1E5RA

Proline 3-hydroxylase (type ii) -apo form
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
290
structure length
260
Chain Sequence
MRSHILGKIELDQTRLAPDLAYLAAVPTVEEFSNGFWKHVPLWNQPTAHVEHVPYLKEIVTTVFDGTHLQMARSRNLKNAIVIPHRDFRYFRTFMVLEDSPLAFHSNEDTVIHMRPGEIWFLDAATVHSAVNFSEISRQSLCVDFAFDGPFDEKEIFADATLYAPGSTPDLPERRPFTAEHRRRILSLGQVIERENFRDILFLLSKVHYKYDVHPSETYDWLIEISKQAGDEKMVVKAEQIRDFAVEARALSERFSLTSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PROLINE OXIDASE
publication title Structure of Proline 3-Hydroxylase. Evolution of the Family of 2-Oxoglutarate Dependent Oxygenases.
pubmed doi rcsb
total genus 71
structure length 260
sequence length 290
chains with identical sequence B
ec nomenclature ec 1.14.11.28: Proline 3-hydroxylase.
pdb deposition date 2000-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05118 Asp_Arg_Hydrox Aspartyl/Asparaginyl beta-hydroxylase
A PF05373 Pro_3_hydrox_C L-proline 3-hydroxylase, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1720.10 Mainly Alpha Orthogonal Bundle Proline Oxidase; Chain: A, Domain 2 L-proline 3-hydroxylase, C-terminal domain 1e5rA02
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1e5rA01
1UZWA 1QIQA 2BJSA 1UO9A 1HJFA 1OBNA 2WO7A 2VAUA 1BK0A 1W28A 1E5HA 2VBPA 1HB4A 2VCMA 1ODNA 2DBIA 1W06A 2JB8A 1WA6X 1E5RA 1HB2A 3ON7A 1W04A 2JB4A 1W2OA 5APAA 1GP4A 1DCSA 1HB1A 1W9YA 1W2AX 5C3PA 1W03A 1QJFA 3ZKYA 2BRTA 1HB3A 2Y6FA 5C3SA 1GP6A 1RXFA 2VBBA 4BB3A 3ZOIA 2VE1A 1IPSA 2Y60A 2VBDA 1QJEA 1GP5A 1W3XA 3ZKUA 2DBNA 1HJGA 1W05A 1BLZA 2IVJA 1UOGA 1ODMA 1UOBA 1E5IA 3OOXA 2CSGA 1E5SA 5C3OA 4RGKA 4XAEA 1UOFA 1W3VA 1OC1A 2IVIB 2BU9A 5C3QA 5C3RA 1W2NA 1UNBA 1RXGA
chains in the Genus database with same CATH superfamily
1SACA 1VBC2 1QQP1 1YJLA 2LW8A 1TNFA 5IJRA 5KC5A 1X50A 2PAEA 3LA7A 3WNMA 1SLAA 3MIEA 3FMGA 1DHKB 4Y5TA 2ZGNA 4JC1A 1Y9MA 4BK5A 2KXLA 4A45A 1OLRA 1ZZ9A 1SDDB 5CYYA 1MZ6A 2PFWA 2VOWA 1IPJA 2A6YA 1CZSA 4OULA 5EQUA 3OYWB 4GJYA 5A33B 3FLPA 1RMU2 2DUPA 3M4FA 5D2AA 4HK8A 3WSOA 4CCOA 5IK5A 3POFA 3NAPC 4N53C 4XQDA 2JDNA 3ROUA 1JZ7A 3H1MA 5GLWA 4NHXA 3LA2A 4CCNA 1QJX3 1CPMA 4HXCA 1ND2A 1XJAA 5FP7A 2WT0A 2NMNA 2JDHA 2WWJA 4OQ9A 4AOCA 3ZXJA 1CX1A 3WG1A 4YWAA 4AGVA 4JX0A 2J1SA 5K7PA 5A3OA 3ALQA 4YM0A 4XZUG 3T0AA 2BZDA 3IDAA 5D21A 3PMSA 4R9AA 1W8ZA 1YRZA 1NCRA 5K0UB 1QGLA 3MV01 5A7QA 4AI0A 1COV3 1GZTA 4CCCA 1V70A 1LHUA 1HN0A 1VE0A 2XJRA 1XNTA 2KM2A 3DXTA 3AVRA 2YHJA 1XYPA 2QE3A 4BMEA 4AG4A 1H1AA 4UFMA 3VZOA 5BNNA 4EN0A 3AKRA 2VXJA 4P9IA 4YZ5A 3O1UA 4N43A 3M3CA 1X9PA 1ONAA 4NPRA 4RS5C 3JU9A 4MSVA 4BZ4A 3JD72 4XJ9A 1HQNA 4DXSA 3OBZA 5D8AC 3V56A 2CWMA 2P5BA 4IEQA 2WWUA 1PGL1 4IGQA 1AL22 4W6XA 1LULA 1RUF3 2QVSB 1YI9A 4JGYB 4L0PA 4Z92B 5JSOA 1KFXL 3ZYFA 3PJYA 4NMIA 4OI1A 3SKVA 3WQ1A 1O3RA 1JHNA 1KJRA 4Q4X3 3DL3A 4LK7A 4LA2A 4BMBA 2CL2A 3OD4A 5EPAA 3AP7A 3ZYIB 1JI6A 1SHWB 1CIYA 1O4ZA 2SBAA 1RUE1 3AYAA 4HONA 4XFGA 3E97A 1DQ4A 3M3EA 3OUHA 4HKOA 3LSDA 1W0NA 3MO4A 3QH6A 1VBE2 3OB8A 3AJZA 1EV12 1W05A 4YYOA 4RA0A 3ZDVA 4OHVA 4Q4V3 4Q0UA 1LHWA 5FZKA 2GMPA 4HT1T 3HN3A 4NJ4A 2GZWA 1LGBA 1GWLA 3WDVA 1N1TA 4CDUC 4XC9A 3ORJA 3AL5A 5F39A 4FT8A 3VBOB 1C3HA 2VNRA 4XIKA 4QX2A 3IKWA 3N3HA 2IXHA 5T5PA 1UOBA 4QU2A 1LGNA 2J22A 2Y26A 3W5NA 2VOKA 4PIXA 4NHLA 4UBHA 4UW6A 1PK6C 4P9WA 5JUVA 4QHOA 1ND3C 3RDIA 4DXTA 5FY5A 2WLQA 3RYPA 1GOHA 4DRRA 1WWYA 2QKDA 2V4VA 1NZIA 2JDUA 1WD3A 4IERA 4COYA 2WR9A 4FFFA 3TWIA 1PZ8A 4DS0A 3CLPA 1RJ8A 1S0IA 2GNBA 4GXLA 1U12A 3NJVA 5AVAA 3N9LA 4NIIA 5ACA1 1RUNA 4XYXA 3TEZA 3AKQA 3AMPA 1QJY3 3WNKA 2ZBJA 3ST7A 1H0BA 2WUHA 3GXUA 4R4XA 1IKQA 2EVXA 1NOVA 2A6ZA 1PM7A 1EAH2 2XMLA 1IS4A 1V6JA 1XNKA 2R30A 3I3BA 4HANA 5CNAA 1LESA 1UYXA 3R4UA 5F5QA 2B9UA 3ES1A 3IIAA 3RPQA 5BYNA 1J84A 5I91A 2HLEA 4CPBA 2Y6HA 3KQRA 2E7QA 2QQOA 2NM1A 3NWKA 3OEAA 4HN0A 4JKMA 3T2TA 2AEZA 2QDRA 5CBLA 1X82A 2XB6C 2J1RA 2XWBB 4RHV2 5FYMA 5JI9A 1VPHA 3MBWA 1D7PM 1SLIA 3N7MA 4IGOA 4XCBA 4Y24A 4AW7A 4E4DX 5IVEA 2C26A 5H9RA 2ZEWA 1T6BX 1AYM2 2DCZA 2GN7A 2XL9A 4FPYA 3M3IA 4MXVA 3K4AA 3P5BA 3UJOA 4XE9A 4BWOA 1VBB2 2FCUA 1X8EA 3I2IA 3WD5A 3BKZA 4XFBA 2HWB2 1UX7A 3E5XA 1UWWA 2D40A 4WVMB 2ID4A 3ACFA 1FV3A 4QX7A 3GZTB 3OGRA 2E6VA 3AZXA 4HZFA 1VAKA 1C1FA 4EZ4A 2VMEA 4IE4A 5JXIA 4K8FA 2DF7A 1GNZA 1S0BA 2JEMA 4QDSA 3VBUA 2A70A 2VM9A 5CFDA 3AMMA 4FOVA 4JDMA 3WVJA 1WKYA 1GUIA 3N9QA 2VZVA 4CDQC 4NIDA 5FO8B 2XVKA 3CKHA 1RUJ3 4GWJA 4JCKA 5IK7A 2Y38A 1PVC1 5FXXA 3DYOA 2QQKA 3LWCA 4PHZA 2YGMA 3J26N 3RG0A 5C4WC 3WLUA 4I2OA 4TXWA 4GB33 2QUOA 2R1BA 2OT7A 2VE1A 2RS32 4WZFA 2H6BA 1A34A 3CJIC 4CCJA 4OQ8A 3GCXA 1Q8PA 1SMVA 2CAUA 1OQDA 3A0NA 1GOFA 4ES8A 4LO6B 5EXOA 3U1XA 4DPNA 4HVRA 2VTXJ 2DBNA 4LOSA 4Q29A 3KT4A 4NE9A 2BNMA 1VR3A 2WT2A 4Y5Z0 3FHIB 2WN2A 4FO9A 1YLLA 4AEJA 2D3RA 5A7WA 4AQTA 3POBA 1AR82 2WZPP 2P37A 2XJVA 2Y6GA 3WHTA 3HQXA 1FPN1 3Q9OA 1UF2C 1XE8A 1DGRN 1JS9A 1UY1A 5CG8A 1Q43A 4IV1B 1OOPC 2G9ZA 2QQUA 4AFCA 2GC3A 2LTNA 4O65A 3AFKA 1PGW1 4AE2A 3I2KA 3VDAA 1H8TA 5FZCA 2VOTA 3SC7X 1DDLA 5FTTC 3GGLA 4UOJA 1O4TA 1W0PA 4HBNA 1OLQA 1LOAA 3GZAA 2JKBA 1RUE3 1SPPB 3VDCA 2W91A 3D0JA 4CDXB 5FYTA 1GOGA 2GNTA 4P08A 1LOEA 1QY4A 4PBOA 3N7KA 2A6WA 2VXRA 5C3RA 5LBBA 1RTVA 2RMU1 4B7EA 2G1MA 4ET7A 5LWBA 2W1SA 1UOJA 1K42A 4DIQA 4R9DA 2I45A 2WZ8A 2XL7A 5A33A 3OYWA 1KRIA 1UIJA 3D5OA 4NOTA 3LE0A 2RS12 2ARAA 2ZA9A 3GHMA 2HWC1 4TWTA 4NIAA 4CU9A 2XVGA 3W59A 4BLIA 3THCA 2D97A 2HEWF 2OQ7A 2VO5A 1XYOA 4W6YA 4QX0A 4HETA 3POSA 1RVF2 3PVNA 3ZYHA 3NW4A 2ZAHA 1UZYA 2ZHLA 3U07A 3WF0A 4COUA 4I0WB 4XFFA 5K0UA 4Y1YA 3VZNA 1WLDA 4MX3A 2X09A 1VBA2 2CGNA 2WNEA 5FMBA 2RR13 1MEC2 4P14A 2PYTA 1JYWA 5EIYB 2X5IB 5FRAA 1DQ5A 1UCXA 3NNLA 2QQWA 4RFT0 3ILRA 1E5RA 5ACA3 1UPSA 1VBD2 2WNVB 3AL6A 3CZUA 5J09A 2KD7A 2QQLA 3FC0A 1OFNA 3TNPB 3NNJA 1K5MC 3PIGA 1HB1A 2HKXA 5L7OB 1X8MA 2R063 1OMIA 5JXJA 1CWPA 3MLJA 2AYHA 4OI2A 1ZZCA 5L9RA 5BNOA 5C3PA 4FI9A 3UGHA 4OFGA 1D4M1 1LENA 4Q0VA 2CV6A 4TLGA 2J1VA 2SLIA 2DVBA 4TN7A 5A3UA 5JWPA 3LA3A 4JGYA 1CJPA 4X6RB 5FLHA 1HX6A 4N7IA 2YUEA 5JIUA 2FD8A 1SLTA 2QQMA 4IDZA 3CIHA 4L2NA 3F2ZA 4CU7A 5C3SA 5HV0A 1F4AA 3B94A 4Q8KA 2RS51 5KBFA 1YQ2A 3ZSLA 3BTZA 1Z7S1 4OHWA 5AFBA 2WS91 1H1IA 2VNVA 1Q3EA 2JWPA 2W1WA 1VRH1 5J37A 1VALA 3KVBA 1UYYA 2HH9A 2A5ZA 4ZZ5A 1EY2A 2P3KA 4CDWC 1BK1A 3HR9A 2BWAA 1S2EA 2RJLA 2VBDA 2VMGA 4XCAA 3RMYA 1Y9QA 1WLTA 1BYHA 1OKQA 3Q8CA 4ZZ8A 3O1TA 2N7GA 2NPIA 1N47A 1HJGA 4QKNA 1KGYA 1V9U3 2DUQA 3FZ3A 5FP9A 1IHMA 4NPMA 4M0HA 3PLQA 1QOOA 2OUHA 2GMEA 3CMGA 4H14A 5CG9A 2VPVA 4AEMA 4CEYB 1ULCA 2ZJCA 4IEVA 5IVBA 1ENSA 1B35C 3GYDA 5EJ3A 4GWNA 2R043 4OI4A 3ZIXA 3BCWA 4QGMA 4KWUA 1POV0 1VP6A 1PZ9A 5EWSA 2ZS6B 4FQ4A 3FUQA 1NQJA 4KGGA 4M4RA 5FZFA 1ZBE1 2PLV1 1O5UA 1JMUB 2Q4SA 2ZGRA 3LPFA 2VQUA 3ZSEA 1P8JA 1TME2 5BPXA 1NA1B 4AAPA 5ISLA 1ZYBA 3WF3A 3U11A 2BU9A 4JKLA 2DFCA 4KNCA 4K40A 4NIHA 4AEDC 1RXGA 1CAVB 4JHZA 4TLFA 3ZFGA 5AFEA 3QOPA 1R1A1 5CKMA 1KD7A 1FPN3 1JZ6A 4PJYA 1AJKA 2ZHMA 2I2SA 3J7HA 3QBQA 3Q8EA 5A1FA 1AR71 2VCAA 1C28A 5I0TA 3B3QE 1G9DA 3LIGA 5FBJA 1HJFA 4GH4B 4XMIA 5AVPA 2XWJB 5FY8A 5FZHA 4AI9A 2WA3A 4BOWA 3ABZA 4W50A 3TB0A 1CGPA 4LJHA 1TEIA 4NN0A 3FFQA 1OHFA 3NNFA 4NROA 3HMYA 4QB1A 5ABJC 2RM21 2IXLA 1AVBA 1UAIA 3QLQA 4WM7C 1JZ2A 4JRLA 5FQ0B 1UL9A 5LRSA 5A3LA 