4IEYA

Cys-persulfenate bound cysteine dioxygenase at ph 7.0 in the presence of cys, home-source structure
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
186
structure length
186
Chain Sequence
ELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type 1
publication title Cysteine Dioxygenase Structures from pH4 to 9: Consistent Cys-Persulfenate Formation at Intermediate pH and a Cys-Bound Enzyme at Higher pH.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 56
structure length 186
sequence length 186
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2012-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ieyA00
4FT8A 2XKPA 1J59A 2P17A 4XFCA 3I59A 4KU8A 1ZX5A 4L11A 3EQEA 2C0ZA 1SFNA 3PVBB 4XFAA 1O5LA 5KHKA 3DL3A 1NE4A 1QXRA 2OZJA 2KXLA 3SCGA 5JR7B 1YFXA 3BALA 3LZZA 5CADA 2PA7A 1OI6A 2Q4SA 4I2OA 3FZ3A 5LRRA 3EHKA 4D7TA 4XF0A 3BCWA 3H7YA 1TQ5A 2GC3A 1X7NA 3FJSA 5KHJA 1O3TA 4IEQA 3E6BA 4MGKE 2BNOA 3SCHA 2ZCWA 4HLTA 3CF6E 4IEUA 4J1XA 5J48A 2MPFA 4XFFA 2XL9A 1OD5A 1RC6A 1LKNA 4BHPA 4F7ZA 4IERA 1UIJA 3HQXA 2MNGA 1WLTA 4LEJA 3U11A 2HKXA 1CAUA 5CVRA 4Q0UA 3HT2A 5FLJA 1XRUA 1ZZ7A 3H8UA 1QXJA 2OPKA 1CX4A 1ZZ6A 1RTVA 3QACA 4A2UA 2GU9A 1YFYA 3ACLA 4I0AA 4R8HA 2CAUA 1J1LA 1WGPA 2O1QA 2PFWA 2PTMA 1O7FA 1EP0A 3CJXA 3KGZA 2ET7A 2H6CA 2PQQA 4GULA 1ZZ8A 4HBNA 4O9GA 1OMIA 1Q5OA 2PAMA 4IEYA 3E5UA 3BPZA 1XE7A 4XF4A 2CGPA 4R52A 1X8EA 5FQ0B 5KHIA 1V70A 2PHLA 3E6DA 5E16A 3H3ZA 3KMHA 4JTOA 3RZZA 1NXMA 2QNKA 2XLGA 2IXLA 3RYRA 4AVCA 4E2GA 4ZU5A 5LEKA 2QCSB 2O8QA 3MYXA 4BYYA 1VJ2A 1ZREA 1I5ZA 3DV8A 3D0SA 1L3JA 2I45A 4LA2A 2FQPA 4XFBA 2E9QA 3OF1A 5FPZA 3RYKA 2XLAA 5FQ0A 1EPZA 3ST7A 4JV4A 4BIFA 4PIZA 1ZRDA 4YNIA 4B29A 3O14A 4O9EA 4QGLA 3UKVA 3CLPA 3NW4A 5KHGA 5JSOA 3UKTA 4EV0A 4HN1A 3RPQA 3M70A 2D5HA 2V09A 4QM9A 4AQ2A 3BU7A 3ZDSA 3NSTA 2ET1A 3B02A 2F4PA 1VR3A 1ZNPA 4RD7A 1RUOA 2D93A 2K0GA 4DINB 1NYWA 4BH9A 3S0MA 4J1WA 3SHRA 4QGMA 3IBMA 4I01A 1J58A 4JVAA 4HSLA 3BB6A 1JUHA 2IXHA 5I91A 4QGNA 1ZVFA 5JAXA 4NVPA 3IDCB 2Z2SB 3KGLA 4ONUA 3FHIB 4Q0VA 1G6NA 2D40A 3E5XA 2Y0OA 4MUVA 4EWDA 2B5HA 5FDBA 3FFQA 5I0RA 3OCPA 1X82A 3LA2A 4I02A 3MPBA 5JSPA 4I3PA 4XFHA 2VPVA 3WW1A 1CAWB 3ES1A 4N9HA 4EWAA 2EAAA 5F1RA 3ROUA 4XEZA 1ZZCA 3USSA 1PMIA 2GZWA 3IDBB 2ATFA 1O3RA 4HZFA 1IPJA 2HJIA 4Q0PA 4Q0QA 4OLLA 4X6RB 5AVPA 5FLHA 3WW2A 2UYAA 1Q43A 3WW3A 4H7LA 1EY2A 4XFGA 2XL7A 4FAGA 1CAWA 3FX3A 4META 4IEVA 3LA3A 2PAEA 2XKOA 3HIFA 2BNMA 4AQ6A 4ZU7A 5I0SA 1EYBA 2IXKA 3LA7A 5JSRA 4P9GA 4IETA 2D5FA 3SCFA 4I0BA 1CAXB 4XETA 1SEFA 5EZWA 3GYDA 3H50A 5D1IA 3OD0A 4HSJA 1RUNA 1DZTA 2UY8A 1CGPA 1U12A 4L2NA 4FBFA 2QDRA 3L2HA 1Q3EA 3SMHA 3LOIA 1LRHA 1J3PA 1ZZBA 4LA3A 4XFIA 3NL1A 4PIXA 5HI0A 1DGRA 5JCTA 4JTNA 1CAVB 2B8MA 3MZHA 4EWEA 4N9IA 3GBFA 1ZRCA 2EA7A 3NKTA 5I93A 1UIKA 5I8TA 5T3NA 1O5UA 3PLQA 3VHRA 1YUDA 2IXJA 2WFPA 4E2SA 1ZRFA 4HN0A 3ES4A 2XGXA 4UXAA 3C3VA 1QWRA 1CAVA 1OFNA 2GC2A 2XLFA 4EROA 2FMYA 4CYDA 4WVZA 2GC1A 4FAHA 4YARA 4MX3A 1FI2A 3G7DA 3U0ZA 4XF1A 2GAUA 4QM8A 5E1RA 5K8SA 2PYTA 3TNPB 2EVXA 4XF9A 5LEJA 3EJKA 3S7EA 3IWZA 3H1YA 1DZRA 1I6XA 2XHKA 2IC1A 4Q29A 5J7MA 3H3UA 4LUKA 4AVAA 2Q1ZB 5J3UA 4UBGA 3KSCA 3R6SA 1O3QA 2H0VA 4UBHA 5C6CA 4MV2A 4XF3A 3ELNA 3MDPA 1H1IA 2H6BA 1NZCA 2WC2A 5FCCA 4AVBA 2QJVA 1Y9QA 2B9UA 5BUVA 3H1MA 1H1MA 4PJYA 1ZRRA 4IEZA 4KWJA 4QX5A 4D7SA 2BEOA 3I54A 3RDIA 4E2QA 2IXIA 1J3QA 2QVSB 4YSFA 4ORFA 1RGSA 2IXCA 1YFUA 3E5QA 4LLOA 5FPXA 2OZ6A 3U10A 1YLLA 3OTFA 2PHDA 4WBBA 3UKNA 5BY5A 1LB2A 3SXWA 2Z69A 3PNAA 4LTAA 3EBRA 1QY4A 5I8YA 5KBFA 1GQHA 2ETEA 3LAGA 2VECA 4HMZA 4QXKA 5C8WA 1YHFA 3H7JA 1CAUB 5LRSA 4Z07A 3FE5A 3CO2A 4ZU4A 3H1WA 4X6QB 3DKWA 3EO6A 2GH2A 2BGCA 2BNNA 4IEXA 3HT1A 3TNQA 5FLIA 1WA4A 3ETQA 4IESA 1O3SA 4KU7A 3E97A 4YYOA 2VQAA 3OGJA 1RL3A 1IPKA 4KWLA 4TLFA 5BXXA 1DGWA 4HVRA 1SQ4A 4K8FA 3FWEA 4Q0SA 4IEOA 3H9AA 4MGIE 1HW5A 1XE8A 3D0JA 2UY9A 1CAXA 3QOPA 5I8SA 4MZUA 2UYBA 2ZKLA 3M3IA 3N4MA 2PAKA 4KL1A 4LULA 3E6CC 1FT9A 4MH0E 1UCXA 3I7DA 2GC0A 1Y3TA 1UW8A 5CU1A 2K9ZA 1J3RA 3CL1A 3DN7A 3KCCA 3NJZA 1O4TA 5KHHA 2Q30A 4I09A 5I0UA 3WW4A 3LWCA 4IEWA 4HVOA 4HVQA 4PIYA 1YWKA 4KWKA 1UPIA 1FXZA 5I0TA 3RNSA 2OYZA 2CAVA 1UD1A 2OA2A 3JZVA 2MHFA 4F8AA 5BV6A 2DCTA 4LUMA 4MGZE 4QMAA 4YRDA 3NVCA 1PM7A 1GQGA 4IEPA 4AXOA 1NE6A 3D82A 1VP6A 2CV6A 4MGYE 3IIAA 3I59B 4WZCA 1LR5A 4Z82A 2Q0AA 5EFUA 5BPXA 2BYVE 4OFGA 1YFWA 1X8MA 1ZZ9A 2N7GA 3S7IA 3RYPA 3CEWA
chains in the Genus database with same CATH superfamily
