZSA 4YWAA 5K0UC 4K1ZA 1GICA 4Q8LA 3ZFGB 3UV9A 1AR81 5FY1A 5C70A 4FTSA 4H2AA 4P9IA 4QB2A 2R49A 3KF3A 3VKNA 2JDMA 2ZGTA 4P9JA 3OB8A 4XUOA 3ZXDA 1QJY2 2K0GA 3U11A 1QY4A 4IEQA 2E51A 1C1LA 1V6IA 4KWLA 2WBKA 4GH4C 2TUNA 2ZX0A 1W06A 2GSYA 3DCQA 4ASLA 4KWKA 5FWEA 5CKQA 3VBFB 2RS13 2JICA 3I54A 1E5IA 5EJZB 1OUSA 5C3OA 4Q0UA 2VE1A 3M70A 1UY3A 4QX1A 5T5PA 1VBE2 4OHWA 4NHKA 1ZRFA 4FXGB 4HSJA 4J1WA 4Q0PA 3H42B 1LHUA 3OF1A 4FP3A 4YVWB 4YZ2A 4Y1UA 4P14A 1SPPA 3FMGA 4IGOA 4JHZA 4QMAA 1I5ZA 3CF6E 4XZPA 1OI6A 4IV1A 2ZCWA 1H8VA 1JXNA 3OCPA 1W8OA 3KV4A 4YLZA 2ZX4A 5FP4A 4W6YA 1ZZBA 4RS5A 4XJ9A 1VAVA 1ZRRA 4XFHA 5F2WA 2BZDA 3NJXA 4KGQA 4YVSC 1DIWA 3CU7A 2BEOA 1QJFA 5IK7A 1YCIA 2YPDA 3GDBA 4PLMA 4DB5A 2YUEA 3ETQA 4XUTA 2VTFA 1C4RA 1QXRA 1RUF1 3ZYRA 2FBEA 1JH5A 2HWF1 2E53A 4FPJA 4GA9A 1PHMA 5FLHA 5LZ6A 2B46X 4K6BA 1RUC3 2EIGA 3J9SA 1O4YA 3MDPA 1PX4A 1PIV2 3SEEA 4HL0A 4UT5A 4UFJA 2CGNA 4ZU4A 1YRZA 4N53C 5FJHA 2WWJA 4TWTA 1VAMA 3SKJE 1UN1A 4LIVA 3A22A 4QKDA 5CG8A 4FPGA 3BTZA 3AXDA 2X8KA 1RUD1 1HJGA 3LKJA 3OG2A 4ORFA 1WCDJ 2AZ5A 2Z69A 4RSUA 3ZYGA 1PVC2 3NNLA 2YBKA 2J7MA 3M3QA 2R042 3ON7A 4AEKA 4D7YA 5FP7A 1V9U2 1WCKA 3HT1A 2P3JA 3N35A 2K9ZA 4RHV1 4F83A 1MS0A 3ZN6B 1DQ2A 2XJVA 1G9DA 1RUD3 5HCHA 2HJIA 5LW9A 4PIYA 4D69A 5ERLA 2CY6A 4EN7B 2WWUA 4FFGA 2VQ0A 3KHBA 2WZR2 1H0BA 2PHWA 4Y1ZA 2VNVA 2WT2A 3FZ3A 2D6MA 2YB7A 4RQPB 3KWVA 2ATFA 2WZEA 3VLBB 2OUJA 1HIXA 3APBA 5C3RA 1W6QB 3ZVXA 4UW6A 1GP4A 4X8NA 4FTBA 5LCWL 4D94A 2BGCA 3KM5A 2Y26A 3I2GA 4CEWA 1D2SA 2MEV1 3L2HA 4WM7B 2BPA2 1O4ZA 1W2TA 4IGPA 3WDTA 1SHWB 2C24A 2WIIB 1FV2A 3U4SA 3GBFA 4AAPA 1AR91 2WR9A 3U75A 1F35A 3KHCA 4UBGA 2HWD2 3NNFA 1SLCA 3POJA 3O5SA 3UYJA 4N8MA 3WXPA 4M4RA 2MEV3 3OBZA 2OZJA 3J7NA 1IOAA 4AFBA 1MZFA 1B35A 1D0GA 4XJUA 3OPWA 2WA3A 5DAVA 2R1DA 3UJQA 2WUHA 5GZGA 3S57A 1DQ5A 2WNUC 1SLIA 2WS93 4PIZA 5ABJB 3WW3A 1DLCA 3CLPA 2BBAA 3UESA 3ZDVA 5FZBA 1ZZ9A 4AEDA 3T2TA 1OBNA 2QZ3A 4M0HA 3ZM8A 1BEV1 4QPIB 1OOPA 2WAOA 3IM0A 1X7NA 2RDRA 4JQTA 5FPVA 3DN7A 2VZOA 1X36A 5F5AA 4IUGA 2CAUA 4QQOA 4ZZ5A 5ACA3 2X5IC 3UKVA 4QX7A 3AKTA 4ZPIA 4ZZ8A 4BK5A 3K77A 4AYUA 1AYN3 4OULA 4P5HA 4PDWB 1HRV2 1Y4WA 3D3AA 1UOJA 4XCAA 3BCWA 3VKOA 4BOWA 4UF0A 3WF2A 3MIBA 3C3VA 1GOGA 3WG1A 1ASJ3 3K4DA 2IXLA 1ZVFA 4UW5A 2AREA 4KI5M 4Y22B 4D7SA 1EP0A 4XFIA 4X6RB 4DPNA 2DTWA 2AR6A 5JXGA 2DWRA 2BW8A 4COWA 2EIEA 4AAXA 1YQCA 3EBRA 1D2QA 2JXAA 4YW7A 3O7OA 1G8WA 4BDVB 4DXZA 1C3HA 1V6JA 4HFSA 2ZAAA 4M3CA 3IB3A 2AACA 5DDJ2 4M3CE 5FR3A 4AVBA 1HKDA 5KXDA 3RJRA 1JW6A 1BK0A 3GYDA 4PQQA 1REDA 1UIJA 4QKNA 4QPGA 4KGGA 3KF5A 3VBRB 4XF4A 2QNKA 1YO8A 4Z92B 4LO4B 2BJSA 3B5LB 5EYYA 2PA7A 1ENQA 1MPXA 2Q8CA 4FOYA 1JU3A 3AVSA 4JGZC 4M01A 5FXVA 1RUE3 3C2UA 1GZWA 5CG9A 3SQOA 1JUIA 4Q4Y3 2XWBB 1POV0 3I3DA 3KCXA 2VNGA 3PDQA 4QQPA 3CZUA 3SNMA 5FBJA 5FZMA 1D0HA 1U5IA 1S55A 2OKXA 3SXWA 3HNMA 1VB2A 3FUOA 1VBC1 1GZ9A 1CWPA 4D8MA 1XNAA 2X09A 4MXWB 4UW4A 1HQLA 1W8ZA 2W0XA 1ZM1A 3HIFA 2NMNA 2VQUA 4LHKA 1IQDC 4LPLA 3T1LA 2A71A 3EHKA 3W59A 2J1RA 5FPXA 3ACGA 4UWDA 2HYKA 1EYBA 1X8MA 5DZGA 5LATA 3PUIA 2MNGA 2ADDA 4CCKA 2JB8A 2QQIA 3UK9A 4FAGA 4R9BA 4L11A 1RHI2 4CDWB 3AYAA 2JX9A 3V56A 3LCPA 5BNOC 1QHDA 4PBOA 3SISA 3VDDA 3LSDA 1EV13 3VB9A 2CHHA 4NROA 5FXZA 4UFLA 2I45A 5C9AA 1L7LA 2J42A 4R8HA 1OURA 1NA1A 1SCSA 4GAZA 4L97A 1VLNA 1JOBA 2VMDA 4LLFA 2QDNA 3UGHA 2GMEA 4IV3A 4M00A 2ZEYA 5FZEA 3GF6A 1K5MB 4UI9L 3ZIXA 5IHRA 1EAH2 1HRI1 1MZ5A 3H8OA 2BP6A 2A3XA 4FOWA 4CP0A 5LEJA 1J58A 2W68A 1ZBA2 2A6WA 2VO5A 1VJ2A 2QQWA 5GZDA 3GCXA 3ZFEC 2WO1A 1OMIA 1DF0A 4TYSA 3T2PA 4BQYA 1LEMA 2ORZA 2Q30A 2UU8A 4RGGA 5JZGA 2R0FA 3PIGA 5CFDA 2W91A 4EROA 2QBXA 1A34A 4FFIA 3T3YA 1HRI3 2JG9A 4JTNA 3AM2A 4JRAA 4XPVA 4XXPA 5FTTC 2VW1A 5K9YA 3O1PA 2OS2A 3QACA 3ALQA 1REFA 3M2MA 5A33B 3KQRA 4QT6A 1O5UA 1PO22 3VDCA 2PLV3 1S1AA 3ZR5A 2BBVA 3OEAA 2FDGA 5FK7A 2G4IA 1ULDA 4Z82A 5FFOC 5FZDA 4NIDA 5DAQA 5JI7A 5T5OA 3U78A 2VZQA 4MGKE 1RUJ3 4COYA 5T5LA 4MGTA 2VMEA 5FZFA 3EYPA 1NAEA 4R9DA 3USSA 1UWWA 1MEC3 1ZZCA 4O7XA 4DRRA 1DGWX 2BNOA 2W1SA 3UNPA 5K0UA 4AFAA 1CAUA 1IKQA 1SFPA 1VE0A 2RS32 1W8NA 3VL9A 1QJX1 3DECA 5GLUA 3POYA 3VUOA 3MI8A 1E5SA 1Q5OA 4KBBA 1GZCA 1H8TB 1HXS2 