4DUWA 5A3TA 4AFAA 4NWWA 2PA7A 4LO5B 4WV8A 5J1XA 5FK7A 3GZEA 3CJXA 3ON7A 1OVPA 1XQNA 1AYN1 2HWC3 4QPGA 2Q8CA 4YW7A 1R092 3RS6A 2VNOA 1RJ7A 3A7QA 3VHNA 3VHRA 1YNAA 1J1TA 1RHI1 5E1RA 2GMMA 3LFMA 3K3NA 5JIAA 3NV2A 4YZ1A 2PN5A 2X29A 1K3IA 2WO2A 2ZX0A 5F6LB 3TEXA 3UGGA 1LECA 3HQRA 1N3PA 1ULOA 3S6PA 3U4XA 2CNAA 3LD8A 1OF4A 4AI8A 3AP9A 5FZ7A 4TTGA 3M7AA 2B8MA 3AZWA 1OA3A 3EO6A 5FZOB 2TNFA 3AKTA 3KB5A 4IV1C 1T2XA 3WCRA 2VBBA 2XLGA 3V65A 1DP0A 1FXZA 3AP4A 4B4QA 1V6MA 1OI6A 3HT1A 4LR4A 3N7JA 4BB3A 4AAXA 1X7NA 2Q8EA 3KV5A 1UYPA 4CXXA 5C70A 3JBG1 2QQPA 1W0OA 4UF0B 4P02B 1S2BA 1DG6A 2GC0A 1JYVA 2BERA 3VD4A 4QXBA 4LKDA 2R072 1CD3G 3CDZB 1VAVA 4LHNA 3J8F1 3M1HA 2IXJA 4N53B 3H42B 1YQ8A 1OQEA 1NLSA 4OHYA 2F4LA 3VHOA 4Q4Y3 1STMA 2RS53 2HEVF 2VW0A 4BLJA 5I0SA 3VD9A 2XPJA 2WSUA 2ZGLA 3ETQA 2WS93 4HMZA 4OMCA 3SKJE 4PDWA 3R4SA 2Y6KA 1SPPA 4CDXA 2AZ5A 4BQ2A 4Y22B 1VRH3 1SQ4A 4S2GA 4KH9A 3WOGA 5FPBA 2GC1A 1PMIA 3BPSA 2HWD2 4K21A 4KQ7A 4M00A 1QOSA 3LIHA 3DF0A 1PMJX 2HWE2 3NV1A 2PMWB 4NR1A 1O3SA 1OC1A 2ERFA 1UMIA 5F7UA 2X5IC 1RUI1 2HYXA 4AZZA 2IWGB 2BDRA 3GDBA 2IC1A 1ZZ6A 2GDFA 2PHUA 4Y1VA 1O6UA 1QU0A 1YFYA 2DV9A 2ZGPA 4LORA 4RS5B 3AMHA 4XTMA 5FK8A 4A6SA 1JZ3A 4L97A 3SH5A 4JQTA 4ASLA 2PAKA 2P6CA 1VLNA 4P9XA 1G9BA 5A32B 1AR92 5CFCC 1DGRA 2JE7A 2XGXA 1HQLA 2YFZA 4FQZA 3VBHC 1ZBE3 2JJ6A 1OH4A 2PLV3 4PLOA 1V6KA 4R8HA 3RMXA 3MIGA 4D6RA 1SLLA 1CPNA 1WCKA 3VDDC 3VZJA 4N90A 2MEV2 1W9FA 3RWNA 3H50A 3W58A 1F8VA 1A78A 3HNBM 2WNVA 1YUDA 4XFAA 2AH2A 1RUH1 1CZVA 5I8YA 1REFA 4B8EA 1Y43B 4UFIA 4YPJA 5L7OA 5LEKA 1R1A3 1J58A 1RUD2 4XQ4A 5FMDA 2P3YA 2BFUS 4Z1VA 4FTEA 3K46A 1AR73 3NO8A 4XFIA 1FAYA 1MZFA 5LZ6A 2JB4A 1NUKA 1OPOA 2FMDA 4XUPA 1GP4A 5HV4A 5K8SA 1DCSA 1E57A 1XU1A 2B39A 4DXRA 1Q56A 3IIIA 2DYCA 1PO11 1O8PA 5FYIA 1J59A 4CDUB 5KXCA 4C1WA 1GBGA 2IFRA 4LMFA 2C4XA 2I07B 2VQTA 4Y1XA 2ARXA 2HWF2 2E53A 1RINA 5A1AA 1LCLA 3D0SA 1FMD2 3SCGA 1UX6A 4QHBA 1CAXB 5T54A 1KDMA 1PK6B 2D93A 4MH0E 4YW3A 2VOVA 1ND3B 3HJRA 2AEYA 4DEQA 5FZAA 3A22A 4QAWA 3IAQA 1OFSA 3MUZ1 1XU2A 1ZA7A 2W2IA 3ZYBA 3KZ4C 3H3LA 1H9WA 4EROA 2XHNA 2JIJA 2XBO1 2VH9A 4FVVA 4YM1A 1F5JA 4EWEA 2ZHNA 2HJIA 1OURA 1RHI3 5AC93 3P1IA 4CUGA 1LOFC 1QXPA 5ERLA 2AUYA 3OBRA 4LE4A 3M2MA 2PHRA 4Q4X1 2UYBA 4OZOA 4QU1A 5T5LA 1Y3TA 5CISA 4MZUA 5IVCA 2FDGA 1GP5A 4XTPA 1ENQA 1V6LA 2WZR1 3FN9A 4RR3A 1C5HA 1RUC1 4LK6A 1VBC1 4CEYA 5JOYA 2EAAA 4FAGA 4HK9A 1TMF2 4UW4A 1U5IA 3WP5A 2WLPA 1J83A 5FY9A 2Y34A 3UK9A 3B00A 1SZBA 2VR4A 5DZEA 5FY0A 4XUQA 5FYHA 2R1DA 1S55A 3N35A 4DEVA 4KWLA 4BQ3A 5A3NA 4QDQA 3AXDA 2PTMA 5FKCA 4KMQA 1OLME 2NLRA 3VD7A 1PIV2 4GZ9A 5EJZB 1NA1A 4XUNA 3ZYGA 1RITA 4GQ7A 4N7UA 3RFRA 1I9RA 5HXVA 5JR2A 4BXSV 1GKBA 3PUQA 1CAVA 2VNGA 4CU8A 3POJA 3KT7A 1I1EA 1OD3A 4HLTA 1R082 2P34A 2RVAA 3J8F3 4XACA 1AHSA 1A6CA 4MGZE 3WW2A 4JZRA 4G4FA 4GH4A 1OH3A 3ZXLA 4ASMB 1LNSA 5GZEA 4CCDA 4K1ZA 2OKXA 3ZXAC 3RZGA 3LDBA 4XEZA 2WIIB 2FBEA 1UZVA 2D6KA 5IAVA 2ZGKA 1QIQA 3OSDA 5FPXA 3O1MA 4CDQB 3KV6A 4YM2A 3U75A 3C7OA 4LKSA 2EIBA 4NRPA 1HV0A 5FY1A 5LY2A 2DVAA 4M4PA 3ASIA 4Y33A 4AF9A 3VBSC 4LOTA 5C4WB 5FQ0A 1QJY1 2LROA 3QD6A 2RV9A 3UV9A 4LO7A 3VD5A 2EXHA 3WP4A 2VBPA 3OGJA 3JD71 2A6XA 2FMYA 2HYKA 4ONUA 2DTYA 2JD4A 3CJIB 3ES4A 2IXKA 2ZXQA 3J7NA 4FP2A 5DXDA 2LS6A 4BQWA 1C1LA 4YM3A 1O3TA 5DAPA 1AL21 1RUI3 1JUIA 3O14A 3KM5A 5E88A 4DXZA 1WLCA 4XUTA 1W9TA 1HIXA 2W68A 4D7TA 3LFIA 2X53S 1I5PA 5FZIA 1W6QA 1ZRIA 2WZEA 1EUTA 1LOCA 1EPZA 1ZNPA 3VKMA 4E8CA 2VQAA 5HI0A 4FPEA 3AMNA 3IBMA 5FZ9A 1RIRA 5G05L 3HBZA 1GANA 5JDBA 2R0FA 2WT1A 5F37A 1OOPB 4WM8C 1ZBA2 4AHYA 2YC0A 1PO23 1VBE1 3C7FA 1EV11 1OPMA 3OGSA 5FZOA 1JYIA 1QXRA 5I93A 2ZEZA 2B42B 1WUVA 2YGLA 1RUH3 2B5HA 3S30A 4HN1A 5GZGA 3FUOA 1WLWA 4XW3A 3S7EA 1LGCA 2FDJA 4B1MA 4CEWC 3IDBB 4UF0A 2JG9C 4IGPA 4KU7A 1H2KA 1PGSA 4COVA 2NP0A 1RUJ1 4UFHA 3JXSA 1PHMA 1AR63 1REDA 2K9ZA 5LK7B 1TG7A 2FDIA 2BVVA 4ISQA 2ZABA 3CF6E 1PO13 3N7LA 3LGRA 4GB31 4QM9A 4RGAA 1UU5A 3D3AA 5I0DA 3NAPA 4N53A 5DDJ3 3KHCA 4XBNA 4H3WA 4CUAA 5DAVA 4DY3A 3NSTA 4LE3A 3OBAA 1HXS3 3KMHA 2VMFA 1ASJ3 1XPWA 2ORXA 2ZKNA 2QDNA 3ZYJB 3ZFFC 4QQPA 3LSEA 1WA4A 1YQ5A 1HQWA 3FHQA 4Y22A 2QCSB 3CO2A 4PIZA 2XONA 3I2FA 4KG0A 2UWBA 2P6HA 5E89A 5IVYA 4D3WA 2R32A 3D4KA 2FZ1A 5A6XA 1JN2P 1G9AA 1KITA 2Q1ZB 3E6BA 2XBO3 4ZXKA 1N3QA 2V5DA 1W9SA 5C8WA 2NZ9A 4JDOA 2FDFA 4UWDA 2C24A 4I09A 4MOAA 5IT6A 3AK0A 2J42A 1O7FA 2UYAA 3ECQA 4YW6A 3NV4A 2NQYA 2WZR3 3OPWA 4QX8A 2BBVA 1K5MB 1RUC3 1VBC3 4RS5A 5LASA 1SLBA 4RQPC 2GC2A 2BFUL 4LHKA 5D8AA 2IVIB 3AJYA 4AFDA 1W8UA 4B3NA 1CONA 5A32A 4F7ZA 4COWA 1F15A 5LA0A 5I0UA 1AYM1 1W6OB 4AFBA 2ZPXA 4E2SA 1UZWA 2BV4A 1UKGA 2E31A 2EIGA 3MIDA 1DLLA 3OEBA 1VBB1 4ISRA 4MHRA 2MHFA 5T50A 5BV6A 4GULA 3JQWA 1ZRRA 5CAZA 4P5HA 1UO9A 1QQP2 1RMU3 1S1AA 4TSVA 5LW9A 4XHBA 4R52A 5A80A 1X36A 3SQOA 4L99A 4XVHA 2YBPA 1ENXA 2EAKA 3A0KA 4XURA 1UU4A 3ZXEA 4EN8B 2PAMA 2ZX1A 3WV6A 2YPDA 4P9LA 4N9HA 4OI0A 1UU6A 2YB7A 2ZX4A 4HPKB 1GICA 4CDWB 2PELA 2DBIA 3OD0A 3WINE 1HN1A 1W06A 1UYZA 5FP8A 1UY0A 1YIPA 4DMIA 1OKOA 3E5QA 2RR11 3ZYPA 3JCIA 4Q1RA 1HB2A 2VMIA 3MGUA 3AC0A 4D8MA 1O91A 4XF9A 1FNZA 3NNGA 3P3PA 1XSQA 2BVBA 4IEOA 3I2JA 3N36A 1PK6A 1SFYA 2B46X 1Q5OA 2PHFA 5LBEA 4YZ2A 1ND3A 1B35B 5JSPA 1IGOA 2W46A 1WW5A 2WJSA 2WC2A 3OF1A 2R061 3EXUA 4Z82A 3JD73 3INAA 3B7MA 2ZZQA 4DFSA 2P2KA 4LIVA 4A7YA 1U0AA 5FPUA 1QDCA 2CHHA 1AL23 3DCQA 3OG2A 5G04L 2Y6JA 1AR81 4CU6A 5JPMB 1KS4A 4AVTA 1WMFA 1DZQA 4KI5M 4ITCA 2VZPA 3ZM8A 1HB3A 1OQ1A 1XE0A 2Z42A 4KU8A 3JZVA 1Y7BA 1ALYA 3BB6A 4U2AA 5H9QA 2KR2A 3IDCB 3ZFEC 3POEA 5C9AC 3WY6A 4AEDB 1PGL2 4NVPA 2VUCA 2OYZA 1DYOA 2YG0A 4UAPA 3GF6A 5KR7A 3ZPYA 1IPSA 3MDPA 3PNAA 2GU9A 2NYYA 4DINB 4L8QA 1VBE3 1EUUA 1EV13 5B4NA 1S0DA 4FFHA 1QJEA 1XNCA 1W3XA 1F5FA 1XXNA 1W90A 2A73B 2ZGSA 1JH5A 1T6GC 5DUWA 5LK5A 2OZJA 3DN7A 1ZRDA 4LT5A 5LEJA 2VULA 2VG9A 5CFDC 4QX5A 3BGAA 1V9U1 2ILMA 2VVDA 1W99A 2ZMKA 1WCDJ 4ZS3A 4CE8A 5ABJB 1AXKA 3AZYA 3HOBA 4QQOA 3NJYA 4QXKA 4WM7B 5GZCA 1JYNA 3IM0A 3PL0A 5SV5A 1QXJA 1YHFA 1S4CA 3PU3A 5HCHA 4GKYA 3AZZA 4GIQA 4MGYE 4ATEA 2ZOEB 3O1VA 2R041 5EZWA 2WN3A 2OVUA 1D4VB 4SLIA 5FZ1A 5LA9A 4CUCA 2ZZJA 3AB0A 2O8OA 4NPLA 1LB2A 4NO4A 2HBTA 5FDBA 3BTYA 1D0GA 1VBA1 4YSFA 2W87A 2D98A 3RZKA 2YU1A 1XE7A 3T2PA 2W5FA 1FNYA 4CDQA 4XIOA 3CQOA 4A2UA 3PVOA 1JZ4A 3H8XA 1E5HA 3LDRA 2JKXA 4XBQA 4LKFA 4KBZA 4XXAA 1Q8SA 1NXMA 3HAGA 3I97A 4URTA 4DZGA 4EN7B 1MS1A 1EAH3 4QX3A 5JOWA 2I74A 2ATFA 2A7AA 2GH8A 1U5XA 4K7JA 3CJIA 2WL1A 2JG8B 1JTZX 5F8PA 1Q8QA 5FJKA 4A7KA 2ENRA 4D0QA 2PHLA 2WO7A 5ACA2 3KV4A 5DMYA 3U0ZA 3HWJA 5A7SA 3H7JA 2IFWA 4RHV3 2W94A 3O1SA 1W8FA 1MQTB 1IS5A 2TBVA 5KHIA 5FUIA 2VCMA 3VZLA 3WG3A 2ES3A 3IZOA 3ZDSA 3HPNA 2EXIA 5GM0A 1AYM3 4QPYA 4M3CE 2E26A 3WQBA 5I0RA 4LBNA 3SXWA 3ACGA 1VBB3 3ELNA 4UFKA 1WA6X 3RI8A 1OOPA 2HWB3 3FWEA 1I5ZA 5FKBA 3O0VA 3FLTA 5DAWA 3KGLA 3H1WA 4IUGA 3N9NA 4DY5A 2JIGA 3WEZA 1UMZA 2OXBA 2IUWA 5DUXA 4AVSA 4Y1UA 4EZHA 2D3PA 1GZCA 4YW4A 4LA3A 4S2DA 1J3RA 3GJBA 4AVCA 1KXGA 2ADDA 5KHJA 1QJFA 4DB5A 2GP5A 1A8DA 4AHWA 5F3CA 3HIFA 2UU8A 4IEUA 3LKJA 4RFRB 5FMCA 2QZ3A 4YW2A 5CZKA 5C5UA 3O1OA 2W95A 3I3DA 1PZ7A 2RS33 3GJAA 3K75B 4IE7A 4B7KA 2RHPA 4XF0A 3KSCA 4XPVA 1UPIA 4P9JA 1PVC2 5HCBA 2X05A 2IXIA 4CA9A 3R6SA 2W1QA 2J1EA 1VJ2A 3JQXA 3NRUA 3JUUA 4IV3C 1WCQA 4P00B 