3M4FA

Structural insights into the acidophilic ph adaptation of a novel endo-1,4-beta-xylanase from scytalidium acidophilum
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
181
structure length
181
Chain Sequence
NPGGIDYVQNYNGDVADFQYNEGAGTYTCGWDGSTDFVVGLGWSTGAARDITYSATYNAGGSGSYLAVYGWVNSPQAEYYIVESYGDYNPCSNAEGLGTLESDGSTYTVCTDTRTNEPSITGTSTFTQYWSVRQSERTSGTVTVGNHFNYWAQHGFGDSYNFQVMAVEAFSGSGSASVSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase
publication title Structural insights into the acidophilic pH adaptation of a novel endo-1,4-beta-xylanase from Scytalidium acidophilum
pubmed doi rcsb
source organism Scytalidium acidophilum
molecule tags Hydrolase
total genus 56
structure length 181
sequence length 181
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3m4fA00
3O7OA 1TE1B 3WX5A 2B45X 2BWAA 3VZJA 1UU5A 3ZSEA 1BK1A 3VGIA 2BW8A 2DCKA 5EJ3A 3AMNA 3WQ1A 3VL8A 3VZKA 3MF6A 3VZMA 4IXLA 1XYNA 3WT3A 3M4FA 3WP4A 4S2GA 3WQ7A 3WR0A 3VZNA 3EXUA 2DFCA 4HK9A 3WXPA 2VGDA 1KS5A 4NPRA 2D98A 3WP5A 1XNDA 3VHNA 1F5JA 1UU4A 1NLRA 1YNAA 4XPVA 3WY6A 3RI8A 4S2DA 2DCZA 1KS4A 3VZOA 1OLRA 1H8VA 1OA3A 1XXNA 1M4WA 3AKPA 2DCYA 1REFA 2VG9A 4S2HA 3AKQA 2F6BA 4S2FA 1H4GA 1AXKA 3VZLA 2B46X 4XQDA 2NLRA 1QH6A 1UKRA 4XQ4A 2BWCA 1OA2A 1UU6A 3AMPA 5HXVA 5K7PA 3VLBB 1HV1A 4HK8A 4HKLA 4H7MA 1BVVA 1XNCA 3AKSA 3RI9A 1OA4A 3MF9A 1C5HA 3LGRA 4XQWA 2D97A 2VULA 3WQ0A 1BCXA 2JICA 1H0BA 1XYOA 3MFAA 1QH7A 3AMQA 1W2UA 3HD8B 3MFCA 2B42B 3WP6A 3AMHA 3VHPA 1PVXA 1IGOA 2QZ3A 1XNKA 2NQYA 1XNBA 2VUJA 1H4HA 2DFBA 3B7MA 1HIXA 1OLQA 3AKRA 2JEMA 2QZ2A 3LB9A 3B5LB 5K9YA 2JENA 2BVVA 3VL9A 1REDA 1REEA 1HV0A 3WP3A 4HKOA 1XYPA 2DCJA 1ENXA 1T6GC 3AKTA 3VHOA 2Z79A 1C5IA 2C1FA 1H1AA 3AMMA 4HKWA
chains in the Genus database with same CATH superfamily
5T5PA 3ZFEA 4EJRA 4N53C 2BNMA 5I0RA 2A3XA 1ZRRA 3CDZB 2ZX2A 3NV4A 5FY0A 3ZYBA 5CADA 4YGDA 4LKFA 4R9AA 5L9RA 3ILRA 1AL0G 4N9HA 4GALA 1FMD2 3K51A 2GN7A 2E7TA 3O1OA 4CZSA 4QKBA 3KV4A 4Z8BA 1V0AA 2BUKA 2WS92 4XJUA 4DXSA 2UU8A 3JB4C 3H7YA 4XMAA 4AI8A 4LQRA 5AC93 1BBT3 2C24A 4FFHA 3IDEA 4YG6A 2ZEZA 1SPPB 5FZ6A 3VZMA 4OVEA 2VPVA 2BDRA 3CU7A 2QQJA 4LJHA 1OQ1A 3OY8B 2E7QA 2DUOA 5JSPA 3WZ1A 3NNJA 3WUCA 1VBB1 4XF4A 1QJU3 2KM2A 3BTAA 1UPIA 4QPGB 1HQLA 4QDQA 3WXPA 3T2OA 2QQOA 4MOAA 4DPNA 2VZUA 1DQ4A 2AZ5A 3VBUB 1W8UA 5C3OA 4IEZA 5FPVA 1JS9A 4BXSV 3ZYGA 4CYDA 1QJY3 1RUJ3 3EHKA 2DVDA 1ND2B 4AEDC 5I8YA 1VALA 5CG8A 1MS3A 2VR4A 2ORZA 4FSJA 4JTNA 1KS4A 3RZZA 1OLRA 4R4XA 3SCFA 1UWWA 4XZUG 1AYN1 3TN93 2JB8A 2V5YA 3ZYRA 1W6QB 3KVAA 1DBNA 4BQ4A 2VH9A 1X82A 4Z2AA 5A6YA 1AZDA 1WW4A 1MQTB 2XKPA 4LORA 4LO8A 5JZGB 4N9IA 4AEKA 3KD4A 1R083 1UW8A 2EXHA 4CUGA 5BNPA 1UO9A 4R52A 3POBA 5KXDA 1J1LA 4TLGA 4D3WA 3JUUA 4CEWA 1HV1A 5IVYA 1V6JA 3A4UA 3DYPA 1QJX3 5CKNA 1GSLA 4NHLA 2RDNA 3EQEA 2RS33 3GZAA 2J42A 3VBFB 4LIVA 2PAEA 4P14A 4Q1PA 4QAWA 1OA4A 1CESA 2WNUB 3Q8AA 4W4ZA 3WG1A 4AF9A 4AQSA 4N53A 1WCSA 2Q8OA 3CL1A 3MZHA 2BRTA 1F2NA 3VHRA 4Q4Y2 5KXEA 2Z69A 3PMSA 1TZOA 2XHKA 4U2AA 5DAQA 4CCDA 3GALA 2JDKA 2QQVA 3NAPB 2XLFA 5DABA 4AI9A 1AYN2 3B7MA 1HIXA 2RJKA 4QXKA 4CDQB 2I2SA 5EHDA 4NOTA 1HRI1 1H8TB 2DVGA 2RM21 3DYOA 3MUY1 1SLBA 2D3SA 5FXXA 4YW5A 4XZPA 5J48A 2PXJA 2O8QA 2BVVA 1H2KA 1OUSA 1W6OA 3D0JA 2QTWB 2C4XA 5GKAC 5SV8A 3M3CA 1OUXA 1POV0 4LLOA 1WMEA 1HB1A 5GLTA 4BQ3A 2JXAA 3IDBB 1MS4A 2EAKA 1OPMA 1Y7BA 2D6PA 2XOMA 3E6BA 5LB6A 3HOBA 4AG4A 5LZ6A 3DPRC 3AK0A 3H1YA 4ZXEA 3ZYPA 2FD8A 1RUD1 1AXYA 3V0BB 1PGL1 4Q2FA 3ACHA 5B4XA 4NHXA 5A3NA 4O7XA 4CDUB 4LKEA 4RHV1 5FFOC 3VDBA 4OI1A 3OYWA 2W52A 1UZWA 3PU3A 2DVFA 4D8MA 4NPMA 1YC61 4AGGA 1QXJA 1JYCA 3MF6A 2YDEA 2XG3A 4RA0A 3J8F3 3OEBA 2DU1A 4ZXKA 1HRI2 3IBMA 2HWB3 1LODA 5L7OB 3DCQA 4Q4V2 1CD3G 5EYYA 2HBUA 3WDUA 4K21A 5FYUA 2ZGQA 1YXWA 2VGDA 4OHZA 3ENRA 2XB6C 2PQSA 5KHGA 5JR2A 3C7EA 2D5HA 1QHDA 4N8MA 3ZPOA 4HN1A 4PF5A 3VD9A 3D82A 3BPZA 3GGLA 4NRPA 1LEDA 2ZZJA 3NW4A 1X36A 2R1DA 4NIAA 4Q0PA 4AE2A 4OUMA 1NLRA 3NKGA 1QMJA 2PHTA 4IEUA 2XUMA 1SLCA 4HMZA 2F4LA 2Y6KA 4I3PA 3VKMA 2PHRA 2DCZA 3DXUA 5FO7B 5CU1A 3USUB 5A70A 1F8VA 1GZTA 5FTTC 1SLTA 4YW3A 1UZ0A 3T2QA 2OPKA 3FBMA 1RUG1 1NQDA 1UZVA 4BIOA 1GICA 4S2HA 1X8EA 1CR7A 1W8ZA 3B69A 1O3RA 3U14A 3CKHA 1QWRA 4NWWA 2LTNA 1YIFA 1WBLA 2E9QA 3D4KA 2P2KA 4IQPA 3PU8A 1KDMA 4SBVA 5KWRA 3VD4A 4UXAA 2DURA 1OA2A 1UU6A 3A21A 2JIJA 3FLRA 2V09A 4QPYA 2GH2A 5DG1A 1J3QA 2R0HA 3ZSMA 3M3EA 5F32A 4FPEA 2VUDA 4QM8A 5FMOL 4XFGA 5CBLA 2J1AA 1BVVA 5L73A 1VRH2 2IXIA 2ZGLA 3R4DB 4YZ4A 1XNCA 3HBZA 3VKNA 5JI7A 4AEDB 3O1VA 3DPRA 1MEC2 1UL9A 1RUE2 5JXJA 4DRVA 3MLJA 1YJKA 3SITA 1IQDC 2ZEWA 4CEYA 3CNAA 5IVCA 2E33A 3HNYM 2G9FA 5EV7A 4QX2A 1EY2A 2XBO2 1OQEA 4UWDA 1PZ9A 3VHPA 1N1TA 4D0QA 1B35B 1WMDA 1W6PA 1XNBA 3NJVA 4JHTA 4V2VA 2D3PA 4QGLA 3PIJA 1S55A 2TUNA 5F6LB 1RUG2 4RQPA 5GLWA 3S7IA 3BTZA 1FT9A 5IK8A 2ZX1A 5A7WB 3DKWA 4IEQA 1PMIA 4GJZA 4UI9L 1PMJX 2VOWA 5AFBA 5FQ0B 5A3TA 4YG3A 2K9ZA 1WCQA 1UYZA 1DHKB 1AJOA 3BKZA 2Z79A 1HB2A 4GJYA 4D7YA 3UT0A 5C3SA 4FTBA 4FFGA 1TMF2 4LA3A 5DDJ3 1RUOA 1WW6A 1NA1C 4IE5A 5LA1A 1MVQA 2Z2SB 4F3JA 1O5UA 1PK6B 4META 4Y5TA 1PGSA 3VD5A 