4IEYA

Cys-persulfenate bound cysteine dioxygenase at ph 7.0 in the presence of cys, home-source structure
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type 1
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ieyA00
1GQHA 1LRHA 4RD7A 4YSFA 1L3JA 2QDRA 4H7LA 4IESA 1IPKA 4MGYE 2D5FA 3KGLA 3E97A 3MPBA 4LA3A 4D7SA 4QM9A 1YHFA 4YNIA 1X7NA 4QMAA 3HT1A 5LEJA 4Z07A 1RUOA 4AQ2A 4XF3A 4XF4A 5JSRA 4I3PA 4JTOA 3ST7A 4N9IA 2XHKA 4UXAA 4O9EA 1ZZ6A 1X8EA 1G6NA 3NW4A 3EQEA 2VQAA 2IC1A 2PYTA 2IXJA 2H6CA 3BU7A 3NJZA 4IEZA 5JAXA 1J59A 4X6QB 2ATFA 4E2SA 2VPVA 3E6CC 1OMIA 2P17A 4LUMA 4PIXA 4EROA 2KXLA 3E6DA 3RNSA 1XE8A 1QWRA 1ZNPA 5LEKA 3CF6E 4EV0A 4Q0SA 5JCTA 2PFWA 2PTMA 1UPIA 3KSCA 3EHKA 4KU8A 4B29A 1SFNA 1QY4A 1LR5A 3BB6A 4IEQA 4Q0PA 4WZCA 1J3PA 5JR7B 1FT9A 3E5XA 3I7DA 3IIAA 2FMYA 2O8QA 2PAKA 2D5HA 1SQ4A 4KU7A 1UIJA 4TLFA 2Q4SA 5CADA 2XL7A 3DN7A 1ZZCA 2QNKA 1ZRRA 4BH9A 4DINB 2GC3A 4I0AA 1Y3TA 4LULA 2BYVE 3TNPB 2EVXA 3ES1A 4R8HA 5F1RA 3H9AA 3SHRA 3LZZA 2Z2SB 3D0JA 3LA7A 4IEXA 5FLJA 1CGPA 4IETA 1VR3A 3S7IA 5K8SA 5I8YA 1HW5A 5D1IA 4KL1A 5I0RA 1V70A 1QXRA 1ZZBA 3FJSA 1FI2A 1VP6A 3SCGA 4JTNA 5BPXA 4ORFA 2Z69A 4LLOA 3PVBB 4BHPA 4I0BA 4YARA 1SEFA 3DKWA 4HVRA 4MGZE 3D0SA 2PAEA 3CJXA 2GC2A 4Z82A 5JSPA 4IEPA 5J7MA 4X6RB 4KWKA 2CAVA 2O1QA 3FFQA 1ZVFA 3H7YA 3LOIA 5JSOA 1O5UA 1J3QA 2H6BA 1CAUA 2UYBA 2H0VA 2B5HA 1XRUA 2PA7A 3HQXA 5FCCA 3RPQA 1YLLA 1WGPA 4EWEA 2B8MA 3FZ3A 1GQGA 1XE7A 3M3IA 4ZU5A 2Q1ZB 3LA2A 1EPZA 4LUKA 2D40A 5EZWA 2UYAA 5CVRA 3D82A 1NE6A 4J1XA 3CL1A 1RGSA 2HJIA 3OGJA 1NE4A 3NKTA 1O3TA 5HI0A 4KWJA 4L2NA 4MGIE 4AVAA 1VJ2A 1RL3A 5FQ0B 4UBHA 2HKXA 2GAUA 3MDPA 4MZUA 5E16A 3OD0A 1X8MA 4YRDA 1QXJA 1DGWA 1J58A 1CAWB 1OD5A 3I54A 4XFBA 4HVOA 5BXXA 1Y9QA 2QCSB 1ZX5A 1IPJA 4BIFA 1O3QA 2GU9A 3IDBB 4XF9A 5I0UA 5FLHA 4P9GA 3KCCA 4Q0VA 3EO6A 2GC1A 1EYBA 1UW8A 3H1YA 1NZCA 1TQ5A 4IEOA 4UBGA 4QXKA 1H1MA 3UKVA 3WW1A 2XKPA 5BV6A 1RTVA 3WW4A 4L11A 4O9GA 1ZZ8A 5C6CA 2XLAA 4F8AA 3ZDSA 1CAVA 4HN1A 4QGNA 4JV4A 2XLGA 2FQPA 3E5UA 3IWZA 2PHLA 1ZRCA 5KHIA 3RZZA 3ETQA 4XFAA 3E6BA 2WFPA 1JUHA 3H1MA 2Q30A 5FDBA 1RUNA 2GZWA 2MPFA 2BNMA 2IXIA 3LWCA 3LA3A 3KGZA 5C8WA 3EJKA 3FE5A 3LAGA 4EWDA 2QVSB 3WW3A 1CAXA 4HLTA 4YYOA 1WLTA 4IEWA 3CLPA 3NVCA 5I91A 4K8FA 3H3UA 4MUVA 3TNQA 4EWAA 5KBFA 3OF1A 1YFXA 2ET7A 4XF0A 4PIZA 1CX4A 4XFHA 4HSJA 2EA7A 2MNGA 3I59A 2OA2A 3WW2A 4N9HA 4QGLA 4F7ZA 4ONUA 3CEWA 4KWLA 3RYRA 5J48A 4E2GA 2ZCWA 2GH2A 4MH0E 4QM8A 4AXOA 5BY5A 5FLIA 3JZVA 4XFCA 2DCTA 4BYYA 3RYPA 3UKTA 5FPZA 1OFNA 3PLQA 3H1WA 1EY2A 5AVPA 1PM7A 4FBFA 2CV6A 2I45A 3GYDA 4GULA 3SXWA 3SMHA 3IDCB 3BPZA 4A2UA 4IEYA 3S0MA 3UKNA 1LKNA 4IEVA 4JVAA 1O7FA 1ZREA 4Q0QA 4WVZA 4D7TA 1Q3EA 2ET1A 3O14A 5LRRA 1YFUA 2MHFA 5BUVA 2QJVA 3C3VA 3MZHA 3RDIA 5LRSA 1Q5OA 4QX5A 2WC2A 2BEOA 5I0SA 5E1RA 2PHDA 1UCXA 4HMZA 1ZRFA 5I8SA 3DL3A 3ES4A 2ETEA 2C0ZA 2PAMA 4HZFA 2N7GA 3FWEA 3U0ZA 4IERA 4PIYA 1LB2A 5FPXA 2OYZA 2UY9A 4HBNA 4XETA 5I8TA 3I59B 2IXHA 2OZ6A 5EFUA 1J3RA 4HN0A 2IXLA 4FAGA 2B9UA 4NVPA 1UD1A 4Q29A 3PNAA 4Q0UA 4XF1A 3U11A 2XL9A 2BGCA 3RYKA 3EBRA 3NSTA 5CU1A 4AQ6A 3N4MA 4I02A 3ROUA 1H1IA 3VHRA 3USSA 3OCPA 2OZJA 1PMIA 3MYXA 3H50A 4E2QA 4LTAA 3R6SA 1CAUB 4FT8A 3IBMA 1ZZ7A 3ELNA 3GBFA 3KMHA 3NL1A 4MGKE 4MX3A 1YFYA 1J1LA 3H8UA 1YUDA 2PQQA 4WBBA 3G7DA 1DZTA 1ZZ9A 3H3ZA 3DV8A 1EP0A 3CO2A 3HT2A 1RC6A 1DZRA 1UIKA 3ACLA 3SCFA 1ZRDA 4LA2A 5T3NA 1O3SA 1O3RA 4OFGA 2IXKA 2OPKA 3HIFA 2VECA 2ZKLA 4HVQA 5J3UA 3FHIB 3QACA 2Y0OA 4OLLA 3OTFA 4I09A 4IEUA 4J1WA 5KHHA 4ZU7A 2CGPA 1NYWA 3FX3A 1O5LA 3BCWA 4FAHA 1DGRA 1I5ZA 2IXCA 3SCHA 2K9ZA 3BALA 1YFWA 4I2OA 2XLFA 1Q43A 2CAUA 4LEJA 3U10A 4CYDA 3H7JA 1I6XA 4AVCA 5KHKA 5FQ0A 4PJYA 1FXZA 4R52A 4ZU4A 5I93A 4XEZA 3E5QA 1NXMA 2Q0AA 4QGMA 1YWKA 3M70A 3QOPA 4META 2BNNA 1CAVB 1CAWA 4HSLA 2XKOA 4XFFA 2F4PA 4I01A 3B02A 2XGXA 5KHJA 2E9QA 2UY8A 2BNOA 1U12A 3L2HA 1O4TA 1WA4A 4XFIA 1X82A 3S7EA 2K0GA 1OI6A 2EAAA 5KHGA 4XFGA 2D93A 2GC0A 2V09A 4MV2A 4AVBA 5I0TA 1CAXB
chains in the Genus database with same CATH superfamily
1GQHA 1PIV3 2VNGA 3CJIA 2XB6C 1O59A 4CXYA 5FUIA 1AXKA 4FPLA 1YNAA 4GJYA 1EUUA 3ACIA 4LKEA 5HXMA 1RHI3 3AFGA 4M3CE 5FPUA 4NPLA 1TNRA 3WEZA 3PUHA 1DQ1A 2W1UA 1ACCA 1VLNA 2D5FA 3KGLA 3E97A 5FK8A 4D7SA 4QM9A 3N9LA 1YHFA 1OURA 4YNIA 4QMAA 3BYWA 3PURA 4RL7A 1QJFA 2HYXA 3LPGA 1HN0A 5JSRA 1FPN3 1Q8QA 4N9IA 1JU4A 4ITCA 3VBFB 1WLDA 3LIHA 1NLSA 1HRI2 1OHFA 2D3PA 2GP3A 4R9AA 1W8UA 3I3MA 3N7KA 2FZ1A 4RHV2 4G4FA 4FTSA 1OUSA 3NW4A 1H6YA 4OI4A 2IXJA 4GB31 1CQ9A 3NJZA 2KR2A 3JBG1 4RA0A 5ABJA 3I4IA 2PLV3 1PK6C 4QPGC 4YGEA 3I3QA 2ORXA 4E2SA 1BEV2 1POQA 1YJKA 4Y1UA 3HEIA 5FP8A 1UZZA 2P17A 3KCXA 4LUMA 2JJ6A 4CU6A 3FLPA 1NCQB 3WDYA 3AP7A 4K21A 2AYHA 3TEXA 1LESA 1QJX1 1U5ZA 1XE8A 1ZNPA 2JIGA 2R041 3IIIA 3SNMA 3T1LA 3ZVXA 4EV0A 4Q0SA 4CRQA 1VMFA 1REFA 1YO8A 3M4FA 1AXYA 1UPIA 1Z7S3 2XWBB 3W9AA 2Q1FA 1LODA 4B29A 2HEVF 4QU2A 4GWNA 5F32A 1QOTA 3I3BA 1H2MA 4RGGA 4ZXKA 2ZZJA 1LHVA 3VHNA 3M3CA 4HFSA 2ARAA 1J3PA 4XUTA 2HLEA 4HONA 4Q4W3 3DUIA 5EJ3A 3IIAA 4LITA 3AYDA 5IK8A 