5HPOA 4EYUA 5CFCB 3BN6A 3POGA 3NJZA 3VBHB 2WQZC 4IL7A 1AR83 3J4UH 2YV8A 3VDDB 3UYJA 2F17A 4J25A 5F6KA 2IVJA 4QD2A 4X8PA 5FLIA 1F2NA 4M01A 4Q4Y1 4LXLA 1XB9A 1MS4A 1W2UA 2C0ZA 2VTFA 4MUVA 1K5MA 2WKKA 4B29A 1KDKA 4YG0A 1OT5A 3PVEA 3RI9A 1CZTA 4RL7A 4YVSC 3T3YA 1IQDC 3FL7A 4ARXA 3CL1A 2Q0AA 3RJRA 5EHDA 4V1PA 5HCFA 1PGW2 5A3MA 4M3CF 4FCAA 1F9KA 5JVVA 1W8HA 4CCEA 5GJ6A 1UN1A 5C3QA 4ZY9A 4JTOA 3VBOA 1CAWB 4GD4A 4IW3A 3VKNA 5FOBB 4Y4RA 2VZ3A 2C5DA 4QWNA 3UL2A 3HD8B 3I54A 3BI3A 1BMV2 4K8RB 3KCCA 1NZCA 3H8UA 4I3PA 1K5JA 4A42A 4E2QA 1GQGA 2RMU2 1RVF3 3I2GA 1DGWX 4CDWA 4QKDA 1OBNA 3VL9A 1OLMA 3AKPA 2JICA 4AGRA 1BK0A 1VMHA 3DYMA 3KCYA 3W20A 4OYUA 3TRSB 1VBA3 1MVEA 3GHNA 3H9AA 1WBFA 1V6OA 5F3IA 1MEC3 3N9OA 3SNMA 2GP3A 3NQHA 3IAPA 1Q8OA 2WFF1 1EPWA 1YYNA 1ODNA 2F4PA 1QJU2 2DUOA 2JDMA 3AP6A 3MFAA 4Q2FA 4AYUA 1ZREA 4CRQA 3NJXA 3RWKX 4AQ6A 1PNFA 4HKWA 5FZDA 4EN6B 1K12A 3G6JB 5EYYA 2A3WA 3ZFGC 1LU2A 3ITQA 4BE3A 1ENRA 1W04A 1AXZA 3VL8A 5GZFA 1WMXA 3MZHA 3VBFC 4XDOA 4UW5A 4Q8LA 2R071 4LLOA 1A8MA 5FYZA 3LDKA 2DCKA 1PMHX 1MS3A 3AKSA 1NE6A 1PM4A 2A1XA 1UZ0A 2D5FA 1LR5A 2V4AA 2VMDA 4QQHA 4COZA 4O9EA 1LODA 5KHGA 2QFEA 3DPRC 1PVXA 4QGNA 3NKGA 3VZKA 4AEDA 3BPZA 1D4M2 3N9PA 4WVZA 3BU0A 4GKXA 1HRV2 4MXWB 4CUBA 4UW3A 5L73A 5A6YA 4MGQA 4BYYA 3VBRC 4CVUA 2Q30A 2VCBA 3ZN6B 4WVMA 2ET7A 2W08A 5FY4A 3J7LA 2NMOA 5DPNA 5FZ4A 5IYYA 1W8NA 2RS52 4G3YC 5A70A 2WYFA 1H4HA 2WQ8A 1Z7S2 2VGDA 2VUDA 1DLCA 1NT0A 4ES9A 5AC91 5JOXA 2ZTNA 4H2AA 4M3CB 5JLVA 5ABJA 5FJHA 1DQ2A 4AEKA 4Q26A 4XXPA 4WM7A 3VBSB 2WNUC 2OQ6A 2XKPA 1RUG2 4DQAA 1B09A 5FZMA 5LBCA 3UESA 2Z79A 2AENA 3AYDA 2RJKA 4LO4B 2DCTA 4XF3A 5T3NA 4OLLA 4GA9A 3IB3A 3B93A 3DEMA 1IPKA 2VW1A 3ACLA 4Q4W2 1N1VA 1ULFA 2JG8C 2C9AA 1H1MA 4YFWA 3SMHA 4FAHA 5IVJA 4YRDA 5J96B 5F32A 1BBT2 2OPKA 1EYBA 2Y6LA 4R9BA 4ZU7A 5GZDA 2BPA2 1GFF2 3IPVB 1RGSA 1WCSA 3KHBA 2WAAA 4HFSA 4YVWC 2PHDA 5IHRA 1BJQA 1MQTC 2V72A 1E5IA 4QB6A 1K45A 4Y4YA 1BEV2 3TOJA 1W2TA 3ACHA 2VTXA 1ACCA 4I0BA 5FP4A 4BJ0A 4XHXA 1FATA 3LZZA 1S0GA 2VW2A 3DUIA 2AREA 3FLRA 4IETA 2BBAA 3KLSA 4WM8B 1C8M2 1WBLA 4AHXA 4NAMA 5JR7B 4XABA 3T09A 4IV1A 2A3XA 3WDXA 2A3YA 3AP5A 4XDQA 4DUVA 1APNA 5T52A 2ADEA 3LEGA 3GCWA 4IXLA 2XJSA 2Y0OA 1XNDA 3ENRA 4LQRA 1OD5A 4XOGA 4CEWB 1ZRFA 2CWSA 2XJUA 4FFGA 2JG9B 4E27A 3I49A 2O0OA 5JZGA 3RRDA 3PIJA 2ZEXA 2P3IA 2VAUA 1OXCA 3MEPA 3WW3A 5CIRA 3MW3A 5C8CC 2G9FA 4FPKA 5H9SA 3RZHA 3MPBA 4MVTA 1X33A 3LB9A 2LRPA 2CY6A 3HN1A 1SFNA 3WDTA 3THTA 2Y64A 3M8LA 4DOUA 1Y9GA 2FDKA 2RM22 3VDBA 1WMEA 1R093 1UMHA 5IWFA 3ZFFB 3WZ1A 1UIKA 1SDWA 5BNPC 4D7YA 3VLBB 3OGGA 4A41A 2A75A 3EB7A 3KCXA 3H7YA 5FYBA 4IEZA 4C8DA 2QJVA 2JECA 4CP2A 2ZKLA 2XLAA 3O0XA 1AYN2 2D6OX 3PTYA 1DBNA 4FOYA 3R0RA 3AMQA 3BVCA 2A6VA 3PMEA 1QKQA 3NV3A 2K46A 1MS5A 4BCUA 2OZ6A 2TUNA 2WFF3 1MS8A 2ZCWA 2X5IA 1PO21 3ILFA 3MI8A 4MLOA 1WGPA 4BIOA 5A3PA 1I3HA 4KL1A 2C9KA 4PF5A 3WX5A 2Q5TA 4OZXA 4FXKB 1NXD1 3WDYA 1GWMA 2LALA 3T0BA 3ZR5A 4RQPB 5FLJA 2O8QA 2R16A 1RXFA 4YNIA 1FOD2 2B45X 3S7IA 1YIFA 4IESA 5LRRA 5CFCA 1TQ5A 1CQ9A 4Y26A 4FPJA 3VBHA 4QXHA 1GLHA 5IFTA 1AR61 3KS7A 4NHYA 2R073 1ULGA 1ZA4A 3VDDA 3I2DA 3MICA 2J1UA 3PUHA 4GWIA 1R081 1BXHA 3TEYA 3WP6A 2X10A 3ETPA 3JBG2 4BA6A 5DDJ1 3Q8BA 1NY71 3ZKUA 4XETA 1ULPA 1H9PA 2VCCA 4W6WA 3SISA 1HXS1 4J6GA 1ASJ1 4O61A 4I01A 4Q1PA 4QPIC 4XFHA 1OF3A 2XQXA 1UY2A 1Z0HA 2WNOA 1NYWA 3RZMA 1HRI1 4AR2A 2JXAA 3T2OA 4FTBA 3J8F2 5C6CA 3L9JT 2XUEA 5LATA 3V0AB 5BNQA 4ORFA 1O59A 2VZOA 3T2QA 4XUOA 2HWD3 4AI2A 4OUSA 2YFUA 2OPWA 2W9XA 4A3ZA 5J36A 2ZMLA 3C7GA 5T5JA 3VD3A 3ZN5A 1M06G 5IVVA 1W6MB 3H3UA 3E5UA 2CGPA 3VKFC 2DCJA 2VZ1A 1XRUA 1FT9A 5GKAC 2BOJA 3UKTA 3TN91 3WF1A 1CX4A 3OTFA 1RC6A 4OMDA 2RJ2A 1R1ZA 3WNOA 2CDPA 3ZXDA 5JMOA 4UXAA 2D3SA 3ZXGA 4BQXA 1LU1A 2DU0A 4K9SA 1MACA 4QKFA 1DU3D 4IE6A 1BCXA 1O8SA 1JBCA 2IZWA 2WINB 2GNMA 4Z2WA 4MADA 3WNNA 1VMJA 3DV8A 4CZSA 2Z2SB 2GNDA 3K77A 1WZXA 1LOFA 3W9AA 2BWCA 2Z69A 1ZBA1 3JB8A 5EYXA 1C4RA 1RMU1 2MEV3 3WCSA 3WG4A 3BIWE 1EP0A 1REEA 3ZFEB 3TEWA 5C9AB 1W28A 5GALA 3D82A 2AR6A 1FX5A 2ETEA 3FFZA 5D1IA 4MGIE 3KD4A 3OGVA 2A71A 1HB4A 4Y3OA 1NCQC 3PJQA 2GAUA 3L2HA 1GQPA 2YROA 2RDNA 1ZVFA 1QF3A 2BGOA 1XNBA 2FQPA 1MS0A 2W52A 4QDRA 4ZKTB 1LJ7A 1GQHA 3ZSKA 1QJX2 1URXA 3LOBA 4UFLA 1CR7A 2JDPA 5A7OA 5CFDB 4IEWA 1H8VA 2BTVC 2HWF3 4Q0QA 1W2OA 4X6QB 2KA3A 5FZGA 1MR5A 1ZZ8A 1FMD3 3DYPA 4P9GA 3RZJA 2E7AA 3H8OA 4MXWA 2YC2A 1GYKA 4LUMA 5DN2A 3MIHA 1UW8A 5L19A 1W03A 2XJPA 2BW8A 4C90A 1COV2 2R7EB 1XOYA 2P3JA 4TZDA 4JGZC 1XBFA 3UKVA 4CXYA 3FBMA 3KWVA 3LAGA 3PUSA 1GWKA 5CEHA 1KEXA 2QNKA 5A7NA 1PX4A 4HOOA 2Y6FA 1GP6A 4MV2A 1AUYA 4M3CA 1CESA 3WUCA 1GZ9A 2EA7A 3OBTA 3VBSA 2W0XA 2PHTA 3AXEA 3K2OA 2LM3A 3ACIA 2Q1FA 2XKOA 4GMP1 1RUF2 1AX2A 1W6PB 3OCPA 3MFCA 2YZ4A 1CVNA 1TMF3 1YQCA 4Q0SA 5FZBA 3ZMNA 4AVVA 1SEFA 1NG0A 5JZGC 2DDUA 1BZWA 1JUHA 3QH7A 5DQ0A 4Q4X2 2E32A 4E8DA 2XOMA 5B2GB 5FO9B 1SG3A 1WW7A 4CSWA 3HBKA 1G6NA 2WSVA 3IPVA 2ZEYA 4K3UA 4E4SA 3S57A 4FPHA 1ND2C 1MPXA 3TAYA 1PIV3 2WFPA 3C3VA 3UJQA 3UT0A 1I6XA 1LRHA 2DVFA 3MLLA 4W4ZA 2W92A 3MF6A 3RYKA 4Q4V2 3B69A 3A4UA 3HT2A 1LEMA 5JPNB 2CYFA 3SCHA 1NCRC 4WM8A 5FY7A 3RQ0A 1R083 5CVRA 2H6CA 5L9BA 2GALA 3X29B 1ZRCA 4OCTA 2XG3A 4S2HA 2QTWB 4AI1A 3POYA 3O1RA 4HSJA 3SEEA 1FI2A 4CEWA 5BNNC 1LOBA 1HDKA 2JG9A 3PVBB 4GAZA 1XC6A 2QQJA 1HRI3 4N43C 1UNBA 5LCWL 4QQ2A 1G8WA 1YJKA 1IG3A 4NHKA 5ANQA 2P1BA 3KF5A 3I59B 5FXVA 4LUKA 4A44A 4CP1A 1VB2A 5DZGA 3WXPA 4XMAA 1EAH1 2WWSA 2UY9A 3WT3A 3POWA 3SLIA 3OY8B 5BXXA 1LHOA 2VMHA 4GALA 4O9GA 5FCCA 1OVSA 2RE9A 3TN93 2XHKA 4W65A 1POV3 3EMRA 4H7MA 4JHTA 1QWRA 3ZFFA 1LOGA 5BY5A 3AYEA 1QJY2 3O0WA 4RHV1 4I3GA 4ZXEA 4IV3B 1JZ8A 1O5LA 2XXZA 3SITA 4QPWA 4FOWA 4KBBA 3CNAA 2XJTA 4EV0A 4LHSA 5BNOB 1JU3A 2BGPA 4RYDA 4LBJA 3VHPA 2C1FA 3D6EA 3THDA 3WQ7A 3ZYRA 4BIFA 4F8AA 1LEDA 4PT6A 1SBFA 4WZCA 3CU7A 1U5ZA 2XUMA 3VGIA 2HWB1 5IUQA 2PHXA 1ZBA3 2LUWA 5FYYA 5LY1A 5K4LA 1V6IA 1OA2A 1N1SA 3TYJA 4FOQA 4JKKA 3I8TA 1AXYA 3CEWA 3U37A 5DG2A 3EQEA 4Z07A 1GV9A 1SCSA 1HW5A 4B4PA 4IEPA 4F83A 1H30A 1UXZA 2W3JA 3OPTA 1XYNA 1X9TA 4RQPA 4XJ8A 4YVSB 4FTSA 5E6HA 2EF6A 2QQIA 3NL1A 3W21A 4QMAA 2MNGA 3ZKYA 4H55A 5FYUA 5A3WA 4NWVA 1SFPA 4ARYA 3T08A 3LOIA 2D5HA 3LEKA 2AC1A 3TBDA 3O1PA 3IT8A 2WAOA 4H7LA 2CU5A 4MO3M 4XJUA 3K3OA 4CDUA 3BIEA 2RS31 5KXEA 3PURA 3Q8FA 5F2WA 4D6QA 4RD7A 5EV7A 1KJLA 1R64A 4Y1ZA 5DAQA 4FPCA 5IK8A 1RUJ2 1VRBA 3M3OA 4K6BA 5DUUA 5EP9A 3USUB 1CAXA 3AZVA 1YXWA 2V73A 4IE0A 5C7GA 2Y60A 1IZ3A 2QQNA 2WRAA 2XDVA 1U5YA 2C6SA 2Y33A 2P17A 4MGSA 4YGDA 3UGFA 4BM8A 2YXSA 4GB32 4LBLA 2J7MA 4E9KA 1WCUA 1YC61 2XVLA 5SV8A 3ZSJA 4CXWA 3V0AA 3BTAA 1J1LA 1D2QA 4FXGB 1C57A 2XLFA 2ZMNA 2D6NA 2OX0A 2YDEA 4LITA 1HLCA 4P9YA 1RYYA 4YLZA 4NIGA 1W6MA 2YY1A 3ZO0B 5JAXA 2EALA 1W39A 2PQQA 1TE1B 2BP6A 2TEPA 3F95A 4HKLA 2DU1A 1LKNA 3AM2A 4JRAA 2X8KA 4D7SA 5DG1A 3ZX7A 1UOGA 3OPZA 2GSYA 3W5MA 2VY0A 5CB7A 3K4ZA 4GMP3 5FXZA 3ZFGB 3C7EA 1DQ6A 3JB4C 4QHZA 4XF4A 1US3A 2RDRA 1POQA 2YU2A 2BNNA 2VD7A 2CSGA 3GALA 1UKRA 4CP9B 3VBFB 3BUCA 2EICA 2ZHKA 4GWMA 4N9IA 4EN9B 4KGQA 4BHPA 2ZGQA 3KGZA 3L2YA 1IG0A 1DYKA 4LBMA 5JXGA 4YG6A 5HXMA 4P5YA 4OVEA 2Y8KA 4OHZA 1V00A 1QHDA 1QQP3 1W2NA 4I0AA 1H6XA 3VBUC 1RUE2 1W8WA 1BVP1 5CKQA 4YGCA 3DPRB 3C7HA 4JAAA 3ZFEA 4D94A 2ZGMA 5FYVA 5C9AA 2RS11 