3M4FA

Structural insights into the acidophilic ph adaptation of a novel endo-1,4-beta-xylanase from scytalidium acidophilum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
181
structure length
181
Chain Sequence
NPGGIDYVQNYNGDVADFQYNEGAGTYTCGWDGSTDFVVGLGWSTGAARDITYSATYNAGGSGSYLAVYGWVNSPQAEYYIVESYGDYNPCSNAEGLGTLESDGSTYTVCTDTRTNEPSITGTSTFTQYWSVRQSERTSGTVTVGNHFNYWAQHGFGDSYNFQVMAVEAFSGSGSASVSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endo-1,4-beta-xylanase
publication title Structural insights into the acidophilic pH adaptation of a novel endo-1,4-beta-xylanase from Scytalidium acidophilum
pubmed doi rcsb
source organism Scytalidium acidophilum
total genus 56
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m4fA00
3VZJA 1KS5A 4XQDA 2JICA 3VHOA 1OA4A 1XYPA 1XXNA 2B42B 3AKSA 2VULA 3AKTA 1HV1A 2BWCA 2DFBA 2JENA 3AMNA 2NQYA 2B45X 3WP4A 1H1AA 1F5JA 2DCYA 3WP3A 1HV0A 4HKOA 1QH6A 3AMMA 1HIXA 5EJ3A 3MF6A 1XYOA 3HD8B 1BK1A 4H7MA 3WQ0A 3WP6A 2DCJA 4XQ4A 5HXVA 2D98A 3AMHA 1XNBA 1C5HA 3B5LB 1T6GC 3AKRA 1PVXA 1BCXA 4XQWA 1YNAA 3WXPA 3VL9A 2QZ3A 1UKRA 4IXLA 1H8VA 1H0BA 3MF9A 2DCKA 3LGRA 1OA3A 3VHNA 3B7MA 3M4FA 4HKLA 1OLQA 1UU4A 1REEA 1UU5A 1UU6A 1KS4A 1M4WA 1W2UA 3WQ7A 1TE1B 4HK9A 2NLRA 1QH7A 3VZOA 3WQ1A 5K7PA 3VL8A 3WY6A 3O7OA 3AMQA 3VGIA 3VZMA 3LB9A 3WP5A 1REFA 3MFAA 3VHPA 1XNCA 3EXUA 1XNDA 2DCZA 4S2HA 1NLRA 2D97A 3VZNA 5K9YA 2F6BA 1XYNA 1IGOA 2C1FA 2VUJA 3AKQA 2B46X 2DFCA 4XPVA 1AXKA 4NPRA 2JEMA 3ZSEA 1C5IA 1XNKA 3RI9A 1ENXA 3RI8A 3WR0A 2VG9A 2BVVA 1REDA 3MFCA 1OLRA 3VZLA 1H4GA 3AKPA 2VGDA 4HKWA 1H4HA 4S2FA 3AMPA 4S2GA 3WT3A 3WX5A 1BVVA 2QZ2A 1OA2A 2Z79A 4S2DA 2BW8A 2BWAA 3VZKA 4HK8A 3VLBB
chains in the Genus database with same CATH superfamily
5DUXA 4WM7C 4CU9A 1O8SA 3VHOA 5A33B 4UFHA 4YGCA 3IB3A 4LUMA 1NUKA 4XZUG 5TSWA 1G9FA 3GHNA 1SCSA 3H42B 2WO3A 5E16A 1LOEA 3GZEA 2VY0A 2W1UA 1GP4A 1XE8A 2BOJA 2TEPA 4BK5A 4YPJA 5FP9A 1JHNA 2RS53 3K4ZA 1W8NA 3FZ3A 5EQUA 2VOTA 4LOTA 4QDSA 2D5HA 5T54A 2QKDA 1PGW1 4A3XA 3LIHA 1G9DA 4UFIA 4XJWA 4GA9A 3ZYJB 1H1AA 3BPSA 4WV8A 1R082 4FAGA 4HKOA 4FP3A 1JS9A 3T3YA 4LJHA 1QH6A 4C1WA 2AREA 4NOTA 3SISA 1UD1A 5I0SA 2BQPA 2AYHA 2WWSA 3OGRA 4QKBA 4AL9A 1NCRC 2HWC2 5J37A 2ETEA 4AYUA 1TME1 1VBB3 1F15A 3M3IA 2XUEA 4LOSA 3E6DA 3PVEA 4NVPA 3UKTA 4Y1VA 1FMD2 1ACCA 2W2IA 1E5SA 4AFBA 3POEA 2MNGA 3T0BA 3TNPB 4BQWA 3ALQA 5FUNA 1DHKB 5DZFA 1H9WA 1UKRA 1UOJA 1V6JA 3B01A 2QDRA 3OBAA 4IEUA 5JDBA 5CYYA 1H9PA 1HDKA 2IVIB 2W91A 5EPAA 1NA1B 1NLQA 1QDCA 3GJAA 4M0NA 5F2SA 1NA1C 3CLPA 3ZMOA 1VBA1 2J1UA 3KWVA 4Q0PA 1HB4A 3WHTA 3B7MA 3M4FA 4HKLA 1W6NB 1W9FA 3VD5A 5A1FA 1YQ8A 1G9CA 1R092 3WF0A 5FY7A 1AR93 1CZVA 5KWRA 3M2MA 2WL1A 5G04L 4IQPA 1R64A 4AVBA 5KHGA 4I0WB 5K7PA 3CKHA 1OVSA 2OPWA 2FD8A 4CPBA 1QJU2 2WZ8A 1RGSA 3C7HA 3ECQA 3ILRA 4H3WA 5APAA 2EF6A 2GMEA 1GLHA 1YWKA 1AX2A 5ACA2 4HPKA 2ZZQA 1SLTA 4MADA 3N9NA 1D7PM 2P3YA 3VBOB 4EQVA 2VUJA 4EN6B 4IEOA 5C9AA 3VBOC 5FDBA 1W06A 3RNSA 3CF6E 1RUD2 5FP8A 1PIV2 1VBD3 1Y7BA 2ZEWA 4BOWA 1HXS1 4D3WA 1AL23 2VW1A 5C8WA 2EA7A 1F4AA 1C5IA 5T50A 4E8DA 1JBCA 1ZRDA 3ACGA 2WAOA 1ENQA 3RI8A 4ISQA 3KV4A 2XDVA 5FXZA 3AKPA 3JD71 3CEWA 4ATFA 4XE9A 5BY5A 3ZXGA 2EIDA 1OF3A 1XSRA 1YI7A 4CUCA 1AYM1 5DQ0A 3Q8FA 3R4DB 4BMEA 1OQ1A 5FFOC 1QJX3 2IC1A 2VQTA 4L92A 4NIDA 4AAPA 2A3YA 2BDRA 2WRAA 1YQ2A 2VUDA 3MUZ1 1AR81 3ZSMA 2ORXA 3VZKA 4N90A 3FUOA 4I01A 1O4ZA 3ZYRA 3MIEA 4P08A 1X36A 2R1BA 3I54A 1XYPA 3CZUA 4NUBA 1FNYA 4P5HA 3OB8A 5CFDA 1S2KA 5J3UA 4FFGA 1RUG1 4P9LA 1S0BA 4Q0VA 3W9AA 1XRUA 4QX2A 5FY0A 4LKFA 2RVAA 1C1FA 5DDJ1 1WCDJ 4AFMA 2W5FA 4HN1A 4UF0B 1CZTA 2WSVA 2QQPA 5FZLA 3K46A 1J3PA 5JWPA 2ZGPA 2JWPA 5HCBA 1WLTA 2ZAHA 4X6QB 3N7LA 1US3A 2R16A 5A80A 5FY1A 1SFPA 1UMZA 3NNJA 4U2AA 4XABA 4Q26A 5FYBA 2OX0A 1W6MB 1PO13 2IXKA 5A7PA 1OHFA 2CY6A 4SBVA 4RS5B 2XBO2 3POIA 4RS5C 2RS33 3DL3A 2ZMNA 4M4RA 4KNCA 4XQ4A 2Q8EA 3RYKA 2ZEXA 4KL1A 3SITA 2ATFA 3H8UA 3U11A 4NROA 2PLV2 3GZAA 1GBGA 5BNQA 4JQTA 1F9KA 1Q8PA 4FPYA 5FKCA 1XQNA 5HCHA 1YNAA 4HSJA 1GQGA 2PHFA 1H2KA 4IV3A 1AR73 1VBE3 4FO9A 5A7OA 5LRRA 3USUB 2FDIA 3TYJA 1H0BA 3ZSKA 4LUKA 4QDRA 5A7QA 3TBDA 1C8M2 1PNGA 3O1MA 1R1A2 4XF0A 4JDOA 4CXYA 5ABJA 4BYYA 4Y5SA 3O1SA 3CMGA 3OPTA 5I0TA 1UYXA 1OLQA 1U12A 3BI3A 1BVP1 2NPIA 1KS4A 3FLPA 3HAGA 2N7GA 1HJGA 1ULFA 1X33A 2VTXJ 2VCAA 3NL1A 2Y64A 4Y22A 5FO8B 2JDPA 1W39A 2WFF1 3JBG3 4FPOB 3VL8A 3WY6A 3MYXA 3ZSLA 1OFSA 2PAKA 4MXWB 3LQCA 3T4VA 4IV1B 2G4IA 4QGLA 3N36A 1UY0A 2B5HA 3ZXDA 4IV1C 1WZXA 5FYMA 3SC7X 5FOJB 3OBTA 4PLNA 1CAXB 4INDA 2D97A 2RJ2A 4XBNA 4IE4A 4QPWA 2JE9A 5L19A 2A1XA 3E6CC 5A33A 3C7OA 3PMSA 5KHJA 1O5LA 5C6CA 2E51A 3RG0A 4E2QA 1RHI2 3M70A 2UWCA 4QKDA 1GQPA 1V6IA 2JD4A 2I74A 4KU8A 2VOXA 3LDRA 2X5IB 5EZWA 2K0GA 3AL6A 2X5IC 1RUC1 1QJY1 5FLJA 3SKJE 4V2VA 5LBFA 5BV6A 2GP5A 4HKWA 4O65A 4UT5A 2GAUA 2WN3A 5JZGB 5IVVA 1WBLA 4QGNA 1ZX5A 4ZU4A 2OVUA 1BVVA 1Q5OA 1VIWB 1ZZ7A 2IXIA 2WFPA 4XETA 5FMOL 2XHKA 4BK4A 5HBAA 2D6LX 4LA2A 5DAWA 1OUXA 4R9AA 3PURA 3ABZA 1PM7A 3FX3A 1NCRA 3QBQA 1RMU3 2Y34A 2B9VA 2J1AA 1POQA 4L9BA 2VC9A 5F8PA 4DXRA 5FP3A 2WWJA 3J8F1 2IFRA 