1PNGA

Crystal structure of peptide-n(4)-(n-acetyl-beta-d-glucosaminyl) asparagine amidase at 2.2 angstroms resolution
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
310
structure length
310
Chain Sequence
NTVNIKTFDKVKNAFGDGLSQSAEGTFTFPADVTTVKTIKMFIKNECPNKTCDEWDRYANVYVKNKTTGEWYEIGRFITPYWVGTEKLPRGLEIDVTDFKSLLSGNTELKIYTETWLAKGREYSVDFDIVYGTPDYKYSAVVPVIQYNKSSIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPINNQSPGNWAPDRAGWCPGMAVPTRIDVLNNSLTGSTFSYEYKFQSWTNNGTNGDAFYAISSFVIAKSNTPISAPVVTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)ASPARAGINE AMIDAS
publication title Crystal structure of peptide-N4-(N-acetyl-beta-D-glucosaminyl)asparagine amidase F at 2.2-A resolution.
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
total genus 82
structure length 310
sequence length 310
ec nomenclature ec 3.5.1.52: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase.
pdb deposition date 1994-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09112 N-glycanase_N Peptide-N-glycosidase F, N terminal
A PF09113 N-glycanase_C Peptide-N-glycosidase F, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pngA02
2.60.120.230 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1pngA01
3MIDA 3MLLA 1PGSA 1YJKA 1YJLA 1YI9A 3MIBA 3MLKA 3MIFA 4QHBA 4E4ZA 3MLJA 3KS7A 1PHMA 1PNFA 3MICA 3PHMA 1PNGA 3PMSA 1OPMA 3MIHA 3MIEA 4R4XA 3MIGA 1SDWA 4R4ZA 1YIPA
chains in the Genus database with same CATH superfamily
3K77A 1WD3A 4QM9A 3VBOC 3WF4A 3ZFFC 2WS93 1J1TA 2WZEA 2YFUA 4XJAA 1RXGA 5A7NA 2UWBA 4COZA 3ETQA 3KGLA 4Q4W3 4FAGA 4I0AA 3JQXA 3ZXLA 3ZXEA 3CKHA 2D6NA 1DLCA 4NJ4A 3ZR6A 5GLTA 3EBRA 2LTNA 3NKTA 1ENQA 3OB8A 4EN9B 5D8AA 2ZGNA 3JQWA 4N53C 1QHDA 2BBAA 3GCWA 1S0IA 4WBBA 5AC91 5FZGA 4H3WA 5IFTA 5A7OA 3RMXA 3RRDA 3VN4A 2YB7A 2AGSA 5JZGC 5A3NA 1HKDA 1OLME 3HQUA 1J1LA 2RVAA 3GNEA 1I5PA 4LBOA 2Y6FA 3NAPB 3WNNA 3C7HA 1HV1A 5EHDA 1CQ9A 2ZPXA 3O1PA 5IWFA 1TME1 3OPZA 3PTRB 4CP9A 2BUKA 2HWC2 5FJHA 1PO13 4D69A 1V6JA 1ONAA 2NN8A 2NPIA 5KXBA 4NIGA 1A8DA 3B5LB 3DPRA 4JGYA 1QIQA 2JG8C 4R4XA 1X8EA 5JI9A 4LHSA 2YBKA 1RC6A 2W47A 5FPVA 4CCJA 3H8OA 3ELNA 3FHQA 1VAMA 2QZ2A 1C8M2 1O5LA 1Q5OA 2DCTA 1GFF2 2QNKA 2EXHA 4KH9A 2RDNA 4UBHA 1DG6A 2QFEA 4RD7A 1EV11 3SQOA 5ABJC 2ZGTA 4URTA 1UZZA 3VD5A 3ZN6A 4BQ3A 1JYNA 2YBPA 3WHTA 2WUHA 5BNPA 1HIXA 2ZGMA 1FPN3 4IGOA 4NAOA 1GOHA 4QHBA 1G8WA 3WR0A 2Z79A 4K3UA 4MUVA 5GZFA 2WNUB 2IZWA 1DQ0A 4YZ5A 1S0JA 2W52A 2DVBA 5IK8A 1XYNA 5DG2A 1NQDA 1ZBA3 4OQ9A 1QJY3 4JQRA 2Y38A 2BNNA 2VZTA 3VBRB 5FZKA 1DZRA 2DCZA 3LA3A 3R4SA 1WW4A 4L0PA 1UX7A 2VZSA 4JKLA 1LOCA 4HOOA 2QJVA 4IGQA 1A3KA 2EF6A 4JZRA 5L73A 2R32A 4AI1A 4GB33 4CA9A 2JE7A 4OYUA 3H8XA 3ZSMA 4E4DX 5A7SA 1VBA2 1OC1A 2WQ8A 4AVVA 5LA0A 1W05A 2PAKA 2VC9A 2AREA 4IV3C 4RR3A 5C3OA 5L9VA 3PVOA 3KCXA 1NE4A 2HWB3 4RGGA 4NHYA 3RZHA 5CVRA 3CMGA 5D8AC 3PUAA 5BNOA 3POSA 2ZX2A 1VP6A 5A6ZA 1QOOA 2P6CA 2DVFA 2XL9A 2XVKA 1UZ0A 1V00A 2DURA 2IXLA 1JZ5A 1SBFA 4COUA 2X5IA 3VL8A 1FI2A 2WN2A 1WMFA 3HBZA 2B45X 1PK6A 4JDOA 5I0UA 4MH0E 1PMHX 1AHSA 1QJU3 1W6QB 1WGPA 2Y6LA 3M3OA 4LUKA 5C70A 3ZFFB 2HEYF 1ENRA 4BHPA 1M06G 3ZSEA 4AEKA 4P9JA 5L9RA 5T5OA 3WNKA 3LEMA 5GM0A 4XJZA 5GZDA 2RMU2 4PJYA 3DGTA 3HNBM 1G86A 5HCFA 1WWYA 1XU1A 5KHKA 2VCBA 3DPRC 3CQOA 4JGYC 2HWE3 5FPZA 4Q0SA 3VZJA 4LBJA 3E1F1 3QCWA 4FPJA 4XDOA 4Z07A 3JXSA 5DZGA 2D7FA 2B7YA 4N53B 2V09A 5FYHA 5M0TA 5F2SA 1W6MA 1W9SA 1WA4A 2A5ZA 4LHNA 4OMDA 3WNMA 5IVCA 3AP6A 3NMBA 4P9GA 1S0CA 1LHNA 2WQZC 3HD8B 4YW6A 5FP7A 2ENRA 4E27A 5JZGB 1BEV3 1R092 4TN7A 3K75B 1LB2A 5DDJ1 3NRUA 5A3UA 2QBXA 4E2GA 5J98B 4BK4A 1W6NB 4C8DA 4EN8B 2JJ6A 3PVBB 2G9FA 1W9FA 4LBKA 4Z1VA 1OSGA 4I3GA 4PHZA 2MEV2 4YVSC 3IM0A 3WNPA 4D7YA 3O1UA 3WG2A 1BQPA 4L97A 4XDPA 1RUI2 3IAPA 2VVEA 2R49A 1HRI1 2QQIA 1QH7A 4W4ZA 5CYYA 1BBT1 2KD7A 2XJQA 4F8AA 2JG8B 1MS8A 4QPIA 4AQ2A 4C91A 4HANA 3BALA 4XOGA 2O0OA 2BVBA 2OA2A 3K4AA 2JDHA 3FUOA 4LEJA 1OF4A 4LIUA 5IK4A 4NUBA 4XBLA 4PQQA 5FO9B 1UYXA 3NNLA 3AMQA 4LBQA 2PQSA 4LXLA 4NMIA 4RR3C 5BNQA 5ABJB 2VJXA 1RUC3 2WA3A 3NJYA 1PIV1 1WBLA 4KGGA 1CONA 2VBDA 4NHXA 4O65A 3AZZA 3DEMA 5EPAA 2WDBA 1LKNA 4QHOA 1AR81 1RMU1 5JSRA 1VRBA 1L3JA 1UW8A 4BQ1A 2UU8A 2K46A 3USUB 3AJYA 4YM1A 3VBHC 5C7GA 2D97A 2X5IC 3KCYA 4PIZA 2LW8A 2CWMA 1C8NA 2OVUA 3RZLA 2UYAA 1PK6C 1ZNPA 1GWMA 2WR9A 3J7MA 3ME2A 4LT5A 1OH3A 1OA3A 1VE0A 1VBD3 1DFQA 3T0BA 4KBBA 2XHNA 4IEYA 3ZSKA 4Q4W1 3WT3A 2E53A 2QKDA 1GP4A 4ZKTB 1PGW2 3T0AA 3H3UA 1YI9A 3Q8FA 4Q27A 5E16A 5I8TA 2WNOA 2DYCA 1UN1A 2W94A 4XUTA 5LK5A 3TAYA 2R6QA 4MHRA 1LODA 1V9U3 3PUQA 5D8AB 2BV4A 4CCEA 4ZHNA 3NW4A 1H8VA 4NN0A 5C8CC 1O3SA 1W0NA 2R073 3Q8EA 1UIKA 1OUSA 5E6HA 3OY8B 5IW0A 2D3SA 2PLV2 3GHNA 2V5DA 1ZYBA 4MGKE 1OT5A 3QH7A 5JOZA 2YU2A 4DUVA 3ZR5A 1OF3A 3UNPA 4Q4X2 1YFXA 3GZEA 1MQTC 1UYYA 1S2BA 3M8LA 4YG3A 1L7RA 4HN0A 3J7LA 4LK7A 1KS5A 1QQP3 1LGNA 2VZQA 5TSWA 1KJLA 2ERFA 3JB8A 2V73A 4AGRA 1I1EA 2QDRA 2IXKA 1W9YA 3DPRB 4JGYB 5CBLA 2XJUA 4KL1A 4PDWA 4QGLA 4XXAA 1RUD3 4QPIC 2G1MA 1CGPA 3POIA 1WZXA 1GLHA 3AYDA 4M3CA 4WVMA 1AR63 1O4YA 2OS2A 5AC92 1N1TA 3W21A 4RHV3 4COWA 4MG2A 2WAAA 1QY4A 3SNMA 1EAH3 2J1RA 3VBFA 1ZX5A 4FP2A 2XGXA 