2ZHLA

Crystal structure of human galectin-9 n-terminal crd in complex with n-acetyllactosamine dimer (crystal 2)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
142
structure length
142
Chain Sequence
QAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-9
publication title Structural analysis of the recognition mechanism of poly-N-acetyllactosamine by the human galectin-9 N-terminal carbohydrate recognition domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 35
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2zhlA00
3B3QE 5DZFA 1W6PB 4GWMA 3AP4A 3WZ1A 3O0XA 4W65A 1VIWB 2WT1A 1G7YA 3UK9A 4XIKA 5F9TA 2P3IA 3L2YA 1GZCA 5GJ6A 4XOGA 1DZQA 1LOGA 1LTEA 3B69A 1WW4A 3WUDA 4DRVA 5GZGA 3USUA 1MVQA 5GLTA 2ZACA 3U4XA 2OUJA 1AXYA 5FREA 3MW4A 4BOWA 1SCRA 3SH5A 1N1VA 3PJQA 1UN1A 4AGVA 1UX6A 3FBYA 1WW6A 1ONAA 4PQ9A 5T52A 3M2MA 5KXEA 3N7JA 1W6QA 4K1YA 1S0JA 4Q1RA 3UL2A 4YG0A 1FYUA 4IQPA 4MYEA 1G9CA 4TZDA 1BKZA 1S1AA 1Q8OA 1B09A 3AYCA 2ZMKA 2YZ4A 1GYKA 2DU0A 2D7FA 4Y20B 3SISA 3M3EA 1DQ4A 3FLTA 2W08A 3RQ0A 1MS0A 1BXHA 2W52A 5EWSA 2VW0A 4FPFA 4FVVA 2GMMA 2DV9A 3N7KA 5E8AA 5T5OA 1LU2A 3OBRA 3ZSJA 3AP5A 3N36A 3ZSKA 1MACA 4YGBA 5LK5A 1S0FA 3ZVXA 2GNBA 2WT0A 4YG3A 2I2SA 3OY8A 4R9BA 2ZBJA 4HL0A 1F5FA 4LBNA 1SFYA 3IPVA 2ZGSA 3MW3A 1WLDA 3V0AB 5DZEA 1CPNA 4Q1PA 2AREA 2D6MA 1WD3A 5E88A 4ISQA 3AYAA 3WDXA 4YGCA 4Y24A 2ZGKA 4PCRA 1FATA 1HLCA 1S0BA 4LBQD 4BMBA 1JW6A 2TEPA 3MW2A 2W39A 1V6IA 2ZGUA 1LHOA 2D43A 4GALA 4ZKTB 1HKDA 1W6OA 2A3YA 1BYHA 2JDZA 1SLIA 1LOFA 3I8TA 4D69A 1LGBA 3ZYPA 1NXD1 3OPZA 1Q8QA 4WVWA 3O0WA 3ILFA 1H9PA 4XHXA 5T5LA 2EAKA 5DZGA 5BYNA 1UMZA 5JDBA 1JBCA 2ZKNA 2FMDA 1N1TA 1SBFA 2JE7A 2EXIA 5GZCA 1AF9A 1V00A 1WLCA 4P9XA 3PVNA 2GMEA 1WW7A 1Z78A 1MR5A 3AZWA 2NMOA 2ZGTA 5T5PA 2A3XA 5F5QA 3RS6A 4Y1ZA 1SBEA 4JRAA 3POWA 2XG3A 4XZPA 1DBNA 2DUQA 2KM2A 1G8WA 1KQRA 1W6NB 1HQLA 3BIWE 3N7MA 3D4KA 1AJKA 4FQZA 3R05A 5AVAA 4K20A 2DYCA 1C57A 1CIWA 4GKXA 1UKGA 2UWAA 5GZEA 5DUXA 1EPWA 5JLVA 3RG0A 1X50A 1QOOA 4FPOB 5EYXA 3VUOA 4YM3A 1SLTA 2DVAA 2OUHA 4LBKA 1GBGA 3AP6A 4Y1VA 1N3PA 1GNZA 2GMPA 1FNZA 2ZMLA 2WT2A 2DVBA 4XDQA 5E89A 3V64A 3WHUA 1GZWA 1QDCA 3NV1A 4AVSA 3VKLA 1SCSA 2A6YA 3ZYRA 1QOSA 4XTPA 2EXHA 3DGTA 3SH3A 3FUQA 1D2SA 4ATEA 1WW5A 3ZXJA 4C1XA 4FP2A 2VUAA 2VH9A 5H9PA 1ENRA 2LALA 2YMZA 1GNHA 4XJZA 1QMJA 1S0DA 2UWBA 2P37A 4XMIA 2JE9A 3UJOA 1AX2A 1DYPA 2W68A 3MEPA 1Q8VA 5GM0A 3LSEA 1LODA 4FPEA 1LU1A 1MS9A 1GLHA 3A0KA 1PZ8A 1JHNA 2PELA 4XTMA 1GZ9A 1MS3A 4M3CB 4XJ9A 1QDOA 4AYUA 4ISRA 4XMAA 2YXSA 3IMNA 4Q8LA 1W6MB 2DTYA 1S0IA 3GALA 4AGGA 1XQNA 4ITCA 1QF3A 3AP9A 3FLPA 2AUYA 3LCPA 2ZZJA 3ZXEA 1KRIA 3LSDA 4XJ8A 2A7AA 2E7QA 1LHWA 2NP0A 2NM1A 3R4UA 5GALA 1ENQA 2D6OX 3AZYA 4DQAA 3SLIA 1AXKA 2ZABA 2ZHKA 5IK5A 1WBLA 4LBQA 1GV9A 2GN7A 5GZFA 1LHUA 1IS3A 5JVVA 5H9SA 2CL2A 3WHTA 3WG1A 2UURA 5IUQA 2WQZC 3WDUA 2R49A 1AZDA 2R0FA 2D6NA 5GLWA 2GNTA 2R1DA 1YXWA 4Z8BA 1DGLA 2Q5TA 1KITA 1QGLA 1Z0HA 2FHRA 2ZA9A 3A0NA 4R9AA 1G9AA 2D3SA 4FOVA 4FPKA 1YO8A 1VLNA 3JU9A 4NO4A 3V0BA 1RINA 2GALA 2VW1A 5DG2A 4CTEA 3WUCA 3T1MA 1MS1A 1BJQA 1W6PA 2VU9A 1UZYA 3AX4A 3ENRA 3QLQA 1MS8A 2ZGLA 4LBLA 1JOJA 2VY0A 4YW1A 1C1FA 1LCLA 5EXOA 4YZ1A 1U0AA 1W0OA 1DYKA 3ZXLA 3ZXKA 1J1TA 1CJPA 2DUOA 4YZ2A 2JD4A 1CPMA 3WNXA 2WLQA 1MZ6A 2RHPA 3AZXA 4GXLA 4M00A 2E7TA 2DU1A 4DS0A 2P34A 4DRRA 4XBLA 1JUIA 3N35A 2WSUA 1GKBA 3ZXFA 3HR9A 1GANA 2V5YA 1PZ9A 4XYXA 4Y20A 2A75A 4ASMB 1UL9A 3N3HA 1OQ1A 4Y26A 1G9BA 3OYWB 1URXA 1H30A 3POYA 4XE9A 3VV1A 2CNAA 2A6ZA 4AVVA 5IK7A 1JN2P 4CZSA 3APBA 4UW6A 5HCAA 2G4IA 4JCKA 2EALA 5T54A 4I30A 2P2KA 3Q9OA 1YRZA 4Y1YA 2AGSA 4M01A 3V65A 3WV6A 2R0HA 1QU0A 4FPGA 1LULA 4WZFA 4U36A 4FPLA 2D3RA 4ZXKA 2DURA 2PHTA 4LBJA 1LEMA 3AYEA 3V0AA 1FAYA 3T1LA 3AJYA 3AYDA 2EF6A 2A6VA 3NV2A 3OGGA 1LHVA 3JUUA 3ZPYA 5H9RA 3W58A 4TYSA 1ULGA 5CB7A 1OKQA 4XIOA 4GA9A 4RA0A 4YW5A 2DVFA 1FV2A 3FUOA 1G9FA 2E6VA 1LEDA 4FPJA 3AXEA 1LOFC 2VW2A 4P9WA 4U2AA 2A6XA 1LGCA 1S0CA 2CTVA 2UU8A 3TAYA 2ARBA 1LOAA 4Y1UA 3PVOA 1WUVA 3R4SA 4Y22B 5GLUA 4BLJA 1DQ0A 2ES3A 1AVBA 4FQ4A 5EYYA 1WLWA 3RMYA 3VKNA 4FPCA 1V6NA 2ZGMA 3M1HA 2D3PA 3NV3A 3SNMA 1IS5A 2EXKA 3NWKA 1N3QA 4ATFA 3GNEA 2CWSA 5JMCA 4XXPA 5GZDA 4BLIA 5JOXA 2OW4A 1S0EA 1RITA 1F31A 2A71A 2Z42A 4F83A 1SACA 4YZ5A 1WBFA 1MS4A 2A3WA 2SBAA 3ILNA 3PVEA 3SH4A 3BOPA 5GLZA 1CQ9A 4M3CF 5SV8A 1FNYA 1SLCA 1ULDA 2WSVA 1A8DA 2YV8A 1DQ5A 1W6NA 2WJSA 3QCWA 4PBOA 5DUVA 5HCFA 3UJQA 1G9DA 4PBPA 2P3KA 1UZZA 2OVUA 2A5ZA 3WCSA 1S0GA 1AX1A 3SITA 1QNWA 1APNA 1PZ7A 2NN8A 3N7LA 4UW5A 1LHNA 1VAVA 2PHXA 3POSA 1CONA 1AX0A 4BPZA 1QKQA 2E53A 4LBMA 1NLSA 3FLRA 1LESA 4SLIA 2UWCA 3USUB 3FFZA 4Y1XA 3WDWA 1CESA 3KQRA 1V6JA 1Y7BA 3WDVA 5T50A 3IKWA 3M3CA 1O4ZA 5JOYA 1HQWA 4FOQA 2C9AA 1VAMA 1CR7A 2BQPA 3RSJA 1C1LA 2ZGQA 1MZ5A 4GWNA 3TB0A 3AK0A 2R1BA 1W6QB 2ZGPA 4YFZA 3B01A 1AJOA 1QNYA 1TEIA 1Q8PA 2D44A 5CAZA 4XBNA 4XJWA 1FV3A 3H0OA 1YIFA 2CYFA 2EIGA 2YROA 4XJUA 4YZ4A 5DXDA 3WVJA 3D6EA 1IOAA 2DVDA 4P14A 5KXBA 3ZSLA 1LJ7A 2PHFA 1R1ZA 1MVEA 1WCSA 2A70A 4UW3A 1GSLA 4M3CA 4YW2A 2CY6A 1QOTA 1W6MA 2P3JA 1KDMA 