1MS3A 5A3MA 1UIJA 2PMWB 3AM2A 3AKSA 3MI8A 1JW6A 2XL7A 1W39A 3OYWA 1WZXA 4GXLA 4B4PA 1S2KA 1W2TA 2ZMLA 4CUCA 1US2A 3K46A 1A8DA 2VY0A 3AL5A 2VBDA 2ZKNA 3J8F2 3MIBA 3NAPC 4A6SA 4K6BA 3TN92 5LWBA 4JC1A 4I0AA 4MGQA 2YG0A 4BXFA 2FDHA 4HANA 4OQ9A 2AACA 1N1YA 1OLME 4L9BA 5A7SA 4CEWA 5C70A 1LU2A 3C7GA 4I3GA 4BLIA 2E7AA 3PJYA 2RMU3 2VMGA 4AR2A 1GR3A 2BOIA 2HH9A 2JX9A 3N9PA 1MZ6A 3VZLA 2GNTA 5FMBA 1FOD1 1V9U3 1W9SA 1RUD3 3LA7A 4DXTA 1ND2C 4PCRA 1D4M2 1CGPA 4DY5A 1RUG2 2HBTA 2ARBA 1UX6A 1VR3A 3IN9A 1SCRA 4GWMA 4COUA 4KL1A 2XUMA 1ZZBA 1AR61 3GGLA 4CDWC 3FC0A 3POWA 5FXXA 4Y24A 2VUDA 1GBGA 3AP6A 3MV11 5A32B 4OQ8A 1VP6A 3AZYA 3OJBA 4W6WA 5BPXA 3OB8A 1CZSA 2WT1A 4GMP0 1R1ZA 1R091 3T08A 1AYM2 3DKWA 1UOGA 3O1VA 2WLPA 5FKCA 4KBZA 1U5IA 2DVDA 2PAEA 2VG9A 5FYBA 2HWB2 5L7OC 1LOBA 2GC2A 1PHMA 2QQWA 3KLSA 4CDQB 2DU1A 2VCBA 4LPLA 1JOPA 2J1SA 2X5IA 4XJZA 3USUB 4FXGB 4JDOA 4DEQA 2O1QA 3FFQA 2ZMNA 1F35A 3NAPA 1KDKA 5JSOA 3WNMA 4BA6A 4XUNA 3B69A 1UOFA 4Z1VA 1KXGA 5FMDA 1UWWA 5FPVA 4DPNA 2H6BA 4RYDA 3MLLA 2P5BA 4XJAA 3HQXA 1OT5A 4QAWA 3WY6A 2GALA 2TUNA 1AUYA 4XUQA 2W68A 1QH6A 2B8MA 3ZXAC 4KG8A 1XE7A 5JIAA 3M3IA 1YJLA 2RS31 4AI3A 4CEWB 2DUPA 1W6QA 1RUF1 1UX7A 4YW1A 4CDUA 2MEV1 1JZ4A 2FDKA 3RZGA 1BVP1 1OFSA 1C8M2 2HWF2 4QPWA 1HLCA 4J1XA 1OXCA 1QJZA 4XVHA 1JZ5A 4MYEA 1J84A 4QB2A 1WA6X 2BBAA 4L2NA 3LSEA 2ZGTA 3IMMA 1KRIA 1R083 1COV1 2HEWF 4DRVA 4QXBA 2HKXA 1T6BX 5G04L 1QXPA 1ND3A 2BVBA 4MZUA 3VBHA 1JYIA 2DDUA 2KM2A 3OEBA 4WVMB 1KEXA 4AI0A 4ZHNA 1JYTA 3ZSEA 5IVYA 3KT7A 1IS6A 1CAWB 1OD5A 4PDWA 1NKGA 1I9RA 2VOVA 5BXXA 3OPWA 4COYA 4PBOA 2XH6A 3WDWA 1K5MB 4NIIA 1ZX5A 1IPJA 2P4EA 1RVF2 4NOTA 1HJGA 2ZEYA 4QPIB 3PTYA 3ZFFB 3T2PA 1LJ7A 2JECA 2ZGSA 3SQOA 1QJEA 4PHZA 1EYBA 1UW8A 1VBC2 5A3NA 5IWFA 5H9SA 1X9TA 1H1MA 3UKVA 4ASLA 2WNUB 4FQ4A 2XKPA 3WW4A 4Y5SA 3T4HB 3BIWE 2HYKA 2WABA 5FPAA 4AVTA 1RUE3 4DEVA 2OX0A 5C6CA 1NLQA 4F8AA 3ZDSA 3LB9A 5C4WC 2R063 1TME1 2NMOA 5KHIA 2JE8A 1PM4A 4RS5C 5FYIA 4IQPA 1GANA 2HWC1 3K3OA 3LKJA 5DUWA 4YW3A 4Q4X1 1JUHA 5A3PA 4XPVA 2Q30A 1OKOA 2RJKA 4BCUA 1R1A3 5CG8A 3HBZA 1TEIA 1MS9A 5C8WA 1UKRA 3KV6A 2FD8A 2XHNA 3O12A 4C0BA 2NQYA 1F8VA 5FYUA 1BLZA 1XJAA 4N8MA 4EN9B 3WW3A 1CAXA 1H8TB 2JE9A 4DUXA 1DYPA 2D6LX 1WLTA 1EV13 3GZUC 2VCAA 4RN5A 3DGTA 1VMHA 1W6NA 1W8NA 3NVCA 1FPN2 5I91A 2BOJA 2DYCA 3H3UA 1SPPB 2P2KA 2QQJA 1A78A 1YFXA 4Y20A 2QTWB 1W0OA 2JIJA 1H4GA 4AFAA 4XFHA 4M3CB 3ZYHA 4URTA 5FJKA 1QF3A 2YMZA 4WVVA 1S0DA 3LFMA 1IKPA 5GLWA 3VDDC 2OA2A 4DIQA 2PLV2 4LLFA 3SH4A 3POIA 3CEWA 4OI1A 2XVLA 3DPRA 4E2GA 4XZPA 2ZCWA 2GH2A 2ZGPA 3AJZA 1ULEA 3GALA 4QM8A 4ES9A 3WP6A 2WRAA 2VO5A 5FLIA 3WX5A 3J4UH 1H6XA 2VH9A 2DCTA 4HK9A 1KGYA 1BMV1 1X33A 5C4WA 1A6CA 5F2WA 5A6QA 4A7YA 3NJYA 4AVSA 2R0HA 4BWOA 2CGOA 5T5OA 1AX0A 4K3UA 2C9KA 1G7YA 3GBWA 2JDAA 3WQ1A 4ASKA 3AXDA 1GU3A 3BPZA 4R9DA 4A2UA 1VBB3 4OUEA 2D44A 2IFWA 1RUI1 2VOTA 5C9AC 1W6OA 4GQ7A 1XNDA 2WS93 2Y34A 4IEVA 1QJY1 1V6IA 2SBAA 2VNOA 2PQSA 4XHXA 3H42B 5C8CA 2ZX3A 5LRRA 4URAA 2WN3A 2MHFA 4JRAA 5A1AA 2AC1A 3WG4A 1VIWB 2FCVA 2J42A 2XVGA 3LEIA 3NV2A 4Y5TA 3AMMA 3AMQA 4D6SA 2O0OA 1VRH3 3RDIA 3ZDVA 3AZXA 1GLHA 5F37A 1UYXA 2X10A 2ZA9A 1PO21 2J1RA 1AHSA 4XCAA 4HMZA 3ZPYA 3VDDA 1ZBA3 1HIXA 1UY0A 1V00A 4QX8A 1SFPA 1FAYA 5AVAA 1UY2A 1CPMA 1G9FA 4Y20B 5FY4A 4GWIA 3NRUA 1OA3A 4PIYA 1AX1A 5F3EA 2OYZA 1V9U2 2UY9A 2W1QA 1RUD2 3IM0A 2V4VA 3SLIA 1ZA7A 4Y4YA 5T5PA 5C7GA 3KS7A 4JKMA 3IPVA 4GB32 1ULOA 4FPJA 4CCLA 4OUSA 5LBFA 2ZTNA 3MLJA 4OHXA 3DPRB 4A45A 5IATA 5GLVA 3RMXA 4Q29A 1JN2P 3PUSA 4PF5A 1F4HA 3AKRA 4LQRA 3I2HA 3WQ7A 3ITQA 4MGTA 2OXBA 3K51A 5DAWA 3U11A 4B1MA 3AC0A 1ODNA 2JB8A 1DCSA 1QJX2 2R042 2Y6KA 3FLRA 3QLQA 3SC7X 1R64A 1ULGA 3NSTA 2WYFA 3J9SA 3VBSA 5FY7A 4B7KA 3N4MA 5DZGA 4RQPC 4AL9A 4COVA 1W8WA 4YM2A 4JX0A 4DXZA 4NWWA 4GWJA 3OD4A 3N9MA 2I07B 1GOHA 1OH3A 2VUAA 3VD3A 1C5IA 5I0SA 4LTAA 3C2UA 4D69A 3IBMA 3PVOA 2W91A 3ZPOA 3ELNA 3GBFA 3KMHA 2A3YA 2EF6A 2LROA 1N1SA 4CCNA 5C8CB 2XONA 5ISLA 3NL1A 2RDNA 3WCSA 3VD4A 5FRAA 4ASMB 3FUOA 4CP2A 1J1LA 3H8UA 3MF9A 3ORJA 5EHDA 3G7DA 2BVVA 3H3ZA 3DV8A 1APNA 1EP0A 1DIWA 1DF0A 5ACA1 1IS3A 4NHMA 3T2TA 4BQ1A 1RC6A 5K0UB 1AR91 1E57A 3WD5A 4CP9B 5IVCA 2EIGA 4XJ9A 4FPGA 1HB2A 3O7OA 4P02B 4OHZA 2VQ0A 4OCTA 3SCFA 3THPA 5IVBA 5KXBA 1O3SA 2DTWA 1REDA 1H2KA 4PQ9A 3B9IA 5T54A 1KDMA 2WINB 5FOBB 2UU8A 3OBTA 3QACA 2Y64A 2Y0OA 2ZABA 3D4KA 4JDNA 1N3QA 1R082 2WZR1 1IQAA 2RS11 2WNVA 1OF3A 4I09A 3IPVB 1FOD2 4IEUA 3S30A 4BXSV 2RDRA 3B01A 4ZU7A 1FATA 2HWD3 2B4KA 1O5LA 3LDRA 4FAHA 4NIAA 5LA9A 2P3JA 1I5ZA 3MIEA 2IXCA 3ZKYA 3ECQA 4O65A 5FZ9A 3ZXKA 3UGHA 4R9CA 2YFZA 1HRI3 3BN6A 1YFWA 5IW0A 1W0NA 4AFBA 3T0AA 2HWE1 2ILMA 4LEJA 4CYDA 1YXWA 1ZRIA 1LEMA 3VBUB 2JD4A 4OUMA 3QBQA 5KXDA 1HRV1 1R092 4H7MA 4MO3M 4QX1A 4UI9L 3VZJA 4O61A 3VBOC 3AKTA 1LGBA 1GSLA 1PVC3 3QH7A 2G19A 4PJYA 5FZGA 1BEV3 4UW5A 4JHZA 3T2OA 5BNNC 4IV3B 4LKFA 4P5HA 4IE4A 4WM8C 4GMP3 3T3YA 1D0GA 1EAH3 1H9WA 1WMDA 2B45X 2ZGOA 3AMHA 3M70A 4LIUA 1SDWA 3ILRA 5F3IA 4KH9A 4GALA 1UZ0A 4JKKA 2F4PA 4I01A 3PJQA 3PU3A 5EYYA 5FXWA 3TOJA 