3MBWA 1F8VA 4YVSB 2HWF2 2XKPA 5B4XA 3PUIA 3AYDA 4CDUA 4ZZ5A 2GN7A 2WSVA 2WQ4A 4NRPA 1ZX5A 1RUJ1 5ABJA 5JMOA 2JIJA 1UYYA 1SCSA 3NNFA 2CWSA 4B1LA 2VGDA 3DGTA 3N7KA 1SFNA 3T09A 3WR0A 1AL22 3PVBB 3O1OA 3BYWA 4C1XA 1W28A 1K45A 1Y43B 1S0GA 1T6GC 1O6UA 4PQQA 1F2NA 4ZPIA 3ZN5A 1I9RA 4A7YA 3UETA 5T52A 2JG8C 4QB1A 5KHKA 2J1UA 1F5FA 2V4AA 1QXRA 1JXNA 3SCGA 4C0BA 4EZHA 1H2NA 2F6BA 4XDPA 2A75A 5JR7B 2V5DA 2XJTA 4IUGA 4EE2A 3MUZ1 3VKLA 3VBFB 1RUI1 1OI6A 2Q4SA 3VUOA 4A41A 1IS4A 4IW3A 2BUKA 2DVBA 1R1A3 5FREA 3WT3A 2GMMA 1SFYA 4W6XA 3VBHC 1EAH3 4XF0A 3BCWA 3ZXJA 2B46X 2BWCA 1TQ5A 2RS13 5KHJA 4DXRA 4PDWB 4XMIA 2YFUA 5FY7A 4ZONA 2A6YA 1YJKA 1UKRA 2JD9A 4HOOA 3WG2A 1GICA 5F3GA 1RC6A 4F7ZA 5FY4A 4IERA 1OD3A 1UIJA 5A7WB 3CJIA 2NLRA 4PT6A 3W5MA 1H1AA 3HQXA 3WVJA 2MNGA 1WLTA 4CP1A 5A3MA 2QFEA 1JW6A 4JRLA 5EV7A 4LHSA 3AMQA 5IVFA 4ZKTB 1SFPA 3WG4A 2B42B 1PO22 1S2BA 3WINE 4A3XA 4BQYA 1AYM3 4CEYA 1G8WA 1D7PM 1XRUA 3KB5A 2FZ1A 1C57A 3LSDA 4URTA 2VXRA 2HYKA 3MIBA 3I2HA 2EAKA 5C3RA 1RUD2 2VMCA 2HWB3 3C7GA 3BI3A 1YFYA 2DTWA 1JU4A 1UY0A 4HPKA 4Q4W3 3TN92 1GP6A 2JWPA 1J1LA 2PFWA 3BOPA 4FI9A 1HKDA 3AM2A 1O7FA 2XVGA 5JVVA 3LSEA 4FSJA 2DFBA 3MGUA 2R0FA 2H6CA 2CY6A 3ILNA 3IAQA 1ZBE2 5HXVA 4AEKA 1W6NA 5DABA 2AACA 4IEYA 2WWJA 1PVC3 1GR3A 1ASJ2 1ND3A 1XE7A 2WO1A 3CQOA 4IDZA 2CTVA 2WFF3 4Y1XA 3VBOA 4XF4A 1OVPA 1WCKA 3LEKA 4C90A 1VBD1 1YQ5A 1YXWA 2VUDA 4DMIA 5J37A 1OH4A 1OOPC 1K5JA 1PGL1 2WJSA 5KWRA 2ZPXA 3PIJA 5FQ0B 1XJAA 3O0VA 2HWC1 3PU8A 3H3ZA 1KD7A 2Q8CA 5J36A 2VOKA 2ZEYA 1RUC3 1W6PA 3RZZA 4AGVA 2I2SA 1G9CA 1WW6A 2GNBA 2QNKA 2XLGA 2PLV3 1ND2C 1UYZA 1WD3A 4BE3A 4BLIA 2VBPA 4DFSA 2VCAA 1JZ3A 2RDRA 5JOYA 2QCSB 2O8QA 4PHZA 1C28A 1MS0A 1VJ2A 2ZTNA 4AFAA 1D4M1 1Y9MA 4BYYA 5A6XA 4WM8A 5HV0A 3DV8A 5K0UA 2VQ0A 3CKHA 3LE0A 1H30A 3GZAA 3O1PA 4W6WA 3GF6A 2BGOA 4QX8A 2YROA 1EPZA 1RINA 1YJLA 4PIZA 4LO8A 3T30A 5FUIA 5FP3A 5L19A 4QGLA 5LK7B 4S2DA 1MEC2 1AHSA 3B5LB 4AQSA 3RJ2X 2Q1MA 5A6ZA 4EV0A 1VAVA 4OHZA 3VZNA 4DS0A 4HN1A 1BEV2 4RS5C 2D98A 1S4CA 2XVLA 3W20A 1K5MB 3CZJA 1EUTA 2CL2A 3BU7A 3K75B 4YM2A 4IE5A 1JZ4A 5L73A 4LO7A 4FPEA 4GWNA 3RZJA 1W2TA 1BBT3 3H3LA 1Y7BA 1RHI1 3VBUC 2W1SA 4FTEA 3PUSA 1LOFA 1F31A 3U37A 4DUXA 5FP9A 1ACCA 4M4PA 2HEWF 3KS7A 1XBFA 4HSLA 1DIWA 1BK1A 1Z78A 1OFSA 1NQDA 3UJOA 1HB3A 2ZX2A 3PU3A 4AEDC 4Z2AA 3SISA 2GMPA 4UW5A 1ZVFA 4YVSA 4AI9A 3POFA 3NV2A 3CBNA 2V5YA 1NCQA 5C4WB 4ATFA 5IK4A 3OBTA 1TMF3 3ACGA 4AFBA 1W05A 3KHBA 3L9JT 4ONUA 3FHIB 4Q0VA 1HRI3 1U5ZA 1RUI2 1VBE3 1ZA7A 5T55A 4LO6B 4Y1YA 3VDDB 3PJYA 3WDVA 1PK6B 5FDBA 5CNAA 4AI0A 4NHMA 3LA2A 2R6QA 5DAVA 5JSPA 3KCYA 5EQUA 3RI8A 1QJZA 2HWE2 4AI2A 2ZGSA 2W0XA 3AKQA 1VBA3 4FP3A 4ZHNA 1SLLA 4N8MA 4FVVA 3DKQA 3S6PA 4ASKA 4Y3OA 5F1RA 1OLME 1W9WA 4ES8A 3J7LA 1LCLA 4QX3A 1PMIA 2GZWA 4M4RA 2ATFA 1F9KA 3RI9A 3FL7A 5C3OA 4OHWA 1OH3A 3VBFA 2DCJA 3LFMA 3NKGA 5DUUA 3WW2A 2EIBA 5IATA 4R9DA 4C0HA 5JXHA 1E5HA 1XE0A 4R9CA 4NPRA 4QDSA 1JYWA 4J6GA 4R4ZA 1CAWA 2JG9C 5A1LA 2VR4A 3USUA 1OPMA 1V9U1 3FX3A 1TE1B 4META 3LDKA 1JBCA 4OQ9A 2X05A 1PGW1 1CN1A 5C33A 1WLWA 3H42B 3C7FA 2HBUA 1FAYA 2XKOA 1JYVA 2E7TA 1VMFA 1V6LA 1T6BX 1KGYA 1UZ0A 4G3YC 1VB4A 5CAZA 3LA7A 4X8PA 4LBQB 4RHV3 1F4AA 4P9GA 2RR11 4CCNA 4W65A 4IETA 1GQPA 1WKYA 2D5FA 1WBLA 2GNTA 3T3YA 1MR5A 3SCFA 3TAYA 1PO23 2ZX0A 3N9NA 4FOYA 4XETA 3ZIWA 4AG4A 5FWJA 1O8PA 2R49A 4BOWA 2WQZC 5JZGB 2VCBA 2P3KA 2D6OX 5K9YA 2ZGUA 2RHPA 3UT0A 2DBNA 2PHXA 2ZMKA 2W92A 3FLRA 3EB7A 1W0PA 1STMA 2XWBB 2X5IA 1OQDA 1TME3 3AB0A 2VNVA 2JE7A 1UWWA 3J7NA 4LKDA 3T0BA 3AJZA 1VAMA 4MHUA 1VBD2 1W8HA 2OPWA 2W91A 2HYXA 1NA1B 3SMHA 1VAKA 1XNKA 1LRHA 4IV3B 1PGL2 1ZZBA 1LGCA 1QIQA 2VC9A 4PIXA 4XJAA 2VQUA 5JCTA 1PZ8A 1K3IA 1HX6A 1CAVB 1OXCA 5FZAA 1AXZA 4N9IA 4AF9A 3MFAA 4KGQA 5EYYA 3WXPA 1ASJ3 2EA7A 3GM8A 3ZYBA 3KT7A 1Z7S2 1S0DA 1Y9GA 1FPN2 2V4VA 4BPZA 5FZMA 3S57A 1D4M2 3UK9A 1Q56A 5I8TA 3M1HA 1N1YA 3FN9A 3ZDVA 2P37A 2UWBA 5F5CA 1NCRA 3TEWA 2VO5A 4FFFA 1AR71 2VXJA 4I0WB 2ZKNA 2WFPA 3EMRA 4HANA 2ZGPA 2WIIB 4HN0A 2FDKA 4YW2A 1O59A 4NIGA 2Y64A 3C3VA 1N3QA 4FXGB 1S0IA 1LTEA 1RUH2 1W8TA 3CJIC 5CFDA 3FFZA 4AVTA 2FMYA 1IOAA 2DUQA 4K8RB 5KXBA 5FPVA 1MZEA 2GC1A 2R072 1TG7A 2J1EA 3ZX7A 4FAHA 4YARA 3LD8A 4JGZC 1HQLA 2D6LX 2WZR3 5DDJ1 1H8TB 4XW3A 2RVAA 1OSGA 4CU8A 4CEYC 3TNPB 2BOJA 2EVXA 2VUCA 1RMU1 4UF0A 5GZEA 3K4DA 1YQ8A 1W2UA 1HQNA 3HBKA 4UYBA 2XJSA 3LEGA 1OUXA 1RUE3 2XHKA 3AXDA 2QQNA 3N7LA 3WP6A 4QD2A 1RHI2 1VBC3 2IC1A 3RRDA 5FZ4A 4LUKA 5JOWA 1IPSA 4GJYA 3KLSA 4EZ4A 2VTXJ 1EV13 2NYYA 5FZKA 1O3QA 2HEYF 2VZ3A 3F2ZA 1QNYA 5C6CA 3RS6A 1KS4A 1QDOA 3AJYA 4MV2A 3BIWE 5DUWA 5C9AC 2WNUC 1ND3C 3VBOC 1EUUA 1NXD1 2DWRA 3LIGA 1H1IA 4YVWC 1XNAA 4CZSA 1RUG1 4IXLA 2CGNA 1UX7A 5FZDA 1Y9QA 2B9UA 5BUVA 1H1MA 4Y1UA 1LHWA 5FV3A 5FQ0A 1AR62 4W6YA 4LOSA 3JD73 3B93A 1J3QA 4ORFA 5FMOS 2SBAA 2XWJB 1COV1 2OUJA 4P9WA 5ISLA 2BDRA 2P1BA 2WZ8A 1AXKA 3I2GA 1YNAA 5A3WA 4AHWA 3OTFA 3MW4A 2IUWA 5DPNA 1A3KA 5BY5A 3BODA 1PK6A 1UMHA 1S0CA 1YEWA 2ZAHA 3PVOA 4RGGA 2Z69A 5FY8A 3SQOA 1UMIA 3W9AA 3ACIA 1QJU3 2QQJA 2W94A 5EJZB 1QY4A 2A3WA 3LGRA 1TEIA 5DUVA 2R043 4DRRA 1UYXA 1V9U2 2ETEA 1D0GA 1YIPA 2VECA 3ITQA 3LAGA 3MIHA 2E53A 1PGW2 5C8WA 1BKZA 1YHFA 5FZ0A 2YU2A 1R1A1 4Y4YA 4AGRA 4KGGA 4RS5B 3FE5A 4RGKA 2ZABA 3H1WA 1XXNA 4X6QB 3OBRA 3DKWA 3D4KA 4WV8A 5FYHA 3UGFA 2RR12 3TNQA 4S2FA 4XXAA 4MG2A 3R4DB 4EN6B 5FZ1A 4AOCA 3I3QA 1W6QA 4KU7A 2XH6A 5FP8A 2TNFA 1GZTA 3I2OA 1LOFC 4HKLA 4YYOA 1O4YA 3V65A 5FZ9A 4ZXKA 4XUPA 4INDA 2EIDA 3M2MA 1PZ7A 2P3IA 4YVSC 1DGWA 1HXS1 2C26A 2WUHA 3INAA 3R05A 5F2WA 1US2A 1UZYA 2TUNA 1RITA 1V00A 5KXDA 2HWD3 2QQVA 1YRZA 3FWEA 4AAXA 3VBRA 3KV5A 3DYMA 1XU2A 1JTZX 1R083 3E1F1 2ZKLA 3U4XA 3M3IA 4BCUA 2PAKA 4M3CB 3V0BB 4QPIB 1M06G 3POBA 4YGDA 1OPOA 2YBPA 