3OJBA 4GWNA 4IEZA 5LBFA 3ZN6B 1FPN1 1PM4A 4AI8A 5JVVA 3MBWA 3MW2A 1UQXA 2XUEA 3RNSA 4W6XA 3TNQA 2AEYA 4BXFA 3BU7A 5KWRA 3FBYA 3VD3A 4Q4V3 1HDKA 1ZBA1 2OX0A 1QJY1 4X8NA 4XQ4A 1TME2 3T2PA 1EYBA 1TNRA 3L2YA 5KHIA 4JDNA 3KWVA 1B35A 1W0OA 2FBEA 2XQRA 4NVPA 1VBC3 4BLJA 1F9KA 3DV8A 1IG0A 2XJVA 3B00A 3ITQA 4GD4A 5KC6A 4CCMA 1W2UA 3LEIA 3R05A 2Q8OA 1GZWA 1W2AX 2OUHA 3ZFGA 5BUVA 2K9ZA 2D6OX 4MXVA 1IS4A 1C1FA 1G6NA 4RR3B 1EV12 1Q8PA 5HCBA 3FHAA 2OQ7A 3GBWA 3U14A 1GWLA 4CPBD 4LBNA 1H9WA 1F4HA 3KHBA 4ZXKA 4CCNA 1RVF3 3AVRA 3MIFA 5F2WA 4R9AA 5CISA 3N9MA 2WQ4A 4NIDA 2VR4A 5CIRA 4DQAA 3N7MA 2OPKA 4N43C 1R64A 2X5IB 4YZ3A 2PTMA 4V1PA 1ULEA 5FREA 1AL0G 5DUVA 3VHRA 4YYOA 5C8WA 2JENA 1PK6B 1NKGA 1QJU1 1YQ8A 3A23A 4IESA 1JW6A 3E6BA 4V2WA 4OI2A 4M01A 2DDUA 4W6WA 3MIGA 2ZMLA 1CD3G 3RSJA 1J83A 2QQVA 1S0EA 4FPEA 3E5UA 4GULA 4BQXA 1KS4A 1O3QA 4KGQA 5FP4A 3S6PA 4C0HA 5FDBA 1QXJA 2Y6HA 3VHOA 2J1AA 2DV9A 1FAYA 1UYZA 2GC2A 4D0QA 1EPZA 4Y1XA 1VALA 3FE5A 2VZPA 1RUG3 3AL6A 4XBQA 2VE1A 3SEEA 1W04A 2Y6JA 5CFDA 4ZU5A 2R30A 2VTXA 4JX0A 4Y1VA 5C8CB 5FR3A 1N47A 1V6LA 3OTFA 4Y20A 3WP4A 1JOBA 1UYPA 1UXZA 2Q1FA 1BEV1 5J96B 4S2DA 4UBGA 1OOPC 1RIRA 3KVBA 2OYZA 1QOTA 1VBB3 2V5YA 4YM0A 5FFOC 5FZIA 1STMA 2VVDA 1QJX3 1MQTB 4LKEA 5IVEA 4YW5A 5DPNA 1XNTA 1PGL1 1UNBA 4QXCA 4E8CA 3N4MA 1AZDA 4LLFA 4LHLA 4MGIE 1ZREA 3ETPA 1POV3 4A6OA 2GH2A 5F3EA 3MDPA 2ZAAA 2P3YA 2RJKA 1AXKA 1X9PA 4QDQA 1FOD3 3LKJA 1F2NA 4I0WB 2A1XA 4QPIB 5EXOA 4BJ0A 2H0BA 2HLEA 4QKNA 3WV6A 3IWZA 4CEYA 2PAEA 4Q8KA 2OW4A 4CZSA 5KHGA 2VQUA 4BQ5A 3ZFGC 3IN9A 4OI1A 2CSGA 4FFGA 5AC93 4WM7A 4FPFA 1GICA 1U0AA 1SDDB 1RUC1 4AFMA 1IGOA 4FOQA 5F5CA 1PZ8A 3L2HA 3K4ZA 4HL0A 5DDJ2 4IEVA 4UW5A 5E89A 4P9YA 1J59A 3TOJA 1W8TA 4GWJA 5LWBA 2DUQA 3ZXDA 2NMNA 3HEIA 4K40A 5A3TA 3GDBA 2Q5TA 2UYBA 3OGVA 4HVOA 4RSUA 4MGTA 2MHFA 3MLJA 3GXUA 2PXJA 4QPWA 2BNOA 2YYOA 1HRI2 4QB1A 4Y1ZA 4OVEA 1BBT2 3PDQA 1VBD1 1IG3A 2VMFA 3VDBA 4PBPA 5FZOA 1H6XA 1LR5A 1UOJA 2C4XA 4P5YA 2X8KA 2W95A 5F6LB 1RITA 3WF3A 4QX1A 5HCHA 2Y33A 2XH6A 3CF6E 5LA2A 3TEYA 2UWAA 3I54A 4C0BA 5B2GB 4XBNA 2BDRA 3LPFA 2VOTA 1V9U1 1CPMA 3OGGA 1S2EA 2V4AA 2HJIA 2WSVA 4QT6A 2D6KA 3JCIA 5CFCA 2ZMNA 5FQ0A 1TMF3 2FD8A 1AR82 1RMU2 2ZBJA 3BGAA 2ET7A 2WWSA 3D0JA 3HOBA 2QQNA 4UFJA 2MNGA 1ULGA 3FX3A 3LDKA 1US3A 4N43B 5L19A 4XJ9A 2BOIA 1S55A 4D7SA 4BMEA 3VZLA 2GN7A 4ATFA 1NCRA 4GIQA 4QQLA 1O8PA 4P9WA 2ZGLA 1V6KA 4AFDA 2CU5A 2E31A 2E9QA 4BPZA 2JXAA 5LRSA 3OYWA 2D6LX 4IETA 3O1RA 4Q4W2 3MFCA 3N7JA 4AVCA 3ZXJA 4YWAA 4DUWA 1S0DA 4S2FA 5EV7A 4E2QA 2Y64A 4EN0A 4OI4A 4EZ4A 1YHFA 2RDSA 1SLBA 4IEUA 5A33A 3T08A 3KT4A 5GZCA 1NXMA 2ZXQA 1QU0A 2JIJA 3O12A 4M3CF 4M3CB 4RQPC 4WVMB 4CEYC 5KBFA 2NMOA 3L9JT 4RHV1 1CAWB 3RMYA 3RWNA 3P1IA 3B94A 1J3RA 1EAH1 3CJIC 1O3RA 4WM7C 2ES3A 3ILRA 3U4XA 4EJRA 3D3AA 1CX4A 3NAPA 1OOPB 3MUY1 4KWJA 4XUQA 3P3NA 2DTYA 2WYFA 4P9IA 3RFRA 2C0ZA 2DUOA 4XF4A 5HI0A 4QKFA 1Q8SA 2YZ4A 1HXS3 2XMLA 2EAKA 4Q4V1 2CL2A 1DQ4A 1U5IA 3POBA 5CNAA 3NNMA 4MADA 1AJOA 1SPPB 3UESA 3EO6A 3V64A 1ZZ8A 2IVIB 2BERA 3HT1A 2E7QA 1LHVA 4DS0A 3SH3A 1XNCA 1NQJA 4W50A 2Q4SA 1D0GA 1AR93 1ACCA 5F9TA 4OMCA 3T0DA 1DQ1A 1OLRA 3I59B 2Y0OA 3IDEA 3ILNA 4Q4Y3 3ZFGB 1GZWB 2W0XA 3HBKA 3ZOIA 2CHHA 1IS5A 1JZ6A 3SCFA 3IIIA 4MSVA 4BIFA 3K3NA 1YEWA 4BA6A 3UV9A 1JZ2A 3OSDA 1FPN2 3H1WA 3GZTB 3S7IA 3UJOA 1RVF1 4C1XA 1OMIA 5C4WA 1Z7S1 1HQWA 4CUBA 1YLLA 2F4LA 2D43A 4K6BA 2RG4A 1KD7A 4QGMA 5DAPA 2YGLA 5DN2A 2WABA 1HJGA 1ZBA2 2H6CA 1QJY2 1GNYA 1XRUA 4IUGA 1BXHA 4ZONA 5F3CA 2JDAA 4QD2A 3GBFA 1QJEA 3OEBA 4S2HA 1R1A3 4XIKA 4FOVA 3U0ZA 1LOEA 1X36A 1DYKA 2PYTA 4YZ1A 1SACA 2Z42A 3LWCA 3T1MA 2BU9A 4Q8LA 2YG0A 4META 1Y9GA 5A3MA 1HJFA 3OUHA 1BZWA 1JYVA 2VW2A 1RUJ3 2XDVA 5EZWA 4BQ2A 4XJUA 5C3RA 4P00B 4A2UA 5FKBA 1MS0A 5IT6A 2E26A 2ZJCA 4AEMA 4DRRA 1F8VA 2VZUA 1RUG1 3KGZA 5F37A 5HV4A 5IK7A 4BISA 2GMMA 2WYSA 2OZ6A 2VNOA 4YFZA 5JAXA 1SG3A 5FYBA 3CU7A 1CN1A 5SV8A 3ZKYA 2XXZA 3TB0A 1D0HA 4KWUA 5DQ0A 1G9CA 3IZOA 1AL23 1BMV1 2E7TA 1VBE3 1UXXX 1YC61 2GP5A 1W6QA 3RQ0A 5FLJA 1VBB1 1VRH1 4XCBA 4Q2FA 5E88A 3VBOA 1JU4A 2WJSA 4DEVA 3W58A 3U4SA 1FX5A 4ASLA 3WNLA 1QJU2 4XEZA 4YW3A 4X6RB 2JDZA 2GH8A 2PHDA 1GZ9A 2P1BA 4P08A 1DGRN 3HVDA 3I97A 3UETA 1Y9QA 2QCSB 1UZVA 2VW0A 1POV1 4B3NA 1SMVA 4TYSA 5FPBA 2BGPA 1G9DA 4Y26A 2GSYA 2BWCA 4Z82A 3TWIA 4BU2A 2YC0A 5T55A 5T5PA 1SLCA 2VULA 2PAMA 4CRQA 1ND2C 1DQ6A 5CB7A 3HNMA 3ECQA 3O0WA 4JQTA 4RQPB 4CEYB 1OLMA 3ZYBA 1OHFA 1QF3A 1SFYA 1ZZ6A 3ZX7A 4AOCA 4B1MA 4CDXA 3A7QA 1AYM3 3CJIB 1RUNA 1ODMA 3WXPA 1PNFA 2RS13 4WM7B 1LNSA 1BEV2 3ZO0B 1XNDA 4H7MA 3BB6A 4AGVA 3AKQA 1K5JA 2B39A 1OVSA 3N35A 2BW8A 3VV1A 2C1FA 3QOPA 3J7NA 3MW4A 1CAXB 2DCYA 3WVJA 3RDIA 5D1IA 4D94A 4OQ8A 2VM9A 3BN6A 2GDFA 1PGL2 4IEWA 5ACA1 4IDZA 1PO23 2JG8A 4LE4A 4FFIA 1UMHA 1ND3C 3DN7A 1UD1A 2WZ8A 3BU0A 1KGYA 3SXWA 3W5MA 5CAZA 2G4IA 5FZOB 3ABZA 4YLZA 1ZRDA 5EP9A 3BOPA 1GP6A 1WCDJ 2FZ2A 1JZ3A 3VZMA 2P4EA 2ZHNA 5K4LA 4FFFA 4HK8A 2VNVA 5JSOA 2WO1A 3CLPA 1Y43B 1RUC2 2L9LA 5FMOL 3KV9A 3WUCA 4XW3A 1TMF1 5FQ0B 3AZXA 5JOYA 4Q1PA 4D3WA 2YPDA 4AZZA 1FYUA 2R063 1Y3TA 1I3HA 1XOYA 3WG1A 1NG0A 1IKQA 4OHVA 4OHXA 1Y7BA 3I3QA 4G3YC 2JDMA 5H9SA 4FT8A 3ZYFA 4FTEA 1NCRB 