1OA2A 4HOOA 3VBOB 2DURA 5FZ9A 2V4VA 4XDPA 4JGYC 2HBUA 3LWCA 5M0TA 4K8RB 3LOBA 4GH4A 1CAXA 4Y33A 1PGW1 3VBUC 1QJX3 1UU6A 2W3JA 2XR4A 2HWE3 4BHPA 1VMJA 1DG6A 1ZRCA 2PHLA 2R1BA 4H7MA 1X33A 2XKPA 1XU1A 4NHYA 4GMP0 4YGCA 1LESA 3ZSMA 4AHXA 1MVQA 4DFSA 5FZIA 2RHPA 2PN5A 5BNOA 4CEYB 2P2KA 1VRH2 4RFT0 4CU7A 4AI2A 4IERA 4A45A 2BNMA 3HPNA 3ME2A 4O61A 3UKTA 2YPJA 3VZNA 4ASKA 4YVSA 5BY5A 4H55A 2J1TA 3E6CC 5D21A 5JUVA 1FMD2 1H2NA 2E7QA 3VBSB 4BCUA 1WW4A 4LQRA 3N3HA 2AEYA 1TMF1 4I09A 1AR62 1DFQA 1XNDA 3IIIA 2ZGUA 3LA3A 5LBBA 3MEPA 4HPKA 2VAUA 5A3NA 4P9WA 4AVSA 5A3UA 1SLBA 3U14A 4AVTA 4G9SB 1HN1A 4XUPA 5EJ1B 5FZOB 4OQ9A 1U12A 3ELNA 5L9RA 3THTA 4DXSA 5JAXA 2F4PA 5ANQA 1JODA 1JZ4A 2XVGA 5A3TA 1L7QA 2WYSA 4MXVA 4EWAA 1W90A 4LBNA 3BYWA 3JBG1 3GBGA 2N7GA 4LOTA 4NPRA 4DUXA 4DUWA 4RN5A 4Y5Z0 4XBLA 5HCFA 3SMHA 3EJKA 2WO3A 5C71A 1NKGA 2Y0IA 1NY72 1U0AA 2XJPA 1NOVA 4JAAA 2EXIA 3PVEA 1QOOA 2JKXA 3VL8A 4C90A 1Q8QA 2WNOA 3JBG3 4NOTA 2ETEA 5FPAA 1WKYA 1H2MA 3I2FA 4QX8A 3ORJA 4RS5C 1QGLA 2C6SA 2VUAA 4YG0A 4AXOA 1SDDB 1UX7A 4P02B 2IFWA 4FPCA 3RG0A 4PBPA 2XLAA 4YPJA 4NIAA 3OGVA 2J1EA 1DYKA 5BUVA 1V70A 4QHOA 1OVPA 1R1A3 2DUPA 5FMCA 3PUSA 1PO12 4LKEA 1H1IA 2VUDA 1RL3A 4LXLA 3RJ2X 2XVKA 4IDZA 1VR3A 1NQDA 4OUMA 4AR2A 4Z2AA 1IG0A 4IGQA 1SFNA 2NQYA 2EICA 4NPLA 5FUIA 2V5DA 2FHRA 3ILRA 4BQ4A 1W9WA 2V72A 3CBNA 1IS6A 3OJBA 2AEZA 1GQPA 4XUNA 2DCYA 3ZYPA 4BU2A 5CISA 3PTYA 3V0AB 2BQPA 4LIUA 2VQAA 4Q27A 2NMOA 4RL7A 2X53S 3FLRA 1UMHA 4OI0A 3T0DA 2ZACA 1STMA 3K2OA 5H9QA 1DGRN 3JQWA 1O3RA 4IXLA 3AKPA 1W05A 4AQSA 1XNBA 2BVVA 4DY5A 3EB7A 4XF3A 4CCLA 2HH9A 2PQSA 4NVPA 1DBNA 2WNUA 2EXKA 2WDBA 1UU4A 5FMBA 2VR4A 4GALA 3ITQA 1CN1A 3W20A 3ZXKA 3KVBA 4CDQB 4E9KA 2HWC1 4D6RA 1VBB2 1O7FA 1EPWA 2DTYA 4YM2A 4Q4V2 3SC7X 3OGRA 3RYRA 1MS1A 1R093 1BBT3 2RV9A 4QKFA 5GJ6A 2PELA 2X5IA 4AQTA 5I0SA 2FZ1A 2VUJA 4Y1YA 5IK8A 3WG3A 4FPEA 4LR4A 3L9JT 1ZBE3 1K45A 1JZ7A 2YBSA 3M3CA 2WFF1 5JXJA 2D3RA 1I5PA 1KS4A 5F7UA 2HWC3 4RR3B 1HQWA 3B9IA 3RDIA 3AZYA 1XNTA 1PK6C 2PHXA 3HBZA 4LJHA 2WRAA 2YU2A 2PMWB 4XF0A 1Q8OA 3VBHB 1E5RA 4AQ2A 1KQRA 4LBLA 1Q8SA 3Q9OA 2WFF3 2P34A 1JZ5A 1C57A 2WA4A 2BERA 3PLQA 1KDKA 4WVZA 5A6XA 2RS12 3A7QA 3ACIA 3NKTA 3P5BA 2ERFA 5EP9A 5EZWA 2IXJA 5CIRA 3AKQA 3WNMA 4AEDC 3DPRB 3MICA 1BXHA 1QH6A 4A7ZA 4CTEA 5KWRA 4ZS2A 3T2QA 4Y4YA 3F95A 3RWKX 2D6NA 5E1RA 3RVHA 4AHYA 2RM21 5F2SA 2BGOA 4XJ8A 1J3PA 4QAWA 4CU6A 4P9LA 2VL4A 4B4QA 1YXWA 2W9XA 3FX3A 1GNYA 3VHRA 2Y33A 4CDXC 3HMYA 3MV01 4QDRA 4D6QA 4WVMA 2Y6LA 4YGBA 3AK0A 4JDMA 4MUVA 5T54A 3WT3A 1JOPA 4BQ1A 4D6SA 5CA6A 5JSOA 5A80A 3K3OA 2ZS6B 4JGZA 2RM23 2BNNA 4UW3A 1FOD3 1X9TA 1YI7A 1PMJX 3K46A 2D43A 4NAOA 4GB31 1ZREA 3DYMA 2DCZA 1POV1 5KHHA 5L9BA 1XB9A 4TN7A 4CCDA 2P1BA 1RUC2 2HEVF 3H3UA 3N9OA 4FTEA 3GBWA 2XOMA 3ZOIA 3CMGA 5FPUA 2WJSA 4I0AA 2ZXQA 1X8EA 2RDQA 4Q2FA 1YFWA 1QIQA 1YNAA 2D97A 1H30A 2QQVA 4HSLA 4B7KA 3VZKA 1AUYA 2DVFA 3R0RA 4IEVA 1KJLA 2UWBA 1POV3 2O0OA 2WSVA 4LA3A 2XBO3 3DXTA 1GMMA 2HWB3 4NR1A 2BOJA 1UO9A 3RI8A 4LNVA 2K2SA 1AXYA 4HBNA 1IS4A 5GZFA 2G9ZA 2FDJA 2RVAA 2A75A 1QQP1 3IDBB 4QDSA 1UOFA 1S0FA 3WUCA 4XACA 4IV1B 3POEA 3PTRB 5FP9A 3VD3A 5DUUA 4BK4A 4EZHA 2JDPA 1GKBA 4BA6A 2RS53 3WEZA 1UKRA 3EXUA 1I9RA 1YFXA 2FQPA 1L3JA 3HVDA 4MOAA 2DCKA 1FPN3 4YW2A 2A7AA 2XQXA 3UGGA 1C8M3 4HONA 5E6HA 4AVCA 3FHQA 3MIFA 1AHSA 3VD5A 2QJVA 3GZEA 4ZXEA 3GNEA 2CGOA 2DVDA 1RUG2 3ZPOA 4AVAA 4BIFA 3MFAA 1HQNA 5IVBA 2ZMKA 1Q8PA 4K8FA 1N1SA 3LZZA 5GKAC 3ZFEA 5CADA 4N9IA 3JU9A 4XXAA 4D3WA 3BOPA 4NAMA 5H9PA 3WX5A 4EJRA 2B9UA 3HOBA 2Y6HA 2WT0A 4Q0QA 2Q1ZB 3ST7A 1F5FA 4F8AA 1UKGA 3I3MA 1V0AA 3POGA 3PVOA 3I59A 4DXTA 2VD7A 2GH2A 5K4LA 1ZX5A 5SV5A 5A3OA 1YFUA 4QHZA 3TNQA 1O91A 2E33A 4R9CA 3HNBM 2RJKA 4XQDA 2D6KA 1F5JA 1UD1A 1Z7S1 2QTWB 2WS92 4XTPA 3TNPB 5LY2A 1NA1C 4MO3M 3O1VA 3R05A 1ODNA 1IPJA 3S0MA 1W3XA 2CNAA 5AVPA 1T6BX 2G1MA 5J36A 5CB7A 4OI4A 5A3MA 1XQNA 2YC2A 3RZMA 1GUIA 2OZ6A 3ZFFC 3A0NA 4RYDA 3IMMA 5ACA2 4N7UA 5LA1A 3H0OA 3RZKA 3LB9A 3ATGA 1JHJA 3OBAA 4IE0A 4CEWB 1OD3A 1CJPA 1QJU3 1AYN2 2D6PA 3KZ4C 4O9EA 1RJ8A 3E5UA 1H4HA 5E88A 5A7WA 5FPLA 1DQ6A 3HNYM 4YRDA 1XE0A 1ND3B 1UZYA 2ILMA 2GZWA 2LUWA 2XB6C 1QMJA 