2HYKA 3INAA 3PMEA 1LOBA 3B9CA 3WG3A 1DFQA 3OY8B 4LBOA 2GNMA 2D6LX 1AXZA 1V6MA 3IPVB 1KJLA 5KXCA 2ARXA 5CBLA 5IK8A 2ZAAA 4DPNA 4FPYA 3HMYA 2JECA 3DUIA 5CNAA 3T2TA 1IKQA 3HN1A 2XB6C 4WVVA 4YGEA 2D6PA 4AVTA 3AZZA 1BQPA 4XJAA 4L8QA 4DFSA 5JOZA 3WG2A 1I3HA 2NMNA 4YZ3A 3WLUA 1W6OB 1C4RA 2E51A 2PHRA 1F9KA 1FX5A 1LGNA 1Q56A 2CWMA 2NYYA 1N1YA 2WNEA 2JKBA 5T5JA 1KJRA 3M3QA 1UPSA 1DHKB 2ERFA 3ASIA 3AP7A 1RIRA 1V6KA 5FRAA 1IS6A 1CVNA 1ULCA 4AWDA 4Q26A 1ULFA 3D5OA 3ZSMA 1DQ6A 1LOEA 4YM1A 1SLBA 1JXNA 3MPPG 4CRQA 5CA6A 2YY1A 1SLLA 4YM0A 2PHWA 2VXRA 4JC1A 1KDKA 2ZHNA 3A4UA 4XBQA 3AXDA 1SBDA 2DVGA 3B00A 4XILA 1G86A 4BQ1A 1ULEA 1DQ1A 3WDTA 5DUUA 1GICA 2ZHLA 1YI7A 3W59A 3WOGA 1N1SA 4Q8KA 2JJ6A 2H0BA 2V73A 1DLLA 2AH2A 1LOCA 2PHUA 5H9QA 1ENSA 1MS5A 4PF5A 2GDFA 5IK4A 5JOWA 1IS4A 4FPHA 1YYNA 2C5DA 2ZGOA 2SLIA 3RMXA 4KBBA 2ZMNA 2B7YA 5GLVA 4GKYA 1GZWB 1A78A 2R16A 3C2UA 3OYWA 1CN1A 1N3OA 2GNDA 1BZWA 4R9DA 4YM2A 2DTWA 5DUWA 4OZXA 1N47A 5HCBA 2GN3A 3WCRA 3VKOA 4YG6A 2AENA 3AJZA 2D6KA 4FP3A 3VKMA 5DG1A 4K21A 5L73A 4Q27A 3RRDA 1W0PA 4C1WA 2LTNA 1HDKA 1A3KA 3IN9A 1UAIA 5IT6A 3WG4A 3O0VA 2EXJA 3O5SA 3O12A 1I1EA 4AGRA 2ZGNA 3AFKA 4YGDA 2ZGRA 2ZHMA 4H55A 3BTAA 3CNAA 2DUPA 4FOYA 4YFWA 1LENA 4NOTA 4XHBA 4YW4A 1SLAA 4WV8A 3IM0A 2A6WA 1JYIA 4Q2FA 1ZM1A 2AYHA 4BMEA 5KXDA 4LBQB 5T55A 4Y22A 3WDYA 2ENRA 3OJBA 4YW3A 1V6LA 3OBTA 4UW4A 1IKPA 4K1ZA 1VALA 3NV4A 1OFSA 4R9CA 1O4YA 3M3OA 3ATGA 4M3CE 1D0HA 3ILRA 1WD4A 2AR6A 4BM8A 2DWRA 4FOWA 3BODA 1LECA 1DIWA 1V6OA 1ZA4A 4YLZA 3I4IA 3KM5A 2WKKA 1Q8SA 3VKFC 2NZ9A 1H9WA 3V0BB 4P9YA 4HANA 4RL7A 4XXAA 1DQ2A 1JYCA 3AZVA
chains in the Genus database with same CATH superfamily
1RXFA 3HEIA 1W6PB 3RYPA 3I49A 1RUF2 4K8RB 3VBRA 4Q4W2 2OXBA 1VIWB 3G7DA 3H3LA 2WT1A 3AKQA 4O61A 5C3SA 4FFIA 2XPJA 1BBT3 1YJLA 2P3IA 3ZN6B 5F9TA 3BALA 1HN0A 1DZQA 5FZLA 3B94A 1MVQA 2V4VA 5GLTA 1H8TA 5K9YA 3PIGA 1HV0A 3RZZA 3ACLA 4I09A 2IVIB 3SH5A 1N1VA 2VULA 3PJQA 1VE0A 4PQ9A 5T52A 3JD72 2RR13 1C8M1 4BQ2A 2D5HA 2BGOA 1HQNA 5LATA 5FZHA 3TRSB 4CCNA 3AYCA 4D7YA 2ZMKA 4G4FA 4MZUA 2D7FA 4XDOA 3SISA 4NRPA 3M3EA 3VD4A 3CEWA 1OH3A 5LEJA 1NCQB 3GDBA 4G3YC 1MS0A 2GC1A 1OURA 5L7OB 5EWSA 3TNQA 5F1RA 4FVVA 2GMMA 4XUNA 3N7KA 5T5OA 3RJ2X 1RXGA 2JG9B 5A80A 1IG0A 1SZBA 2QQMA 3NAPA 5L36A 1R64A 2WNOA 5CIRA 2XBO2 4DNYA 2K2SA 1S0FA 1S55A 4YVSA 3GF6A 1C3HA 2DF7A 4IGPA 4YRDA 3C8XA 4HL0A 1F5FA 4QXHA 1SFYA 5SV5A 5FYYA 3WQ7A 2HWB2 1W2AX 3T2OA 1CPNA 1FMD1 2OQ7A 1RUE3 3GZUC 4XF1A 4MV2A 2QQIA 2OQ6A 4IGQA 4IE7A 3C3VA 5FK8A 4XZUG 4YGCA 2Z69A 4LK7A 1RHI3 1FATA 1S0BA 2VCCA 2BWCA 2G1MA 2XKOA 3IIIA 1B35A 2BUKA 4I0BA 3ZFGA 2ZGUA 1AL21 4MGKE 4N43B 2JDKA 2A3YA 5FYCA 1BYHA 4D69A 1SLIA 3I8TA 5AC93 3N4MA 2ID4A 3ZKYA 5A3NA 4WVMB 3T2QA 1UZWA 4NIDA 4WVWA 3OB8A 4C0BA 1UKRA 3BU0A 1QEXA 1UMZA 2D97A 3NJXA 2ZKNA 3ZFFC 4ES9A 1AR61 1N1TA 1J84A 2JE7A 2ZXQA 3DYOA 1AF9A 1V00A 1WLCA 4E4HA 5EJ3A 2GMEA 2VNGA 2ZCWA 2QQWA 3AZWA 5IVYA 2YGLA 5A3UA 5CG9A 2YU1A 1DGRA 3NW4A 3WX5A 3LEKA 4QPIC 3KVBA 3I2OA 2P6CA 2JG8B 4Q4X2 2O0OA 3VD7A 4IXLA 4RS5B 4FQZA 3R05A 2E32A 2QZ3A 2DYCA 1CIWA 1JTZX 3MF6A 1UKGA 2UWAA 3LDRA 1OVSA 5C9AA 1QJY3 3RG0A 1X50A 5A7PA 4COWA 4EQVA 1W06A 2Z5WA 1L3JA 3EQEA 3FHQA 1O3RA 1AR71 1N3PA 3GHNA 2ARCA 1PNFA 2PN5A 2JICA 2QVSB 2CU5A 4MADA 4XDQA 3NV1A 5JXJA 5FO9B 1UZVA 1XNDA 1SCSA 3H3ZA 3K4AA 1OOPA 1POQA 4CDXB 5KHIA 2OPWA 3KCXA 4AAPA 4LK6A 5H9PA 4E27A 1ASJ2 2YMZA 1GNHA 1OI6A 1D4M2 2Q30A 2XLGA 4LIVA 3S7IA 2XBO1 4NHKA 1S4CA 3GJAA 4XQ4A 5LASA 3O1SA 1W2UA 1QJFA 1VBC1 5GM0A 1G9CA 4UF0B 3LSEA 4FPEA 4IE0A 4XTMA 1OFNA 1GLHA 2XHKA 3POBA 1JHNA 5JIAA 4BQ5A 5J36A 4L11A 2HWB1 4CU9A 4CUAA 1GR3A 4XJ9A 1AR81 2RM22 3IMNA 3DPRC 2FDJA 3LAGA 4Q8LA 4WM7B 3J7NA 1LKNA 4JKLA 5A7OA 4E4ZA 3J4UH 2V5DA 4D7TA 3H42B 1QH6A 1ST8A 3I2JA 3WQBA 4C91A 4GH4C 2AUYA 3LCPA 1NA1A 2ZZJA 3RYRA 5EFUA 1K3IA 1JOBA 4R4XA 4CDWA 1LHWA 4AVCA 4CCCA 1OVPA 2D6OX 3OEAA 4DQAA 1PVC2 3TOJA 1UYZA 1W8UA 1OA2A 4LBQA 4Q4V1 4AZZA 4WM8A 3S57A 3MDPA 2WC2A 1YQCA 2BNMA 2W46A 1NE6A 1O91A 2QZ2A 4ONUA 3MPBA 3WG1A 2XJQA 1HRI3 5IUQA 1AZDA 1KFXL 2R0FA 4QPGB 2GNTA 1BEV3 2JE8A 5FPAA 5KBFA 1ZREA 3PU8A 3BTXA 2VZRA 2ZA9A 2J7MA 1X7NA 5FUPA 1G9AA 1FOD3 4FOVA 2ZX2A 5F3IA 1VLNA 5FMOL 3JU9A 4NO4A 4RFRB 1RINA 5FDBA 2MEV3 4Z07A 2J1TA 4Q4X1 1Y9MA 3WSOA 4D7SA 4CTEA 5A6QA 4A7YA 3WUCA 4IUGA 3T1MA 2QUOA 2XJRA 4CCKA 2Y6LA 4K7JA 1ZBE2 2VUCA 4KU8A 5FMDA 4JGZA 1H8TC 1PMIA 1LCLA 4DB5A 3BTZA 4QQOA 2V72A 5HBAA 2BVBA 1COV3 1QXRA 4EWEA 2VMIA 5EXOA 1W0OA 2RS52 1QWRA 5CFCB 1ULOA 2DUOA 3MO4A 2HKXA 3NNGA 5FK7A 1L7RA 3UV9A 1CPMA 4BE3A 3LEMA 2RHPA 2HWF2 3ACHA 3AZXA 3PUSA 4AXOA 4GXLA 1RUNA 2QQPA 4DS0A 1XYPA 2DU1A 1QJX3 1QQP2 3CJXA 4XBLA 1OQDA 2WSUA 5C8WA 1JYTA 4P08A 1D4M1 3WP5A 4XYXA 1PZ9A 3KCYA 2WS93 5IVVA 4NIIA 1G9BA 3FHIB 5C8CB 1OH4A 3VBSB 2WR9A 1JN2P 1JYVA 1UY1A 2P4EA 2YG0A 4PIZA 1Z7S2 5HXMA 3NAPC 3J26N 3C7OA 4TXWA 1CAVA 3OEBA 3TNPB 2P2KA 3L2HA 2VQUA 4YVSC 5ABJA 4UBGA 2QNKA 3V65A 4KU7A 3WV6A 1QXPA 4CP9B 5C6CA 4NHXA 2RJKA 4MGQA 2DFCA 2ZPXA 1MQTB 2D3RA 1GZTA 1DGWA 1HRV3 3AMNA 4I01A 3ZYFA 4CDUA 3TEWA 2PHTA 1EP0A 1LEMA 