4AOCA 1L3JA 4DXZA 3K75B 1OKQA 1OOPB 5F9TA 5JPNB 1ULFA 1WA4A 2Z4FA 1AL21 1BK1A 5IFTA 3IN9A 4Y4YA 5C33A 2VMGA 1SDDB 1HX6A 2IWGB 3PVOA 4WZFA 3USSA 5FZ9A 2VTXJ 3NV2A 4DUVA 4LOTA 2WT1A 3DGTA 5T55A 2YPDA 3H7JA 4ARXA 5HPOA 4BLIA 1UOBA 1YFXA 2A73B 1QQP3 3CF6E 3LQCA 4UOJA 2R32A 5A1LA 2BGCA 4AQ2A 4ZU7A 1QEXA 2YU2A 1OQDA 3P1IA 4KBZA 4UYBA 5FYCA 2RG4A 3I3QA 3OPTA 4FTEA 3AP9A 1DF0A 1GP5A 4YNIA 3I2GA 3JBG3 4RR3B 2XPJA 2QUOA 1OT5A 1W9SA 5T5JA 3UGHA 5ACA2 1FOD3 3KWVA 3OBZA 4ZZ5A 2EA7A 3PL0A 5BNNC 3N9MA 4JRAA 1PO13 2R041 4PDWA 1J59A 1C1FA 3RI8A 4GB33 4YZ2A 1Q8OA 1XU1A 2J1UA 3PNAA 5D21A 4MGKE 2GMMA 2WBKA 3LPFA 1JBCA 4MLOA 3K77A 4KI5M 4B4PA 5IT6A 2D43A 1R1A2 4MX3A 4L8QA 2WNOA 1ULDA 1Z7S3 3T4HB 1J58A 4ZKTB 1CAWB 2D44A 3WEZA 2ZZQA 4RSUA 1H4GA 1ASJ1 1S2KA 2ET1A 2Q0AA 3FMGA 3JD71 4XAAA 4OMDA 3ZSLA 5EXOA 2GALA 5I0UA 4CVUA 3FWEA 5KXBA 2BWCA 3ATGA 3S30A 2GC3A 2CHHA 2HWC3 4QXCA 1ZREA 4DEQA 4D7SA 4YM3A 5DMYA 2QQKA 1GZCA 2HEVF 4MXWA 4PBOA 1CAVB 1G86A 4ZU4A 3D5OA 1JODA 2CNAA 4XAEA 5A80A 1I5ZA 5IFPA 1RB8G 2WO1A 4AAPA 5K8SA 1KD7A 2ERFA 3T2TA 1NA1A 1DZTA 4F83A 5DAVA 2EAAA 5DUVA 1WBFA 3AZXA 4I02A 1A34A 1C8M1 3C7HA 1CAUA 3ON7A 2X53S 3AMQA 2Y64A 1W2UA 1O7FA 4QB2A 5KHKA 2X8KA 4TTGA 5IK5A 2MEV3 4DB5A 1IS3A 3OB8A 5FPZA 5JXHA 2VCCA 5GZFA 4XIKA 4YW2A 2TEPA 1ND3A 4SLIA 5C7GA 2EIDA 2YBSA 3EJKA 3J9SA 1RUH3 1ZZ6A 4MGIE 4X8PA 3GCXA 5FZ8A 1R092 4A44A 2W91A 2HYXA 2G4IA 1DFQA 3GBWA 1LESA 1X9TA 2Y0IA 1LOFA 5E88A 3TYJA 2IXKA 4Y4RA 3KQRA 4ARYA 4GH4B 3RWNA 5IVFA 3MUZ1 1FV2A 4YVWB 3O1MA 4NN0A 3K4AA 3PVBB 3OGRA 1Y9QA 4FQ4A 4LNVA 3R6SA 5BYNA 1GLHA 1AF9A 2O8OA 4QMAA 4Y1YA 2W1WA 5BNNA 3KQ4B 5DN2A 1S2BA 3B9CA 2FBEA 1CPMA 2PLV3 3WG2A 1ZBE1 3IMNA 4RS5B 2DVBA 4BU2A 2JDHA 1HRV1 3K3OA 3KVBA 2JG8C 2B45X 2G9ZA 4QU2A 5F6KA 1GZWA 5C3PA 1GNHA 3C8XA 3SC7X 3AP6A 1OH4A 2AREA 5B4NA 3AC0A 4LHKA 4ISRA 1CJPA 4NPLA 4A7KA 1T6BX 4L2NA 4DY5A 1QNYA 4JDOA 5EP9A 4BQ5A 1OBNA 1ZZ9A 2RHPA 1AR93 2KA3A 4COUA 2YU1A 4MGQA 3IZOA 5LW9A 5M0TA 3LA7A 1SBFA 3ACFA 3FC0A 2JDUA 1XYNA 3O0WA 2MNGA 3HPNA 3I59B 1U5ZA 3T30A 1FYUA 4S2GA 4XETA 3PLQA 1KGYA 1POQA 1NYWA 3V56A 1RUC3 2P3IA 2WKKA 4K40A 1RVF3 5T54A 3RVHA 2YXSA 3EYPA 4BZ4A 2FCTA 4PHZA 2W08A 4YRDA 3BIWE 3AZWA 3OGVA 5E1RA 2BPA2 2PQQA 2BGPA 5A3PA 4JGYB 1W0OA 3S0MA 1ZBE2 2TNFA 3MYXA 1M4WA 2QKDA 4UFKA 1UY1A 2JG9B 1ULEA 2OQ7A 1WCDJ 4LO6B 5DAWA 3WDXA 3PVEA 3IDAA 4CDWB 2VG9A 4YM0A 1ULCA 2WN2A 3AVSA 4FP2A 4K3UA 1S0EA 1HXS1 1AXKA 5DZGA 2BP6A 3NRUA 1SG3A 1UKGA 1VBD3 4XQ4A 4KU8A 4IEYA 1BXHA 1VAMA 4AVSA 2DUPA 4Y1UA 1O4YA 2VQUA 2GN3A 3NO8A 4YGEA 1DGRN 2PA7A 2XJQA 2HWE3 4FAHA 3UGGA 1RHI2 4DUWA 3LAGA 2ORXA 3VBHA 2VOTA 1LGNA 2YC4A 4D94A 2K0GA 2QQNA 2YV8A 1BVP1 1BCXA 4DXRA 2P37A 2EICA 3CO2A 4O65A 3GBGA 4ZU5A 3WF3A 2R0FA 2A5ZA 1K5MC 4XF3A 4C1WA 4CTEA 5HCBA 3M7AA 4XOGA 1D4M3 2DWRA 3M2MA 3MFCA 3ZPYA 4E27A 2FDKA 3J26N 1CN1A 2VBDA 2YGMA 2WWSA 5C70A 3MW2A 1RUF3 4IV1C 1PVC1 2QZ2A 5FYYA 1RGSA 5K9YA 3DECA 3A0KA 1GNYA 1V6KA 1HQWA 1VBC1 1FPN1 3ASIA 3I2FA 4MSVA 1PIV1 2PYTA 4WVMB 3VL9A 4BISA 5GZCA 1JZ8A 4FI9A 4LBLA 5GZGA 2W87A 1VBE1 3WP3A 4HKOA 4NIDA 1UNBA 3MW4A 5DUUA 3HWJA 5LCWL 4NIGA 2WWUA 1CZTA 5FWJA 2GNBA 3SLIA 3U0ZA 2C26A 1H2NA 1ST8A 2XWBB 3C7FA 4IW3A 4LBOA 2W5FA 4JRLA 1V00A 2WZEA 5A33A 4UW3A 3LPGA 4LT5A 5C71A 2WUHA 1VLNA 1V9U2 1W6MB 3B9IA 2BWAA 3JB8A 1UU5A 5J98B 1XB9A 3K48A 1QKQA 1GV9A 1UCXA 2G1MA 2VUCA 4XILA 4AFCA 1GBGA 2FZ1A 3GHNA 4AWDA 4URTA 1L7LA 3M3OA 3FL7A 5D1IA 3FX3A 1AX1A 1JZ7A 1OH3A 4Q29A 4GKXA 4AXOA 2IZWA 3MIHA 4I2OA 5LA0A 2QFEA 3D6EA 1LOGA 1PVC2 1JH5A 1C4RA 5FYMA 2AEYA 1LGCA 4NWVA 3VBSB 3DKQA 1PIV2 1O3SA 2JWPA 3KF5A 5D2AA 3VKOA 4PF1A 4Q4W3 3CHXA 3H42B 3W58A 1O8PA 1A8MA 1VB2A 1EV13 1Y43B 2RVAA 4PLMA 1NCQC 2NMOA 3TEXA 3VDAA 2RMU2 4XBNA 3AJYA 5C8CB 2HJIA 3GYDA 3LZZA 4LUMA 3T1LA 2AR6A 1KQRA 4JKMA 5D8AB 1H2LA 1OF3A 1POV3 3IWZA 5CFCC 3J7NA 5LBEA 1EAH1 1VBA3 4GAZA 3SH5A 2A6VA 2ZX3A 1UY0A 4UFMA 5BV6A 1TNRA 2YFUA 4IV1A 4YFZA 1BEV1 3FHQA 5IYYA 2XVGA 4BH9A 2EIBA 3ZYJB 4IGOA 4Y33A 5T3NA 5A7OA 5FLIA 3EMRA 1PO22 2OA2A 1AYM1 4R9CA 4CPBA 3ZN6B 4CXXA 1OPOA 1VMJA 3OF1A 1RXGA 4BIFA 5CFDC 2F17A 1UOGA 3TAYA 2WNVB 5JOXA 5L19A 2WZR1 3ZM8A 2XVKA 4DNYA 4V2WA 3RYPA 1F4AA 1UPSA 4CU7A 1GFF2 1BHGA 3IIIA 4W6XA 4HT1T 4C90A 1H0BA 5FKBA 1U5IA 4FOQA 3WCSA 1I1EA 2NYYA 5DG2A 4WVWA 1KITA 1R64A 1GKBA 1W9TA 4Y22A 1AR83 1US3A 4PIZA 4W65A 3D3AA 3N9OA 4C0BA 1V70A 3HAGA 2VMFA 4OMCA 4Y20A 1E5RA 5FLHA 1TME3 2BGOA 2P34A 3HT1A 4YSFA 1MPXA 2DFBA 5FZCA 2XGXA 1W8OA 4HLTA 2R063 1RMU3 2IVIB 2OUHA 3IPVB 1NLQA 1E5HA 5FY5A 3MO4A 3T0AA 3TRSB 2WYSA 2WFF3 3NNMA 4QT6A 1BEV2 1NKGA 2JKXA 4YW6A 4MGZE 2WQ4A 1REDA 3LDKA 4WM7C 4XJ9A 1C1LA 3KMHA 2R072 5ABJB 4Q0QA 1T6GC 2D6NA 4EE2A 4BXFA 1Z78A 1FNYA 5FY4A 1NCQA 1S2EA 1XJAA 3AMMA 4ITCA 3BI3A 4X6RB 1FMD1 1K5MB 4L0PA 1K42A 2SLIA 2WZR2 4CA9A 3UYJA 4CU6A 2WS91 4Q4X3 3Q8FA 4P9GA 4QKFA 3WX5A 5CFCA 2BBAA 2F4PA 1KEXA 1D0HA 2BOIA 4LE3A 4LMFA 5J1XA 3WD5A 5F3CA 4BK4A 1WA6X 1W39A 3MBWA 4M00A 2HH9A 2VZRA 3ZKYA 1QNWA 4DMIA 2DDUA 5BNOB 4EN9B 3ZXDA 3KB5A 4N43B 4BQXA 4DEVA 1XBFA 3QLQA 1FI2A 2P6CA 3KT4A 5FPAA 5AC92 1CAXB 3Q8BA 1DU3D 4CEWC 2Y6HA 1NE6A 4HPKB 