4JGYA 4MGZE 4NUBA 1ASJ2 2XL9A 5J37A 3ZSEA 3WDUA 1VBA1 4MGIE 4E27A 2QQMA 2JE8A 1GSLA 2OPKA 3PUAA 4KMQA 4YYOA 4QKBA 3H8XA 3H1MA 1B35B 2NPIA 1LHVA 4WM8C 1KXGA 4AHWA 1H2LA 1KD7A 3U4XA 3WDYA 4GZ9A 4INDA 1NXMA 3FFQA 4A41A 3HN3A 5T52A 3EQEA 1QWRA 4GMP1 1UXXX 4JV4A 5T50A 3V0BB 3K48A 4NRMA 1RVF1 1S4CA 1SLTA 2R073 4D7TA 2XPJA 2PHDA 3ZXAC 1W9YA 2UYBA 1OOPB 5A3PA 1J1LA 1C5HA 2GC3A 2XMLA 4UYBA 3WDXA 1VPHA 4L8QA 2FMDA 3HN1A 5CNAA 2DUOA 3OSDA 5JIUA 2BYVE 2VVEA 3AP7A 4QXKA 1GWLA 3SH4A 4PQ9A 4GMP3 4EZ4A 2XJRA 2ORXA 3MIGA 2JB4A 3USUA 1RVF3 5LEKA 3PU8A 2XG3A 1R1ZA 1W8UA 3NAPB 2R061 4CCOA 1RUE2 1D4M1 1YYNA 2D98A 1S0EA 1AR73 1COV1 3ENRA 4OMDA 4Q4Y2 4BE3A 4BXFA 5J09A 5KHKA 1NCRB 2ARBA 4Y1VA 5FYYA 4IESA 3O1TA 4UF0B 2ZGLA 1ACCA 4DOUA 3ZKUA 4ATFA 4CE8A 1HB3A 3K51A 1N3OA 3NWKA 1AR83 1TME1 2EXHA 2OUHA 3J8F1 3O1SA 3DYPA 3A21A 4LO5B 2RJ2A 3VDAA 4U36A 2WFPA 4W65A 1D4M3 3WF3A 1U5ZA 1COV3 1FYUA 2WQ4A 1NLRA 5F1RA 1HB2A 2FDIA 2Q4SA 5F5CA 3HD8B 3D5OA 1DP0A 4MZUA 3IN9A 5C33A 1QEXA 1DDLA 1LJ7A 3KB5A 3OEBA 3FLPA 4P00B 1UYYA 5I8TA 2VZRA 4OHXA 4U2AA 4C0HA 4JKMA 1EV12 4QPGB 2ZMLA 5FZ6A 4BYYA 4UAPA 1SEFA 1W0PA 4OMCA 3WG2A 1UZZA 2HYXA 2VZ3A 5F6KA 4AWDA 1NX9A 4Q4X2 3AJZA 1ZZ8A 1VALA 3M8LA 1DQ1A 2CYFA 3VHNA 1SG3A 1V6OA 3WP4A 2B9VA 4YG6A 4BQWA 4L9BA 1GZWB 5AC91 4ONUA 1YHFA 3AYCA 1J59A 1OLMA 3ASIA 1FV3A 3J7HA 4GWIA 1OLME 3NJZA 2Y6FA 2WNVC 4V2VA 3NKGA 1MR5A 1AL21 2F4LA 1JYIA 1RMU1 3SLIA 1WW5A 4YM0A 4I01A 1UOGA 5C4WC 4YFWA 4P08A 4PIXA 1RUF3 2DVAA 1RYYA 1EUTA 2HWF3 4OHZA 3H8UA 1PNFA 5AC93 1YLLA 2A73B 3HQRA 1QOTA 4OCTA 3WNXA 1CR7A 1H1MA 2D40A 5DXDA 1CIWA 5EWSA 4CXXA 1UF2C 3LE0A 1R081 2FCVA 3CL1A 1RMU3 3KS7A 5FZGA 1JYVA 1UMIA 3IMNA 4BWOA 3LDKA 4FSJA 1RUI1 3POFA 1IQAA 5F3GA 3VD7A 3AJYA 3TN91 3AL5A 1S0DA 1F15A 1Y7BA 3WUDA 3WNPA 5C9AB 3POSA 3CKHA 2VOKA 3CO2A 2ZAHA 2ZX1A 4K9SA 3Q8BA 3S30A 4AI1A 5KHJA 2R7EB 5FY9A 4CP2A 2ZEZA 1RUJ2 4HZFA 2VW2A 3FC0A 4LLOA 3FWEA 5FP3A 4RHV3 4IV3B 1MEC2 4XMIA 3OD4A 4HANA 3RRDA 1LGBA 3TN93 3ZYBA 2RMU2 3RFRA 5F39A 4EV0A 4YZ5A 4NPMA 3AKRA 4IV3C 4FPOB 3KGLA 2QQUA 1CQ9A 2IXHA 4HVQA 2FCUA 1NCQA 4XEZA 1UU5A 1PK6A 1F4AA 1LGCA 1OUXA 3AP6A 1UYZA 1LEDA 2GC2A 2VMCA 3P6BA 3FHAA 4NO4A 4DQAA 2WYFA 1K5JA 2E63A 5A7QA 5JZGB 4CSWA 1RUNA 5CFDB 4XILA 2AC1A 5LK5A 3U1XA 4ZKTB 2ADEA 5J98B 4O9GA 4F3JA 5AFEA 2Y6GA 5ANNA 5A32A 4XFAA 4NWVA 3IAPA 3BPZA 3W58A 4GWJA 2HWE2 1OHFA 3D4KA 1AR93 3KGZA 3N7LA 2PQQA 5IVYA 3P3NA 3B7MA 3JD72 4DY3A 3AZZA 4QM9A 1XYOA 5LBEA 4B29A 1BVP1 2EVXA 2XL7A 5A6ZA 5KXCA 4Z1VA 3BTXA 4EYUA 2JIJA 4KNCA 2TEPA 3LIGA 1YQ2A 4QD2A 4I3GA 5HCBA 5J1XA 4Q4W2 1T6GC 2RDNA 1WMXA 4CDXA 3ZKYA 2VCBA 5C3PA 1W03A 2CWMA 4OLLA 2VCAA 1QJEA 3LEKA 1BEV3 1X9PA 5CEHA 4XBQA 3AZXA 3DL3A 1BQPA 1CAUB 1W2UA 1W39A 3B3QE 4Y3OA 1JTZX 1YI9A 1DQ4A 1DZTA 1TG7A 5FV3A 4MH0E 2WKKA 2DVGA 3PJYA 1JZ3A 2RR12 4BMBA 1RUH1 5IWFA 4RA0A 4AI3A 2KXLA 1MQTA 2WAAA 4PF5A 3DF0A 5BNNC 4QGLA 2V4AA 1F4HA 1EPZA 3H1WA 4C91A 4ISRA 1G9BA 5A7SA 3J7LA 3B94A 1CAXB 3NNMA 1QDOA 4UFKA 1V6NA 2GC0A 4AGVA 2XKOA 4AZZA 2P3KA 1LU2A 2YC0A 4NHLA 2ZHKA 4RFRB 1PGL2 1LNSA 4MHUA 4LE4A 1W9SA 1Q3EA 3VBOC 2DCJA 5T5JA 2ZHMA 1K3IA 5JOXA 1SCRA 1EUUA 3KQ4B 2VGDA 3PJQA 4OUEA 4XBNA 3BB6A 5BNPA 3FE5A 4DZGA 3WHTA 4QHBA 1HX6A 2A6XA 4URAA 3JUUA 4XCBA 4YVSB 2P6HA 4DMIA 1JYNA 5JXHA 3LFMA 1UPIA 2DU1A 3EO6A 5I8SA 3ES1A 3JQXA 1R1A2 4QPWA 3LPGA 1VB4A 3TEWA 1XNKA 1BLZA 1UZ0A 2QCSB 3N9PA 1H4GA 3BGAA 1Y9GA 5FMOL 2H0VA 4PT6A 5J96B 3G6JB 1ENSA 2DUQA 4HPKB 3DV8A 1PZ8A 4PLOA 1QJY1 5H9SA 2D44A 4JRLA 4R4XA 2ZGKA 3E97A 4FQZA 2A6ZA 4Z2WA 5F3CA 1NT0A 2VTXJ 3PVNA 3M3IA 4IE4A 4XAEA 1Y9QA 4N53B 3THPA 5IVJA 1CVNA 2JE7A 3QH7A 1V6LA 4GULA 4MHRA 1PZ7A 5F5QA 1VBE1 4YZ4A 1OH3A 4ZONA 1IS3A 3WHUA 1VBC3 4OI2A 4A3XA 4Y24A 4JCKA 1NE4A 2XGXA 1B09A 3AX4A 3KV5A 5FYUA 3VKFC 1SBFA 3HR9A 2KA3A 3ILFA 3RGBA 5IUQA 3RWNA 2W5FA 2GALA 1DGRA 2VZUA 2R6QA 5KHGA 2VMHA 2XLGA 3HJRA 3ZYJB 4OUSA 4RD7A 4UFIA 4A2UA 3VHOA 4F7ZA 4DEQA 2LW8A 3B69A 2BRTA 2HKXA 4B3NA 4K3UA 4YW3A 3IPVA 1UYXA 1R092 3QCWA 4Q4X1 2XJUA 3ZFFA 1BBT2 4Z07A 2GP5A 3R4SA 1PMIA 3POWA 2W47A 1A3KA 1ZBE2 4JKLA 3ZN6A 3VZJA 2E32A 5C5UA 4QXCA 4IEWA 4LBMA 1AVBA 2Y64A 5JDBA 1PIV1 3ROUA 1ENXA 3O0VA 