3AKPA 1H30A 3AZWA 5JIAA 1VBD2 5C9AC 1OA4A 1PMJX 3URFA 1UKGA 1E5IA 1WBFA 4IV3A 3V56A 5LEJA 1MVQA 3OYWB 4NHKA 4HZFA 3WDWA 2ID4A 2PHWA 3H3LA 3FBMA 2BEOA 1W8OA 1UWWA 3JUUA 3KM5A 4NPMA 1V9U2 3VZNA 4CU7A 1WCQA 3DKWA 3K51A 4CUAA 3CIHA 5A33B 3NVCA 3OY8A 2BNMA 1WD4A 2NM1A 3WINE 4DNYA 4CDXC 4GKXA 5JOWA 3ZN5A 2PA7A 2P2KA 2W3JA 4AF9A 5F3IA 1GNHA 2PELA 1X50A 4N7UA 2IXJA 4OHWA 5FY5A 1YQ2A 5FCCA 5F32A 3WF0A 2VZOA 1WMDA 3ON7A 3NNJA 4OLLA 4PLNA 3N9QA 3OUIA 1FV2A 4DMIA 1DDLA 1V6MA 5FO7B 4DXRA 1GQGA 4O61A 4KMQA 1OD3A 2YGMA 3Q8CA 2WT2A 5LZ6A 1JZ7A 1GMMA 2I07B 4UFIA 2DTWA 3S5QA 4XF3A 2AC1A 2ZEXA 2C9AA 3GJBA 1LEMA 2VXJA 4FPHA 4XYXA 3OBAA 1ND2B 2PHXA 3PVNA 3VKFC 1AF9A 2HWF3 1V6NA 2W1WA 4HG6B 4FVVA 3VD9A 2WNVA 4RHV2 1G9AA 2JDYA 2Z4FA 1EAH2 2ZAHA 4CUCA 5GLVA 2G9ZA 3H8UA 1GWKA 1NLQA 3TN91 2WLPA 5C4WB 4YVSA 1H4GA 1W6PA 4OZXA 2XVGA 4Q4V2 4AI2A 3FZ3A 1AX1A 3INAA 1R1A1 4B7EA 3HJRA 2SLIA 4J1WA 1ZZBA 1X33A 2EXIA 4DRVA 3WDXA 4Y22A 5IVJA 1XBFA 2XBO3 3I2FA 4NWWA 1ULFA 2ZKNA 3I2JA 2RJLA 3FFZA 2QQPA 1NXD1 1RUF3 4IEOA 1YIFA 1JN2P 5F5AA 3AP7A 3FC0A 1W2OA 2W68A 1FV3A 3MF9A 1CAUB 1AR73 2IXIA 3GJAA 3N36A 1LU1A 1RUH1 4LTAA 2J42A 3RZGA 3LIHA 2ZKLA 3RVHA 4QGNA 4DXZA 3E6DA 3ZYGA 1MEC1 4TLGA 2YY1A 1N1YA 3B93A 1RVF2 1YCIA 3NJZA 3VBHA 1Z7S2 4I30A 5LK7B 1AL21 4AAXA 2ZX0A 3AP5A 1W9WA 1XXNA 3POEA 1C28A 4AVBA 4JHZA 1TE1B 4XETA 4B29A 1OBNA 1YYNA 5A32B 3VBOB 2WO3A 2BVVA 4ONUA 3SCHA 5FZ0A 5K0UC 1YQCA 2AENA 4FQ4A 4CU8A 5KXCA 4RFRB 1W2NA 2EA7A 1O4TA 4AQ6A 3ACIA 2WAOA 5C9AB 2R1BA 2WRAA 4CP1A 3KS7A 1DF0A 5A7WB 2W39A 1JXNA 3C2UA 4YNIA 3GZAA 1LHUA 1QDOA 3LQCA 1W39A 4GA9A 3N9NA 4AW7A 1F5FA 3EXUA 3BTAA 4RN5A 2PQQA 3ORJA 1ST8A 2FZ1A 3HNYM 3BCWA 4HT1T 4E8DA 3BYWA 1LECA 1RUG2 1O8SA 2BGOA 4E4HA 5C8CA 2ZGKA 3SKJE 1LHOA 1RJ7A 1K42A 2YUEA 5FLIA 1OUXA 3VKOA 4UOJA 1AYM1 2WNVC 4HKOA 1VMHA 2BFUS 3USSA 2RS11 4CDXB 5KC5A 1BMV2 5DZFA 1WCSA 1K3IA 1MQTA 5FPUA 3AVSA 1Q43A 1VBB2 1VRH2 4YW7A 1CWPA 1NLSA 2VBPA 4GJYA 3TEZA 3IKWA 3D5OA 3O7OA 3VBUC 2IFWA 4FXGB 3WP5A 1W8FA 4ZPIA 3WZ1A 4O9GA 2VUDA 1DLLA 1C3HA 1PO21 4H2AA 4LK6A 5CADA 4LA3A 1TG7A 3JD71 4K8RB 4YG6A 5FK8A 1KJRA 2YROA 2OPWA 4YPJA 5T50A 2RHPA 2A3YA 5FYYA 2VBBA 3ROUA 2RR11 2A71A 4MGZE 2J22A 3MPBA 5GALA 2CGNA 3DYMA 4XZUG 2OUJA 4UAPA 5FZ3A 4URAA 3WP3A 1WUVA 2HWD3 4E9KA 5FZHA 4A7YA 3VZKA 1MPXA 2VH9A 4L9BA 5GJ6A 5C6CA 1TQ5A 2HYKA 1T6GC 3NNGA 5JR2A 5EFUA 2A6WA 2UY9A 3C7EA 4UF0B 1C5HA 2LROA 3LFMA 4A41A 1HB1A 1YQ5A 2VY0A 3POGA 4IW3A 1GU3A 1OPMA 2YDEA 1PM7A 4KWKA 5F1RA 1G9BA 4XF0A 1ZZ9A 3CZJA 5FP9A 3AP4A 5ACA2 1YFUA 2SBAA 2F4PA 2WS91 4B4RA 3RYPA 2IXHA 2EVXA 2ADDA 4NWVA 3IDBB 3AXEA 1E57A 2W1SA 4IV3B 1EP0A 1TEIA 1DZTA 4CPBA 1JI6A 2BGCA 2Z2SB 4XABA 5EJ3A 1QOSA 4JCKA 4YGCA 5A1LA 1JYWA 3K48A 1MZEA 3R6SA 5FOJB 1OFNA 1PX4A 2KA3A 1B09A 1RXFA 4B8EA 4LPLA 1DCSA 4LO8A 3J8F3 5G04L 5JDBA 1K5MC 1LENA 2Q8EA 3S30A 4N43A 4CU6A 1KITA 1TMF2 2J1UA 2OQ6A 4L99A 2RJ2A 4OUMA 5F5IA 2FCTA 4D6SA 4HVQA 1REFA 3THTA 2P3JA 4AG4A 1JMUB 4WZCA 1POQA 2D98A 2PHLA 4CSWA 5IVFA 3T4HB 5JXHA 3WY6A 2VMCA 1R083 3ILFA 3LEGA 3WCRA 1XPWA 2RS53 3LFIA 1H2LA 3P3PA 1PO11 2WINB 2BBVA 1WLTA 3DCQA 2O8OA 3JBG3 5I0DA 4UI9L 1EUTA 1YWKA 2QE3A 3OBRA 3NNFA 4OUSA 4LBMA 3MGUA 5EWSA 4BK5A 3E97A 1LRHA 5C71A 1FNZA 3WDTA 1S1AA 3M3EA 4WVZA 2B9UA 3I2GA 1F5JA 2B46X 5FZ7A 4DINB 1TZOA 1CAWA 5A3PA 1U12A 2CTVA 5KHHA 4EYUA 2I2SA 3EQEA 2BRTA 2GZWA 1HV0A 2VU9A 5F39A 1OOPA 2WNVB 4EN7B 3RJ2X 5I0RA 1J58A 2R7EB 4L11A 4EROA 5E1RA 1BHGA 5CKNA 3QD6A 2ZX4A 3N7KA 5A7PA 3LPGA 1SPPA 3E5QA 4DY3A 1QMJA 1FXZA 2KXLA 3HWJA 4YVSB 1COV3 3VBUB 1W6PB 1VB2A 2ARXA 4MHUA 4A7KA 1MZFA 4LUMA 1HLCA 3VD7A 4FPGA 3U11A 1RINA 3ACFA 3G6JB 4GB31 1KEXA 2D40A 2XBO1 3AXDA 4BOWA 3CNAA 4Y22B 3AP9A 4ORFA 1HQNA 3RI8A 5J36A 4DFSA 3I59A 1UZWA 1Z78A 1AR92 1SDWA 2WWJA 2VUJA 3B9IA 3ZXFA 3R4DB 4QX8A 1H1MA 5FUNA 3FMGA 4GXLA 5A3LA 1AR71 2D93A 2HWB1 1JU3A 2VO5A 1L7LA 4GMP3 4LR4A 5E8AA 5K9YA 4KI5M 4PI0A 3VDAA 1LULA 1WW7A 4RFT0 1HB2A 1FATA 1RYYA 2QQLA 2RS33 2E33A 2ZZJA 4LQRA 2ZA9A 1BKZA 1F4AA 3DXTA 3RGBA 1CZVA 3OG2A 5FYZA 1QWRA 2W91A 2WBKA 3H8RA 3TN92 5BNNC 3LF7A 3VBHB 5C5UA 1Q8QA 5FWEA 5A80A 3FJSA 2RDQA 4LULA 2ETEA 3AL5A 2OXBA 5K8SA 3V0AA 3NV2A 3AMNA 4LIVA 4LOSA 4ATEA 5DXDA 1R1A2 2C9KA 4LO4B 4QU2A 5ANQA 2R0FA 3ZM8A 4CXWA 4BB3A 1ENSA 4LE3A 4MV2A 3AMPA 1KQRA 3U1XA 2ET1A 5FY9A 2UWCA 1MZ5A 4A6SA 2GU9A 1VMJA 2ZZQA 4ZZ5A 3VUOA 1M4WA 3I3MA 2DVGA 4JAAA 4DXTA 3LOBA 2YV8A 4JRLA 2HWE1 1NA1C 4G9SB 3MEPA 4AXOA 5ANNA 1RUH2 2K2SA 4J6GA 1LTEA 2RM23 1O7FA 1O4ZA 1ZZ7A 1NYWA 1DGLA 3AJZA 3LB9A 2DWRA 2O14A 1UPIA 4OHYA 1PMIA 4XF9A 1MEC2 1K5MB 5KXDA 4UFHA 1DGRA 1LU2A 2QQMA 1W3VA 3QACA 3S57A 1AL22 5JR7B 1X9TA 2RMU3 1OPOA 4N9IA 1LOBA 1W8NA 2XQXA 3S7EA 5FYCA 2R1DA 3AMMA 3I2HA 2VOXA 1RUE3 4CTEA 1JYXA 4TZDA 5LB6A 2IFRA 4QPGC 4IXLA 1XE8A 2ZEYA 3R4UA 3GF6A 3OEAA 1CX1A 2IUWA 1JOJA 5LBEA 5FYIA 2ZABA 2O8QA 2VMEA 2XKOA 4KU7A 1QNWA 1XB9A 1X8MA 1IHMA 4M3CE 4Q26A 4XF1A 3POFA 5FZ4A 5LY1A 2F17A 1FMD3 4GKYA 3A0KA 3M3QA 4HFSA 1ALYA 2HBUA 4MGSA 4RQPA 1VJ2A 4CP0A 1JZ4A 1TNFA 5EIYB 2TNFA 3CJIA 2Y60A 2ZTNA 2MEV3 5J3UA 3BIEA 4F7ZA 2KM2A 5FYSA 1UO9A 1YNAA 2W9XA 1AYM2 4X8PA 3FLTA 2RS12 1RUI3 4WV8A 4D8MA 3MIDA 1CAXA 