3GNEA 4MVTA 2ADDA 3OJBA 3WW4A 3ZLIA 4KMQA 3QCWA 1H9WA 5F2SA 2YHJA 4XEZA 3KCXA 4UW6A 4YPJA 3I3MA 3I2DA 2HWD1 1KFUL 3DUIA 5CFDA 2VW1A 1MS0A 2HKXA 4FPKA 1QJU2 3MIFA 3PUAA 2RS53 1AR73 5JOZA 3KGZA 4UF0B 3S6PA 1HN0A 1LHUA 3KM5A 1AX2A 2OZJA 2W0XA 3BODA 2ZXQA 4CSWA 1QJY2 1RUJ2 4XTMA 2A6XA 5K4LA 2UY8A 4OUEA 1L7QA 2X5IC 3VZOA 4MGTA 4TLFA 3A0NA 1GZ9A 2DCYA 4OI2A 3TN92 4FXGB 2CSGA 4FPOB 5A3UA 4CP0A 3FLTA 4N90A 1W6NB 5F3GA 3OPZA 3MPBA 3IT8A 1SLAA 3I4IA 3ZFFC 1IKQA 4PIYA 1LHNA 2BQPA 4IL7A 3ALQA 2WNUA 4JKLA 1WLCA 4RL7A 1GMMA 4MXVA 3RGBA 1E57A 4AI3A 1E5IA 4JGZB 2IXLA 3O0VA 4WM7A 3WHUA 1MACA 1S0GA 4DS0A 1APNA 1LENA 3MI8A 2Q1MA 2ZJCA 3LWCA 1QJX2 4Q4Y1 4WM8B 5JVVA 4R4ZA 2HLEA 2WIIB 2RS32 1W8WA 3NAPA 2HWD2 4FOVA 4QX3A 4LBQD 1TNFA 4AHWA 2LS6A 3MF9A 4FO9A 1GWLA 3S7EA 2D97A 1IPJA 2R6QA 5ERLA 5H9RA 4EZHA 3RG0A 4Q8KA 3WQBA 5K0UC 3GZEA 3N3HA 3MV11 3T2PA 3LOBA 3QD6A 1J3PA 5JXIA 4BPZA 1AJKA 2NN8A 4DFSA 1JW6A 1H6XA 1RXFA 5FMBA 5E6HA 3WP6A 4JC1A 4A6OA 5A7QA 4HG6B 4E9KA 1CZSA 4D7TA 1XC6A 4NHKA 2RV9A 4XUQA 3J8F1 2K2SA 2PHUA 4R8HA 3WF1A 2OW4A 1ZA7A 1XOYA 3L2HA 1LTEA 2CY6A 2YMZA 3PUIA 4AVCA 2WLPA 4G3YC 1C8NA 1OVSA 5JIAA 3B3QE 5T50A 2VVEA 2ZMNA 3B02A 1VAKA 3POJA 5DZEA 3ZFEB 3ZOIA 1REEA 4IV3C 1ZNPA 4OYUA 2SBAA 3GDBA 1DCSA 4DRRA 1Q8VA 3UKNA 1I9RA 4WBBA 1ZBA3 2ZABA 1VRBA 4Z1VA 2JDYA 1T2XA 1HB3A 2X5IA 3MV01 4ATFA 4GA9A 3AP5A 4QGMA 2PMWB 1OXCA 4A3XA 1XE7A 1JYIA 1WUVA 4QX0A 4UW5A 2GMEA 1LOCA 1WWYA 5EJ3A 4AK3A 4LO4B 3HT2A 3HR9A 3OTFA 4Q4V1 3ZFFA 5FP9A 3ILFA 4ASMB 1V6OA 4ORFA 2OUJA 1JU4A 4V1PA 5E8AA 1FAYA 1HB4A 2ZHNA 2AEZA 3J8F2 4RN5A 2HWB2 4LTAA 4GQ7A 4LK7A 2QQIA 1H6YA 2VNGA 3FN9A 1I6XA 1MVEA 1DYPA 5FO9B 2VCMA 1IS6A 1V6MA 1VJ2A 5A3MA 1M06G 2ZOEB 3NSTA 2YC0A 4XUPA 5FZ0A 3UGFA 3PUHA 3POIA 4Y1ZA 1GP4A 1W0NA 2W92A 4OQ9A 4CEYC 3D0SA 3I3BA 2MHFA 3VN4A 1XNDA 1UD1A 4JDMA 3J4UH 3S5QA 5K0UA 1F5JA 2AACA 2ARXA 3SCHA 1YNAA 1YQ5A 4PJYA 4E4HA 1VBB3 4LOSA 1UY2A 2I07B 1IZ3A 2P3JA 3WHTA 5IVJA 2FMYA 5BNPB 3WDWA 4K1ZA 5F7UA 4RQPC 3ZXAC 3TEZA 5IVVA 1FNZA 2VBPA 1YUDA 4COVA 3AL6A 3JQWA 4M3CA 1STMA 2GC0A 4TSVA 4MHUA 4COYA 1VRH1 4XXAA 4LE4A 1GQGA 4G9SB 1MEC1 1RUE1 4IV3A 4QHOA 3AMPA 4N53B 3LEGA 1RIRA 3ZXGA 4AVTA 1WD3A 2ETEA 1IOAA 5FY8A 1RJ8A 2XBO1 4GULA 4IGQA 5T52A 4AYUA 2VZVA 2PTMA 3KV6A 3ZDSA 1FXZA 1F4HA 4XFFA 5TSWA 1Z0HA 4XF1A 3AMHA 3POEA 1W6OB 3P3PA 4HOOA 2QZ3A 2CWSA 2WQ8A 4PQQA 2V4VA 1X8MA 3AYEA 4IUGA 3ZXKA 4K6BA 3WCRA 3AM2A 3AZZA 2WABA 3CMGA 4GIQA 4LO7A 1MR5A 4PI2A 2DYCA 2OS2A 1OKOA 3AKRA 3LEKA 1W2OA 3PJYA 4QX1A 3THPA 3WW1A 4B4RA 3QH6A 5LATA 5FZ7A 1TMF1 1VB4A 2JENA 3HQUA 2WZPP 2RR11 1YLLA 2FDJA 1DYOA 4W50A 5H9QA 5FO8B 1IPSA 1HDKA 2P17A 4GD4A 1HV0A 2XDVA 3MW3A 1OFNA 1UOFA 3HNMA 1J3RA 4MYEA 2ZA9A 1WD4A 3EBRA 4F7ZA 2RM23 3H1WA 5EJ1B 2JB4A 2W46A 4P9XA 2H0BA 2C1FA 4PDWC 2E53A 1P8JA 1G9DA 1UQXA 1DLCA 3N7MA 4IEOA 3OBAA 3OYWB 1JHNA 2JD9A 2QQWA 1TE1B 5H9SA 2TBVA 3R05A 5FBZA 2W2IA 4IDZA 1GWKA 5JWPA 1UX7A 4KG0A 1RJ7A 1VMFA 4LPLA 3I2OA 1QJFA 5FZIA 4CP1A 5LRRA 3VL8A 1Q56A 4OULA 2GP5A 1Q8PA 1JXNA 1RUD3 3VZKA 3WW3A 3AYCA 4JV4A 4HANA 2Q5TA 2VQAA 5ANQA 3WG3A 3QBQA 4CCKA 5ACA1 3AX4A 1W9FA 4NHYA 1LKNA 1QQP2 1UX6A 2ET7A 4OLLA 4FPHA 4RHV3 4BWOA 4IE6A 4E4DX 2VMDA 3LA2A 3N35A 4Y24A 5DZFA 4E8CA 2RR12 5I8SA 5LY2A 1DDLA 3W20A 5CISA 3KF3A 3ZO0B 2GU9A 1FOD2 3I7DA 4QPIC 2D98A 4NAMA 1UYPA 5FYSA 3RDIA 5IAXA 3S5AA 4OQ8A 4YGCA 1S1AA 4DQAA 5KC6A 1R1A1 5AVAA 3MIEA 1PO12 2FCUA 4XYXA 2VMHA 3PURA 2VD7A 4KBBA 5FJHA 5C5UA 2OT7A 4TYSA 3L9JT 3TNPB 3THTA 3MPPG 2WZ8A 4HBNA 2VZQA 1ND3C 3AZYA 4D6SA 5IK7A 4UFLA 2ZGTA 3I2HA 3OPWA 5FMDA 3HIFA 2XL9A 3BTXA 2F6BA 4K8FA 4MV2A 3RYKA 2LRPA 1LRHA 1DZQA 1LOFC 2K46A 2V4AA 4LO5B 3SCGA 2O14A 2WC2A 3DPRB 3PDQA 4JQRA 4B1LA 5EJZB 2HWC2 4HVRA 2C5DA 4FXKB 3O1RA 1RUG3 4XXPA 3C3VA 4HK8A 4OZOA 2CGPA 2GC2A 2IC1A 3O1UA 2GNMA 3F95A 1D4VB 1UIJA 4ZHNA 1W8HA 3ACGA 1N47A 3FLPA 3ZMOA 4JX0A 1Q8SA 4A7ZA 1W6PB 1CIYA 1C5HA 2UYBA 3RQ0A 3RNSA 3WVJA 4AI0A 1VPHA 1UY3A 2JIGA 3K2OA 1WCUA 4RQPB 1WLTA 3KT7A 4CP9A 1BQPA 1A6CA 1R091 4MGSA 3M70A 4XFBA 4HL0A 4XJWA 5FXZA 4CCNA 1PVXA 5FY1A 2OIIA 1GANA 5FPBA 4AHXA 3NVCA 2ZACA 3GJBA 1YEWA 1AXZA 1ODMA 1W8NA 2J1TA 4ES9A 2A6YA 3BTYA 2E51A 3IM0A 3WV6A 2RS11 3LEMA 2UWBA 5FY7A 1DGLA 4N7UA 4FPLA 4D6QA 1IQAA 1XYPA 3LFIA 4URAA 4LITA 5HV0A 5FZOB 4QPIA 1SLIA 4Q1RA 1U5YA 2B5HA 4JHZA 3C2UA 3ZIXA 2VMIA 2VXRA 3H8RA 3BOWA 2ZEYA 4ZPIA 1DYKA 4XFCA 3POYA 1AVBA 2PLV2 3SMHA 5FCCA 4AHYA 5FR3A 2VQ0A 3SXWA 2ZTNA 2VOKA 1W9WA 4HFSA 2A75A 3KGLA 1DQ6A 3NL1A 1TEIA 4GMP1 4H14A 4BA6A 4L9BA 4XE9A 1NY72 4OI4A 3U37A 2ZKLA 3T3YA 3MHZA 3AMNA 4Z2WA 5C3RA 3KS7A 2Z42A 3E1F1 3CZJA 1VBD1 2NPIA 2EXIA 2Y8KA 2YYOA 1LHWA 2G9GA 2HWF1 5JCTA 3K3NA 2EIGA 1CZVA 3CIHA 3SNMA 1R1ZA 2L9LA 1AL23 4QQ2A 1CPNA 3RZJA 1ZM1A 1AX0A 4PDWB 2RS12 1KXGA 1LGBA 3OGJA 1LU2A 4AEJA 4YW1A 2XVLA 2YBPA 2DUQA 1PZ7A 1RUC2 4GKYA 4GZ9A 4NRQA 3VBHC 1DQ5A 3ZXEA 1GQPA 1RVF2 3J7LA 3LOIA 4PCRA 4YZ3A 2ARBA 2E7AA 1IPKA 4C0HA 4COWA 5JDBA 5FUNA 3RS6A 2JDMA 4BE3A 4OHYA 4QQLA 1PHMA 3QOPA 4EN6B 5KHHA 1QY4A 5FWEA 2Y26A 2CWMA 3FHAA 1X33A 2CDPA 1YHFA 1PGW2 1OF4A 4LBQA 1F31A 3AKPA 5C9AA 1Q3EA 2UY9A 2XR4A 1UOJA 