2VVEA 4QPGB 3K48A 2HWB3 1V6LA 1XPWA 2YFUA 5T55A 5DZEA 1SPPA 4QPGC 4ZY9A 3VDDA 3V0AA 1IS5A 1MEC2 1W3VA 5EJZB 3OUIA 4D7TA 1D4M2 2FDKA 5I8SA 1J58A 3OY8B 5DG2A 3ZX7A 4YG3A 4FFHA 1EAH3 1WLDA 1GFF2 2YU2A 3DKWA 4UBGA 3A0NA 2DFBA 4MLOA 2GALA 4QU1A 3N35A 4XFCA 1VBC2 3OEAA 5IYYA 4LMFA 1SQ4A 1BBT1 1ZNPA 2R062 5EYYA 4I3PA 3OGGA 2O8QA 3JUUA 4GB32 1BQPA 4PF1A 3VV1A 2FDFA 5CKMA 1CX1A 4NHLA 1V6KA 4AK3A 4NRPA 4LHLA 5FZ4A 1GWLA 3RGBA 1WUVA 2YG0A 1LOAA 1ZZCA 4E4HA 2E26A 3HWJA 3PJQA 3RRDA 3I59B 1RVF2 1PHMA 5H9PA 2B7YA 1CAUB 2PAEA 2RJKA 1UY3A 4L97A 4LQRA 1YFWA 5JCTA 3ZN6A 2OUHA 4FQZA 1VRH3 1PX4A 4OLLA 4XQWA 3VBOA 2ID4A 4ET7A 1EV13 2BGOA 3KHBA 3ZPOA 1QOSA 4BCUA 1B35A 5KXBA 2GN3A 1STMA 2WS93 4YW3A 3V0BB 2TBVA 5FMDA 2VL4A 4B8EA 2MEV2 4D94A 3VDAA 5L9RA 1W2UA 1WW6A 2E63A 2WNEA 1BXHA 3WQ7A 4MGTA 3NRUA 5FPVA 3UGGA 2ZKLA 3HQXA 5H9RA 2HWF3 3ST7A 5L9VA 4K9SA 1DYPA 2DVDA 1JOBA 4MVTA 4MGKE 1MZEA 3WF2A 1WMEA 4CP0A 4YG0A 3WW3A 2GU9A 3IPVB 3NMBA 4UFKA 3UESA 1QJFA 2QQKA 2XKPA 2ZEYA 4Y4RA 3VB9A 1S0DA 4LKSA 1FOD1 4XAEA 2C1FA 5I0DA 4QX3A 2P1BA 3HJRA 2QQWA 2B46X 2JJ6A 2E6VA 1KDMA 2G9ZA 4IE5A 5FRAA 4BB3A 4E2GA 2XQRA 5JOWA 5JI7A 5LA2A 4NJ4A 3O12A 2RMU2 5LBEA 3RSJA 3BYWA 3K75B 1QY4A 3VKMA 1UPSA 2GNTA 5JIAA 1LEMA 3I4IA 2D43A 4DY3A 2VECA 4CDXA 5C3PA 1DQ4A 4OMCA 4S2FA 5L36A 2VXRA 4IEXA 1US2A 1HRI1 2HWD1 1H1IA 2Y0OA 3D4KA 1JXNA 2DF7A 4YVSB 4B4PA 4YVSC 2VMEA 2VR4A 1WCSA 1QJX1 2HYXA 1PGW2 5FP4A 5FMOS 1W6PB 2QUOA 3DPRB 3FL7A 4HVOA 3T2TA 2E53A 3DPRC 1AX1A 1POV1 2WKKA 4HVRA 4BWOA 1AXYA 3MGUA 4Q4V2 5FK8A 4AEDA 4AG4A 2H6CA 3T30A 4YM2A 3FUQA 3OYWA 1UCXA 2AC1A 3PVNA 4CZSA 1ZBE3 4MSVA 3ZDVA 5FZHA 4GZ9A 2OYZA 1RUF3 2KR2A 2XLGA 2WT0A 5T5OA 1TME2 1PO22 3M1HA 3NV4A 1O8PA 1W2NA 3C2UA 4W4ZA 4M3CE 4LO6B 1QU0A 4AXOA 3LPFA 3MEPA 1C8NA 2ZGSA 3B3QE 2BWCA 3HOBA 4Q27A 1MQTB 4AF9A 3IZOA 3AMNA 3LOIA 1MQTC 5F3GA 3ZDSA 4RR3A 4CCOA 3JU9A 2BZDA 1F5JA 2DCYA 1J84A 5EFUA 4GAZA 1PMHX 5I0RA 4FXGB 1QNYA 2JB8A 4QKFA 1VBA2 3FHQA 2PHXA 1GP6A 1F4HA 4P9XA 4PCRA 4DZGA 3I97A 5KR7A 2Q30A 3O1PA 1JH5A 4I02A 3AYCA 4L0PA 1IHMA 3HBKA 3T4HB 1DQ1A 1BMV1 2ZGKA 4BHPA 5FZ0A 2UY9A 1H8TB 1T6GC 2CV6A 2CAVA 4XCAA 1H8TC 4RFT0 3ZFEA 2A71A 3POFA 3MLLA 4QDQA 3TN93 3ZIWA 2RR13 1FPN1 2JDKA 4AVTA 3ZVXA 1WLWA 3HMYA 2R1DA 4GKXA 4PLOA 1CPNA 4XEZA 1GV9A 5JR2A 1SBFA 5IFTA 1DBNA 4BXSV 2D40A 1OA3A 4H7LA 4DUXA 4ARYA 1PMJX 1JUIA 3H3UA 5C7GA 1PVC3 1OUSA 3M3EA 5FYYA 2BRTA 3GBFA 2PXJA 3WV6A 2Y6JA 1HXS2 2RDRA 3HEIA 5FYCA 3VZOA 1CVNA 1ZZ9A 4LE3A 1G7YA 5F3EA 4XAAA 4JGZB 1JYWA 3POJA 4I2OA 4XFBA 4K7JA 4JGZC 3JD72 5AC93 5FJHA 5FPUA 2J1EA 3WHUA 4AEJA 4S2HA 2IXLA 4XXPA 5LW9A 1W9TA 1E5HA 1AYM2 2FCTA 5LBBA 4FPFA 2QQIA 1DGWX 2VZRA 2OKXA 5BNPB 1JW6A 5BNPC 1VMHA 2GMPA 5FLHA 3VBUC 1OQDA 2QBXA 3APBA 1Z7S1 1ASJ3 2OZJA 4LBQD 4PBPA 3H1MA 1HLCA 4D69A 4E9KA 1AR82 5F39A 1COV1 3OY8A 4NHYA 4Y20A 3MW3A 4JTNA 1MVQA 3D82A 2VG9A 5F6LB 3G7DA 2FCVA 5IJRA 4JKMA 2BOIA 5FZ9A 1RUG2 1VR3A 3AMPA 1HJFA 2AACA 5DDJ2 2O14A 5A3PA 4WVZA 1TNFA 3CBNA 3ME2A 4EN9B 4XMIA 3FHIB 5IATA 2QZ2A 1OA2A 2XXZA 1NOVA 4LK6A 1TMF3 1X9PA 2ZOEB 5L7OC 1RMU1 2LM3A 1W04A 3GCWA 4OFGA 4PIYA 2BBAA 4COUA 2DCTA 3BOPA 5C33A 1EUTA 3SCGA 2HWB1 4EWEA 2VOKA 3LZZA 5A3WA 2ARCA 4AI9A 3DYMA 4ONUA 2W46A 2GC0A 4WBBA 2R071 4XF9A 2RJLA 4IGQA 4XC9A 3I3MA 5FV3A 2E7TA 5GZGA 1LECA 5H9SA 1UAIA 1IS6A 4UFMA 3T09A 2WZEA 4AVCA 3NNMA 4CA9A 4F7ZA 1ULDA 1YFXA 4N7UA 4TSVA 1YJKA 2P5BA 1C28A 2GN7A 2LALA 4HPKB 4ZZ5A 4IEVA 3S5AA 1MS1A 1DIWA 1C3HA 1H2MA 3MPPG 3D5OA 1GZWA 4QX1A 3ILNA 5C9AB 4OYUA 3WQ0A 3WP6A 2RM21 5K8SA 5C9AC 3ZYHA 2YC2A 3ZKUA 3PUIA 1VAKA 4Q4W1 5H9QA 1XU1A 5C3OA 1CPMA 2VMDA 3PVBB 2EIGA 5C4WB 3I3BA 3N3HA 2WFF2 1RUNA 3H1WA 5C4WC 3V64A 1IPSA 2WNOA 5JAXA 2VMFA 1UYYA 3LFIA 1DG6A 3W58A 3WNKA 2QZ3A 4XXAA 4YW2A 3WDTA 4A44A 2ZGTA 5GZCA 2Y33A 3WDYA 3MF9A 2JB4A 1GICA 3WDWA 1DCSA 5K0UA 1D2SA 4GWNA 2K9ZA 5IK5A 2XUMA 3PTYA 4YGBA 5C3QA 3LGRA 1ULEA 2DUOA 1OOPC 5DXDA 4UWDA 4CXXA 2EIBA 2YU1A 2Q1FA 2HWE1 1JZ8A 1BEV1 3TNQA 2VW2A 1W2OA 2BNMA 1U0AA 1CONA 1GMMA 3AL5A 1RUC2 1QJY2 4JHTA 2WAAA 1W9SA 5EWSA 4WM8C 2YC4A 4N43B 4TYSA 4JRAA 1YLLA 2D5FA 5CFDB 1QXJA 4N43C 5CFDC 1JI6A 1L7RA 1UN1A 2HLEA 3SLIA 2VUAA 1S2BA 3POSA 5CG9A 1Y9MA 5LK5A 1FATA 2UWBA 1UL9A 4NO4A 2GC3A 3FHAA 1O3QA 1N3QA 5CNAA 4QX8A 2EIEA 1BZWA 4NHKA 1V9U3 2PHWA 3NNGA 5FZ7A 5CIRA 1GP5A 3LA2A 4Z07A 3ZN4A 1QQP3 4LHNA 5IW0A 3AB0A 4XFHA 3S7IA 1AYN3 3TEXA 1AUYA 5EJ1B 2BVVA 1REDA 1WKYA 1XB9A 4GWMA 2Q5TA 1MQTA 2Z2SB 2DV9A 5GALA 3ZXJA 2Z4FA 2QQMA 4TLGA 4S2GA 3IAQA 3QLQA 5C3SA 4K40A 4YZ1A 3PUHA 1JYNA 2V5DA 2VBDA 4HLTA 3OEBA 4CSWA 1SG3A 3N9LA 3FLTA 1UXXX 3Q8BA 4P02B 1LESA 5JMOA 1RUE3 2XPJA 3OTFA 2BW8A 4FFIA 1GNHA 2UU8A 1BBT2 1MS0A 2Y0IA 3P1IA 4KMQA 2XQXA 3SH5A 3KHCA 2D3RA 2DVGA 2RS11 4OUEA 2J1SA 3AP6A 3IIIA 1W99A 5FBZA 5ABJB 4QM9A 3U4SA 2ZGRA 2W39A 5ABJC 4UW5A 2YDEA 2B42B 4KQ7A 1S0IA 2WYSA 3NNFA 1RUF1 5LB6A 2KM2A 5HI0A 2J42A 3J7HA 3JB4C 4Y22B 1ZREA 4W6YA 4Y33A 2WZR1 1SLAA 3NO8A 4K8FA 4YFWA 2XB6C 3UV9A 5IVJA 4QHZA 2IUWA 3BIEA 1W9WA 4NIIA 3ZXEA 4BM8A 4J6GA 4AHZA 1OPMA 1M06G 4HANA 3BTYA 4PI2A 3NJYA 4WVVA 1PNFA 1UZYA 1LGNA 2YPDA 2VCCA 3BIWE 