3NO8A 1ZA7A 1CPNA 1W6QA 3GJBA 5FMOS 3GGLA 1CAVB 1TNRA 2VOVA 2NYYA 5C8CC 2XJQA 1CONA 3ABZA 5LY1A 3F2ZA 1FATA 4WM8A 4JDNA 3S5QA 1UQXA 2I07B 1PVC1 1WCUA 3HWJA 1JYCA 1OT5A 4H14A 1DGLA 3T09A 4CXWA 2ZMNA 3URFA 1HB4A 2R041 5A3WA 5J7MA 4QM8A 1V9U1 4K7JA 1SDWA 1VMHA 2W1UA 3J7MA 2ZHLA 5DAPA 5CBLA 4O65A 5DQ0A 3BALA 1SBDA 2WZR1 4K1YA 3MUZ1 4Q8KA 1RC6A 5IVFA 4DO0A 2OA2A 5CVRA 2LROA 2X5IB 2R043 3R4DB 1TE1B 2ZBJA 3BI3A 5FZ7A 1VIWB 1V00A 3DUIA 4KQ7A 4H7LA 3SH5A 1FOD2 2D3SA 1RXFA 2VM9A 2WZR3 3PL0A 4HT1T 4XAAA 4CYDA 1G9FA 3AL6A 4CCMA 3FJSA 2OXBA 3DKQA 1OH4A 2HWD1 2QQNA 1WA4A 2BV4A 4YW4A 2W95A 4GWNA 1UX6A 3AYEA 3LEIA 4GKYA 4MYEA 1XBFA 4ARYA 1C28A 4C0BA 4BXSV 4DEVA 3RZJA 2A1XA 3GXUA 1AYM2 4YFZA 3O1OA 2C9KA 1J1TA 1HJFA 1S0IA 2PAMA 1ND2C 2Y0OA 4GJZA 2KR2A 4CDUC 4BIOA 1F31A 2Y34A 3I3EA 4ASMB 2XBO2 1UY2A 2IXKA 2HWB2 2WT1A 4QU1A 2WABA 4W6WA 5D8AC 4Y22A 5JSRA 3D0SA 1GANA 3D82A 4XUQA 2R16A 4AFMA 1WD4A 3RZLA 2SLIA 4L92A 4AI0A 4CVUA 1K12A 5DZFA 1CZTA 1DYPA 1QF3A 5DUWA 5JR2A 1BVVA 2RS52 2R0HA 5I93A 5CZKA 4WVMB 1FPN2 5IAXA 1GP5A 1H6YA 1W6MB 1C8M2 2KD7A 3NV1A 1WLTA 2OX0A 4MGQA 4X6QB 1PNGA 4JGZB 5FQ0B 3WVJA 1I1EA 4BLIA 1UY1A 2VBPA 2YMZA 2A5ZA 3WINE 1HRV1 2PAKA 2WNVA 3POIA 2GMMA 2YHJA 2OVUA 3KT4A 1S0GA 3OUJA 4QX5A 4C8DA 1JHNA 2ENRA 2NZ9A 2VNRA 1TMF3 5C4WA 1SLAA 3I4IA 1OC1A 2HEYF 4ARXA 2GU9A 3MPPG 5APAA 4ZY9A 3GALA 1CAWA 1YQ8A 2NLRA 1G9CA 3OOXA 3MO4A 3O1RA 1SLLA 2A3YA 1FT9A 1LHNA 3KSCA 1O8PA 4LBQA 1BMV2 4WVVA 3WD5A 2JG8C 4NIGA 2VOWA 1Y9MA 1F2NA 2LTNA 2JE9A 4L2NA 3T2OA 4LEJA 3ECQA 5DDJ1 3ZXFA 1VBD2 1POQA 2JD4A 1ULPA 1A8MA 4JVAA 3I49A 5BNOB 2Z42A 4E4HA 1S0BA 3AP9A 4CP1A 3UL2A 4Y5TA 1IPSA 3TYJA 1XNCA 4CCNA 1AX2A 3LPFA 4CPBA 1VP6A 4CDWA 1YIFA 2HBTA 4FFHA 4I30A 2GNMA 1YQ5A 4COZA 3H3ZA 5EXOA 1RB8G 3UJOA 3D6EA 5L9VA 1AXZA 1OVSA 1CPMA 4GXLA 1U5YA 1AL0G 5JMOA 1IS5A 4CP9A 1ST8A 4LA2A 4Y20B 4Y26A 4ET7A 4YZ1A 5FO9B 3NV3A 5FXWA 4E4ZA 1QJU2 2GNDA 3NL1A 1GQHA 3ZFEB 3D8CA 1DZRA 1OPMA 5JPMB 5FIXA 3QOPA 4FOQA 5A7OA 2ZJCA 5FZ1A 3VZLA 3ZSLA 1M06G 1UYPA 2W87A 1GP6A 4E2QA 3VDBA 4EWDA 2KM2A 5F3EA 3TEZA 1NUKA 2W52A 3JB8A 1OD5A 3LSEA 1L7RA 4YGEA 1ULOA 5IVEA 1W0OA 2ZKNA 3MW3A 1RHI1 5HXVA 3I59B 1GOHA 2GH8A 4J6GA 1YWKA 2WC2A 3M4FA 1PMHX 1RITA 4SLIA 1XYPA 4EWEA 2QFEA 3ZIWA 2JDHA 5IW0A 2UURA 2IXCA 3MV11 1UAIA 5B2GB 2D3PA 1OF4A 2V5YA 2A70A 3ACFA 3B02A 2Q8EA 5KR7A 2R072 3OY8A 4IE6A 3PUQA 2BFUL 4OYUA 4XTMA 4XVHA 3VHPA 3LDBA 5CKMA 3WZ1A 1UXZA 3O1UA 2Q8DA 3TRSB 1EAH1 1W3VA 4CRQA 4AOCA 2J1VA 2WZ8A 5LRRA 5CFCC 1NCQC 4XDQA 3HEIA 2C0ZA 1ZBA1 3DYOA 5T3NA 4Z8BA 4JKKA 5J48A 3MYXA 1AR72 1ONAA 1JOJA 2GC1A 2QQJA 1GR3A 2W92A 5A7WB 1CIYA 5BYNA 5JMCA 2BWAA 5DUXA 1A78A 5FLIA 1US3A 3ZYHA 1IZ3A 5EJ3A 2BOIA 3ZXGA 1KITA 4FFFA 4BJ0A 4E4SA 5DPNA 5EIYB 4AEMA 1AR82 4AW7A 1XOYA 2FZ2A 3JB4C 3VBUB 3X29B 4AI8A 4W8JA 5G04L 3KT1A 4L99A 4AK3A 5FDBA 3KLSA 3IWZA 1PO21 2W2IA 4LE3A 1WBLA 3P1IA 2XHNA 1TVGA 4KWJA 3VBOA 3WW1A 5L7OC 4FPKA 4WZCA 1ND3C 1UY0A 2IVIB 1A6CA 5FY7A 1E5HA 5HCAA 5KXEA 3P3PA 3G7DA 2L9LA 4QX2A 4QXBA 3VKMA 1W8TA 1QH7A 3AB0A 3MLLA 2ZGQA 4Q0VA 4B4PA 1F9KA 4P9YA 3B00A 3NNGA 3DGTA 3U37A 1MZ6A 3CJIC 3IDAA 4W50A 4NJ4A 1LAJA 4QB6A 2RS31 3USUB 2D93A 2WL1A 4YM1A 4PF1A 1XU2A 2WWSA 4QDQA 4N7IA 2D5FA 5FP8A 4KU7A 1NYWA 2BFUS 2V09A 3E6DA 1HXS1 4IQPA 1MQTC 2C9AA 2YYOA 4GQ7A 2BGPA 3N9LA 1UY4A 3LEGA 4N43C 5IATA 3FL7A 1LOBA 4OVEA 3O0WA 1WMEA 4JQRA 4L0PA 3ZFGC 3AZWA 2VXJA 3WY6A 3VBSA 2NN8A 1OLRA 3GZTB 3ETPA 4XIKA 1RUF2 4GB33 4MGYE 1LECA 5E8AA 2QQKA 3ZSKA 2HWF2 1N47A 2VMFA 3NNJA 5FWJA 1NLSA 3IT8A 3C7HA 4HK9A 3WQBA 1NCRC 4OHYA 1ENRA 4URTA 1SPPB 3NJYA 2JWPA 3VBFC 2QKDA 1YJLA 2WQ8A 4GJYA 3SEPA 3HQUA 3PURA 2OW4A 1QNWA 3C7GA 4HKLA 1VRH1 1H1AA 2H6CA 4IE7A 4RS5B 3ZDSA 1RUD2 1UNBA 2YY1A 3GM8A 4LBJA 3E5QA 4LOSA 4M0NA 4N9HA 4S2HA 4ZU5A 1T2XA 1UL9A 5JWPA 4YVWC 3NV2A 3LA7A 1WBFA 5HBAA 2WO2A 1OF3A 1QQP3 1FMD1 2QDRA 1YIPA 2J1SA 2K46A 4A3ZA 1ODMA 1Z0HA 1UOBA 4IEOA 1AR61 1FXZA 3RNSA 4RHV2 5GLTA 4KWUA 3Q8FA 1SQ4A 2B42B 1O6UA 2TNFA 4CUGA 4AVVA 5JI9A 3ZN4A 3OBTA 5FZCA 3VD4A 5DAXA 1H9PA 2CWSA 1ULGA 1IHMA 2P3IA 3SCGA 1UMZA 3I8TA 3WQ1A 3H1YA 4J1XA 1Z78A 4NRQA 2BVBA 3AVRA 4PHZA 2ZOEB 2MEV2 3BU7A 3DEMA 