4LBJA 3VD3A 4P9LA 3AYDA 3P3NA 3NV2A 2VAUA 3RYKA 3E5UA 1B35C 3PMSA 3SHRA 1NLQA 1OKQA 5IVJA 2XJSA 2VECA 1QJU2 4HZFA 1FV2A 3FUOA 1G9FA 3CKHA 3MYXA 4YNIA 2E6VA 3LD8A 5A7WB 3AXEA 3FX3A 1PM4A 1HXS2 2BJSA 3I3DA 5FY5A 4AW7A 2HWC1 2WZ8A 4XF4A 1LOAA 3MUZ1 1ZZCA 4Y1UA 4OI0A 3LB9A 1WUVA 3R4SA 4Y22B 5LA9A 5FXWA 4QKBA 4BLJA 1DQ0A 4XFHA 2B46X 3WD5A 1OSGA 2XL9A 1WLWA 5F3GA 4HVOA 1CZTA 2ZGMA 3B7MA 3M1HA 3NV3A 1H1AA 1MZFA 3NJYA 1N3QA 2VNRA 1AYN1 5DAXA 1J58A 1VMFA 4IE5A 3CO2A 3IB3A 4I02A 4TLGA 4YW7A 3IMMA 2VE1A 3AKTA 1WGPA 2DCJA 4Y4YA 3Q8AA 4YZ5A 2CV6A 5J96B 3PVEA 3UGGA 3ILNA 4YARA 3I3MA 4QMAA 3SH4A 3RFRA 1U5YA 2XQRA 2HWD2 5GLZA 5A32A 1J3PA 1CAUB 3CQOA 4QX3A 5SV8A 1FNYA 2RS51 1A8DA 4QXCA 4PHZA 1UO9A 1O8SA 1TME1 1AHSA 1BBT2 4LKDA 2VZTA 2HWF1 2A5ZA 3SITA 3G6JB 3HOBA 5C4WA 4ORFA 3O1UA 3POSA 3PVBB 5FWJA 1CONA 5FV3A 5FZ6A 4JX0A 5CYYA 5I8SA 1NLSA 3FLRA 4W50A 2WAAA 5CFDA 1W9TA 4Y1XA 5E1RA 4ASKA 1PO21 1W0NA 2JDHA 3ZM8A 1SDWA 1RUJ3 2RR12 4CEWB 5CEHA 1HQWA 2WZR3 2ZGQA 3TB0A 4GWNA 1W6QB 2OZ6A 3PJYA 4C0HA 4UXAA 1QNYA 5J48A 3CMGA 1WMEA 5CAZA 2BOJA 1EV13 4XFBA 1JZ5A 2VPVA 1US2A 1W3VA 1IOAA 2DVDA 3OOXA 3P5BA 3PTRB 4N53B 4QXKA 4RSUA 5A7SA 3EO6A 3URFA 1JU4A 3BPZA 3M4FA 3E6BA 1MVEA 4AEKA 2A70A 1NCRB 2BERA 2F17A 3RI9A 3HNMA 4MVTA 2H6CA 1SMVA 2HJIA 5L19A 1CGPA 4DUXA 1KDMA 1RMU1 5FR3A 1DG6A 2O8OA 3WF0A 1NA1C 4XDPA 4A44A 3B9CA 3WG3A 4BQ3A 4CCJA 1RUE2 4CDWC 2B39A 1AXZA 2VGDA 3IPVB 3J7LA 2Q8CA 1KJLA 5FLHA 3NRUA 2VTFA 5C33A 3NNLA 1HXS1 3VBFB 1ZVFA 4RGAA 2HBUA 2JECA 1RHI2 5A6YA 4WM8C 1ZBA1 1PHMA 3T2TA 3ZPOA 1F4AA 1JZ6A 2E31A 3ALQA 3A7QA 4IERA 1TZOA 2GAUA 4NAOA 4NHMA 1W3XA 3C7HA 4NUBA 2VQAA 4QT6A 4DFSA 3MLJA 5AC92 1QJEA 5FYMA 3FHAA 2NMNA 4YZ3A 1PO13 3HNYM 4J6GA 3LFMA 5IFPA 4ZHNA 2ORZA 3WP6A 2PHRA 1MEC2 4R4ZA 3U78A 4COYA 1F9KA 3HVDA 1FX5A 4E4SA 1N1YA 5T5JA 2JKBA 3M3QA 1UPSA 2HWD1 4JZRA 3AC0A 1PM7A 3AFGA 3DL3A 5HPOA 1V6KA 2QBXA 5FRAA 4HK8A 1CVNA 1W04A 3VBOB 2C1FA 4YM1A 2Q8DA 4JGZC 1SLBA 1OPOA 2IXCA 4QQPA 1SLLA 2PHWA 1VBE1 3AXDA 3IAQA 2VMGA 4BQXA 3GBFA 5EJZB 1G86A 1QJY2 2VCBA 3LPGA 5LCWL 3JB4C 4GMP3 3O1VA 2AZ5A 2JDYA 4RHV3 3JZVA 3OBZA 5LBBA 4MGYE 4QX5A 4XUTA 4DXZA 1J59A 2V73A 5I0DA 2CGOA 3J8F1 3KLSA 3DECA 2UYBA 4N7UA 1H2LA 4KBBA 1RC6A 2B7YA 4P9GA 2J42A 1GZWB 1A78A 1VB4A 2JDNA 1RUI3 2R16A 3C2UA 3OYWA 4COVA 1PMHX 4CP1A 4AI8A 3DYMA 1F35A 1BZWA 4XUQA 4CU6A 5DUWA 3KHBA 4NPLA 5ABJC 3VKOA 1HB2A 4YG6A 4UFIA 4UWDA 2YDEA 2JD9A 2D6KA 5DG1A 4K21A 5BNNA 5L73A 5JXIA 2IWGB 1YIPA 3JBG1 1VRH1 1ODMA 3LEGA 1XOYA 1HDKA 2WFF3 4CDUC 4CP0A 5JSRA 5CG8A 4AFAA 1OHFA 1UAIA 1XXNA 3HBKA 1CIYA 1GWLA 2EXJA 3O5SA 4AGRA 2VMHA 1D2QA 4JHTA 4HPKB 1F15A 2HWE3 5EPAA 3J9SA 4NHYA 1C5HA 1BK1A 3T0DA 3TYJA 1XSQA 3IM0A 3HT1A 3K4DA 5FXVA 4B4PA 1NQDA 3GCXA 1MEC1 1ZM1A 3P3PA 2IXIA 2X53S 2XVGA 3ACGA 2X5IC 5FPXA 1HRI2 3IT8A 4O65A 4BQ4A 1VBA1 1V6LA 2Q0AA 3CJIA 2DBNA 4QGNA 3OG2A 3THTA 2C0ZA 1BEV2 2IXHA 4W6XA 5JCTA 1GWMA 2P17A 3WW1A 1DCSA 4CDQB 3PUAA 5FXXA 1D0HA 1FOD2 2D5FA 3ILRA 3MICA 4RR3B 1UU4A 2WL1A 1LECA 1V6OA 3BODA 1KEXA 2MEV2 3H1MA 3LEIA 3I4IA 3KM5A 4PDWC 2GC2A 4RN5A 1W2NA 1W9WA 2XL7A 2WFPA 4HBNA 5D8AA 2GH8A 4XXAA 3KV6A 1DQ2A 1JYCA 4A45A 2JEMA 5C4WC 1TNRA 3O1PA 1Y43B 5DZFA 3WZ1A 5APAA 1RVF1 4KWKA 3UK9A 5CFDC 2F6BA 2VZUA 2BOIA 3ZYHA 1GZCA 2Z2SB 1FI2A 5GJ6A 1LOGA 1LTEA 2QQKA 5F37A 5GZGA 2RS13 3U4XA 2E9QA 3USUA 4BK4A 5C3QA 4HKWA 4BOWA 1SCRA 4NPMA 2R6QA 4KMQA 1UN1A 2IC1A 1O3TA 2Y6HA 1QJX2 1WW6A 5FZ1A 4NN0A 4K1YA 4BYYA 5K0UB 4MHUA 2WS92 4Q1RA 3UL2A 4IQPA 4IV3B 3EHKA 4IEPA 4CEYC 1Q8OA 1RTVA 3AKRA 4EN9B 3PNAA 1GYKA 4NMIA 4Y20B 4ES8A 3U75A 5I93A 4NIHA 3GGLA 5FZOB 3GM8A 1LAJA 1IQDC 3FLTA 2W08A 1AYM1 4UOJA 4AEDB 1BXHA 1V70A 2JDUA 3VBUA 4QX2A 5E8AA 3ZFFB 1LU2A 3OBRA 1A34A 3MFCA 3KT4A 3ZSJA 1OC1A 4IGOA 3JXSA 3N36A 2RS31 2WZPP 1HRV2 5LK5A 1NZCA 2WINB 2WT0A 1RUC3 2JIJA 3OY8A 4WVZA 2ZBJA 1RJ8A 4QPIB 3DN7A 3BN6A 5A70A 3V0AB 4Q1PA 1Q3EA 2WQ4A 4UAPA 2IVJA 1WD3A 3NQHA 1SPPB 4ISQA 5EQUA 3CZJA 3MFAA 4P5YA 4KL1A 3THPA 3WDXA 3H8XA 4Y24A 3RZHA 4LHNA 4AFMA 4PCRA 4K8FA 4BQWA 4X8PA 2I07B 5FJKA 3LIGA 5FYIA 1UQXA 2BNOA 2W39A 3IDCB 3RPQA 4GALA 1HKDA 3KSCA 2JDZA 4YYOA 2VNVA 2C26A 2VVDA 2UY8A 3I7DA 1Y9GA 2QFEA 3K4ZA 3B93A 3KMHA 1BVVA 1NXD1 2FDHA 3O0WA 2W5FA 3NJZA 2DDUA 2EAKA 5DZGA 4B7KA 5JDBA 3D3AA 1SBFA 5FUNA 4QGLA 2E33A 4AI0A 5C3PA 3OPTA 1ZNPA 4P9XA 2VBDA 3GZAA 5LY1A 2QE3A 3Q8EA 3S0MA 1Z78A 2VCMA 3SMHA 2A3XA 1W8FA 5ACA3 3KV4A 4Y1ZA 3ZFEC 3WP3A 4LTAA 5FWEA 4OUSA 3POWA 3WEZA 1DBNA 3VD5A 4B29A 4IEQA 5F2WA 1KXGA 1G8WA 3BIWE 3CF6E 3DPRB 3D4KA 5BNPC 5TSWA 2PLV3 4K20A 1C57A 1X33A 4QX8A 4GKXA 2Q8OA 4RYDA 1VBB3 5C3RA 5FPBA 5JLVA 1XE7A 3HWJA 4GH4B 4YPJA 1RUJ2 1EY2A 4J1XA 3BGAA 2DVAA 2WIIB 4Y1VA 3RZMA 2WO3A 2ZMLA 3GXUA 2XWJB 5BNOB 2WT2A 3ST7A 5HI0A 4FXKB 2W1WA 2DVBA 3TN91 5E89A 3WHUA 1QDCA 1VJ2A 4NVPA 4JKKA 5F5AA 2DCTA 2A6YA 2ZKLA 4XTPA 2P6HA 3DGTA 3SH3A 3FUQA 4ATEA 4FSJA 3ZXJA 2PQQA 1UMIA 1EV12 1RUH3 3TEZA 2VH9A 3Q8FA 1NX9A 3ITQA 1GP5A 5E16A 3I59A 1I9RA 4XJZA 1GWKA 1O8PA 4QQ2A 3VDDC 1PX4A 1AX2A 4GIQA 3MEPA 5HXVA 1Q8VA 3POJA 4HSJA 4R9CA 1U5IA 1MS9A 1NQJA 4NIGA 2PELA 