4JGZA 4MO3M 4BH9A 3DN7A 5A6YA 3VD4A 2UYAA 1JOJA 2D98A 1LOGA 2FDJA 4QXHA 1AX0A 2AZ5A 2Y38A 1CD3G 3EJKA 4RHV1 3VKLA 1UNBA 4CVUA 5F3IA 1O4YA 2BVBA 3OCPA 4HBNA 5BNPA 4KGGA 3E5XA 1KGYA 3H3ZA 5CKQA 4LO5B 4C0BA 2FBEA 3VBUA 3JQWA 2FDHA 2LRPA 3P3PA 3WG2A 2LROA 2H6BA 3KV9A 5LY2A 1G8WA 2ZGQA 3WNLA 4WVMA 2WDBA 2B9UA 1QF3A 1Q8SA 2HEYF 1FOD2 3SH4A 2QFEA 4CP1A 5J36A 5HXMA 5LATA 3CNAA 4FOQA 1YEWA 5KXEA 5KHIA 4Q4Y3 1NCRB 2WINB 3T2QA 1PVC1 4FSJA 4JZRA 4YLZA 2BGPA 3ZR5A 4GQ7A 4XOGA 3HNYM 3O7OA 4ASLA 5J96B 1O3RA 2D3PA 3BODA 1YUDA 3AVSA 4DRRA 2EICA 4Q5OA 4M01A 4X6RB 3VDDB 3C8XA 1O4TA 1SPPB 4D0QA 5AC91 3VDDC 1GANA 5IK8A 5FZDA 1N1VA 3V0AB 3EXUA 5L7OA 1AHSA 1NLRA 1HRI2 1OBNA 2HWD2 4Y26A 1LKNA 5HV4A 1W2TA 1H2NA 4B4QA 2JDYA 3AP4A 5K9YA 1JMUB 2J7MA 3AVRA 4LNVA 3H8OA 3H50A 1AZDA 1ZBA1 5M0TA 2WUHA 1W0PA 1MS4A 3Q9OA 5CKNA 5AVAA 1OPOA 3C7EA 5DAXA 3RI9A 3ZYFA 1ENXA 1FV3A 1DZQA 2YV8A 1SLIA 2VBPA 3LA3A 1FI2A 1WW7A 5J98B 2C24A 3JQXA 2DURA 3OJBA 2CU5A 4AQTA 3AXEA 4D8MA 2VMCA 1KITA 2R041 5JMCA 3JZVA 3FLRA 1DFQA 1LHOA 5FAXA 2BV4A 2R0HA 3ZN6B 3I2KA 5CISA 4EE2A 3AJYA 2E33A 4KI5M 4MHRA 4NIHA 2WJSA 1UW8A 2X29A 3NKGA 5IAXA 1B35B 5J1XA 5FY9A 2AGSA 2ZX2A 1B35C 5C4WA 4PIXA 4CDWB 5I93A 2OW4A 5FPBA 2WN2A 2XOMA 3CO2A 4CDWC 1VB4A 4XJAA 1LODA 2YUEA 3VN4A 4Y1XA 1V70A 3MLKA 1YQ5A 2IXCA 4QHOA 5C5UA 2VZSA 3GZUC 4GWIA 5G05L 4CCLA 4CU7A 4YNIA 1BMV2 1X8MA 1UXZA 1QJEA 1KEXA 1Z0HA 2OT7A 5E1RA 2JDZA 3V56A 2ILMA 1R083 3AZXA 4CDUB 1HB1A 1G6NA 1OOPA 2PHLA 5GLUA 4AWDA 4CDUC 1TEIA 4Y1UA 5DAVA 1FPN2 1EPWA 3IMMA 4CU8A 3NJZA 5CADA 5EIYB 3R4SA 4P9WA 2V4VA 4ZXEA 2QVSB 3E1F1 1UX7A 2HWC3 1L3JA 2YMZA 5CAZA 2ZHKA 5F5IA 2GZWA 2D6OX 3MLJA 3N7JA 4UAPA 4AVAA 1NX9A 2BEOA 4RGAA 5KXCA 2DWRA 3HD8B 5DUWA 1FMD3 4WM8A 4XDOA 4BLIA 4D6RA 5A7SA 5A32B 1CR7A 3THCA 2DCJA 1UY1A 4N43A 1NQJA 2DDUA 2E9QA 5FLIA 3BU7A 1PK6B 2WWUA 4BLJA 2PQSA 3RJ2X 1NYWA 1PK6C 2B4KA 1HRV2 2BUKA 3I2OA 2JIGA 3AP7A 2X53S 2ZGOA 3DYPA 4W65A 3WW1A 1RUJ1 1Q3EA 3J7MA 4IXLA 4LT5A 1H2LA 2X10A 4CDXB 3K51A 2P34A 4FTBA 4CDXC 3FWEA 4QB6A 1R093 5JSRA 5JXGA 3IDEA 1YO8A 3WF4A 3I2DA 1JN2P 4YVWB 1YFYA 1UU5A 4LBJA 4YVWC 3AYEA 1QJU3 5KC5A 1FV2A 3U0ZA 1Z7S2 3BGAA 5D1IA 2VVFA 2BPA2 2W95A 1J3QA 1COV2 4YZ4A 5A3MA 1ULOA 4L2NA 2ADDA 3HN3A 4OCTA 5ACA3 4AR2A 3RYPA 5A7WB 1OH4A 4AEDB 1XOYA 3N7KA 4XFFA 1T2XA 3ENRA 1SDWA 4AEDC 1S0FA 4BQ2A 3ACHA 2RDNA 3OYWB 4ORFA 5FO7B 1J83A 2EXJA 3U37A 2I2SA 3NSTA 3VBHA 1RUI1 5ANQA 2DCZA 3VKFC 2BFUL 1RUD3 4RFRB 5SV5A 1PIV3 3H8RA 3WDVA 2A6VA 4N9HA 3CQOA 2F4PA 3FC0A 4KWUA 1ODMA 1YIPA 2ZZJA 2O1QA 5D8AA 3ZR6A 5CVRA 2EXHA 5FYHA 3AP9A 4RR3B 2KD7A 1CQ9A 5FUPA 4RR3C 1RMU2 1IPJA 3ZSEA 1OSGA 4HETA 5FY4A 1L7QA 2WC2A 3SCHA 2Z42A 3D6EA 4XFAA 1OKOA 1OLRA 5F2WA 3S6PA 2OQ6A 4AE2A 1RXFA 5T5PA 4QPYA 3CJXA 3NJVA 3B9CA 2R072 2K2SA 4XFIA 3UL2A 4DS0A 2OXBA 2R32A 3JB8A 1FX5A 4OHYA 3DEMA 3L9JT 3ZFEB 3AYAA 2OS2A 2Z79A 4M3CA 4FQ4A 4EV0A 1J1LA 5GKAC 5GZFA 3ZFEC 1IKPA 2VMHA 3K4DA 4AHWA 5FXXA 1JTZX 5FPLA 3R0RA 4QWNA 2ZX3A 3LEGA 2VO5A 2QQNA 1RUOA 3ETPA 1KFUL 1OI6A 2XWJB 1W3XA 3QCWA 1RUH1 2JE8A 4UOJA 4HMZA 4DEVA 2VM9A 4E8CA 5FYSA 1DZRA 2RM22 4MV2A 4AVSA 3URFA 3AZZA 2QTWB 4Q4W2 4R4XA 4YW5A 1WW5A 1ZM1A 1OLMA 4GMP1 3GBWA 1GUIA 2XMLA 4Y5TA 1XU2A 4YW7A 2G9FA 1F31A 5F9TA 4LBOA 5D21A 4Q2FA 1Y9GA 3KQ4B 3BKZA 4R52A 3LSEA 3NAPA 4GH4A 4QB1A 4FBFA 4OHZA 3T2PA 2XBO3 4XBLA 1UZ0A 2Z69A 5JXJA 1RTVA 1DGRA 1BJQA 5FYTA 2X09A 1K5MB 3MDPA 1UQXA 1K5MC 1HX6A 4XUQA 2PLV3 3KS7A 3GYDA 4MGSA 2WLPA 3VD3A 1W0OA 4OQ9A 1VAVA 3ETQA 1SFNA 1GNYA 4U36A 5F7UA 2HWE2 5JR7B 3HT2A 1BEV2 1CWPA 2YGLA 4R4ZA 3L2HA 3AKRA 1JZ7A 4Y20B 4JKKA 1OH3A 1C8M3 5A3TA 3MUY1 1R1A3 2XR4A 4YW1A 5L9BA 3WXPA 2Y8KA 2YGMA 2ARXA 4AFAA 2RS51 1V0AA 4YG6A 5FXWA 3ES1A 3OOXA 1O59A 1LENA 4R9CA 2GC1A 3WEZA 2PAMA 4UBHA 2HJIA 1KRIA 3DXUA 1I1EA 3GHMA 2FZ1A 4LBQB 2ZHMA 4Q4X3 5FYUA 4YYOA 1LGCA 2ZEZA 4TN7A 4AHXA 1NCQC 3N9MA 5AVPA 1N1YA 5ERLA 1UX6A 3WQ1A 2Y26A 2NP0A 4FI9A 1VALA 4XVHA 1PX3A 1VBB1 2ORZA 4O7XA 5EHDA 5FPXA 1POV0 1ONAA 1DQ0A 3PL0A 3O0XA 3PJYA 4LO8A 5FMBA 3DKQA 4BQ1A 3CHXA 2DU0A 2EAAA 2VAUA 1W8ZA 2D93A 3LE0A 3WG3A 2WNUA 5FOBB 4UW4A 3G6JB 1RHI3 4AEMA 4PI0A 2BFUS 4URTA 4CDWA 3WDUA 4UW6A 4ZONA 1LNSA 3U10A 1VMFA 4I09A 3E97A 3LF7A 4RN5A 4XJ8A 1QOTA 4EROA 4KG0A 1OQEA 3FMGA 3NW4A 5SV8A 5A70A 1ENSA 2RS12 4KWLA 3WR0A 1AR91 2WT2A 1IOAA 5F5QA 1GZWB 4HL0A 3ZXLA 4CDUA 4RQPC 4WVWA 4OZOA 2O0OA 3LWCA 2WNVA 2QE3A 2ZPXA 3U4XA 4NRQA 4AHYA 4QKNA 4R9DA 2WZR2 4D7SA 4CCKA 1RC6A 1AL0G 2VCMA 4B7KA 1S55A 1YQ6A 2PN5A 2JKBA 1PMIA 3U07A 1NKGA 2W68A 1W8OA 3AZVA 3F2ZA 3KGZA 4XUTA 4AQ2A 1A3KA 1WA6X 3U75A 2LUWA 4GJZA 4QX7A 2SBAA 1MEC3 3I49A 1D4M3 2BGCA 5J7MA 5K0UB 1PK6A 4HG6B 1VBD1 5K0UC 4IDZA 3WF3A 2VVDA 1AL21 1TVGA 4P5YA 1QDOA 3LAGA 4F3JA 1SACA 1LHUA 2HBUA 1GZTA 2XJRA 5FR3A 4NHXA 4QX0A 5BUVA 2ARBA 5C70A 1VBC3 3RS6A 3QACA 2HYKA 2VQUA 2PQQA 4FPKA 2R063 2Y6GA 3AZWA 4RHV2 1AVBA 4GB33 3EHKA 2WQZC 4LA3A 4ZU5A 2NQYA 4YVWA 2AEZA 2QQJA 4LK7A 3HN1A 1W8TA 4WZCA 1TZOA 4P9JA 5T3NA 1KQRA 2RV9A 1S0CA 3BTAA 3ASIA 1ZZ6A 5C71A 1WCKA 4H14A 3WW2A 4URAA 1LU1A 1RVF3 1BK1A 3L2YA 3PIGA 1UIJA 5A7WA 4AEKA 2AENA 3INAA 1UMHA 