5A1LA 2LRPA 5C8CA 5LRSA 2PHFA 1NY71 1ALYA 4JTOA 1W2OA 2B4KA 1AR92 5JVVA 2VZTA 3UKNA 1IG3A 5FYCA 4GKXA 1J83A 1LOFC 5DABA 1ZZ7A 2VPVA 4R52A 2O1QA 2VU9A 5I0RA 5FY8A 5JOZA 4OQ8A 3VN4A 2DU0A 2ZHNA 2Z5WA 4R9AA 2WZPP 2WINB 2IWGB 2C26A 3MW2A 4CU8A 1O3TA 1GFF2 4FCAA 1PO11 1Z7S3 2QQOA 5FZ8A 4CUCA 3RYKA 1XC6A 4OI1A 1W8HA 1TZOA 1OKOA 1BEV2 1JUHA 2CDPA 3OYWA 5F6LB 4BH9A 3WCRA 3WCSA 1MS3A 2JDAA 4WBBA 2UY9A 2DFBA 4RQPC 1OKQA 1KFUL 2XUEA 1PK6B 1PO13 1ULCA 3BUCA 2P3YA 2VMGA 4FT8A 4WM7C 1NE6A 5IVVA 1HB1A 5A32B 2W1QA 1DLLA 5IK5A 4CDUA 1ND2A 2QZ2A 3AC0A 3C7OA 4E2SA 5FYTA 1NXD1 4FXKB 2YGLA 4AEDB 1ULFA 5D8AA 1VBA3 1W2NA 2VY0A 2ZA9A 4UBHA 2AYHA 2LALA 4XHBA 1OPOA 3AXEA 4CCEA 2PHUA 1WZXA 2YZ4A 4HG6B 1VBB1 2WNEA 1JZ6A 1WGPA 1PZ9A 2QUOA 4Q4V1 1W99A 1NG0A 3RSJA 4AE2A 5ABJC 1N3PA 5FYHA 1MVEA 1O5LA 3OUIA 3GHMA 4H3WA 4E4DX 4BISA 2OQ7A 3WV6A 4A6OA 4KBZA 3OPZA 1MACA 4A7YA 4Y1XA 1G6NA 4QPIC 5FKCA 1YUDA 5A6QA 1J3RA 3S6PA 2JIGA 3JZVA 4E2GA 1W8FA 3IDEA 2XWJB 4Q0SA 2GN3A 4COUA 1S0CA 4MG2A 2B45X 2PXJA 1AX1A 3K3NA 1KDMA 1UW8A 3T1MA 1LGNA 5LA2A 1WLWA 1GU3A 2R063 3I2IA 1BHGA 5FY4A 3NV4A 1SBEA 2D7FA 3MBWA 2QE3A 1AXKA 1CX4A 4PDWC 2RS11 5GLWA 2XONA 5L19A 2RDSA 4R4ZA 4AG4A 3C7EA 1VBC2 4HETA 1TME3 2OT7A 2JG8A 3GCWA 3J8F3 3LQCA 4M3CB 1D4VB 3WW2A 4XETA 3CQOA 4AHZA 4EE2A 1LR5A 2BUKA 5BNPB 3ZPYA 4Q1RA 3RMXA 4DS0A 1O8SA 1WUVA 4LHNA 3ZXLA 1GOFA 2WSUA 5I8YA 5HPOA 5GZCA 5FO8B 2XHKA 3I3QA 5FMDA 1C5IA 3U07A 4AQ6A 1QKQA 5JR7B 4XYXA 1IGOA 1J84A 2IFRA 3FLTA 3VBRC 4UOJA 1DU3D 1QDCA 4BMEA 2ZKLA 2VZSA 3FHIB 4NIHA 1RGSA 1JYXA 3K75B 1H2KA 1W6PA 2EIBA 2DV9A 5A7NA 1RUC1 2B8MA 2Q8OA 2ZPXA 1YEWA 4XURA 2J1UA 4BQ3A 3H8RA 4EN6B 1LTEA 4MLOA 1HRI2 1O59A 1MS5A 4P5YA 2R30A 5IJRA 1AL23 1YC61 2JEMA 1WW7A 2DVBA 2YFZA 4NRPA 5FUPA 2PLV2 2WO7A 4M3CF 2FCTA 2P37A 2VNOA 3FBMA 4ES8A 1KS5A 5CYYA 4LTAA 3VDDB 5CKNA 1D7PM 3ZMNA 1CJDA 1LULA 2GNBA 1OFNA 3WQ0A 3POBA 1NA1B 5D2AA 3I2HA 1R083 4CDWC 2XUMA 1FX5A 4YG3A 4I3PA 1A8DA 3K4ZA 4KL1A 3IBMA 4CXYA 2P4EA 4XF1A 1RUI3 2YU1A 4JX0A 5FO7B 4IW3A 3IIAA 2ZGPA 3IPVB 4ITCA 2E7TA 1OQ1A 3ZFFB 1RUG1 2LS6A 3KV6A 2B7YA 2GDFA 5B4NA 1MZEA 1RUOA 2G9GA 2RG4A 2ZABA 3A4UA 4XABA 1CESA 3B93A 5CFCA 2PYTA 3K4AA 5ISLA 4B7EA 1W6OA 2IZWA 4AL9A 4C1XA 2UYAA 2ZZQA 4AFCA 5C3QA 5KBFA 5FCCA 1YJKA 1NLQA 1K5MC 2Y60A 3W5MA 1X50A 3LGRA 1RUG3 1GLHA 1SZBA 1N1YA 2JG9B 1QJX2 3ZXEA 4B8EA 5FPZA 1CZVA 4IEZA 4DIQA 5LA0A 1QNYA 2WQZC 4AEJA 4ZXKA 2J1AA 1N1VA 3ILNA 4WM8B 3AMNA 1W6NA 3GHNA 5T55A 1OLQA 4Q26A 1JN2P 2QVSB 4YZ3A 5L7OA 2H0BA 1P8JA 1ND3A 2WS91 2B5HA 1PGW2 1PM4A 2E7AA 3PMEA 5KHIA 3HT2A 2HLEA 1DGWA 4XQWA 5DN2A 5FZAA 3UGFA 3TOJA 5HV0A 1Y43B 3BOWA 1UZWA 3OUHA 2VG9A 4QPYA 3AZVA 5FYMA 3CJIA 4META 3LAGA 2CL2A 3H7JA 4NHXA 1QXPA 5K0UB 5ACA1 2Q1FA 2CV6A 3V0BA 1FNZA 1AZDA 2X10A 2GN7A 3VZMA 4HVRA 1US2A 2ZGRA 4MSVA 1JBCA 2Z2SB 1AYN1 3Q8CA 4I0BA 2XQRA 3C7FA 3J4UH 5C3SA 3SITA 4N43A 1WD3A 1KEXA 2PTMA 4GH4B 1ASJ1 3AMPA 3ZFGA 1XSQA 1TMF2 2JENA 2VBBA 3MW4A 2ZX3A 4OHVA 4W4ZA 1AF9A 3AKSA 3NAPA 3QBQA 1H8TC 5HV4A 1JYTA 1RUH3 4TLGA 1TNFA 2O8OA 2DYCA 4BPZA 1V6MA 3TWIA 4K20A 4FPHA 1NCRA 3N9QA 3NVCA 4MVTA 2DF7A 1SACA 2W08A 2J22A 2E31A 3VBFA 3JBG2 2IXIA 3VD9A 2ET1A 4BQ2A 1W9TA 4LULA 5FPBA 4TTGA 3N36A 5LBCA 3PVBB 2FDFA 4IETA 4YNIA 1XRUA 1ZNPA 4XJZA 4YVWA 1BZWA 2ARCA 2IC1A 1F8VA 1WCSA 4GWMA 3SKVA 3I97A 4I02A 5A1AA 1YQ6A 5A7PA 5A1FA 3WP6A 5IAVA 4CEYC 3OTFA 1EY2A 1OA3A 5EHDA 4FQ4A 2JDYA 1XE7A 4UFMA 2NM1A 1RUE1 2MHFA 1X82A 5FXXA 3PUHA 4Q4Y1 3CEWA 3MLJA 4QU2A 2WNVB 1RJ7A 3O0XA 1GZTA 3CZJA 4XFFA 1JU4A 3VBSC 2OIIA 3T4HB 4JZRA 3KCYA 4TLFA 3PMSA 4UXAA 5C4WB 2FD8A 5BXXA 4B1LA 5KXBA 1CAWB 1QJY3 2OYZA 1I6XA 3O14A 1ULEA 3RS6A 2PAEA 4LBQB 3NW4A 2X05A 4TZDA 5F37A 3BKZA 4QX3A 2ZGOA 1HDKA 5JPNB 1LB2A 4CU9A 4S2FA 2ZEWA 1UCXA 2XJSA 3LDRA 5IFPA 2CGPA 1LOFA 1VBE3 5CU1A 4HN1A 1DQ0A 4LHLA 2BU9A 5A70A 1EV11 4HN0A 2AH2A 4E8CA 2WLQA 5DG2A 3W9AA 4XJWA 3IKWA 4WZFA 1KRIA 2YBPA 3WSOA 1C1FA 3T30A 4BB3A 5GLVA 5FOJB 3BODA 4AGRA 3W5NA 2GAUA 1LODA 2VMIA 4V1PA 5FREA 4XZUG 5EPAA 3ZN5A 2HWC2 3NSTA 4AFDA 4CP9B 2R32A 4LBQD 3M3EA 5BNPC 1IPKA 1WWYA 1JI6A 1OA4A 4RQPA 1NZIA 3I3BA 3LD8A 4Q4X3 4LK6A 5FYBA 5IYYA 3SCHA 4WVWA 3RI9A 5AVAA 