1OD5A 5CAZA 1WGPA 3W5NA 2P3KA 3AP7A 3ZIWA 3U10A 2IFRA 4OHWA 5JSOA 5BPXA 1DGWA 2VE1A 3SEPA 2R043 1XSRA 4MXWB 2WO7A 4Z92B 1BZWA 1QJEA 2DCTA 5IK4A 3I8TA 1RHI1 1N3OA 2WAOA 3ELNA 5A3WA 4AFBA 1VBD2 4K8RB 1NA1B 4NR1A 1OI6A 2H6CA 3TEYA 4KWKA 2HWF2 2EXJA 4OUSA 4E4ZA 3V0AA 2FZ2A 1CWPA 1US2A 3ITQA 3CJIC 4H7MA 3NV3A 2GAUA 1CAUB 2PHLA 3VBRC 1ZRDA 3NMBA 4YVSA 4E2GA 1ASJ3 2HWE2 5FUPA 3JD73 2O1QA 4XDPA 1SFPA 1NXD1 1UF2C 3Q9OA 4W6WA 4IEXA 5DPNA 1IG3A 1QIQA 2GH8A 3LGRA 1SBDA 1NCRC 2VULA 2A1XA 4DZGA 3IMMA 3RZGA 4Q0VA 2A3WA 3ZR6A 4CDXC 3IKWA 2P4EA 4CRQA 1RC6A 4X8NA 5GALA 1UYXA 4EWEA 1UZZA 5C4WA 1PM4A 2B39A 2VUJA 4IE4A 1RUF2 1TVGA 3LE0A 3VDDA 3U4XA 2HEWF 4QQPA 4AFMA 1C8M3 3DXTA 3R4UA 3BOPA 3F2ZA 2JE9A 3H0OA 3I3DA 4MADA 5GLZA 4A2UA 1QXPA 1WLDA 4D6RA 5BNNB 2IXCA 3NKTA 3DV8A 5JIUA 1OLMA 1SFYA 5IWFA 3ZFGC 3KHCA 2DCJA 1V9U1 4QM9A 1GZWB 3AKTA 4O9EA 2ATFA 2QBXA 2ZGPA 3LSDA 1H1MA 3NWKA 4CP2A 2QVSB 3WT3A 3O14A 4KU7A 5HBAA 2QNKA 5JSRA 3SH3A 1H1IA 5GLVA 1JUIA 4WZCA 3UKTA 3C7OA 5L9BA 2ZX4A 3ZDVA 3O1TA 5AFEA 1CONA 3MLLA 3PMEA 2VNRA 3OUJA 5FKCA 3JCIA 2BW8A 2V5DA 2ZAHA 5FYBA 2EIEA 1GP6A 3WQ1A 1JUHA 2JDNA 1ZBE3 3LKJA 2J1VA 1HRV3 3UESA 1JHJA 3B93A 2X29A 2XJRA 3UJOA 1AR61 4AL9A 3QACA 2XMLA 3WF4A 5FOBB 3JU9A 2RMU1 4G4FA 3CJIA 3H3UA 3VBRA 3VBOC 3VDCA 4M0HA 2A6WA 1UN1A 4AI1A 2BERA 2J1RA 4Q4W2 4QQOA 4I0WB 4AAXA 1EV12 2ZMKA 3HQXA 1CJDA 2QQPA 4QGNA 3N4MA 1NCRA 3AXDA 1JYTA 3M3QA 4RGAA 5EYXA 4CDXA 3ZN5A 1OFSA 1S0IA 1W3XA 4BK5A 3KCYA 1D2QA 2VCAA 4YZ1A 1O4TA 2ILMA 2YPJA 3GBFA 4MHRA 4XMIA 2H0VA 2BJSA 1PO21 2IXHA 3SQOA 1RINA 3LA3A 1LB2A 3FUQA 5JR7B 4EZ4A 2WNVA 2VQTA 3ETQA 1COV1 3OGGA 2VY0A 2AC1A 4CE8A 4J25A 1RUI1 2VC9A 3OEAA 2OZ6A 1QH6A 2VZPA 3RMXA 1DLLA 3VBHB 4JCKA 3W59A 2YBKA 4M3CE 3ZFGA 4CUBA 3G6JB 5HXVA 3HNBM 3VLBB 2JG8B 5JMOA 5JXGA 1AR62 3HJRA 4HKLA 1F35A 2A71A 3OBTA 5DAXA 3ORJA 3WNXA 1YIPA 2VU9A 2ZHLA 2JDPA 1XE8A 4DO0A 4LR4A 1HXS3 3NJYA 4XDQA 4LKSA 2X10A 5FXWA 3AKSA 5FZLA 3B01A 3WNKA 1LHVA 2R7EB 3POSA 4HSJA 4K9SA 3M8LA 2JJ6A 3R4SA 2D40A 4RYDA 4ZONA 5I93A 4LXLA 1XE0A 2IFWA 2D3RA 1JOPA 5IJRA 5DUXA 4Q5OA 4MG2A 2GNTA 1AR82 2VOVA 4QPGC 4UFIA 5A32A 2WT0A 5I0SA 1RL3A 1TME2 5A3LA 5ABJA 3VBUC 4FPJA 5CB7A 1SCSA 2E6VA 3ACIA 3RRDA 4A41A 2R071 2R062 1RMU2 3HBKA 5FZ1A 4LBJA 1ND2C 2PELA 2WFF2 1N3PA 4MH0E 2I45A 1CVNA 1COV2 4L11A 4KL1A 5A33B 2DVAA 2GZWA 3VBOA 1MS8A 1RUI2 4GWMA 1GYKA 5FDBA 2PHXA 2QQMA 1H30A 4EV0A 1PVC3 1MQTC 2ADEA 2Y33A 3KV5A 4QU1A 4AGVA 5JZGC 1D0GA 1ZZ8A 5FAXA 1CIWA 5E16A 1VBC3 4Y3OA 1HLCA 1FPN3 5EFUA 5FPUA 1PIV3 3WNPA 4OHXA 4Q4X2 1IS4A 1E5SA 1VBE3 4DIQA 1AUYA 1AHSA 4P02B 4XF0A 3AP4A 1UXZA 4FAGA 5AC91 1BBT1 1S0JA 2GMPA 4Y5Z0 4Y5SA 4QX5A 5EQUA 5A3OA 1JYWA 2O0OA 3ZSEA 3VBFC 3A7QA 2A7AA 2DCKA 1WW5A 3BYWA 5A1AA 4B8EA 2CGOA 4JKKA 1XRUA 2OXBA 3FUOA 2WNUC 4ONUA 5FMOS 3RPQA 1PMHX 4HETA 1QJU1 1HKDA 4YW4A 3JQXA 4AFAA 4IEWA 1QGLA 4XVHA 3MICA 4B3NA 4C8DA 1JYNA 2ZGMA 3N9QA 4DUXA 5LEKA 2JE8A 4ZS3A 2Z5WA 3WP4A 2HEYF 1QJY1 2PAMA 1RUJ1 3NAPC 2Q1FA 2XJTA 3GXUA 4HSLA 1GR3A 3BVCA 2DFCA 1F9KA 4QX8A 4CDQC 4A45A 1KS5A 1ACCA 1AR72 4EN0A 2FHRA 4EN7B 1H8TC 4BCUA 2IXJA 3TN91 3MEPA 5LA2A 5LRSA 1SPPA 1QF3A 1TQ5A 3OBRA 2IUWA 3POGA 2D6KA 2DBIA 5IW0A 3ZMNA 4IV1B 3OY8A 4A3ZA 2WSUA 1JZ4A 1SCRA 5EIYB 1PZ8A 3BU7A 4QPWA 3BALA 4UFJA 5F5AA 1GOFA 2NZ9A 3LFMA 4P9JA 3U78A 1R081 2W94A 3PTRB 4QPGA 1O5LA 3DL3A 5F8PA 5FRAA 2VZ3A 4QWNA 4XFIA 4IGPA 4KGGA 3VBUA 1BBT2 4KWLA 5BUVA 4NO4A 1QOSA 4PQ9A 5JLVA 1QJX1 2VNOA 3ILNA 1ND2A 3KT1A 3URFA 4EYUA 3RZHA 3TNQA 2RS31 4M3CF 1MS1A 5FYHA 4QXHA 4FP3A 4I0BA 1NZIA 1UKRA 4QX7A 4CDUC 1EAH3 1YRZA 1W6QA 1W3VA 3BPSA 4QHBA 4BQWA 3GM8A 3PTYA 3WLUA 5F5CA 3IB3A 2FQPA 2QJVA 5J09A 1G9AA 1MQTA 5JZGA 1BEV3 2ZHKA 1NAEA 3ME2A 1N1YA 4OZXA 4Y22B 4BHPA 5L36A 2VBBA 2E26A 3AYAA 3PIGA 2VAUA 3G7DA 2WN3A 4Y20B 1W05A 4OCTA 2LROA 2Q30A 4R9BA 1ODNA 1AYM3 4JQTA 5L7OC 3KZ4C 4EWAA 5KHJA 4OI0A 4GMP0 3E5XA 3VBFA 5J7MA 2WZR3 2VL4A 1SBEA 2J22A 2JECA 1ULOA 1KFXL 1EP0A 2LUWA 1R082 1ULGA 4YWAA 1XNKA 2NQYA 2XUEA 4FFFA 1HJGA 1DP0A 3BIEA 2ZGUA 3I54A 1MZ5A 1XU2A 3O12A 3LB9A 3FFZA 4CXWA 1CQ9A 1NCQB 4N7IA 5CNAA 1JN2P 4KWUA 2XJPA 4GWNA 1ZZBA 2B9VA 2WDBA 1H2MA 2BFUL 3EB7A 5A6XA 5FZKA 3LF7A 4BDVB 4CDQA 3P6BA 2NMNA 3EO6A 5CFCB 1XPWA 3WNLA 4BQYA 1H8TA 5C6CA 2GC1A 4Y1VA 1ZZCA 1G8WA 4NMIA 3VB9A 2ZKNA 1UXXX 1ZBA2 1GOHA 1Y9GA 1G9FA 4HKWA 4H55A 3HQRA 3T4VA 5H9PA 1PNGA 3ZXLA 5F1RA 1MZFA 1YJLA 2W39A 3N7KA 4P9WA 1VR3A 1DZRA 3WSOA 3W21A 4B4QA 1D2SA 2ZGKA 4AQTA 5FY9A 2HWB1 3HN3A 4RFRB 4XC9A 1O3TA 1FMD3 1D7PM 5CFDB 2DF7A 4BYYA 2WS93 1W8TA 1W9YA 5G05L 1QU0A 1O8SA 1PM7A 5FV3A 4ET7A 1FX5A 4D69A 3V0BA 1ZRCA 3AZVA 3NQHA 3GZUC 4CDUA 4IXLA 4XHBA 2PAKA 4Z82A 3WDVA 3O1PA 3WR0A 5GM0A 1B35C 5FZAA 5T5OA 4XDOA 5J3UA 2B4KA 1W2AX 1YQ8A 2ZGSA 4NPRA 4W8JA 1A3KA 3INAA 4IE7A 3UL2A 3CZUA 3WP5A 4UW4A 2P3YA 4XUOA 3ZXJA 4AR2A 4E2SA 5L7OA 4J1XA 4PLNA 3THDA 5DXDA 1FATA 1LULA 1OHFA 2HWD3 3O1SA 1N3QA 3RZKA 1VBB2 4LBKA 2AENA 5DAPA 3GZTB 4XJAA 2XWJB 2BU9A 3SH4A 4BMEA 4LHSA 4WM7B 3WDTA 1EYBA 3BN6A 3ZYIB 1REFA 2E31A 2VVDA 4ISQA 5BNQA 2QE3A 3M1HA 4YM1A 3ROUA 4B29A 5LWBA 4CCJA 1YO8A 2ZAAA 3AKQA 2Q8EA 