4AOCA 4R9BA 1A8MA 4BQYA 4DIQA 1PVC2 4AGVA 1LR5A 3THTA 4Z2WA 3TEYA 1U5XA 5FZIA 3SCFA 1WA4A 1DP0A 2NYYA 3BU0A 1JZ5A 1MR5A 3LEIA 2A6XA 3VL9A 2GH2A 1HB3A 3M3QA 2GNMA 5AC92 1RITA 2BYVE 2MEV3 3NKTA 2BNNA 4QU2A 3KVBA 1DZTA 3USSA 1GOFA 2B39A 2YB7A 4OUMA 3RPQA 2A70A 1REEA 1UU4A 2WO2A 3O1RA 5C5TA 4DUWA 5A1LA 3BALA 3P6BA 1ZBA2 4W6XA 1VB2A 4XF3A 1K3IA 1PO11 2CAUA 1V6OA 1S0EA 1Z78A 3UT0A 1J3RA 2UWAA 2WQ4A 5L73A 3WNMA 4YARA 1H1MA 2NN8A 2QDNA 2RS31 4Q8KA 3VD9A 1GZ9A 4C1XA 3HNBM 4RD7A 3J26N 1D0GA 4QQOA 2B8MA 2PA7A 1XNCA 4HT1T 2VCBA 1LB2A 2Q0AA 4JVAA 4I3GA 1RL3A 4CP2A 3U14A 3WSOA 2C0ZA 4XMAA 2GH8A 2VBBA 4K20A 4XZPA 2WR9A 2R042 3AZYA 5A32A 1AR71 1VBE1 3UJQA 5EV7A 1YIFA 3A22A 4Q0SA 2QNKA 1PZ7A 5JPMB 1AXKA 1UO9A 4DB5A 4QHBA 4EN8B 2R49A 1LU2A 1SZBA 4AI0A 3HQRA 4K1ZA 1S2EA 4DFSA 3BPZA 1H4GA 3UYJA 2CGPA 4EZHA 1FAYA 3JBG1 3KT7A 3I3QA 4EWDA 1W8UA 5KHKA 1WWYA 5F5CA 4XUPA 1C1LA 1U5YA 2IVJA 3AYDA 5LBCA 3ORJA 4LULA 2XL7A 3LKJA 4MHUA 2C9KA 4LBMA 1PM4A 5DPNA 1K5MA 4BA6A 2JE7A 4Q4V3 4BQ5A 4DUVA 1JYTA 3LDKA 3UETA 1WCQA 3IDCB 4OI1A 4MZUA 3VBUB 3VD7A 3WUCA 4UXAA 1BLZA 2XL9A 4GKYA 4I30A 2Y6LA 3VZJA 1W8FA 2L9LA 1ZRRA 2D44A 2XVGA 3MHZA 4HFSA 1GOHA 1PO23 4WVMB 5I91A 1BYHA 2NMOA 5JI9A 5KHHA 2E7AA 3CZJA 2WT1A 4LBLA 3GJBA 4XJUA 1ZZBA 2VTFA 1QIQA 2W9XA 2Z5WA 3WUDA 3SQOA 4CU6A 1JYCA 1RB8G 4LORA 3QD6A 4QGMA 1WMDA 4CTEA 5JOZA 3GF6A 2WA4A 3M8LA 2DUPA 1RUJ2 4LBQA 5AFEA 3VKNA 1VBA3 1CX4A 2AR6A 2PFWA 4DO0A 1CJDA 1NCQA 1ND2A 3IIAA 3KF5A 5L7OB 2VMGA 2XBO1 3POWA 2H0BA 2V09A 3MF6A 2VZ3A 3POGA 4V1PA 5LASA 3WD5A 1XYOA 4MYEA 4H7MA 5DAQA 5DUVA 2A73B 1WGPA 2R7EB 1S1AA 2PLV1 3C7GA 4GALA 3VBRA 4YGDA 3KB5A 1G9BA 2VZVA 1VJ2A 2JG9B 4QM8A 4EYUA 1XNBA 2CSGA 2JG9C 3VKOA 4NIGA 4ATEA 3WLUA 5CG8A 3OPWA 3VBSA 3FFZA 1XE0A 1EAH1 1MVEA 1W8HA 3NV3A 3RDIA 1H8VA 3IM0A 2XJTA 3KCYA 1RUI2 3HBZA 3IT8A 1VE0A 3DXTA 3N9QA 4QX5A 2J1TA 1HXS3 5JXHA 5DG1A 1DYKA 3J7NA 4Z82A 3WG4A 1YQCA 3B69A 1GR3A 1UU6A 4KBBA 4LIUA 4RQPA 4UI9L 3WG1A 4Q4X1 4N7IA 4ASMB 2P6HA 3RYRA 2NLRA 4OUSA 4N8MA 2V4AA 2E32A 4IEZA 3WOGA 3TEZA 4Z92B 1E57A 3EYPA 3WP5A 4XACA 5ISLA 4Q0UA 2ZABA 2W92A 5FPAA 3V65A 1Y9QA 4J1XA 1H30A 1VRH1 3SEPA 4J1WA 5FZ1A 4HSLA 5FKBA 1EV11 3MIDA 1H6YA 2GC2A 3SEEA 5FZGA 2DVBA 1MS5A 3NWKA 4FPJA 2WS91 4XPVA 1CAWA 1OOPB 2HKXA 4KG8A 4F8AA 5GZDA 2CWSA 1WMXA 3GALA 2EXKA 3MIBA 1JYVA 3O1VA 3CJIA 4A7ZA 5DDJ3 1TNRA 1D2QA 1RUH2 1FNZA 3EO6A 4XBQA 5LZ6A 4HZFA 4JCKA 3KSCA 4WM8B 1U5ZA 2HWF1 5F1RA 4RSUA 3N4MA 3WT3A 2OPKA 1JU4A 4Z1VA 2Y6HA 1GU3A 4OULA 2YYOA 5FZCA 3AJZA 1HB2A 3Q8CA 4NWWA 4BZ4A 1F8VA 5C8CC 4NE9A 4D6SA 1Y3TA 4LITA 4JQRA 3VLBB 4O9EA 3HIFA 2W52A 4A4AA 4CCJA 4BQ3A 1UYPA 2P3JA 1N1TA 3AM2A 1D4M1 3RMXA 1K5JA 3O1UA 3GNEA 1VLNA 2GMMA 2A3XA 2VZOA 3EQEA 4LHSA 3ZXFA 5A3LA 3J8F2 3O0VA 2UYBA 4JDMA 4XW3A 1HQLA 2CDPA 1SHWB 2WBKA 2WZPP 4L8QA 1YRZA 4PQ9A 5EP9A 3IBMA 4DQAA 5D2AA 4YZ3A 2R061 4FAHA 4V2WA 2B45X 3GGLA 3LCPA 5JIUA 1FT9A 4YM3A 3VBRB 2RS52 4AVVA 5A3UA 3VBRC 2VZ1A 2HH9A 3VBHB 2C5DA 4OHXA 3POYA 1Y43B 3AMMA 3H3LA 4TWTA 1RJ8A 2VU9A 1N1SA 2GDFA 3VBHC 3O1TA 5GLWA 4XJ9A 4BIFA 3PUSA 3ZXKA 1YJLA 1OD5A 2WFF3 4CEYC 1KJRA 2ZTNA 3MV01 3U78A 4FFFA 4LO4B 5D8AB 2JXAA 5D8AC 4Q1RA 4YWAA 2XONA 4DPNA 3H8XA 1ZBE1 2VZQA 4P9IA 5FZMA 2FZ2A 5GZEA 4BDVB 1PVXA 1L7LA 1VBB2 5FXVA 1NQDA 1W28A 2OQ7A 3N9PA 3LEMA 3PU3A 1ULPA 4PQQA 1NT0A 4QPIA 3RJRA 1FYUA 5B2GB 4KU7A 4COYA 2A7AA 1K45A 3WNNA 4PBOA 1XJAA 4ZS3A 3EMRA 5FZ3A 1LEDA 2ENRA 4QQ2A 4MGYE 3SXWA 3H1YA 3DF0A 1QJY3 4M3CB 4B3NA 1GKBA 1N3PA 2YY1A 4Y3OA 2ZXQA 1SBEA 1RINA 3AMQA 3J7LA 1AR92 2JD9A 4LTAA 3LB9A 1E5IA 2WO1A 4XF4A 1WBFA 3KCXA 3IKWA 5BNOC 4MGQA 5C3RA 3TN91 2RR11 5LWBA 3EBRA 2CGNA 4E27A 2F6BA 2C6SA 5FQ0B 2QJVA 1QXPA 1AR63 3I2JA 5FBJA 4TZDA 2VW0A 5CFCA 3T08A 3A4UA 2OZ6A 3NAPB 4GH4B 4CUGA 3PHMA 2IZWA 3MO4A 3NAPC 4GH4C 1OD3A 3LFMA 3ZPYA 1F35A 1VBD2 2YC0A 4AW7A 4A42A 3SHRA 5FZFA 1AL22 1QMJA 4OZXA 1IQAA 1H4HA 1NE6A 4ZHNA 5IFPA 2BTVC 3D3AA 2ZX1A 1W6QA 4XHXA 3ZOIA 4EZ4A 3A23A 2IFWA 1CJPA 1PGSA 2H0VA 2YPJA 3I2FA 2JDNA 3NVCA 4W6WA 3S5QA 2YZ4A 1BBT3 2XJPA 2YFZA 1LTEA 4CUAA 2A5ZA 1ZA7A 1ZRCA 5LA9A 1YI9A 4Q4V1 5IUQA 1QJX2 4IW3A 3DYOA 3KZ4C 4O61A 5I8YA 2JG9A 1S0GA 1KS5A 3D0SA 4AQ6A 3S57A 4OI0A 5B4XA 1ASJ1 4PHZA 4C90A 1OA4A 5KXDA 4CCNA 1PO21 3PIJA 2J1RA 4NWVA 2E31A 1ZVFA 3I8TA 3PTRB 5FYVA 5F6KA 3ZYGA 1XSQA 1UZVA 4PT6A 1OF4A 3AP5A 3ZFFA 1WLCA 2QQOA 4FOVA 2D3SA 3AKTA 1DYOA 2VTXA 4TLFA 3ZYIB 4CPBD 1W6OB 1JZ4A 1UZZA 2JENA 2EAKA 1QGLA 1YC61 3WCRA 4N53A 3AC0A 1IPKA 4Q8LA 3TOJA 4DEQA 1O3TA 1U5IA 4B7EA 3ACLA 5KBFA 4JDNA 1TMF1 2P37A 2WNUB 5FYZA 4MH0E 3SNMA 4PLMA 1LJ7A 2WNUC 3D0JA 1CIWA 1X8EA 4NRMA 4QB2A 1Q8VA 5JLVA 1PO12 3OSDA 5HXVA 3HNMA 3AMHA 4DOUA 1I3HA 3RWKX 2ZHLA 4AQSA 1HN1A 5F3CA 3U1XA 3ZKYA 2RS32 1VPHA 2ZACA 4MXVA 3VBFB 4BU2A 1ZRFA 3VBFC 3R6SA 1LAJA 1FOD3 3NQHA 3ACIA 3K4AA 4IE7A 2DCKA 4ASKA 3T1LA 3O1OA 2WNVB 5JVVA 2WNVC 5DAPA 1VMJA 5A3OA 1AR72 1VBE2 3CDZB 3D8CA 3KV5A 3POBA 2SLIA 4COZA 5FWJA 3O5SA 3OF1A 1DF0A 4FCAA 2V73A 1TE1B 4E4ZA 4JGYB 1MZ6A 2WYFA 2OIIA 1OC1A 3H7JA 4PDWA 5GLTA 1DQ6A 4JGYC 4Z2AA 5FY5A 3HPNA 2V5YA 1HRI3 1AXZA 2HWD3 2VOVA 4RGKA 2ZGMA 