5LK7B 3ZR6A 1Q43A 3OGSA 2ZZJA 2WFF2 3B9CA 2Q5TA 4BZ4A 1O3SA 3RPQA 1RTVA 2XXZA 4WM7A 2ZGNA 3AYDA 4PCRA 4EQVA 5DG1A 2AGSA 4ZS3A 5L73A 3WNNA 5FRAA 2WN3A 1PIV3 4TXWA 5FYZA 1OQDA 4QQLA 3WDWA 4CPBD 3IZOA 1XE8A 3ZXJA 2WNUB 4A7KA 1HN0A 2PLV1 4DXRA 5BV6A 1SFYA 2EA7A 3BU0A 3RZGA 2VCCA 3O12A 5IVCA 1CX1A 1QJZA 2P6CA 2VXRA 1XYNA 3CHXA 2BDRA 3TEXA 3BPSA 3LFIA 1PVC3 1WCQA 3OY8B 1QXJA 1RUJ1 3DXUA 4HVOA 2YV8A 4FOVA 3V64A 3T08A 3WQ7A 5ABJA 5BNNA 1V9U3 1KJRA 1LRHA 1Q56A 1W2AX 4MX3A 1MEC1 2YFUA 2WN2A 3IDCB 2C5DA 4QPIA 2RMU1 4CDQC 3N7MA 5I0DA 2RM22 3NQHA 4HMZA 4KG0A 3Q8EA 1PVXA 3CDZB 4YSFA 3BTYA 5TSWA 3MIHA 4MADA 5HXMA 3PU3A 2QQPA 3BIWE 1O4TA 1MS9A 2JDKA 3WP5A 3ZX7A 5IT6A 4FI9A 1OQEA 5BNNB 4YW1A 2RMU3 4LITA 1XSRA 2VZPA 4N90A 4RR3C 4S2DA 4LK7A 5FY0A 4PDWA 2VBDA 4RGAA 4GB32 2HWE1 4YARA 4HK8A 5H9RA 4K21A 1PX3A 5KC5A 4LORA 3VBHC 2HWD3 5FLJA 3JD71 1JMUB 2A6YA 2H6BA 3ZLIA 4KU8A 3PIJA 5DZEA 3WOGA 3OPTA 1ZA4A 4GD4A 1Q8VA 5GZEA 3WW4A 2D6LX 4COVA 4DINB 3MZHA 2F6BA 3INAA 1AJOA 1H9WA 3WG4A 1LOAA 2YC4A 1SMVA 4Q4W1 4A6SA 2G9FA 1ZYBA 3DPRC 1I3HA 4NIIA 3JD73 3T4VA 3OD0A 3TAYA 1W28A 4XFGA 1LHOA 5FZHA 4A4AA 1QQP2 3I7DA 3OGJA 1LOGA 3VBRA 3AFGA 3I2DA 5JOWA 4IEYA 4XHXA 2Q0AA 5FZ3A 5FYVA 4PLNA 1W9FA 4Q4W3 4XFCA 2RR11 3N9MA 4DUVA 3THCA 2EIDA 2CTVA 3JCIA 3HBKA 2NP0A 1WMFA 1WLCA 2VUCA 5DMYA 1KFXL 4IEXA 3E6BA 4IE5A 4G4FA 1BK1A 2ZTNA 5JCTA 4BM8A 3IAQA 2XH6A 1HRV3 3QD6A 5LASA 3VGIA 3I2OA 4QQHA 2RR13 2QQLA 1GQGA 1HV0A 2D5HA 2ZX2A 4E8DA 4QXHA 1PGL1 1W04A 2DCTA 3Q8AA 3GZUC 4YW5A 3SHRA 1APNA 4MXWA 5F32A 1GBGA 1GYKA 4ZU7A 2E9QA 3CIHA 1K42A 5LBFA 1FNYA 2XLFA 4N53A 5JXIA 2Y38A 2GMPA 1GV9A 3ACHA 3N9NA 2UWAA 3U0ZA 4CUBA 5C7GA 1NQJA 4QB1A 3S7EA 2ZGSA 5DDJ3 1R1A1 5EFUA 3WDVA 4IV1C 4FP2A 1BYHA 1Z7S2 2Z4FA 3RQ0A 4FBFA 1OXCA 5A3LA 2ET7A 3R6SA 3VKLA 3AMMA 3A23A 3AP5A 2OPWA 3H50A 3RZZA 3MF6A 4EN8B 3WP3A 4ATEA 4MV2A 5FYSA 1YFYA 2JKBA 4IEPA 2VECA 4FO9A 4RGKA 1FI2A 2AENA 4XDOA 5F8PA 5I91A 1W0NA 3TEYA 2PFWA 1K5MA 1RXGA 3AP4A 5IFTA 3H9AA 2VULA 2VQTA 5K8SA 2I2SA 1C8NA 4Q1PA 2IVJA 1WMDA 3M1HA 5C8CB 2VW0A 5FY5A 2DBIA 3RMYA 4ES9A 1LOCA 4QQ2A 2O14A 3MHZA 5FBZA 1DCSA 3QLQA 4IL7A 1H6XA 4X8PA 3SH3A 5JOYA 2VOXA 2RJLA 1AX0A 3CNAA 2A3WA 4QX0A 1VBA2 5F5IA 1CAVA 1RIRA 2DBNA 1JZ8A 1RHI3 4YGDA 1MS8A 1S2KA 1HV1A 2ZEXA 4JC1A 5A33A 2FMYA 2XDVA 2D6OX 3KD4A 1WA6X 5FZLA 1S2EA 3AMQA 4XIOA 4XW3A 5EQUA 4AF9A 3GJAA 4HLTA 3H7YA 5BPXA 5IK4A 4I2OA 1R091 2Y6JA 1BBT1 1RVF2 3NMBA 1M4WA 1LOEA 4M4PA 2VZVA 1ZBE1 3E1F1 5G05L 3OYWB 5I0UA 5GALA 3BVCA 4CCJA 2V73A 3THDA 4NN0A 4XOGA 3VZOA 2FDKA 2O8QA 3FUQA 1ZZ6A 4LUMA 4EN9B 5C5TA 4YM3A 4JGYB 2XJTA 1QU0A 4LKDA 3N4MA 1EAH3 3MF9A 3OGGA 4CUAA 2E6VA 3T0BA 4A44A 1E57A 4CEWC 2JJ6A 1ZBA3 2B39A 2R062 1D4M2 2VCMA 1H8TA 1G86A 1COV2 4FPFA 2DFCA 1PGSA 4Q5OA 4XJAA 4XMAA 5FAXA 5FZ4A 4UFHA 4CDUB 1KGYA 5I0TA 1ND2B 4QGMA 4IEUA 4P9GA 3KT7A 4P9XA 1UIKA 3ZSJA 3KMHA 3BTAA 1TME2 3J8F2 5D8AB 4DRVA 5FJKA 2JECA 4TSVA 1CGPA 4LO6B 1N3QA 5HI0A 1B35C 3FN9A 4BLJA 1PO23 3MIDA 2BWCA 2EXJA 2W39A 1S0JA 4LKSA 5F3IA 1CZSA 3W21A 3ZYFA 1GWMA 4YW6A 4MGSA 2ZGMA 3EMRA 3OBRA 5F9TA 4CEYA 2LM3A 2SBAA 3WR0A 2VH9A 5C8WA 1OOPC 1W8WA 4NE9A 1GWKA 3N7KA 5FUNA 2C4XA 4ISQA 3RZHA 5KC6A 1FOD1 1REEA 2X29A 3ZYIB 5J3UA 4FPLA 2RS33 1LKNA 4OFGA 4JDOA 5JSPA 3N7JA 2EALA 4KH9A 3NAPC 1G7YA 1W6MA 4AGGA 1Y3TA 4PJYA 5AC92 3HAGA 1HXS3 5FQ0A 2IUWA 3KV9A 1OFSA 1AYM1 1TQ5A 1LENA 1BKZA 5FZOA 2UWCA 3AFKA 1AL22 1JZ2A 1RMU2 3M7AA 3PNAA 2XBO1 2JG8B 4B1MA 1BCXA 2HWB1 1G9AA 1MS4A 1UPSA 4FPYA 2W1WA 3FBYA 5FK8A 5L36A 2EAKA 1IKPA 4SBVA 1AYM3 2JD9A 1RINA 1S2BA 5FZ0A 4XE9A 2GNTA 2W46A 3TBDA 2RS51 4FVVA 4XC9A 1R082 1ZRIA 3MUY1 5CAZA 3S5AA 1FPN1 5C6CA 1VRH3 1RUI2 2VVFA 1C8M1 1VMFA 5E89A 2CDOA 3E5XA 3ES4A 3O1MA 2VVDA 5EYXA 4A42A 1O3QA 5JLVA 3TN92 5FZKA 1HW5A 4QPGC 3UT0A 4S2GA 3S7IA 1HLCA 1FMD3 1W6PB 4XF9A 1XPWA 4J25A 3V65A 2W94A 4OZXA 4HKOA 3CJXA 1AR63 2BTVC 3KCCA 3QH6A 4LMFA 3FFZA 5AFBA 3TB0A 2YXSA 3A0KA 1OSGA 4PI2A 5B4XA 3WF1A 4Q29A 3LOIA 4NHMA 2PHTA 5SV8A 2P17A 3MFCA 1XXNA 2TBVA 3MGUA 1BMV1 3GZAA 4Y20A 2CSGA 2ID4A 3WNOA 2P5BA 2Q1MA 5D1IA 5FOBB 3MPBA 2VZ1A 4QGNA 1LCLA 3V0AA 1VBD1 2CAVA 1AJKA 3ACLA 4XFBA 2YROA 2GP3A 4D0QA 4CA9A 1JS9A 1LHWA 1PM7A 3JXSA 2YG0A 2VJXA 3KVAA 3AMHA 1U5XA 4NWWA 2EF6A 3C8XA 1URXA 5DAWA 4W6XA 4FAHA 4ZHNA 5BNQA 2YGMA 3WF4A 5E16A 5LB6A 2EAAA 2VC9A 2E26A 2DDUA 2OQ6A 5A6YA 1VBD3 1WW6A 2XVLA 4Y5SA 3ZO0B 3VDDC 3WLUA 4LBOA 2ES3A 1TEIA 5C9AC 4CDQA 3MIEA 1FAYA 3ZMOA 5K7PA 4LHSA 4KG8A 2WLPA 5CFCB 1NCQB 4Y4RA 2Y8KA 1QJU1 1W6OB 4JHTA 3R4UA 4OZOA 4EN0A 1BJQA 3B01A 1DYOA 2JDUA 1NZCA 2C1FA 2JDNA 3D0JA 1CD3G 3PHMA 4G3YC 3L2YA 2VTXA 3LF7A 4LO7A 5GM0A 3MLKA 3NJVA 3WNLA 4XQ4A 5DUVA 2HEWF 2ARXA 2MPFA 1N1TA 2FDHA 4K40A 4RR3A 2VOTA 5FKBA 2F17A 3HQXA 4HKWA