4MVTA 2D3RA 1WLCA 2ADDA 3WVJA 1SLCA 1WWYA 2E9QA 2UY8A 5HCBA 4U36A 5DDJ3 1EPWA 1BBT1 5A1LA 1X82A 4QB1A 4W6YA 5GLUA 3S7EA 3S5QA 1AJKA 3POFA 1FV2A 5F5IA 4XE9A 1IZ3A 5F5CA 4XXPA 2BQPA 1HKDA 4K40A 5K9YA 3F95A 2D93A 4MV2A 4DNYA 4CEYA 2RS32 3O1PA 1W8TA 3S57A 1RUF2 1HV1A 2Y38A 5GZEA 2MEV2 3L9JT 4AEDC 4FPYA 1SHWB 4YSFA 1EV12 3FHAA 4YW7A 5FZMA 1N3OA 3ZR6A 3LCPA 4K9SA 4INDA 2R7EB 3DYMA 5A3WA 2RJLA 4AHYA 5EJZB 2E33A 1GWKA 3J8F3 1F5JA 3R4DB 1VAMA 4Q4Y1 5HCAA 5IAXA 1JZ8A 3I49A 3AVRA 3VD9A 1UAIA 2WWJA 1Y43B 3I3DA 1DGLA 5EYXA 4AQ2A 3KF5A 4BQWA 4Y1XA 2XWJB 3W21A 5A33B 3WNLA 4AK3A 5DQ0A 2Q8OA 1YIPA 2A6ZA 4LR4A 2A75A 4QKBA 3PMSA 3ZFGC 1FX5A 4WM8A 4O9EA 4KWUA 4FFGA 5JLVA 2VZ1A 1G6NA 3ETPA 5A3LA 5LY1A 2C1FA 4DO0A 3EQEA 1D4M3 2VQAA 4UYBA 1RUG3 2PYTA 1ASJ1 4PBPA 3ZOIA 2CWMA 3Q8BA 1J59A 2ATFA 4UAPA 3V56A 4OI0A 2RR13 1CX1A 2DCYA 2VPVA 3BGAA 5FAXA 3E6CC 1VBB2 3VDBA 4EROA 5JZGB 4TN7A 4A4AA 2WR9A 1CD3G 5K4LA 4MHRA 4KNCA 1LEDA 1AYN1 3CF6E 2VZPA 1W6PB 4XC9A 4V2WA 1CN1A 2PHFA 4QQ2A 4LO4B 1K42A 5FYVA 3UETA 1FMD1 2PTMA 3U4XA 3KSCA 3EHKA 3VGIA 1JZ6A 4PQQA 3MICA 4KU8A 4A44A 2HWB3 5CIRA 3WNNA 2VGDA 5A7OA 1LR5A 4K8RB 4Q0PA 4WZCA 1N47A 4UFMA 4DRRA 2A71A 1FT9A 1WLWA 3VBFC 3OGRA 3E5XA 3I7DA 4QX0A 1S1AA 2VC9A 2DBIA 3SITA 2BP6A 5C5TA 4B4QA 2O8QA 2PAKA 3AZVA 1B35C 5FFOC 1SQ4A 4TLFA 1W28A 2IZWA 3M2MA 2Q4SA 1RUC1 4EZHA 4YZ5A 3OEAA 5J36A 3DN7A 3S6PA 2FDGA 3ZIWA 3JQXA 2CYFA 1OQDA 3PUIA 2G9ZA 4N53B 4S2HA 3NV1A 4LHLA 3ZFGA 1VE0A 2PHRA 3MIGA 2YB7A 3P3NA 4D6RA 2JKXA 1Q8VA 3LF7A 1NCQC 2GC3A 4E9KA 2QE3A 1DYKA 3PDQA 2R49A 4LULA 5L9RA 2VTXA 2HWF3 2VW2A 2VMCA 2WO1A 3OY8A 4Q27A 4FVVA 2EXKA 2Y60A 1NA1B 4YVWB 4XTPA 5H9RA 4WM7C 4R8HA 1CESA 2JG9C 4KMQA 4YGDA 5FZKA 5F1RA 3UJQA 4FI9A 5ERLA 4ET7A 5JPMB 2JG8A 1NCRA 2R071 3HBKA 3MW2A 1CJPA 4K7JA 4C91A 2XBO1 5C3RA 3S5AA 1VBD3 4Q8LA 1JOJA 5DZFA 5L73A 3S7IA 2F6BA 4GA9A 1UYZA 1S0EA 2VMEA 5D1IA 1NUKA 1QXRA 3M3EA 2RHPA 2WFF1 4RGAA 2BFUS 1HXS1 2OIIA 4KBBA 1FI2A 2P3IA 3CHXA 4W4ZA 4YPJA 2OPWA 3KQ4B 4ZZ5A 1RVF3 3WDUA 5HV0A 2Z69A 4LLOA 3HNBM 1AR71 2BJSA 2RM23 3HD8B 1JZ3A 4I0BA 2CNAA 1F2NA 5BNOC 2ZXQA 1F15A 3K75B 3F2ZA 2QQOA 1C4RA 3HN1A 3JD73 3GBGA 4CU7A 3DCQA 4CUGA 4FP2A 2VQUA 3TEYA 3N9NA 2AGSA 3Q8FA 4Z82A 5T5JA 1SLAA 5FZEA 4IEPA 2XPJA 3POYA 1GV9A 4KWKA 2CAVA 5A3UA 1BK1A 1ZVFA 1LHNA 1OC1A 5CFCA 4YW5A 2VTXJ 1OVPA 3DXTA 4HPKA 4DQAA 3GHMA 1PZ9A 2CSGA 2H0VA 3HPNA 5H9QA 2B5HA 3K4ZA 1XRUA 4JGYA 4CCMA 1Z7S1 1W8FA 2YGLA 5FBZA 5IAVA 3U4SA 3AFKA 4ISQA 1C1FA 3WG3A 5JMCA 5F2SA 3SH5A 3RZJA 1LENA 2P37A 1GQGA 5LA2A 3RZMA 4DMIA 3APBA 4LBQB 1WBFA 1UU4A 3LIGA 4A42A 5JOWA 4GZ9A 3VBRB 4N90A 2C24A 4R9BA 3OUJA 2OUHA 4QKDA 1DBNA 1RXFA 1AR81 1UY1A 2WJSA 4LO7A 4A3XA 1YYNA 4LBNA 3VB9A 5CVRA 3ZSKA 2HWD2 4KGQA 4D94A 1NE6A 3V0AA 2ZHMA 3H8XA 4AYUA 3OSDA 1IQDC 3CL1A 4BDVB 4FPKA 4GH4B 2VZSA 3OGJA 1NE4A 3NKTA 2JG8B 4QXCA 4Y33A 4DFSA 1Y4WA 4KWJA 1MZ5A 4AVAA 4N43A 3KV4A 2FDIA 1W2UA 2ZX1A 5E8AA 4CDQC 3JCIA 4EN6B 2D97A 3I3EA 4TXWA 4MGSA 3NJVA 4P9IA 5FPBA 1PVC2 4R4XA 4TLGA 2RG4A 3U78A 1S2EA 1J58A 3LEGA 5A6YA 2XG3A 3N7LA 1EAH2 4LBKA 1PGL1 4HVOA 4CDXB 4UWDA 1Y9QA 2QZ3A 3FMGA 1BXHA 4E8DA 2JDYA 4M0NA 1W9TA 2OQ7A 4LHKA 1H1AA 2GU9A 3I2JA 1G9AA 4IDZA 2Y0IA 2QQIA 3OUHA 4LO8A 5FLHA 3KQRA 5DDJ2 2YY1A 4G9SB 4HKOA 1UQXA 3J7LA 4J6GA 3QD6A 4I0WB 4ES8A 5I0DA 5C71A 3H1YA 1NZCA 2NLRA 3ZYRA 3WXPA 2A1XA 3J26N 4FTEA 3HMYA 3ZXJA 5FK7A 2JD9A 4OZXA 2V5DA 2GMEA 1Y9MA 3BTAA 1QEXA 4O9GA 1ZZ8A 1AL21 3EXUA 2CU5A 2NYYA 3RVHA 4DS0A 5A6ZA 5CFCB 3CJIB 4HPKB 3NJXA 1CAVA 1PO12 3FBMA 5ACA2 2D98A 2X53S 5DPNA 1AR92 4YG3A 5DXDA 3RJRA 2PHLA 1ZRCA 2DFBA 4D3WA 3VKLA 3IAQA 3RZZA 4QD2A 2Y26A 2A7AA 3WF4A 4XFAA 4PI2A 2YFUA 4RR3C 4HETA 3BTYA 4JKLA 3TBDA 3NMBA 5FZDA 5FDBA 4FCAA 2XOMA 1POV1 2GZWA 2YU2A 2W9XA 2NMNA 5FUNA 4BPZA 1LU1A 3LWCA 3LA3A 4EN7B 2DBNA 5H9PA 5FY5A 3WNKA 4SLIA 2RS12 4BJ0A 1K5MC 2VW0A 3FE5A 1XNKA 1H30A 3V0AB 1IOAA 2QVSB 3KHBA 3HNYM 4HLTA 4O7XA 1RINA 4IEWA 1UY4A 1WCSA 1PK6A 1WKYA 2P34A 4QPIC 4QPGA 3VLBB 3WSOA 2Q8CA 4GKYA 2FHRA 2OKXA 1LOGA 4N43B 4YG0A 2IUWA 4EN0A 3TNQA 4DY3A 5LATA 1PVXA 1LOFC 3AXEA 4LOTA 1W2AX 1W2OA 3W5NA 1D2QA 2WNUC 1JBCA 3GCXA 3PUAA 3BKZA 1WUVA 1FNZA 3G6JB 2E7TA 3T4VA 4HSJA 5ABJB 4GB33 2W1SA 1WBLA 2MNGA 4COZA 4IGOA 1Z78A 3RFRA 5JR2A 3WW2A 1KJLA 5JXJA 2VMFA 4F7ZA 1PMHX 1PX3A 2RR12 4BK5A 3RYRA 4UOJA 4BB3A 4MH0E 4RSUA 3VHPA 1YEWA 3BVCA 3KB5A 1QJX3 2R043 1XC6A 2PHUA 5HCFA 1GP4A 3JZVA 2SLIA 4XFCA 2RVAA 4XIKA 2W52A 4UW6A 5FPZA 3PLQA 1GYKA 3QCWA 5DAXA 3ZN6A 2WNEA 4NHKA 2TEPA 4FBFA 1BBT2 4ZZ8A 3ZXLA 4GULA 3SXWA 5FPLA 1H8TC 3IDCB 3SMHA 5A1FA 5F6KA 1UXZA 3CQOA 3IZOA 3SKVA 2GH8A 3UKNA 1OF4A 1XQNA 1TZOA 5D2AA 5FZBA 2G9FA 5FZOA 1S55A 4JVAA 4C90A 3U37A 1O7FA 4ARXA 4QKNA 1ZREA 3KF3A 4NRMA 3OYWB 4XUOA 4B7EA 4LIVA 1XBFA 1U0AA 4D7TA 3ABZA 3AYEA 1RUH1 3VD5A 4NN0A 5F9TA 3OBRA 1I3HA 3O1OA 5BUVA 5K7PA 3NNMA 4XAEA 3W20A 4D8MA 4ZKTB 4LO5B 5LRSA 1Q5OA 1JYNA 3AMPA 3BU0A 2WC2A 1D0HA 2TBVA 1VBE1 1RXGA 4L0PA 1ND2A 4LK6A 4W65A 5E1RA 4Z8BA 1V0AA 5IK5A 4LT5A 2CL2A 2A73B 1H4HA 2R061 1LECA 1PK6B 2E26A 