1ZRDA 1MS3A 4MG2A 4AYUA 3KV9A 5A7QA 3JQWA 3NNJA 4XMAA 5EIYB 1UW8A 1W6MB 1XE8A 2CDOA 4QD2A 3AMPA 4OHVA 5CADA 2GP5A 4ITCA 1TNFA 4O9GA 3AP9A 2QKDA 4QPYA 3ZOIA 1ND2A 1KRIA 2E7QA 2NP0A 3POIA 5GALA 3MBWA 4LLFA 3AZYA 4JQTA 2ZABA 2Y8KA 5IK5A 5GZFA 1PO12 3KS7A 2KA3A 4QU2A 3VLBB 1IS3A 2W0XA 1RUG1 4JGYC 4BISA 2CL2A 4JTNA 2DFBA 4Z2WA 4UYBA 2WQZC 3WDUA 4CA9A 3NJVA 2R49A 3KV5A 5JI7A 5ERLA 1UNBA 2GC0A 5CKQA 1DGLA 2QQNA 1QGLA 3FL7A 4Z8BA 2DBIA 3A0NA 3AVRA 1FPN3 2WNVA 2D3SA 5AFBA 2HBTA 3V0BA 2GALA 2R041 1PK6A 5D21A 2DCZA 1T6BX 4BU2A 3A21A 1W39A 1RUD3 1W6PA 2BVVA 3AX4A 1UZYA 1R083 3QOPA 2BZDA 2J1VA 3QLQA 2ZGLA 4XACA 1EAH1 1JOJA 5A6XA 1OD5A 3ZN6A 2J22A 4LPLA 1C1FA 5BNQA 5FTTC 1IPKA 1W8TA 4HFSA 1ND3C 3HJRA 4RHV2 2XOMA 4IV1B 4OUMA 4CCEA 1J1TA 1CJPA 1HB4A 1SEFA 1UIKA 3NL1A 4YZ2A 4M00A 2YU2A 2Y6JA 3DXTA 3KF3A 3T0BA 1K5MB 1RUI2 1VRBA 3HR9A 2WYFA 4D94A 1GANA 1H8VA 5KHHA 5LK7B 5J7MA 1UL9A 3N3HA 1OQ1A 4Y26A 5A3LA 1GOGA 4AEJA 2RDSA 3VV1A 1NCQA 5L7OA 2A6ZA 1UXZA 1RL3A 5IK7A 4AHYA 4CZSA 3APBA 1SQ4A 3CL1A 1TVGA 2WNUB 2HEVF 4GB33 3VZMA 2JG9A 1L7LA 4X6RB 1PIV3 1XNAA 1GFF2 1XU1A 2WFF2 3I2GA 4N90A 3RNSA 2FDIA 5JUVA 2FQPA 3MGUA 4MX3A 2LROA 2YFUA 1XSRA 1POV3 1ACCA 2OPKA 2CGPA 3T4HB 3IWZA 2ZX3A 1GNYA 1REFA 1RUF1 3LGRA 4Q4W1 2DURA 2WWJA 1XNTA 5FZ8A 2XJPA 1JYNA 1FAYA 3H9AA 4O7XA 2MNGA 3CIHA 3OGGA 4V1PA 1LHVA 3JUUA 1K12A 3PUIA 3W58A 4UFKA 2UYAA 2QQJA 5AVPA 5CB7A 1KS5A 3D82A 2JIGA 2WABA 2YBKA 1O5UA 2HEWF 3FN9A 4LNVA 5FZMA 5JI9A 1EYBA 5FQ0B 5K4LA 3JD71 2VW2A 4BZ4A 3BUCA 3TAYA 5JZGB 4N43A 4ZS3A 2R062 2EAAA 2VMCA 2QQLA 2VTXA 1UXXX 4NWWA 3O1RA 4WVMA 1UYXA 5EYYA 2LRPA 1AVBA 5G04L 4DOUA 4CSWA 3RMYA 2XQXA 4FPCA 4AQTA 4QKDA 4UBHA 3SNMA 1W8ZA 5B4XA 1GU3A 1U5XA 3SKVA 5JMCA 4XXPA 1J3RA 4BLIA 2OW4A 2VC9A 1F31A 3PURA 1YQ2A 2VVEA 2YYOA 4RD7A 1JI6A 1BCXA 1AL0G 2A3WA 1O3SA 2WWSA 3BOPA 4Y4RA 5DAVA 1SLCA 4WVVA 2WSVA 4BJ0A 1WLTA 1WMFA 2WJSA 2JG8A 1Q5OA 3P1IA 3UJQA 4RS5A 4DY3A 4PBPA 5FZ7A 2P3KA 4FBFA 3WCSA 3GZTB 3KCCA 1S0GA 1AX1A 2RS12 1QNWA 1APNA 5F8PA 5FMOS 4UW5A 5L9BA 3I2KA 5DAPA 4EV0A 4MSVA 1HX6A 2LW8A 2UWCA 3FFZA 1CESA 2VUJA 2XJUA 3MV01 4B8EA 1GQGA 2R073 3SC7X 3WDVA 1GOFA 4AQSA 1HN1A 5F5IA 4E9KA 2F4PA 3GHMA 2BQPA 1XNBA 5T3NA 2V4AA 1MZ5A 2FDGA 5C70A 2ZGPA 4CDXA 4YFZA 3B01A 3HAGA 3MV11 5BXXA 1AJOA 1DF0A 5JPMB 4P02B 2WFF1 4PLNA 4XJWA 1BHGA 1NAEA 3WF1A 1W90A 3POGA 1FXZA 1NOVA 2YROA 3KF5A 1XNCA 4YZ4A 5DXDA 1NZIA 4YW6A 4MGTA 3D6EA 1DZRA 5KXBA 3QBQA 3KVAA 4UF0A 5F3EA 1IPJA 2FCTA 4LIUA 4NAMA 4FFGA 5ANQA 1R1ZA 5I91A 3U0ZA 3UETA 4OCTA 4XFIA 1RUC2 3H8OA 5IJRA 4LO8A 4MUVA 4AOCA 4WM7A 5EZWA 5JMOA 3INAA 1EUUA 3VBRC 3I97A 1X9PA 2GNMA 1VMJA 1R093 2WQ8A 1J3QA 3LQCA 4XEZA 4XUOA 3KHCA 4OI1A 3T08A 4ARXA 2ARXA 3N9LA 3ZYBA 3E1F1 3U10A 2BBVA 2VMEA 2FBEA 3HMYA 2R061 1JH5A 3THCA 3LA3A 1Y9QA 5ANNA 5JPNB 1IKQA 4UI9L 5FKCA 4YGEA 4EN0A 4LKFA 4AVTA 2J1RA 2OT7A 4XJAA 3OD4A 3POFA 5JOZA 1I3HA 3ZMNA 4GMP0 4L97A 2CAUA 4NPRA 4KH9A 3USSA 4E8DA 5FLIA 1W6OB 2JDMA 2XLAA 3E6DA 4E2GA 2BBAA 4XCBA 1ASJ1 2VR4A 4QPGA 4A6OA 5DDJ2 4B1LA 4D6QA 4A41A 4URTA 5A1LA 1KJRA 1PK6C 3BI3A 3I54A 1W8WA 3AP7A 4FTSA 5ACA2 1AR93 2WN2A 4YVWB 1DQ6A 4PI0A 2Q1FA 5FY9A 2JDAA 2ET7A 5FZ4A 1CAWB 3VDAA 4L2NA 4BH9A 2RM21 5FP9A 2YHJA 3R6SA 2P3YA 3W9AA 3A4UA 3RGBA 2GSYA 4W6WA 2PLV2 2I45A 4IEYA 1SBDA 4I0AA 3B00A 1VBB2 1W9FA 4GJYA 4QPWA 3ZYIB 2Z4FA 1ULEA 2OA2A 4G9SB 5FPZA 4A3ZA 4K6BA 1GICA 1YLLA 2ZHLA 1YI7A 3B5LB 5CFCA 1J83A 3KGLA 2J1AA 3AKPA 5FZ9A 4Q8KA 2JJ6A 1ZRCA 1YQ5A 1OXCA 1PVC1 1DLLA 3EYPA 2PHUA 3JQXA 5H9QA 4OHWA 1MS5A 5J09A 2GDFA 5IK4A 4H2AA 3RMXA 3O1OA 1V9U3 4Y5TA 2RMU3 3ZFGC 5L7OC 2X5IB 2W91A 1UIJA 4MXWB 1P8JA 1C5IA 1RUH2 4JTOA 3AMHA 5C8CA 3VBSA 1CN1A 4IEUA 2GNDA 2Y0IA 4UT5A 4Q0VA 4IEWA 4YM2A 2F4LA 3EJKA 4I2OA 2DTWA 4OZXA 4CE8A 1N47A 2VZVA 3WCRA 2W47A 4LJHA 1TMF3 2JWPA 3U07A 4RQPB 4KGQA 3RRDA 4CP9A 4PDWB 2VMFA 4QX0A 5EJ1B 4JDNA 5I8TA 1MQTA 1VBD3 2NPIA 4XC9A 2B9VA 3WG4A 4OVEA 2BV4A 1I1EA 2EA7A 3S5AA 2ADEA 4QX7A 1ZBE1 3AFKA 4YGDA 3UKTA 4AHWA 4KWLA 5CKMA 2IZWA 3B9IA 3CNAA 3BTAA 2P5BA 1YFWA 1D4VB 3BYWA 3GYDA 3VBHB 4FOYA 3BIEA 5LZ6A 3H8UA 5C9AC 5LBEA 1UY4A 4N43C 1KFUL 5A7WA 3SXWA 1JYIA 4FAHA 3PUQA 4YSFA 3HNBM 5EV7A 1QQP1 4LUKA 2Y26A 5DDJ1 5T55A 4V2VA 4Y22A 2ZEZA 5FY4A 4ZXEA 2C9KA 2ZX4A 3HPNA 4H14A 2BU9A 4MO3M 1OOPC 1C8M3 3KWVA 4YW3A 4CEYB 1XB9A 2RJ2A 2X8KA 3B02A 3SCFA 2IUWA 3M7AA 4J1WA 2RVAA 2CAVA 3M3OA 3LA2A 1Z7S1 1W03A 1FPN2 4M3CE 4N8MA 2XR4A 3VZOA 4FTEA 2VM9A 4BM8A 1DIWA 5F6KA 4YLZA 4EYUA 5IVFA 2WKKA 1Q8SA 3IDEA 1RUD2 4CU7A 2CHHA 3VDCA 1C28A 4XABA 1UU6A 5FY0A 1CAUA 1R082 4D8MA 4RGGA 1NY72 4NWVA 5LW9A 1J1LA 4GWMA 5JWPA 5J1XA 2X05A 3O0XA 1GUIA 2W95A 3H7JA 3L2YA 3FE5A 1YNAA 4FT8A 5C7GA 4DRVA 3ACFA 5FZEA 3WUDA 3WNNA 1LB2A 2ZACA 3H1WA 2OUJA 3MIDA 4MLOA 1QJU1 4XURA 5FZAA 1FMD3 4CEWA 4P9IA 4AGVA 4KBZA 4QQHA 1H6YA 2H6BA 3U11A 4WZCA 4ZU7A 1W6QA 2G9ZA 4YG0A 2VBBA 4LHKA 2ZEYA 4URAA 2PXJA 1CAXB 1S1AA 2CSGA 5HV4A 4K40A 5KHGA 2YZ4A 4XCAA 2DU0A 1OBNA 4AFBA 1AL23 1U12A 2VUDA 2BWAA 1OD3A 4IEZA 2OKXA 3ROUA 3AL6A 1STMA 2TBVA 4IETA 3RQ0A 2VL4A 4N53A 2W52A 5CKNA 4HOOA 1PIV2 2VW0A 