5IVBA 2B8MA 2B46X 1PK6C 1X50A 2DTWA 3USUA 4EQVA 4Z07A 4PIXA 4BQ1A 3VD7A 3VV1A 1OOPC 1YFUA 2J1EA 3IAPA 4LLFA 1NE4A 4FPGA 1V6LA 1SMVA 1UIKA 4QKNA 5FYZA 1SDWA 3DF0A 4FTSA 2ZGRA 5F39A 1V6NA 4LUKA 4P00B 5HCHA 4UAPA 5B2GB 4CCCA 4TWTA 2C0ZA 2JICA 1XYOA 4Q4Y3 5E89A 4CEWB 1IKPA 1JMUB 2ZGOA 1QH7A 2N7GA 3JXSA 1SQ4A 4L97A 2D6MA 4JTOA 4M01A 4P9IA 4RR3C 5EZWA 4AEDA 4CCLA 2B42B 4B1MA 3H3ZA 4I0AA 4OHVA 3U4SA 2WA4A 2VW0A 1AYN3 2MPFA 1BKZA 3ZSJA 2AGSA 4NRMA 5IAVA 4RGGA 5CG9A 5FZ3A 4QDRA 5I0DA 1RUNA 3RJ2X 4XFHA 2YC2A 3FZ3A 4MZUA 1LCLA 4P5HA 5DDJ1 1HN1A 1NOVA 3HEIA 4H7LA 4LKDA 4C91A 3OD0A 4LHNA 4Q0UA 1B35A 3E5UA 3BCWA 3MDPA 4QDSA 3T09A 2VOXA 4I3GA 3TWIA 5KXCA 2X5IB 4QKDA 3ETPA 4M0NA 1X9PA 4AGRA 4CU8A 2BBVA 2RM22 4WV8A 2BTVC 1U5XA 5A7WA 1O4ZA 3V64A 1YYNA 4I01A 1OLME 3W5MA 1JOJA 4B7KA 5FQ0A 3ZFFB 2KD7A 2ZHMA 5FK7A 5J36A 3ZXFA 4WVZA 3IIAA 3PUSA 4NHMA 1DQ2A 4Q8LA 3GJAA 4HVOA 4FPYA 3POFA 4HXCA 1QQP1 5C3QA 1TG7A 5HCAA 2YROA 5A1FA 5JOWA 3E97A 1J84A 4CU9A 3P3NA 1O3QA 2VTFA 3T0BA 2EVXA 1RUD2 2FMDA 3MIDA 3JBG1 1PK6A 2AYHA 5I91A 1PGL2 4U36A 1U0AA 5A6QA 1BMV1 1FOD1 1OOPA 1W90A 5HV4A 3D8CA 4RHV2 5FZEA 3UNPA 3WDYA 1O91A 1HRI3 3M3IA 2WJSA 4AFDA 4AVVA 1VIWB 3M4FA 1SACA 2D7FA 1PO11 1RITA 3L2YA 5DDJ2 4Q4V3 5K0UB 4IETA 3ZKUA 4AVAA 4YLZA 1QOOA 4BMBA 4GB31 3RWKX 1XQNA 2RJ2A 2VM9A 2ZPXA 4XUTA 3ACLA 3VD3A 1G7YA 4H2AA 4H3WA 5JOYA 4IESA 5ISLA 4IEPA 1Q43A 3A23A 1EUTA 2VZ1A 3OGSA 1IS5A 3LEIA 3NV1A 1Z7S1 4P9YA 3X29B 1QJZA 4L92A 2EF6A 4M3CB 3I2IA 4GH4C 4RR3A 4YVWC 1XXNA 3S57A 1OA3A 3FFQA 2P6HA 1ULPA 3I3EA 4HN0A 2C9KA 4IV3B 2HWC1 3FE5A 4NAOA 1W06A 4LEJA 3AXEA 4YFWA 3TOJA 5F3EA 2Y60A 3O5SA 2PFWA 2WL1A 2WT2A 2P1BA 4RS5C 4S2FA 1JU3A 4I30A 1NG0A 1MS5A 2QQLA 5EPAA 5CVRA 1ONAA 1JYVA 1ZZ7A 3T0DA 2CAUA 3JBG2 5GJ6A 2CGNA 1BMV2 2VJXA 4CPBD 5JPMB 1L7RA 2PHFA 2Q8DA 2Y0OA 3Q8EA 1CAWA 1O59A 5FZFA 1EPZA 1VRH3 2WQZC 3AJZA 1GUIA 4QQHA 2NM1A 4YGBA 2MEV1 4GB32 4NE9A 1MEC3 3RI9A 3LIHA 1RUE3 5DQ0A 4XABA 4F8AA 3SKVA 2D6OX 4J1WA 2B9UA 4MUVA 4XQWA 2QQUA 4Y26A 3DEMA 3RMYA 1LOAA 3AFGA 5IHRA 2H6BA 5LY1A 1NX9A 3GHMA 1CAVA 1RUH1 1Z7S2 4BLJA 2VZTA 4I09A 3IAQA 4ZY9A 4E2QA 2XBO3 3WINE 2CL2A 1IGOA 3E6DA 2FCVA 2WFPA 5GZEA 1YFWA 5FZOA 4ZZ8A 2CYFA 4LBNA 1W99A 3NNFA 4KQ7A 4P9LA 1GNZA 3AFKA 4BB3A 3HN1A 3WF0A 5FLJA 4CEYB 2FDFA 3AB0A 1YI9A 4FPFA 4JGYC 5FBJA 1SFNA 1W2TA 5CYYA 5FP3A 4A7YA 2GDFA 2JG9C 4XFAA 2PLV1 3LCPA 2ARCA 1NT0A 3WF2A 4A6SA 5A6ZA 3MLKA 4Q0SA 1SLLA 3A22A 4CDWC 4PLOA 2GP3A 2HBTA 1OSGA 1ENXA 1N1VA 2EALA 2VXJA 1NY71 1TMF3 2XONA 5LBBA 2RR13 2Q8CA 1PX3A 3N9PA 4KWJA 4A4AA 2MEV2 2UWAA 4GH4A 3E5QA 4YVWA 5C9AC 1AR91 1OMIA 2E63A 2R30A 3LDRA 4XJ8A 4AHZA 3VZJA 5BY5A 3OSDA 3U75A 2YGLA 3N9LA 4X6QB 5FPLA 1LJ7A 1RUH2 3ES1A 3RJRA 4INDA 4KH9A 2OX0A 3P5BA 4AZZA 1Y9MA 4RS5A 3PUQA 5LEJA 2ZBJA 4XF9A 3SISA 2XLAA 1RUC1 1UYYA 3UKVA 4COZA 1RVF1 3N9NA 2AUYA 1AL22 4ES8A 4NROA 3GCWA 1F5FA 5EWSA 1UMZA 1V6IA 4YVSC 2WAAA 1JI6A 2DV9A 3NJXA 2BNOA 5FYIA 1URXA 4FOYA 2Y6JA 3EXUA 1W8FA 3W9AA 1PGW1 1J1TA 5C8WA 1A78A 3MIBA 3UETA 2DTYA 5ACA3 3H8XA 1ZRIA 4LK6A 2ZCWA 1GWMA 4QXBA 1BJQA 1Q5OA 3I59A 1NQJA 2WRAA 2YUEA 2WNEA 3HVDA 5FZGA 4P5YA 5GZDA 1UU4A 3WY6A 2W47A 5F5QA 5C4WC 2YB7A 3B94A 1UY4A 1YWKA 2PHDA 5IUQA 2BNNA 1AR92 1J83A 2W95A 5SV5A 1UMHA 2XHNA 3VDDC 2VNVA 4XACA 1EPWA 5FP4A 1ENSA 2VMCA 2RDRA 3THCA 2B7YA 1R1A3 2CU5A 1JZ2A 2R042 2D6LX 1A8DA 1RYYA 1VAVA 1JYXA 1ALYA 1PNFA 2A70A 2PN5A 4FFIA 4K7JA 2J1SA 3ST7A 4JGYA 2HWE1 5AVPA 5FIXA 1CGPA 3ABZA 3U07A 2JG9A 2NLRA 5FZDA 1LOBA 5A7PA 2Y38A 5K7PA 4CDWA 4CUCA 5CEHA 1B09A 4Y1XA 4XIOA 4NIHA 5FREA 3U11A 1UAIA 3QH7A 2KXLA 4NIIA 5FZMA 1LNSA 3BGAA 2UWCA 2WWJA 4CP9B 1LR5A 3T08A 1ASJ2 1LHOA 3H9AA 3JD72 4HZFA 1YQ2A 2FDGA 1D4M1 1Q8QA 3CEWA 4LA2A 4WVVA 1OVPA 2LM3A 4YM2A 1DGRA 2CTVA 5FOJB 1RUF1 2ZGNA 3J7MA 1ZYBA 3MFAA 1YFYA 1G9CA 3VBSC 3VUOA 5KC5A 4YG0A 1YQ6A 1WMFA 3BU0A 4HONA 2JE7A 2R1BA 2Y6GA 3AYDA 5JI9A 1WW7A 4BQ2A 3BUCA 2ENRA 5DUWA 5I0TA 5C8CC 1C8M2 1K45A 1ZX5A 2JEMA 4QPIB 5T5LA 2NP0A 1LEMA 1YQCA 2BEOA 4XW3A 1R093 5D8AC 2OYZA 4AVBA 3I97A 2ZMLA 2XQXA 5JAXA 1K3IA 5L9VA 3JZVA 1XNTA 2XXZA 3KHBA 1BK0A 2IVJA 4LULA 4KG8A 4Q27A 4UFHA 4XURA 1IHMA 4CCEA 5FZ4A 4E8DA 3B00A 1DGWX 3WG4A 2FDIA 1S0DA 5F5IA 1W04A 5KR7A 1KRIA 3VHOA 5IVEA 2JDZA 1DG6A 1RTVA 1ND3B 5JUVA 1C5IA 2C6SA 2HYKA 5FXVA 4IEVA 2RS13 3TBDA 5FUIA 4WVMA 3ZSKA 1D4M2 2R16A 3CBNA 1MZEA 3CJXA 4TZDA 4Q26A 3NNGA 1G6NA 1NLSA 5I8TA 1SEFA 2ZS6B 3I2JA 4YW7A 3OOXA 3SKJE 2WNVC 3VGIA 3RYRA 4TN7A 5FYTA 4RGKA 1WMXA 3FJSA 2LALA 4KNCA 3WW2A 2BFUS 1HRV2 5G04L 3UK9A 3ZYHA 1W6MA 2ZEXA 2BOJA 2P5BA 4Q4W1 5LA9A 4K20A 1SHWB 4GMP3 1I3HA 1EV11 1JTZX 3WOGA 1NZCA 2D93A 1K5JA 3SHRA 4XTPA 3WQ7A 1VMHA 3VZNA 4HK9A 5CZKA 3J7HA 4JDNA 4LBQB 2QDRA 1JOBA 1POV1 5FZHA 4A42A 3U1XA 5FP7A 4BM8A 2HWF3 3I2KA 5C9AB 3ZN4A 1VBA1 3C7GA 3FBYA 3FHIB 5FJKA 1XNAA 3OG2A 5KBFA 3VHNA 2E32A 1YI7A 2W1QA 2XKOA 5FPXA 2XQRA 1GOGA 1K12A 1HJFA 3VBSA 4GWJA 2BZDA 2RDQA 3R0RA 3KV9A 1LOEA 2RE9A 4YARA 1QXRA 5GLUA 4UBGA 1VP6A 5ABJC 5CA6A 3N36A 2ID4A 3OUIA 4PI0A 2JG8A 1JZ3A 1HQNA 1DQ0A 4XCBA 1S0BA 2W1SA 3BB6A 3WUDA 3V0AB 4L99A 5C8CA 3WNOA 1PX4A 1W03A 5CKQA 4LHLA 