2ZHMA 4Q5OA 4QU1A 4MH0E 3WG1A 3I7DA 3ABZA 3PTYA 4Y22B 2ILMA 3PVEA 1NA1A 4G4FA 5CU1A 3ZFEA 5F5IA 3VB9A 1J3RA 4TLGA 3DN7A 4RA0A 3VBFC 3J8F1 1W9FA 2LROA 2WFF1 1HQWA 1Z7S3 1DU3D 2YFZA 1CESA 3T1MA 3WW4A 2R1BA 1LEMA 3LWCA 3ZN4A 2JX9A 4QPGA 5FWEA 4DY5A 1G9DA 3WNOA 1L7LA 2BVVA 1HN0A 4PDWC 1UPIA 2Y33A 2Q5TA 4CA9A 4KI5M 3UJQA 4CTEA 2JE8A 3FLPA 1AR82 2CAVA 3Q8FA 1RMU2 1E57A 1UD1A 2A3YA 2OA2A 2SLIA 4LK6A 5BV6A 4DUVA 2OQ6A 5JLVA 3MIDA 4M0HA 4MGZE 5FTTC 4GB32 4YRDA 3NVCA 4QQ2A 1ULCA 2BFUL 5FZ7A 1PNFA 2Y6LA 1WW7A 4XE9A 3ZYGA 4AXOA 4MADA 1IS6A 4CDUB 5BXXA 1UQXA 1LHOA 2Q0AA 5BPXA 5ABJB 3WD5A 3O1MA 1Y4WA 4FCAA 3HWJA 3NJVA 3M8LA 2BYVE 4YFZA 5CFCA 1QMJA 1YFWA 2ZGRA 3JBG3 1ULOA 1S0EA 2A73B 3AMMA 2RS51 2OQ7A 3RYPA 5AC93 3MIFA 5T5OA 2XMLA 2FCUA 4EN9B 3EYPA 5C8CA 1XSQA 1H2MA 5FZIA 1O8SA 2OS2A 3I3BA 1W3XA 1VRH2 5BNPB 1A34A 1JODA 3SH5A 3JB4C 3APBA 5G05L 1QOTA 1RJ7A 1YQ6A 1G9AA 3B94A 1V6MA 4PQ9A 2AYHA 4OVEA 5SV8A 4D69A 4Q4X3 1ODMA 4XFAA 3SEEA 1POV1 1OQEA 2D3PA 5E89A 3WNXA 2QKDA 1VIWB 1AYN2 2EXJA 3WF0A 1PX4A 2PXJA 4A7KA 3AMHA 1QJFA 2Y6FA 1ULDA 3RVHA 1YFXA 1Q8QA 4TN7A 4RFT0 1XB9A 3BALA 3LZZA 5FY1A 5FMDA 3BTXA 3W58A 5C3QA 2ZMLA 2FDFA 2VOTA 5FPLA 3B9IA 3PDQA 4FTBA 4Q1PA 1US3A 3OY8B 2JE9A 1HRI1 4QKNA 3H7YA 4L0PA 2GC3A 1X7NA 3FJSA 3NAPB 1O3TA 5F3CA 1DQ1A 4MGKE 1YO8A 1OLQA 3IMNA 4AFDA 1SLCA 4V2VA 2Q8EA 3CF6E 4HKWA 1GOFA 5AFBA 4DUWA 1VBA1 2JKXA 2LM3A 2LALA 4NOTA 4XFFA 5F39A 2XL9A 5LB6A 3SLIA 2DV9A 4ASMB 1LKNA 1YQCA 4TTGA 1WWYA 5FZ6A 4PLOA 4HPKB 3X29B 4PLNA 1UU5A 2RJLA 1ULFA 4AHZA 2WL1A 4I3GA 1JZ8A 1BMV1 4OI1A 2LS6A 4Q0UA 3HT2A 1N1SA 1V6KA 1K5MC 5FLJA 1HXS2 1W6NB 1W90A 3H8UA 5DZEA 2Q8OA 2OPKA 1ODNA 2K2SA 4Q26A 1LOGA 5FYTA 4PCRA 3MPPG 5T5LA 1QJY2 1WLCA 2GMEA 3AZYA 3K51A 4P5YA 3SKVA 1FMD1 5ACA2 3MHZA 2WO3A 5FO7B 2J22A 1OT5A 3K3OA 4WZFA 4R8HA 1H6YA 2WSUA 2CAUA 3KT1A 2O1QA 3MV01 1ALYA 2XJPA 4NWWA 1EP0A 5DN2A 5LY2A 4ARYA 2W1UA 2D7FA 1DQ5A 1DQ4A 1UO9A 3KGZA 4G9SB 4HK9A 4IGOA 4BQ4A 1JZ5A 3JCIA 2Y34A 2YDEA 3VD3A 1HJFA 1OMIA 1Q5OA 2DU0A 3MLKA 4HL0A 3K48A 2PHWA 3LB9A 5C4WC 1LOAA 2EF6A 2G9GA 4WM8B 1CQ9A 5K0UB 2WA4A 4LE4A 4XXPA 3BGAA 4BQXA 5CEHA 2WAAA 4FTSA 1DYPA 1H2LA 3VDDC 3O0XA 4NROA 5KHIA 2PHLA 3JQWA 1PK6C 2JD4A 4Y24A 2C5DA 5E16A 3VDBA 4M3CA 2A7AA 1CPMA 1NXMA 4QPIA 4SLIA 4QT6A 2EICA 5GALA 3GJBA 4JZRA 5BNOA 5F37A 2VMFA 4BB3A 4X8NA 2ARCA 2R7EB 3LPGA 5FZEA 3MO4A 3AVSA 3LEIA 4BMBA 1RB8G 4CCKA 2G9ZA 3B00A 3WOGA 3ZYJB 3D0SA 5CKNA 2QQLA 2FQPA 4XFBA 3M3OA 3ZSEA 2VL4A 3VZLA 2XLAA 4YW6A 4YW4A 3ST7A 2DUPA 1BXHA 2X29A 3I2KA 4B29A 3VDCA 2W3JA 4NRMA 5IJRA 4UFLA 2VAUA 1AX0A 4XZPA 2R061 1X9TA 3AP4A 2RG4A 3NW4A 3GBWA 4N53B 2Y60A 3UKTA 3K46A 1ZA4A 1AR83 1HB2A 4YGBA 5A3PA 5FAXA 1FATA 2BQPA 2WABA 1W0NA 3VZMA 4CXYA 4ZZ8A 2RS52 5DAWA 3UYJA 1QH7A 1DYKA 4ARXA 2XJVA 4GB33 4JDNA 1QQP2 2V09A 1HV0A 4QM9A 1AX1A 4AQ2A 4XJWA 3ZPOA 2GP5A 3DEMA 4FOVA 4QXBA 1NCQB 3NSTA 2CU5A 2ET1A 2Y0IA 1UL9A 3B02A 2F4PA 3SKJE 3ETPA 3VLBB 1VR3A 4RD7A 1JS9A 3D6EA 3POSA 4Q4Y3 5FZOA 4FPFA 4YW7A 1JYIA 4DY3A 2J7MA 3VGIA 1ZBA3 5JZGC 2VQTA 1RUE1 3VD9A 3K3NA 1QJX2 2DF7A 2P6CA 5GLVA 3IBMA 5A7OA 5FIXA 3SHRA 3U75A 4CCCA 4OUEA 3GGLA 1SPPB 4Q4V2 4QHZA 4XACA 3V64A 1JUHA 2ENRA 4WM7C 2XQXA 2IXHA 4H14A 1XNCA 5T5JA 2ZJCA 4QGNA 1HRV1 1NA1C 4GKYA 4IV3C 4BWOA 4J25A 4CUGA 1JHNA 4BJ0A 5BNPA 2K46A 1Q8VA 2A6XA 3I49A 1CWPA 1G6NA 3E5XA 2QE3A 4LBLA 4EWDA 2B5HA 2QUOA 5GZCA 3JB8A 1NLQA 1GBGA 2A5ZA 2WS91 3HAGA 3IT8A 2OIIA 1PM4A 1W9SA 3QH6A 3WW1A 1CAWB 3USUB 1XQNA 2JDUA 4YZ1A 1QGLA 3ES1A 5IT6A 2VZPA 4LR4A 5FPAA 1JH5A 3ROUA 2PMWB 1TZOA 1ZZCA 2OUHA 4KG8A 1KITA 4ZY9A 1REDA 3IDBB 3N9MA 1PIV2 2E51A 5FK7A 1O3RA 1DGRN 1IPJA 3KZ4C 4HZFA 5B2GB 3AFKA 2RS33 4X6RB 4OLLA 5AVPA 2GNMA 2PN5A 2AENA 3T4HB 2UYAA 3WNPA 1LULA 2WBKA 3OY8A 5A6YA 3KV9A 4H7MA 4KBZA 4XABA 1R1ZA 4H7LA 3NAPA 2XL7A 3NV3A 3CMGA 1LU1A 5A7PA 1L7QA 4BQ2A 1H8TC 1BMV2 2J1AA 2VBBA 4IEVA 1NY71 3F95A 3LA3A 1RIRA 2W87A 1DYOA 2R041 3IDEA 1BLZA 5AVAA 3O1RA 4CDQA 4LE3A 3POIA 2X5IB 4L92A 5LA9A 2WINB 1CJDA 3MV11 5I0SA 5J1XA 1FMD2 1WMDA 1FOD1 1UOFA 2R16A 5JSRA 1OUSA 3LF7A 4JDMA 1K12A 2RMU3 2G19A 4JKLA 3AKSA 3KVAA 4I0BA 2MEV3 3BTAA 1MS3A 1TNRA 3VL8A 5FUPA 1SDDB 4K1YA 5GM0A 4U36A 2VOVA 1S0BA 4XBLA 1KEXA 4QQOA 1GSLA 5IWFA 3WUCA 2WO2A 1MPXA 2QDRA 3J7MA 3L2HA 2WLQA 1NCRB 2UWCA 2VTXA 3ZXGA 3IM0A 4PLMA 1YIFA 2GALA 2JDKA 1RUF1 3WDTA 4KH9A 4LA3A 2UURA 5HI0A 1DGRA 1H4GA 1VLNA 1O91A 4JTNA 5JXJA 5IFPA 4CCOA 4EWEA 5IK5A 4L8QA 3MZHA 5CFDB 3GZEA 3N35A 4L99A 3ZOIA 5JI9A 3WUDA 1UOGA 2F17A 2QQIA 3J7HA 3NKTA 4YGEA 3VZJA 2R0HA 4MXWB 1R081 5I93A 1C5IA 3ZXAC 1UIKA 4SBVA 1DBNA 3R4SA 4C8DA 4XJUA 1LODA 3ZMOA 2BU9A 3VBSA 5IVVA 1YI9A 3RSJA 2JDZA 2DYCA 4UF0B 2Y6KA 5FBJA 2E26A 2QDNA 1ZRFA 3AMNA 4JRAA 1BQPA 2V73A 1R092 4UXAA 5ANQA 4TWTA 1U0AA 4S2HA 3MICA 1OFNA 1RVF3 2R062 3CDZB 4QPWA 4U2AA 1QEXA 4CYDA 4QKFA 2ARXA 5IVBA 4I30A 3WX5A 5FP4A 2XONA 3RGBA 2JDHA 4JHZA 1XYPA 2VOXA 1REFA 3IN9A 3AYEA 3IPVA 4MX3A 1FI2A 3G7DA 1GV9A 5FJHA 4XF1A 4P9JA 4QM8A 2RM23 2PYTA 2VCCA 4A7ZA 1UX6A 2JEMA 2DUOA 3OEAA 3MI8A 5F6LB 1OKOA 1W2NA 3EJKA 3TOJA 3ZFGA 3S7EA 3ENRA 2EXHA 1JHJA 4Z1VA 