5JI7A 1M06G 3EB7A 4TTGA 2YBPA 5DUXA 5FP3A 1ULFA 2BERA 4CDWA 2PAMA 4QX3A 2BU9A 2N7GA 3Q8CA 4FSJA 2QQNA 3U0ZA 4X8PA 1VMJA 1J1TA 1NX9A 3ZXGA 5IYYA 4QHOA 5FPXA 4UW3A 1FOD3 4HBNA 5I8TA 4OI2A 2IXHA 1VBD2 2OZ6A 3AJYA 3D6EA 3HOBA 1H8VA 2VQTA 5EFUA 5LBBA 1LULA 4HN0A 2YC4A 1QHDA 1QQP1 2XJUA 2P6HA 1UL9A 1JYWA 1AR63 1UD1A 2EAKA 5L7OA 2B46X 1I1EA 4XDQA 4AFMA 4PLOA 1ZBE1 1O4YA 4XYXA 3WP4A 4PLMA 2BGPA 2WQ8A 3WF0A 4GJZA 2ORZA 1R093 3K48A 2RM22 4JAAA 4JGZC 5L9BA 4AQ6A 5BNPC 3ZN6B 4F83A 3VHRA 1MS0A 2R1BA 1U5XA 1MR5A 2D6PA 2XXZA 3JD72 3M7AA 5DUVA 5JDBA 3D8CA 2X5IB 4AI1A 3N35A 3ZIXA 5CFDC 1TE1B 2XVKA 2VXJA 5IFPA 3WOGA 3NAPB 3NWKA 3LDBA 3MYXA 3H50A 4M00A 5AC91 3ZO0B 1X50A 2DWRA 5DABA 5FZOB 3ZSLA 1LAJA 4NIGA 2WSUA 1JYCA 2ENRA 2VMDA 2XQRA 4RGKA 1ZZ7A 3B3QE 1RB8G 1QU0A 3B5LB 4QPYA 3KM5A 1AXZA 3UGGA 1IG0A 3ZFEC 3EYPA 5FMOS 4XJ8A 3VKMA 3C7HA 1RUC2 3TEZA 2VBBA 2W46A 5FYHA 3WG1A 5JOXA 1GZWA 1W6QB 5FZ7A 3M3QA 4BLJA 2WQZC 3BI3A 1YQ6A 4CDUB 4Z2WA 5FWEA 1ENRA 3CO2A 2RS33 1IKQA 4CCCA 1UIKA 1RUF3 1L7QA 2MEV3 1PZ8A 5CBLA 3I2DA 4CDWB 1PGSA 5GZGA 4OFGA 3JQWA 4AI2A 2Z79A 4BOWA 2GSYA 2OPKA 4L99A 4YWAA 3HIFA 2ZKLA 4JZRA 4KI5M 1OSGA 3FHIB 2YGMA 3AP5A 2JB4A 4BK4A 1ND3B 1PNGA 4H14A 3PVEA 1VRH1 3VBHB 5TSWA 4J1WA 2DURA 1LNSA 2P3YA 2L9LA 2OVUA 4JGZA 3UL2A 4PDWB 4E8CA 5BNPA 3O1TA 4AZZA 5F7UA 4CVUA 1HB4A 1OOPC 5GZDA 5CA6A 5L7OB 2A5ZA 5D8AC 4A6OA 1F31A 5FV3A 3SCHA 2VUJA 5IK7A 4EQVA 3BALA 4I2OA 3VV1A 4A3ZA 1Q43A 3AP9A 1GQPA 3ZKUA 1VRBA 1XNCA 1MQTC 1XSQA 4PLNA 5JXGA 2O8OA 1RUNA 1A8MA 1AR72 2ARXA 3WZ1A 2YU1A 5FQ0A 3THTA 4R52A 4RFT0 3B00A 4BM8A 5K0UC 2TNFA 4RS5A 1W03A 2NN8A 1NXMA 2FDJA 2Q0AA 3ZFEA 2ZGLA 4K1YA 4QGMA 4BMBA 3CNAA 3QOPA 4JRLA 2WSVA 4XBNA 3WUDA 2XKOA 5FY8A 1BYHA 3B02A 5JWPA 3GCWA 2XGXA 4YW6A 4Q8KA 3GM8A 1RUJ1 4H3WA 2ZGMA 5KHJA 2BNOA 1U12A 4NRQA 1O4TA 4TWTA 3VZNA 3LSDA 1HQLA 4AAPA 1G9BA 1GZWB 3KT1A 1MEC1 2D6MA 2V73A 4XFGA 1OLRA 2F4LA 1RMU1 4Q1RA 5FY1A 1BVVA 2I74A 1QNWA 1VBA1 5F6LB 5I0TA 4B3NA 1CAXB 4NIHA 4QU1A 3UNPA 5HBAA 3FFZA 1W3XA 1W6NB 3VBUC 3POBA 4RD7A 5A80A 1CZVA 3GHNA 2GMPA 2DU0A 1OOPA 2QDRA 4H7LA 1DLLA 5CZKA 2ZHKA 4C1XA 3C7EA 1HB3A 1LOEA 1UYPA 3NNGA 3NNFA 4IV3C 1IPKA 5EV7A 3W59A 1XYPA 2X05A 5EPAA 3ON7A 4CCJA 4IV1C 1E5IA 4GKXA 3MPBA 3M1HA 1E5SA 4FPHA 4LA3A 5E6HA 3WDTA 1X7NA 1UPSA 2Z4FA 3X29B 3HT1A 1ALYA 3N7JA 3JBG2 4AW7A 1W99A 1KJRA 4DB5A 3PIJA 5LEJA 1RUOA 2ZX0A 3KVBA 3VKOA 4P9LA 1KQRA 3BTXA 4LO6B 4XF4A 2QKDA 3MV01 4QX7A 2XHKA 5F3CA 1PGL2 4UXAA 3MW4A 2UURA 3AP4A 4EYUA 3BIEA 2VTFA 5C4WB 1MZEA 1X8EA 5C9AA 1RIRA 2JICA 4M3CF 4ZXEA 3TEWA 2A6XA 4QQLA 3BU7A 1DQ6A 4PF1A 1FV3A 3KT4A 4Q4V1 4PT6A 4LBJA 4E27A 5JAXA 5AFEA 1F5FA 4X6QB 5JIUA 3AZWA 1NG0A 1GNYA 1VAVA 2BGOA 3N3HA 1W6OB 2JDZA 1JS9A 4LBMA 5ANNA 2UWBA 4X8NA 3U1XA 4CZSA 5CISA 1RJ7A 3E6DA 4RHV1 3RNSA 2EIEA 1AL22 1NOVA 4AG4A 4WVWA 5F8PA 3DEMA 3Q9OA 5IFTA 1LHWA 4ZS2A 4Y5Z0 1SFNA 5IK4A 3WINE 4IUGA 5FXZA 4FPCA 1I5PA 1KITA 3BB6A 4IEQA 4FPOB 2C9AA 2IFRA 3KD4A 4AHXA 2AUYA 1AZDA 3EMRA 2CTVA 4Z92B 4LHSA 3VDDB 1BK0A 5LZ6A 4YW2A 4GIQA 1SBDA 1JHNA 4ISRA 4FFHA 3ZMNA 4YVSC 2QQUA 2W92A 2DFCA 2ERFA 2J7MA 3OGVA 1OD3A 5EJ1B 4BQXA 1DYOA 3R4UA 2QNKA 1FYUA 1ZRRA 1GP5A 4G3YC 4BH9A 2OT7A 4AHZA 1SMVA 4DINB 1UMHA 5FZCA 5LK5A 2XJSA 5JZGC 1QJU1 1JI6A 2IWGB 2Y6JA 2NM1A 4RQPA 2E6VA 4P9XA 2BYVE 1ULCA 3WHTA 4BQ2A 4IE0A 4Q5OA 4CCEA 1UZVA 2ZZQA 2WDBA 1AR62 3ES1A 5F39A 1OPMA 3WDXA 3H9AA 5C9AB 3SHRA 4OHYA 3RGBA 2D3SA 4QHBA 3LZZA 3ME2A 1JODA 2RJ2A 3J8F1 2V4AA 3VBSB 4FTBA 4P5YA 2RV9A 1TMF1 2W47A 3TN91 2YC2A 4IEXA 3H8OA 4ZY9A 1ULDA 3VZMA 3FUQA 1HW5A 4XXAA 1SLLA 4OHWA 2GN3A 5I0RA 2WYSA 2NZ9A 3FJSA 2E53A 3L2YA 4FOYA 4BIOA 4E4SA 1LCLA 1W8HA 1BCXA 2W95A 1GMMA 3SCGA 3I2IA 4JTNA 2NP0A 2WUHA 4ORFA 4LKDA 4FPEA 1GOGA 2B39A 2ZOEB 1ODMA 4N53C 1UU6A 4AWDA 3PMEA 1D4M1 2VE1A 2WWSA 4IXLA 3RRDA 4BHPA 4YARA 1SEFA 3K4AA 2FBEA 1WW4A 2ZGUA 4HVRA 4YZ2A 1SLTA 3WV6A 3D0SA 3AB0A 1RUH2 2G9GA 5IVVA 1DQ0A 3CU7A 2Q1MA 4YVWC 5JSPA 4EE2A 5J7MA 2R32A 4X6RB 3O0VA 1G9CA 2DVFA 1W2NA 1XNTA 1PO13 3PTRB 4QDSA 5ACA3 1WW5A 3LOIA 4CUBA 1AR93 1VBE2 1POV0 2UWCA 4XDOA 1IG3A 2QBXA 4MXWA 1AYM1 4AGVA 4BZ4A 1CAUA 4DUVA 1N1VA 1WCDJ 3PL0A 4K1ZA 3I2GA 1X36A 5FZ4A 5J96B 2PA7A 3T1MA 2C26A 4CP0A 2C6SA 2XR4A 3OPZA 2VVEA 5FZ0A 1YLLA 2WNVB 3GF6A 4YM1A 3UJOA 3FZ3A 1COV2 2WZR3 2RS13 4ZU5A 3WT3A 2Q1ZB 1SBFA 1L7LA 2OQ6A 1EPZA 2RDSA 4LUKA 3TAYA 5JXHA 1V6OA 2FDFA 3KWVA 4WZFA 5T50A 2AREA 1DGRN 2RS51 3D82A 5EQUA 3VBOA 3B9CA 1V6JA 3VZKA 4GD4A 1QQP2 2ZAHA 5IVEA 5BNNA 4MADA 3VL9A 2VBPA 1RGSA 2Y6HA 1O3TA 1XU2A 1XNAA 3JXSA 5FKBA 1ST8A 2AEYA 2HWE3 1VJ2A 2R1DA 2VZRA 4NWVA 1RL3A 2B42B 4UBHA 2GAUA 3MDPA 5CAZA 4P9WA 2PHWA 3LE0A 3O0WA 3OD0A 5LW9A 1X8MA 2VMIA 3CMGA 5EP9A 1C8M1 2ADEA 1DGWA 1HDKA 1YQCA 2O14A 3RMYA 3HVDA 1H0BA 2WA4A 3ACHA 1ZA4A 5BNQA 2QCSB 4XHBA 4DOUA 5AC92 5IHRA 3WP3A 4BIFA 2FCUA 1O3QA 5C5UA 3ASIA 3IDBB 4L92A 1O8PA 3RQ0A 3WCRA 1TME2 4FO9A 1SDDB 4AEDA 3VBRC 5FWJA 3KCCA 2GDFA 4Q0VA 4RFRB 4D6QA 5JOYA 1BBT3 2GC1A 2QZ2A 2HWC2 1TQ5A 3LFIA 4UBGA 3T30A 4Q4X2 3A23A 3TWIA 4CP1A 4CEYB 3WW1A 5BV6A 