3VKFC 4AQ6A 4YVSB 5D8AA 4PBPA 3VZLA 1ENQA 3K46A 4XQDA 2OQ6A 5LBFA 2YZ4A 4CCOA 1S4CA 1IG0A 2J7MA 4XHXA 3HMYA 2YFZA 2GSYA 4OFGA 3WNMA 5BNOC 4UBHA 2VO5A 2WSVA 4N43C 3H8OA 1HXS2 2ARAA 2RDSA 2XJVA 3NNLA 4FPCA 1AR81 3APBA 3ES4A 2FDHA 1RHI3 1C28A 4GXLA 4XUNA 5C4WB 1TME1 2QCSB 4FVVA 1EUUA 1ZRFA 2UYAA 2Y6FA 4NUBA 1VBA2 3ZN6A 2BV4A 2R061 1C3HA 1RMU1 2GNDA 3OCPA 3VDDB 2VCBA 3WQ0A 1GU3A 3GF6A 5LBCA 5HXMA 2ES3A 2WFF1 5J37A 2YY1A 1XSQA 3DN7A 4K1YA 2WLQA 4W6YA 2Q1ZB 4RFT0 1WKYA 5CKMA 3ZVXA 2V72A 4MO3M 1OLQA 4TXWA 4C1XA 4LIUA 3H3LA 3K4ZA 2W1UA 1UZYA 2Y6LA 2W9XA 1JZ5A 3TEWA 3E6CC 3I49A 4ATEA 1C57A 3B5LB 3CLPA 4NVPA 2VZSA 3ZYFA 4R9DA 4ASLA 4M4RA 4EN8B 5J96B 2VMEA 2XLGA 4Q4X1 2CAVA 5APAA 4XCAA 5ANNA 1BLZA 2VZOA 2I74A 3IPVA 3O0XA 1ZA4A 4JAAA 4M4PA 1OD3A 4ASKA 2VW2A 2VVFA 4BOWA 2WINB 1H1AA 2X05A 1WLWA 1N1SA 1VBC2 2XJUA 1FPN2 5F2WA 4DOUA 2Q4SA 1F15A 4JGZC 2XL7A 3O7OA 1O6UA 1VBE2 2OVUA 3AL5A 2VECA 4XJZA 4FQZA 1V9U3 2WA3A 3LD8A 3KSCA 1Y3TA 4WM8C 3PHMA 1LAJA 5KHIA 1U12A 1W2NA 4FT8A 2AH2A 5F3IA 2PHWA 4CCMA 2Y34A 1K5MA 3H50A 3CJIB 2A3YA 2WO3A 2QDNA 3VBRB 2D5FA 1X7NA 1DQ1A 2WR9A 4YZ5A 5LASA 4MGYE 3RFRA 1ENRA 2V73A 1WCKA 4O9GA 2RS51 1AR71 1OC1A 2JD4A 1W28A 3V65A 1S0FA 1KJLA 4CXYA 4EROA 4HVQA 2ZX0A 4FBFA 4QHZA 3AVRA 5C5TA 1NCRB 2JDAA 4LBMA 1NUKA 4JZRA 5BNOA 4N43A 1HW5A 5JMCA 4DY3A 3IDCB 5CIRA 4IE0A 4CDXB 3OD4A 3ZX7A 1YCIA 2DBNA 1CAXA 4O61A 3RSJA 1FV3A 1GQHA 4UT5A 4HPKA 5BXXA 2JX9A 1AR63 4P08A 3LSEA 1ZVFA 3LDBA 2EXKA 2OKXA 3PJQA 3TB0A 2RMU3 2JKBA 3ECQA 5LK5A 2CV6A 1MS9A 1Y4WA 3DYMA 3ZFEC 4XPVA 4S2DA 1H8VA 2R49A 2RJLA 4UF0A 3N7JA 3K4DA 3ZFGB 1QDOA 1QDCA 4XBQA 2XJSA 3MGUA 4NJ4A 2WO2A 1LECA 2XH6A 3CQOA 1DIWA 4E4SA 1EAH2 4JVAA 2RS52 4DINB 5A7SA 2VUAA 1PO23 1W6NA 1KJRA 3SEEA 4FCAA 1OURA 3H1MA 4RD7A 3OUHA 2BVBA 1SZBA 1COV3 1LU1A 3KLSA 3T1MA 3RZLA 1I5PA 2A6ZA 1RUI3 3VKLA 4AW7A 3ZR5A 4EWDA 2G19A 5A32B 1H9PA 4JGZA 5F37A 4BJ0A 2X09A 5FP8A 4QD2A 1AYM2 5FZBA 5FYVA 4AEMA 4CUAA 2C9AA 1JZ6A 2OPWA 2W68A 3PVNA 4PT6A 4WM8A 3WNNA 2VTXA 1MZ6A 3HD8B 4AI2A 4J6GA 5HCFA 4B7EA 3Q8CA 3VBOB 1G9BA 4GWIA 1H4HA 3LIGA 4QB6A 4ZS2A 2BYVE 3KCCA 2UURA 1W0PA 5IATA 4DXTA 1CX1A 3N7LA 3NJZA 1S0CA 4XBLA 1CX4A 5A7NA 1ZBA1 2DU0A 5BNPC 1NXMA 1KDKA 4YYOA 1VE0A 4KGQA 3UJQA 2WYFA 4QB1A 2R073 2LW8A 3H8UA 1QOTA 1UMIA 2W3JA 1WZXA 3MIGA 2CDOA 3UV9A 3POWA 4FOWA 2KR2A 5LK7B 3RZMA 4IERA 2YG0A 5HI0A 5FK8A 5FMCA 1BYHA
chains in the Genus database with same CATH topology
5T5PA 3ZFEA 4EJRA 4N53C 2BNMA 5I0RA 2A3XA 1ZRRA 3NV4A 2ZX2A 5CADA 4YGDA 4R9AA 3ILRA 1AL0G 4N9HA 4GALA 1FMD2 3K51A 2GN7A 2E7TA 4CZSA 4Z8BA 2WS92 2BUKA 4XJUA 2UU8A 3JB4C 3H7YA 4XMAA 4AI8A 5AC93 1BBT3 4YG6A 3IDEA 3VZMA 4OVEA 2VPVA 3CU7A 1OQ1A 3OY8B 2E7QA 2DUOA 5JSPA 3WZ1A 3WUCA 1VBB1 4XF4A 1QJU3 2KM2A 3BTAA 1UPIA 4QPGB 1HQLA 3WXPA 4DPNA 1DQ4A 2AZ5A 3VBUB 4IEZA 3ZYGA 4CYDA 1QJY3 1RUJ3 3EHKA 2DVDA 1ND2B 4AEDC 5I8YA 1VALA 5CG8A 1MS3A 4FSJA 4JTNA 1KS4A 3RZZA 1OLRA 4R4XA 3SCFA 1AYN1 3TN93 2V5YA 3ZYRA 1W6QB 1DBNA 2VH9A 1X82A 1AZDA 1WW4A 1MQTB 2XKPA 5JZGB 4LO8A 4N9IA 4AEKA 3KD4A 1R083 1UW8A 2EXHA 5BNPA 4R52A 5KXDA 1J1LA 4D3WA 3JUUA 4CEWA 1HV1A 1V6JA 3A4UA 1QJX3 1GSLA 4NHLA 3EQEA 3GZAA 2RS33 3VBFB 2PAEA 4P14A 4Q1PA 1OA4A 1CESA 2WNUB 3WG1A 4AF9A 4AQSA 4N53A 1WCSA 2Q8OA 3CL1A 3MZHA 3VHRA 1F2NA 4Q4Y2 5KXEA 2Z69A 3PMSA 2XHKA 4U2AA 3GALA 3NAPB 2XLFA 1AYN2 3B7MA 1HIXA 2RJKA 4QXKA 4CDQB 2I2SA 4NOTA 1HRI1 1H8TB 2DVGA 2RM21 1SLBA 2D3SA 4YW5A 4XZPA 5J48A 2O8QA 2BVVA 1H2KA 1W6OA 3D0JA 5GKAC 5SV8A 3M3CA 1POV0 4LLOA 1WMEA 5GLTA 2JXAA 3IDBB 1MS4A 2EAKA 1OPMA 1Y7BA 2D6PA 3E6BA 4AG4A 3DPRC 3AK0A 3H1YA 3ZYPA 1RUD1 1AXYA 3V0BB 1PGL1 4Q2FA 4CDUB 4RHV1 5FFOC 4OI1A 3OYWA 2W52A 2DVFA 4AGGA 1QXJA 1JYCA 3MF6A 2YDEA 2XG3A 4RA0A 3J8F3 2DU1A 4ZXKA 1HRI2 3IBMA 2HWB3 1LODA 5L7OB 4Q4V2 1CD3G 5EYYA 3WDUA 4K21A 2ZGQA 1YXWA 2VGDA 4OHZA 3ENRA 2XB6C 5KHGA 2D5HA 1QHDA 4HN1A 4PF5A 3D82A 3BPZA 1LEDA 2ZZJA 3NW4A 1X36A 2R1DA 4AE2A 4Q0PA 4OUMA 1NLRA 3NKGA 1QMJA 2PHTA 4IEUA 2XUMA 1SLCA 4HMZA 3VKMA 4I3PA 2PHRA 2DCZA 5FO7B 5CU1A 3USUB 1F8VA 5FTTC 1SLTA 4YW3A 2OPKA 3FBMA 1RUG1 1NQDA 4BIOA 1GICA 4S2HA 1X8EA 1CR7A 3B69A 1O3RA 1QWRA 4NWWA 2LTNA 1YIFA 1WBLA 2E9QA 3D4KA 2P2KA 4IQPA 1KDMA 4SBVA 5KWRA 4UXAA 2DURA 1OA2A 1UU6A 3FLRA 2V09A 4QPYA 2GH2A 5DG1A 1J3QA 2R0HA 3ZSMA 3M3EA 4FPEA 5FMOL 4QM8A 4XFGA 5CBLA 1BVVA 5L73A 1VRH2 2IXIA 2ZGLA 3R4DB 4YZ4A 1XNCA 3HBZA 3VKNA 5JI7A 4AEDB 3DPRA 1MEC2 1UL9A 1RUE2 4DRVA 3MLJA 1YJKA 3SITA 4CEYA 3CNAA 2G9FA 5EV7A 1EY2A 2XBO2 1OQEA 1PZ9A 3VHPA 1N1TA 1B35B 1WMDA 1W6PA 1XNBA 2D3PA 4QGLA 1S55A 2TUNA 5F6LB 1RUG2 4RQPA 5GLWA 3S7IA 1FT9A 5IK8A 2ZX1A 3DKWA 4IEQA 1PMIA 5AFBA 2VOWA 5FQ0B 4YG3A 2K9ZA 1DHKB 1AJOA 2Z79A 4D7YA 4FTBA 1TMF2 4LA3A 5DDJ3 1RUOA 1WW6A 1NA1C 1MVQA 2Z2SB 4F3JA 1O5UA 1PK6B 4META 1PGSA 4DXZA 1L3JA 5F9TA 1OKQA 1OOPB 5JPNB 1ULFA 1WA4A 1AL21 1BK1A 3IN9A 4Y4YA 5C33A 2VMGA 1HX6A 2IWGB 3PVOA 4WZFA 3USSA 3NV2A 5T55A 2WT1A 3DGTA 3H7JA 4BLIA 1YFXA 3CF6E 2A73B 1QQP3 2R32A 2BGCA 4AQ2A 4ZU7A 1OQDA 4FTEA 3AP9A 1DF0A 4YNIA 4RR3B 3JBG3 2XPJA 2QUOA 5T5JA 5ACA2 1FOD3 2EA7A 5BNNC 4JRAA 1PO13 2R041 4PDWA 1J59A 1C1FA 