5BNNA 4N53A 4Q29A 2JDNA 1RUJ2 3ZPYA 1KJRA 1E5RA 3LDRA 3PMEA 1VBB3 4UW3A 4LOTA 3GJAA 1PO11 3KSCA 4CEWB 3UNPA 2HWF3 4C91A 1ST8A 5L36A 2JXAA 4AWDA 2WO7A 1UU4A 3AP7A 1H0BA 3N36A 4NO4A 1HRV2 4FPCA 5FO8B 3ELNA 3MDPA 2VUAA 1V6NA 3JBG1 4AZZA 3BTYA 2YB7A 3I8TA 4XHXA 4AL9A 4AVBA 5AC91 1VE0A 1QXPA 3KVBA 4YM1A 1AL23 3TEYA 3WNMA 2PHTA 3H1MA 4PJYA 1ZRRA 1C8M1 2JB4A 3ACHA 3AXEA 3I3EA 4D7SA 5IVJA 3IDAA 2BEOA 2WS92 3OUIA 4QPIC 3QCWA 3I2FA 2E32A 2W39A 1YCIA 3RDIA 2QVSB 2QBXA 2RDQA 3WF2A 4DO0A 4YSFA 1SPPA 1CX1A 4K1ZA 2BJSA 3ZN6A 5A3UA 1YFUA 1IG3A 5JPMB 2AGSA 3AYAA 2P6HA 3I4IA 2J1RA 3R4UA 1DCSA 3AZZA 2Z5WA 2OZ6A 2I74A 4CCMA 4Q4X1 1OVSA 4NR1A 1KJLA 3RZHA 4YW5A 1KRIA 5JIUA 4COZA 5FZ8A 5J09A 2VZQA 2J42A 1OKQA 2VNOA 2LUWA 3T2TA 5CBLA 4XQWA 4LBMA 5I8YA 1HB4A 2AZ5A 1GQHA 1PMHX 2C24A 5FZLA 1W6QB 3TRSB 2BBAA 3WF3A 5DUXA 1SDWA 5LA1A 1GANA 5C70A 3I2DA 4YG3A 1AZDA 5FXVA 4NIAA 2QQWA 1NY72 3H7JA 2IZWA 1CAUB 4RQPA 2IVIB 4OZOA 2YG0A 4ZU4A 1VB2A 3AP9A 4AEJA 2GH2A 4LBKA 5A3TA 3NQHA 1CIWA 3HVDA 5LA0A 1P8JA 2BNNA 4IEXA 4NUBA 5JMCA 2W95A 1QF3A 1JYNA 2YZ4A 1AR91 5FLIA 1HIXA 1WA4A 4CDUC 1CZSA 3VBRB 3ETQA 4IESA 5ABJC 5T54A 5FO9B 3E97A 5FYVA 2XPJA 4DXTA 3WQ0A 4FPLA 4V2WA 4QB6A 4O7XA 5DMYA 3QLQA 2DVFA 2VH9A 2ZGOA 3JUUA 4JGYA 4KWLA 3LPFA 3VD4A 4H3WA 1RUD3 4QHBA 4BISA 4DEQA 3I3DA 3D3AA 4FPYA 3TN93 1UPSA 1WCDJ 2WT2A 2ZA9A 3IIIA 3Q9OA 1RUF2 4OZXA 3ZFEB 2ZEWA 5BNPC 2VJXA 1HW5A 2HWC2 1U5YA 1XE8A 4NIHA 1SMVA 3GNEA 3JQXA 2B7YA 5A70A 1ZBE3 5I8SA 3KM5A 2AC1A 3N4MA 1SZBA 2XBO1 4A3ZA 5JXIA 5LCWL 1Q8SA 1H4HA 4KMQA 5FYUA 4QPGB 2WZEA 5L9VA 4LULA 2RDNA 4FPGA 1D0HA 4Y26A 2YU1A 2VULA 1GUIA 1W06A 1KXGA 2ZX4A 1Y3TA 1UW8A 1WZXA 3U07A 2W08A 1UYPA 4IL7A 2TBVA 3CL1A 3VHNA 5A32B 3M4FA 5KHHA 4CE8A 2Q30A 5IYYA 1YI7A 4I09A 4GMP1 1REEA 2WLPA 3WNNA 4XUNA 3OYWB 1GWMA 3N7JA 5D8AA 3NAPC 1HJGA 1ENXA 4MXWA 4XBNA 5LZ6A 4D6SA 4FFIA 1GYKA 2Y6JA 5CFCB 3RNSA 3LDBA 1N3PA 1R093 3OB8A 4F8AA 2FZ2A 2DCTA 5G04L 4A6OA 4XYXA 5C8CB 1LESA 1MEC3 3NO8A 4NE9A 3Q8BA 1R64A 1LENA 2ZGNA 1NE6A 1JU3A 4XIOA 1RYYA 3D82A 1BEV3 4GXLA 4XQ4A 1Q8PA 1PO12 4Y1VA 1CVNA 2ZHKA 1LGBA 3DPRA 4OFGA 1NLRA 4JQTA 2DDUA 2JENA 1S2KA 1F35A 2RV9A 4BDVB 3CEWA 4YWAA 5KC5A 5FYYA 3EXUA 3RZMA 1PZ9A 4BZ4A 5K4LA 3ZIXA 4BXSV 1GNZA 4M0NA 1RUJ3 5FY9A 1GP5A 1DGWX 3OGRA 3PJQA 2B9VA 3ZSLA 3IMMA 3WDUA 2BGPA 4XFCA 5ERLA 3I59A 4KU8A 1C8M2 4QPYA 4EJRA 1BYHA 4L11A 5CIRA 4ES9A 1SBDA 1C5HA 1KDMA 1SLBA 3NRUA 4Q27A 4AW7A 4CEWA 4BQ3A 4YM3A 5C7GA 5A3NA 2QQPA 2LRPA 3VN4A 4COUA 3O1TA 2EXKA 1O5LA 4Q4Y1 4A42A 5CA6A 4WM8C 1RUI3 1NE4A 3AC0A 5FZ3A 4CU9A 5K0UC 2OZJA 5H9RA 2KXLA 4B1MA 2J1VA 4RGAA 1WBFA 1CONA 5CADA 3T1LA 1XU1A 2ES3A 4JDOA 2HWE3 3NWKA 4LMFA 4MGSA 4K3UA 4E4DX 3HPNA 3PIGA 2XVKA 4D7TA 4QX1A 3AKTA 2PHFA 1N1VA 2XB6C 2CYFA 2G4IA 4XDOA 5FRAA 1BZWA 4P9YA 3PTRB 3SCHA 4UWDA 1EAH1 1W8NA 3A0KA 2VMEA 4HLTA 1JOJA 4CP9A 2RS11 2XQRA 5J96B 4V1PA 5J48A 1IG0A 4OCTA 4R4XA 5L9RA 2MPFA 3KHCA 3K4ZA 3TWIA 3ZFGC 3FUQA 4CU7A 2C9KA 1AR92 1W9YA 5FYBA 3WQ1A 3ZMNA 4A44A 5DXDA 5FXZA 4CDWB 2CDOA 4LBOA 4N53C 4NHKA 3WLUA 2VMGA 3AKRA 1G9FA 1XPWA 5LBBA 2CGOA 2RS31 4N43A 5E8AA 5IVEA 1LAJA 1W9TA 1DP0A 2HKXA 1CAUA 2WYSA 1J84A 4HG6B 4KBBA 3WP5A 3ZFFA 2P3YA 4Y1ZA 5CVRA 3OPWA 3B3QE 5FKCA 1ZZ7A 4YLZA 1QXJA 3RFRA 1QDCA 5C5UA 4QKBA 1W3VA 2D6PA 4XHBA 1NCQC 1QJEA 4JAAA 4E4HA 5HBAA 4E8DA 2V72A 1AYM1 5GLWA 2YY1A 3ACLA 4XCBA 1XNDA 3W5NA 2H0BA 2JECA 2QQKA 5HXMA 2VZUA 3T0DA 1WGPA 2XR4A 2PTMA 2XBO2 3ZSKA 3CJXA 2HWB1 3AVRA 5FJKA 3GALA 1SBEA 3H8OA 4Q4W1 1MS9A 2RMU1 5GKAC 4HBNA 1VBD3 5BNOB 2R32A 2PAMA 2FMDA 2MEV1 1E5SA 1WMEA 2VW2A 2ZGQA 3BPZA 1AR72 4XVHA 2CGPA 3THDA 4TYSA 2BPA2 1NAEA 3OGSA 1JYTA 4M00A 1X8EA 2WT1A 5H9PA 2HBTA 1IQDC 1PVC1 3AP6A 3R0RA 4RYDA 3WF1A 1ULPA 2Z79A 3E6DA 4JTOA 1FPN3 4LHNA 3NMBA 1D4M3 3WP3A 3RG0A 4CU6A 2VZOA 2IXLA 3B7MA 4WVWA 3RYRA 4AVCA 3ME2A 4AHYA 4ZU5A 1IS5A 3N9OA 2WR9A 4UOJA 3MYXA 5DDJ2 1JYXA 3UGHA 2WWUA 4OYUA 1ZREA 1RUC1 4ITCA 4Y5SA 3ZXEA 4GWMA 3T2QA 1NT0A 1L3JA 2I45A 2PLV1 4LA2A 5FPZA 3OF1A 4XPVA 2XUEA 5A32A 4IV1B 1GU3A 1RUH3 1VMJA 4JV4A 1ZRDA 2OKXA 3VKNA 3SH4A 1OA3A 4F83A 5IAXA 1MVEA 3OYWA 2R073 4P08A 4BIOA 3UKVA 3WG3A 2P3JA 2YMZA 3UGGA 3VBHA 5KHGA 4KG0A 4OMDA 1UKGA 3PMSA 2B45X 5FZOB 1PX3A 4IGQA 3RPQA 4BK5A 4E9KA 2DU1A 2VW1A 3OOXA 3HBZA 2GP3A 4COYA 3RZKA 1QU0A 2D5HA 3CHXA 2X5IC 1QNWA 2C6SA 3AFGA 4HKOA 3BUCA 1RHI3 3C7HA 4IE6A 3VZKA 5IFTA 5JR2A 3N7MA 3K4AA 3ZDSA 1RUG2 3DYOA 1DG6A 4GWJA 2BV4A 1ZNPA 4NAOA 1NX9A 2K0GA 3GCWA 2L9LA 4AK3A 4DINB 3ZYPA 5IVCA 1NYWA 1I5PA 2Y6GA 5DAQA 4BH9A 3S0MA 1WCQA 2X09A 4Y20A 4QGMA 1BBT1 5DG2A 1CIYA 4I01A 1J58A 3NJXA 4JVAA 4NAMA 1COV2 2G9FA 1TVGA 4CPBD 3M3EA 2YBSA 4B4RA 1NCRC 3ALQA 1BJQA 4COWA 1GNYA 3IDCB 4NN0A 5CZKA 2C1FA 3KGLA 4NPMA 3BTZA 1CJPA 3POEA 3OG2A 1MS1A 1LNSA 4MUVA 3VD5A 3ASIA 3DUIA 2XXZA 1X82A 1TMF1 4L97A 4UFHA 4ATEA 4D6RA 5CFDC 4I02A 1DHKB 3IKWA 3MPBA 2J1SA 2OT7A 3GDBA 4I3PA 4XFHA 1VBE1 4FXKB 5D8AC 1AL21 3PUQA 1SACA 4LBNA 1W0OA 3RZGA 2QQMA 1R1A2 5A33B 1I3HA 2EAAA 1EAH2 2J1TA 2A6VA 2ORZA 1JOBA 2DTYA 4FOWA 2RS12 4XEZA 3USSA 4CCJA 4NWVA 4CSWA 1JZ6A 4CDQB 2KR2A 1OOPA 1GZCA 1JMUB 