5GLTA 1KQRA 4META 4XZPA 3UKNA 5LBFA 4QX1A 4XBLA 2JENA 3I3QA 5I8TA 4BQYA 3VBRB 4HL0A 3T30A 5FZ8A 5FUPA 4CCLA 5JXHA 1RVF1 5FMOS 4BQ5A 4Q0PA 2AACA 3BU7A 4LTAA 1H2LA 3FX3A 4YGBA 4AVAA 1DZTA 4AQ2A 4QPGB 5DZFA 1GNYA 1YCIA 3ZN4A 1Y4WA 3D8CA 4LBQD 4AWDA 4L11A 4YZ4A 1MEC1 3GBFA 1S0JA 5LB6A 1W8TA 1QH6A 1Z78A 4YARA 2UWCA 2WNUB 1DF0A 1VBD1 2V5YA 4JVAA 3O12A 2XQRA 4PQ9A 5C4WA 2JB8A 4PCRA 5IK4A 4YZ3A 2EIEA 1GZWB 5F5AA 1DGLA 2RR12 3URFA 4LHLA 4BPZA 2D44A 1W9YA 5FFOC 5H9PA 1CAUB 1MS9A 5KWRA 4C91A 1IOAA 2JDZA 1H8TC 2D6MA 2R0HA 4YVWB 2XH6A 3ZR6A 4UT5A 4C0BA 5C33A 1NKGA 1JOJA 4A4AA 3R05A 3K4DA 3MIFA 4UBGA 3RVHA 4XILA 2VVFA 2R062 4XF1A 4UI9L 2E33A 4KWJA 4XJZA 3NVCA 3BALA 4HVOA 3OUIA 5L9VA 2BEOA 4ASKA 3V0BB 1YO8A 1DGWA 2WQ4A 4K1YA 1KS5A 1W6PA 2B7YA 3IN9A 3C2UA 1MZEA 4AFMA 4XJWA 4Y20B 1S0EA 4QKBA 4Z2AA 2WBKA 5J3UA 3PU8A 1AZDA 1NE4A 3E6CC 5JMCA 3B02A 3IMNA 4L92A 1NLRA 4ZHNA 3O7OA 4NRMA 3FJSA 4PQQA 1GSLA 2OS2A 2VVEA 4PDWB 2VZSA 4Q27A 5FYCA 3WF4A 1JYTA 3LCPA 1QEXA 5A6ZA 4EE2A 4F3JA 2BGCA 3PTRB 5FPLA 4AQSA 4OUMA 1BMV1 3ZXFA 5C8CB 4GJZA 2O1QA 2XJQA 2E51A 1BLZA 1SBEA 2CAVA 5JSRA 5K0UC 1JU4A 5T5OA 4LBQB 3RGBA 2EIDA 4DO0A 1JW6A 2VUJA 3H0OA 1V9U2 2QQVA 3MV11 3U14A 2BYVE 5HCAA 4AVBA 4XJAA 1W9WA 1UQXA 5BNPB 5IVFA 1L7RA 3WNLA 2JDKA 4B1LA 3OOXA 2R6QA 1TME1 2ZGTA 4FPLA 1ZZBA 2R042 1QJU1 4OHXA 3BODA 1JODA 3I59A 5BNOC 1UZZA 3HQUA 4QB2A 3WDUA 1WD4A 1MVQA 2FCTA 2G19A 4EWDA 4FPGA 1YQ6A 5FPZA 3NKTA 1IKPA 1YFWA 2YMZA 3DECA 5J48A 1YEWA 3KVAA 4JGYC 2YC4A 2YPJA 3B5LB 1US2A 3OY8A 3SH3A 5CKNA 4QGLA 1Q8VA 4FP3A 1UY4A 1FV2A 2J1TA 3RYRA 5KXDA 2EXKA 4YFZA 5F1RA 5FV3A 4B4RA 3MPPG 3H1YA 4IV3A 1UY3A 4V2WA 1DFQA 1J3PA 1FPN2 1D0HA 2D43A 3WP3A 2J1AA 2XR4A 1AX0A 3WDWA 2WDBA 3EJKA 1W6OA 1HRV1 4NAOA 4D6SA 1OUSA 2VUAA 3VV1A 3OUJA 1NX9A 3ZMOA 1NQDA 4BXFA 3M3QA 2YBKA 2JE9A 4C0HA 5F5CA 4OUEA 4BU2A 1G9CA 3MW4A 3VBOC 2RS13 4QPIB 4PIYA 1JOBA 1RL3A 1R091 2VL4A 3KQ4B 3CHXA 2Z5WA 4YVSA 3K48A 1IS3A 2VECA 3CBNA 5APAA 5FIXA 1G86A 3VUOA 3AYCA 1NLQA 4HPKA 1RUG1 2H0VA 4I02A 5FWEA 4AK3A 5FUNA 5FZ0A 2B4KA 2HWC2 1VAMA 1OUXA 4S2FA 5FZLA 5KXBA 1G7YA 4Q4W1 5FZ3A 2VQ0A 3GBWA 2BRTA 1VBD3 5TSWA 2FZ2A 1BBT1 1IQAA 3USUA 1PVC3 2K0GA 2VZRA 2JDYA 4KWKA 1DQ0A 1JOPA 4RR3B 3RSJA 4CTEA 5L36A 5B4XA 2ORZA 1B35A 1XSRA 2Q1MA 3E6DA 3RZZA 2ET1A 4LBOA 4LKEA 2GH2A 2RG4A 4TYSA 4HG6B 3BTXA 1AX1A 1BEV1 5IFPA 4PBPA 4W8JA 5CADA 3TNQA 5FPAA 1ZX5A 3GNEA 1W6NB 2VZQA 1C8M1 2H0BA 3B9IA 2VZTA 3Q8AA 3AX4A 1N3OA 2IXCA 5C5TA 3S0MA 3LQCA 5CU1A 3H3ZA 3WQ0A 4JV4A 4ZU4A 1DIWA 4Y5SA 3CZJA 1NCQB 2VMCA 3IDEA 3PUIA 4NHMA 4R4ZA 5FMOL 2B9VA 4CP9A 3VBFA 1ZM1A 2ARBA 3BYWA 1F35A 2HWD1 4PF1A 2MPFA 4Q4Y2 4YW1A 2G4IA 4MGKE 3WR0A 3I4IA 4QPGC 4EWAA 2E63A 4G9SB 2WS92 2E9QA 2FHRA 2HWE1 1LAJA 1J3QA 3BOPA 4XAEA 3DPRA 1VRH2 5GLVA 4E4ZA 2RDQA 5F5IA 2L9LA 3WW4A 4A6OA 4V2VA 1N1YA 3ME2A 5I8SA 3PDQA 1LHVA 1ST8A 2WO1A 2RMU3 2VC9A 3VBRA 5BUVA 4SBVA 2Y0IA 3N4MA 2YYOA 2ZAAA 3WNXA 2Q8DA 3SH4A 4JGZB 1H6YA 3BOWA 3APBA 5JCTA 3VN4A 3ZSMA 1C5IA 1AR91 2ZX2A 3GM8A 1AL0G 5FZ6A 3T4HB 2BJSA 3THPA 2QZ2A 2DURA 2CDOA 4J1XA 3U78A 1MZ5A 4BH9A 3I7DA 2WABA 1TVGA 5E8AA 2MEV1 1TME3 2WNUA 2ZGUA 4PI0A 5T55A 1W6QB 3RZLA 3DXUA 1QJU3 3GZUC 4QT6A 5F3GA 3O5SA 3UETA 1H4GA 1A3KA 4MG2A 4CCKA 1GZWA 1ZBE2 2PLV2 4UFJA 1RUD1 4K20A 5JZGB 2VOXA 3SCFA 2JG8A 1FOD1 3P3NA 2WFF2 4O7XA 3WHUA 4HVQA 2JE8A 5E16A 2D7FA 3PUAA 1CAUA 3OJBA 1BHGA 3AVSA 4GMP0 3IWZA 1XNAA 1S2KA 1DQ1A 2O14A 3EHKA 4YVWA 3HVDA 1ND2B 4WBBA 5IAXA 3IMMA 1MQTA 4LBKA 1D2SA 1R1A2 4L9BA 4PDWC 3FE5A 2HWF1 3U4SA 2BNOA 4CDXC 4D69A 1AR72 1FMD1 3V0BA 1ULDA 1D4M3 3DKWA 3VKOA 2DFBA 5FXWA 1S0CA 1HRV3 3MUY1 1NAEA 4AL9A 1L7LA 1NCRB 5K9YA 1GMMA 1BVVA 4Y20A 2G9GA 5FOJB 4E2GA 3WG2A 3NAPB 4U36A 2E7TA 3R4DB 3N9MA 4M0NA 3K51A 3WW1A 2D6PA 2OW4A 3FHAA 5GLZA 1JYXA 1YI7A 4BQ1A 1M4WA 1Z7S3 4ZONA 5BNNB 2FDHA 5KHHA 5CA6A 4N43B 1JZ5A 1QMJA 2BUKA 5FPVA 5HBAA 5A1LA 4JDNA 3ZOIA 3J7MA 3ZIWA 4Z8BA 1RUG3 1BQPA 3B01A 4INDA 4ZU5A 2RDSA 1QNWA 4RSUA 1YFUA 4JQRA 5C8CA 3RNSA 2DWRA 1OA4A 1H2MA 4FPFA 1TMF1 4LBQA 2CTVA 1CJDA 3LF7A 5IATA 1RHI2 2UWAA 3I2HA 4NRQA 5AC92 4AHZA 4LEJA 4Q4W3 4CPBD 3SHRA 5FAXA 4IQPA 3ZXKA 4DNYA 1YFXA 1KFUL 1BBT3 5M0TA 2WNVC 5C71A 1VB4A 2EXJA 5BNPA 3V64A 5F9TA 2ZX3A 3VB9A 5IW0A 5DUVA 1PIV1 4CYDA 1AF9A 3LPGA 2W47A 3QCWA 5D8AB 2QBXA 5L7OC 1BEV3 3NNMA 4AXOA 1PNGA 5DAXA 3ZLIA 3LEIA 3ZVXA 3ZPOA 4IEYA 2PQSA 2VZUA 3GBGA 5FR3A 1ULEA 1ODMA 1RB8G 1QOTA 3P6BA 1O3QA 4N8MA 3UNPA 4PI2A 1C8M3 1H2NA 1GU3A 1WMDA 1E5SA 3HNYM 5C3OA 4EJRA 2P4EA 3E1F1 1RUOA 1UOFA 3HNMA 4Q5OA 4DRVA 4MGTA 2V09A 3PHMA 1CIWA 2VU9A 2JDAA 2OUJA 2Z4FA 4RN5A 1QJX1 3USSA 3FBYA 2HBUA 5KC6A 3A23A 5FO7B 5EFUA 3C8XA 4XDPA 3RJ2X 4HSLA 3VZMA 1VIWB 1UD1A 2DVGA 3T1LA 3A21A 4I30A 4QQLA 4XQWA 1FYUA 5A7PA 1GNHA 3MLKA 4DUXA 3LEMA 1IS6A 4RGGA 2WA4A 4LULA 1VMFA 1COV1 5JOZA 2HWE3 3WUDA 2DVDA 1CAWA 1AJOA 3I3MA 2RM23 1POV1 4QPIA 4UYBA 1QDOA 1HKDA 4ZS2A 3MW2A 1QJZA 4RR3C 1L7QA 5LA2A 4CEYC 2ZACA 4WVVA 2Q8OA 1TZOA 4ATFA 2FCVA 4FSJA 5EJ1B 2W39A 4BQ4A 1AR93 1HV1A 1UXXX 4KG8A 1RUI2 3I2OA 1AYN3 3QACA 1RUF1 2WYSA 1F31A 3T4VA 4A7ZA 5FWJA 3J9SA 1TNRA 3U10A 4WVWA 4CP0A 1G9FA 1C8NA 4QM8A 4JTNA 4XAAA 5FREA 5FP3A 2R49A 5KHKA 4ZPIA 1W2AX 1NA1C 3NMBA 3S5AA 1W8OA 4CCMA 2OIIA 4LO8A 1OSGA 1RUD3 2VJXA 1ZZ7A 4BISA 4FFIA 1FOD3 2AGSA 3ILNA 3POIA 1PO22 4E4HA 5A6QA 1QNYA 3DKQA 4Q4V1 4LLFA 1W6NA 2OA2A 4GH4C 1RUH2 4YW5A 2F6BA 3H8RA 2PHWA 3VBUB 4NUBA 4QXCA 1F4HA 3JBG3 5GLUA 2BQPA 5F3EA 2W1UA 3WNPA 1DYPA 2NN8A 3ATGA 3KF3A 2JD9A 2YBSA 4MHUA 4PLMA 5LA1A 2BOIA 1AR62 1NCQA 3T1MA 4EQVA 5J98B 1BKZA 3MYXA 3ZN6A 1PO12 4C1XA 1DZRA 2ARCA 4IE5A 5DDJ2 1NY72 3AFGA 1LHNA 4MYEA 2UURA 4BK4A 1QH7A 1HXS2 4AGGA 1ASJ2 1YWKA 4LNVA 3S5QA 3VKLA 4AI3A 1S0FA 1O4YA 1WW4A 4LIUA 2UY8A 5J7MA 2ZGOA 5F2SA 5ANNA 1HRI2 4R9CA 3MIBA 1SCRA 5FBZA 4BDVB 4PLNA 2DTWA 4URAA 4YG3A 4IEXA 4FPOB 3EBRA 1GR3A 3T0DA 3MF9A 1WW6A 2D6LX 3I3EA 5A7WB 3HEIA 1L3JA 5JI7A 2HEYF 3B9CA 2K2SA 3DGTA 3G7DA 4LPLA 5FZEA 3WF2A 2GN3A 2JX9A 2XBO2 2DCYA 3KT1A 4YGEA 1JHJA 1SLCA 4RGKA 4J1WA 1LTEA 4JGZA 1JYCA 3M70A 3SEPA 1CN1A 1W3VA 1SBDA 5DABA 1PX3A 1V0AA 3TN92 4FBFA 2CGOA 3MHZA 4X8NA 1JXNA 1H8TB 2PXJA 1V6NA 4XFCA 3KV9A 5FYSA 4A3XA 2WZR2 3EYPA 1RUC2 2WO3A
chains in the Genus database with same CATH topology
1UZWA 1QIQA 2BJSA 1UO9A 1HJFA 1OBNA 2WO7A 2VAUA 1BK0A 1W28A 1E5HA 2VBPA 1HB4A 2VCMA 1ODNA 2DBIA 1W06A 2JB8A 1WA6X 1E5RA 1HB2A 3ON7A 1W04A 2JB4A 1W2OA 5APAA 1GP4A 1DCSA 1HB1A 1W9YA 1W2AX 5C3PA 1W03A 1QJFA 3ZKYA 2BRTA 1HB3A 2Y6FA 5C3SA 1GP6A 1RXFA 2VBBA 4BB3A 3ZOIA 2VE1A 1IPSA 2Y60A 2VBDA 1QJEA 1GP5A 1W3XA 3ZKUA 2DBNA 1HJGA 1W05A 1BLZA 2IVJA 1UOGA 1ODMA 1UOBA 1E5IA 3OOXA 2CSGA 1E5SA 5C3OA 4RGKA 4XAEA 1UOFA 1W3VA 1OC1A 2IVIB 2BU9A 5C3QA 5C3RA 1W2NA 1UNBA 1RXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZW A;  1QIQ A;  2BJS A;  1UO9 A;  1HJF A;  1OBN A;  2WO7 A;  2VAU A;  1BK0 A;  1W28 A;  1E5H A;  2VBP A;  1HB4 A;  2VCM A;  1ODN A;  2DBI A;  1W06 A;  2JB8 A;  1WA6 X;  1E5R A;  1HB2 A;  3ON7 A;  1W04 A;  2JB4 A;  1W2O A;  5APA A;  1GP4 A;  1DCS A;  1HB1 A;  1W9Y A;  1W2A X;  5C3P A;  1W03 A;  1QJF A;  3ZKY A;  2BRT A;  1HB3 A;  2Y6F A;  5C3S A;  1GP6 A;  1RXF A;  2VBB A;  4BB3 A;  3ZOI A;  2VE1 A;  1IPS A;  2Y60 A;  2VBD A;  1QJE A;  1GP5 A;  1W3X A;  3ZKU A;  2DBN A;  1HJG A;  1W05 A;  1BLZ A;  2IVJ A;  1UOG A;  1ODM A;  1UOB A;  1E5I A;  3OOX A;  2CSG A;  1E5S A;  5C3O A;  4RGK A;  4XAE A;  1UOF A;  1W3V A;  1OC1 A;  2IVI B;  2BU9 A;  5C3Q A;  5C3R A;  1W2N A;  1UNB A;  1RXG A; 