3QH6A 4FPFA 2DV9A 1I5PA 1NCRA 1PMJX 2VNOA 1YI9A 4AQ6A 1AR63 3DXUA 3AP5A 2Y38A 4L99A 4AK3A 3LWCA 4CUGA 1WMDA 4TTGA 3I3QA 3ZVXA 3OGVA 3ZFEB 1BBT1 4YG3A 4R9BA 1W2OA 3N9MA 3IPVA 1ZRFA 3T2PA 1GP6A 5DZEA 3VBFA 5BNPB 3E97A 4PLOA 4BXFA 2ZAHA 5KHJA 2RR11 1UZ0A 2BPA2 1QY4A 4J25A 1HLCA 5DAQA 4CYDA 4LBQD 4IE6A 3ES1A 4AEMA 4BHPA 4QPGC 3MW2A 2CGNA 1V6IA 1AR73 1LHOA 5I0TA 4ZKTB 2W9XA 3MIGA 3I2HA 3AMMA 1LOFA 4X6QB 3NSTA 5FYSA 3L9JT 2KXLA 3O7OA 1LGBA 4Z1VA 5A7NA 1Q8QA 4FCAA 4XHXA 2PHDA 1H9PA 3ILFA 2FMYA 3C7GA 5LA0A 3NKTA 4LE3A 3CBNA 2XKPA 1JBCA 2FMDA 3VDDB 3ZN4A 5LB6A 3VL9A 2EXIA 3M3IA 4IESA 4BXSV 3PVNA 1E57A 1XBFA 2XBO3 4QAWA 1MR5A 1ZA7A 2NMOA 2ZGTA 3VBOA 4P5HA 5IHRA 1VBC3 1AUYA 5F5QA 2QDRA 4FXGB 5GKAC 4JRAA 1SFPA 5CFCC 2XG3A 4XZPA 2HWB3 2DUQA 1E5IA 1RUE1 1KQRA 1W6NB 4PIXA 2EIEA 1AR83 5AVAA 5BPXA 5FPLA 3MIEA 5GZEA 4EZ4A 1ZRRA 5DUXA 4HT1T 4NRMA 1RHI1 1DU3D 2R072 3ACIA 3VUOA 4CXYA 1W9YA 1SLTA 5BY5A 2E7AA 1GBGA 3FMGA 5J98B 1DGWX 3U14A 1M4WA 2GMPA 1DYOA 1FNZA 5FZCA 1BK0A 5C8CC 3V64A 5AC91 1GZWA 3AKSA 4KG8A 5JXGA 1JZ2A 3VKLA 2FCVA 2ZX0A 1D7PM 2BYVE 1SG3A 4JGYB 4Q4V3 4DY5A 2Q8EA 1WW5A 5A3MA 1K42A 4C1XA 3ES4A 4FP2A 3WNPA 2VUAA 3ZIXA 3PL0A 4Y33A 4AE2A 1ENRA 1S0DA 1UOGA 2P37A 2UWBA 1JZ3A 1V0AA 4DEVA 4H7MA 2RDNA 5FZFA 3ZX7A 2W68A 3HN3A 5DAWA 3ZLIA 1LODA 3RWNA 1LU1A 2GC3A 5EP9A 3LOBA 5FYUA 5FBJA 2QTWB 4M3CB 1JOPA 3SEEA 4EWAA 4ISRA 2YXSA 5IAXA 3O14A 3MIFA 2DTYA 4HPKA 4QU1A 4IDZA 4ZPIA 5FZGA 3RDIA 4LE4A 4OI2A 1QJY1 4DIQA 3FBMA 5F7UA 4HK9A 1CX1A 4AF9A 1ND3B 3HQXA 4XAEA 3ZXEA 3HIFA 3LSDA 1COV2 1LNSA 2EIBA 2A7AA 5FMBA 3KT1A 2J1EA 5A33B 2QQVA 3R4UA 5FYZA 1ENQA 2H0VA 2ZHKA 2TUNA 4D6RA 3LF7A 3S7EA 4B4RA 1OF4A 2V09A 4XQDA 2WDBA 4HKLA 5JVVA 1ULPA 3J7HA 4O9EA 2IXLA 3D0JA 5FO8B 3A23A 3WHTA 1E5HA 1CZVA 1RB8G 1D4M3 2EIDA 4NRQA 4CDQA 2D6NA 3H3UA 2GZWA 2R1DA 5IWFA 3CZUA 4LUMA 4RR3A 2Q5TA 1KITA 2PAKA 3UYJA 1DP0A 5FOBB 4YWAA 1ALYA 1X8EA 1ZX5A 2NLRA 4R9AA 3UNPA 2ET1A 2PTMA 2VVFA 1NUKA 3MF9A 4OHXA 3AMQA 1XRUA 4R8HA 3OF1A 4Y5Z0 3ZXAC 3ETPA 3K51A 4QDSA 2HH9A 1OUXA 2VU9A 3ENRA 3GBWA 4UFHA 3ZIWA 2W92A 4CP2A 1R1A3 4AVBA 2ZOEB 4LBLA 4HVQA 2VY0A 3I3BA 4YW1A 1ZZ9A 4CEWC 1YQ6A 1U0AA 2WA3A 1UU5A 2JD4A 2VZOA 1POV0 2EVXA 4AL9A 2WLQA 2G9GA 1MZ6A 4B4QA 1HB3A 5IW0A 5A1FA 1V9U2 3R0RA 1VP6A 2E7TA 2RMU2 5K0UA 2P34A 3OSDA 4DRRA 2C4XA 4IV3A 1G6NA 1X9TA 1HRI1 1JUIA 1GKBA 1W05A 4HN0A 5DMYA 4NE9A 2JKXA 1CX4A 1UOBA 1XPWA 2BDRA 3DYPA 4Y20A 4N53C 2A75A 1BEV1 1NLRA 2HWC3 2VCAA 5FZOA 1URXA 1H30A 2RDRA 2AACA 5CU1A 2TNFA 4AEDA 1I6XA 4AVVA 2B4KA 1TMF2 4CUCA 1NCRC 1FOD1 5HCAA 5K8SA 3ZFFA 1UOJA 3KQ4B 4LHSA 2MEV1 2EALA 4FFFA 5T54A 3ORJA 3Q9OA 4CXXA 1AYN3 3C7FA 2L9LA 2AGSA 1VBD2 4M01A 4XPVA 5D2AA 1IG3A 2XUEA 5I0RA 2R0HA 1QU0A 3WY6A 4N7IA 5FYVA 3K3OA 1DLCA 4NROA 4PLMA 4QPIA 3VBFC 1COV1 2QDNA 1JHJA 1WA4A 3V0AA 2RS53 2VZPA 3TEXA 4EZHA 2BGPA 2EF6A 2IXKA 3I2DA 4JRLA 5HV0A 1TME3 4A3XA 1SPPA 5H9RA 4N9HA 2HWF3 2XONA 4TYSA 4E2SA 5FYTA 1JS9A 4YW5A 4Q4Y3 1QJX1 3EB7A 4HKOA 4BDVB 2WA4A 1W8HA 5C5UA 4D0QA 1LOFC 4P9WA 3UGFA 2LM3A 2A6XA 1PO23 2WS91 1D0GA 2ARAA 2ARBA 1C8M2 2A73B 3WQ1A 5JAXA 1YQ8A 3PVOA 2WZR2 3M8LA 2ES3A 4E2QA 2VZ1A 5A3WA 4ZS2A 1BLZA 5F5CA 2EXKA 4ATFA 3OTFA 2CWSA 4E4DX 4KI5M 1RITA 4OQ9A 3VHOA 5BNNC 1YWKA 2Z42A 1I5ZA 3SEPA 1SACA 4F83A 3UKNA 5LWBA 3E6CC 1MS4A 1IPSA 5J3UA 1CWPA 4DZGA 1HRV1 1UX7A 5KC6A 1H4GA 1ULDA 4B3NA 5HCFA 3DPRA 4MXVA 4BIOA 4TLFA 4QB2A 4FAGA 1NE4A 1OKOA 1UZZA 2OVUA 3VBRB 4LT5A 1RMU3 5LRRA 2NN8A 2N7GA 5E6HA 4GH4A 1VAVA 2PHXA 3NKGA 4JHZA 3WF4A 4BPZA 1FMD2 1CZSA 1QKQA 1XE0A 2LS6A 4LKSA 4BQ1A 4SLIA 1LESA 2Y64A 2VOKA 3WDWA 1NYWA 5A1AA 1H8TB 2PHLA 3KQRA 1Y7BA 5BNOA 1UD1A 1HXS3 3IKWA 3M3CA 4QDQA 4C8DA 5JR2A 4FOQA 4JDOA 2G9FA 3LFIA 2C9AA 4H3WA 3ZR6A 1ZBA3 2P1BA 4JQRA 3ZN5A 5BV6A 3BPSA 4BIFA 3AK0A 2R1BA 4L9BA 4GJZA 2BTVC 3ZYJB 4HSLA 1F2NA 1AL22 4RGKA 4LEJA 3CJIC 3N9PA 3U37A 1TEIA 4OI4A 4XBNA 1TG7A 1T6GC 4OHYA 3H0OA 2CYFA 2EIGA 3U4SA 4MHRA 2J1SA 3WVJA 3IZOA 3IIAA 4P14A 4HXCA 1A6CA 1AR62 1RYYA 2HWD3 2BFUL 2PHFA 1SHWB 4CUBA 5LBFA 1Y4WA 2VOTA 3MZHA 1GSLA 1UY2A 3UT0A 3NAPB 4YW2A 5D8AC 2CY6A 3BVCA 2WO7A 5ISLA 5FYBA 4Y3OA 4OHZA 1W6MA 2P3JA 4LQRA 4YVSB 3PMEA 3AVSA 1LOBA 1OLQA 3H8RA 2WLPA 4HMZA 3THDA 1UY0A 2QQUA 1V6MA 3T3YA 4EJRA 3TEYA 5KXCA 2O8QA 1VBE3 5CBLA 5IK8A 1RUJ1 2ZAAA 4DPNA 5F6LB 4BB3A 4DUVA 2NQYA 2WZR1 5CNAA 1REDA 2YBSA 4GQ7A 3P6BA 4JVAA 4XFAA 1AR72 3SKJE 2Q1ZB 3J8F3 4AHZA 4Z82A 1B35B 5M0TA 3PHMA 1ZZ7A 4CDQC 1PX3A 3ZFGB 4RR3C 4M4RA 1EV11 1C4RA 2YBPA 4I3PA 5IFTA 2YPJA 3F2ZA 1LGNA 2XVKA 1Q56A 3CHXA 3OGJA 5G05L 1NT0A 2XJVA 1RGSA 2BRTA 2VQTA 4QB1A 4OQ8A 2ERFA 3ASIA 4B7EA 3VBUC 3I2IA 4Q0SA 3W21A 3IDAA 1ULCA 1VBC2 1GMMA 1NG0A 4Q26A 1ULFA 3D5OA 3VZKA 1QIQA 1JXNA 3JBG3 5A3PA 1VRH3 2YY1A 5CA6A 3M70A 4YM0A 1AR82 1KDKA 2ZHNA 4XBQA 3IAPA 1UWWA 1VAKA 4CCLA 3N9QA 4HONA 4XILA 4IV1A 4QWNA 5FLJA 1GP4A 4QHOA 5C5TA 3W59A 1VB2A 2HWE2 3WOGA 2Y34A 5K0UC 1N1SA 5C9AB 4XFCA 1YC61 4IV3C 5FBZA 2H0BA 4IEVA 2WRAA 4LO5B 2AH2A 1ENSA 1O59A 1PO11 1K5MA 4FPHA 2C5DA 4TN7A 2VG9A 2ZMNA 4Q4V2 4Y5SA 1PGSA 1MEC3 5GLVA 4AEDC 4Z2AA 3LPFA 4META 2YC0A 