1OURA 1V70A 3AYEA 5JI7A 4HONA 3I2OA 1W90A 3ZFEC 1BYHA 3FL7A 3S5AA 2TEPA 1LOAA 3D8CA 4QDRA 4FQZA 3M3CA 4Y5TA 3IAQA 1VR3A 1YO8A 1N3QA 3I7DA 5DZEA 3MF6A 2D6MA 1PO22 3C7GA 1UMZA 1RL3A 4XPVA 2JG9C 3PJQA 2BQPA 2FDJA 3JD72 3OBTA 5F7UA 5KR7A 2TBVA 3FWEA 2QVSB 2AR6A 3BOWA 4NIIA 4H55A 2RR12 2XKPA 1Y9MA 4XCAA 2J1VA 1LAJA 4PBOA 1I6XA 4EZHA 3FFQA 5FKCA 1IS6A 3NV1A 2QUOA 3DECA 1Q3EA 2WKKA 5DAXA 4YGBA 2R071 3VDDC 4AHYA 4A4AA 3H9AA 1OFSA 3J8F1 3V0BB 2VUAA 1EUUA 4Y3OA 1ULCA 1OXCA 2JD4A 5BNNB 4U2AA 4FPLA 1AJKA 3LSDA 3B02A 5FZCA 4AI0A 1MS1A 2R062 1CZSA 5H9QA 2VGDA 1AXZA 2VD7A 3MIHA 3THDA 2JE9A 4LKSA 3W5NA 3BTZA 1SQ4A 2WS92 1R081 4GWIA 4XFBA 2CAUA 4MZUA 1AUYA 3F95A 1CVNA 4MO3M 2RS51 4QX5A 1QQP1 1UU6A 3JBG1 4Y33A 3A4UA 1D2SA 1G7YA 3WD5A 4YRDA 4CCOA 2PLV3 4RL7A 5DUWA 1NA1B 1RUD1 4GALA 2UY8A 5H9PA 1KRIA 2XLAA 1AR61 3K2OA 3SHRA 3LE0A 1UU4A 4PIYA 1GZCA 2DVAA 2WFF3 3O5SA 3WF1A 3IMMA 2QDNA 2HYXA 1WMEA 5ISLA 2QZ3A 3RYRA 2W1QA 3PUSA 4JGZC 3VKMA 4YSFA 2KR2A 5A6QA 1ZA7A 3NJXA 2GNTA 4LBLA 4NRQA 2YPJA 5F6KA 5HCAA 2W46A 5C5TA 5IVVA 4QPGB 5I8SA 4CU9A 4IE5A 1COV1 1S4CA 2AH2A 4FTSA 1D7PM 3IDCB 2VZ1A 3OGJA 4UFMA 1LCLA 1QNYA 4Q0VA 1UY1A 4XDQA 4XILA 1PO12 3VHNA 3LOIA 1DBNA 2A75A 2BWAA 2EXJA 4CDQA 4YZ4A 2W1UA 4YW1A 1LHWA 1VBC1 3UGHA 2HH9A 2XB6C 4AFAA 5JPMB 2E6VA 2FDIA 5LA9A 4IEQA 1ND2A 3TBDA 3UK9A 3VB9A 5L7OC 2A6YA 5CKMA 5L36A 1NZCA 1H2NA 3LD8A 2DVDA 2WT1A 5LW9A 2DUPA 4QB6A 3FUQA 3NKGA 3UL2A 4FAHA 1HQLA 4GMP1 1UX6A 1IZ3A 1N3OA 4XUOA 1TME3 3WQ1A 3T2OA 4HN1A 5FO8B 3RS6A 4XJ8A 2RS31 4IV1A 4YGEA 1UY0A 4HKLA 3GALA 4J25A 3K46A 1NAEA 5FIXA 3RWKX 5DUXA 1SFNA 5FY7A 2ZHLA 3ZFEB 1W8UA 2VVFA 3CO2A 5FYVA 3ST7A 5CG8A 4HSJA 3OBZA 1ND3A 1SFPA 3V0AB 2E63A 1LGCA 1XNBA 4HMZA 4NE9A 4W6YA 3KQ4B 3H0OA 4GB32 4BCUA 2XBO2 1POV0 1CPNA 3PNAA 1SHWB 2VXRA 4AEJA 4RS5C 5JMCA 1CAUA 3WOGA 1W99A 3AYCA 2FCVA 1WLCA 1XNKA 1SBDA 5AVAA 3J26N 1UU5A 4XZPA 5C3QA 1AR72 4FPKA 2HWB2 4M4RA 4FO9A 4AFCA 1H8TC 2C6SA 2RM21 1MACA 4LORA 4QU1A 3ASIA 1UOBA 5FZ6A 2ZS6B 4WVVA 1YJLA 3VDDB 4LA2A 4ISQA 2IVJA 5BYNA 1L7QA 1GZTA 3KB5A 1GNZA 3M7AA 4AR2A 2ZHKA 3MPPG 4YW4A 3RZMA 4CXYA 2IWGB 1JYIA 5A32A 2XONA 3ZYIB 2QQWA 3CDZB 1NT0A 2DCJA 3RZZA 1H2KA 2BZDA 1ASJ3 2WNEA 2P34A 3OF1A 1RUE1 2XL7A 1QJX1 4IERA 4KG0A 2JEMA 3BODA 1MR5A 5C9AA 1E5HA 5A7WA 3O1MA 4Y1UA 3VL9A 4FBFA 3HIFA 3CZUA 4PF1A 3D82A 4MOAA 3UKVA 3NSTA 1Z0HA 4CDQC 1RTVA 3AKSA 1FMD1 1FOD1 2HWE2 2ZHMA 2BPA2 4C90A 3T2QA 3IPVA 5FBZA 1F31A 5KHJA 3WHUA 4XURA 4WM8C 1EY2A 1GQHA 3MFAA 1W2TA 2DBNA 5DAQA 4CDWA 5BV6A 2ATFA 1OQDA 5GZEA 2VZRA 1UKRA 2OKXA 2W5FA 1HX6A 4NRPA 2J7MA 3VBSC 4JGZB 4UW3A 1LOFA 1BJQA 2I74A 2JD9A 3SISA 2NYYA 1REEA 4IV1C 4QPYA 1U5YA 2MPFA 3GM8A 3IB3A 1DIWA 5DAVA 5A6YA 3O1TA 3I4IA 3WDVA 4PLOA 1QGLA 4L8QA 3KVAA 1ZRCA 3WF2A 4YG0A 5T54A 3BIWE 5FP8A 2GNBA 3AK0A 4ZU4A 3RZKA 1PGSA 2PHTA 4OUEA 4B4QA 3B3QE 5FPAA 1OA2A 1US2A 4A44A 4FCAA 3W9AA 3C8XA 1ZVFA 2Y6GA 5L7OB 3D0SA 5FYTA 5DDJ3 5FRAA 3O1SA 4MXWB 1YI7A 2WNUC 4I3PA 2VTXJ 2Q8DA 3WNOA 5A1AA 3N9OA 4A7ZA 1AXYA 3M1HA 3X29B 3VBRC 4P9XA 4OI0A 3J9SA 1IPJA 1P8JA 4XFFA 3ZSJA 5KXEA 2EIGA 4CP2A 1QEXA 4LKDA 3UKNA 4A45A 3A0NA 3D6EA 4UF0A 1JS9A 4TSVA 2VQ0A 1UOGA 1BBT3 3DUIA 4HPKB 1W8ZA 3LDBA 4O9EA 1BVP1 1APNA 1IQAA 4XTPA 4JKMA 4QXKA 5FZBA 3ZXGA 3N3HA 1DYOA 2EIDA 2JB4A 2VAUA 4HBNA 1GBGA 1LJ7A 1VIWB 2R043 1ULOA 3I3BA 3LSEA 4AHXA 2OZJA 4R8HA 2ZGOA 4KU8A 2BOJA 2PHFA 4X6QB 2GN3A 2DFCA 4F3JA 3KQRA 4BM8A 4R9BA 1PIV3 3PMSA 1JYTA 5C33A 2JDUA 5FK7A 1DZQA 4BQWA 1C4RA 4Q0UA 4FTBA 4PI2A 1NCQC 1AR83 2JICA 2PFWA 5B4XA 2O1QA 1CZTA 1MS5A 4XUNA 4K8FA 1H8TB 4XIOA 1ZBE3 1SBEA 3PLQA 4AI3A 3ZPOA 2WA4A 5T52A 2WFF1 3HMYA 1W8WA 2R072 3GBGA 3J8F2 4XFHA 3U10A 4CDWC 4Q29A 1AX2A 4XC9A 5AFBA 4IE0A 4ITCA 1GANA 1UCXA 1IPSA 2I45A 5GZGA 1SEFA 2VNGA 1DP0A 2R16A 1V0AA 3MUZ1 5K0UA 1LOFC 3UGFA 1PNGA 1HXS1 3N7LA 3A21A 4HXCA 4YM2A 1QJFA 4DXSA 1R082 3C3VA 2CNAA 3OUJA 1DQ5A 4UYBA 3V65A 3BTYA 4YVWC 4Z2WA 1JBCA 1WA6X 2RS52 2ZCWA 4F83A 2AYHA 1ULDA 5I93A 1QQP2 1MZ6A 3JBG2 1O59A 3W20A 2XJTA 4CDQB 2QQOA 1GP5A 3AC0A 4KWLA 4ZU7A 2Q1ZB 4K7JA 5A70A 4A3ZA 1AR91 1RUD2 4XVHA 1GSLA 5FZEA 5FYMA 4B4PA 1GOGA 1U5XA 3HN3A 2VOKA 4IEPA 4V2VA 1AR62 1CJPA 2ZEWA 2WN3A 4WM8B 2ZOEB 3MLKA 1UPSA 3MV11 4Q4Y1 5HXMA 4QX7A 3BKZA 4GJZA 3RYKA 3WCSA 2AACA 2A73B 1LOGA 3HQRA 5T5LA 5FV3A 4JC1A 3VBSB 2EIBA 3AZVA 4CDUC 3GCXA 3B7MA 3O0VA 5J37A 3WUDA 1JUIA 4IV1B 2OIIA 3VBUA 2QQJA 4S2GA 4NIHA 1D4M3 2PHRA 4DPNA 3AZYA 2XPJA 5GLWA 3AYAA 5CKQA 4ZZ8A 1XU2A 3PJYA 2J1EA 4EQVA 5IJRA 1COV2 1VPHA 4MYEA 1LESA 1S0GA 2CDOA 3A22A 4JVAA 4FOWA 1ND3B 3H3ZA 3KT7A 4IE4A 3UT0A 1OI6A 4L2NA 2X05A 1VBC2 4BZ4A 1OD5A 2WO2A 4GAZA 4DEQA 4JTNA 4E2SA 4R9DA 1UY4A 2A3WA 3RJRA 1AYN3 1RUJ1 3I2KA 4AYUA 5FZMA 1EPWA 2CWSA 3OD0A 2VCMA 4GH4C 5FXWA 4BMBA 2ZGUA 4LO6B 3LEKA 4QQHA 4K9SA 4QXBA 5LA1A 3ZVXA 5IVYA 4EWAA 1HRV3 3QBQA 2VMHA 4GQ7A 4PLMA 5JLVA 4JV4A 2RS32 3WW1A 3Q8AA 3N9LA 2HBTA 3PU8A 2FQPA 4U36A 4XAAA 3THPA 5D2AA 3M4FA 1VBE1 1S0FA 5APAA 2ADEA 1IPKA 3PUHA 1JOPA 1ASJ1 4AVSA 3I3DA 3ZXKA 3ZYPA 3AKRA 1YXWA 5L9BA 4NROA 2XLGA 3NO8A 3LDRA 4AHZA 5LASA 3PURA 4Z92B 3MHZA 4Z8BA 1RGSA 2ZX1A 5FZAA 3M70A 5EYYA 1Q8VA 4MVTA 2FMDA 4CEWA 1JHNA 1NCQB 2FDGA 