1NAEA 1RTVA 5GLTA 3ZX7A 2JXAA 2YDEA 3Q8AA 2Z42A 4UFKA 2DCJA 4HN1A 3UK9A 2WKKA 2XLGA 4YZ4A 2QFEA 2FQPA 4Y4RA 3K77A 3ZLIA 2GP5A 3MO4A 1VBC1 3JU9A 1U5YA 3A7QA 5DZEA 3E6BA 4OULA 2QQLA 5DAVA 4HK8A 3VDAA 1YI7A 2VOXA 4Q4Y3 2IXIA 5LASA 1L7RA 1XNBA 3KGZA 4CDXC 3I8TA 2YPJA 4QHZA 1QOSA 5FO7B 3VBOB 5FIXA 1XSRA 4ATFA 3O5SA 1XYOA 2LUWA 1W6MA 1VPHA 3LAGA 1PIV1 4EWDA 3V0BA 3C7FA 3IT8A 4B1LA 2EXJA 4HG6B 4YYOA 1OLQA 2W0XA 4OMDA 4V1PA 5BNNB 1LGCA 2W5FA 1C1LA 4WM8B 1RHI1 1XXNA 3CLPA 4BISA 2VR4A 3DYPA 4CTEA 1BQPA 4J25A 4FFFA 4YZ3A 4AEKA 1Q8OA 1Y7BA 4C0HA 3IB3A 3MW3A 4NHLA 1K12A 1N1TA 2ET7A 4PIZA 2AH2A 1BMV2 4UT5A 1S0IA 1SZBA 3O1MA 1ASJ3 1C5HA 1O8SA 3CJIC 2BW8A 3GZEA 3HJRA 2BPA2 4HOOA 4N9HA 1JZ2A 3A22A 5CNAA 5T52A 3CZUA 4FQZA 4ONUA 3K3NA 2UWAA 3ZSMA 1FPN1 1OQ1A 2ZGRA 5J48A 2Y33A 4JDMA 4ARYA 2C5DA 3RJ2X 1RUI2 4AXOA 1AYN3 3VBFA 1FNYA 2K2SA 3CIHA 1QDOA 2FMDA 3HNMA 3RYPA 2J1UA 1QJY2 1OFNA 5ANQA 5LY2A 1FMD3 1RUJ2 1B35A 3CBNA 2PLV1 5GZCA 5A3OA 3T0DA 1KS4A 3BOPA 5CKMA 2CV6A 4LXLA 3VKFC 3UESA 2Q5TA 4IEYA 2QUOA 2ZGNA 3RS6A 3RG0A 1RMU2 2WL1A 3THCA 2XDVA 1O6UA 1PO22 3U07A 3WF1A 4XQ4A 5BYNA 1NCQA 2X8KA 3B93A 4Q0QA 3R05A 2WO2A 4WVZA 4ATEA 4LBQD 3U75A 5LCWL 4TZDA 3POSA 5DAPA 1Q3EA 5ABJC 3K2OA 2ET1A 5B4NA 3KV5A 4LORA 1RUC3 3O14A 4WM7A 4IE5A 2Q8EA 3ZFGB 2JG9A 1W9YA 1W05A 2HEYF 3ZYJB 3FN9A 1VB4A 5FZAA 5J98B 3OG2A 4Q4W1 2VCCA 5A3TA 5GZFA 3KZ4C 3OY8B 2PHDA 5A6XA 2VW1A 4JQTA 4Y1ZA 5HXVA 4CPBD 1ZRFA 5I8SA 3DL3A 4M0HA 2Z5WA 3ES4A 5M0TA 2BUKA 1HQNA 3CKHA 4HZFA 2A3XA 3P5BA 1NCRB 3MUZ1 4LKSA 1AX2A 3RI9A 1OPOA 3WF2A 2G4IA 4IERA 5FJHA 2W3JA 4NHYA 5GALA 2CDPA 3URFA 1S0GA 2R073 4E4ZA 3MFCA 2XBO3 1DU3D 3I97A 3LEKA 4ZS3A 5GLZA 1J3RA 2IXLA 5BNOA 3TB0A 5FO9B 2J22A 3P6BA 1P8JA 3A0NA 2C4XA 2RMU1 3MIHA 4Q4V2 2VD7A 2BFUL 3SEEA 2YXSA 3AK0A 5LA1A 2WFF3 4HT1T 2DV9A 1HXS3 1MS4A 5EIYB 4Q0UA 4QQOA 4XF1A 1T6GC 4QKFA 4W6XA 4KGGA 3VL8A 3WR0A 1V9U1 2AENA 3MIDA 2BGCA 1RUD1 3AL6A 3RYKA 5KR7A 1AR73 3EBRA 2QDNA 3W5MA 4CEWC 1B35B 2R16A 2D6NA 2GN7A 4I02A 3ROUA 1H1IA 3USSA 1AVBA 3INAA 2J1EA 1STMA 3WNPA 3VKNA 3OCPA 2XJRA 2BTVC 2LM3A 2OZJA 4XBQA 4AVVA 1PMIA 4XURA 4IE6A 4Y22A 3O1SA 4YLZA 5L36A 2WWUA 5A32A 1D7PM 1X9PA 4FT8A 2X09A 5FREA 5CB7A 4JGYB 5E88A 3MEPA 5J09A 3VUOA 2BZDA 5LK7B 3OBZA 4WM7B 3J7MA 2VZVA 2JG9B 5C3PA 1LHOA 1S0CA 4NHXA 1JOBA 4NMIA 5F5AA 4WBBA 2BWAA 3NV3A 1ZZ9A 5FYCA 4CCDA 2W08A 4CDQA 1UMZA 2WZR2 1O4ZA 4XTMA 4MLOA 1DZRA 1AR83 3USUA 3PVNA 4LJHA 1QJU2 2JDMA 1DHKB 2XUEA 3ACLA 3PIGA 2JDKA 3LEMA 4LA2A 3ZFFC 4LE3A 1LTEA 2B7YA 1QH7A 2ZHLA 4L8QA 4N7IA 2CDOA 4FPFA 5SV8A 4XABA 4HVQA 1SG3A 1WCQA 3CZJA 4CSWA 2X5IC 3A0KA 5DG1A 2HWE2 4OLLA 2LW8A 4QT6A 1ONAA 5L9VA 4MG2A 5F3GA 1TMF2 1NQJA 2EXHA 1WCKA 3N36A 1GOFA 1HRV2 3MF6A 5KHHA 1Y9GA 3JBG3 5BNOB 2CGPA 1GNZA 3FX3A 4KG0A 4XBLA 5C33A 1XOYA 3OPTA 1DGRA 3FHQA 5G05L 3ZYGA 1DP0A 1OVSA 1QNYA 1KS5A 1US3A 3ZN4A 5IVFA 1JYVA 3RZHA 1KFXL 2PELA 2CAUA 2ZMKA 1IS4A 4YGCA 1R081 2JENA 1GUIA 2XJQA 2ARCA 4CU8A 1IGOA 4AVCA 1GWMA 4CDUC 4IGPA 1H9PA 2ZX2A 5C3SA 4ZU4A 5I93A 5C3QA 5FZ3A 3UV9A 5CKNA 3E5QA 3MPPG 1V6LA 4RR3A 1HV0A 4WVMA 2AR6A 1TNFA 4XIOA 2VZTA 1AF9A 2E7QA 4Y22B 4META 2VUCA 1E5HA 1CAVB 1CAWA 3E1F1 5KC5A 3UYJA 1AL23 2IVJA 4QQPA 3ZMOA 4OZOA 1K5MA 1YC61 1ND3C 2WBKA 3VBHC 3ZXDA 1WA4A 2EIDA 1YQ8A 3H3LA 1DQ2A 1YQ2A 1HN1A 4QPIA 3VZOA 3ZFFA 4H55A 4PDWC 1OI6A 4YZ1A 5HCHA 1YRZA 2QQMA 3SKJE 1W04A 3JB8A 1POV3 1RJ8A 4Q4Y2 1ENXA 5HPOA 1LOFA 1RUE1 1NZIA 2VVDA 2Y6FA 1CIYA 2LALA 2DF7A 2V09A 2WNUA 5A7PA 2ZEWA 3MIFA 4QPGB 4MXVA 1UN1A 5JVVA 1M4WA 1LRHA 2RS52 1L3JA 3NKGA 1JZ7A 2VXRA 1JU3A 1S0JA 1JUIA 1PX4A 4JHTA 1OA2A 1MVEA 2A6WA 4XOGA 1B09A 1URXA 4IESA 5A7WA 1G9DA 1R1A1 4MGYE 4ZPIA 4BQ4A 1W9FA 4CE8A 4SBVA 3WHUA 1ASJ2 1WMXA 2RE9A 3OGSA 4S2GA 4AI9A 2YZ4A 1S2BA 4Z07A 1EV11 2BBVA 4AAXA 4HKWA 1W8ZA 2BWCA 4P9YA 2VNVA 4I3PA 1DLCA 4JTOA 4XF3A 3ST7A 1H8TA 3VDCA 4YW4A 4AQTA 1ZZ6A 4QDQA 1AYN2 1SPPA 4XQDA 1UU5A 2W39A 2IC1A 4R4ZA 2H6CA 4AHWA 2A6YA 3LQCA 2VL4A 1FMD2 1NT0A 1WD4A 1ZM1A 4IEZA 5A7NA 3NO8A 4RR3B 2KD7A 1NXD1 2D6OX 2V72A 2BRTA 3LGRA 2ZHNA 4IGQA 4M3CA 4XAAA 1H2LA 1OMIA 2PHTA 4PIXA 1G86A 3WQBA 2VZUA 3ZSJA 2KXLA 1QWRA 2R0FA 3HWJA 4AF9A 1EUTA 5LEKA 1N3PA 5JCTA 1IHMA 3POGA 4AFCA 3RI8A 2VOWA 1W9WA 2DCZA 3MBWA 2PFWA 5FTTC 1YCIA 5FXVA 1Q56A 2A6VA 4FOWA 2FZ2A 3CDZB 3MLKA 1Z0HA 3NV4A 1RUH3 1QY4A 1SLIA 4QX2A 3DPRC 4MOAA 1MACA 3PHMA 1IPSA 2HBUA 2Y6LA 1VBB1 5IJRA 1F9KA 3ZYPA 5CYYA 1ND2B 5JOZA 5JR7B 2WZ8A 4A7ZA 2WS91 3AKQA 2GNDA 3LD8A 1VBE3 3P1IA 5CEHA 1OH4A 5FZ8A 4HL0A 3QH6A 2FMYA 2J1VA 1QMJA 2QQVA 5FYMA 3MGUA 2D5HA 1PIV2 4KU7A 4OHVA 3ZM8A 2RDQA 5B2GB 5APAA 4XMIA 5SV5A 5CADA 1JH5A 2VZOA 1HB1A 1PGW1 1RHI2 1ZZCA 5A7WB 4NRPA 4YG6A 2R6QA 4NPMA 4C1WA 2VCMA 3KV9A 2DVBA 1GFF2 1COV3 1C3HA 2R072 2JEMA 4OVEA 1H2NA 2XBO2 4AGRA 2OW4A 2WA3A 1Y3TA 3KCYA 5KXCA 4YM3A 2ZX4A 1QQP3 1ZBA1 5C8CC 4NIDA 1MVQA 2QQKA 3TNPB 2EVXA 2WFF2 3DECA 5CFDA 1HXS2 3JUUA 3WNOA 1LHUA 3Q8EA 1ULPA 4P14A 5T55A 1ZBE3 4DXRA 2Z2SB 4YM0A 1XE0A 1Q8PA 1BKZA 3D0JA 2X29A 3N7MA 5FLJA 3MFAA 4IETA 3VD7A 2VZQA 5K8SA 5J37A 