2WBKA 1N3OA 1OOPB 1OLME 4R9DA 4ARYA 4A7KA 4MGSA 2AEYA 5CVRA 1VBA3 2WNUA 3RZKA 1OA3A 2HEYF 3Q8BA 1XJAA 2A1XA 2GN3A 1A8MA 4QXBA 1TE1B 4DXRA 5AFEA 2FZ2A 2AENA 1H4HA 2VO5A 4JAAA 3VKMA 5FMCA 4INDA 4C1WA 3MIHA 2LTNA 3ZSEA 4EN7B 1PNGA 1A3KA 3OBAA 5DABA 3RI8A 3KZ4C 3T09A 3O12A 5FY8A 3MLKA 3OD0A 2ZGRA 4GMP1 4H55A 4S2HA 3WT3A 5F39A 3ON7A 2DUPA 4RHV1 1OQEA 1UY3A 1LENA 4XHBA 1RVF3 3UESA 1QH7A 1ZYBA 1NA1B 4LORA 1HW5A 2ZS6B 3KT7A 4LHLA 5FQ0A 4CDWB 2C24A 1IQAA 2A6WA 4AR2A 3ZMOA 4ZZ8A 4FTBA 2YB7A 4Q2FA 5JZGA 1YFXA 3N9NA 1RUI1 5LBCA 3ZXDA 4BMEA 3MLLA 1WCQA 4QHZA 2I74A 1H2KA 3BCWA 4LBQB 3DKWA 4BCUA 3WDYA 4W4ZA 2ENRA 4LULA 3OJBA 4WM8B 4CCDA 2W1UA 3FZ3A 1NXMA 4UW4A 2B9UA 5FIXA 4V2WA 5F32A 1VALA 3EXUA 1O4YA 2BW8A 3WNOA 3ATGA 4P9JA 3MHZA 3H1YA 1YFYA 1H1MA 1T2XA 2X10A 3WF2A 4AI3A 2DWRA 4FOWA 1KD7A 1WCKA 2VMDA 3BTYA 1AYM3 1UOFA 4PJYA 5EHDA 3VKFC 4JKMA 4S2GA 5FKBA 2HYXA 2FDFA 3W5NA 4HANA 4COUA 2XXZA 3ZDSA 1R1A2 2PQSA 2HWE1 3B3QE 3K48A 4E8CA 3VZJA 4A6SA 3AP4A 5LEKA 2RS33 4W65A 4QHBA 4A42A 2O14A 2XHNA 1IGOA 1G7YA 3LIHA 1SDDB 4XIKA 4Q5OA 2B5HA 4JGZB 2B42B 4M4PA 4CPBA 4XOGA 3KGZA 5BNOC 3B69A 1WW4A 1WWYA 1ND2C 2ZZQA 3HD8B 4ZONA 1AXYA 1HV1A 5FREA 3MW4A 5FXZA 3WINE 1S2BA 1UX6A 3FBYA 4EWDA 3SCGA 1ONAA 4KG0A 5FP8A 5B2GB 5KXEA 3M2MA 1H1IA 4SBVA 4CCOA 3N7JA 4CVUA 1S0JA 1WKYA 2JB4A 1FYUA 2W2IA 4MYEA 4TZDA 2HWC2 5DN2A 5FZBA 1BKZA 1PGW2 1B09A 2VOVA 4XF9A 3T30A 3K46A 3AB0A 3OPWA 1WMXA 1DQ4A 2XDVA 2W87A 1US3A 2E26A 4FO9A 1DGRN 4MGIE 1AYN2 1LRHA 1ZRIA 2VTXJ 4IEOA 2WNVC 3S5QA 5I0UA 3K75B 1CAVB 1K5JA 5ABJB 3ZSKA 1MACA 4YGBA 1GQHA 3RZLA 3ZXGA 3GZEA 2GNBA 1ZZBA 2I2SA 1WCUA 4LBNA 4IW3A 1TME2 3T4VA 2RS11 4CDUB 2ZGSA 3MW3A 1WCDJ 1WLDA 2VBPA 3MIBA 4W8JA 4PQQA 3R4DB 2GU9A 2AREA 4OFGA 1YHFA 2D6MA 5E88A 4Q4Y2 2BNNA 3FC0A 3VL8A 3AYAA 2ZGKA 3ZKUA 3ECQA 5CFDB 1PO22 2XUMA 2WZEA 4BMBA 2PA7A 4HN1A 1DDLA 1JW6A 2TEPA 4LLOA 2D43A 4OMCA 4DEQA 1W6OA 2Q1MA 2Y6GA 3E5XA 4P00B 3TN93 4GWIA 3ZYPA 1M06G 5HCHA 1NCQC 3OPZA 5T5LA 5B4NA 5FAXA 4DUWA 5JR7B 5BYNA 2YC2A 3HBZA 2Y6KA 5FZDA 3V56A 4GWJA 5FPVA 2W1SA 1R1A1 3NVCA 4L92A 3WW4A 2JG9C 2ZX1A 4F3JA 4XFGA 1IZ3A 4YVWA 5GZCA 2VOWA 4I0WB 2WYSA 1WW7A 5T5PA 4MGZE 4DO0A 1CAWA 1RUC1 3RS6A 5IAVA 1SBEA 4B1MA 4IV1C 5A32B 2EICA 4XQWA 2VZSA 1XC6A 4EROA 1RMU2 2KM2A 2IXJA 1HQLA 2Y60A 3N7MA 4XF3A 1Y3TA 1AJKA 1H6XA 4EN8B 1VR3A 5CISA 4DXSA 4LO6B 1L7QA 4GAZA 5C4WB 1EPWA 2Q4SA 3NNMA 1K5MC 1QOOA 4FPOB 5EYXA 4YM3A 2OUHA 3FFQA 4BQYA 1PGW1 2WUHA 4LBKA 4QKFA 4KQ7A 3AP6A 2OYZA 1ZBA2 4AQ2A 1GNZA 3U1XA 3RZJA 1KGYA 2X5IA 3VN4A 3C7EA 4LXLA 4MXWA 4AVSA 4NJ4A 5FOJB 2WNUC 5FP7A 1QOSA 2XGXA 2EXHA 3WNKA 3ZYRA 1D2SA 1RUG3 2YC4A 3D0SA 1OLMA 2LALA 5FP3A 1UYPA 1QMJA 2PFWA 4XMIA 4RQPA 5IATA 4CXWA 4D6SA 3X29B 1VMHA 3TBDA 1DZTA 2JE9A 2OZJA 4N9IA 3UJOA 3ZYGA 3RWKX 5ACA1 1DYPA 3FJSA 4PDWA 2Y33A 3A0KA 1PZ8A 4AAXA 4LMFA 1GZ9A 4LOTA 4QGMA 4NIAA 4S2DA 4AI1A 4DINB 1QDOA 2R043 1OUSA 3Q8CA 2PLV1 1H2NA 2JG8C 4Q4Y1 4OLLA 1VBB1 4RS5C 4Z92B 1S0IA 3GALA 2PMWB 1VBE2 1XQNA 3PU3A 3VBHA 4AGGA 1QF3A 3LE0A 2K9ZA 3FLPA 1EAH3 5JZGC 1OPMA 2WO2A 3DF0A 4XJ8A 4ET7A 1U5ZA 2NM1A 3GBGA 3HQUA 2RJLA 3LKJA 2D98A 4PF1A 3J8F2 1AXKA 4ZY9A 1PVXA 3SLIA 2VZQA 5FZ3A 4EN6B 1WBLA 1GV9A 2GN7A 3H50A 4Q29A 4XETA 4FFHA 1VPHA 1LR5A 4TSVA 1LHUA 1RUH1 4CDXC 1F4HA 5H9SA 2E63A 4JDMA 4CEYA 4GULA 4R52A 1GQPA 2UURA 4KWJA 5LA2A 1ENXA 2W94A 3I2FA 5GLWA 2HLEA 1YXWA 5FP4A 3PIJA 4XAAA 4AG4A 1JMUB 1Z0HA 2FHRA 2WN3A 3K77A 4GB32 4FPKA 1YO8A 3SQOA 1EUTA 5DG2A 2VW1A 2R32A 3JBG2 1VRH2 3NNFA 1ZZ8A 5JSOA 3N9OA 2UY9A 4LKEA 1XU2A 1MS1A 1BJQA 2RV9A 4WM7C 4BK5A 3LA7A 2YFZA 5FY1A 1MS8A 4HVRA 3ZDVA 3CU7A 1RUF3 2YPDA 2XVLA 1BVP1 4Q4W3 4YZ1A 3ZXLA 1DYKA 3CLPA 2XH6A 3E5QA 3JCIA 3QACA 3ZXKA 1JYWA 3W5MA 4AVAA 1O5LA 2DCKA 3WNXA 3F95A 3BB6A 2OX0A 3ETQA 2Z79A 3AL5A 4RFT0 3N35A 5KC5A 1CAXA 3ZXFA 3JD73 2G19A 2ADDA 4OULA 2V5YA 3MUY1 1X36A 4ASMB 1VBA2 4WBBA 3VB9A 4KNCA 3OYWB 3POYA 4Q0QA 4XE9A 5J37A 2CNAA 1FPN1 4UW6A 4AFCA 3NMBA 4HLTA 2Y6FA 2G4IA 5F3CA 4JCKA 4XVHA 2KR2A 4I30A 1YRZA 1UF2C 1RUD1 1ODNA 4Y1YA 3A22A 5BNNB 1W8NA 1OA4A 2PAEA 1R081 2W3JA 1O3QA 4LO4B 1NY71 1F5JA 4FPGA 3O1MA 3ZFEA 1LULA 3PLQA 4WZFA 4CPBD 1QXJA 4U36A 4FPLA 3BOWA 4ZXKA 4GZ9A 2XLFA 2C6SA 5BUVA 4AHXA 2MPFA 3AYEA 3NO8A 4NHLA 5FZIA 3AJYA 1RVF2 4QKNA 3T1LA 5BNPA 1E5SA 2A6VA 3FWEA 4QX1A 1WZXA 3ZPYA 2XJTA 1ZZ6A 3VHNA 2ATFA 2OIIA 1ULGA 1CJDA 4XIOA 4GA9A 4RA0A 3DV8A 2FCUA 2DVFA 4IL7A 2ETEA 2JX9A 4IEXA 3RJRA 1LEDA 4FPJA 4OMDA 5CZKA 4U2AA 4M0HA 2UU8A 1LGCA 1S0CA 2CTVA 3QH7A 3VD9A 4GD4A 3ME2A 3S6PA 5GLUA 4FQ4A 3VBSC 4GB31 4H7LA 3CJIB 3OGRA 3VKNA 1H2MA 1V6NA 4ZU4A 2D3PA 1IS5A 1FT9A 1PIV1 2QJVA 4LITA 4YVWC 3NWKA 3VDDA 1AYM2 3GNEA 4KWUA 3RZGA 4XW3A 5GZDA 5JOXA 1S0EA 1E5RA 1H0BA 2A71A 2VOXA 4QDRA 1POV1 3K2OA 1WBFA 1HIXA 1REEA 2SBAA 4XFFA 5DQ0A 1S2KA 2YGMA 3LZZA 1C8NA 3JB8A 1W2TA 3LOIA 1MQTC 5A3OA 3DKQA 1O6UA 2ZTNA 1CQ9A 4M3CF 5D8AB 2RS32 5LY2A 2FDKA 1W28A 2YV8A 1HB1A 1DQ5A 1W6NA 3QCWA 4PBOA 5DUVA 3ABZA 2VXJA 4M0NA 4ZU5A 1G9DA 3DEMA 4W6YA 2BGCA 3LDBA 1PZ7A 2X29A 2K46A 3N7LA 2JENA 4Q4X3 1LHNA 2OS2A 4F7ZA 3CDZB 1AX0A 1R092 2E53A 