3IAPA 1ND3A 1W0NA 4B4RA 3PVOA 3JBG2 2ES3A 3B94A 4CP9A 1MACA 1UY4A 4MX3A 2VNOA 2XJQA 1VRBA 5FPZA 5C8CA 1LHWA 2PTMA 1IZ3A 1DLCA 5F37A 5HPOA 4FPGA 5FUIA 4LLFA 2GSYA 4ZXKA 4CXWA 1KXGA 1LULA 4CRQA 3ZIXA 4A2UA 4BQ4A 3TEWA 1POV3 3A7QA 4GMP0 2DFCA 1DGRN 2D6PA 2JX9A 3RMYA 4BMBA 1PGL1 3ZO0B 3OUJA 4H55A 3T0DA 3FBYA 4K21A 3WINE 3ZFGB 3RZMA 3ZFGC 4A45A 1Q56A 4IUGA 3X29B 4DNYA 2VUCA 3ZYBA 5F5AA 1DGLA 3K2OA 2W1WA 3CU7A 2VD7A 3NV2A 2BP6A 2Q8CA 1ALYA 5E88A 3VZLA 3H9AA 4XCBA 1MZ5A 1HQWA 3SKVA 2XG3A 3AXDA 4A7YA 1NZCA 3A0KA 2O8OA 4FPEA 2FMYA 5FZOB 4K8RB 4LE4A 4ARXA 4YZ5A 1JZ6A 4EJRA 2OUJA 1D4VB 2JDMA 3NJXA 4HVQA 1DLLA 3MW4A 4FPCA 5FREA 2YBPA 4XUOA 4DINB 2XH6A 3KM5A 4CEYA 2UY8A 5FCCA 3FE5A 4XF1A 4CCCA 3BN6A 4DXTA 1IQDC 5T5JA 2FMDA 1V9U1 4FTEA 2JICA 1I5PA 4QQPA 4XIOA 1X9TA 5FZAA 2Q8DA 4Q29A 2ARAA 2QQLA 4IGPA 1QQP1 4LKDA 1H6XA 2A6ZA 4KBZA 4NIAA 1UIKA 4A3ZA 5CEHA 3VDBA 3W5MA 4CDQA 1CESA 1XXNA 1URXA 4I0AA 1AYN1 2HWB2 1UYZA 2IXJA 3O0WA 1FPN3 2BNOA 2G19A 2VQAA 2NZ9A 4LLOA 5DN2A 1YHFA 4E4SA 4EWAA 3ZN5A 3LIGA 3MICA 2A3WA 1EAH2 4XYXA 1I6XA 3GBGA 2XHNA 4R8HA 4M4PA 4XFGA 5J48A 1HV0A 4LXLA 2JDUA 4TTGA 1O91A 2K46A 1HIXA 3MIGA 1RUE1 1NXMA 4E4DX 5DABA 1LCLA 1RIRA 2VE1A 4B29A 2LW8A 1UOGA 2XJVA 1NXD1 2R0FA 4QT6A 1HRV3 4X8NA 1F5FA 4Q4X2 2GNDA 1CAVA 4Y24A 2W47A 2PHTA 2WSUA 5BNOA 4IEPA 5IVEA 1ODNA 1BHGA 3M3OA 2XGXA 5A7NA 3BOWA 4IEWA 4IL7A 4L99A 2JG8A 3RZKA 2UURA 3OBRA 2IWGB 1FXZA 4LBNA 5FQ0A 2HEWF 1Y4WA 3FJSA 1OXCA 3MIFA 4K1YA 4WM7A 1MS9A 4LPLA 4Y5Z0 3PUAA 5A6QA 5FO9B 1SLCA 1VRH2 1X7NA 4BXFA 4XDPA 1Z7S3 5FK7A 1EV12 4UFLA 1HKDA 3ZYPA 4CUBA 1JYIA 4LKEA 3IWZA 4X8PA 1COV3 2WABA 3DV8A 2WS92 4PF5A 1GWKA 1M4WA 3TB0A 4Y1YA 4JHZA 4HK9A 3T0AA 4I0BA 1A78A 3RFRA 2OA2A 2DYCA 4N9IA 2MPFA 3VUOA 1OURA 3A21A 1DQ5A 2J22A 2VNRA 4QD2A 1SBDA 1QNWA 3ES4A 1UF2C 4YM0A 2RE9A 2FQPA 3MFAA 1UMIA 1XNAA 4YGEA 5IK4A 1TQ5A 3Q8AA 5JZGC 3T1MA 3F95A 2HWF2 5LCWL 2CTVA 3OG2A 4META 1QXRA 3I3DA 5CU1A 5FP7A 4CE8A 3ZMNA 5IVCA 2VXJA 1DDLA 4AFCA 1XYNA 4OI2A 2DUQA 5JPNB 3BB6A 4F83A 2BERA 3EB7A 3I7DA 3SH3A 1AR61 4BIOA 5DMYA 1KFXL 2HBTA 1W2AX 3I2HA 1KDKA 5FTTC 4C8DA 1NCQB 3UGHA 1B09A 1Q8QA 1AF9A 1XNKA 1ND2B 3AFGA 3PDQA 4Q4Y1 4IGOA 1ND2C 2I45A 2I07B 3ZM8A 3MFCA 1CN1A 2JECA 2R073 1W6OA 2PELA 1X82A 2CHHA 3T2OA 1NA1A 2ZAAA 4A41A 1GYKA 1NG0A 2D6NA 4YFZA 2ZBJA 4IERA 5BNNB 3IDBB 1MS3A 4KH9A 4XILA 1W6NA 5BNNC 3RZJA 1OT5A 4YW6A 2W1SA 2JIJA 1SDDB 1EUUA 3LPGA 4RGGA 5FZKA 3VBSB 5FMCA 4BQXA 5JSPA 1G9AA 3VBSC 2PMWB 4FPHA 3PU8A 1A34A 2FDGA 1GNZA 4QXKA 1NY71 1PZ9A 4HK8A 2ZMKA 5ANNA 1CGPA 2RM23 3HT1A 5E8AA 4DY5A 1NZIA 4P14A 4Q4W3 2X05A 4HOOA 3OBZA 4W50A 4G9SB 5FZBA 3H0OA 3VBFA 1J1TA 1ENRA 3RVHA 1CIYA 4IE6A 5T5LA 3M3CA 4RQPB 5FIXA 5JUVA 2Y6FA 5LRSA 1APNA 1UZWA 1ZBE2 4A6OA 1RUF2 3WF1A 3UKNA 2D7FA 3TAYA 4OI4A 5I8TA 3HR9A 4OVEA 4G3YC 4LO7A 5LA1A 3LOBA 2W87A 3UNPA 5KC6A 4COVA 4JGYA 2V72A 3KV6A 3UK9A 1V6NA 4JAAA 4WZFA 1QKQA 1F2NA 3BTZA 3ON7A 2HWE3 2DTYA 1BEV3 2RDQA 1GWMA 2W08A 1ZZ8A 4W8JA 2ZX0A 3I3EA 3MPBA 1CAWB 3OGVA 2VMIA 2J1VA 2G1MA 2W1QA 4LIVA 2D6KA 1LOFC 1C5HA 2WIIB 3B5LB 3K3OA 1HW5A 4B1LA 1V00A 1MS8A 2DVFA 2XJSA 4LR4A 2YBSA 4FTSA 2ZGLA 3CJIB 5FWEA 2PHRA 3CJIC 3DCQA 3ZXAC 3MBWA 4JTOA 1I9RA 1R081 4PIZA 2P3KA 3TN92 2ZKNA 3I2GA 2RR12 3ZFGA 2CDOA 3C3VA 3GDBA 5IVBA 1UY2A 1LRHA 2HWC1 2W3JA 3E5UA 5IT6A 1JZ2A 4Y4YA 2GP3A 2PHDA 2D6MA 4UF0A 2MHFA 1JODA 3WQBA 1FMD1 4FXKB 4M3CF 5FZOA 3KVAA 2VH9A 3LA7A 1ZRIA 1UOFA 3OD0A 3KT1A 2A75A 3KD4A 1REFA 4FVVA 4UW3A 1LOCA 4QAWA 2XLAA 4GULA 2YHJA 4XUNA 1MPXA 4G4FA 3WNOA 3MIHA 1W6MA 3VZNA 3IMNA 2Y60A 1Q8OA 4RS5A 1IGOA 3FBMA 3OGSA 4AZZA 4AGRA 1J59A 1KJLA 1R091 1EY2A 2RS13 2JDHA 3R05A 2BJSA 4OMDA 5K4LA 3N9OA 3WDXA 4AAXA 2ZJCA 4DRVA 1ST8A 4GD4A 3MW2A 2EXIA 3JXSA 1LHNA 1VP6A 4EN0A 2QQVA 5JOYA 5DZGA 3WCSA 1QJU1 4CEWB 1ASJ2 1XNTA 4XDQA 3UJOA 3ZLIA 5GM0A 4CEWC 2FCUA 1E5RA 3USUA 3OGJA 2WZR3 3KF3A 5IAVA 5ACA1 1JZ3A 2KA3A 1I5ZA 4RA0A 2AUYA 4CCMA 3OD4A 3MV11 3B00A 1ULGA 2AEYA 4Q0QA 5I0UA 2DU1A 2G9GA 2JDAA 3AX4A 1AJKA 3VDCA 1RUD1 1PIV1 4XJZA 4GXLA 5F32A 5IK7A 2RMU3 3GZTB 5T52A 3UGFA 2VZPA 4QPIB 5EXOA 1D0HA 5JXIA 4D7YA 3RZGA 2P2KA 4QPIC 1OLME 2ADEA 3M7AA 4XQDA 2DVAA 4MXWA 5EYXA 1R1ZA 4IV1A 4DXSA 1TMF2 4L11A 5CA6A 1JU3A 2WA3A 4SLIA 1RJ7A 2XJUA 1V6MA 1SFYA 2NM1A 1CAXA 2YBKA 1YFUA 3JCIA 3C7FA 4RHV3 5GLVA 3KGLA 1DU3D 2VULA 4H2AA 1RXGA 2VZTA 2Y6KA 2DBIA 1X50A 2P6CA 2XVKA 5FYIA 1W8WA 2CNAA 2PYTA 3S0MA 4NHMA 3W20A 4AI3A 2Q8OA 2ERFA 4RL7A 1LOBA 3WP3A 5IWFA 2CWMA 2X5IA 3KCCA 1UPIA 4XIKA 4ES8A 5A1AA 2AH2A 5LK7B 5LEJA 5EJ3A 3UKVA 4KGQA 3FFQA 1EYBA 3KQRA 1TME3 4ES9A 2WO7A 2XLFA 5E6HA 5JZGA 4KWKA 1AJOA 5CFCB 1HRV1 2ET1A 4ISRA 3ELNA 3VHRA 3E5QA 4YZ2A 3I2IA 3O14A 5CFCC 3ATGA 1QHDA 4JRLA 4YSFA 1BCXA 4GWJA 3THPA 3BCWA 1UKGA 2TUNA 4IEQA 3WZ1A 2P3IA 1SEFA 4DMIA 1QEXA 4UFJA 4C91A 1ZA4A 1YXWA 5BYNA 4LHKA 3AFKA 1EP0A 3BUCA 1QJZA 1W6QB 1OKQA 1ZBA3 2TNFA 4GJYA 3KMHA 4QPGA 4OHVA 4QXBA 5A6XA 2C9AA 3DGTA 2P17A 1G86A 5JSOA 3CL1A 5FJKA 2ZS6B 4CCDA 1JOPA 3OUHA 3R4UA 1PGL2 2YXSA 3P5BA 5FZ6A 1IG3A 3DUIA 3NNLA 1OVPA 4JC1A 4E2SA 3BTXA 4M0HA 2ET7A 1GSLA 5E89A 3W21A 1LGBA 5FY8A 3PUQA 