1X50A 2HJIA 4Q0PA 2IFWA 4Q0QA 3FMGA 2A6WA 1Q43A 1V9U3 2VNRA 1H6XA 2WA3A 1NG0A 2NM1A 1UZZA 2KD7A 4XTMA 2XOMA 5A3LA 2AREA 1EY2A 4CUAA 3RWNA 2P5BA 2W5FA 5APAA 2YC2A 5FY0A 1YC61 3TEZA 2ZHLA 2IWGB 3OGVA 2VCMA 3PHMA 2RR13 3HIFA 5FYIA 4GA9A 4ZU7A 3KF3A 3H8XA 3W21A 1AYM2 5GZDA 1EYBA 4CDWA 2IXKA 2NPIA 1OA4A 2YHJA 3TEXA 4O61A 3THCA 1ENSA 3BPSA 2ADEA 4A45A 1CAXB 4NHLA 1X33A 3N9LA 5EZWA 4XIKA 4GD4A 3B01A 1VRBA 4KNCA 4UW4A 1WUVA 4RHV1 3RMYA 4B4PA 4B8EA 4Q4W2 3GYDA 3UV9A 3ZR5A 5D1IA 1LOEA 1VPHA 3P6BA 3OD0A 4R9BA 4ET7A 2ZAAA 3LFIA 1LHNA 1PO21 4BA6A 1LOCA 2UY8A 4CP2A 1CGPA 4CDXB 2XJUA 2ARAA 4Y5TA 1GKBA 2HLEA 3N9QA 4RSUA 1DQ0A 4LO5B 2P2KA 3J9SA 1N1TA 1WCSA 2D6MA 2Z4FA 3VBSB 3WCSA 3LOIA 3J8F2 1JN2P 1CZVA 1AJOA 1J3PA 1PVC2 1VMHA 1W8WA 4XJZA 3WNKA 1TME1 3NL1A 2WFF2 5C71A 3RWKX 4K9SA 5FR3A 4Q8LA 2W1QA 4BXFA 4DZGA 5DQ0A 4BU2A 3TN91 2B8MA 3MIEA 1W6OA 3LKJA 3PVNA 1S2EA 4UT5A 3WV6A 5E88A 4IE7A 5JI7A 4QU2A 3ZYRA 3M3QA 1ZBE1 2BVBA 2CSGA 2ZX3A 3IPVB 5SV5A 3ZYHA 2PLV2 1O5UA 1ASJ1 3VHRA 1HLCA 4QXHA 2VMIA 1LU2A 4E2SA 4Z2WA 1URXA 2VG9A 4NMIA 5F5QA 5L7OB 1S0JA 4PF1A 3ES4A 3ZFGB 1QWRA 1KDKA 3K2OA 2A3XA 5BNNB 4EROA 1SBFA 3Q8AA 4CEWC 5HCAA 3GBGA 2FDIA 1MS5A 4WVZA 4FOQA 4YW3A 1PNGA 4GZ9A 5I0DA 5JOZA 1RMU3 3UL2A 3OUHA 5F3EA 3VKFC 3U0ZA 1AVBA 2GAUA 2GSYA 2WDBA 3CNAA 2YUEA 4IV1A 4UAPA 5FZGA 1QKQA 4XF9A 1MQTB 2BW8A 4TZDA 1WLDA 2WZR1 1QOOA 2OVUA 4QDQA 3GXUA 4YFWA 3U4SA 5FZFA 1I6XA 1GMMA 2YV8A 3MLJA 3VBRC 1UN1A 1GWLA 5DZGA 2WAOA 2VMDA 3H3UA 2AEYA 3KWVA 4W8JA 4GAZA 5J3UA 1RXGA 3JU9A 4B4QA 4UBGA 3CZUA 4AI3A 4D0QA 5CISA 2I07B 5KC6A 1VBC1 2ADDA 3R6SA 4D94A 2H0VA 3P3PA 5A6QA 3ZM8A 3ZN6B 1RUG3 2RJ2A 4L9BA 1JYCA 1VRH3 4XF3A 5HCFA 3HQUA 2B39A 4N7IA 4QXCA 5CB7A 5BYNA 1EV11 2H6BA 5A7SA 5HCBA 2VMHA 3ZFEC 3C7EA 5HCHA 2QJVA 4NIIA 3VV1A 4GH4B 4P5HA 1IS3A 2E31A 4OHXA 1TMF2 2CHHA 1L7RA 4KWJA 2WYFA 1T2XA 3RQ0A 1XC6A 3ZKYA 1COV3 4BK4A 1HRI2 3I54A 4QPGC 2A1XA 1VBE2 2IVJA 5D2AA 2O14A 1AYN3 4RFRB 3NNLA 1UNBA 5IW0A 1OLMA 3SNMA 1W2AX 1NUKA 1W6MA 3H0OA 1OC1A 3JD71 3OBAA 4RQPB 1AUYA 5FPXA 5F6KA 1SHWB 2ZHNA 1VBA2 4YG0A 2JJ6A 5DAXA 2C9AA 5C3PA 5JDBA 2GN3A 3UKNA 3ZR6A 1MZ5A 3O0WA 3VKMA 3FBYA 2ERFA 3PNAA 4RR3B 2BFUS 5EP9A 3S30A 2EIGA 4XAAA 4OULA 2HWE1 3T2OA 5CFCC 5A33A 1QJU1 2KM2A 4CXWA 4Z07A 4Q2FA 2VZVA 3C7OA 4JGYB 2WNEA 3N9PA 1UMZA 3AZXA 3EO6A 4DRVA 2Y8KA 5C8CC 2BGCA 1TNFA 3M3CA 2VU9A 4OI4A 4O65A 4OUSA 5EJ1B 3BVCA 4BQ1A 4XMAA 3SC7X 3KQRA 4F3JA 1WA6X 5K7PA 2FDHA 1ZRIA 1S55A 4XOGA 1O3SA 5FXXA 3VL9A 4B7EA 4A4AA 1WW5A 1HXS3 4LIVA 4RHV2 4XURA 3HNBM 3OGJA 4N90A 2VVEA 4GQ7A 4JGZA 5EHDA 4GMP0 5CYYA 3T08A 5J98B 5HV4A 1IPKA 3FHAA 1QJY3 4YGCA 5F9TA 5FOJB 2WN2A 3P5BA 5ACA3 3MLLA 4AEMA 4CVUA 3CU7A 2EALA 3OPTA 1C8NA 4JX0A 2NQYA 3DYPA 3PURA 2W52A 1M4WA 1OBNA 4E8CA 4Z8BA 4Q0SA 1TME2 4IEOA 5D21A 3D0JA 2OXBA 2UY9A 1CAXA 3GHMA 3QOPA 2GNDA 2ZZJA 5L9BA 4MZUA 5JPNB 4LQRA 2HWD1 5GLUA 5F32A 2AH2A 1JUIA 1WW4A 5D8AB 3E6CC 1FT9A 4LORA 4CDXA 1B35B 5C9AA 4DEVA 2FD8A 5EIYB 2GC0A 3J8F3 5F7UA 2WNUA 4AGGA 1S1AA 3VHOA 4LXLA 5T5PA 1D2SA 4YVWA 4AI1A 4K21A 1F15A 1O4TA 2JDAA 2UU8A 1MZ6A 2D6NA 2BZDA 3CIHA 5F8PA 2D43A 4QX7A 4MOAA 5I0UA 2WNVB 2Y6HA 3OD4A 2ZMNA 3I97A 2XHNA 4MYEA 4XJ8A 5FMOL 4M3CE 4HVOA 1W8UA 2RDSA 4HVQA 4B3NA 1V6IA 5A7NA 5KXEA 1YWKA 4AFCA 2AR6A 2QQOA 3N3HA 1FXZA 1YQ2A 1Z7S1 3DPRB 1FPN1 1XYNA 3U1XA 4KQ7A 1NQJA 3KV6A 1AX2A 1PVXA 3JZVA 4QKDA 2MHFA 1A6CA 2BOIA 3A7QA 3HN1A 5L7OA 2VM9A 1IZ3A 2WZR2 4LUMA 4QMAA 1LOBA 2ID4A 2HEVF 2RJKA 4QX0A 4CDWC 1V6JA 4FFHA 1DQ2A 2BTVC 1B09A 1VP6A 2CV6A 4MGYE 3I59B 1RUH1 2RS53 1LR5A 3IIAA 4MXVA 4EN8B 4FQZA 1GZWA 1QQP3 3O12A 1RUE2 3FHQA 1D4VB 5IHRA 5FYZA 4QDRA 4CUCA 1UY4A 1VBC2 1UY3A 1XNBA 3WEZA 2R071 4LT5A 1ZZ9A 2N7GA 1APNA 4URAA 3ZSMA 4FPJA 3NJYA 3K77A 1G86A 3THPA 2E63A 1MQTA 3POGA 4WM7B 1RJ8A 2WRAA 4FT8A 1EV12 3SH3A 3ZSJA 1J59A 4E4SA 4Q1RA 3LEMA 1UOJA 4NHXA 3Q8EA 4PBPA 3WDWA 2P17A 3FUOA 2ZEZA 5EXOA 1GZ9A 1QJX3 3H8RA 1POV3 4Q4V3 1IKQA 3EQEA 1ULGA 4LPLA 2BP6A 5IAVA 2C0ZA 1C1LA 1ONAA 4GALA 4ISQA 4Y4RA 4D6QA 5BNOC 1W04A 4EQVA 1OHFA 3SEPA 5DAPA 3NNGA 5ANNA 3JD72 5A1FA 3D5OA 3FC0A 2NMOA 3DL3A 2X53S 5IK8A 5CKQA 3WQBA 4CP9B 5FZCA 1LGNA 2D97A 2ZGMA 4Y5Z0 4GH4A 1Z0HA 2IFRA 2PA7A 3BN6A 3C2UA 1E5IA 5A7QA 3I2IA 4I2OA 3FZ3A 2YXSA 1DDLA 4BLJA 3HQRA 5LRRA 4AYUA 1SLAA 3AP5A 4GKXA 1AXYA 3EHKA 1EPWA 1K42A 2WT0A 2WWSA 3AX4A 4XAEA 4N43B 1QJU2 3P3NA 4IEQA 1OLRA 3E6BA 1DFQA 1PIV3 3C8XA 4XQDA 1JZ7A 3ZFFB 2NZ9A 2BNOA 1AR63 1KFUL 1POQA 2GDFA 2R042 2ZCWA 4IV1C 2TEPA 4IEUA 4J1XA 1U5XA 2DBIA 1UZWA 1FOD2 2YBKA 2Q1FA 2P4EA 3KV4A 4RR3A 1OD5A 4BHPA 3B69A 4QB2A 2B4KA 4AE2A 1UOBA 2ORXA 3WF4A 5M0TA 2NN8A 3J4UH 4ZS2A 4B7KA 1CZTA 2BRTA 5A3OA 2ZX1A 4LEJA 3U11A 4PDWA 1MACA 2JIGA 2ZGKA 3AZVA 2BERA 1CR7A 1FMD3 2VUJA 3VHPA 3RZLA 3MUY1 2DCZA 1CX4A 1N3OA 3KQ4B 4LJHA 5EYXA 1ZZ6A 5FP7A 4ZXEA 4CCLA 4E4ZA 3OGGA 4EN7B 1X9PA 2KA3A 3GHNA 1PHMA 1RTVA 3QACA 2JKBA 4A2UA 2GU9A 2ZGTA 4XJ9A 5A7WA 4LO4B 4I0AA 4YG6A 4XUQA 3DF0A 1CD3G 2Y26A 1WCUA 4PBOA 1LEDA 2HWD2 3O1SA 4DQAA 2YYOA 2ET7A 2PQQA 1FYUA 1GOGA 4GULA 1R082 1XNTA 1ZZ8A 2CDPA 4O9GA 4QX2A 1LJ7A 1NLSA 3E5UA 5EWSA 