5DUUA 5I8YA 1JMUB 1KFUL 4CUAA 1V70A 1CJDA 2D43A 4MSVA 2YPDA 1SFYA 1NY71 2P6CA 3ZN5A 4AI8A 2WZEA 5AC93 3IDEA 2I2SA 1OLMA 4XACA 4Y1YA 3VN4A 1XYNA 2LRPA 2WNOA 4BQ5A 3T2QA 3AX4A 3PVBB 5GKAC 1TME3 1SBEA 5FMOL 2HWC3 3PUQA 4MGZE 1Z7S2 3WUCA 3A21A 1DG6A 4Q4X3 1WMEA 2DTYA 3CJXA 1GZCA 5FY9A 5JPNB 2W87A 2W1WA 3J7NA 2GNBA 1GICA 3B94A 4H2AA 4CXWA 4Q4W2 3IDAA 5FYSA 2AZ5A 4BMEA 3H7YA 3V65A 3O1RA 1O5UA 1AR82 3J7HA 2KA3A 3VBSC 1PZ7A 1J3QA 4XMAA 2UYBA 1DQ5A 3I2KA 3NNLA 2WT0A 2WT2A 5FYTA 4Y1VA 1QOOA 5D8AA 1GZTA 1MS8A 1TG7A 5FCCA 3RPQA 2F17A 1WGPA 2EALA 4EWEA 3ENRA 3O1UA 3AVSA 3GXUA 3N9QA 4K20A 4JGZB 2JDNA 5BNPB 1G8WA 1MQTA 2Y8KA 4NO4A 3LA2A 5EZWA 2D40A 1WW6A 2UYAA 2VU9A 4PI0A 2YYOA 5FUPA 4E4DX 3HR9A 5K0UA 3RZKA 1UY3A 4DXSA 2VOKA 4UW4A 4Y3OA 3RWNA 1MPXA 4B4RA 2RMU2 4CP9A 5CFDB 2WZPP 1IS5A 1REEA 5FY0A 2HJIA 3AZZA 2E31A 1SLBA 4XILA 1F4AA 5HI0A 4MGIE 3R4SA 3BPSA 3OGGA 3SEPA 5FQ0B 4AGGA 5L19A 3LPFA 4RS5B 4QQHA 3UT0A 1O91A 5E16A 3ZFEB 2HWD1 1CONA 2BDRA 2VNRA 3BOWA 3FBYA 3P3PA 4OMCA 4YRDA 1QXJA 5IVJA 1W06A 3I54A 3R0RA 4XFBA 5DG2A 4BU2A 1HRI1 1RUI3 1WD3A 3ATGA 5JUVA 1SCSA 1C8NA 3GJAA 2VULA 2WNVC 2VM9A 2PN5A 2DVGA 2DVAA 4LBOA 1QJY3 4AQSA 3DF0A 2D7FA 1CR7A 4XF9A 1RUJ3 4P9GA 5I0UA 2EXIA 1PVC1 3VBUA 2YHJA 2ZS6B 1C57A 3EO6A 1BEV1 5FYYA 5C3OA 4IEOA 1K45A 3IKWA 4QXKA 4W50A 3TRSB 1MEC3 4GMP1 4D7YA 1EAH1 4DZGA 4XUPA 1DDLA 1TVGA 1RMU3 4XQWA 3ALQA 4L11A 3ZYBA 3ILNA 4IV3A 4P08A 1ENQA 1PO23 4C8DA 5DAQA 2XLAA 3ACFA 3IMNA 4IV1A 1VBA3 2JDHA 4QDRA 4Z2AA 4QGNA 2D6KA 4JV4A 1NLRA 2H0BA 4OYUA 2YBSA 3E5UA 1OOPB 1YIFA 3IWZA 5DDJ1 4IE7A 5T5LA 3TYJA 5D8AB 2LS6A 5FOJB 3WG2A 3ETQA 2E63A 2IVIB 5B4XA 1DGWX 2P1BA 2WFPA 1CZTA 3T0BA 3H1MA 1V6NA 3WNXA 3N9OA 4IL7A 2MPFA 4ZONA 1MQTB 1S4CA 1QIQA 1UXXX 2BNMA 2WN2A 2XJVA 4MHUA 1VB2A 3THDA 4FP3A 3ZR5A 4EJRA 2WQ4A 2ZAAA 3EJKA 1PO11 5D21A 4P9JA 1LOAA 3OBAA 3KHCA 4W8JA 1W3VA 2VVFA 4BE3A 2R30A 2W2IA 1UKGA 1UZYA 1LGNA 3NQHA 4K8FA 4MUVA 4EWAA 5DN2A 5KBFA 3DKQA 3OF1A 4UFJA 1HQWA 1XU1A 2YROA 5FP9A 4XF0A 4CEYC 1YQ5A 2YUEA 1CX4A 5DMYA 4CCOA 4S2DA 2EA7A 5JI9A 1V6KA 1GZ9A 1UO9A 3I59A 2PHXA 4BQYA 2XJPA 2BV4A 1T2XA 4Q4V3 4NUBA 4QGLA 4KWLA 4CA9A 4IW3A 2WIIB 4I30A 5JMOA 3DYOA 3KVAA 4P00B 5A33A 3UGFA 1AJOA 5BY5A 2EICA 3D3AA 4RHV3 3AYCA 1RUG1 5GJ6A 4BYYA 3WQ0A 2VMHA 2XQXA 3C8XA 3UKTA 1MZFA 3H1WA 1EY2A 5AVPA 1PM7A 3BODA 2RR11 2I45A 2ZEXA 1AL0G 3GYDA 4QB6A 1NA1C 4YVSA 4A7KA 4NJ4A 1S0BA 1JYXA 3FLTA 4Q26A 3M8LA 4IV1B 4COWA 3S0MA 3W58A 1NQDA 4KQ7A 4QWNA 5FZ1A 1RUE2 2A3WA 1LKNA 1JHJA 1D2SA 5JZGA 1QDCA 2E51A 2K46A 2WLQA 1PNFA 2R062 1MS5A 3HQUA 3O0XA 2JE7A 4NE9A 4NPRA 1W6PA 2ZACA 4UFHA 4LMFA 4AEMA 3AMNA 5KC6A 2HWB1 2ES3A 2ZEZA 1YFUA 4FXKB 3PU8A 5LBEA 1W8OA 2QJVA 3C3VA 4FFIA 3MZHA 3V64A 1DFQA 1ZYBA 3JB4C 1UNBA 5FR3A 1R1A2 2WO3A 4QX5A 1UZWA 4YFWA 4RQPB 2FCTA 2BEOA 4NAMA 2Y6GA 2GNMA 4CXXA 1QJU3 1UCXA 4UF0A 2VJXA 2PXJA 3ZYFA 5J1XA 2Q8DA 3H0OA 1RYYA 3T09A 2DUQA 3WF3A 5FZIA 4F3JA 5FZLA 2ETEA 2C0ZA 2ZGKA 1BHGA 3FWEA 1PMJX 2QQPA 4FOQA 2JWPA 1ZBE2 4A41A 1OKQA 3ZXFA 1LOCA 1LB2A 4QXHA 2WO7A 5CG9A 4N53A 1TMF3 4XETA 1E5RA 3TN93 3I59B 1K5JA 1HRV3 1UOJA 2LTNA 2ZBJA 3HN3A 5A7QA 2DUOA 3RWKX 3GZAA 4XJUA 5FO8B 4FAGA 3I2FA 2HWF1 1JXNA 4EZ4A 1KD7A 1A3KA 2B9UA 1W0PA 3D5OA 4NVPA 4XW3A 3RSJA 5IT6A 3OOXA 4WV8A 4YVWA 3PNAA 2OUJA 1NA1A 2YC0A 4FOVA 4LHNA 4UFIA 4M4RA 5HV4A 4Y26A 4Q1PA 3AKPA 4JCKA 1W90A 2XL9A 1OA4A 1RITA 3C7OA 4DUWA 1XB9A 2ZPXA 1VBD1 1D4VB 5CU1A 1VAKA 4UFLA 3A4UA 5FZFA 4YVSB 2VZ3A 5FYZA 1WCUA 3GZTB 2XMLA 1UMIA 1WW7A 2JDUA 4GH4C 3OUIA 3K4DA 1ENSA 1RVF1 2JG8C 3HAGA 1NCRC 1SACA 2OS2A 4MXWB 4TYSA 3R6SA 4CCKA 1CAUB 4E2QA 1QGLA 3ZYIB 3NNJA 2CGNA 2VAUA 2WS92 5FMCA 3VHOA 1OQEA 1DZQA 2J1TA 2RM21 4JQRA 1AYM3 5AFBA 4MGKE 4MX3A 3JD71 3IAPA 1YFYA 5CKQA 1YUDA 3DXUA 1PGW2 2PQQA 1S0FA 1DZTA 1OBNA 4XZUG 2ID4A 3GDBA 4AOCA 2ZGQA 1VRH2 2E32A 5KXEA 3HT2A 3M3OA 4UF0B 4AFDA 4CU9A 4YFZA 2CHHA 4LBLA 5LA0A 1ZRDA 2RS53 5T3NA 4L97A 1O3RA 1BZWA 1CPNA 2IXKA 2WAOA 1ZBA2 1DQ4A 3ZXEA 5FZHA 3AYAA 3POJA 4D0QA 2VECA 3B7MA 1UOBA 1C28A 2DCKA 2JKBA 2P3KA 3WP5A 1QKQA 4AEJA 5J3UA 4NAOA 3BUCA 2G1MA 4YGBA 4U2AA 1VALA 1MS1A 2JDPA 1BJQA 1CWPA 3OTFA 2YV8A 4N7UA 3SISA 5CFCC 3RZLA 4Q2FA 4LBQA 1GNHA 4XJWA 1NYWA 3HQRA 5JXIA 1A34A 4AE2A 4XCBA 3VBRA 4HXCA 3BCWA 1XPWA 4JGYC 1C8M3 2CWSA 2YBKA 2W94A 1GKBA 2K9ZA 3GJBA 3LOBA 5EXOA 1GWLA 5LBCA 5F5QA 2XLFA 1NY72 2B9VA 5E89A 5FP7A 4LNVA 2ZJCA 4GH4A 3U10A 5A70A 4AEDB 1GP6A 1K3IA 2V5YA 1I6XA 3H7JA 3MHZA 4CPBA 4EN8B 3MUY1 4LE4A 5KHKA 3BTZA 1FXZA 1HJFA 3WDVA 3ILFA 4XEZA 5FP4A 5IUQA 2NPIA 1HX6A 1J83A 3LDKA 2J1AA 5GM0A 1MEC2 1YWKA 5KWRA 3GNEA 4GAZA 4E4HA 4NROA 2BNNA 1UYYA 1OUXA 4HSLA 4N43C 4NR1A 2WAAA 1WMFA 3H8RA 4XFFA 3U14A 4V2VA 1VBA2 4CDXA 4BQ3A 3I2OA 3FL7A 1JTZX 2AEZA 2GMMA 3WLUA 3L2HA 4HKLA 5LB6A 2CY6A 3ACGA 4LOSA 4XFIA 5EWSA 5FZ6A 1VBC3 1UF2C 1V6MA 2K0GA 3POEA 2EAAA 3SH3A 4LK7A 2A70A 5KHGA 4XDPA 4B8EA 4TSVA 2XJTA 4M01A 1Q8SA 1W6MB 2EIBA 2GC0A 3V0BB 5FBJA 4AVBA 4S2FA 4M4PA 1YI9A 1CIWA 1CVNA
chains in the Genus database with same CATH topology