4A42A 2DU0A 3PUIA 5FUPA 4B1LA 2VPVA 1ZRRA 2LALA 5HPOA 4E4SA 1H1IA 4UFKA 1YRZA 5CZKA 4QM8A 2RM22 3IPVB 3RG0A 1K5MA 4HETA 5BY5A 3S0MA 1PVC3 4IL7A 4P02B 3PTYA 1JYCA 4CDWB 1N3PA 3GZUC 4IGPA 3ZYJB 4FSJA 5D21A 4DO0A 2FDHA 4Y5Z0 5JIUA 1IS3A 2WT0A 3MI8A 3C7OA 5FTTC 1RUE2 4LOTA 1QJX2 1SCSA 3IBMA 5JCTA 3O1VA 5LBCA 3P5BA 4YVWB 4HSLA 2QTWB 1WW5A 1ZRFA 3KV4A 1W6OB 1NOVA 2D3PA 5ERLA 4N8MA 4DB5A 2JB8A 4AQSA 3DYPA 2VG9A 1AX0A 3SLIA 3T30A 3ZKUA 2NLRA 3NQHA 1FMD2 1FOD2 4JDMA 2YU1A 4AHWA 3ZDVA 4AGGA 5BNPC 1YIPA 3JU9A 4N9HA 4CXXA 1YUDA 3MLLA 2D5HA 3NV4A 4QAWA 4YW2A 1UL9A 4AE2A 4UW6A 3VKLA 1RHI3 5IATA 3TNPB 2ZMKA 2Z5WA 2GNDA 3H7YA 3HAGA 4MLOA 5FZ9A 1FNYA 4K1YA 3T4VA 5JOXA 5FXXA 4OFGA 4QDSA 2WZR3 1W03A 3UKTA 4CDUB 1VB4A 2VZ3A 2VQAA 1UMIA 2X29A 2EXKA 4UFLA 1E5SA 3ZYRA 5FZLA 4XFCA 4XACA 2R061 2R041 4FPOB 1NLRA 1PVXA 2WWUA 3DXUA 1SLTA 3I2DA 4ASKA 1A6CA 3DYOA 3PIGA 2P17A 2YC2A 1DHKB 3OPWA 2ZGSA 2VMGA 2VOVA 2TUNA 4NOTA 3UJQA 4AAPA 3U37A 2NQYA 3VKNA 3EJKA 4ARYA 4CCCA 5BNOC 4RA0A 1F35A 4GH4B 4CEWC 4MX3A 3IT8A 3ZXAC 4AL9A 1KFUL 1WLDA 1DGWA 3TEWA 4QXHA 1K45A 3I2IA 5GLZA 1ZBE1 4J1XA 4LJHA 2XJPA 4Y24A 1XJAA 4KBZA 3V0BA 3ZSLA 1D2QA 2LM3A 3MV01 5BNNA 3ZLIA 5JXIA 4M0NA 5FY4A 4ZXEA 4MGQA 1CESA 1UF2C 4LNVA 3G7DA 2WL1A 1ZM1A 2PN5A 2VNRA 5JWPA 2FCUA 4BE3A 4K1ZA 2JDKA 4R4ZA 2VTFA 4AEDA 5T3NA 2ZGPA 4UXAA 4YARA 2LRPA 4Y4RA 5K0UB 2IXCA 4COYA 3WW4A 1CAVA 2CYFA 3TRSB 3WQ7A 4I09A 2DBIA 3OPTA 1DU3D 3QH6A 1URXA 4XMAA 3LA2A 2X09A 3MW3A 2A70A 1NA1A 3PHMA 4BLIA 1WCKA 4NR1A 1S0BA 5FAXA 1SZBA 4NIAA 3FLPA 1W3XA 4DZGA 2XHKA 1SLAA 4BIOA 2H6BA 1CIYA 2AZ5A 3FN9A 1AVBA 4LO5B 2CGPA 2DU1A 2HWF1 4I02A 5FZ8A 1C1LA 2EALA 4OHZA 3KZ4C 4FPCA 5DG1A 2GC3A 2P3KA 2WFF2 2D44A 1Y4WA 4CCDA 3KF3A 1RJ8A 4YZ2A 5FY0A 3SITA 1GV9A 2HWC3 4GZ9A 4QMAA 3J4UH 4XFIA 2FHRA 3DKQA 5I0SA 4CP9B 2V72A 1A8MA 1O5UA 3BPSA 4XFGA 2ARCA 5JSPA 1XSRA 4LHKA 5EQUA 1CR7A 1REDA 3BPZA 3H7JA 4QPGA 4LO7A 5IUQA 2B5HA 2EAAA 3ZDSA 1Q8OA 1D4M1 2BJSA 5CA6A 4TTGA 1HXS2 1C8M3 4M0HA 1J84A 5CG9A 2E32A 4D6QA 1XSQA 5FMCA 3ZYHA 3VDCA 2P3IA 4XQWA 2A6ZA 3GGLA 3B69A 1H1AA 2ORZA 5I91A 3KD4A 1SLIA 3H1MA 3LA7A 2W92A 2XG3A 3EB7A 1H6YA 5J48A 4COVA 1NZIA 4BDVB 4LBQD 4NRMA 1RUF1 4N7IA 2D5FA 4ES9A 2FDKA 1CIWA 1HB3A 5BNPB 1AYN1 1FT9A 5HV0A 2LUWA 3OGSA 4YFWA 2C26A 5JXJA 3VHPA 3CJXA 4YGDA 4OZOA 3RI9A 3K4DA 4Q4Y2 3AB0A 1NE6A 4WZFA 3WW3A 3WQBA 5CU1A 2RV9A 5JUVA 1NX9A 1HRV1 5FMOS 2W87A 1KDMA 1T6BX 3K3OA 3M3IA 1BK0A 4BQ4A 5JMOA 3MZHA 4CE8A 4PIXA 3RZJA 2J1TA 2X53S 3MICA 4ZY9A 5SV5A 1IQDC 2AEZA 3ZFEA 4P5HA 3WQ0A 1VBA3 1CJDA 2ILMA 4AQTA 3KV5A 4NAMA 3AX4A 4AEDC 2B4KA 1OH4A 1C57A 2CV6A 2JG9A 2A3XA 1XC6A 1GYKA 5FXVA 3WP6A 3MYXA 4ISRA 1ODNA 2BYVE 1NY71 4LMFA 3DL3A 2WIIB 1XYOA 2DCKA 1RUJ2 2CDPA 2R0HA 3H42B 1Z7S3 4I01A 5BNOB 1HN0A 5BXXA 4CEWB 4E4ZA 5LATA 3VZOA 2VZVA 1V6OA 3CBNA 4R9CA 4W65A 1W9TA 1Q56A 4A3XA 3VDDA 1XYPA 5LRRA 4LLOA 2XVLA 1HN1A 1PVC1 5FUIA 1QH6A 1J3PA 1D4VB 3WNXA 1VBE2 2P6HA 4FPYA 2N7GA 1YFWA 5G05L 1VAKA 5IFPA 3WG4A 1BK1A 3U07A 5C3PA 2GC1A 1GQPA 2ZACA 1H0BA 2CY6A 4M4PA 4Q5OA 1ASJ2 4N90A 2GP3A 5H9RA 2RDRA 4K20A 5LBBA 4R52A 1VLNA 3HT2A 5K7PA 4D7TA 4PDWC 4EWDA 3POJA 2W08A 4ARXA 5FZ1A 3BVCA 4SLIA 1K12A 2ZX3A 4O7XA 1W6MB 5J1XA 3ZIXA 3SCGA 1R093 4BQYA 4UT5A 3WSOA 4QHZA 1DGWX 4RGKA 4XUPA 3F2ZA 5FXZA 3T2TA 2PMWB 3VBFC 1X82A 2Y0IA 1VRH3 4P14A 1UIJA 3ZMOA 2Y8KA 4BH9A 1PZ9A 4NHMA 3N9PA 1RHI1 1O3TA 5FYUA 2HWD1 4OCTA 2GNMA 4JGZA 4XJWA 2Q0AA 4WVWA 1JUHA 1YQ6A 3U78A 2WZR1 1QXPA 2A6VA 1XQNA 3AM2A 4XMIA 5I0TA 3RPQA 1B35C 5A3WA 2B42B 3P6BA 3KCCA 1JODA 3SH5A 4CCKA 5FMDA 1W28A 5IAVA 2CGOA 3SC7X 4DUXA 2YXSA 4W8JA 5J7MA 3EMRA 4Q0PA 2JX9A 5IVBA 3AFKA 4QQ2A 3H50A 3GYDA 3EYPA 3R0RA 4G4FA 5AVPA 4LBQB 5GLUA 1H4HA 4BWOA 5L7OA 1SLLA 2VECA 3LGRA 4BXSV 3CL1A 4MXWA 3T3YA 4EWEA 4FP3A 2VCCA 2YC4A 3OGRA 2ARAA 4Q0QA 4JTOA 4LKFA 2Q30A 4FFHA 3VLBB 4YM3A 1WCUA 2D3RA 3KHCA 4QX3A 4Z2AA 3BUCA 4LITA 3UYJA 4KQ7A 2VW1A 5ACA3 5LCWL 4CUGA 3WLUA 1JH5A 4HPKA 4DY5A 3QLQA 2JWPA 2YFZA 4PCRA 4XFAA 4AK3A 1BVVA 4KNCA 3TYJA 1QKQA 2FDFA 5IHRA 1I5ZA 3ACGA 3LAGA 4B7KA 2BP6A 2R042 1MS9A 4AEDB 5C3SA 2XOMA 3T1LA 3ES1A 4FOYA 2HKXA 2Q8CA 4IEXA 3AMHA 3HQXA 2DFBA 4RS5A 4SBVA 1CAVB 2FMYA 4RYDA 3Q9OA 4HLTA 2C24A 2NZ9A 3IMNA 3SMHA 1PIV2 3ZPYA 1ULPA 1OQ1A 3HN1A 3PIJA 1JHJA 5CFDC 5F5QA 3MIBA 3ZIWA 1H8TA 3CEWA 3ES4A 4ZS3A 5LEKA 1GUIA 3JB4C 1OQEA 3PVEA 3HR9A 4AWDA 5CEHA 4Q4X3 4GMP0 3NWKA 4UW4A 1ZBE2 2E51A 4AVTA 1OKOA 4I2OA 4QX2A 2W2IA 3ACLA 1DQ2A 1KDKA 2VL4A 5I8YA 1RB8G 3WW2A 1WKYA 1E5RA 2RE9A 3T09A 1O91A 2VOWA 2WZPP 4AI9A 2HWC1 3FLRA 1I9RA 1ZZCA 3ZN4A 4JKKA 4C1WA 2GMEA 2ZGQA 2LS6A 3H1YA 2JECA 3LIGA 3WDYA 1VMFA 1T2XA 2B8MA 1C8M1 3Q8BA 5A3OA 1QJZA 3E5XA 4PDWB 2JDPA 5DABA 1YFYA 2WLQA 4EE2A 5FP3A 2XJRA 2XWJB 2F6BA 3BTXA 1RUOA 4IQPA 2VUCA 3WX5A 3VBFB 3LCPA 1TVGA 2YBSA 4WM8A 2BFUL 5FY1A 2JIGA 4CCLA 4P9LA 2BTVC 2JDNA 3SH4A 1S2KA 2HWF2 2A6XA 3UGGA 2GALA 2XJSA 1MS4A 4IE6A 2GC0A 5FBJA 5BPXA 3VBSA 1BLZA 3KT1A 4ASMB 1QDCA 4OULA 1ZRIA 3NL1A 1A34A 4HK9A 2EIEA 1XE7A 1PX3A 1B35B 3MO4A 2A7AA 2HEWF 4QKDA 1D4M2 1LEDA 4QQPA 2WO7A 1VBA1 5HXVA 2WFPA 3M2MA 2J1SA 3I3EA 1HB4A 4HVRA 4TLFA 4XHBA 1KFXL 2X10A 3O14A 4INDA 1C5IA 1EV13 3NJVA 