2JG8B 4OI2A 4S2GA 4EN0A 2VZ1A 4A6SA 2BWAA 4NIDA 1AL0G 1AF9A 4R52A 5FY5A 4DXZA 2C4XA 1ULEA 4CPBA 1V70A 4D8MA 1W8ZA 2XJRA 3KMHA 3WQ7A 1J1TA 5JXGA 3LOBA 4E2GA 4Q8KA 3VBHB 1HV1A 2DVGA 3B9CA 4N7UA 1B35A 5LEKA 3MW2A 5JOXA 2ZACA 4LLFA 4DB5A 3QD6A 5BNQA 1I5ZA 1XOYA 2ZXQA 4PF5A 2WKKA 2E9QA 2LTNA 4CDQC 3RYKA 5H9SA 2R063 3P1IA 4C1WA 1F4HA 3DXTA 1FNZA 3LCPA 1ENRA 1POV0 5GJ6A 5GLZA 4FPHA 4YNIA 3WDYA 4BIFA 3OJBA 1DGLA 4HFSA 2WNVA 1BCXA 3O14A 1IHMA 4IGPA 4O9EA 3WP4A 3CLPA 4GIQA 1KFXL 2OW4A 1MVQA 2VTFA 1AJKA 5JSOA 2YPDA 4HXCA 2XJQA 3DXUA 1V0AA 3BKZA 3FBMA 4QWNA 4Y20B 1FV2A 1IQAA 3M70A 3MF9A 4OI0A 3S5QA 5LASA 4H2AA 4MGTA 2VNGA 4OUMA 1AR81 3JBG2 1DLCA 4DOUA 2QZ3A 4GB31 3V56A 3WHUA 4M01A 5AC92 4W50A 1BK0A 3KCXA 1HB1A 4AVVA 3AYCA 1RUOA 2D93A 5A1AA 1V6OA 2YGMA 5B4NA 4YZ5A 3HEIA 4FPKA 3HMYA 2VZTA 1H9WA 1QHDA 5FK8A 1SLTA 1ZYBA 4J1WA 1W03A 5FZHA 4P02B 4MVTA 1HRV3 2DCKA 3ZVXA 3I3MA 5T50A 3BB6A 3W59A 4CDXC 3HNYM 1K5MA 5LBEA 3G6JB 4LNVA 3ZXDA 4JQRA 5JAXA 5C3SA 4AVSA 1ZBA1 4NVPA 4UFMA 2F4LA 4Q4X2 3VBSC 5LY1A 4BMEA 2Z2SB 1IKPA 1UY2A 2RE9A 2WS93 4OHVA 4EYUA 2VZSA 1GFF2 1OOPB 3GZUC 2D40A 4NHYA 1VRH1 5FFOC 2Y0OA 5F2SA 3FFQA 5I0RA 3OCPA 4DPNA 3T0AA 2DVAA 1F5JA 1WMXA 4MLOA 5JUVA 1SG3A 4XCAA 2VPVA 4GWIA 1ND2B 2JDMA 3MF6A 2AUYA 3TYJA 3WSOA 4N9HA 4OMCA 1RXFA 3GZTB 4AQTA 4EWAA 1GNHA 3AKPA 1UAIA 2D44A 4P9IA 5C4WA 2NMNA 1AYN1 1BVVA 1LHUA 2ARBA 2JDYA 2VOWA 5L7OC 2EXIA 1DZQA 4GJZA 4LHKA 4UI9L 3VDDA 4UFJA 5FLHA 3MW3A 1OURA 5DG1A 1U5IA 4FPOB 2ZEXA 5BNNC 3WW3A 4LITA 1VALA 3HR9A 4XFGA 1KQRA 3POYA 3ILRA 4FAGA 1UZVA 3QBQA 5FMCA 1I1EA 4K6BA 1UY1A 3U14A 2LW8A 4UFIA 5GZGA 3WNLA 4RL7A 1FOD3 4XTPA 4CCDA 2WNOA 4OQ8A 2XUMA 4QHOA 2PAEA 3LIHA 1MQTC 4AR2A 4XBQA 5FPBA 2ZGLA 2BNMA 4QQLA 4AQ6A 1WMFA 5KXCA 2ZBJA 2G1MA 4YZ2A 3ILFA 1J83A 5LBCA 3NV1A 2EIEA 4HETA 3BIEA 3BU0A 3PUHA 4Z92B 3ON7A 2QQUA 2ZOEB 4NRQA 1A8MA 3VBUB 3ZYFA 1SEFA 4LKFA 4FQ4A 2UWAA 4JC1A 2W68A 1LECA 1W6OB 4YPJA 3H50A 4HSJA 3ZXLA 1RUNA 1DZTA 1RUF3 5E6HA 1U12A 4L2NA 4FBFA 4AEDB 1FV3A 1OF4A 2O0OA 4BQWA 2HWC3 1Q3EA 4NPLA 2NP0A 4P9LA 2E7AA 5JWPA 2CWMA 1G9BA 1QOSA 3IB3A 2D3SA 4LBQA 1QJY1 3RMXA 4AAPA 4GH4C 4JKMA 4XFIA 2DFCA 3NV4A 5ACA1 3OUJA 3AL5A 1YYNA 1W99A 4QQPA 3KF5A 4CRQA 3GBFA 5JZGA 3A23A 2JDPA 1ZRCA 5LW9A 3MEPA 1X36A 2W46A 3QH7A 3ACFA 4IQPA 2PHRA 4XZUG 4JKKA 2VVDA 4WM7A 4MHRA 2JG8A 1PGSA 3OEBA 4RQPC 4COVA 1DLLA 1LHVA 3HD8B 3OBZA 5LK5A 5T3NA 3WCRA 2JICA 3HN3A 3J26N 2VBDA 2X10A 3PLQA 4E27A 1YUDA 4OHYA 4IV3A 2VZRA 3MFCA 2DVDA 2IXJA 3DECA 4UW6A 2PQSA 2CNAA 2W1WA 2XGXA 2QTWB 3TB0A 1GLHA 2FCTA 3MIGA 1CAVA 4RR3C 2W9XA 4WVMB 4YZ4A 5CG9A 2GC2A 4D7YA 3PUAA 2XLFA 3KT4A 5C5TA 1UF2C 3V0AB 1ENQA 3NNMA 3POJA 5IK7A 2R30A 3TBDA 2JG9B 1W39A 4LIUA 1RVF1 2E33A 1C4RA 3ZYIB 4JGYC 3A4UA 1XYOA 4XILA 5E1RA 5K8SA 1Q8OA 3OSDA 3VZOA 5FYSA 1HDKA 4K7JA 3VDAA 3ZXFA 5LEJA 1MS4A 4R9AA 5F5AA 2VE1A 3SITA 1A78A 2DURA 2JB8A 3IWZA 1PO13 4JCKA 2RM21 3H1YA 1DZRA 2YGLA 2PHUA 4HK8A 3HOBA 5H9QA 5J7MA 3ZLIA 4DNYA 5FXWA 4YW1A 5LBFA 2DCYA 4AVAA 1H9PA 2Q1ZB 3VKOA 3BOWA 4QAWA 1IGOA 2PELA 2Q8DA 1WD4A 1CPNA 1H8TA 5FYCA 4P14A 4AI8A 4Q4Y2 4UBHA 5F3IA 3LQCA 3POWA 4YZ3A 2P34A 1C3HA 1VBB1 1QQP1 1ZBA2 4BQ5A 1W6MB 1NOVA 1GOHA 3T2PA 3O1UA 3IZOA 1C8M3 2FBEA 1NZCA 2HWF1 2YPJA 2WC2A 1MZFA 1W8FA 2R1DA 3A0NA 5FCCA 5FYMA 2VW0A 5A80A 1JOPA 4DXSA 4MGQA 4XDQA 2ZZQA 2WZPP 3RJRA 5LWBA 4IEZA 4QX5A 4XUTA 3ATGA 3IAPA 2HH9A 4FFGA 4E2QA 2IXIA 1RGSA 1QJX1 2IXCA 1B35C 5EPAA 3NNJA 4JHTA 5FZBA 4QQHA 3WHTA 4Q4V1 4W4ZA 5FKBA 3THTA 5FOBB 2A6ZA 3E5QA 4LLOA 3HJRA 3U10A 1SCRA 1YLLA 4P00B 2WQ8A 5TSWA 2PHDA 4WBBA 3HNMA 1LB2A 3SXWA 2Y38A 2WNVC 4LTAA 3EBRA 4FP2A 1HN1A 5FBZA 4CP0A 1BVP1 2QZ2A 3CJIB 5KBFA 2RS32 1ND2A 1ZM1A 4XC9A 3DPRC 4CXXA 4HMZA 1KS5A 2OX0A 1NZIA 4QXKA 5LRSA 4JGZB 5FPUA 1UU6A 2VY0A 3WZ1A 3CO2A 1AR93 4K40A 4ZS3A 3U78A 4CEYB 3O7OA 2VD7A 5IUQA 2E6VA 1PIV1 4CCEA 4LHLA 3ORJA 2YC4A 1AR61 3HT1A 1GP4A 4UFKA 4CUBA 1N47A 4LKSA 4LK7A 3S5AA 2XG3A 4XUOA 4RN5A 2ZS6B 2BBVA 5LA2A 3FLTA 2HWB2 3M7AA 5KR7A 3AK0A 2FDJA 2AEZA 2VQAA 2X8KA 1RL3A 2RMU2 5EJ3A 1C1FA 2FDGA 1DQ6A 4RS5A 5GLTA 2MEV2 1NKGA 3PL0A 3OPZA 4TLFA 5DZFA 5C9AB 3AL6A 2WNUB 4HVRA 5LATA 1ND3B 1SQ4A 4HONA 3VD7A 3A22A 3VBOB 1A8DA 3D8CA 1QH6A 4K8FA 2XBO3 4YVWB 4AHXA 1UXZA 4YM0A 3H9AA 4MGIE 1DF0A 1RUD1 2W47A 5IVYA 4FO9A 1JZ2A 1D2QA 3VBUA 3WDXA 2W2IA 1H8VA 2UYBA 4M3CF 2FHRA 5JIAA 5GZFA 1W6PB 1OF3A 4KL1A 1AR73 2D3RA 3JXSA 4BM8A 5CG8A 4K20A 3URFA 3AMPA 1FNYA 4AEDA 1RUC2 1UCXA 3AZWA 4Y33A 1FX5A 4WVVA 3GCXA 4GMP3 5AFEA 3WY6A 2A70A 2K9ZA 2WN3A 4ASLA 4D3WA 2O8OA 3I2JA 4KWUA 3KCCA 3NJZA 1GWKA 4H55A 1PMJX 1SLIA 4MO3M 1UXXX 3ZKUA 5FMBA 5DDJ3 3DCQA 3ECQA 2Z42A 4P9XA 3V0BA 2D6KA 4PI0A 4IEWA 4AFMA 1W8OA 3T4VA 4PIYA 4N43C 1GZWB 2FCVA 4KWKA 1RVF2 2XDVA 3A21A 3ZXKA 5I0TA 3ZFFC 4HT1T 1OA2A 3L2YA 1O4ZA 3KD4A 4IE4A 4LBJA 4TSVA 4Y22A 4ISRA 5CKMA 2OYZA 2A71A 5HPOA 3O5SA 5I91A 2E7QA 2VVFA 1W2OA 4DIQA 4WVMA 2RM22 1PM7A 1GQGA 4IEPA 4IE0A 1R091 1MS8A 3V0AA 4LKEA 4Z82A 1JI6A 4WZCA 1XSRA 5EFUA 1H2KA 4TXWA 1MEC1 3ZO0B 2JG9A 2GH8A 4PI2A 1BBT2 3UESA 1G7YA 1X8MA 3Q8CA 1BEV1 4MSVA 3S7IA 4NJ4A 3O1VA 4LBQD 1VBB2 1S0FA 5FUNA 1BHGA 2YC0A 1OQ1A