1QOOA 1YCIA 5BNNA 1QWRA 3S7EA 5J09A 4AI1A 4ZZ8A 1YYNA 4Y1ZA 3TRSB 1UWWA 2R043 3B02A 2ZGNA 1XE7A 1MZFA 3J9SA 2LS6A 1XNDA 1C8M1 4NAMA 4NN0A 2HEVF 1R1A1 3ZFFB 3GCXA 4HXCA 3ZFFC 2WLQA 4AFDA 4TXWA 1S0JA 2CL2A 4ITCA 1GOGA 1IG0A 4NPMA 4XTMA 3AKQA 4QQLA 1WD4A 3QH7A 4BE3A 3I59A 1JYXA 1SMVA 4QMAA 2JEMA 3CIHA 3KT4A 2P4EA 4MUVA 4N53B 4RYDA 1CAUA 4COWA 4N53C 3P3NA 2EALA 3LSDA 1HQNA 2WQ8A 5IHRA 1V9U2 4CCEA 2NMNA 1IS3A 3JD73 3FN9A 3W59A 2BBVA 1JUHA 1QQP2 1HN0A 4QXCA 4ZU7A 2R6QA 4NAOA 1A8DA 1AYN2 4JKLA 1AYM3 2VPVA 5IVYA 3V0BA 3WX5A 1CZSA 4XTPA 1O5UA 1XC6A 4AI8A 4C0HA 4Z8BA 4LEJA 1P8JA 3IDAA 1K12A 4O9GA 2A6WA 4MGIE 3LD8A 4S2DA 1NE4A 3PLQA 1NLSA 4KWJA 4FOYA 5AFBA 1AR83 1IKQA 1RHI1 2BWAA 2QQUA 3B9IA 4B1MA 3KLSA 2RDSA 1LOFA 5GLZA 1RUE2 2JKXA 3RQ0A 2KXLA 2VQ0A 2RG4A 3IN9A 1RUG3 1ZYBA 5DUUA 2VJXA 1ULCA 2VOWA 4P9GA 2IXHA 2DTWA 3AKSA 3NV1A 3IPVA 3WNXA 3K77A 2ZA9A 2X8KA 4K6BA 1RUJ3 1UOBA 2QCSB 2Q1ZB 5FZ8A 4PDWB 1HV1A 4DXZA 5LEKA 2ZMLA 3MZHA 4PDWC 4IETA 4IEYA 2F4LA 5IVFA 5JOXA 3WP4A 2YROA 1ND3B 2VZUA 3Q8EA 3ZSJA 1OMIA 3DECA 1ND3C 3RZZA 3S30A 5LA0A 1W90A 4CP9B 5C8CB 3ILFA 4GIQA 5FZEA 4BISA 2F17A 1BKZA 5BXXA 4FP2A 3GXUA 1N3OA 2GNBA 2XKOA 2C26A 1MEC1 1W03A 4YW4A 4QQHA 1DGWA 1O7FA 4IESA 2LTNA 2CGOA 4HN0A 3MI8A 4YVSA 5GJ6A 4ZPIA 4D6QA 4BPZA 1JHJA 1RUI3 4FOWA 4NMIA 1W9YA 2ZHNA 4M00A 1W6PA 2VNGA 1VBC1 1N47A 3DPRA 3SMHA 3LDBA 4NPLA 5CB7A 1IS4A 4GB31 3WNPA 5A3NA 5A6ZA 3PNAA 4MOAA 2ZGUA 1K42A 2DBNA 1GQHA 2ZX4A 4IE0A 4NR1A 3VHNA 1WD3A 2CYFA 3AK0A 4Q1PA 4CEWA 5HV0A 1VAMA 3ROUA 1AR62 2BU9A 4CEYB 1WCUA 1O6UA 1WMFA 3PMEA 4P00B 1C4RA 1RVF1 1QH7A 3HVDA 4P9YA 4A6SA 5CZKA 3B93A 1C57A 4AGGA 4JV4A 4Q4Y2 3GM8A 3VGIA 3VZMA 3H7YA 3THDA 4BJ0A 3RWNA 1SLLA 1LHVA 4YM1A 3W5NA 3VHPA 5LY1A 1EPZA 1BK0A 1DQ2A 3QOPA 3N7MA 2ZCWA 4CDQB 4OQ8A 1KD7A 4AI2A 3RZHA 1O3SA 4CDQC 1SCRA 5BPXA 1GZCA 4LBKA 4ZS2A 3QH6A 4ZKTB 4HONA 2RHPA 3RZLA 2MEV1 3OPZA 2PHUA 4IV3B 2FHRA 4JX0A 2XVLA 2W94A 3WVJA 4IV3C 4NPRA 2Q1MA 1XBFA 2A6YA 1PZ8A 3J4UH 1RUH3 1H8TA 3HQUA 1NY72 3ITQA 4CYDA 1RUC3 1A6CA 3TWIA 5HCFA 2E7QA 4PJYA 4UYBA 4MG2A 3E6BA 4GMP3 1T6BX 2VGDA 2VNVA 4OHWA 1OFNA 1Q43A 4K3UA 1RYYA 3ACFA 4MGZE 1NAEA 1CAVB 1W05A 2C4XA 3LEKA 5B4NA 5BNOB 4J25A 1S4CA 2Q4SA 2W0XA 4FT8A 4YRDA 2R30A 1SLBA 2JG8B 2XWBB 3WW4A 2JG8C 5HCAA 4EN7B 5CBLA 4FPLA 4XURA 4XHBA 4A7KA 1TG7A 1WW4A 3K3NA 2RMU1 4WM7B 3J8F3 3BVCA 2EVXA
chains in the Genus database with same CATH topology
5DUXA 4WM7C 5A33B 3VHOA 4YGCA 4LUMA 5TSWA 1G9FA 3GHNA 1SCSA 5E16A 1LOEA 2VY0A 2TEPA 1XE8A 1JHNA 2RS53 3FZ3A 5T54A 2D5HA 2QKDA 1PGW1 4A3XA 1G9DA 4XJWA 4GA9A 3ZYJB 1H1AA 4WV8A 1R082 4FAGA 4HKOA 4FP3A 1QH6A 4C1WA 2AREA 4NOTA 3SISA 1UD1A 5I0SA 2BQPA 2AYHA 2WWSA 1NCRC 2HWC2 5J37A 2ETEA 4AYUA 1TME1 1VBB3 3M3IA 3E6DA 3PVEA 4NVPA 3UKTA 4Y1VA 1FMD2 4AFBA 2MNGA 3TNPB 3ALQA 1DHKB 5DZFA 1H9WA 1UKRA 3B01A 1V6JA 4IEUA 2QDRA 5JDBA 1H9PA 1HDKA 1NA1B 1QDCA 4M0NA 1NA1C 3CLPA 3ZMOA 1VBA1 4Q0PA 3WHTA 3B7MA 3M4FA 4HKLA 1W6NB 1G9CA 1R092 1AR93 5KWRA 3M2MA 2WL1A 4AVBA 4IQPA 5KHGA 4I0WB 5K7PA 1QJU2 1RGSA 3ECQA 3ILRA 4H3WA 2EF6A 2GMEA 1GLHA 1YWKA 1AX2A 5ACA2 4HPKA 2ZZQA 1SLTA 3VBOB 2VUJA 4EN6B 4IEOA 5C9AA 3VBOC 5FDBA 3RNSA 3CF6E 1RUD2 1PIV2 1VBD3 1Y7BA 4BOWA 1HXS1 4D3WA 1AL23 2VW1A 5C8WA 2EA7A 1C5IA 5T50A 1JBCA 1ZRDA 1ENQA 3RI8A 4ISQA 3AKPA 3JD71 3CEWA 4ATFA 4XE9A 5BY5A 3ZXGA 1YI7A 1AYM1 3R4DB 4BMEA 1OQ1A 5FFOC 1QJX3 2IC1A 4L92A 2A3YA 1AR81 3ZSMA 3VZKA 4N90A 3FUOA 4I01A 1O4ZA 3ZYRA 3MIEA 1X36A 2R1BA 3I54A 1XYPA 1FNYA 4P5HA 5CFDA 1S2KA 5J3UA 1RUG1 4P9LA 1S0BA 4Q0VA 3W9AA 1XRUA 1C1FA 5DDJ1 1WCDJ 4AFMA 4HN1A 2WSVA 2QQPA 1J3PA 5JWPA 2ZGPA 5HCBA 1WLTA 2ZAHA 4X6QB 3N7LA 2R16A 1UMZA 4U2AA 4Q26A 1W6MB 1PO13 2IXKA 1OHFA 2CY6A 4SBVA 4RS5B 2XBO2 4RS5C 2RS33 3DL3A 2ZMNA 4XQ4A 4KNCA 3RYKA 4KL1A 3SITA 2ATFA 3H8UA 3U11A 2PLV2 3GZAA 1GBGA 5BNQA 1F9KA 1Q8PA 4FPYA 1XQNA 1YNAA 4HSJA 1GQGA 2PHFA 1H2KA 4IV3A 1AR73 1VBE3 4FO9A 5LRRA 3USUB 3TYJA 1H0BA 3ZSKA 4LUKA 3TBDA 1C8M2 1PNGA 1R1A2 4XF0A 4JDOA 5ABJA 4BYYA 5I0TA 1OLQA 1U12A 1BVP1 2NPIA 1KS4A 3FLPA 3HAGA 2N7GA 1ULFA 1X33A 3NL1A 4Y22A 5FO8B 1W39A 2WFF1 3JBG3 4FPOB 3VL8A 3WY6A 3MYXA 3ZSLA 1OFSA 2PAKA 4MXWB 4IV1B 2G4IA 4QGLA 3N36A 5FOJB 2B5HA 3ZXDA 4IV1C 3OBTA 4PLNA 1CAXB 4INDA 2D97A 4XBNA 2JE9A 5L19A 3E6CC 5A33A 3PMSA 5KHJA 1O5LA 5C6CA 2E51A 3RG0A 4E2QA 1RHI2 3M70A 2UWCA 1V6IA 4KU8A 2JD4A 2I74A 2VOXA 2X5IB 5EZWA 2K0GA 2X5IC 1RUC1 1QJY1 5FLJA 5BV6A 4HKWA 2GAUA 5JZGB 1WBLA 4QGNA 1ZX5A 4ZU4A 2OVUA 1BVVA 1Q5OA 1VIWB 1ZZ7A 2IXIA 2WFPA 4XETA 5FMOL 2XHKA 5HBAA 2D6LX 4LA2A 4R9AA 1PM7A 3FX3A 1NCRA 3QBQA 1RMU3 4L9BA 3J8F1 2IFRA 2VVEA 4QPGB 3K48A 2HWB3 1V6LA 5T55A 3VDDA 5DZEA 3V0AA 4QPGC 1IS5A 1MEC2 4D7TA 1D4M2 5I8SA 1J58A 3OY8B 5DG2A 3ZX7A 4YG3A 1EAH3 1WLDA 1GFF2 4UBGA 3DKWA 3A0NA 2DFBA 4MLOA 2GALA 3N35A 4XFCA 1VBC2 1SQ4A 1BBT1 1ZNPA 2R062 5EYYA 4I3PA 3OGGA 2O8QA 3JUUA 4GB32 1BQPA 3VV1A 4NHLA 1V6KA 4AK3A 4LHLA 1WUVA 1LOAA 1ZZCA 3HWJA 3PJQA 3RRDA 3I59B 1RVF2 1PHMA 5H9PA 2B7YA 1CAUB 2PAEA 2RJKA 4L97A 1YFWA 5JCTA 3ZN6A 2OUHA 4FQZA 1VRH3 4OLLA 4XQWA 3VBOA 1EV13 4BCUA 1QOSA 5KXBA 1B35A 2GN3A 2WS93 4YW3A 