#chains in the Genus database with same CATH topology
 1SAC A;  1VBC 2;  1QQP 1;  1YJL A;  2LW8 A;  1TNF A;  5IJR A;  5KC5 A;  1X50 A;  2PAE A;  3LA7 A;  3WNM A;  1SLA A;  3MIE A;  3FMG A;  1DHK B;  4Y5T A;  2ZGN A;  4JC1 A;  1Y9M A;  4BK5 A;  2KXL A;  4A45 A;  1OLR A;  1ZZ9 A;  1SDD B;  5CYY A;  1MZ6 A;  2PFW A;  2VOW A;  1IPJ A;  2A6Y A;  1CZS A;  4OUL A;  5EQU A;  3OYW B;  4GJY A;  5A33 B;  3FLP A;  1RMU 2;  2DUP A;  3M4F A;  5D2A A;  4HK8 A;  3WSO A;  4CCO A;  5IK5 A;  3POF A;  3NAP C;  4N53 C;  4XQD A;  2JDN A;  3ROU A;  1JZ7 A;  3H1M A;  5GLW A;  4NHX A;  3LA2 A;  4CCN A;  1QJX 3;  1CPM A;  4HXC A;  1ND2 A;  1XJA A;  5FP7 A;  2WT0 A;  2NMN A;  2JDH A;  2WWJ A;  4OQ9 A;  4AOC A;  3ZXJ A;  1CX1 A;  3WG1 A;  4YWA A;  4AGV A;  4JX0 A;  2J1S A;  5K7P A;  5A3O A;  3ALQ A;  4YM0 A;  4XZU G;  3T0A A;  2BZD A;  3IDA A;  5D21 A;  3PMS A;  4R9A A;  1W8Z A;  1YRZ A;  1NCR A;  5K0U B;  1QGL A;  3MV0 1;  5A7Q A;  4AI0 A;  1COV 3;  1GZT A;  4CCC A;  1V70 A;  1LHU A;  1HN0 A;  1VE0 A;  2XJR A;  1XNT A;  2KM2 A;  3DXT A;  3AVR A;  2YHJ A;  1XYP A;  2QE3 A;  4BME A;  4AG4 A;  1H1A A;  4UFM A;  3VZO A;  5BNN A;  4EN0 A;  3AKR A;  2VXJ A;  4P9I A;  4YZ5 A;  3O1U A;  4N43 A;  3M3C A;  1X9P A;  1ONA A;  4NPR A;  4RS5 C;  3JU9 A;  4MSV A;  4BZ4 A;  3JD7 2;  4XJ9 A;  1HQN A;  4DXS A;  3OBZ A;  5D8A C;  3V56 A;  2CWM A;  2P5B A;  4IEQ A;  2WWU A;  1PGL 1;  4IGQ A;  1AL2 2;  4W6X A;  1LUL A;  1RUF 3;  2QVS B;  1YI9 A;  4JGY B;  4L0P A;  4Z92 B;  5JSO A;  1KFX L;  3ZYF A;  3PJY A;  4NMI A;  4OI1 A;  3SKV A;  3WQ1 A;  1O3R A;  1JHN A;  1KJR A;  4Q4X 3;  3DL3 A;  4LK7 A;  4LA2 A;  4BMB A;  2CL2 A;  3OD4 A;  5EPA A;  3AP7 A;  3ZYI B;  1JI6 A;  1SHW B;  1CIY A;  1O4Z A;  2SBA A;  1RUE 1;  3AYA A;  4HON A;  4XFG A;  3E97 A;  1DQ4 A;  3M3E A;  3OUH A;  4HKO A;  3LSD A;  1W0N A;  3MO4 A;  3QH6 A;  1VBE 2;  3OB8 A;  3AJZ A;  1EV1 2;  1W05 A;  4YYO A;  4RA0 A;  3ZDV A;  4OHV A;  4Q4V 3;  4Q0U A;  1LHW A;  5FZK A;  2GMP A;  4HT1 T;  3HN3 A;  4NJ4 A;  2GZW A;  1LGB A;  1GWL A;  3WDV A;  1N1T A;  4CDU C;  4XC9 A;  3ORJ A;  3AL5 A;  5F39 A;  4FT8 A;  3VBO B;  1C3H A;  2VNR A;  4XIK A;  4QX2 A;  3IKW A;  3N3H A;  2IXH A;  5T5P A;  1UOB A;  4QU2 A;  1LGN A;  2J22 A;  2Y26 A;  3W5N A;  2VOK A;  4PIX A;  4NHL A;  4UBH A;  4UW6 A;  1PK6 C;  4P9W A;  5JUV A;  4QHO A;  1ND3 C;  3RDI A;  4DXT A;  5FY5 A;  2WLQ A;  3RYP A;  1GOH A;  4DRR A;  1WWY A;  2QKD A;  2V4V A;  1NZI A;  2JDU A;  1WD3 A;  4IER A;  4COY A;  2WR9 A;  4FFF A;  3TWI A;  1PZ8 A;  4DS0 A;  3CLP A;  1RJ8 A;  1S0I A;  2GNB A;  4GXL A;  1U12 A;  3NJV A;  5AVA A;  3N9L A;  4NII A;  5ACA 1;  1RUN A;  4XYX A;  3TEZ A;  3AKQ A;  3AMP A;  1QJY 3;  3WNK A;  2ZBJ A;  3ST7 A;  1H0B A;  2WUH A;  3GXU A;  4R4X A;  1IKQ A;  2EVX A;  1NOV A;  2A6Z A;  1PM7 A;  1EAH 2;  2XML A;  1IS4 A;  1V6J A;  1XNK A;  2R30 A;  3I3B A;  4HAN A;  5CNA A;  1LES A;  1UYX A;  3R4U A;  5F5Q A;  2B9U A;  3ES1 A;  3IIA A;  3RPQ A;  5BYN A;  1J84 A;  5I91 A;  2HLE A;  4CPB A;  2Y6H A;  3KQR A;  2E7Q A;  2QQO A;  2NM1 A;  3NWK A;  3OEA A;  4HN0 A;  4JKM A;  3T2T A;  2AEZ A;  2QDR A;  5CBL A;  1X82 A;  2XB6 C;  2J1R A;  2XWB B;  4RHV 2;  5FYM A;  5JI9 A;  1VPH A;  3MBW A;  1D7P M;  1SLI A;  3N7M A;  4IGO A;  4XCB A;  4Y24 A;  4AW7 A;  4E4D X;  5IVE A;  2C26 A;  5H9R A;  2ZEW A;  1T6B X;  1AYM 2;  2DCZ A;  2GN7 A;  2XL9 A;  4FPY A;  3M3I A;  4MXV A;  3K4A A;  3P5B A;  3UJO A;  4XE9 A;  4BWO A;  1VBB 2;  2FCU A;  1X8E A;  3I2I A;  3WD5 A;  3BKZ A;  4XFB A;  2HWB 2;  1UX7 A;  3E5X A;  1UWW A;  2D40 A;  4WVM B;  2ID4 A;  3ACF A;  1FV3 A;  4QX7 A;  3GZT B;  3OGR A;  2E6V A;  3AZX A;  4HZF A;  1VAK A;  1C1F A;  4EZ4 A;  2VME A;  4IE4 A;  5JXI A;  4K8F A;  2DF7 A;  1GNZ A;  1S0B A;  2JEM A;  4QDS A;  3VBU A;  2A70 A;  2VM9 A;  5CFD A;  3AMM A;  4FOV A;  4JDM A;  3WVJ A;  1WKY A;  1GUI A;  3N9Q A;  2VZV A;  4CDQ C;  4NID A;  5FO8 B;  2XVK A;  3CKH A;  1RUJ 3;  4GWJ A;  4JCK A;  5IK7 A;  2Y38 A;  1PVC 1;  5FXX A;  3DYO A;  2QQK A;  3LWC A;  4PHZ A;  2YGM A;  3J26 N;  3RG0 A;  5C4W C;  3WLU A;  4I2O A;  4TXW A;  4GB3 3;  2QUO A;  2R1B A;  2OT7 A;  2VE1 A;  2RS3 2;  4WZF A;  2H6B A;  1A34 A;  3CJI C;  4CCJ A;  4OQ8 A;  3GCX A;  1Q8P A;  1SMV A;  2CAU A;  1OQD A;  3A0N A;  1GOF A;  4ES8 A;  4LO6 B;  5EXO A;  3U1X A;  4DPN A;  4HVR A;  2VTX J;  2DBN A;  4LOS A;  4Q29 A;  3KT4 A;  4NE9 A;  2BNM A;  1VR3 A;  2WT2 A;  4Y5Z 0;  3FHI B;  2WN2 A;  4FO9 A;  1YLL A;  4AEJ A;  2D3R A;  5A7W A;  4AQT A;  3POB A;  1AR8 2;  2WZP P;  2P37 A;  2XJV A;  2Y6G A;  3WHT A;  3HQX A;  1FPN 1;  3Q9O A;  1UF2 C;  1XE8 A;  1DGR N;  1JS9 A;  1UY1 A;  5CG8 A;  1Q43 A;  4IV1 B;  1OOP C;  2G9Z A;  2QQU A;  4AFC A;  2GC3 A;  2LTN A;  4O65 A;  3AFK A;  1PGW 1;  4AE2 A;  3I2K A;  3VDA A;  1H8T A;  5FZC A;  2VOT A;  3SC7 X;  1DDL A;  5FTT C;  3GGL A;  4UOJ A;  1O4T A;  1W0P A;  4HBN A;  1OLQ A;  1LOA A;  3GZA A;  2JKB A;  1RUE 3;  1SPP B;  3VDC A;  2W91 A;  3D0J A;  4CDX B;  5FYT A;  1GOG A;  2GNT A;  4P08 A;  1LOE A;  1QY4 A;  4PBO A;  3N7K A;  2A6W A;  2VXR A;  5C3R A;  5LBB A;  1RTV A;  2RMU 1;  4B7E A;  2G1M A;  4ET7 A;  5LWB A;  2W1S A;  1UOJ A;  1K42 A;  4DIQ A;  4R9D A;  2I45 A;  2WZ8 A;  2XL7 A;  5A33 A;  3OYW A;  1KRI A;  1UIJ A;  3D5O A;  4NOT A;  3LE0 A;  2RS1 2;  2ARA A;  2ZA9 A;  3GHM A;  2HWC 1;  4TWT A;  4NIA A;  4CU9 A;  2XVG A;  3W59 A;  4BLI A;  3THC A;  2D97 A;  2HEW F;  2OQ7 A;  2VO5 A;  1XYO A;  4W6Y A;  4QX0 A;  4HET A;  3POS A;  1RVF 2;  3PVN A;  3ZYH A;  3NW4 A;  2ZAH A;  1UZY A;  2ZHL A;  3U07 A;  3WF0 A;  4COU A;  4I0W B;  4XFF A;  5K0U A;  4Y1Y A;  3VZN A;  1WLD A;  4MX3 A;  2X09 A;  1VBA 2;  2CGN A;  2WNE A;  5FMB A;  2RR1 3;  1MEC 2;  4P14 A;  2PYT A;  1JYW A;  5EIY B;  2X5I B;  5FRA A;  1DQ5 A;  1UCX A;  3NNL A;  2QQW A;  4RFT 0;  3ILR A;  1E5R A;  5ACA 3;  1UPS A;  1VBD 2;  2WNV B;  3AL6 A;  3CZU A;  5J09 A;  2KD7 A;  2QQL A;  3FC0 A;  1OFN A;  3TNP B;  3NNJ A;  1K5M C;  3PIG A;  1HB1 A;  2HKX A;  5L7O B;  1X8M A;  2R06 3;  1OMI A;  5JXJ A;  1CWP A;  3MLJ A;  2AYH A;  4OI2 A;  1ZZC A;  5L9R A;  5BNO A;  5C3P A;  4FI9 A;  3UGH A;  4OFG A;  1D4M 1;  1LEN A;  4Q0V A;  2CV6 A;  4TLG A;  2J1V A;  2SLI A;  2DVB A;  4TN7 A;  5A3U A;  5JWP A;  3LA3 A;  4JGY A;  1CJP A;  4X6R B;  5FLH A;  1HX6 A;  4N7I A;  2YUE A;  5JIU A;  2FD8 A;  1SLT A;  2QQM A;  4IDZ A;  3CIH A;  4L2N A;  3F2Z A;  4CU7 A;  5C3S A;  5HV0 A;  1F4A A;  3B94 A;  4Q8K A;  2RS5 1;  5KBF A;  1YQ2 A;  3ZSL A;  3BTZ A;  1Z7S 1;  4OHW A;  5AFB A;  2WS9 1;  1H1I A;  2VNV A;  1Q3E A;  2JWP A;  2W1W A;  1VRH 1;  5J37 A;  1VAL A;  3KVB A;  1UYY A;  2HH9 A;  2A5Z A;  4ZZ5 A;  1EY2 A;  2P3K A;  4CDW C;  1BK1 A;  3HR9 A;  2BWA A;  1S2E A;  2RJL A;  2VBD A;  2VMG A;  4XCA A;  3RMY A;  1Y9Q A;  1WLT A;  1BYH A;  1OKQ A;  3Q8C A;  4ZZ8 A;  3O1T A;  2N7G A;  2NPI A;  1N47 A;  1HJG A;  4QKN