1GQHA 1PIV3 2VNGA 3CJIA 2XB6C 1AXKA 4FPLA 1YNAA 1RHI3 3AFGA 4M3CE 1TNRA 1DQ1A 1VLNA 2D5FA 3KGLA 3E97A 4D7SA 4QM9A 1YHFA 4YNIA 4QMAA 4RL7A 5JSRA 1FPN3 1Q8QA 4N9IA 4ITCA 3VBFB 1WLDA 1NLSA 1HRI2 1OHFA 2D3PA 4R9AA 4FTSA 3N7KA 2FZ1A 4RHV2 4G4FA 3NW4A 4OI4A 2IXJA 4GB31 1CQ9A 3NJZA 3JBG1 4RA0A 5ABJA 3I4IA 2PLV3 1PK6C 4QPGC 4YGEA 4E2SA 1BEV2 4Y1UA 1YJKA 1UZZA 2P17A 3KCXA 4LUMA 2JJ6A 3FLPA 1NCQB 3WDYA 3AP7A 4K21A 2AYHA 1LESA 1QJX1 1U5ZA 1XE8A 1ZNPA 2R041 3T1LA 3SNMA 3ZVXA 4EV0A 4Q0SA 4CRQA 1REFA 1YO8A 3M4FA 1AXYA 1UPIA 1Z7S3 2XWBB 3W9AA 1LODA 4B29A 2HEVF 4QU2A 4GWNA 1QOTA 1H2MA 4RGGA 4ZXKA 2ZZJA 1LHVA 3VHNA 3M3CA 4HFSA 1J3PA 4Q4W3 3DUIA 5EJ3A 3IIAA 3AYDA 5IK8A 1MS3A 5A3MA 1UIJA 3AM2A 3AKSA 3MI8A 1JW6A 2XL7A 1W39A 3OYWA 4GXLA 4B4PA 1S2KA 2ZMLA 1A8DA 2VY0A 3J8F2 3NAPC 2ZKNA 3MIBA 4K6BA 3TN92 4JC1A 4I0AA 4HANA 4CEWA 1N1YA 4L9BA 1LU2A 4I3GA 4BLIA 2E7AA 3PJYA 2RMU3 2VMGA 1GR3A 2JX9A 1MZ6A 3VZLA 2GNTA 1FOD1 1V9U3 1RUD3 3LA7A 1ND2C 4PCRA 1D4M2 1CGPA 4DY5A 1RUG2 2ARBA 1UX6A 1VR3A 3IN9A 1SCRA 4GWMA 4COUA 4KL1A 2XUMA 1ZZBA 1AR61 4CDWC 3FC0A 3POWA 4Y24A 1GBGA 3AP6A 5A32B 1VP6A 3AZYA 3OJBA 4W6WA 5BPXA 2WT1A 4GMP0 1R1ZA 1R091 1AYM2 3DKWA 2WLPA 1U5IA 2DVDA 2PAEA 2VG9A 2HWB2 5L7OC 1LOBA 2GC2A 1PHMA 3KLSA 4CDQB 2DU1A 2X5IA 4XJZA 3USUB 4FXGB 4JDOA 2O1QA 3FFQA 2ZMNA 3NAPA 1KDKA 5JSOA 4BA6A 3B69A 4Z1VA 1KXGA 4DPNA 2H6BA 3MLLA 4XJAA 3HQXA 3WY6A 2GALA 2TUNA 1AUYA 2W68A 1QH6A 2B8MA 3ZXAC 4KG8A 1XE7A 5JIAA 3M3IA 1YJLA 2RS31 4AI3A 4CEWB 2DUPA 1W6QA 1RUF1 4YW1A 4CDUA 2MEV1 1BVP1 1OFSA 1C8M2 2HWF2 1HLCA 4J1XA 1QJZA 4MYEA 4L2NA 3LSEA 2ZGTA 1KRIA 1R083 1COV1 2HEWF 4DRVA 2HKXA 1QXPA 1ND3A 2BVBA 4MZUA 3VBHA 1JYIA 2KM2A 4WVMB 4AI0A 3ZSEA 3KT7A 1IS6A 1CAWB 1OD5A 4PDWA 1I9RA 2VOVA 5BXXA 4COYA 4PBOA 2XH6A 3WDWA 1K5MB 1ZX5A 1IPJA 1RVF2 4NOTA 4QPIB 3PTYA 3ZFFB 1LJ7A 2JECA 2ZGSA 1EYBA 1UW8A 1VBC2 5H9SA 1H1MA 3UKVA 4ASLA 2WNUB 4FQ4A 2XKPA 3WW4A 3BIWE 2HYKA 4AVTA 1RUE3 5C6CA 4F8AA 3ZDSA 3LB9A 5C4WC 2R063 1TME1 2NMOA 5KHIA 4RS5C 4IQPA 1GANA 2HWC1 3LKJA 5DUWA 4YW3A 4Q4X1 1JUHA 4XPVA 2Q30A 2RJKA 4BCUA 1R1A3 5CG8A 3HBZA 1TEIA 1MS9A 5C8WA 1UKRA 3O12A 4C0BA 2NQYA 1F8VA 4EN9B 3WW3A 1CAXA 1H8TB 2JE9A 1DYPA 1WLTA 1EV13 2D6LX 3GZUC 3DGTA 1W6NA 3NVCA 1FPN2 5I91A 2DYCA 3H3UA 2P2KA 1A78A 1YFXA 4Y20A 1W0OA 1H4GA 4AFAA 4XFHA 4M3CB 4URTA 1QF3A 2YMZA 4WVVA 1S0DA 1IKPA 3VDDC 2OA2A 2PLV2 4LLFA 3SH4A 3CEWA 4OI1A 2XVLA 3DPRA 4E2GA 4XZPA 2ZCWA 2GH2A 2ZGPA 3AJZA 1ULEA 3GALA 4QM8A 4ES9A 3WP6A 5FLIA 3WX5A 3J4UH 2VH9A 1BMV1 2DCTA 4HK9A 1X33A 5C4WA 1A6CA 4A7YA 4AVSA 2R0HA 4BWOA 2CGOA 5T5OA 1AX0A 4K3UA 3WQ1A 1G7YA 3GBWA 3AXDA 3BPZA 4R9DA 4A2UA 1VBB3 2D44A 2IFWA 1RUI1 5C9AC 1W6OA 4GQ7A 1XNDA 2WS93 4IEVA 1QJY1 1V6IA 2SBAA 2VNOA 4XHXA 5C8CA 2ZX3A 5LRRA 4JRAA 2MHFA 3WG4A 1VIWB 2XVGA 3NV2A 3AMMA 3AMQA 2O0OA 1VRH3 3RDIA 3AZXA 1GLHA 2ZA9A 1PO21 1AHSA 4HMZA 3ZPYA 3VDDA 1ZBA3 1HIXA 1V00A 1FAYA 5AVAA 1CPMA 1G9FA 4Y20B 4PIYA 1OA3A 1AX1A 2OYZA 1V9U2 2UY9A 1RUD2 3IM0A 3SLIA 4Y4YA 5T5PA 3KS7A 3IPVA 4GB32 4FPJA 4OUSA 2ZTNA 3MLJA 4OHXA 3DPRB 5GLVA 3RMXA 4Q29A 1JN2P 4PF5A 3AKRA 3WQ7A 3K51A 3U11A 1QJX2 2R042 3QLQA 3FLRA 4B7KA 1ULGA 3NSTA 3J9SA 3VBSA 3N4MA 5DZGA 4RQPC 4COVA 4YM2A 4DXZA 4NWWA 3OD4A 2I07B 2VUAA 1C5IA 4LTAA 3C2UA 4D69A 3IBMA 3PVOA 3ELNA 3GBFA 3KMHA 2A3YA 2EF6A 1N1SA 5C8CB 3NL1A 3WCSA 5FRAA 4ASMB 3FUOA 4CP2A 1J1LA 3H8UA 3MF9A 3G7DA 2BVVA 3H3ZA 3DV8A 1APNA 1EP0A 1DIWA 1DF0A 5ACA1 1IS3A 4NHMA 3T2TA 4BQ1A 1RC6A 5K0UB 1AR91 1E57A 3WD5A 2EIGA 4XJ9A 4FPGA 3O7OA 4OHZA 3SCFA 5KXBA 2VQ0A 1O3SA 3THPA 2DTWA 1REDA 1H2KA 4PQ9A 3B9IA 5T54A 1KDMA 2WINB 5FOBB 2UU8A 3OBTA 3QACA 2Y0OA 2ZABA 3D4KA 4JDNA 1N3QA 1R082 2WZR1 1IQAA 2RS11 2WNVA 4I09A 3IPVB 1FOD2 4IEUA 3S30A 3B01A 4ZU7A 1FATA 2HWD3 1O5LA 4FAHA 2P3JA 1I5ZA 3MIEA 2IXCA 3ECQA 3ZXKA 4R9CA 1HRI3 1YFWA 4AFBA 2HWE1 2ILMA 4LEJA 4CYDA 1YXWA 1LEMA 3VBUB 2JD4A 4OUMA 3QBQA 5KXDA 1HRV1 1R092 4H7MA 3VZJA 3VBOC 3AKTA 1LGBA 1GSLA 1PVC3 3QH7A 4PJYA 1BEV3 4UW5A 5BNNC 4IV3B 4P5HA 4WM8C 4GMP3 1D0GA 1EAH3 1H9WA 1WMDA 2B45X 2ZGOA 3AMHA 3M70A 1SDWA 3ILRA 4KH9A 4GALA 2F4PA 4I01A 3PJQA 5EYYA 3TOJA 4MVTA 2D3RA 1WLCA 3WVJA 1SLCA 2E9QA 2UY8A 5HCBA 4U36A 5DDJ3 1EPWA 1BBT1 1X82A 4W6YA 5GLUA 3S7EA 1AJKA 1FV2A 4XE9A 1IZ3A 4XXPA 2BQPA 1HKDA 4K40A 5K9YA 2D93A 4MV2A 4DNYA 4CEYA 2RS32 1RUF2 1HV1A 2Y38A 5GZEA 2MEV2 3L9JT 4AEDC 4FPYA 4YSFA 1EV12 1N3OA 3LCPA 4K9SA 4INDA 4AHYA 2RJLA 3J8F3 4Q4Y1 1F5JA 3R4DB 1VAMA 5HCAA 1UAIA 1Y43B 1DGLA 5EYXA 4AQ2A 4Y1XA 2XWJB 5A33B 4AK3A 2Q8OA 1YIPA 2A6ZA 4LR4A 2A75A 3PMSA 3ZFGC 1FX5A 4WM8A 4O9EA 5JLVA 1G6NA 5A3LA 2C1FA 3EQEA 1D4M3 2VQAA 1RUG3 2PYTA 1ASJ1 4PBPA 2CWMA 1J59A 2ATFA 3V56A 4OI0A 2RR13 2DCYA 2VPVA 3E6CC 5FAXA 1VBB2 4EROA 5JZGB 1CD3G 4KNCA 1LEDA 1AYN1 3CF6E 1W6PB 1CN1A 2PHFA 4QQ2A 4LO4B 3U4XA 1FMD1 2PTMA 3KSCA 3EHKA 3VGIA 3MICA 4KU8A 2HWB3 5CIRA 2VGDA 1LR5A 4Q0PA 4WZCA 1N47A 4DRRA 2A71A 1FT9A 1WLWA 3VBFC 3E5XA 3I7DA 1S1AA 3SITA 4B4QA 2O8QA 2PAKA 3AZVA 1B35C 5FFOC 1SQ4A 4TLFA 2IZWA 3M2MA 2Q4SA 1RUC1 4YZ5A 5J36A 3DN7A 3S6PA 3ZIWA 3JQXA 2CYFA 1OQDA 