1A78A 2Q1MA 1W06A 3PU3A 4QWNA 3ACHA 2P37A 3DF0A 2JG9B 2G19A 3THCA 2WNUA 2PHUA 3AKTA 1DYPA 1RUF2 3I49A 2GMPA 2JKBA 1UOFA 1AYN2 3HPNA 3ENRA 5EJZB 4AVAA 3TN93 1GKBA 3WG3A 3VBRA 2XUMA 5CFCC 5LY2A 4TXWA 2QQUA 2WC2A 3U75A 3BI3A 4HKWA 4IE7A 3ZMNA 2B9VA 3TEXA 1H9PA 1U5ZA 5GKAC 4EV0A 1J3QA 1HRV2 1N1SA 1QXRA 1OKQA 3SEPA 1NCRC 1ZA4A 3O0XA 4DIQA 3AFGA 3ALQA 4PF5A 2RMU1 4XXPA 4ZS2A 1MS3A 2C5DA 2VMDA 4Q1RA 2HEVF 3B9CA 2DF7A 4JHTA 1UY2A 3E6CC 1IKPA 2K0GA 3I8TA 1RUH3 5FZFA 4I0BA 3B01A 4BYYA 2E7AA 2VQTA 2Y34A 5B4NA 3SKVA 2YMZA 1NY72 2H0VA 1NCQA 5AFEA 1MEC3 2Z69A 1XNAA 1NUKA 3D4KA 5CFDB 3JZVA 2NP0A 3ATGA 5F3GA 1R091 4Y4YA 4QQOA 4Y20B 4QX0A 1BCXA 4XHXA 5DUUA 5FOBB 3C7FA 2G9GA 3NAPC 4H14A 3ZFFA 3PMEA 4NHLA 1OVPA 3OCPA 1UZYA 1JTZX 3POWA 1PVC2 2MEV1 1WW6A 3GHMA 3OOXA 3WDUA 3IDAA 5FY8A 1RUI1 3J7HA 4H7LA 2XR4A 3FHIB 3W59A 3KLSA 4L92A 5A1FA 3O1OA 3VGIA 4ET7A 3WEZA 4AFBA 5T5JA 2AUYA 4Y5SA 4N53A 4TWTA 4YVWA 1OLQA 2Y26A 1UY3A 4XAEA 3POYA 5EYXA 4MGYE 1JZ8A 5IK5A 1W6OA 3KF5A 3APBA 2YHJA 2VMIA 4FI9A 4KG8A 5JXGA 5HBAA 5JZGA 4XE9A 3KSCA 4NPRA 4K21A 2WSUA 2V4VA 1VAVA 5IAXA 2ORXA 5A7QA 4FXKB 2ZGRA 1W6NA 1W8HA 5FMBA 5FZDA 2VCAA 2EICA 4JRAA 4CYDA 5C4WC 2P5BA 1N1VA 4DOUA 2IC1A 1RHI2 2OT7A 3MIEA 4GWMA 1GOFA 2JKXA 4XQDA 3EHKA 1G9FA 1PZ7A 2HWD2 2XWBB 3KMHA 3KV6A 4XTMA 4NO4A 5DAWA 5F8PA 1WMXA 4CDUA 1XE0A 5FLHA 4CVUA 1H2MA 1HRI3 4RGAA 4D6RA 2ARBA 2D6PA 1GR3A 1O6UA 2WZR2 1UAIA 1R1ZA 1ENXA 4PT6A 3JD73 1YJKA 1IOAA 5FWJA 5EJ1B 2CAVA 1PGW1 4NPLA 2XLFA 2RR13 5ABJA 4QKBA 4QB2A 3OD4A 3CHXA 1SCRA 3NV3A 1KXGA 1PHMA 5IYYA 1MVEA 4EN6B 1X7NA 4PQ9A 5FJKA 3VD4A 1V6IA 4M00A 5DMYA 5J09A 4ES8A 1W0PA 1HW5A 4RS5B 3IIAA 2JE8A 5A6XA 4GH4A 1RMU3 3USUA 2UURA 2GAUA 5FPLA 3PL0A 2PLV1 5CFCB 5JPNB 5FPXA 2ZEZA 3LZZA 2QQKA 1LGBA 4UWDA 4Y1YA 4Q4X1 1F15A 1WLWA 2Y6KA
chains in the Genus database with same CATH topology
1WD3A 4QM9A 3VBOC 3ZFFC 2WS93 1J1TA 4XJAA 2UWBA 4COZA 3ETQA 3KGLA 4Q4W3 4FAGA 4I0AA 3JQXA 3ZXLA 3ZXEA 2D6NA 5GLTA 3EBRA 2LTNA 3NKTA 1ENQA 4EN9B 5D8AA 2ZGNA 3JQWA 4N53C 1QHDA 1S0IA 4WBBA 5AC91 4H3WA 3RMXA 3RRDA 3VN4A 2AGSA 5JZGC 1HKDA 1J1LA 3GNEA 4LBOA 3NAPB 1HV1A 1CQ9A 2ZPXA 1TME1 3OPZA 2BUKA 2HWC2 4D69A 1PO13 5KXBA 1V6JA 1ONAA 2NN8A 2NPIA 1A8DA 3B5LB 3DPRA 4JGYA 2JG8C 4R4XA 1X8EA 5JI9A 1RC6A 3ELNA 1VAMA 2QZ2A 1C8M2 1O5LA 1Q5OA 2DCTA 1GFF2 2QNKA 2EXHA 4KH9A 4UBHA 1DG6A 2QFEA 4RD7A 1EV11 5ABJC 2ZGTA 4URTA 1UZZA 3ZN6A 3WHTA 5BNPA 1HIXA 2ZGMA 1FPN3 4QHBA 1G8WA 3WR0A 2Z79A 4K3UA 4MUVA 5GZFA 2WNUB 2IZWA 1DQ0A 4YZ5A 1S0JA 2W52A 2DVBA 5IK8A 1XYNA 5DG2A 1NQDA 1ZBA3 1QJY3 4JQRA 2Y38A 2BNNA 3VBRB 1DZRA 2DCZA 3LA3A 3R4SA 1WW4A 1LOCA 2QJVA 1A3KA 2EF6A 5L73A 2R32A 4AI1A 4GB33 2JE7A 3ZSMA 4E4DX 4AVVA 1VBA2 4IV3C 2PAKA 2AREA 4RR3A 3PVOA 3KCXA 1NE4A 2HWB3 4RGGA 5CVRA 5D8AC 5BNOA 3POSA 2ZX2A 1VP6A 1QOOA 2DVFA 2XL9A 2XVKA 1V00A 2DURA 2IXLA 1SBFA 4COUA 2X5IA 3VL8A 1FI2A 1WMFA 3HBZA 2B45X 1PK6A 4JDOA 5I0UA 4MH0E 1W6QB 1AHSA 1QJU3 3M3OA 1WGPA 4LUKA 1M06G 3ZFFB 2HEYF 1ENRA 4BHPA 3ZSEA 4AEKA 4P9JA 5T5OA 5GM0A 4XJZA 5GZDA 2RMU2 4PJYA 3DGTA 1G86A 5HCFA 1XU1A 5KHKA 3DPRC 4JGYC 2HWE3 5FPZA 4Q0SA 3VZJA 4LBJA 3QCWA 4FPJA 4Z07A 5DZGA 2D7FA 2B7YA 4N53B 2V09A 1W6MA 2A5ZA 1WA4A 4LHNA 3AP6A 4P9GA 1S0CA 1LHNA 2WQZC 3HD8B 4E27A 2ENRA 5JZGB 1BEV3 1R092 1LB2A 5DDJ1 4E2GA 5J98B 1W6NB 4EN8B 2JJ6A 3PVBB 2G9FA 4LBKA 4Z1VA 1OSGA 4I3GA 4YVSC 2MEV2 3IM0A 4D7YA 3WG2A 1BQPA 4L97A 1RUI2 2VVEA 2R49A 1HRI1 1QH7A 1BBT1 2XJQA 4F8AA 2JG8B 1MS8A 4QPIA 4AQ2A 4C91A 4HANA 3BALA 4XOGA 2O0OA 2BVBA 2OA2A 4LEJA 3FUOA 5IK4A 4XBLA 5FO9B 4LBQA 3AMQA 4RR3C 5ABJB 5BNQA 1RUC3 2WA3A 1PIV1 1WBLA 4KGGA 1CONA 3AZZA 1LKNA 1AR81 1RMU1 5JSRA 1L3JA 1UW8A 4BQ1A 2UU8A 3USUB 3AJYA 4YM1A 3VBHC 2D97A 2X5IC 3KCYA 4PIZA 2CWMA 1C8NA 2OVUA 2UYAA 1PK6C 1ZNPA 3ME2A 4LT5A 1OA3A 1VBD3 1DFQA 4KBBA 4IEYA 3ZSKA 4Q4W1 3WT3A 2E53A 2QKDA 4ZKTB 1PGW2 3H3UA 1YI9A 4Q27A 5E16A 5I8TA 2DYCA 1UN1A 3TAYA 5LK5A 2R6QA 1LODA 1V9U3 5D8AB 3NW4A 1H8VA 4NN0A 5C8CC 1O3SA 2R073 1UIKA 3OY8B 2D3SA 2PLV2 3GHNA 1ZYBA 4MGKE 3QH7A 5JOZA 4Q4X2 1YFXA 1MQTC 3M8LA 1S2BA 4YG3A 4HN0A 1KS5A 1QQP3 1LGNA 5TSWA 1KJLA 2ERFA 3JB8A 2V73A 4AGRA 1I1EA 2QDRA 2IXKA 5CBLA 3DPRB 4JGYB 2XJUA 4KL1A 4PDWA 4QGLA 4XXAA 1RUD3 4QPIC 1CGPA 1GLHA 3AYDA 4M3CA 4WVMA 1AR63 1O4YA 5AC92 1N1TA 4COWA 4RHV3 1QY4A 3SNMA 1EAH3 3VBFA 1ZX5A 4FP2A 2XGXA 3OJBA 4GWNA 4IEZA 3ZN6B 1FPN1 4AI8A 5JVVA 3MW2A 3RNSA 4W6XA 3TNQA 3BU7A 5KWRA 3FBYA 4Q4V3 1HDKA 1ZBA1 1QJY1 4X8NA 4XQ4A 1TME2 1EYBA 1TNRA 3L2YA 5KHIA 4JDNA 1B35A 1W0OA 2FBEA 4NVPA 1VBC3 4BLJA 1F9KA 3DV8A 2XJVA 3B00A 5KC6A 1W2UA 3R05A 5BUVA 2Q8OA 1GZWA 3ZFGA 2OUHA 2K9ZA 2D6OX 4MXVA 1IS4A 1C1FA 1G6NA 4RR3B 1EV12 1Q8PA 5HCBA 3GBWA 4LBNA 1H9WA 4ZXKA 1RVF3 3MIFA 4R9AA 2WQ4A 5CIRA 4DQAA 3N7MA 2OPKA 4N43C 2X5IB 4YZ3A 2PTMA 4V1PA 1ULEA 5FREA 1AL0G 5DUVA 3VHRA 4YYOA 5C8WA 2JENA 1PK6B 1QJU1 4IESA 1JW6A 3E6BA 4OI2A 4M01A 4W6WA 3MIGA 2ZMLA 1CD3G 3RSJA 1S0EA 4FPEA 3E5UA 4GULA 1KS4A 1O3QA 4KGQA 3S6PA 4C0HA 5FDBA 1QXJA 3VHOA 2DV9A 1FAYA 2GC2A 1EPZA 4Y1XA 1VALA 3FE5A 1RUG3 4XBQA 5CFDA 4ZU5A 2R30A 4Y1VA 5C8CB 1N47A 1V6LA 3OTFA 4Y20A 3WP4A 1BEV1 5J96B 4S2DA 4UBGA 1OOPC 1RIRA 2OYZA 1QOTA 1VBB3 