chains in the Genus database with same CATH topology
4LUKA 3J26N 1RUH2 1ZRDA 5EV7A 3VBHA 1W6NB 5JZGC 2Z79A 5L7OB 5CFDC 4DNYA 1QOSA 2AUYA 2JG9C 3VV1A 2R071 3VBUA 1WLDA 2YDEA 3LA2A 1V6KA 3SCFA 4WV8A 4CDXB 4LT5A 5GLZA 3DPRA 1GNZA 1DHKB 1DZQA 1J3QA 3CJIB 2UY8A 2RE9A 3DKWA 4C1WA 1GNHA 1VBB3 2A6VA 2I74A 2PHRA 4GIQA 2JDZA 4LBKA 4LO8A 4Q4V3 3M3OA 5JIAA 1LU1A 3RYPA 3U10A 4B4RA 1AR71 1MQTB 4N43B 1VAKA 4CZSA 4I0WB 5K0UC 4K1ZA 1GICA 4Q8LA 3ZFGB 3UV9A 1AR81 4FTSA 4P9IA 2R49A 3VKNA 2ZGTA 4P9JA 3ZXDA 1QJY2 2K0GA 3U11A 1QY4A 4IEQA 2E51A 1C1LA 1V6IA 4KWLA 4GH4C 2TUNA 2ZX0A 2GSYA 4ASLA 4KWKA 3VBFB 2RS13 2JICA 3I54A 4Q0UA 3M70A 5T5PA 1VBE2 4OHWA 4NHKA 1ZRFA 4FXGB 4HSJA 4J1WA 4Q0PA 1LHUA 3OF1A 4FP3A 4YVWB 4YZ2A 4Y1UA 4P14A 3FMGA 4QMAA 4XZPA 1I5ZA 3CF6E 1OI6A 4IV1A 2ZCWA 1H8VA 1JXNA 3OCPA 4YLZA 2ZX4A 4W6YA 1ZZBA 4RS5A 4XJ9A 1VAVA 1ZRRA 4XFHA 4KGQA 4YVSC 1DIWA 3CU7A 2BEOA 5IK7A 1YCIA 4PLMA 4DB5A 2YUEA 3ETQA 1C4RA 1QXRA 1RUF1 3ZYRA 2FBEA 1JH5A 2HWF1 2E53A 4FPJA 4GA9A 1PHMA 5FLHA 2B46X 4K6BA 1RUC3 2EIGA 3J9SA 1O4YA 3MDPA 1PIV2 4HL0A 2CGNA 4ZU4A 1YRZA 4N53C 4TWTA 1VAMA 1UN1A 5CG8A 4FPGA 3AXDA 2X8KA 1RUD1 3LKJA 4ORFA 1WCDJ 2AZ5A 2Z69A 4RSUA 3ZYGA 1PVC2 3M3QA 4AEKA 2R042 4D7YA 1V9U2 1WCKA 3HT1A 2P3JA 3N35A 2K9ZA 4RHV1 4F83A 1MS0A 3ZN6B 1DQ2A 2XJVA 1G9DA 1RUD3 2HJIA 4PIYA 4D69A 2CY6A 4EN7B 2VQ0A 2WZR2 1H0BA 2PHWA 4Y1ZA 2WT2A 3FZ3A 2D6MA 4RQPB 3VLBB 2ATFA 2OUJA 1HIXA 3APBA 1W6QB 3ZVXA 4UW6A 4X8NA 4FTBA 4D94A 2BGCA 3KM5A 2Y26A 4CEWA 1D2SA 2MEV1 3L2HA 4WM7B 2BPA2 1O4ZA 3WDTA 2WIIB 1FV2A 3GBFA 1AR91 4UBGA 2HWD2 1SLCA 3O5SA 3WXPA 2MEV3 2OZJA 1IOAA 4AFBA 1MZFA 1B35A 1D0GA 4XJUA 2WA3A 3UJQA 2R1DA 5GZGA 1DQ5A 2WNUC 1SLIA 2WS93 4PIZA 5ABJB 3WW3A 3CLPA 4AEDA 1ZZ9A 3T2TA 2QZ3A 4M0HA 1BEV1 4QPIB 1OOPA 3IM0A 1X7NA 3DN7A 1X36A 2CAUA 4QQOA 5ACA3 2X5IC 3UKVA 3AKTA 4AYUA 1AYN3 4OULA 4P5HA 4PDWB 1HRV2 3VKOA 3BCWA 4BOWA 3MIBA 3C3VA 3WG1A 1ASJ3 4UW5A 2IXLA 1ZVFA 2AREA 4Y22B 4D7SA 1EP0A 4XFIA 4X6RB 4DPNA 2DTWA 2AR6A 2DWRA 2BW8A 4COWA 3EBRA 1D2QA 2JXAA 3O7OA 1G8WA 4DXZA 1C3HA 1V6JA 4HFSA 2ZAAA 4M3CA 5DDJ2 4M3CE 5KXDA 4AVBA 1HKDA 3RJRA 1JW6A 3GYDA 1REDA 1UIJA 4QPGA 4KGGA 3VBRB 4XF4A 2QNKA 1YO8A 4Z92B 4LO4B 3B5LB 5EYYA 2PA7A 1ENQA 4FOYA 4JGZC 4M01A 1RUE3 3C2UA 1GZWA 5CG9A 1JUIA 4Q4Y3 2XWBB 1POV0 3KCXA 2VNGA 3SNMA 4QQPA 1D0HA 1U5IA 1S55A 3SXWA 1VB2A 3FUOA 1VBC1 1GZ9A 4MXWB 4UW4A 1HQLA 2W0XA 3HIFA 1ZM1A 4LHKA 2NMNA 3T1LA 2A71A 3EHKA 3W59A 5FPXA 2HYKA 1EYBA 1X8MA 5DZGA 2MNGA 3UK9A 4FAGA 4R9BA 4L11A 1RHI2 4CDWB 3AYAA 2JX9A 3V56A 3LCPA 5BNOC 1QHDA 4PBOA 3SISA 3VDDA 3LSDA 1EV13 2I45A 5C9AA 4R8HA 1NA1A 1SCSA 4L97A 1VLNA 4LLFA 2QDNA 2GMEA 4IV3A 4M00A 3GF6A 1K5MB 3ZIXA 1EAH2 1HRI1 1MZ5A 2A3XA 4FOWA 4CP0A 5LEJA 1J58A 2W68A 1ZBA2 2A6WA 3ZFEC 1VJ2A 5GZDA 1OMIA 1DF0A 4TYSA 1LEMA 4RGGA 2Q30A 2UU8A 5JZGA 2R0FA 5CFDA 4EROA 1HRI3 2JG9A 4JTNA 3AM2A 4JRAA 4XPVA 4XXPA 5FTTC 2VW1A 5K9YA 3QACA 3ALQA 1REFA 3M2MA 5A33B 3KQRA 4QT6A 1O5UA 1PO22 2BBVA 2PLV3 1S1AA 2G4IA 1ULDA 4Z82A 5FFOC 5JI7A 5T5OA 4MGKE 1RUJ3 4COYA 5T5LA 4R9DA 3USSA 1ZZCA 1MEC3 4DRRA 1DGWX 2BNOA 5K0UA 4AFAA 1CAUA 1IKQA 2RS32 3VL9A 1QJX1 5GLUA 3POYA 3VUOA 3MI8A 1Q5OA 4KBBA 1GZCA 1H8TB 1HXS2 1OA2A 3VBOB 2DURA 4JGYC 3LWCA 3LOBA 4GH4A 1CAXA 1PGW1 3VBUC 1QJX3 1UU6A 2HWE3 4BHPA 1DG6A 1ZRCA 2PHLA 2R1BA 4H7MA 1X33A 2XKPA 1XU1A 4GMP0 4YGCA 1LESA 3ZSMA 4AHXA 1MVQA 4DFSA 2RHPA 2PN5A 4CEYB 2P2KA 1VRH2 4RFT0 4AI2A 4IERA 2BNMA 3ME2A 3UKTA 2YPJA 3VZNA 4YVSA 5BY5A 4H55A 3E6CC 1FMD2 1H2NA 2E7QA 3VBSB 4BCUA 1WW4A 3N3HA 1TMF1 4I09A 1AR62 1DFQA 1XNDA 2ZGUA 3LA3A 3MEPA 