3RI8A 4GB33 4YZ2A 1Q8OA 1XU1A 3PNAA 4MGKE 2GMMA 1JBCA 4MLOA 4B4PA 5IT6A 2D43A 1R1A2 4MX3A 4L8QA 4ZKTB 1ULDA 1Z7S3 1J58A 1CAWB 2D44A 2ZZQA 4RSUA 1H4GA 1ASJ1 1S2KA 2ET1A 2Q0AA 3FMGA 3JD71 3ZSLA 5EXOA 2GALA 5I0UA 3FWEA 5KXBA 2BWCA 3ATGA 3S30A 2GC3A 2HWC3 1ZREA 4D7SA 4YM3A 1GZCA 2HEVF 4MXWA 4PBOA 1CAVB 1G86A 4ZU4A 3D5OA 2CNAA 1I5ZA 1RB8G 5K8SA 1KD7A 2ERFA 3T2TA 1NA1A 1DZTA 4F83A 2EAAA 5DUVA 1WBFA 3AZXA 4I02A 1C8M1 1CAUA 2X53S 3AMQA 5KHKA 1W2UA 1O7FA 2X8KA 5IK5A 2MEV3 4DB5A 1IS3A 5FPZA 5GZFA 4XIKA 4YW2A 2TEPA 1ND3A 4SLIA 3EJKA 3J9SA 1RUH3 1ZZ6A 4MGIE 4X8PA 1R092 2G4IA 1DFQA 3GBWA 1LESA 2Y0IA 3TYJA 1LOFA 5E88A 2IXKA 3KQRA 4GH4B 3RWNA 1FV2A 4YVWB 4NN0A 3PVBB 1Y9QA 4FQ4A 4LNVA 3R6SA 5BYNA 1GLHA 2O8OA 1AF9A 4QMAA 4Y1YA 5BNNA 1S2BA 3B9CA 2FBEA 1CPMA 2PLV3 3WG2A 1ZBE1 3IMNA 4RS5B 2DVBA 1HRV1 2JG8C 2B45X 4QU2A 5F6KA 1GZWA 1GNHA 3AP6A 2AREA 4LHKA 4ISRA 1CJPA 4A7KA 4L2NA 4DY5A 1QNYA 4JDOA 1ZZ9A 2RHPA 1AR93 2KA3A 4COUA 3LA7A 1SBFA 3FC0A 3O0WA 1XYNA 2MNGA 3I59B 1U5ZA 1FYUA 4S2GA 4XETA 3PLQA 1NYWA 3V56A 1RUC3 2P3IA 2WKKA 4K40A 1RVF3 5T54A 2YXSA 4BZ4A 2W08A 4YRDA 3BIWE 3AZWA 5E1RA 2BPA2 2PQQA 4JGYB 1W0OA 3S0MA 1ZBE2 2TNFA 3MYXA 1M4WA 2QKDA 2JG9B 1ULEA 1WCDJ 4LO6B 3WDXA 3PVEA 4CDWB 2VG9A 4YM0A 1ULCA 4FP2A 4K3UA 1S0EA 1HXS1 1AXKA 5DZGA 1UKGA 1VBD3 4XQ4A 4KU8A 4IEYA 1BXHA 1VAMA 4AVSA 2DUPA 4Y1UA 1O4YA 3NO8A 2GN3A 4YGEA 1DGRN 2PA7A 2XJQA 2HWE3 4FAHA 1RHI2 3LAGA 3VBHA 1LGNA 4D94A 2K0GA 2YV8A 1BVP1 1BCXA 2P37A 3CO2A 3GBGA 4ZU5A 2R0FA 2A5ZA 1K5MC 4XF3A 4C1WA 4CTEA 5HCBA 3M7AA 4XOGA 1D4M3 2DWRA 3M2MA 3MFCA 3ZPYA 4E27A 3J26N 1CN1A 2YGMA 2WWSA 3MW2A 1RUF3 4IV1C 1PVC1 2QZ2A 1RGSA 5K9YA 3A0KA 1V6KA 3ASIA 1HQWA 1VBC1 1FPN1 4MSVA 4N7UA 1PIV1 2PYTA 4WVMB 3VL9A 5GZCA 4LBLA 5GZGA 1VBE1 3WP3A 4HKOA 3MW4A 5DUUA 3HWJA 2GNBA 3SLIA 3U0ZA 2XWBB 1H2NA 4LBOA 4JRLA 1V00A 5A33A 4UW3A 4LT5A 1VLNA 1V9U2 1W6MB 3B9IA 2BWAA 3JB8A 1UU5A 5J98B 3K48A 1QKQA 1GV9A 1UCXA 4XILA 4AFCA 1GBGA 2FZ1A 3GHNA 4AWDA 4URTA 3M3OA 5D1IA 3FX3A 1AX1A 4Q29A 4GKXA 4AXOA 2IZWA 3MIHA 4I2OA 2QFEA 3D6EA 1LOGA 1PVC2 1JH5A 1C4RA 1LGCA 4NWVA 3VBSB 1PIV2 1O3SA 3VKOA 4Q4W3 3W58A 1A8MA 1VB2A 1EV13 1Y43B 4PLMA 1NCQC 2NMOA 2RMU2 4XBNA 3AJYA 5C8CB 2HJIA 3GYDA 3LZZA 4LUMA 3T1LA 2AR6A 1KQRA 5D8AB 1H2LA 1POV3 3IWZA 5CFCC 1EAH1 1VBA3 3SH5A 2A6VA 2ZX3A 5BV6A 1TNRA 4IV1A 4YFZA 1BEV1 2XVGA 4BH9A 3ZYJB 5T3NA 5FLIA 1PO22 2OA2A 1AYM1 4R9CA 3ZN6B 1OPOA 3OF1A 4BIFA 5CFDC 3TAYA 2WNVB 5JOXA 5L19A 2WZR1 2XVKA 4DNYA 3RYPA 1UPSA 1GFF2 4W6XA 4HT1T 4C90A 1H0BA 1I1EA 1U5IA 4FOQA 3WCSA 2NYYA 5DG2A 4WVWA 1KITA 1GKBA 4Y22A 1AR83 4W65A 4C0BA 1V70A 3HAGA 4Y20A 5FLHA 1TME3 2P34A 3HT1A 4YSFA 2DFBA 2XGXA 4HLTA 2R063 1RMU3 2OUHA 3IPVB 3TRSB 2WFF3 4QT6A 1BEV2 4MGZE 2WQ4A 1REDA 4WM7C 4XJ9A 1C1LA 3KMHA 2R072 5ABJB 4Q0QA 1T6GC 2D6NA 1Z78A 1FNYA 1NCQA 3AMMA 4ITCA 4X6RB 1K5MB 1FMD1 2SLIA 2WZR2 2WS91 4Q4X3 4P9GA 3WX5A 5CFCA 2F4PA 1D0HA 4LE3A 3WD5A 1W39A 4M00A 1QNWA 4DMIA 5BNOB 4EN9B 3ZXDA 3KB5A 4N43B 3QLQA 1FI2A 3KT4A 5AC92 1CAXB 1DU3D 4CEWC 1NE6A 4HPKB 3GNEA 4MVTA 3OJBA 3WW4A 3QCWA 1H9WA 2YHJA 4XEZA 3KCXA 4UW6A 3I2DA 2HWD1 1KFUL 3DUIA 5CFDA 2VW1A 1MS0A 2HKXA 4FPKA 1QJU2 3MIFA 2RS53 1AR73 5JOZA 3KGZA 3S6PA 1LHUA 3KM5A 1AX2A 2OZJA 2W0XA 3BODA 1QJY2 1RUJ2 4XTMA 2A6XA 2UY8A 3VZOA 2X5IC 4TLFA 3A0NA 1GZ9A 2DCYA 4OI2A 3TN92 4FXGB 4FPOB 4CP0A 3FLTA 4N90A 1W6NB 3OPZA 3MPBA 3IT8A 1SLAA 3I4IA 3ZFFC 1IKQA 4PIYA 1LHNA 2BQPA 4IL7A 3ALQA 2WNUA 1WLCA 4RL7A 4MXVA 4AI3A 1E57A 3WHUA 4JGZB 2IXLA 3O0VA 4WM7A 1MACA 1S0GA 4DS0A 1APNA 1LENA 3MI8A 2Q1MA 2ZJCA 3LWCA 1QJX2 4Q4Y1 4WM8B 5JVVA 4R4ZA 2WIIB 2RS32 3NAPA 2HWD2 4FOVA 4LBQD 1TNFA 4AHWA 3MF9A 4FO9A 3S7EA 2D97A 1IPJA 2R6QA 5H9RA 4Q8KA 3RG0A 5K0UC 3N3HA 3LOBA 3QD6A 1J3PA 4BPZA 1AJKA 2NN8A 4DFSA 1JW6A 3WP6A 4JC1A 4E9KA 4D7TA 4NHKA 3J8F1 2K2SA 2PHUA 4R8HA 2OW4A 3L2HA 1LTEA 2CY6A 2YMZA 4AVCA 2WLPA 4G3YC 1C8NA 5JIAA 3B3QE 5T50A 2VVEA 2ZMNA 3B02A 1VAKA 5DZEA 3ZFEB 1REEA 4IV3C 1ZNPA 2SBAA 4DRRA 1Q8VA 3UKNA 1I9RA 4WBBA 1ZBA3 2ZABA 4Z1VA 2X5IA 4ATFA 4GA9A 3AP5A 4QGMA 4A3XA 1XE7A 1JYIA 1WUVA 4UW5A 2GMEA 1LOCA 5EJ3A 4AK3A 4LO4B 3HT2A 3HR9A 3OTFA 4Q4V1 3ZFFA 3ILFA 4ASMB 1V6OA 4ORFA 2OUJA 4V1PA 5E8AA 1FAYA 2ZHNA 3J8F2 2HWB2 4LTAA 4GQ7A 2VNGA 1I6XA 1MVEA 1DYPA 5FO9B 1IS6A 1V6MA 1VJ2A 5A3MA 1M06G 2ZOEB 3NSTA 2YC0A 4Y1ZA 4CEYC 3D0SA 3VN4A 2MHFA 1XNDA 1UD1A 4JDMA 3J4UH 5K0UA 1F5JA 2ARXA 3SCHA 1YNAA 4PJYA 1VBB3 2I07B 1IZ3A 2P3JA 3WHTA 2FMYA 5BNPB 3WDWA 4K1ZA 4RQPC 3ZXAC 1FNZA 4COVA 1YUDA 3JQWA 4M3CA 2GC0A 4TSVA 4COYA 1VRH1 4XXAA 4LE4A 1GQGA 4G9SB 1MEC1 1RUE1 4IV3A 3AMPA 4N53B 1RIRA 3ZXGA 4AVTA 1WD3A 2ETEA 1IOAA 1RJ8A 2XBO1 4GULA 5T52A 4AYUA 2PTMA 3ZDSA 1FXZA 4XFFA 5TSWA 1Z0HA 4XF1A 3AMHA 1W6OB 3P3PA 2QZ3A 2CWSA 1X8MA 3AYEA 3ZXKA 4K6BA 3WCRA 3AM2A 3AZZA 4LO7A 4GIQA 4PIZA 1MR5A 2DYCA 3THPA 4EN0A 3AKRA 3PJYA 4B4RA 3WW1A 3QH6A 1TMF1 1VB4A 2JENA 2WZPP 2RR11 1YLLA 5H9QA 5FO8B 1HDKA 2P17A 1HV0A 3MW3A 1OFNA 1J3RA 4MYEA 2ZA9A 1WD4A 3EBRA 4F7ZA 2RM23 3H1WA 4P9XA 2H0BA 2C1FA 4PDWC 2E53A 1G9DA 3N7MA 4IEOA 3OYWB 1JHNA 1TE1B 5H9SA 2TBVA 3R05A 5FBZA 5JWPA 4KG0A 1RJ7A 4CP1A 5LRRA 3VL8A 