chains in the Genus database with same CATH topology
1F8VA 4YVSB 2HWF2 2XKPA 3AYDA 4CDUA 2GN7A 2WSVA 2WQ4A 1ZX5A 1RUJ1 5ABJA 1SCSA 2CWSA 2VGDA 3DGTA 3N7KA 1SFNA 3WR0A 1AL22 3PVBB 4C1XA 1Y43B 1S0GA 1T6GC 1F2NA 3ZN5A 1I9RA 4A7YA 5T52A 2JG8C 5KHKA 1F5FA 1QXRA 1JXNA 3SCGA 4C0BA 1H2NA 2F6BA 5JR7B 2A75A 2XJTA 3VKLA 3VBFB 1RUI1 1OI6A 2Q4SA 3VUOA 1IS4A 2BUKA 2DVBA 1R1A3 5FREA 3WT3A 2GMMA 1SFYA 4W6XA 3VBHC 1EAH3 4XF0A 3BCWA 3ZXJA 2B46X 2BWCA 1TQ5A 2RS13 5KHJA 4PDWB 4XMIA 2A6YA 1YJKA 1UKRA 3WG2A 1GICA 1RC6A 4F7ZA 4IERA 1UIJA 3CJIA 2NLRA 1H1AA 3HQXA 3WVJA 2MNGA 1WLTA 4CP1A 5A3MA 2QFEA 1JW6A 4JRLA 5EV7A 3AMQA 4ZKTB 3WG4A 2B42B 1PO22 1S2BA 3WINE 4A3XA 1AYM3 4CEYA 1G8WA 1XRUA 3KB5A 2FZ1A 1C57A 3LSDA 4URTA 2VXRA 2HYKA 3MIBA 2EAKA 1RUD2 2HWB3 1YFYA 2DTWA 4HPKA 4Q4W3 3TN92 1J1LA 2PFWA 3BOPA 1HKDA 3AM2A 1O7FA 2XVGA 5JVVA 3LSEA 4FSJA 2DFBA 3MGUA 2R0FA 2H6CA 2CY6A 3ILNA 1ZBE2 5HXVA 4AEKA 1W6NA 4IEYA 1PVC3 1GR3A 1ASJ2 1ND3A 1XE7A 3VBOA 4Y1XA 2CTVA 2WFF3 4XF4A 1WCKA 4C90A 1VBD1 1YXWA 4DMIA 5J37A 1PGL1 1OOPC 2WJSA 5KWRA 2ZPXA 5FQ0B 3O0VA 2HWC1 3H3ZA 1KD7A 5J36A 2VOKA 4AGVA 1RUC3 1W6PA 3RZZA 2I2SA 1G9CA 1WW6A 2GNBA 2QNKA 2XLGA 2PLV3 1ND2C 4BE3A 1WD3A 4BLIA 4DFSA 5JOYA 2QCSB 2O8QA 4BYYA 1C28A 1MS0A 1VJ2A 2ZTNA 4AFAA 1D4M1 4WM8A 3DV8A 5K0UA 2VQ0A 1H30A 3GZAA 4W6WA 3GF6A 2YROA 1EPZA 1RINA 1YJLA 4PIZA 4LO8A 5L19A 4QGLA 5LK7B 4S2DA 1MEC2 1AHSA 3B5LB 4AQSA 3RJ2X 2Q1MA 4EV0A 1VAVA 4OHZA 3VZNA 4DS0A 4HN1A 1BEV2 4RS5C 2D98A 2XVLA 1K5MB 2CL2A 3BU7A 4YM2A 5L73A 4LO7A 4FPEA 4GWNA 1BBT3 1Y7BA 1RHI1 3VBUC 4FTEA 1LOFA 1F31A 2HEWF 3KS7A 4HSLA 1DIWA 1BK1A 1Z78A 1OFSA 1NQDA 3UJOA 2ZX2A 4AEDC 5I91A 3SISA 2GMPA 4UW5A 1ZVFA 4YVSA 3NV2A 2V5YA 1NCQA 5C4WB 4ATFA 5IK4A 3OBTA 1TMF3 4AFBA 3L9JT 4ONUA 3FHIB 4Q0VA 1HRI3 1U5ZA 1RUI2 1VBE3 5T55A 4LO6B 4Y1YA 3VDDB 3PJYA 3WDVA 1PK6B 5FDBA 5CNAA 4AI0A 4NHMA 3LA2A 2R6QA 5JSPA 3KCYA 3RI8A 1QJZA 2HWE2 4AI2A 2ZGSA 2W0XA 3AKQA 1VBA3 4FP3A 1SLLA 4FVVA 3S6PA 5F1RA 4ES8A 1LCLA 1PMIA 2GZWA 2ATFA 1F9KA 3RI9A 4OHWA 3VBFA 2DCJA 3NKGA 5DUUA 3WW2A 4R9DA 4C0HA 4R9CA 4NPRA 4J6GA 4R4ZA 1CAWA 2JG9C 3USUA 1OPMA 1V9U1 3FX3A 1TE1B 4META 1JBCA 1PGW1 1CN1A 5C33A 1WLWA 1FAYA 2XKOA 2E7TA 1V6LA 4G3YC 1VB4A 5CAZA 3LA7A 4X8PA 4LBQB 4RHV3 4P9GA 2RR11 4W65A 4IETA 2D5FA 2GNTA 1WBLA 1MR5A 3SCFA 3TAYA 1PO23 2ZX0A 4AG4A 4FOYA 4XETA 3ZIWA 2R49A 4BOWA 2WQZC 5JZGB 5K9YA 2P3KA 2D6OX 2ZGUA 2RHPA 2PHXA 2ZMKA 3FLRA 1W0PA 2XWBB 3AB0A 2X5IA 1OQDA 1TME3 4WM7B 2JE7A 3AJZA 1VAMA 1VBD2 3SMHA 1NA1B 1PGL2 1VAKA 1XNKA 1LRHA 4IV3B 1ZZBA 1LGCA 4XJAA 4PIXA 5JCTA 1PZ8A 1HX6A 1CAVB 1AXZA 4N9IA 4AF9A 3MFAA 4KGQA 5EYYA 3WXPA 1ASJ3 2EA7A 3KT7A 1Z7S2 1S0DA 4BPZA 1FPN2 1D4M2 3UK9A 1Q56A 5I8TA 3M1HA 1N1YA 2P37A 2UWBA 1NCRA 1AR71 4I0WB 2ZKNA 2WFPA 4HANA 2ZGPA 2WIIB 4HN0A 4YW2A 3C3VA 1N3QA 4FXGB 1S0IA 1LTEA 1RUH2 3CJIC 5CFDA 3FFZA 4AVTA 2FMYA 1IOAA 2DUQA 5KXBA 1MZEA 2GC1A 2R072 3ZX7A 4FAHA 4YARA 4JGZC 1HQLA 2D6LX 2WZR3 5DDJ1 1H8TB 4XW3A 1OSGA 4CEYC 3TNPB 2EVXA 1RMU1 5GZEA 1W2UA 1HQNA 2XJSA 1RUE3 2XHKA 3AXDA 3N7LA 3WP6A 4QD2A 1RHI2 1VBC3 2IC1A 3RRDA 4LUKA 5JOWA 3KLSA 1EV13 2NYYA 1O3QA 2HEYF 5C6CA 1QNYA 3RS6A 1KS4A 1QDOA 3AJYA 4MV2A 3BIWE 5DUWA 5C9AC 2WNUC 1ND3C 3VBOC 1NXD1 2DWRA 1H1IA 4YVWC 4CZSA 1RUG1 4IXLA 2CGNA 1Y9QA 2B9UA 5BUVA 1H1MA 4Y1UA 1LHWA 4W6YA 3JD73 3B93A 1J3QA 4ORFA 5FMOS 2SBAA 2XWJB 1COV1 2OUJA 4P9WA 1AXKA 1YNAA 4AHWA 3OTFA 3MW4A 1A3KA 5BY5A 3BODA 1PK6A 3PVOA 1S0CA 2ZAHA 4RGGA 3W9AA 2Z69A 1QJU3 1QY4A 2A3WA 3LGRA 1TEIA 5DUVA 2R043 4DRRA 1V9U2 2ETEA 1D0GA 1YIPA 2VECA 3LAGA 3MIHA 2E53A 1PGW2 5C8WA 1BKZA 1YHFA 4Y4YA 1R1A1 4AGRA 4KGGA 4RS5B 3FE5A 2ZABA 3H1WA 1XXNA 4X6QB 3OBRA 3DKWA 3D4KA 4WV8A 2RR12 3TNQA 4S2FA 4XXAA 3R4DB 4EN6B 1W6QA 4KU7A 2XH6A 2TNFA 1LOFC 4HKLA 4YYOA 1O4YA 3V65A 4ZXKA 4INDA 3M2MA 1PZ7A 2P3IA 4YVSC 1DGWA 1HXS1 3INAA 5BXXA 3R05A 1UZYA 2TUNA 1RITA 1V00A 5KXDA 2HWD3 1YRZA 3FWEA 3VBRA 1XU2A 1JTZX 1R083 2ZKLA 3M3IA 4BCUA 2PAKA 4M3CB 3V0BB 4QPIB 1M06G 4YGDA 1OPOA 2ZHMA 4MH0E 3WG1A 3I7DA 3PTYA 4Y22B 2ILMA 3PVEA 1NA1A 4G4FA 5CU1A 3ZFEA 1J3RA 3DN7A 4RA0A 3VBFC 3J8F1 2WFF1 1HQWA 1Z7S3 1DU3D 1CESA 3T1MA 3WW4A 2R1BA 1LEMA 3LWCA 3ZN4A 2JX9A 4QPGA 4DY5A 1G9DA 2BVVA 4PDWC 1UPIA 2Q5TA 4CTEA 3UJQA 3FLPA 1AR82 2CAVA 1RMU2 1E57A 1UD1A 2A3YA 2OA2A 2SLIA 5BV6A 5JLVA 3MIDA 4M0HA 4MGZE 5FTTC 4GB32 4YRDA 3NVCA 4QQ2A 1ULCA 2BFUL 1PNFA 1WW7A 4XE9A 3ZYGA 4AXOA 1IS6A 4CDUB 1LHOA 2Q0AA 5BPXA 5ABJB 3WD5A 4FCAA 3HWJA 3M8LA 2BYVE 4YFZA 5CFCA 1QMJA 1YFWA 2ZGRA 3JBG3 2A73B 1S0EA 3AMMA 2RS51 3RYPA 5AC93 3MIFA 5T5OA 4EN9B 5C8CA 1H2MA 1VRH2 5BNPB 3SH5A 3JB4C 3APBA 1QOTA 1RJ7A 1G9AA 3B94A 1V6MA 4PQ9A 2AYHA 4OVEA 5SV8A 4D69A 4Q4X3 4XFAA 1POV1 1OQEA 2D3PA 5E89A 3WNXA 2QKDA 1VIWB 1AYN2 2EXJA 4A7KA 3AMHA 1ULDA 1YFXA 1Q8QA 4RFT0 3BALA 3LZZA 3W58A 2ZMLA 3B9IA 4FTBA 4Q1PA 3OY8B 2JE9A 1HRI1 3H7YA 2GC3A 1X7NA 3FJSA 3NAPB 1O3TA 1DQ1A 4MGKE 1YO8A 1OLQA 3IMNA 4AFDA 1SLCA 3CF6E 4HKWA 5AFBA 1VBA1 4NOTA 2LM3A 2LALA 4XFFA 2XL9A 3SLIA 2DV9A 4ASMB 1LKNA 4PLOA 4HPKB 3X29B 4PLNA 1UU5A 2RJLA 1ULFA 4AHZA 2WL1A 