A;  1KGY A;  1V9U 3;  2DUQ A;  3FZ3 A;  5FP9 A;  1IHM A;  4NPM A;  4M0H A;  3PLQ A;  1QOO A;  2OUH A;  2GME A;  3CMG A;  4H14 A;  5CG9 A;  2VPV A;  4AEM A;  4CEY B;  1ULC A;  2ZJC A;  4IEV A;  5IVB A;  1ENS A;  1B35 C;  3GYD A;  5EJ3 A;  4GWN A;  2R04 3;  4OI4 A;  3ZIX A;  3BCW A;  4QGM A;  4KWU A;  1POV 0;  1VP6 A;  1PZ9 A;  5EWS A;  2ZS6 B;  4FQ4 A;  3FUQ A;  1NQJ A;  4KGG A;  4M4R A;  5FZF A;  1ZBE 1;  2PLV 1;  1O5U A;  1JMU B;  2Q4S A;  2ZGR A;  3LPF A;  2VQU A;  3ZSE A;  1P8J A;  1TME 2;  5BPX A;  1NA1 B;  4AAP A;  5ISL A;  1ZYB A;  3WF3 A;  3U11 A;  2BU9 A;  4JKL A;  2DFC A;  4KNC A;  4K40 A;  4NIH A;  4AED C;  1RXG A;  1CAV B;  4JHZ A;  4TLF A;  3ZFG A;  5AFE A;  3QOP A;  1R1A 1;  5CKM A;  1KD7 A;  1FPN 3;  1JZ6 A;  4PJY A;  1AJK A;  2ZHM A;  2I2S A;  3J7H A;  3QBQ A;  3Q8E A;  5A1F A;  1AR7 1;  2VCA A;  1C28 A;  5I0T A;  3B3Q E;  1G9D A;  3LIG A;  5FBJ A;  1HJF A;  4GH4 B;  4XMI A;  5AVP A;  2XWJ B;  5FY8 A;  5FZH A;  4AI9 A;  2WA3 A;  4BOW A;  3ABZ A;  4W50 A;  3TB0 A;  1CGP A;  4LJH A;  1TEI A;  4NN0 A;  3FFQ A;  1OHF A;  3NNF A;  4NRO A;  3HMY A;  4QB1 A;  5ABJ C;  2RM2 1;  2IXL A;  1AVB A;  1UAI A;  3QLQ A;  4WM7 C;  1JZ2 A;  4JRL A;  5FQ0 B;  1UL9 A;  5LRS A;  5A3L A;  4DUW A;  5A3T A;  4AFA A;  4NWW A;  2PA7 A;  4LO5 B;  4WV8 A;  5J1X A;  5FK7 A;  3GZE A;  3CJX A;  3ON7 A;  1OVP A;  1XQN A;  1AYN 1;  2HWC 3;  4QPG A;  2Q8C A;  4YW7 A;  1R09 2;  3RS6 A;  2VNO A;  1RJ7 A;  3A7Q A;  3VHN A;  3VHR A;  1YNA A;  1J1T A;  1RHI 1;  5E1R A;  2GMM A;  3LFM A;  3K3N A;  5JIA A;  3NV2 A;  4YZ1 A;  2PN5 A;  2X29 A;  1K3I A;  2WO2 A;  2ZX0 A;  5F6L B;  3TEX A;  3UGG A;  1LEC A;  3HQR A;  1N3P A;  1ULO A;  3S6P A;  3U4X A;  2CNA A;  3LD8 A;  1OF4 A;  4AI8 A;  3AP9 A;  5FZ7 A;  4TTG A;  3M7A A;  2B8M A;  3AZW A;  1OA3 A;  3EO6 A;  5FZO B;  2TNF A;  3AKT A;  3KB5 A;  4IV1 C;  1T2X A;  3WCR A;  2VBB A;  2XLG A;  3V65 A;  1DP0 A;  1FXZ A;  3AP4 A;  4B4Q A;  1V6M A;  1OI6 A;  3HT1 A;  4LR4 A;  3N7J A;  4BB3 A;  4AAX A;  1X7N A;  2Q8E A;  3KV5 A;  1UYP A;  4CXX A;  5C70 A;  3JBG 1;  2QQP A;  1W0O A;  4UF0 B;  4P02 B;  1S2B A;  1DG6 A;  2GC0 A;  1JYV A;  2BER A;  3VD4 A;  4QXB A;  4LKD A;  2R07 2;  1CD3 G;  3CDZ B;  1VAV A;  4LHN A;  3J8F 1;  3M1H A;  2IXJ A;  4N53 B;  3H42 B;  1YQ8 A;  1OQE A;  1NLS A;  4OHY A;  2F4L A;  3VHO A;  4Q4Y 3;  1STM A;  2RS5 3;  2HEV F;  2VW0 A;  4BLJ A;  5I0S A;  3VD9 A;  2XPJ A;  2WSU A;  2ZGL A;  3ETQ A;  2WS9 3;  4HMZ A;  4OMC A;  3SKJ E;  4PDW A;  3R4S A;  2Y6K A;  1SPP A;  4CDX A;  2AZ5 A;  4BQ2 A;  4Y22 B;  1VRH 3;  1SQ4 A;  4S2G A;  4KH9 A;  3WOG A;  5FPB A;  2GC1 A;  1PMI A;  3BPS A;  2HWD 2;  4K21 A;  4KQ7 A;  4M00 A;  1QOS A;  3LIH A;  3DF0 A;  1PMJ X;  2HWE 2;  3NV1 A;  2PMW B;  4NR1 A;  1O3S A;  1OC1 A;  2ERF A;  1UMI A;  5F7U A;  2X5I C;  1RUI 1;  2HYX A;  4AZZ A;  2IWG B;  2BDR A;  3GDB A;  2IC1 A;  1ZZ6 A;  2GDF A;  2PHU A;  4Y1V A;  1O6U A;  1QU0 A;  1YFY A;  2DV9 A;  2ZGP A;  4LOR A;  4RS5 B;  3AMH A;  4XTM A;  5FK8 A;  4A6S A;  1JZ3 A;  4L97 A;  3SH5 A;  4JQT A;  4ASL A;  2PAK A;  2P6C A;  1VLN A;  4P9X A;  1G9B A;  5A32 B;  1AR9 2;  5CFC C;  1DGR A;  2JE7 A;  2XGX A;  1HQL A;  2YFZ A;  4FQZ A;  3VBH C;  1ZBE 3;  2JJ6 A;  1OH4 A;  2PLV 3;  4PLO A;  1V6K A;  4R8H A;  3RMX A;  3MIG A;  4D6R A;  1SLL A;  1CPN A;  1WCK A;  3VDD C;  3VZJ A;  4N90 A;  2MEV 2;  1W9F A;  3RWN A;  3H50 A;  3W58 A;  1F8V A;  1A78 A;  3HNB M;  2WNV A;  1YUD A;  4XFA A;  2AH2 A;  1RUH 1;  1CZV A;  5I8Y A;  1REF A;  4B8E A;  1Y43 B;  4UFI A;  4YPJ A;  5L7O A;  5LEK A;  1R1A 3;  1J58 A;  1RUD 2;  4XQ4 A;  5FMD A;  2P3Y A;  2BFU S;  4Z1V A;  4FTE A;  3K46 A;  1AR7 3;  3NO8 A;  4XFI A;  1FAY A;  1MZF A;  5LZ6 A;  2JB4 A;  1NUK A;  1OPO A;  2FMD A;  4XUP A;  1GP4 A;  5HV4 A;  5K8S A;  1DCS A;  1E57 A;  1XU1 A;  2B39 A;  4DXR A;  1Q56 A;  3III A;  2DYC A;  1PO1 1;  1O8P A;  5FYI A;  1J59 A;  4CDU B;  5KXC A;  4C1W A;  1GBG A;  2IFR A;  4LMF A;  2C4X A;  2I07 B;  2VQT A;  4Y1X A;  2ARX A;  2HWF 2;  2E53 A;  1RIN A;  5A1A A;  1LCL A;  3D0S A;  1FMD 2;  3SCG A;  1UX6 A;  4QHB A;  1CAX B;  5T54 A;  1KDM A;  1PK6 B;  2D93 A;  4MH0 E;  4YW3 A;  2VOV A;  1ND3 B;  3HJR A;  2AEY A;  4DEQ A;  5FZA A;  3A22 A;  4QAW A;  3IAQ A;  1OFS A;  3MUZ 1;  1XU2 A;  1ZA7 A;  2W2I A;  3ZYB A;  3KZ4 C;  3H3L A;  1H9W A;  4ERO A;  2XHN A;  2JIJ A;  2XBO 1;  2VH9 A;  4FVV A;  4YM1 A;  1F5J A;  4EWE A;  2ZHN A;  2HJI A;  1OUR A;  1RHI 3;  5AC9 3;  3P1I A;  4CUG A;  1LOF C;  1QXP A;  5ERL A;  2AUY A;  3OBR A;  4LE4 A;  3M2M A;  2PHR A;  4Q4X 1;  2UYB A;  4OZO A;  4QU1 A;  5T5L A;  1Y3T A;  5CIS A;  4MZU A;  5IVC A;  2FDG A;  1GP5 A;  4XTP A;  1ENQ A;  1V6L A;  2WZR 1;  3FN9 A;  4RR3 A;  1C5H A;  1RUC 1;  4LK6 A;  1VBC 1;  4CEY A;  5JOY A;  2EAA A;  4FAG A;  4HK9 A;  1TMF 2;  4UW4 A;  1U5I A;  3WP5 A;  2WLP A;  1J83 A;  5FY9 A;  2Y34 A;  3UK9 A;  3B00 A;  1SZB A;  2VR4 A;  5DZE A;  5FY0 A;  4XUQ A;  5FYH A;  2R1D A;  1S55 A;  3N35 A;  4DEV A;  4KWL A;  4BQ3 A;  5A3N A;  4QDQ A;  3AXD A;  2PTM A;  5FKC A;  4KMQ A;  1OLM E;  2NLR A;  3VD7 A;  1PIV 2;  4GZ9 A;  5EJZ B;  1NA1 A;  4XUN A;  3ZYG A;  1RIT A;  4GQ7 A;  4N7U A;  3RFR A;  1I9R A;  5HXV A;  5JR2 A;  4BXS V;  1GKB A;  3PUQ A;  1CAV A;  2VNG A;  4CU8 A;  3POJ A;  3KT7 A;  1I1E A;  1OD3 A;  4HLT A;  1R08 2;  2P34 A;  2RVA A;  3J8F 3;  4XAC A;  1AHS A;  1A6C A;  4MGZ E;  3WW2 A;  4JZR A;  4G4F A;  4GH4 A;  1OH3 A;  3ZXL A;  4ASM B;  1LNS A;  5GZE A;  4CCD A;  4K1Z A;  2OKX A;  3ZXA C;  3RZG A;  3LDB A;  4XEZ A;  2WII B;  2FBE A;  1UZV A;  2D6K A;  5IAV A;  2ZGK A;  1QIQ A;  3OSD A;  5FPX A;  3O1M A;  4CDQ B;  3KV6 A;  4YM2 A;  3U75 A;  3C7O A;  4LKS A;  2EIB A;  4NRP A;  1HV0 A;  5FY1 A;  5LY2 A;  2DVA A;  4M4P A;  3ASI A;  4Y33 A;  4AF9 A;  3VBS C;  4LOT A;  5C4W B;  5FQ0 A;  1QJY 1;  2LRO A;  3QD6 A;  2RV9 A;  3UV9 A;  4LO7 A;  3VD5 A;  2EXH A;  3WP4 A;  2VBP A;  3OGJ A;  3JD7 1;  2A6X A;  2FMY A;  2HYK A;  4ONU A;  2DTY A;  2JD4 A;  3CJI B;  3ES4 A;  2IXK A;  2ZXQ A;  3J7N A;  4FP2 A;  5DXD A;  2LS6 A;  4BQW A;  1C1L A;  4YM3 A;  1O3T A;  5DAP A;  1AL2 1;  1RUI 3;  1JUI A;  3O14 A;  3KM5 A;  5E88 A;  4DXZ A;  1WLC A;  4XUT A;  1W9T A;  1HIX A;  2W68 A;  4D7T A;  3LFI A;  2X53 S;  1I5P A;  5FZI A;  1W6Q A;  1ZRI A;  2WZE A;  1EUT A;  1LOC A;  1EPZ A;  1ZNP A;  3VKM A;  4E8C A;  2VQA A;  5HI0 A;  4FPE A;  3AMN A;  3IBM A;  5FZ9 A;  1RIR A;  5G05 L;  3HBZ A;  1GAN A;  5JDB A;  2R0F A;  2WT1 A;  5F37 A;  1OOP B;  4WM8 C;  1ZBA 2;  4AHY A;  2YC0 A;  1PO2 3;  1VBE 1;  3C7F A;  1EV1 1;  1OPM A;  3OGS A;  5FZO A;  1JYI A;  1QXR A;  5I93 A;  2ZEZ A;  2B42 B;  1WUV A;  2YGL A;  1RUH 3;  2B5H A;  3S30 A;  4HN1 A;  5GZG A;  3FUO A;  1WLW A;  4XW3 A;  3S7E A;  1LGC A;  2FDJ A;  4B1M A;  4CEW C;  3IDB B;  4UF0 A;  2JG9 C;  4IGP A;  4KU7 A;  1H2K A;  1PGS A;  4COV A;  2NP0 A;  1RUJ 1;  4UFH A;  3JXS A;  1PHM A;  1AR6 3;  1RED A;  2K9Z A;  5LK7 B;  1TG7 A;  2FDI A;  2BVV A;  4ISQ A;  2ZAB A;  3CF6 E;  1PO1 3;  3N7L A;  3LGR A;  4GB3 1;  4QM9 A;  4RGA A;  1UU5 A;  3D3A A;  5I0D A;  3NAP A;  4N53 A;  5DDJ 3;  3KHC A;  4XBN A;  4H3W