2V5YA 4YM0A 5FFOC 2VVDA 1QJX3 1MQTB 4YW5A 1PGL1 3N4MA 1AZDA 4LLFA 4LHLA 4MGIE 1ZREA 1POV3 2GH2A 3MDPA 2ZAAA 2RJKA 1AXKA 1FOD3 3LKJA 1F2NA 4I0WB 5EXOA 4QPIB 2H0BA 3WV6A 3IWZA 4CEYA 2PAEA 4Q8KA 2OW4A 4CZSA 5KHGA 3ZFGC 3IN9A 4OI1A 4WM7A 4FPFA 1GICA 1U0AA 1RUC1 4AFMA 1IGOA 4FOQA 1PZ8A 3L2HA 4HL0A 5DDJ2 4IEVA 4UW5A 5E89A 4P9YA 1J59A 3TOJA 2DUQA 3ZXDA 2NMNA 4K40A 2Q5TA 2UYBA 4RSUA 4HVOA 2MHFA 3MLJA 2BNOA 2YYOA 1HRI2 4Y1ZA 4OVEA 1BBT2 1VBD1 4PBPA 1LR5A 5F6LB 2X8KA 1RITA 2XH6A 3CF6E 2UWAA 3I54A 4C0BA 5B2GB 4XBNA 1V9U1 1CPMA 3OGGA 2HJIA 2WSVA 4QT6A 2D6KA 3JCIA 5CFCA 2ZMNA 5FQ0A 1TMF3 1AR82 1RMU2 2ZBJA 2ET7A 2WWSA 3D0JA 2MNGA 1ULGA 3FX3A 4N43B 5L19A 4XJ9A 4D7SA 1S55A 4BMEA 3VZLA 2GN7A 4ATFA 1NCRA 4GIQA 4QQLA 4P9WA 2ZGLA 1V6KA 4AFDA 2E9QA 4BPZA 2JXAA 5LRSA 3OYWA 2D6LX 4IETA 4Q4W2 3MFCA 3N7JA 4AVCA 3ZXJA 1S0DA 4S2FA 5EV7A 4E2QA 4EN0A 4OI4A 1YHFA 1SLBA 4IEUA 5A33A 5GZCA 3KT4A 1NXMA 4M3CB 1QU0A 3O12A 4M3CF 4RQPC 4WVMB 4CEYC 5KBFA 2NMOA 3L9JT 4RHV1 1CAWB 3RMYA 3RWNA 3B94A 1J3RA 1EAH1 3CJIC 1O3RA 4WM7C 2ES3A 3ILRA 3U4XA 4EJRA 1CX4A 3NAPA 1OOPB 4KWJA 3P3NA 2DTYA 4P9IA 2C0ZA 2DUOA 4XF4A 5HI0A 1Q8SA 2YZ4A 1HXS3 2EAKA 4Q4V1 2CL2A 1DQ4A 1U5IA 5CNAA 1AJOA 3EO6A 3V64A 1ZZ8A 3HT1A 2E7QA 1LHVA 4DS0A 3SH3A 1XNCA 1NQJA 2Q4SA 1D0GA 1AR93 5F9TA 1DQ1A 1OLRA 3I59B 2Y0OA 3IDEA 3ILNA 4Q4Y3 3ZFGB 1GZWB 2W0XA 1IS5A 3SCFA 4MSVA 4BIFA 4BA6A 3UV9A 1FPN2 3H1WA 3GZTB 3UJOA 4C1XA 1RVF1 1OMIA 5C4WA 1Z7S1 1HQWA 1YLLA 4K6BA 2D43A 4QGMA 1KD7A 2YGLA 1ZBA2 2H6CA 1QJY2 1XRUA 1BXHA 4QD2A 3GBFA 4S2HA 4XIKA 1R1A3 3U0ZA 4FOVA 1LOEA 1X36A 1DYKA 2PYTA 4YZ1A 1SACA 2Z42A 3LWCA 3T1MA 4Q8LA 4META 5A3MA 1BZWA 2VW2A 1RUJ3 5EZWA 4XJUA 4A2UA 1MS0A 5IT6A 2ZJCA 4AEMA 4DRRA 1F8VA 3KGZA 1RUG1 5IK7A 2GMMA 2OZ6A 2VNOA 4YFZA 5JAXA 3CU7A 1CN1A 5SV8A 3TB0A 1D0HA 1G9CA 1AL23 1BMV1 2E7TA 1VBE3 1W6QA 3RQ0A 5FLJA 1VBB1 1VRH1 3VBOA 4Q2FA 5E88A 2WJSA 3W58A 4ASLA 1FX5A 1QJU2 4XEZA 4YW3A 4X6RB 2JDZA 2GH8A 2PHDA 1GZ9A 1DGRN 1Y9QA 2QCSB 2VW0A 1POV1 4B3NA 1SMVA 4TYSA 1G9DA 4Y26A 2GSYA 2BWCA 4Z82A 3TWIA 2YC0A 5T55A 5T5PA 1SLCA 2VULA 2PAMA 4CRQA 1ND2C 1DQ6A 5CB7A 3ECQA 3O0WA 4RQPB 4CEYB 1OHFA 1QF3A 1SFYA 1ZZ6A 3ZX7A 4CDXA 1AYM3 3CJIB 1RUNA 3WXPA 1PNFA 2RS13 4WM7B 1BEV2 3ZO0B 1XNDA 4H7MA 3BB6A 4AGVA 3AKQA 2B39A 3N35A 2BW8A 3VV1A 2C1FA 3QOPA 3MW4A 1CAXB 2DCYA 3WVJA 3RDIA 5D1IA 4D94A 2GDFA 1PGL2 4IEWA 5ACA1 1PO23 2JG8A 4LE4A 1ND3C 3DN7A 1UD1A 3SXWA 5CAZA 2G4IA 4YLZA 1ZRDA 3BOPA 1WCDJ 2FZ2A 3VZMA 2ZHNA 4HK8A 5JSOA 3CLPA 1Y43B 1RUC2 5FMOL 3WUCA 4XW3A 1TMF1 5FQ0B 3AZXA 5JOYA 4Q1PA 4D3WA 1FYUA 2R063 1Y3TA 1I3HA 3WG1A 1NG0A 1IKQA 4OHVA 4OHXA 1Y7BA 4G3YC 4FTEA 5H9SA 4FT8A 1NCRB 3AKPA 1H30A 3AZWA 5JIAA 1VBD2 5C9AC 1OA4A 3URFA 5LEJA 1UKGA 1WBFA 4IV3A 3V56A 1MVQA 3OYWB 4NHKA 4HZFA 3WDWA 2PHWA 3FBMA 2BEOA 3JUUA 3KM5A 1V9U2 3VZNA 3DKWA 3K51A 5A33B 3NVCA 3OY8A 2BNMA 1WD4A 2NM1A 3WINE 4DNYA 4CDXC 4GKXA 5JOWA 3ZN5A 2PA7A 2P2KA 4AF9A 1GNHA 2PELA 1X50A 4N7UA 2IXJA 4OHWA 5FCCA 1WMDA 4OLLA 4PLNA 1FV2A 4DMIA 1DDLA 1V6MA 5FO7B 1GQGA 2YGMA 2WT2A 2I07B 2DTWA 4XF3A 2C9AA 1LEMA 4XYXA 4FPHA 1ND2B 2PHXA 3PVNA 3VKFC 1AF9A 2HWF3 1V6NA 4FVVA 2WNVA 4RHV2 1G9AA 1EAH2 2ZAHA 5GLVA 3H8UA 3TN91 2WLPA 5C4WB 4YVSA 1H4GA 1W6PA 4OZXA 2XVGA 4Q4V2 4AI2A 3FZ3A 1AX1A 3INAA 1R1A1 4B7EA 2SLIA 4J1WA 1ZZBA 1X33A 2EXIA 4DRVA 3WDXA 4Y22A 2XBO3 4NWWA 1ULFA 2ZKNA 3FFZA 2RJLA 2QQPA 1NXD1 1RUF3 4IEOA 1YIFA 1JN2P 3AP7A 3FC0A 2W68A 1FV3A 3MF9A 1CAUB 1AR73 2IXIA 3N36A 1LU1A 1RUH1 4LTAA 2ZKLA 4QGNA 4DXZA 3E6DA 3ZYGA 1MEC1 2YY1A 1N1YA 3B93A 1RVF2 1YCIA 3NJZA 3VBHA 1Z7S2 4I30A 5LK7B 1AL21 2ZX0A 3AP5A 1XXNA 1C28A 4AVBA 1TE1B 4XETA 4B29A 1YYNA 5A32B 3VBOB 2BVVA 4ONUA 3SCHA 5K0UC 5KXCA 2AENA 4FQ4A 2EA7A 1O4TA 4AQ6A 5C9AB 2R1BA 4CP1A 3KS7A 1DF0A 2W39A 1JXNA 3C2UA 4YNIA 3GZAA 1LHUA 1QDOA 1W39A 4GA9A 4AW7A 1F5FA 3EXUA 3BTAA 2PQQA 2FZ1A 4HT1T 3BCWA 1LECA 1RUG2 5C8CA 2ZGKA 1LHOA 1RJ7A 2YUEA 5FLIA 3VKOA 1AYM1 2WNVC 4HKOA 3USSA 2BFUS 4CDXB 2RS11 5KC5A 1BMV2 5DZFA 1WCSA 1MQTA 1Q43A 1VBB2 1VRH2 1NLSA 3IKWA 3D5OA 3O7OA 3VBUC 2IFWA 4FXGB 3WP5A 3WZ1A 4O9GA 1DLLA 1C3HA 1PO21 5CADA 4LA3A 3JD71 4YG6A 1KJRA 2YROA 5T50A 2RHPA 2A3YA 3ROUA 2RR11 2A71A 4MGZE 3MPBA 5GALA 2CGNA 2OUJA 3WP3A 1WUVA 2HWD3 4E9KA 4A7YA 3VZKA 2VH9A 5GJ6A 4L9BA 5C6CA 1TQ5A 2HYKA 1T6GC 5EFUA 2A6WA 2UY9A 1C5HA 2VY0A 1OPMA 2YDEA 5F1RA 1PM7A 4KWKA 1G9BA 4XF0A 1ZZ9A 3AP4A 5ACA2 1YFUA 2SBAA 2F4PA 2WS91 4B4RA 3RYPA 2IXHA 2EVXA 4NWVA 3IDBB 3AXEA 1E57A 4IV3B 1EP0A 1TEIA 1DZTA 2BGCA 5EJ3A 2Z2SB 1QOSA 4JCKA 4YGCA 3K48A 1MZEA 3R6SA 5FOJB 1OFNA 2KA3A 1B09A 4B8EA 4LO8A 3J8F3 5JDBA 1K5MC 1LENA 3S30A 4N43A 1KITA 1TMF2 4L99A 4OUMA 4HVQA 1REFA 3THTA 2P3JA 4AG4A 4WZCA 2D98A 2PHLA 3WY6A 1R083 3ILFA 3WCRA 2RS53 1H2LA 3P3PA 1PO11 2WINB 2BBVA 1WLTA 2O8OA 3JBG3 2QE3A 1YWKA 3OBRA 4OUSA 4LBMA 3MGUA 5EWSA 3E97A 1LRHA 1FNZA 3WDTA 1S1AA 3M3EA 4WVZA 2B9UA 4DINB 1F5JA 2B46X 1CAWA 1U12A 2CTVA 5KHHA 2I2SA 3EQEA 2GZWA 1HV0A 2VU9A 1OOPA 2WNVB 4EN7B 3RJ2X 5I0RA 1J58A 4L11A 4EROA 5E1RA 3QD6A 2ZX4A 3N7KA 3E5QA 4DY3A 1QMJA 1FXZA 2KXLA 3HWJA 4YVSB 1COV3 3VBUB 1W6PB 1VB2A 2ARXA 4A7KA 1MZFA 4LUMA 1HLCA 4FPGA 3U11A 1RINA 3G6JB 4GB31 4BOWA 2D40A 