3V0BB 2TBVA 4B8EA 2MEV2 4D94A 1W2UA 1WW6A 2E63A 2WNEA 1BXHA 3WQ7A 2ZKLA 3HQXA 5H9RA 2HWF3 3ST7A 4K9SA 1DYPA 2DVDA 4MVTA 4MGKE 1MZEA 1WMEA 4CP0A 4YG0A 3WW3A 2GU9A 3IPVB 2XKPA 1S0DA 1FOD1 2C1FA 2B46X 2JJ6A 2E6VA 1KDMA 5A32A 5FRAA 5JOWA 4E2GA 5JI7A 3O12A 2RMU2 3RSJA 1QY4A 3VKMA 1UPSA 2GNTA 5JIAA 1LEMA 3I4IA 2D43A 4DY3A 2VECA 4CDXA 1DQ4A 5L36A 4S2FA 2VXRA 4IEXA 1HRI1 2HWD1 1H1IA 2Y0OA 3D4KA 1JXNA 2DF7A 4YVSB 4B4PA 4YVSC 1WCSA 1QJX1 1PGW2 5FMOS 1W6PB 2QUOA 3DPRB 4HVOA 3T2TA 2E53A 3DPRC 1AX1A 1POV1 2WKKA 4HVRA 4BWOA 1AXYA 3MGUA 4Q4V2 4AEDA 4AG4A 2H6CA 4YM2A 3FUQA 3OYWA 1UCXA 3PVNA 4CZSA 1ZBE3 4MSVA 2OYZA 1RUF3 2XLGA 2WT0A 5T5OA 1TME2 1PO22 3M1HA 3NV4A 3C2UA 4M3CE 4LO6B 1QU0A 4AXOA 3MEPA 1C8NA 2ZGSA 3B3QE 2BWCA 4Q27A 1MQTB 4AF9A 3AMNA 3LOIA 1MQTC 3ZDSA 4RR3A 3JU9A 1F5JA 2DCYA 5EFUA 5I0RA 4FXGB 1QNYA 1VBA2 2PHXA 4P9XA 4DZGA 4PCRA 2Q30A 1JH5A 4I02A 3AYCA 1IHMA 1DQ1A 1BMV1 2ZGKA 4BHPA 2UY9A 1H8TB 1T6GC 2CV6A 2CAVA 1H8TC 4RFT0 3ZFEA 2A71A 3MLLA 3TN93 3ZIWA 2RR13 1FPN1 4AVTA 3ZVXA 1WLWA 3HMYA 2R1DA 4GKXA 4PLOA 1CPNA 4XEZA 1GV9A 1SBFA 1DBNA 2D40A 1OA3A 4H7LA 1JUIA 3H3UA 1PVC3 3M3EA 3GBFA 3WV6A 1HXS2 3VZOA 1CVNA 1ZZ9A 4LE3A 1G7YA 4JGZB 4I2OA 4XFBA 4K7JA 4JGZC 3JD72 5AC93 3WHUA 4AEJA 4S2HA 2IXLA 4XXPA 1AYM2 4FPFA 5BNPB 1DGWX 1JW6A 5BNPC 2GMPA 5FLHA 3VBUC 1OQDA 3APBA 1Z7S1 1ASJ3 2OZJA 4LBQD 4PBPA 3H1MA 1HLCA 4D69A 4E9KA 1AR82 1COV1 3OY8A 4Y20A 3MW3A 4JTNA 1MVQA 3D82A 2VG9A 5F6LB 3G7DA 1RUG2 1VR3A 3AMPA 5DDJ2 4WVZA 1TNFA 3ME2A 4EN9B 4XMIA 3FHIB 2QZ2A 1OA2A 1NOVA 1TMF3 2ZOEB 5L7OC 1RMU1 2LM3A 4OFGA 4PIYA 4COUA 2DCTA 3BOPA 5C33A 3SCGA 2HWB1 4EWEA 2VOKA 3LZZA 4ONUA 2GC0A 4WBBA 2R071 4XF9A 2RJLA 2E7TA 5GZGA 1LECA 5H9SA 1UAIA 1IS6A 4AVCA 4F7ZA 1ULDA 1YFXA 4N7UA 4TSVA 1YJKA 1C28A 2GN7A 2LALA 4HPKB 4IEVA 1MS1A 1DIWA 1C3HA 1H2MA 3MPPG 3D5OA 1GZWA 3ILNA 5C9AB 3WQ0A 3WP6A 2RM21 5K8SA 5C9AC 1VAKA 4Q4W1 5H9QA 1XU1A 1CPMA 3PVBB 2EIGA 5C4WB 3N3HA 2WFF2 1RUNA 3H1WA 5C4WC 3V64A 5JAXA 1DG6A 3W58A 2QZ3A 4XXAA 4YW2A 3WDTA 5GZCA 2ZGTA 3WDYA 3MF9A 1GICA 3WDWA 5K0UA 1D2SA 4GWNA 2K9ZA 5IK5A 2XUMA 3PTYA 4YGBA 3LGRA 1ULEA 2DUOA 1OOPC 5DXDA 2HWE1 1BEV1 3TNQA 2VW2A 2BNMA 1U0AA 1CONA 1RUC2 1QJY2 5EWSA 4WM8C 4N43B 4TYSA 4JRAA 1YLLA 2D5FA 5CFDB 1QXJA 4N43C 5CFDC 3SLIA 1UN1A 2VUAA 1S2BA 3POSA 5CG9A 5LK5A 1FATA 2UWBA 1UL9A 4NO4A 2GC3A 1O3QA 1N3QA 5CNAA 1BZWA 4NHKA 1V9U3 2PHWA 5CIRA 3LA2A 4Z07A 3ZN4A 1QQP3 4LHNA 3AB0A 4XFHA 3S7IA 1AYN3 1AUYA 2BVVA 1REDA 4GWMA 2Q5TA 1MQTA 2Z2SB 2DV9A 5GALA 3ZXJA 4S2GA 3QLQA 4K40A 4YZ1A 4HLTA 3FLTA 2XPJA 1LESA 1RUE3 3OTFA 2BW8A 1GNHA 2UU8A 1BBT2 1MS0A 2Y0IA 3SH5A 2D3RA 2DVGA 2RS11 3AP6A 5FBZA 5ABJB 4QM9A 2ZGRA 2W39A 5ABJC 4UW5A 2YDEA 2B42B 4KQ7A 1S0IA 1RUF1 5HI0A 2KM2A 3JB4C 4Y22B 1ZREA 4W6YA 2WZR1 1SLAA 3NO8A 4K8FA 4YFWA 2XB6C 3UV9A 3ZXEA 4BM8A 4J6GA 4AHZA 1OPMA 1M06G 4HANA 4WVVA 1PNFA 1UZYA 1LGNA 4JGZA 3BIWE 4BH9A 3DN7A 2UYAA 1JOJA 2D98A 1LOGA 1AX0A 2AZ5A 2Y38A 1CD3G 3EJKA 4RHV1 3VKLA 1O4YA 2BVBA 3OCPA 4HBNA 5BNPA 4KGGA 3E5XA 3H3ZA 4C0BA 4LO5B 2FBEA 3VBUA 3JQWA 3P3PA 3WG2A 2H6BA 1G8WA 2ZGQA 4WVMA 2B9UA 1QF3A 1Q8SA 2HEYF 1FOD2 3SH4A 2QFEA 4CP1A 5J36A 3CNAA 4FOQA 5KXEA 5KHIA 4Q4Y3 1NCRB 2WINB 1PVC1 4FSJA 4YLZA 4GQ7A 4XOGA 3O7OA 4ASLA 5J96B 1O3RA 2D3PA 3BODA 1YUDA 4DRRA 4M01A 4X6RB 3VDDB 1O4TA 5IK8A 5AC91 3V0AB 3VDDC 1GANA 1N1VA 3EXUA 5L7OA 1AHSA 1NLRA 1HRI2 2HWD2 4Y26A 1LKNA 1H2NA 4B4QA 3AP4A 5K9YA 4LNVA 3H50A 1AZDA 1ZBA1 1W0PA 1MS4A 3Q9OA 5AVAA 1OPOA 3RI9A 1ENXA 1FV3A 1DZQA 2YV8A 1SLIA 3LA3A 1FI2A 1WW7A 5J98B 3JQXA 2DURA 3OJBA 4AQTA 3AXEA 1KITA 2R041 5JMCA 3JZVA 3FLRA 1DFQA 1LHOA 5FAXA 2R0HA 3ZN6B 3AJYA 2WJSA 1UW8A 2X29A 3NKGA 1B35B 2AGSA 2ZX2A 1B35C 5C4WA 4PIXA 4CDWB 5I93A 2OW4A 3CO2A 4CDWC 1VB4A 4XJAA 2YUEA 1LODA 3VN4A 4Y1XA 1V70A 3MLKA 2IXCA 3GZUC 4YNIA 1BMV2 1X8MA 1Z0HA 5E1RA 2JDZA 3V56A 2ILMA 1R083 3AZXA 4CDUB 1OOPA 1G6NA 2PHLA 5GLUA 4AWDA 4CDUC 1TEIA 4Y1UA 1FPN2 1EPWA 5CADA 3NJZA 3R4SA 4P9WA 2QVSB 2HWC3 1L3JA 2YMZA 5CAZA 2ZHKA 2GZWA 2D6OX 3MLJA 3N7JA 4AVAA 2BEOA 4RGAA 5KXCA 2DWRA 3HD8B 5DUWA 1FMD3 4WM8A 4BLIA 5A32B 1CR7A 2DCJA 4N43A 1NQJA 5FLIA 2E9QA 3BU7A 1PK6B 4BLJA 3RJ2X 1NYWA 1PK6C 1HRV2 2BUKA 3AP7A 2X53S 2ZGOA 4W65A 3WW1A 1RUJ1 1Q3EA 4IXLA 4LT5A 1H2LA 4CDXB 3K51A 2P34A 4FTBA 4CDXC 3FWEA 1R093 5JSRA 3IDEA 1YO8A 3I2DA 1JN2P 4YVWB 1YFYA 1UU5A 4LBJA 4YVWC 3AYEA 1QJU3 5KC5A 1FV2A 3U0ZA 1Z7S2 5D1IA 2VVFA 2BPA2 1J3QA 1COV2 4YZ4A 5A3MA 4L2NA 5ACA3 3RYPA 4AEDB 4XFFA 3N7KA 3ENRA 1SDWA 4AEDC 1S0FA 3OYWB 4ORFA 5FO7B 3VBRA 2EXJA 2I2SA 3NSTA 3VBHA 1RUI1 3VKFC 2DCZA 2BFUL 1RUD3 5SV5A 1PIV3 3WDVA 2A6VA 4N9HA 2F4PA 3FC0A 1YIPA 2ZZJA 2O1QA 5D8AA 5CVRA 2EXHA 3AP9A 4RR3B 1CQ9A 4RR3C 1RMU2 1IPJA 3ZSEA 1OSGA 4HETA 2WC2A 3SCHA 2Z42A 3D6EA 4XFAA 1OLRA 3S6PA 4AE2A 5T5PA 4QPYA 3CJXA 3B9CA 2R072 2K2SA 4XFIA 3UL2A 4DS0A 2R32A 3JB8A 1FX5A 4OHYA 3L9JT 3ZFEB 3AYAA 2Z79A 4M3CA 4FQ4A 4EV0A 1J1LA 5GKAC 5GZFA 3ZFEC 1IKPA 2VMHA 4AHWA 1JTZX 3R0RA 2ZX3A 1RUOA 1KFUL 1OI6A 2XWJB 3QCWA 1RUH1 4HMZA 1DZRA 2RM22 4MV2A 4AVSA 3URFA 3AZZA 4Q4W2 4R4XA 4YW5A 1WW5A 1ZM1A 4GMP1 3GBWA 1XU2A 2G9FA 1F31A 5F9TA 4LBOA 