1Q56A 4OULA 1Q8PA 1JXNA 3VZKA 1RUD3 3WW3A 3AYCA 4JV4A 4HANA 2Q5TA 2VQAA 3WG3A 3QBQA 5ACA1 3AX4A 4OLLA 1LKNA 1QQP2 1UX6A 2ET7A 4RHV3 4FPHA 4BWOA 4E4DX 3LA2A 3N35A 4Y24A 5DZFA 2RR12 5I8SA 1DDLA 3ZO0B 2GU9A 1FOD2 3I7DA 4QPIC 2D98A 3RDIA 4YGCA 1S1AA 4DQAA 5KC6A 1R1A1 5AVAA 3MIEA 1PO12 4XYXA 2VMHA 4KBBA 4TYSA 3TNPB 3L9JT 3THTA 3MPPG 4HBNA 1ND3C 3AZYA 5IK7A 2ZGTA 3HIFA 2XL9A 2F6BA 4K8FA 4MV2A 3RYKA 1LRHA 1DZQA 1LOFC 4LO5B 3SCGA 2WC2A 3DPRB 4JQRA 2HWC2 4HVRA 2C5DA 4FXKB 1RUG3 4XXPA 3C3VA 4HK8A 2CGPA 2GC2A 2IC1A 2GNMA 1D4VB 1UIJA 3FLPA 3ZMOA 1N47A 1Q8SA 4A7ZA 1W6PB 1C5HA 2UYBA 3RQ0A 3RNSA 3WVJA 4AI0A 4RQPB 1WLTA 3KT7A 1BQPA 1A6CA 1R091 4XJWA 3M70A 4XFBA 4HL0A 1PVXA 2OIIA 1GANA 4AHXA 3NVCA 2ZACA 1AXZA 4ES9A 2A6YA 2E51A 3IM0A 3WV6A 2RS11 2UWBA 1DGLA 4FPLA 1IQAA 1XYPA 4QPIA 1SLIA 4Q1RA 1U5YA 2B5HA 3C2UA 3ZIXA 2VMIA 2VXRA 3BOWA 1DYKA 4XFCA 3POYA 1AVBA 2PLV2 3SMHA 5FCCA 4AHYA 2VQ0A 3SXWA 2ZTNA 2VOKA 4HFSA 2A75A 3KGLA 1DQ6A 3NL1A 1TEIA 4GMP1 4H14A 4BA6A 4L9BA 4XE9A 1NY72 4OI4A 2ZKLA 3AMNA 4Z2WA 3KS7A 2Z42A 1VBD1 2NPIA 2EXIA 5JCTA 2YYOA 1LHWA 2G9GA 2HWF1 2EIGA 3SNMA 1R1ZA 1AL23 4QQ2A 1CPNA 1ZM1A 1AX0A 4PDWB 2RS12 1KXGA 1LGBA 3OGJA 1LU2A 4AEJA 4YW1A 2XVLA 2DUQA 1PZ7A 1RUC2 4GKYA 3VBHC 1DQ5A 3ZXEA 1RVF2 4PCRA 3LOIA 4YZ3A 4C0HA 4COWA 2ARBA 2E7AA 1IPKA 5JDBA 3RS6A 4BE3A 4OHYA 4QQLA 1PHMA 3QOPA 4EN6B 5KHHA 1QY4A 2Y26A 2CWMA 1X33A 1YHFA 1PGW2 4LBQA 1F31A 3AKPA 5C9AA 1Q3EA 2UY9A 1OD5A 5CAZA 1WGPA 2P3KA 3AP7A 3ZIWA 3U10A 2IFRA 4OHWA 5JSOA 5BPXA 1DGWA 2R043 4MXWB 4Z92B 1BZWA 2DCTA 5IK4A 3I8TA 1RHI1 1N3OA 3ELNA 4AFBA 1VBD2 1NA1B 4NR1A 1OI6A 2H6CA 4KWKA 2HWF2 2EXJA 4OUSA 4E4ZA 3V0AA 2FZ2A 3CJIC 4H7MA 3NV3A 2GAUA 1CAUB 2PHLA 3VBRC 1ZRDA 4YVSA 4E2GA 1ASJ3 2HWE2 3JD73 2O1QA 1NXD1 1UF2C 3Q9OA 4W6WA 4IEXA 2GH8A 3LGRA 1SBDA 1NCRC 2VULA 4DZGA 4Q0VA 2A3WA 4CDXC 3IKWA 4CRQA 1RC6A 4X8NA 5GALA 4EWEA 1UZZA 5C4WA 2B39A 2VUJA 1RUF2 3VDDA 3U4XA 2HEWF 4QQPA 4AFMA 1C8M3 3R4UA 3BOPA 3H0OA 2JE9A 5BNNB 5GLZA 4A2UA 1QXPA 1WLDA 2IXCA 3NKTA 3DV8A 5JIUA 1SFYA 3ZFGC 2DCJA 1V9U1 4QM9A 1GZWB 3AKTA 4O9EA 2ATFA 2ZGPA 3LSDA 1H1MA 3NWKA 4CP2A 2QVSB 3WT3A 3O14A 4KU7A 5HBAA 2QNKA 5JSRA 3SH3A 1H1IA 5GLVA 1JUIA 4WZCA 3UKTA 2ZX4A 5AFEA 1CONA 3MLLA 3PMEA 2VNRA 3JCIA 2BW8A 2ZAHA 3WQ1A 1JUHA 3LKJA 1ZBE3 1HRV3 3B93A 2X29A 2XJRA 3UJOA 1AR61 3QACA 5FOBB 3JU9A 2RMU1 4G4FA 3CJIA 3H3UA 3VBRA 3VBOC 4M0HA 2A6WA 1UN1A 4AI1A 4Q4W2 4QQOA 4I0WB 1EV12 2ZMKA 3HQXA 1CJDA 2QQPA 4QGNA 3N4MA 1NCRA 3AXDA 3M3QA 4RGAA 5EYXA 4CDXA 3ZN5A 1OFSA 1S0IA 3KCYA 1D2QA 4YZ1A 1O4TA 2ILMA 2YPJA 3GBFA 4XMIA 2H0VA 1LB2A 1PO21 2IXHA 1RINA 3LA3A 3FUQA 5JR7B 2WNVA 3ETQA 1COV1 3OGGA 2VY0A 1RUI1 2OZ6A 1QH6A 3RMXA 1DLLA 3VBHB 4JCKA 3W59A 4M3CE 3ZFGA 3G6JB 5HXVA 3VLBB 2JG8B 1AR62 3WNXA 4HKLA 2A71A 3OBTA 1YIPA 2VU9A 2ZHLA 1XE8A 4LR4A 1HXS3 4XDQA 3AKSA 3B01A 1LHVA 3POSA 4HSJA 4K9SA 3M8LA 2JJ6A 3R4SA 2D40A 5I93A 2IFWA 2D3RA 5DUXA 2GNTA 1AR82 2VOVA 4QPGC 5A32A 2WT0A 5I0SA 1RL3A 1TME2 5A3LA 5ABJA 3VBUC 4FPJA 5CB7A 1SCSA 2E6VA 3RRDA 2R071 2R062 1RMU2 4LBJA 1ND2C 2PELA 2WFF2 1N3PA 4MH0E 2I45A 1CVNA 1COV2 4L11A 4KL1A 5A33B 2DVAA 2GZWA 3VBOA 1MS8A 1RUI2 4GWMA 1GYKA 5FDBA 2PHXA 1H30A 4EV0A 1PVC3 1MQTC 4AGVA 5JZGC 1D0GA 1ZZ8A 5FAXA 1CIWA 5E16A 1VBC3 1HLCA 1FPN3 5EFUA 1PIV3 4OHXA 4Q4X2 1IS4A 1VBE3 1AUYA 1AHSA 4XF0A 3AP4A 4FAGA 5AC91 1BBT1 1S0JA 2GMPA 4Y5Z0 4QX5A 2O0OA 3ZSEA 3VBFC 2A7AA 2DCKA 1WW5A 4B8EA 2CGOA 5FMOS 1XRUA 3FUOA 4ONUA 2WNUC 3RPQA 4HETA 1QJU1 1HKDA 4YW4A 3JQXA 4AFAA 4IEWA 1QGLA 4B3NA 3MICA 2ZGMA 5LEKA 2Z5WA 3WP4A 2HEYF 1QJY1 2PAMA 1RUJ1 3NAPC 2XJTA 4HSLA 1GR3A 2DFCA 1F9KA 4CDQC 1KS5A 1AR72 2FHRA 4EN7B 1H8TC 4BCUA 2IXJA 3TN91 3MEPA 5LRSA 1QF3A 1TQ5A 3OBRA 2D6KA 3ZMNA 4IV1B 3OY8A 2WSUA 1SCRA 1PZ8A 3BU7A 3BALA 2NZ9A 4P9JA 1R081 4QPGA 1O5LA 3DL3A 5FRAA 4XFIA 4KGGA 3VBUA 1BBT2 4KWLA 5BUVA 4NO4A 1QOSA 4PQ9A 5JLVA 1QJX1 2VNOA 3ILNA 1ND2A 3KT1A 3URFA 3TNQA 2RS31 4M3CF 1MS1A 4FP3A 4I0BA 1UKRA 4CDUC 1EAH3 1YRZA 1W6QA 4QHBA 3WLUA 3PTYA 2FQPA 2QJVA 5J09A 1G9AA 1MQTA 5JZGA 1BEV3 2ZHKA 3ME2A 1N1YA 4OZXA 4Y22B 4BHPA 5L36A 3AYAA 3G7DA 4Y20B 2Q30A 4R9BA 1AYM3 5L7OC 3KZ4C 4EWAA 5KHJA 4OI0A 4GMP0 3E5XA 3VBFA 5J7MA 2WZR3 1SBEA 2JECA 1KFXL 1EP0A 2LUWA 1R082 1ULGA 1XNKA 2NQYA 2ZGUA 3I54A 1MZ5A 1XU2A 3O12A 3LB9A 3FFZA 1CQ9A 1NCQB 4N7IA 5CNAA 1JN2P 2XJPA 4GWNA 1ZZBA 1H2MA 2BFUL 4CDQA 2NMNA 3EO6A 5CFCB 5C6CA 1H8TA 2GC1A 4Y1VA 1ZZCA 1G8WA 2ZKNA 1ZBA2 4HKWA 1G9FA 4H55A 5H9PA 1PNGA 3ZXLA 5F1RA 2W39A 1MZFA 1YJLA 3N7KA 4P9WA 1VR3A 1DZRA 4B4QA 1D2SA 2ZGKA 4AQTA 2HWB1 1O3TA 1FMD3 5CFDB 2DF7A 4BYYA 2WS93 1QU0A 1PM7A 3V0BA 1ZRCA 1FX5A 4D69A 3AZVA 4CDUA 3GZUC 4IXLA 4XHBA 2PAKA 4Z82A 3WDVA 3WR0A 5GM0A 1B35C 5T5OA 5J3UA 2ZGSA 4NPRA 3UL2A 1A3KA 3INAA 3WP5A 4UW4A 4E2SA 3ZXJA 5L7OA 4J1XA 4PLNA 5DXDA 1FATA 1LULA 1OHFA 2HWD3 1N3QA 1VBB2 4LBKA 2AENA 3GZTB 4XJAA 2XWJB 3SH4A 4BMEA 4WM7B 3WDTA 1EYBA 3ZYIB 1REFA 2VVDA 4ISQA 5BNQA 2QE3A 3M1HA 4YM1A 3ROUA 4B29A 1YO8A 2ZAAA 3AKQA 2B8MA 2B46X 1PK6C 1X50A 2DTWA 3USUA 4Z07A 4PIXA 4BQ1A 3VV1A 1OOPC 1YFUA 4LLFA 1NE4A 4FPGA 1V6LA 1SMVA 1UIKA 1SDWA 3DF0A 4FTSA 2ZGRA 1V6NA