4HPKA 4P9WA 4AVSA 1SLBA 4AVTA 4G9SB 1U12A 3ELNA 3THTA 5JAXA 2F4PA 2XVGA 4EWAA 4MXVA 4LBNA 3JBG1 3GBGA 2N7GA 4NPRA 4Y5Z0 5HCFA 4XBLA 3SMHA 3EJKA 2Y0IA 1NY72 1U0AA 2XJPA 1NOVA 4JAAA 2EXIA 3PVEA 1QOOA 3VL8A 4C90A 1Q8QA 3JBG3 4NOTA 2ETEA 1H2MA 4RS5C 4AXOA 4YG0A 1QGLA 2VUAA 2IFWA 4FPCA 3RG0A 4PBPA 2XLAA 1DYKA 5BUVA 1V70A 1R1A3 2DUPA 1PO12 1H1IA 1RL3A 3RJ2X 2XVKA 1VR3A 1NQDA 4OUMA 1SFNA 2NQYA 2FHRA 3ILRA 1IS6A 3OJBA 3ZYPA 2DCYA 3PTYA 3V0AB 2BQPA 4Q27A 2VQAA 2NMOA 4RL7A 2X53S 3FLRA 4OI0A 2ZACA 5H9QA 1DGRN 3JQWA 1O3RA 4IXLA 3AKPA 4AQSA 1XNBA 2BVVA 4DY5A 4XF3A 4NVPA 1DBNA 2WNUA 2EXKA 1UU4A 4GALA 1CN1A 3ZXKA 4CDQB 4E9KA 2HWC1 1VBB2 1O7FA 1EPWA 2DTYA 4YM2A 4Q4V2 3RYRA 1MS1A 1R093 1BBT3 5GJ6A 4AQTA 5I0SA 2PELA 2X5IA 5IK8A 2FZ1A 2VUJA 4Y1YA 3WG3A 4FPEA 4LR4A 3L9JT 1ZBE3 3M3CA 2WFF1 2D3RA 1KS4A 2HWC3 4RR3B 1HQWA 3B9IA 3RDIA 3AZYA 1PK6C 2PHXA 3HBZA 4XF0A 1Q8OA 3VBHB 4AQ2A 1KQRA 4LBLA 1Q8SA 3Q9OA 2WFF3 2P34A 1C57A 2WA4A 3PLQA 1KDKA 4WVZA 2RS12 3NKTA 2ERFA 5EZWA 2IXJA 5CIRA 3AKQA 4AEDC 3DPRB 3MICA 1BXHA 1QH6A 4A7ZA 4CTEA 5KWRA 4Y4YA 2D6NA 5E1RA 4AHYA 2RM21 4XJ8A 1J3PA 4P9LA 4B4QA 1YXWA 3FX3A 3VHRA 4CDXC 3HMYA 4WVMA 5T54A 4YGBA 3AK0A 4JDMA 4MUVA 3WT3A 4BQ1A 5CA6A 5JSOA 2ZS6B 4JGZA 2RM23 2BNNA 4UW3A 1FOD3 1YI7A 2D43A 4GB31 1ZREA 2DCZA 1POV1 5KHHA 1RUC2 2HEVF 3H3UA 4FTEA 3GBWA 2WJSA 4I0AA 1X8EA 4Q2FA 1YFWA 2D97A 1YNAA 4HSLA 1H30A 4B7KA 3VZKA 1AUYA 2DVFA 3R0RA 4IEVA 1KJLA 2UWBA 1POV3 2O0OA 2WSVA 4LA3A 2XBO3 2HWB3 4NR1A 3RI8A 4LNVA 2K2SA 1AXYA 4HBNA 1IS4A 5GZFA 2A75A 1QQP1 3IDBB 3WUCA 1S0FA 5BNOA 5BNPC 4IV1B 5DUUA 1GKBA 4BA6A 2RS53 1UKRA 3EXUA 1I9RA 1YFXA 2FQPA 1L3JA 2DCKA 1FPN3 4YW2A 2A7AA 1C8M3 4AVCA 3MIFA 1AHSA 2QJVA 3GNEA 2CGOA 2DVDA 1RUG2 4AVAA 4BIFA 3MFAA 1HQNA 2ZMKA 1Q8PA 4K8FA 1N1SA 3LZZA 5GKAC 3ZFEA 5CADA 4N9IA 3JU9A 4XXAA 4D3WA 3BOPA 5H9PA 3WX5A 4EJRA 2B9UA 2WT0A 4Q0QA 2Q1ZB 3ST7A 1F5FA 4F8AA 1UKGA 3PVOA 3I59A 2GH2A 1ZX5A 5SV5A 1YFUA 3TNQA 1O91A 4R9CA 2RJKA 4XQDA 2D6KA 1F5JA 1UD1A 1Z7S1 4XTPA 2WS92 3TNPB 1NA1C 3R05A 1IPJA 3S0MA 2CNAA 5AVPA 5J36A 5CB7A 4OI4A 5A3MA 1XQNA 2OZ6A 3ZFFC 3A0NA 5ACA2 4N7UA 3H0OA 3LB9A 3ATGA 4CEWB 1CJPA 1QJU3 1AYN2 2D6PA 3KZ4C 4O9EA 1RJ8A 3E5UA 1H4HA 5E88A 1DQ6A 4YRDA 1ND3B 1UZYA 2LUWA 2ILMA 2GZWA 2XB6C 4JGYA 1QMJA 4MGZE 1ASJ2 2XL9A 5J37A 3ZSEA 3WDUA 1VBA1 4MGIE 4E27A 2OPKA 1GSLA 4YYOA 3H1MA 1B35B 2NPIA 1LHVA 4WM8C 1KXGA 4AHWA 1H2LA 1KD7A 3U4XA 3WDYA 4INDA 1NXMA 3FFQA 5T52A 3EQEA 1QWRA 4GMP1 5T50A 4JV4A 3V0BB 3K48A 1RVF1 1SLTA 2R073 4D7TA 2XPJA 2PHDA 3ZXAC 2UYBA 1OOPB 1J1LA 1C5HA 2GC3A 3WDXA 4L8QA 2FMDA 3HN1A 5CNAA 2DUOA 5JIUA 2BYVE 2VVEA 3AP7A 4QXKA 3SH4A 4PQ9A 4GMP3 2XJRA 3MIGA 3USUA 1RVF3 5LEKA 2XG3A 1R1ZA 3NAPB 2R061 1RUE2 1D4M1 1YYNA 2D98A 1S0EA 1AR73 1COV1 3ENRA 4Q4Y2 5J09A 4BE3A 5KHKA 1NCRB 2ARBA 4Y1VA 4IESA 2ZGLA 4DOUA 4ATFA 3K51A 1N3OA 3NWKA 1AR83 1TME1 2EXHA 2OUHA 3J8F1 4LO5B 4U36A 2WFPA 4W65A 1D4M3 1U5ZA 1COV3 1FYUA 2WQ4A 1NLRA 5F1RA 2Q4SA 3HD8B 3D5OA 4MZUA 3IN9A 5C33A 1DDLA 1LJ7A 3KB5A 3FLPA 5I8TA 4OHXA 4U2AA 4C0HA 1EV12 4QPGB 2ZMLA 4BYYA 1SEFA 1W0PA 4AWDA 3WG2A 1UZZA 5F6KA 4Q4X2 3AJZA 1ZZ8A 1VALA 3M8LA 1DQ1A 2CYFA 3VHNA 1V6OA 3WP4A 4YG6A 4L9BA 1GZWB 5AC91 4ONUA 1YHFA 3AYCA 1J59A 3ASIA 1FV3A 3NJZA 2WNVC 3NKGA 1MR5A 1AL21 1JYIA 1RMU1 3SLIA 1WW5A 4YM0A 4I01A 5C4WC 4YFWA 4PIXA 1RUF3 2DVAA 2HWF3 4OHZA 3H8UA 1PNFA 5AC93 1YLLA 2A73B 3WNXA 1QOTA 1CR7A 1H1MA 2D40A 5DXDA 1CIWA 5EWSA 1UF2C 1R081 3CL1A 3KS7A 1RMU3 4BWOA 3IMNA 4FSJA 1RUI1 1IQAA 3AJYA 3TN91 1S0DA 1Y7BA 3WUDA 5C9AB 3POSA 4K9SA 2VOKA 3CO2A 2ZAHA 2ZX1A 3S30A 4AI1A 5KHJA 4CP2A 1RUJ2 4HZFA 2VW2A 3FC0A 4LLOA 3FWEA 4RHV3 4IV3B 1MEC2 4XMIA 3OD4A 4HANA 3RRDA 1LGBA 3TN93 2RMU2 4EV0A 4YZ5A 3AKRA 4FPOB 3KGLA 1CQ9A 2IXHA 4HVQA 1NCQA 4XEZA 1UU5A 1PK6A 1LGCA 3AP6A 2GC2A 1LEDA 4NO4A 4DQAA 1RUNA 2E63A 5JZGB 5CFDB 4XILA 4ZKTB 5J98B 4F3JA 4O9GA 5AFEA 5A32A 4XFAA 4NWVA 3W58A 3BPZA 2HWE2 1OHFA 3D4KA 1AR93 3KGZA 3N7LA 2PQQA 3P3NA 3B7MA 3JD72 4DY3A 3AZZA 4QM9A 1XYOA 4B29A 1BVP1 2EVXA 2XL7A 5KXCA 4Z1VA 4KNCA 2TEPA 4QD2A 4I3GA 5HCBA 4Q4W2 1T6GC 4CDXA 2CWMA 4OLLA 1BEV3 4XBQA 3AZXA 3DL3A 1BQPA 1CAUB 1W2UA 1W39A 3B3QE 1JTZX 1YI9A