4Q2FA 4R52A 3LSEA 3NAPA 4GH4A 4FBFA 4OHZA 2XBO3 4XBLA 2Z69A 1RTVA 1DGRA 1BJQA 1K5MB 3MDPA 1K5MC 1HX6A 2PLV3 3KS7A 3GYDA 2WLPA 1W0OA 1VAVA 3ETQA 1SFNA 4U36A 2HWE2 5JR7B 3HT2A 1BEV2 2YGLA 4R4ZA 3L2HA 3AKRA 4Y20B 1C8M3 1R1A3 4YW1A 3WXPA 2YGMA 2ARXA 4AFAA 2RS51 4YG6A 3ES1A 1LENA 4R9CA 2GC1A 2PAMA 4UBHA 2HJIA 1KRIA 1I1EA 3GHMA 2FZ1A 4LBQB 2ZHMA 4Q4X3 4YYOA 1LGCA 4AHXA 1NCQC 5AVPA 1N1YA 1UX6A 3WQ1A 2Y26A 2NP0A 1VALA 1VBB1 5FPXA 1POV0 1ONAA 1DQ0A 3O0XA 3PJYA 4LO8A 4BQ1A 2DU0A 2EAAA 2D93A 3WG3A 2WNUA 5FOBB 4UW4A 3G6JB 1RHI3 4AEMA 2BFUS 4URTA 4CDWA 3WDUA 4UW6A 3U10A 4I09A 3E97A 4XJ8A 4EROA 1QOTA 4KG0A 1OQEA 3FMGA 3NW4A 5SV8A 1ENSA 2RS12 4KWLA 3WR0A 1AR91 2WT2A 1IOAA 5F5QA 1GZWB 4HL0A 3ZXLA 4CDUA 4RQPC 4WVWA 2O0OA 3LWCA 2WNVA 2QE3A 2ZPXA 3U4XA 4AHYA 4R9DA 2WZR2 4D7SA 1RC6A 1AL0G 4B7KA 1S55A 2PN5A 3U07A 2JKBA 1PMIA 2W68A 3AZVA 4AQ2A 3KGZA 1A3KA 2LUWA 2SBAA 1MEC3 1D4M3 2BGCA 5J7MA 5K0UB 1PK6A 1VBD1 5K0UC 2VVDA 1AL21 1QDOA 3LAGA 4F3JA 1SACA 1LHUA 2XJRA 5BUVA 2ARBA 1VBC3 3RS6A 3QACA 2HYKA 2PQQA 4FPKA 2R063 3AZWA 4RHV2 1AVBA 4GB33 3EHKA 2WQZC 4LA3A 4ZU5A 2NQYA 4YVWA 3HN1A 4WZCA 4P9JA 5T3NA 1KQRA 1S0CA 3BTAA 3ASIA 1ZZ6A 1WCKA 4H14A 3WW2A 1LU1A 1RVF3 1BK1A 3L2YA 4AEKA 1UIJA 2AENA 3INAA 4R9BA 1A8MA 1PVC2 4AGVA 1LR5A 3THTA 4Z2WA 1U5XA 3SCFA 1WA4A 2NYYA 1MR5A 2A6XA 3VL9A 2GH2A 3M3QA 2GNMA 5AC92 1RITA 2BYVE 2MEV3 3NKTA 2BNNA 4QU2A 1DZTA 3USSA 2B39A 4OUMA 3RPQA 2A70A 1REEA 1UU4A 3BALA 1ZBA2 4W6XA 1VB2A 4XF3A 1PO11 2CAUA 1V6OA 1S0EA 1Z78A 1J3RA 2UWAA 2WQ4A 5L73A 4YARA 1H1MA 2NN8A 2QDNA 2RS31 4Q8KA 1GZ9A 4C1XA 4RD7A 3J26N 1D0GA 4QQOA 2B8MA 2PA7A 1XNCA 4HT1T 1LB2A 2Q0AA 4JVAA 4I3GA 1RL3A 4CP2A 2C0ZA 4XMAA 2GH8A 4K20A 4XZPA 2R042 3AZYA 1AR71 1VBE1 3UJQA 5EV7A 1YIFA 4Q0SA 2QNKA 1PZ7A 5JPMB 1AXKA 4DB5A 4QHBA 4EN8B 2R49A 1LU2A 4AI0A 4K1ZA 4DFSA 3BPZA 1H4GA 2CGPA 1FAYA 3JBG1 3KT7A 4EWDA 5KHKA 1C1LA 1U5YA 3AYDA 4LULA 2XL7A 3LKJA 4LBMA 1K5MA 4BA6A 2JE7A 4Q4V3 3VBUB 3IDCB 4OI1A 4MZUA 3WUCA 4UXAA 2XL9A 4GKYA 4I30A 3VZJA 1ZRRA 2D44A 2XVGA 4HFSA 1PO23 4WVMB 5I91A 1BYHA 2NMOA 5JI9A 5KHHA 2E7AA 2WT1A 4LBLA 4XJUA 1ZZBA 2Z5WA 3WUDA 1JYCA 1RB8G 3QD6A 4QGMA 1WMDA 4CTEA 5JOZA 3GF6A 2WA4A 3M8LA 2DUPA 1RUJ2 4LBQA 5AFEA 3VKNA 1VBA3 1CX4A 2AR6A 2PFWA 1CJDA 1NCQA 1ND2A 3IIAA 5L7OB 2VMGA 2XBO1 3POWA 2H0BA 2V09A 3MF6A 4V1PA 3WD5A 1XYOA 4MYEA 4H7MA 5DUVA 2A73B 1WGPA 1S1AA 2PLV1 4GALA 4YGDA 3KB5A 1G9BA 1VJ2A 2JG9B 4QM8A 1XNBA 2JG9C 3VKOA 4ATEA 3WLUA 5CG8A 3VBSA 3FFZA 1EAH1 1MVEA 3NV3A 3RDIA 1H8VA 3IM0A 2XJTA 3KCYA 1RUI2 3HBZA 3IT8A 4QX5A 1HXS3 5DG1A 1DYKA 4Z82A 3WG4A 3B69A 1GR3A 1UU6A 4KBBA 4RQPA 3WG1A 4Q4X1 4N7IA 4ASMB 3RYRA 2NLRA 4OUSA 4IEZA 3WOGA 4Z92B 1E57A 3WP5A 4Q0UA 2ZABA 3V65A 1Y9QA 4J1XA 1H30A 1VRH1 4J1WA 4HSLA 1EV11 3MIDA 2GC2A 2DVBA 1MS5A 3NWKA 4FPJA 2WS91 4XPVA 1CAWA 1OOPB 2HKXA 4KG8A 4F8AA 5GZDA 2CWSA 3GALA 2EXKA 3MIBA 3CJIA 4A7ZA 5DDJ3 1TNRA 1D2QA 1RUH2 1FNZA 3EO6A 4XBQA 4HZFA 4JCKA 3KSCA 4WM8B 1U5ZA 2HWF1 5F1RA 4RSUA 3N4MA 3WT3A 2OPKA 4Z1VA 4OULA 2YYOA 3AJZA 1F8VA 4NWWA 4BZ4A 5C8CC 1Y3TA 4JQRA 3VLBB 4O9EA 3HIFA 2W52A 2P3JA 1N1TA 3AM2A 1D4M1 3RMXA 3GNEA 1VLNA 2GMMA 2A3XA 3EQEA 3ZXFA 5IT6A 5A3LA 3J8F2 3O0VA 2UYBA 4JDMA 4XW3A 1HQLA 2WZPP 4L8QA 1YRZA 4PQ9A 4DQAA 3IBMA 4YZ3A 2R061 4FAHA 2B45X 3LCPA 5JIUA 1FT9A 4YM3A 3VBRB 2RS52 4AVVA 3VBRC 3VBHB 2C5DA 4OHXA 3POYA 1Y43B 3AMMA 4TWTA 3VBHC 1RJ8A 2VU9A 1N1SA 2GDFA 5GLWA 4XJ9A 4BIFA 3ZXKA 1YJLA 1OD5A 2WFF3 4CEYC 1KJRA 2ZTNA 4LO4B 5D8AB 2JXAA 5D8AC 4Q1RA 4DPNA 1ZBE1 4P9IA 2FZ2A 5GZEA 1PVXA 1VBB2 1NQDA 4QPIA 3RJRA 5B2GB 1FYUA 4KU7A 4COYA 2A7AA 4PBOA 1LEDA 2ENRA 4QQ2A 4MGYE 3SXWA 3H1YA 3DF0A 1QJY3 4M3CB 4B3NA 1GKBA 1N3PA 2YY1A 1SBEA 1RINA 3AMQA 1AR92 4LTAA 3LB9A 4XF4A 1WBFA 3KCXA 3IKWA 5BNOC 3TN91 2RR11 3EBRA 2CGNA 4E27A 2F6BA 5FQ0B 2QJVA 1QXPA 1AR63 4TZDA 2VW0A 5CFCA 3A4UA 2OZ6A 3NAPB 4GH4B 3PHMA 2IZWA 3NAPC 4GH4C 3ZPYA 1VBD2 2YC0A 4AW7A 3SHRA 1AL22 1QMJA 4OZXA 1IQAA 1H4HA 1NE6A 2BTVC 4XHXA 2ZX1A 1W6QA 2IFWA 1CJPA 1PGSA 2H0VA 2YPJA 3NVCA 4W6WA 2YZ4A 1BBT3 2XJPA 1LTEA 2A5ZA 1ZRCA 1YI9A 4Q4V1 5IUQA 1QJX2 3KZ4C 5I8YA 2JG9A 1S0GA 1KS5A 3D0SA 4AQ6A 4C90A 1ASJ1 5KXDA 1OA4A 1PO21 4NWVA 1ZVFA 3I8TA 5F6KA 3ZYGA 3AP5A 3ZFFA 1WLCA 4FOVA 2D3SA 3AKTA 4TLFA 3ZYIB 1W6OB 1UZZA 2JENA 2EAKA 1QGLA 3WCRA 4N53A 1IPKA 4Q8LA 3TOJA 1O3TA 1U5IA 4B7EA 3ACLA 5KBFA 4JDNA 1TMF1 2P37A 2WNUB 3SNMA 4MH0E 4PLMA 1LJ7A 2WNUC 3D0JA 1CIWA 1X8EA 1Q8VA 5JLVA 1PO12 5HXVA 4DOUA 3AMHA 1I3HA 2ZHLA 4AQSA 2RS32 2ZACA 4MXVA 3VBFB 1ZRFA 3VBFC 3R6SA 1FOD3 2DCKA 3T1LA 2WNVB 5JVVA 2WNVC 1AR72 1VBE2 3D8CA 2SLIA 4COZA 3O5SA 3OF1A 1DF0A 4FCAA 2V73A 1TE1B 4E4ZA 4JGYB 1MZ6A 3H7JA 2OIIA 4PDWA 5GLTA 1DQ6A 4JGYC 2V5YA 1HRI3 1AXZA 2HWD3 2VOVA 2ZGMA 1ND3A 4B4RA 3PVOA 3JBG2 2ES3A 3B94A 1MACA 4MX3A 5C8CA 2VNOA 2XJQA 5FPZA 1LHWA 2PTMA 1IZ3A 4FPGA 4LLFA 2GSYA 4ZXKA 1KXGA 1LULA 4CRQA 3ZIXA 4A2UA 1POV3 4GMP0 2DFCA 1DGRN 2D6PA 2JX9A 3RMYA 4BMBA 1PGL1 3ZO0B 4H55A 3FBYA 4K21A 3WINE 3ZFGB 3ZFGC 1Q56A 3X29B 4DNYA 1DGLA 3CU7A 3NV2A 3VZLA 1ALYA 5E88A 3H9AA 1MZ5A 1HQWA 2XG3A 3AXDA 4A7YA 1NZCA 3A0KA 2O8OA 4FPEA 2FMYA 4LE4A 4YZ5