1JZ4A 4LBMA 2BP6A 4OZOA 3VHPA 1YUDA 3USUB 1HJFA 2Y0OA 4X8NA 5FJHA 4BWOA 1V6JA 2CDPA 5T50A 5JOYA 1O4ZA 1QHDA 3ZO0B 2O1QA 3WNMA 4ASLA 2R063 1VAMA 1CR7A 4KGGA 3RSJA 1C1LA 2MHFA 2YUEA 4UFMA 2WAOA 3AM2A 4JGYA 5KWRA 1F8VA 4FI9A 5KHKA 2GH2A 2ZEWA 2IFRA 1UYYA 3WNLA 1IHMA 1O7FA 1OT5A 2IFWA 2RDQA 4MH0E 4LA3A 1Q8PA 4RQPC 1CD3G 2D44A 1FV3A 2BEOA 1YIFA 1W9SA 2VJXA 3D8CA 4XJUA 2GP3A 1ASJ3 2W1QA 5FY7A 3ZR5A 5FYHA 3ZSLA 1K45A 4HG6B 3VBUB 3PDQA 3BKZA 1LJ7A 5IVBA 1MPXA 1WCSA 4UW3A 4XUPA 4F8AA 4M3CA 4EE2A 2D40A 3S30A 1Q43A 1AR92 3VBHC 5FO7B 4K3UA 1QOTA 5L9VA 2HYKA 1UMHA 1RJ7A 5FPUA 5FUIA 5C3OA 1DFQA 3OY8B 2RM23 4LBOA 2D6LX 2D93A 2DCYA 1ND3A 1OMIA 1YFUA 5FCCA 2R071 4PIYA 5A33A 4FPYA 1JYXA 1W99A 3OUIA 3DUIA 2XWBB 1X82A 2B8MA 4IE4A 3WW3A 2AEZA 3HN1A 2XB6C 1OF3A 2D6PA 1PVC3 3AZZA 1BQPA 4L8QA 5K7PA 3PUHA 3TN92 3WG2A 4XF0A 5LA1A 3VHRA 4AI2A 4ZZ5A 3WLUA 1GOHA 2E51A 3UKVA 1RUOA 2J1UA 4LO7A 5A3TA 2CWMA 2QCSB 2X09A 2NYYA 3WP4A 2WNEA 2JB8A 4A7ZA 1DHKB 2FD8A 4NR1A 1XYNA 4PT6A 5FZ0A 4BA6A 1RIRA 4A2UA 5IYYA 1IS6A 4AWDA 2VZ3A 1JZ7A 3ELNA 2PYTA 3ZSMA 5JIUA 4PI2A 4Q0UA 1LOEA 3MPPG 4CRQA 2B45X 4QM8A 4AFDA 4QB6A 1BMV1 4K9SA 2VXRA 1R091 2K0GA 2KD7A 4JC1A 3EMRA 3WXPA 1BMV2 5JSPA 4COZA 4S2FA 2DVGA 2JDPA 3PTYA 5FZKA 3WW2A 3HQRA 1PGL2 1DQ1A 1ZBE3 3WDTA 5DUUA 1W8OA 3IBMA 2ZEXA 5I8YA 4UFLA 5A6ZA 5LRSA 3VZNA 2R30A 3VGIA 3KD4A 5IVEA 3SCHA 4HETA 3KB5A 1LOCA 4AI9A 3EBRA 5L9RA 4PF5A 5JOWA 1IS4A 3WQ0A 1YYNA 2ZGOA 2SLIA 3VDBA 4DXTA 1OLRA 4GKYA 1YCIA 4I3GA 1QQP3 1RUG2 1S2EA 5DDJ3 1NKGA 4MOAA 1UPIA 3UGHA 1HJGA 3POEA 5DPNA 3GCWA 3OCPA 5HCBA 1XNKA 4C90A 3I59B 1AR91 1JZ8A 3AJZA 4FP3A 1SFNA 1Z7S3 5F2SA 4TWTA 3OUHA 4CU8A 2LUWA 4Q27A 1W0PA 3RVHA 5JXHA 3VBOC 3HT2A 2R042 3IN9A 5IT6A 3K3NA 5I0SA 3O0VA 3IDBB 2ZGNA 2JXAA 2ZHMA 2WO1A 2WWUA 4QQLA 1EAH2 3TWIA 2BFUS 3VZLA 4YFWA 3DCQA 2AC1A 2FZ1A 4NOTA 4Q0PA 1SLAA 4YW4A 1QJZA 2R7EB 4WV8A 2VQ0A 1ND2B 1MZEA 4CCMA 1X8MA 1UCXA 2RG4A 4DMIA 1V9U1 1WA6X 2RMU1 5FFOC 3WF3A 2AYHA 1QJU3 1O4TA 3OGSA 1JU3A 5C71A 4QM9A 1JODA 4LA2A 4A4AA 5IVCA 5KXDA 3QD6A 2VD7A 3BU7A 3J7MA 1YJKA 4OUEA 3OBTA 3MI8A 1KS4A 1IKPA 4K1ZA 3NV4A 1OFSA 1TMF1 2XMLA 4LR4A 3GJBA 2ORXA 3O1TA 3LDKA 4UFJA 2PAMA 1YEWA 4OYUA 1WD4A 2AR6A 4D3WA 4L0PA 3H7YA 5KR7A 1ZA4A 4JV4A 1VBD1 1EPZA 2QQOA 2WNVB 4LOSA 5D1IA 3W20A 3WR0A 2NZ9A 1H9WA 2RE9A 2ILMA 3OUJA 1JUHA 3V0BB 1TQ5A 2ZJCA 4P9YA 1PK6B 4RL7A 1PGL1 3I3EA 1XYOA 3T0AA 3AZVA
chains in the Genus database with same CATH topology
1W6PB 3RYPA 1RUF2 3VBRA 4Q4W2 1VIWB 3G7DA 2XPJA 2WT1A 3AKQA 1BBT3 1YJLA 2P3IA 3ZN6B 5F9TA 3BALA 1DZQA 3B94A 1MVQA 5GLTA 1H8TA 5K9YA 1HV0A 3RZZA 3ACLA 4I09A 3SH5A 1N1VA 2VULA 3PJQA 4PQ9A 5T52A 3JD72 2RR13 1C8M1 2D5HA 1HQNA 3TRSB 3AYCA 4D7YA 2ZMKA 4G4FA 4MZUA 2D7FA 3SISA 3M3EA 3CEWA 5LEJA 1NCQB 5L7OB 4G3YC 1MS0A 2GC1A 5EWSA 3TNQA 5F1RA 4FVVA 2GMMA 3RJ2X 3N7KA 5T5OA 2JG9B 3NAPA 5L36A 5CIRA 2XBO2 4DNYA 2K2SA 1S0FA 1S55A 4YVSA 3GF6A 1C3HA 2DF7A 4YRDA 4HL0A 1F5FA 1SFYA 5SV5A 3WQ7A 2HWB2 1CPNA 1FMD1 1RUE3 3GZUC 4XF1A 4MV2A 3C3VA 4YGCA 2Z69A 1RHI3 1FATA 1S0BA 2XKOA 2BWCA 1B35A 2BUKA 4I0BA 3ZFGA 2ZGUA 1AL21 4MGKE 4N43B 3N4MA 2A3YA 1BYHA 4D69A 1SLIA 3I8TA 5AC93 4WVMB 4WVWA 4C0BA 1UKRA 1UMZA 2D97A 2ZKNA 3ZFFC 4ES9A 1AR61 1N1TA 2JE7A 1AF9A 1V00A 1WLCA 5EJ3A 2GMEA 2VNGA 2ZCWA 3AZWA 2YGLA 5CG9A 1DGRA 3NW4A 3WX5A 4QPIC 2JG8B 4Q4X2 2O0OA 4IXLA 4RS5B 4FQZA 3R05A 2QZ3A 2DYCA 1CIWA 1JTZX 3MF6A 1UKGA 2UWAA 5C9AA 1QJY3 3RG0A 1X50A 4COWA 2Z5WA 1L3JA 3EQEA 1O3RA 1AR71 1N3PA 3GHNA 1PNFA 2PN5A 2JICA 2QVSB 4XDQA 3NV1A 5FO9B 1XNDA 1SCSA 3H3ZA 1OOPA 4CDXB 5KHIA 3KCXA 5H9PA 4E27A 1ASJ2 2YMZA 1GNHA 1OI6A 1D4M2 2Q30A 2XLGA 3S7IA 2XBO1 4NHKA 4XQ4A 1W2UA 1VBC1 5GM0A 1G9CA 3LSEA 4FPEA 4XTMA 5JIAA 1OFNA 1GLHA 2XHKA 1JHNA 5J36A 4L11A 2HWB1 1GR3A 4XJ9A 1AR81 2RM22 3IMNA 3DPRC 3LAGA 4WM7B 4Q8LA 4E4ZA 1LKNA 3J4UH 4D7TA 1QH6A 4C91A 4GH4C 2AUYA 3LCPA 1NA1A 2ZZJA 3RYRA 5EFUA 4R4XA 4CDWA 1LHWA 4AVCA 2D6OX 4DQAA 1PVC2 3TOJA 1OA2A 4LBQA 4Q4V1 4WM8A 3MDPA 2WC2A 2BNMA 1NE6A 1O91A 2QZ2A 4ONUA 3MPBA 3WG1A 2XJQA 1HRI3 5IUQA 1AZDA 1KFXL 2R0FA 4QPGB 2GNTA 1BEV3 5KBFA 1ZREA 2ZA9A 1X7NA 1G9AA 1FOD3 4FOVA 2ZX2A 1VLNA 5FMOL 3JU9A 4NO4A 5FDBA 1RINA 2MEV3 4Z07A 4D7SA 4Q4X1 4CTEA 4A7YA 3WUCA 3T1MA 2QUOA 2XJRA 4K7JA 1ZBE2 4KU8A 4JGZA 1H8TC 1PMIA 1LCLA 4DB5A 4QQOA 5HBAA 2BVBA 1COV3 1QXRA 4EWEA 2VMIA 5EXOA 1W0OA 2RS52 1QWRA 5CFCB 2DUOA 3UV9A 2HKXA 1CPMA 4BE3A 2RHPA 2HWF2 3AZXA 4AXOA 4GXLA 1RUNA 2QQPA 4DS0A 1XYPA 2DU1A 1QJX3 1QQP2 3CJXA 4XBLA 1OQDA 2WSUA 5C8WA 1D4M1 3WP5A 4XYXA 1PZ9A 3KCYA 2WS93 1G9BA 3FHIB 5C8CB 3VBSB 1JN2P 4PIZA 1Z7S2 3NAPC 3J26N 3TNPB 1CAVA 2P2KA 3L2HA 4YVSC 5ABJA 4UBGA 2QNKA 3V65A 4KU7A 3WV6A 1QXPA 5C6CA 2RJKA 2DFCA 2ZPXA 1MQTB 2D3RA 1DGWA 1HRV3 3AMNA 4I01A 4CDUA 2PHTA 1EP0A 1LEMA 4LBJA 4P9LA 3AYDA 3P3NA 3NV2A 3RYKA 3E5UA 1B35C 3PMSA 3SHRA 1OKQA 2XJSA 2VECA 1QJU2 4HZFA 1FV2A 3FUOA 1G9FA 3MYXA 4YNIA 2E6VA 3AXEA 3FX3A 1HXS2 4AW7A 2HWC1 4XF4A 1LOAA 1ZZCA 4Y1UA 4OI0A 3LB9A 1WUVA 3R4SA 4Y22B 4BLJA 1DQ0A 4XFHA 2B46X 3WD5A 1OSGA 2XL9A 1WLWA 4HVOA 2ZGMA 3M1HA 3B7MA 3NV3A 1H1AA 1MZFA 