A;  4CUA A;  5DAV A;  4DY3 A;  3NST A;  4LE3 A;  3OBA A;  1HXS 3;  3KMH A;  2VMF A;  1ASJ 3;  1XPW A;  2ORX A;  2ZKN A;  2QDN A;  3ZYJ B;  3ZFF C;  4QQP A;  3LSE A;  1WA4 A;  1YQ5 A;  1HQW A;  3FHQ A;  4Y22 A;  2QCS B;  3CO2 A;  4PIZ A;  2XON A;  3I2F A;  4KG0 A;  2UWB A;  2P6H A;  5E89 A;  5IVY A;  4D3W A;  2R32 A;  3D4K A;  2FZ1 A;  5A6X A;  1JN2 P;  1G9A A;  1KIT A;  2Q1Z B;  3E6B A;  2XBO 3;  4ZXK A;  1N3Q A;  2V5D A;  1W9S A;  5C8W A;  2NZ9 A;  4JDO A;  2FDF A;  4UWD A;  2C24 A;  4I09 A;  4MOA A;  5IT6 A;  3AK0 A;  2J42 A;  1O7F A;  2UYA A;  3ECQ A;  4YW6 A;  3NV4 A;  2NQY A;  2WZR 3;  3OPW A;  4QX8 A;  2BBV A;  1K5M B;  1RUC 3;  1VBC 3;  4RS5 A;  5LAS A;  1SLB A;  4RQP C;  2GC2 A;  2BFU L;  4LHK A;  5D8A A;  2IVI B;  3AJY A;  4AFD A;  1W8U A;  4B3N A;  1CON A;  5A32 A;  4F7Z A;  4COW A;  1F15 A;  5LA0 A;  5I0U A;  1AYM 1;  1W6O B;  4AFB A;  2ZPX A;  4E2S A;  1UZW A;  2BV4 A;  1UKG A;  2E31 A;  2EIG A;  3MID A;  1DLL A;  3OEB A;  1VBB 1;  4ISR A;  4MHR A;  2MHF A;  5T50 A;  5BV6 A;  4GUL A;  3JQW A;  1ZRR A;  5CAZ A;  4P5H A;  1UO9 A;  1QQP 2;  1RMU 3;  1S1A A;  4TSV A;  5LW9 A;  4XHB A;  4R52 A;  5A80 A;  1X36 A;  3SQO A;  4L99 A;  4XVH A;  2YBP A;  1ENX A;  2EAK A;  3A0K A;  4XUR A;  1UU4 A;  3ZXE A;  4EN8 B;  2PAM A;  2ZX1 A;  3WV6 A;  2YPD A;  4P9L A;  4N9H A;  4OI0 A;  1UU6 A;  2YB7 A;  2ZX4 A;  4HPK B;  1GIC A;  4CDW B;  2PEL A;  2DBI A;  3OD0 A;  3WIN E;  1HN1 A;  1W06 A;  1UYZ A;  5FP8 A;  1UY0 A;  1YIP A;  4DMI A;  1OKO A;  3E5Q A;  2RR1 1;  3ZYP A;  3JCI A;  4Q1R A;  1HB2 A;  2VMI A;  3MGU A;  3AC0 A;  4D8M A;  1O91 A;  4XF9 A;  1FNZ A;  3NNG A;  3P3P A;  1XSQ A;  2BVB A;  4IEO A;  3I2J A;  3N36 A;  1PK6 A;  1SFY A;  2B46 X;  1Q5O A;  2PHF A;  5LBE A;  4YZ2 A;  1ND3 A;  1B35 B;  5JSP A;  1IGO A;  2W46 A;  1WW5 A;  2WJS A;  2WC2 A;  3OF1 A;  2R06 1;  3EXU A;  4Z82 A;  3JD7 3;  3INA A;  3B7M A;  2ZZQ A;  4DFS A;  2P2K A;  4LIV A;  4A7Y A;  1U0A A;  5FPU A;  1QDC A;  2CHH A;  1AL2 3;  3DCQ A;  3OG2 A;  5G04 L;  2Y6J A;  1AR8 1;  4CU6 A;  5JPM B;  1KS4 A;  4AVT A;  1WMF A;  1DZQ A;  4KI5 M;  4ITC A;  2VZP A;  3ZM8 A;  1HB3 A;  1OQ1 A;  1XE0 A;  2Z42 A;  4KU8 A;  3JZV A;  1Y7B A;  1ALY A;  3BB6 A;  4U2A A;  5H9Q A;  2KR2 A;  3IDC B;  3ZFE C;  3POE A;  5C9A C;  3WY6 A;  4AED B;  1PGL 2;  4NVP A;  2VUC A;  2OYZ A;  1DYO A;  2YG0 A;  4UAP A;  3GF6 A;  5KR7 A;  3ZPY A;  1IPS A;  3MDP A;  3PNA A;  2GU9 A;  2NYY A;  4DIN B;  4L8Q A;  1VBE 3;  1EUU A;  1EV1 3;  5B4N A;  1S0D A;  4FFH A;  1QJE A;  1XNC A;  1W3X A;  1F5F A;  1XXN A;  1W90 A;  2A73 B;  2ZGS A;  1JH5 A;  1T6G C;  5DUW A;  5LK5 A;  2OZJ A;  3DN7 A;  1ZRD A;  4LT5 A;  5LEJ A;  2VUL A;  2VG9 A;  5CFD C;  4QX5 A;  3BGA A;  1V9U 1;  2ILM A;  2VVD A;  1W99 A;  2ZMK A;  1WCD J;  4ZS3 A;  4CE8 A;  5ABJ B;  1AXK A;  3AZY A;  3HOB A;  4QQO A;  3NJY A;  4QXK A;  4WM7 B;  5GZC A;  1JYN A;  3IM0 A;  3PL0 A;  5SV5 A;  1QXJ A;  1YHF A;  1S4C A;  3PU3 A;  5HCH A;  4GKY A;  3AZZ A;  4GIQ A;  4MGY E;  4ATE A;  2ZOE B;  3O1V A;  2R04 1;  5EZW A;  2WN3 A;  2OVU A;  1D4V B;  4SLI A;  5FZ1 A;  5LA9 A;  4CUC A;  2ZZJ A;  3AB0 A;  2O8O A;  4NPL A;  1LB2 A;  4NO4 A;  2HBT A;  5FDB A;  3BTY A;  1D0G A;  1VBA 1;  4YSF A;  2W87 A;  2D98 A;  3RZK A;  2YU1 A;  1XE7 A;  3T2P A;  2W5F A;  1FNY A;  4CDQ A;  4XIO A;  3CQO A;  4A2U A;  3PVO A;  1JZ4 A;  3H8X A;  1E5H A;  3LDR A;  2JKX A;  4XBQ A;  4LKF A;  4KBZ A;  4XXA A;  1Q8S A;  1NXM A;  3HAG A;  3I97 A;  4URT A;  4DZG A;  4EN7 B;  1MS1 A;  1EAH 3;  4QX3 A;  5JOW A;  2I74 A;  2ATF A;  2A7A A;  2GH8 A;  1U5X A;  4K7J A;  3CJI A;  2WL1 A;  2JG8 B;  1JTZ X;  5F8P A;  1Q8Q A;  5FJK A;  4A7K A;  2ENR A;  4D0Q A;  2PHL A;  2WO7 A;  5ACA 2;  3KV4 A;  5DMY A;  3U0Z A;  3HWJ A;  5A7S A;  3H7J A;  2IFW A;  4RHV 3;  2W94 A;  3O1S A;  1W8F A;  1MQT B;  1IS5 A;  2TBV A;  5KHI A;  5FUI A;  2VCM A;  3VZL A;  3WG3 A;  2ES3 A;  3IZO A;  3ZDS A;  3HPN A;  2EXI A;  5GM0 A;  1AYM 3;  4QPY A;  4M3C E;  2E26 A;  3WQB A;  5I0R A;  4LBN A;  3SXW A;  3ACG A;  1VBB 3;  3ELN A;  4UFK A;  1WA6 X;  3RI8 A;  1OOP A;  2HWB 3;  3FWE A;  1I5Z A;  5FKB A;  3O0V A;  3FLT A;  5DAW A;  3KGL A;  3H1W A;  4IUG A;  3N9N A;  4DY5 A;  2JIG A;  3WEZ A;  1UMZ A;  2OXB A;  2IUW A;  5DUX A;  4AVS A;  4Y1U A;  4EZH A;  2D3P A;  1GZC A;  4YW4 A;  4LA3 A;  4S2D A;  1J3R A;  3GJB A;  4AVC A;  1KXG A;  2ADD A;  5KHJ A;  1QJF A;  4DB5 A;  2GP5 A;  1A8D A;  4AHW A;  5F3C A;  3HIF A;  2UU8 A;  4IEU A;  3LKJ A;  4RFR B;  5FMC A;  2QZ3 A;  4YW2 A;  5CZK A;  5C5U A;  3O1O A;  2W95 A;  3I3D A;  1PZ7 A;  2RS3 3;  3GJA A;  3K75 B;  4IE7 A;  4B7K A;  2RHP A;  4XF0 A;  3KSC A;  4XPV A;  1UPI A;  4P9J A;  1PVC 2;  5HCB A;  2X05 A;  2IXI A;  4CA9 A;  3R6S A;  2W1Q A;  2J1E A;  1VJ2 A;  3JQX A;  3NRU A;  3JUU A;  4IV3 C;  1WCQ A;  4P00 B;  5HPO A;  4EYU A;  5CFC B;  3BN6 A;  3POG A;  3NJZ A;  3VBH B;  2WQZ C;  4IL7 A;  1AR8 3;  3J4U H;  2YV8 A;  3VDD B;  3UYJ A;  2F17 A;  4J25 A;  5F6K A;  2IVJ A;  4QD2 A;  4X8P A;  5FLI A;  1F2N A;  4M01 A;  4Q4Y 1;  4LXL A;  1XB9 A;  1MS4 A;  1W2U A;  2C0Z A;  2VTF A;  4MUV A;  1K5M A;  2WKK A;  4B29 A;  1KDK A;  4YG0 A;  1OT5 A;  3PVE A;  3RI9 A;  1CZT A;  4RL7 A;  4YVS C;  3T3Y A;  1IQD C;  3FL7 A;  4ARX A;  3CL1 A;  2Q0A A;  3RJR A;  5EHD A;  4V1P A;  5HCF A;  1PGW 2;  5A3M A;  4M3C F;  4FCA A;  1F9K A;  5JVV A;  1W8H A;  4CCE A;  5GJ6 A;  1UN1 A;  5C3Q A;  4ZY9 A;  4JTO A;  3VBO A;  1CAW B;  4GD4 A;  4IW3 A;  3VKN A;  5FOB B;  4Y4R A;  2VZ3 A;  2C5D A;  4QWN A;  3UL2 A;  3HD8 B;  3I54 A;  3BI3 A;  1BMV 2;  4K8R B;  3KCC A;  1NZC A;  3H8U A;  4I3P A;  1K5J A;  4A42 A;  4E2Q A;  1GQG A;  2RMU 2;  1RVF 3;  3I2G A;  1DGW X;  4CDW A;  4QKD A;  1OBN A;  3VL9 A;  1OLM A;  3AKP A;  2JIC A;  4AGR A;  1BK0 A;  1VMH A;  3DYM A;  3KCY A;  3W20 A;  4OYU A;  3TRS B;  1VBA 3;  1MVE A;  3GHN A;  3H9A A;  1WBF A;  1V6O A;  5F3I A;  1MEC 3;  3N9O A;  3SNM A;  2GP3 A;  3NQH A;  3IAP A;  1Q8O A;  2WFF 1;  1EPW A;  1YYN A;  1ODN A;  2F4P A;  1QJU 2;  2DUO A;  2JDM A;  3AP6 A;  3MFA A;  4Q2F A;  4AYU A;  1ZRE A;  4CRQ A;  3NJX A;  3RWK X;  4AQ6 A;  1PNF A;  4HKW A;  5FZD A;  4EN6 B;  1K12 A;  3G6J B;  5EYY A;  2A3W A;  3ZFG C;  1LU2 A;  3ITQ A;  4BE3 A;  1ENR A;  1W04 A;  1AXZ A;  3VL8 A;  5GZF A;  1WMX A;  3MZH A;  3VBF C;  4XDO A;  4UW5 A;  4Q8L A;  2R07 1;  4LLO A;  1A8M A;  5FYZ A;  3LDK A;  2DCK A;  1PMH X;  1MS3 A;  3AKS A;  1NE6 A;  1PM4 A;  2A1X A;  1UZ0 A;  2D5F A;  1LR5 A;  2V4A A;  2VMD A;  4QQH A;  4COZ A;  4O9E A;  1LOD A;  5KHG A;  2QFE A;  3DPR C;  1PVX A;  4QGN A;  3NKG A;  3VZK A;  4AED A;  3BPZ A;  1D4M 2;  3N9P A;  4WVZ A;  3BU0 A;  4GKX A;  1HRV 2;  4MXW B;  4CUB A;  4UW3 A;  5L73 A;  5A6Y A;  4MGQ A;  4BYY A;  3VBR C;  4CVU A;  2Q30 A;  2VCB A;  3ZN6 B;  4WVM A;  2ET7 A;  2W08 A;  5FY4 A;  3J7L A;  2NMO A;  5DPN A;  5FZ4 A;  5IYY A;  1W8N A;  2RS5 2;  4G3Y C;  5A70 A;  2WYF A;  1H4H A;  2WQ8 A;  1Z7S 2;  2VGD A;  2VUD A;  1DLC A;  1NT0 A;  4ES9 A;  5AC9 1;  5JOX A;  2ZTN A;  4H2A A;  4M3C B;  5JLV A;  5ABJ A;  5FJH A;  1DQ2 A;  4AEK A;  4Q26 A;  4XXP A;  4WM7 A;  3VBS B;  2WNU C;  2OQ6 A;  