2XBO1 3AXDA 3CNAA 4Y22B 3AP9A 4ORFA 1HQNA 3RI8A 5J36A 4DFSA 3I59A 1Z78A 1AR92 1SDWA 2VUJA 3B9IA 3ZXFA 3R4DB 1H1MA 3FMGA 4GXLA 5A3LA 1AR71 2D93A 2HWB1 4GMP3 4LR4A 5E8AA 5K9YA 1LULA 1WW7A 4RFT0 1FATA 2RS33 2ZZJA 2ZA9A 1BKZA 1QWRA 3TN92 5BNNC 3VBHB 1Q8QA 3FJSA 4LULA 2ETEA 5K8SA 3V0AA 3NV2A 3AMNA 4ATEA 5DXDA 1R1A2 4LO4B 4QU2A 2R0FA 1ENSA 4LE3A 4MV2A 3AMPA 1KQRA 2ET1A 3VUOA 2UWCA 1MZ5A 2GU9A 2ZZQA 1M4WA 2DVGA 4JAAA 3LOBA 2YV8A 4JRLA 2HWE1 1NA1C 4G9SB 3MEPA 4AXOA 1RUH2 2K2SA 4J6GA 1LTEA 2RM23 1O7FA 1O4ZA 1ZZ7A 1NYWA 1DGLA 3AJZA 3LB9A 2DWRA 4OHYA 1UPIA 1PMIA 4XF9A 1MEC2 1K5MB 5KXDA 1DGRA 1LU2A 3QACA 1AL22 5JR7B 2RMU3 1OPOA 4N9IA 1LOBA 3S7EA 2R1DA 3AMMA 2VOXA 1RUE3 4CTEA 4TZDA 2IFRA 4QPGC 4IXLA 1XE8A 3R4UA 3GF6A 1JOJA 2ZABA 2O8QA 2XKOA 4KU7A 1QNWA 4XF1A 1X8MA 1IHMA 4M3CE 4Q26A 4GKYA 1FMD3 3A0KA 3M3QA 4HFSA 1ALYA 4RQPA 1VJ2A 4CP0A 1TNFA 2TNFA 3CJIA 2ZTNA 2MEV3 5J3UA 4F7ZA 2KM2A 1YNAA 4X8PA 1AYM2 3FLTA 2RS12 1RUI3 4WV8A 3MIDA 1CAXA 1V70A 3AYEA 5JI7A 3ZFEC 1BYHA 2TEPA 1LOAA 3D8CA 5DZEA 4FQZA 3M3CA 5H9RA 3S7IA 1VR3A 1YO8A 1N3QA 3I7DA 3MF6A 2D6MA 1PO22 1UMZA 1RL3A 4XPVA 2JG9C 3PJQA 2BQPA 3JD72 3OBTA 2TBVA 3FWEA 2QVSB 2AR6A 3BOWA 4H55A 2RR12 2XKPA 4PBOA 1I6XA 3FFQA 1IS6A 3NV1A 2QUOA 1Q3EA 2WKKA 4YGBA 2R071 3VDDC 4AHYA 3H9AA 1OFSA 3J8F1 3V0BB 2VUAA 1ULCA 2JD4A 5BNNB 4U2AA 4FPLA 1AJKA 3LSDA 3B02A 4AI0A 1MS1A 2R062 5H9QA 2VGDA 1AXZA 3MIHA 2JE9A 1SQ4A 2WS92 1R081 4XFBA 2CAUA 4MZUA 1AUYA 1CVNA 2RS51 4QX5A 1QQP1 1UU6A 3JBG1 3A4UA 1D2SA 1G7YA 3WD5A 4YRDA 2PLV3 4RL7A 5DUWA 1NA1B 1RUD1 4GALA 2UY8A 5H9PA 1KRIA 2XLAA 1AR61 3SHRA 1UU4A 4PIYA 1GZCA 2DVAA 2WFF3 3O5SA 2QDNA 1WMEA 2QZ3A 3RYRA 4JGZC 3VKMA 4YSFA 2GNTA 4LBLA 2YPJA 5F6KA 5HCAA 4QPGB 5I8SA 1COV1 2AH2A 4FTSA 3IDCB 3OGJA 4XDQA 4XILA 1LCLA 1QNYA 4Q0VA 3VHNA 5AC93 1PO12 3LOIA 1DBNA 2A75A 2BWAA 2EXJA 4CDQA 4YZ4A 4YW1A 1LHWA 1VBC1 2XB6C 4AFAA 5JPMB 2E6VA 4IEQA 1ND2A 3TBDA 3UK9A 5L7OC 2A6YA 5L36A 1NZCA 1H2NA 2DVDA 2WT1A 2DUPA 3FUQA 3NKGA 3UL2A 4FAHA 1HQLA 4GMP1 1UX6A 1IZ3A 1N3OA 1TME3 3WQ1A 4HN1A 5FO8B 3RS6A 4XJ8A 2RS31 4IV1A 4YGEA 4HKLA 3GALA 5DUXA 1SFNA 2ZHLA 3ZFEB 2VVFA 3CO2A 3ST7A 5CG8A 4HSJA 1ND3A 3V0AB 2E63A 1LGCA 1XNBA 4HMZA 4W6YA 3H0OA 4GB32 4BCUA 2XBO2 1POV0 1CPNA 3PNAA 2VXRA 4AEJA 4RS5C 5JMCA 1CAUA 3WOGA 3AYCA 1WLCA 1XNKA 1SBDA 5AVAA 3J26N 1UU5A 4XZPA 1AR72 4FPKA 2HWB2 4FO9A 4AFCA 1H8TC 2RM21 1MACA 3ASIA 2ZS6B 4WVVA 1YJLA 3VDDB 4LA2A 4ISQA 5BYNA 3KB5A 1GNZA 3M7AA 2ZHKA 3MPPG 4YW4A 1JYIA 2IWGB 5A32A 3ZYIB 2DCJA 3RZZA 1H2KA 3OF1A 1ASJ3 2WNEA 2P34A 4IERA 1RUE1 2XL7A 1QJX1 4KG0A 2JEMA 3BODA 1MR5A 5C9AA 4Y1UA 3VL9A 4FBFA 3HIFA 3D82A 3UKVA 3NSTA 1Z0HA 4CDQC 1RTVA 3AKSA 1FMD1 1FOD1 2HWE2 2ZHMA 2BPA2 4C90A 3IPVA 5FBZA 1F31A 5KHJA 3WHUA 4WM8C 1EY2A 1GQHA 3MFAA 4CDWA 5BV6A 2ATFA 1OQDA 5GZEA 1UKRA 1HX6A 3VBSC 4JGZB 4UW3A 1LOFA 1BJQA 2I74A 3SISA 2NYYA 1REEA 4IV1C 4QPYA 1U5YA 2MPFA 1DIWA 3I4IA 3WDVA 4PLOA 1QGLA 4L8QA 1ZRCA 4YG0A 5T54A 3BIWE 2GNBA 3AK0A 4ZU4A 1PGSA 2PHTA 4B4QA 3B3QE 1OA2A 4FCAA 3W9AA 1ZVFA 5L7OB 3D0SA 5DDJ3 5FRAA 4MXWB 1YI7A 2WNUC 4I3PA 4A7ZA 1AXYA 3M1HA 3X29B 3VBRC 4P9XA 4OI0A 3J9SA 1IPJA 3ZSJA 4XFFA 5KXEA 2EIGA 4CP2A 3UKNA 3A0NA 3D6EA 4TSVA 2VQ0A 1BBT3 3DUIA 4HPKB 4O9EA 1BVP1 1APNA 1IQAA 4XTPA 3ZXGA 4QXKA 3N3HA 4HBNA 1GBGA 1LJ7A 1VIWB 2R043 3LSEA 4AHXA 2OZJA 4R8HA 2ZGOA 4KU8A 2PHFA 4X6QB 2GN3A 2DFCA 4F3JA 3KQRA 4BM8A 4R9BA 1PIV3 3PMSA 5C33A 1DZQA 1C4RA 4Q0UA 4FTBA 1NCQC 1AR83 2JICA 2PFWA 2O1QA 1MS5A 4K8FA 1H8TB 4XIOA 1ZBE3 1SBEA 3PLQA 4AI3A 2WA4A 5T52A 2WFF1 3HMYA 2R072 3GBGA 3J8F2 4XFHA 3U10A 4CDWC 4Q29A 1AX2A 5AFBA 4ITCA 1GANA 1UCXA 2I45A 5GZGA 1SEFA 2VNGA 2R16A 5K0UA 1LOFC 1PNGA 1HXS1 3N7LA 4YM2A 1R082 3C3VA 2CNAA 3V65A 1DQ5A 4YVWC 4Z2WA 1JBCA 2RS52 2ZCWA 4F83A 2AYHA 1ULDA 5I93A 1QQP2 1MZ6A 3JBG2 2XJTA 4CDQB 4KWLA 4ZU7A 2Q1ZB 4K7JA 1AR91 1RUD2 1GSLA 4B4PA 1U5XA 4IEPA 2VOKA 1AR62 1CJPA 4WM8B 2ZOEB 3MLKA 1UPSA 4Q4Y1 3RYKA 3WCSA 2A73B 5T5LA 1LOGA 4JC1A 3VBSB 3AZVA 4CDUC 3B7MA 3O0VA 5J37A 3WUDA 1JUIA 4IV1B 2OIIA 3VBUA 4S2GA 1D4M3 2PHRA 4DPNA 3AZYA 2XPJA 5GLWA 3AYAA 1XU2A 3PJYA 1COV2 4MYEA 1LESA 1S0GA 4JVAA 4FOWA 1ND3B 3H3ZA 3KT7A 1OI6A 4L2NA 4BZ4A 1VBC2 1OD5A 4E2SA 4JTNA 4R9DA 2A3WA 3RJRA 1AYN3 1RUJ1 4AYUA 1EPWA 2CWSA 3OD0A 4GH4C 4BMBA 2ZGUA 4LO6B 4QQHA 4K9SA 3ZVXA 4EWAA 1HRV3 3QBQA 2VMHA 4GQ7A 4PLMA 5JLVA 4JV4A 2RS32 3WW1A 3THPA 2FQPA 4U36A 3M4FA 1VBE1 1S0FA 1IPKA 1ASJ1 4AVSA 3ZXKA 3ZYPA 3AKRA 1YXWA 2XLGA 3NO8A 4AHZA 4Z92B 4Z8BA 1RGSA 2ZX1A 3M70A 5EYYA 1Q8VA 4MVTA 2FMDA 4CEWA 1JHNA 1NCQB 2DU0A 2VPVA 1ZRRA 2LALA 4E4SA 1H1IA 1YRZA 4QM8A 2RM22 3IPVB 3RG0A 1K5MA 4HETA 5BY5A 3S0MA 1PVC3 4IL7A 3PTYA 1JYCA 4CDWB 1N3PA 3GZUC 3ZYJB 4FSJA 4Y5Z0 5JIUA 1IS3A 2WT0A 3MI8A 5FTTC 1RUE2 1QJX2 1SCSA 3IBMA 5JCTA 4YVWB 4HSLA 1WW5A 1ZRFA 1W6OB 1NOVA 2D3PA 4DB5A 4AQSA 2VG9A 1AX0A 3SLIA 2NLRA 1FMD2 1FOD2 4JDMA 4AHWA 4AGGA 5BNPC 1YIPA 3JU9A 4N9HA 1YUDA 3MLLA 2D5HA 3NV4A 4YW2A 1UL9A 4AE2A 4UW6A 3VKLA 1RHI3 3TNPB 2ZMKA 2Z5WA 2GNDA 3H7YA 3HAGA 4MLOA 1FNYA 4K1YA 5JOXA 4OFGA 3UKTA 2WZR3 4CDUB 1VB4A 2VQAA 2X29A 3ZYRA 2EXKA 4XFCA 2R061 2R041 4FPOB 1NLRA 1PVXA 1SLTA 3I2DA 1A6CA 2P17A 1DHKB 2ZGSA 2VMGA