1N3QA 2VNRA 1AYN1 1J58A 3CO2A 4I02A 3AKTA 1WGPA 2DCJA 4Y4YA 5J96B 4YZ5A 2CV6A 3PVEA 4YARA 3ILNA 4QMAA 3SH4A 1U5YA 2HWD2 5GLZA 5A32A 1J3PA 1CAUB 5SV8A 2RS51 1FNYA 1A8DA 1TME1 1AHSA 1BBT2 2HWF1 2A5ZA 3SITA 3G6JB 5C4WA 4ORFA 3POSA 3PVBB 1CONA 5I8SA 1NLSA 3FLRA 5CFDA 4Y1XA 5E1RA 1PO21 1SDWA 1RUJ3 2RR12 4CEWB 1HQWA 2WZR3 2ZGQA 3TB0A 4GWNA 1W6QB 2OZ6A 3PJYA 4C0HA 4UXAA 1QNYA 5J48A 1WMEA 5CAZA 1EV13 4XFBA 2VPVA 1IOAA 2DVDA 4N53B 4QXKA 4RSUA 3URFA 3EO6A 3M4FA 3BPZA 3E6BA 1MVEA 4AEKA 2A70A 1NCRB 3RI9A 4MVTA 2H6CA 1SMVA 2HJIA 5L19A 1CGPA 1KDMA 1RMU1 1DG6A 2O8OA 1NA1C 3B9CA 3WG3A 1RUE2 4CDWC 2B39A 1AXZA 2VGDA 3IPVB 1KJLA 5FLHA 5C33A 1HXS1 3VBFB 1ZVFA 4RGAA 2JECA 1RHI2 4WM8C 1ZBA1 1PHMA 3T2TA 3ALQA 4QU2A 4IERA 4WVVA 2GAUA 4QT6A 4NHMA 4DFSA 2VQAA 3MLJA 5AC92 2NMNA 4YZ3A 1PO13 4J6GA 3WP6A 2PHRA 1MEC2 4R4ZA 4COYA 1F9KA 4E4SA 1FX5A 1N1YA 5T5JA 2JKBA 3M3QA 1UPSA 2HWD1 1PM7A 3AFGA 3DL3A 1V6KA 5FRAA 4HK8A 1CVNA 3VBOB 2C1FA 4YM1A 4JGZC 1SLBA 1OPOA 2IXCA 4QQPA 1SLLA 2PHWA 1VBE1 3AXDA 2VMGA 3GBFA 1G86A 1QJY2 3JB4C 4GMP3 2AZ5A 4RHV3 3JZVA 1J59A 4MGYE 4QX5A 4DXZA 2V73A 2CGOA 3J8F1 3KLSA 2UYBA 4N7UA 1H2LA 4KBBA 1RC6A 2B7YA 4P9GA 1GZWB 1A78A 1VB4A 4CP1A 1RUI3 2R16A 3C2UA 3OYWA 4COVA 4AI8A 1BZWA 5DUWA 5ABJC 3VKOA 4YG6A 2YDEA 2D6KA 5DG1A 4K21A 5BNNA 5L73A 2IWGB 1YIPA 3JBG1 1VRH1 4CP0A 1HDKA 2WFF3 4CDUC 5JSRA 5CG8A 4AFAA 1OHFA 1UAIA 1XXNA 2EXJA 3O5SA 4AGRA 2VMHA 1D2QA 4HPKB 2HWE3 3J9SA 1C5HA 1BK1A 3TYJA 3IM0A 3HT1A 4B4PA 1NQDA 1MEC1 1ZM1A 3P3PA 2IXIA 2X53S 2XVGA 2X5IC 5FPXA 1HRI2 3IT8A 1VBA1 1V6LA 2Q0AA 3CJIA 4QGNA 3THTA 2C0ZA 1BEV2 2IXHA 4W6XA 5JCTA 2P17A 3WW1A 4CDQB 1D0HA 1FOD2 2D5FA 3ILRA 3MICA 4RR3B 1UU4A 2WL1A 1LECA 1V6OA 3BODA 2MEV2 3H1MA 3I4IA 3KM5A 4PDWC 2GC2A 2XL7A 2WFPA 4HBNA 5D8AA 2GH8A 4XXAA 1DQ2A 1JYCA 5C4WC 2JEMA 1TNRA 1Y43B 5DZFA 3WZ1A 1RVF1 4KWKA 3UK9A 5CFDC 2F6BA 1GZCA 2Z2SB 1FI2A 5GJ6A 1LOGA 1LTEA 5GZGA 2RS13 3U4XA 2E9QA 3USUA 4HKWA 4BOWA 1SCRA 2R6QA 1UN1A 2IC1A 1O3TA 1QJX2 1WW6A 4NN0A 4K1YA 4BYYA 5K0UB 2WS92 4Q1RA 3UL2A 4IQPA 4IV3B 3EHKA 4IEPA 4CEYC 1Q8OA 1RTVA 3AKRA 4EN9B 3PNAA 1GYKA 4ES8A 4Y20B 5I93A 3FLTA 2W08A 1AYM1 4AEDB 1BXHA 1V70A 3VBUA 5E8AA 3ZFFB 1LU2A 3OBRA 3MFCA 3KT4A 3ZSJA 3N36A 2RS31 2WZPP 1HRV2 5LK5A 1NZCA 2WINB 2WT0A 1RUC3 3OY8A 4WVZA 2ZBJA 1RJ8A 4QPIB 3DN7A 3V0AB 4Q1PA 1Q3EA 2WQ4A 1WD3A 4ISQA 3MFAA 3WDXA 4KL1A 3THPA 4Y24A 4LHNA 4AFMA 4PCRA 4K8FA 4X8PA 2I07B 2BNOA 2W39A 3IDCB 3RPQA 4GALA 1HKDA 3KSCA 2JDZA 4YYOA 2VVDA 2UY8A 3I7DA 2QFEA 3KMHA 3B93A 1BVVA 1NXD1 3O0WA 3NJZA 2EAKA 5DZGA 4B7KA 5JDBA 1SBFA 4QGLA 4AI0A 1ZNPA 4P9XA 3GZAA 2QE3A 3S0MA 1Z78A 3SMHA 2A3XA 5ACA3 4Y1ZA 3ZFEC 3WP3A 4LTAA 4OUSA 3POWA 1DBNA 4B29A 4IEQA 1KXGA 1G8WA 3BIWE 3CF6E 3DPRB 3D4KA 5BNPC 5TSWA 2PLV3 4K20A 1C57A 1X33A 2Q8OA 4GKXA 1VBB3 5JLVA 1XE7A 3HWJA 4GH4B 1RUJ2 1EY2A 4J1XA 2DVAA 2WIIB 4Y1VA 2ZMLA 2XWJB 5BNOB 2WT2A 3ST7A 5HI0A 4FXKB 2DVBA 3TN91 5E89A 3WHUA 1QDCA 1VJ2A 4NVPA 2DCTA 2A6YA 2ZKLA 4XTPA 3SH3A 3DGTA 4ATEA 3FUQA 4FSJA 3ZXJA 2PQQA 1EV12 1RUH3 2VH9A 5E16A 3I59A 1I9RA 4XJZA 3VDDC 4QQ2A 1AX2A 4GIQA 3MEPA 5HXVA 1Q8VA 4HSJA 4R9CA 1U5IA 1MS9A 1NQJA 2PELA 1ZRDA 1MS3A 4AYUA 3JQWA 4XMAA 1UW8A 1W6MB 1XE8A 4QD2A 3AMPA 4OHVA 5CADA 4ITCA 1TNFA 4O9GA 3AP9A 2QKDA 4QPYA 1ND2A 1KRIA 2E7QA 2NP0A 5GALA 4LLFA 3AZYA 2ZABA 5IK5A 5GZFA 1PO12 3KS7A 2KA3A 3VLBB 1IS3A 2W0XA 1RUG1 4JGYC 2CL2A 4JTNA 2DFBA 4Z2WA 2WQZC 3WDUA 2R49A 5JI7A 2GC0A 4Z8BA 1DGLA 1QGLA 3A0NA 1FPN3 2WNVA 2D3SA 5AFBA 3V0BA 2GALA 2R041 1PK6A 2DCZA 1W39A 1RUD3 1W6PA 2BVVA 3AX4A 1UZYA 1R083 3QOPA 3QLQA 2ZGLA 1EAH1 1JOJA 1OD5A 3ZN6A 5BNQA 1C1FA 5FTTC 1IPKA 4HFSA 1ND3C 4RHV2 4IV1B 4OUMA 1J1TA 1CJPA 1SEFA 1UIKA 3NL1A 4YZ2A 4M00A 1K5MB 1RUI2 3HR9A 4D94A 1GANA 1H8VA 5KHHA 5LK7B 5J7MA 1UL9A 3N3HA 1OQ1A 4Y26A 5A3LA 4AEJA 3VV1A 1NCQA 5L7OA 2A6ZA 1RL3A 5IK7A 4AHYA 4CZSA 3APBA 1SQ4A 3CL1A 2WNUB 4GB33 2HEVF 3VZMA 2JG9A 4X6RB 1PIV3 4N90A 1GFF2 1XU1A 2WFF2 3RNSA 2FQPA 3MGUA 4MX3A 1POV3 2OPKA 2CGPA 3IWZA 2ZX3A 1REFA 1RUF1 3LGRA 4Q4W1 2DURA 2XJPA 1FAYA 3H9AA 2MNGA 3OGGA 4V1PA 1LHVA 3JUUA 3W58A 2UYAA 5AVPA 5CB7A 1KS5A 3D82A 1O5UA 2HEWF 4LNVA 5JI9A 1EYBA 5FQ0B 3JD71 2VW2A 4BZ4A 3TAYA 5JZGB 4N43A 2R062 2EAAA 4NWWA 4WVMA 5EYYA 1AVBA 4DOUA 3RMYA 4FPCA 4AQTA 4UBHA 3SNMA 1U5XA 5JMCA 4XXPA 1J3RA 4BLIA 2OW4A 1F31A 2VVEA 2YYOA 4RD7A 1BCXA 1AL0G 2A3WA 1O3SA 2WWSA 3BOPA 1SLCA 2WSVA 1WLTA 1WMFA 2WJSA 2JG8A 1Q5OA 3UJQA 4RS5A 4DY3A 4PBPA 2P3KA 4FBFA 3WCSA 3GZTB 3KCCA 1S0GA 1AX1A 2RS12 1QNWA 1APNA 5FMOS 4UW5A 4EV0A 4MSVA 1HX6A 2UWCA 3FFZA 1CESA 2VUJA 2XJUA 4B8EA 1GQGA 2R073 3WDVA 4AQSA 4E9KA 2F4PA 3GHMA 2BQPA 1XNBA 5T3NA 1MZ5A 2ZGPA 4CDXA 4YFZA 3B01A 3HAGA 5BXXA 1AJOA 1DF0A 5JPMB 2WFF1 4PLNA 4XJWA 1FXZA 1NOVA 2YROA 1XNCA 4YZ4A 5DXDA 3D6EA 1DZRA 5KXBA 3QBQA 1IPJA 3U0ZA 5I91A 1R1ZA 4XFIA 1RUC2 4LO8A 4MUVA 4WM7A 5EZWA 3INAA 3VBRC 2GNMA 1R093 1J3QA 4XEZA 4OI1A 2ARXA 3U10A 2BBVA 3HMYA 2FBEA 2R061 1JH5A 3LA3A 1Y9QA 5JPNB 1IKQA 4YGEA 4EN0A 4AVTA 4XJAA 3OD4A 5JOZA 1I3HA 3ZMNA 4GMP0 4L97A 2CAUA 4NPRA 4KH9A 3USSA 5FLIA 1W6OB 2XLAA 3E6DA 1ASJ1 4QPGA