4I3GA 1BMV1 4OI1A 4Q0UA 3HT2A 1N1SA 1V6KA 1K5MC 5FLJA 1HXS2 1W6NB 3H8UA 5DZEA 2Q8OA 2OPKA 2K2SA 4Q26A 1LOGA 4PCRA 3MPPG 5T5LA 1QJY2 1WLCA 2GMEA 3AZYA 3K51A 1FMD1 5ACA2 5FO7B 4WZFA 4R8HA 2WSUA 2CAUA 3KT1A 2O1QA 1ALYA 2XJPA 4NWWA 1EP0A 3KGZA 2D7FA 1DQ5A 1DQ4A 4HK9A 4G9SB 3JCIA 2YDEA 1OMIA 1Q5OA 2DU0A 3MLKA 4HL0A 3K48A 2PHWA 3LB9A 5C4WC 1LOAA 2EF6A 2G9GA 4WM8B 1CQ9A 5K0UB 2WA4A 4LE4A 4XXPA 4FTSA 1DYPA 1H2LA 3VDDC 3O0XA 5KHIA 2PHLA 3JQWA 1PK6C 2JD4A 4Y24A 2C5DA 5E16A 4M3CA 2A7AA 1CPMA 1NXMA 4QPIA 4SLIA 4QT6A 5GALA 5BNOA 4X8NA 4BMBA 1RB8G 3B00A 3WOGA 3ZYJB 3D0SA 2FQPA 4XFBA 3M3OA 3ZSEA 3VZLA 2XLAA 4YW4A 3ST7A 2DUPA 1BXHA 2X29A 4B29A 1AX0A 4XZPA 2R061 3NW4A 3AP4A 4N53B 3GBWA 3UKTA 1ZA4A 1AR83 4YGBA 5FAXA 1FATA 2BQPA 3VZMA 2RS52 1QH7A 1DYKA 2XJVA 4GB33 4JDNA 1QQP2 2V09A 1HV0A 4QM9A 1AX1A 4AQ2A 4XJWA 4FOVA 1NCQB 3NSTA 3VLBB 2ET1A 2Y0IA 1UL9A 3B02A 2F4PA 1VR3A 4RD7A 3D6EA 3POSA 4Q4Y3 4FPFA 1JYIA 4DY3A 3VGIA 1ZBA3 5JZGC 1RUE1 3SHRA 1QJX2 2DF7A 5GLVA 3IBMA 4Q4V2 3V64A 1JUHA 2ENRA 4WM7C 5T5JA 2IXHA 4H14A 1XNCA 2ZJCA 4QGNA 1HRV1 1NA1C 4GKYA 4IV3C 4BWOA 1JHNA 5BNPA 1Q8VA 2A6XA 1G6NA 3E5XA 2QE3A 4LBLA 4EWDA 2B5HA 2QUOA 5GZCA 3JB8A 1GBGA 2A5ZA 2WS91 3HAGA 3IT8A 2OIIA 3QH6A 3WW1A 1CAWB 3USUB 1XQNA 4YZ1A 1QGLA 3ES1A 5IT6A 4LR4A 3ROUA 1JH5A 2OUHA 1ZZCA 4KG8A 1KITA 1REDA 3IDBB 1PIV2 2E51A 1O3RA 1DGRN 1IPJA 3KZ4C 4HZFA 5B2GB 3AFKA 2RS33 4X6RB 4OLLA 5AVPA 2GNMA 2PN5A 2AENA 1AR62 2UYAA 1LULA 3OY8A 4H7MA 1R1ZA 4H7LA 3NAPA 2XL7A 3NV3A 1LU1A 1BMV2 1H8TC 4IEVA 1NY71 3LA3A 1RIRA 3IDEA 2R041 5AVAA 4CDQA 4LE3A 4L92A 2X5IB 2WINB 1CJDA 5I0SA 1FMD2 1WMDA 1FOD1 2R16A 5JSRA 4JDMA 2RMU3 3AKSA 4I0BA 2MEV3 3BTAA 1MS3A 1TNRA 3VL8A 4K1YA 5GM0A 4U36A 2VOVA 1S0BA 4XBLA 4QQOA 1GSLA 3WUCA 2QDRA 3L2HA 2WLQA 1NCRB 2UWCA 3ZXGA 3IM0A 4PLMA 1YIFA 2GALA 1RUF1 3WDTA 4KH9A 4LA3A 2UURA 5HI0A 1DGRA 1H4GA 1VLNA 1O91A 4JTNA 5IK5A 3MZHA 4EWEA 4L8QA 5CFDB 3N35A 4L99A 5JI9A 3WUDA 3NKTA 4YGEA 3VZJA 2R0HA 4MXWB 1R081 5I93A 1C5IA 3ZXAC 1UIKA 4SBVA 1DBNA 3R4SA 4XJUA 1LODA 3ZMOA 3VBSA 1YI9A 3RSJA 2JDZA 2DYCA 2QDNA 1ZRFA 3AMNA 4JRAA 1BQPA 2V73A 1R092 4UXAA 4TWTA 1U0AA 4S2HA 3MICA 1OFNA 1RVF3 2R062 4U2AA 4CYDA 2ARXA 4I30A 3WX5A 1XYPA 2VOXA 1REFA 3IN9A 3AYEA 3IPVA 4MX3A 1FI2A 3G7DA 1GV9A 4XF1A 4P9JA 4QM8A 2RM23 2PYTA 4A7ZA 1UX6A 2JEMA 2DUOA 3MI8A 5F6LB 3EJKA 3TOJA 3ZFGA 3S7EA 3ENRA 2EXHA 4Z1VA 5BNNA 4N53A 4Q29A 1RUJ2 3ZPYA 1KJRA 4UW3A 3PMEA 1VBB3 1PO11 3KSCA 4CEWB 2HWF3 4C91A 5L36A 2JXAA 4AWDA 1UU4A 3AP7A 1H0BA 3N36A 4NO4A 1HRV2 4FPCA 5FO8B 3ELNA 3MDPA 2VUAA 1V6NA 3JBG1 3I8TA 4XHXA 4AVBA 5AC91 4YM1A 1QXPA 1AL23 2PHTA 3H1MA 4PJYA 1ZRRA 1C8M1 3AXEA 4D7SA 2BEOA 2WS92 4QPIC 3QCWA 3RDIA 2W39A 1YCIA 5JOXA 2QVSB 4YSFA 4K1ZA 3ZN6A 1YFUA 5JPMB 2AGSA 3AYAA 3I4IA 3R4UA 3AZZA 2Z5WA 2OZ6A 2I74A 4Q4X1 4NR1A 1KJLA 4YW5A 1KRIA 5JIUA 4COZA 5J09A 1OKQA 2VNOA 2LUWA 3T2TA 5CBLA 4XQWA 4LBMA 5I8YA 2AZ5A 1GQHA 3TRSB 1W6QB 5DUXA 1SDWA 1GANA 3I2DA 4YG3A 1AZDA 1NY72 3H7JA 2IZWA 1CAUB 4RQPA 4ZU4A 1VB2A 3AP9A 4AEJA 2GH2A 4LBKA 1CIWA 2BNNA 4IEXA 5JMCA 1QF3A 2YZ4A 1AR91 5FLIA 1HIXA 1WA4A 4CDUC 3VBRB 3ETQA 4IESA 5ABJC 5T54A 5FO9B 3E97A 2XPJA 3WQ0A 4FPLA 3QLQA 2DVFA 2VH9A 2ZGOA 3JUUA 4JGYA 4KWLA 4H3WA 1RUD3 4QHBA 4FPYA 3TN93 1UPSA 1WCDJ 2WT2A 2ZA9A 3Q9OA 1RUF2 4OZXA 3ZFEB 5BNPC 1HW5A 2HWC2 1U5YA 1XE8A 1SMVA 3GNEA 3JQXA 2B7YA 1ZBE3 5I8SA 3KM5A 3N4MA 2XBO1 1Q8SA 1H4HA 4QPGB 4LULA 4FPGA 1D0HA 4Y26A 2VULA 2ZX4A 1KXGA 1Y3TA 1UW8A 3U07A 2W08A 4IL7A 2TBVA 3CL1A 3VHNA 5A32B 3M4FA 5KHHA 2Q30A 1YI7A 4I09A 4GMP1 1REEA 2WLPA 3OYWB 3N7JA 5D8AA 3NAPC 4MXWA 1ENXA 4XBNA 1GYKA 5CFCB 3RNSA 1N3PA 1R093 4F8AA 2FZ2A 2DCTA 4XYXA 5C8CB 1LESA 1MEC3 3NO8A 1LENA 2ZGNA 1NE6A 4XIOA 3D82A 1BEV3 4GXLA 4XQ4A 1Q8PA 1PO12 4Y1VA 1CVNA 2ZHKA 1LGBA 3DPRA 4OFGA 1NLRA 2JENA 1S2KA 3CEWA 5KC5A 3EXUA 1PZ9A 4BZ4A 3ZIXA 1GNZA 4M0NA 1RUJ3 1DGWX 3PJQA 3ZSLA 3WDUA 4XFCA 3I59A 4KU8A 1C8M2 4QPYA 4EJRA 1BYHA 4L11A 5CIRA 4ES9A 1SBDA 1C5HA 1KDMA 1SLBA 4AW7A 4Q27A 4YM3A 4CEWA 2QQPA 3VN4A 4COUA 2EXKA 1O5LA 4Q4Y1 5CA6A 4WM8C 1RUI3 1NE4A 5K0UC 2OZJA 5H9RA 2KXLA 4RGAA 1WBFA 1CONA 5CADA 3T1LA 1XU1A 2ES3A 4JDOA 2HWE3 3NWKA 4K3UA 4E4DX 2XVKA 4D7TA 3AKTA 2PHFA 1N1VA 2XB6C 2CYFA 2G4IA 5FRAA 1BZWA 4P9YA 3SCHA 1EAH1 3A0KA 4HLTA 1JOJA 2RS11 4V1PA 5J48A 4R4XA 2MPFA 3TWIA 3ZFGC 3FUQA 1AR92 3WQ1A 3ZMNA 5DXDA 4CDWB 4LBOA 4N53C 4NHKA 3WLUA 2VMGA 3AKRA 1G9FA 2CGOA 2RS31 4N43A 5E8AA 3WP5A 2HKXA 1CAUA 3ZFFA 4KBBA 4Y1ZA 5CVRA 3B3QE 1ZZ7A 4YLZA 1QXJA 1QDCA 2D6PA 4XHBA 1NCQC 4JAAA 5HBAA 1AYM1 5GLWA 2YY1A 3ACLA 1XNDA 2H0BA 2JECA 1WGPA 2PTMA 2XBO2 3ZSKA 3CJXA 2HWB1 3GALA 1SBEA 4Q4W1 1MS9A 2RMU1 5GKAC 4HBNA 1VBD3 5BNOB 2R32A 2PAMA 2FMDA 2MEV1 2ZGQA 1WMEA 2VW2A 3BPZA 1AR72 2CGPA 4TYSA 2BPA2 4M00A 1X8EA 2WT1A 5H9PA 1PVC1 3AP6A 3R0RA 2Z79A 3E6DA 4JTOA 1FPN3 4LHNA 1D4M3 3WP3A 3RG0A 2IXLA 3B7MA 4WVWA 3RYRA 4AVCA 3ME2A 4AHYA 4ZU5A 1IS5A 3MYXA 5DDJ2 1ZREA 1RUC1 4ITCA 3ZXEA 4GWMA 1L3JA 2I45A 2PLV1 4LA2A 5FPZA 3OF1A 4XPVA 5A32A 4IV1B 1RUH3 4JV4A 1ZRDA 3VKNA 3SH4A 1OA3A 4F83A 1MVEA 3OYWA 2R073 4BIOA 3UKVA 3WG3A 2P3JA 2YMZA 3VBHA