4N53B 4S2HA 3NV1A 4LHLA 3ZFGA 2PHRA 3MIGA 3P3NA 1Q8VA 1NCQC 2GC3A 4E9KA 2QE3A 1DYKA 2R49A 4LULA 2HWF3 2VW2A 4Q27A 3OY8A 4FVVA 2EXKA 4YVWB 1NA1B 4XTPA 5H9RA 4WM7C 4R8HA 1CESA 2JG9C 4YGDA 5F1RA 3UJQA 5JPMB 2JG8A 1NCRA 2R071 3MW2A 4C91A 1CJPA 4K7JA 2XBO1 1VBD3 4Q8LA 1JOJA 5DZFA 5L73A 3S7IA 2F6BA 4GA9A 1S0EA 5D1IA 1QXRA 3M3EA 2RHPA 2WFF1 4RGAA 2BFUS 1HXS1 2OIIA 4KBBA 1FI2A 2P3IA 1RVF3 3WDUA 2Z69A 4LLOA 1AR71 2RM23 3HD8B 4I0BA 2CNAA 1F2NA 5BNOC 3HN1A 1C4RA 3JD73 3GBGA 4FP2A 2AGSA 4Z82A 5T5JA 1SLAA 4IEPA 2XPJA 3POYA 1GV9A 4KWKA 2CAVA 1BK1A 1ZVFA 1LHNA 5CFCA 4YW5A 4HPKA 4DQAA 3GHMA 1PZ9A 5H9QA 2H0VA 2B5HA 4JGYA 1XRUA 1Z7S1 2YGLA 5FBZA 3AFKA 4ISQA 1C1FA 3WG3A 5JMCA 3SH5A 1LENA 2P37A 1GQGA 4DMIA 3APBA 4LBQB 1WBFA 1UU4A 5JOWA 3VBRB 4N90A 4R9BA 5GLWA 2OUHA 1DBNA 2WJSA 1AR81 4LO7A 4A3XA 1YYNA 4LBNA 3ZSKA 5CVRA 4D94A 2HWD2 4KGQA 1NE6A 3V0AA 2ZHMA 4AYUA 3CL1A 4FPKA 4GH4B 3OGJA 1NE4A 3NKTA 2JG8B 4DFSA 4KWJA 1MZ5A 4AVAA 4N43A 1W2UA 2ZX1A 5E8AA 4CDQC 3JCIA 4EN6B 2D97A 4P9IA 1PVC2 4R4XA 1J58A 2XG3A 3N7LA 1EAH2 4LBKA 1PGL1 4HVOA 4CDXB 1Y9QA 2QZ3A 3FMGA 1BXHA 4M0NA 4LHKA 1H1AA 2GU9A 1G9AA 2Y0IA 4LO8A 5FLHA 3KQRA 5DDJ2 2YY1A 4G9SB 4HKOA 4J6GA 3QD6A 4I0WB 4ES8A 3H1YA 1NZCA 2NLRA 3ZYRA 3WXPA 3J26N 4FTEA 3HMYA 3ZXJA 4OZXA 2GMEA 3BTAA 4O9GA 1ZZ8A 1AL21 3EXUA 4DS0A 2NYYA 5CFCB 3CJIB 4HPKB 1CAVA 1PO12 3FBMA 5ACA2 2X53S 2D98A 1AR92 4YG3A 5DXDA 3RJRA 2PHLA 1ZRCA 2DFBA 4D3WA 3VKLA 3RZZA 4QD2A 2Y26A 2A7AA 4XFAA 4RR3C 4HETA 3TBDA 5FDBA 4FCAA 4BPZA 1POV1 2GZWA 1RUNA 2NMNA 1LU1A 3LWCA 3LA3A 4EN7B 5H9PA 4SLIA 2RS12 1K5MC 2VW0A 3FE5A 1XNKA 1H30A 3V0AB 1IOAA 2QVSB 4HLTA 1RINA 4IEWA 2P34A 1WCSA 1PK6A 4QPIC 4QPGA 3VLBB 4GKYA 2FHRA 1LOGA 4N43B 4YG0A 4EN0A 3TNQA 4DY3A 1PVXA 1LOFC 3AXEA 1D2QA 2WNUC 1JBCA 1WUVA 1FNZA 3G6JB 2E7TA 4HSJA 5ABJB 4GB33 1WBLA 2MNGA 4COZA 1Z78A 3WW2A 1KJLA 4F7ZA 2RR12 3RYRA 4MH0E 4RSUA 3VHPA 3KB5A 1QJX3 2R043 2PHUA 5HCFA 3JZVA 2SLIA 4XFCA 4XIKA 2W52A 4UW6A 5FPZA 3PLQA 1GYKA 3QCWA 3ZN6A 2WNEA 4NHKA 2TEPA 4FBFA 1BBT2 3ZXLA 4GULA 3SXWA 3SMHA 1H8TC 3IDCB 5F6KA 2GH8A 3UKNA 1XQNA 2G9FA 1S55A 4JVAA 4C90A 1O7FA 1ZREA 3OYWB 4B7EA 4D7TA 1U0AA 3AYEA 1RUH1 4NN0A 5F9TA 3OBRA 1I3HA 5BUVA 5K7PA 4ZKTB 4LO5B 5LRSA 1Q5OA 3AMPA 2WC2A 1D0HA 2TBVA 1VBE1 5I0SA 4W65A 1ND2A 5E1RA 5IK5A 4Z8BA 4LT5A 2CL2A 2A73B 1H4HA 2R061 1LECA 1PK6B 5JI7A 1M06G 5DUXA 1ULFA 4CDWA 2PAMA 2N7GA 4FSJA 3U0ZA 4X8PA 1J1TA 3ZXGA 5FPXA 4UW3A 1FOD3 4HBNA 5I8TA 4OI2A 2IXHA 1VBD2 2OZ6A 3AJYA 3D6EA 1H8VA 5EFUA 1LULA 4HN0A 1QHDA 1QQP1 2XJUA 1UL9A 1AR63 1UD1A 2EAKA 5L7OA 2B46X 1I1EA 4XDQA 4AFMA 4PLOA 1ZBE1 1O4YA 4XYXA 3WP4A 4PLMA 1R093 3K48A 2RM22 4JAAA 4JGZC 4AQ6A 5BNPC 3ZN6B 4F83A 3VHRA 1MS0A 2R1BA 1U5XA 1MR5A 2D6PA 3JD72 3M7AA 5DUVA 5JDBA 3D8CA 2X5IB 4AI1A 3N35A 3ZIXA 5CFDC 1TE1B 2XVKA 3WOGA 3NAPB 3NWKA 3MYXA 3H50A 4M00A 5AC91 3ZO0B 1X50A 2DWRA 3ZSLA 2WSUA 1JYCA 2ENRA 1ZZ7A 3B3QE 1RB8G 1QU0A 3B5LB 4QPYA 3KM5A 1AXZA 3ZFEC 5FMOS 4XJ8A 3VKMA 1RUC2 3WG1A 5JOXA 1GZWA 1W6QB 4BLJA 3M3QA 2WQZC 4CDUB 4Z2WA 1ENRA 3CO2A 2RS33 1IKQA 1UIKA 1RUF3 2MEV3 1PZ8A 5CBLA 3I2DA 4CDWB 1PGSA 5GZGA 4OFGA 3JQWA 4AI2A 2Z79A 4BOWA 2GSYA 2OPKA 4L99A 3HIFA 2ZKLA 1OSGA 3FHIB 2YGMA 3AP5A 1ND3B 1PNGA 4H14A 3PVEA 1VRH1 3VBHB 5TSWA 4J1WA 2DURA 3UL2A 2OVUA 4JGZA 4PDWB 5BNPA 1OOPC 5GZDA 5CA6A 5L7OB 2A5ZA 5D8AC 1F31A 3SCHA 2VUJA 5IK7A 3BALA 4I2OA 3VV1A 1Q43A 3AP9A 1XNCA 1MQTC 4PLNA 2O8OA 1A8MA 1AR72 2ARXA 3WZ1A 5FQ0A 3THTA 4R52A 4RFT0 3B00A 4BM8A 5K0UC 2TNFA 4RS5A 2NN8A 1NXMA 2Q0AA 3ZFEA 2ZGLA 4K1YA 4QGMA 4BMBA 3CNAA 3QOPA 4JRLA 2WSVA 4XBNA 3WUDA 2XKOA 1BYHA 3B02A 5JWPA 2XGXA 4Q8KA 4H3WA 1RUJ1 5KHJA 2ZGMA 2BNOA 1U12A 1O4TA 4TWTA 3VZNA 3LSDA 1HQLA 1G9BA 1GZWB 3KT1A 1MEC1 2D6MA 2V73A 4XFGA 1OLRA 4Q1RA 1RMU1 1BVVA 2I74A 1QNWA 1VBA1 5F6LB 5I0TA 4B3NA 1CAXB 5HBAA 3FFZA 1W6NB 3VBUC 4RD7A 3GHNA 2GMPA 2DU0A 1OOPA 2QDRA 4H7LA 1DLLA 2ZHKA 4C1XA 1LOEA 3W59A 5EV7A 4IV3C 1IPKA 1XYPA 4IV1C 4GKXA 3MPBA 3M1HA 4FPHA 4LA3A 3WDTA 1X7NA 1UPSA 3X29B 3HT1A 1ALYA 3N7JA 3JBG2 4AW7A 5LEJA 1KJRA 4DB5A 1RUOA 2ZX0A 3VKOA 4P9LA 1KQRA 4LO6B 4XF4A 2QKDA 2XHKA 1PGL2 4UXAA 3MW4A 2UURA 3AP4A 5C4WB 1MZEA 1X8EA 5C9AA 1RIRA 2JICA 4M3CF 2A6XA 4QQLA 3BU7A 1DQ6A 1FV3A 3KT4A 4Q4V1 4LBJA 4E27A 5JAXA 5AFEA 1F5FA 4X6QB 5JIUA 3AZWA 1NG0A 1VAVA 3N3HA 4LBMA 1W6OB 2JDZA 4CZSA 2UWBA 4X8NA 1RJ7A 3E6DA 4RHV1 3RNSA 1AL22 1NOVA 4AG4A 4WVWA 3Q9OA 1LHWA 4Y5Z0 1SFNA 5IK4A 3WINE 4FPCA 1KITA 3BB6A 4IEQA 4FPOB 2C9AA 2IFRA 3KD4A 4AHXA 2AUYA 1AZDA 2CTVA 4Z92B 3VDDB 4YW2A 4GIQA 1SBDA 1JHNA 4ISRA 3ZMNA 4YVSC 2DFCA 2ERFA 3R4UA 2QNKA 1FYUA 1ZRRA 4G3YC 4BH9A 4AHZA 1SMVA 4DINB 5LK5A 5JZGC 2XJSA 1QJU1 2IWGB 2NM1A 4RQPA 2E6VA 4P9XA 2BYVE 1ULCA 3WHTA 2ZZQA 1AR62 3ES1A 1OPMA 3WDXA 3H9AA 5C9AB 3SHRA 4OHYA 2D3SA 4QHBA 3LZZA 3ME2A 4FTBA 3J8F1 3VBSB 1TMF1 3TN91 4IEXA 1ULDA 3VZMA 3FUQA 1HW5A 4XXAA 1SLLA 4OHWA 2GN3A 5I0RA 4E4SA 2NZ9A 3FJSA 2E53A 3L2YA 4FOYA 4BIOA 1LCLA 1BCXA 3SCGA 4JTNA 2NP0A 4ORFA 4FPEA 2B39A 2ZOEB 4N53C 1UU6A 4AWDA 3PMEA 1D4M1 2WWSA 4IXLA 3RRDA 4BHPA 4YARA 1SEFA