2XKP A;  1RUG 2;  4DQA A;  1B09 A;  5FZM A;  5LBC A;  3UES A;  2Z79 A;  2AEN A;  3AYD A;  2RJK A;  4LO4 B;  2DCT A;  4XF3 A;  5T3N A;  4OLL A;  4GA9 A;  3IB3 A;  3B93 A;  3DEM A;  1IPK A;  2VW1 A;  3ACL A;  4Q4W 2;  1N1V A;  1ULF A;  2JG8 C;  2C9A A;  1H1M A;  4YFW A;  3SMH A;  4FAH A;  5IVJ A;  4YRD A;  5J96 B;  5F32 A;  1BBT 2;  2OPK A;  1EYB A;  2Y6L A;  4R9B A;  4ZU7 A;  5GZD A;  2BPA 2;  1GFF 2;  3IPV B;  1RGS A;  1WCS A;  3KHB A;  2WAA A;  4HFS A;  4YVW C;  2PHD A;  5IHR A;  1BJQ A;  1MQT C;  2V72 A;  1E5I A;  4QB6 A;  1K45 A;  4Y4Y A;  1BEV 2;  3TOJ A;  1W2T A;  3ACH A;  2VTX A;  1ACC A;  4I0B A;  5FP4 A;  4BJ0 A;  4XHX A;  1FAT A;  3LZZ A;  1S0G A;  2VW2 A;  3DUI A;  2ARE A;  3FLR A;  4IET A;  2BBA A;  3KLS A;  4WM8 B;  1C8M 2;  1WBL A;  4AHX A;  4NAM A;  5JR7 B;  4XAB A;  3T09 A;  4IV1 A;  2A3X A;  3WDX A;  2A3Y A;  3AP5 A;  4XDQ A;  4DUV A;  1APN A;  5T52 A;  2ADE A;  3LEG A;  3GCW A;  4IXL A;  2XJS A;  2Y0O A;  1XND A;  3ENR A;  4LQR A;  1OD5 A;  4XOG A;  4CEW B;  1ZRF A;  2CWS A;  2XJU A;  4FFG A;  2JG9 B;  4E27 A;  3I49 A;  2O0O A;  5JZG A;  3RRD A;  3PIJ A;  2ZEX A;  2P3I A;  2VAU A;  1OXC A;  3MEP A;  3WW3 A;  5CIR A;  3MW3 A;  5C8C C;  2G9F A;  4FPK A;  5H9S A;  3RZH A;  3MPB A;  4MVT A;  1X33 A;  3LB9 A;  2LRP A;  2CY6 A;  3HN1 A;  1SFN A;  3WDT A;  3THT A;  2Y64 A;  3M8L A;  4DOU A;  1Y9G A;  2FDK A;  2RM2 2;  3VDB A;  1WME A;  1R09 3;  1UMH A;  5IWF A;  3ZFF B;  3WZ1 A;  1UIK A;  1SDW A;  5BNP C;  4D7Y A;  3VLB B;  3OGG A;  4A41 A;  2A75 A;  3EB7 A;  3KCX A;  3H7Y A;  5FYB A;  4IEZ A;  4C8D A;  2QJV A;  2JEC A;  4CP2 A;  2ZKL A;  2XLA A;  3O0X A;  1AYN 2;  2D6O X;  3PTY A;  1DBN A;  4FOY A;  3R0R A;  3AMQ A;  3BVC A;  2A6V A;  3PME A;  1QKQ A;  3NV3 A;  2K46 A;  1MS5 A;  4BCU A;  2OZ6 A;  2TUN A;  2WFF 3;  1MS8 A;  2ZCW A;  2X5I A;  1PO2 1;  3ILF A;  3MI8 A;  4MLO A;  1WGP A;  4BIO A;  5A3P A;  1I3H A;  4KL1 A;  2C9K A;  4PF5 A;  3WX5 A;  2Q5T A;  4OZX A;  4FXK B;  1NXD 1;  3WDY A;  1GWM A;  2LAL A;  3T0B A;  3ZR5 A;  4RQP B;  5FLJ A;  2O8Q A;  2R16 A;  1RXF A;  4YNI A;  1FOD 2;  2B45 X;  3S7I A;  1YIF A;  4IES A;  5LRR A;  5CFC A;  1TQ5 A;  1CQ9 A;  4Y26 A;  4FPJ A;  3VBH A;  4QXH A;  1GLH A;  5IFT A;  1AR6 1;  3KS7 A;  4NHY A;  2R07 3;  1ULG A;  1ZA4 A;  3VDD A;  3I2D A;  3MIC A;  2J1U A;  3PUH A;  4GWI A;  1R08 1;  1BXH A;  3TEY A;  3WP6 A;  2X10 A;  3ETP A;  3JBG 2;  4BA6 A;  5DDJ 1;  3Q8B A;  1NY7 1;  3ZKU A;  4XET A;  1ULP A;  1H9P A;  2VCC A;  4W6W A;  3SIS A;  1HXS 1;  4J6G A;  1ASJ 1;  4O61 A;  4I01 A;  4Q1P A;  4QPI C;  4XFH A;  1OF3 A;  2XQX A;  1UY2 A;  1Z0H A;  2WNO A;  1NYW A;  3RZM A;  1HRI 1;  4AR2 A;  2JXA A;  3T2O A;  4FTB A;  3J8F 2;  5C6C A;  3L9J T;  2XUE A;  5LAT A;  3V0A B;  5BNQ A;  4ORF A;  1O59 A;  2VZO A;  3T2Q A;  4XUO A;  2HWD 3;  4AI2 A;  4OUS A;  2YFU A;  2OPW A;  2W9X A;  4A3Z A;  5J36 A;  2ZML A;  3C7G A;  5T5J A;  3VD3 A;  3ZN5 A;  1M06 G;  5IVV A;  1W6M B;  3H3U A;  3E5U A;  2CGP A;  3VKF C;  2DCJ A;  2VZ1 A;  1XRU A;  1FT9 A;  5GKA C;  2BOJ A;  3UKT A;  3TN9 1;  3WF1 A;  1CX4 A;  3OTF A;  1RC6 A;  4OMD A;  2RJ2 A;  1R1Z A;  3WNO A;  2CDP A;  3ZXD A;  5JMO A;  4UXA A;  2D3S A;  3ZXG A;  4BQX A;  1LU1 A;  2DU0 A;  4K9S A;  1MAC A;  4QKF A;  1DU3 D;  4IE6 A;  1BCX A;  1O8S A;  1JBC A;  2IZW A;  2WIN B;  2GNM A;  4Z2W A;  4MAD A;  3WNN A;  1VMJ A;  3DV8 A;  4CZS A;  2Z2S B;  2GND A;  3K77 A;  1WZX A;  1LOF A;  3W9A A;  2BWC A;  2Z69 A;  1ZBA 1;  3JB8 A;  5EYX A;  1C4R A;  1RMU 1;  2MEV 3;  3WCS A;  3WG4 A;  3BIW E;  1EP0 A;  1REE A;  3ZFE B;  3TEW A;  5C9A B;  1W28 A;  5GAL A;  3D82 A;  2AR6 A;  1FX5 A;  2ETE A;  3FFZ A;  5D1I A;  4MGI E;  3KD4 A;  3OGV A;  2A71 A;  1HB4 A;  4Y3O A;  1NCQ C;  3PJQ A;  2GAU A;  3L2H A;  1GQP A;  2YRO A;  2RDN A;  1ZVF A;  1QF3 A;  2BGO A;  1XNB A;  2FQP A;  1MS0 A;  2W52 A;  4QDR A;  4ZKT B;  1LJ7 A;  1GQH A;  3ZSK A;  1QJX 2;  1URX A;  3LOB A;  4UFL A;  1CR7 A;  2JDP A;  5A7O A;  5CFD B;  4IEW A;  1H8V A;  2BTV C;  2HWF 3;  4Q0Q A;  1W2O A;  4X6Q B;  2KA3 A;  5FZG A;  1MR5 A;  1ZZ8 A;  1FMD 3;  3DYP A;  4P9G A;  3RZJ A;  2E7A A;  3H8O A;  4MXW A;  2YC2 A;  1GYK A;  4LUM A;  5DN2 A;  3MIH A;  1UW8 A;  5L19 A;  1W03 A;  2XJP A;  2BW8 A;  4C90 A;  1COV 2;  2R7E B;  1XOY A;  2P3J A;  4TZD A;  4JGZ C;  1XBF A;  3UKV A;  4CXY A;  3FBM A;  3KWV A;  3LAG A;  3PUS A;  1GWK A;  5CEH A;  1KEX A;  2QNK A;  5A7N A;  1PX4 A;  4HOO A;  2Y6F A;  1GP6 A;  4MV2 A;  1AUY A;  4M3C A;  1CES A;  3WUC A;  1GZ9 A;  2EA7 A;  3OBT A;  3VBS A;  2W0X A;  2PHT A;  3AXE A;  3K2O A;  2LM3 A;  3ACI A;  2Q1F A;  2XKO A;  4GMP 1;  1RUF 2;  1AX2 A;  1W6P B;  3OCP A;  3MFC A;  2YZ4 A;  1CVN A;  1TMF 3;  1YQC A;  4Q0S A;  5FZB A;  3ZMN A;  4AVV A;  1SEF A;  1NG0 A;  5JZG C;  2DDU A;  1BZW A;  1JUH A;  3QH7 A;  5DQ0 A;  4Q4X 2;  2E32 A;  4E8D A;  2XOM A;  5B2G B;  5FO9 B;  1SG3 A;  1WW7 A;  4CSW A;  3HBK A;  1G6N A;  2WSV A;  3IPV A;  2ZEY A;  4K3U A;  4E4S A;  3S57 A;  4FPH A;  1ND2 C;  1MPX A;  3TAY A;  1PIV 3;  2WFP A;  3C3V A;  3UJQ A;  3UT0 A;  1I6X A;  1LRH A;  2DVF A;  3MLL A;  4W4Z A;  2W92 A;  3MF6 A;  3RYK A;  4Q4V 2;  3B69 A;  3A4U A;  3HT2 A;  1LEM A;  5JPN B;  2CYF A;  3SCH A;  1NCR C;  4WM8 A;  5FY7 A;  3RQ0 A;  1R08 3;  5CVR A;  2H6C A;  5L9B A;  2GAL A;  3X29 B;  1ZRC A;  4OCT A;  2XG3 A;  4S2H A;  2QTW B;  4AI1 A;  3POY A;  3O1R A;  4HSJ A;  3SEE A;  1FI2 A;  4CEW A;  5BNN C;  1LOB A;  1HDK A;  2JG9 A;  3PVB B;  4GAZ A;  1XC6 A;  2QQJ A;  1HRI 3;  4N43 C;  1UNB A;  5LCW L;  4QQ2 A;  1G8W A;  1YJK A;  1IG3 A;  4NHK A;  5ANQ A;  2P1B A;  3KF5 A;  3I59 B;  5FXV A;  4LUK A;  4A44 A;  4CP1 A;  1VB2 A;  5DZG A;  3WXP A;  4XMA A;  1EAH 1;  2WWS A;  2UY9 A;  3WT3 A;  3POW A;  3SLI A;  3OY8 B;  5BXX A;  1LHO A;  2VMH A;  4GAL A;  4O9G A;  5FCC A;  1OVS A;  2RE9 A;  3TN9 3;  2XHK A;  4W65 A;  1POV 3;  3EMR A;  4H7M A;  4JHT A;  1QWR A;  3ZFF A;  1LOG A;  5BY5 A;  3AYE A;  1QJY 2;  3O0W A;  4RHV 1;  4I3G A;  4ZXE A;  4IV3 B;  1JZ8 A;  1O5L A;  2XXZ A;  3SIT A;  4QPW A;  4FOW A;  4KBB A;  3CNA A;  2XJT A;  4EV0 A;  4LHS A;  5BNO B;  1JU3 A;  2BGP A;  4RYD A;  4LBJ A;  3VHP A;  2C1F A;  3D6E A;  3THD A;  3WQ7 A;  3ZYR A;  4BIF A;  4F8A A;  1LED A;  4PT6 A;  1SBF A;  4WZC A;  3CU7 A;  1U5Z A;  2XUM A;  3VGI A;  2HWB 1;  5IUQ A;  2PHX A;  1ZBA 3;  2LUW A;  5FYY A;  5LY1 A;  5K4L A;  1V6I A;  1OA2 A;  1N1S A;  3TYJ A;  4FOQ A;  4JKK A;  3I8T A;  1AXY A;  3CEW A;  3U37 A;  5DG2 A;  3EQE A;  4Z07 A;  1GV9 A;  1SCS A;  1HW5 A;  4B4P A;  4IEP A;  4F83 A;  1H30 A;  1UXZ A;  2W3J A;  3OPT A;  1XYN A;  1X9T A;  4RQP A;  4XJ8 A;  4YVS B;  4FTS A;  5E6H A;  2EF6 A;  2QQI A;  3NL1 A;  3W21 A;  4QMA A;  2MNG A;  3ZKY A;  4H55 A;  5FYU A;  5A3W A;  4NWV A;  1SFP A;  4ARY A;  3T08 A;  3LOI A;  2D5H A;  3LEK A;  2AC1 A;  3TBD A;  3O1P A;  3IT8 A;  2WAO A;  4H7L A;  2CU5 A;  4MO3 M;  4XJU A;  3K3O A;  4CDU A;  3BIE A;  2RS3 1;  5KXE A;  3PUR A;  3Q8F A;  5F2W A;  4D6Q A;  4RD7 A;  5EV7 A;  1KJL A;  1R64 A;  4Y1Z A;  5DAQ A;  4FPC A;  5IK8 A;  1RUJ 2;  1VRB A;  3M3O A;  4K6B A;  5DUU A;  5EP9 A;  3USU B;  1CAX A;  3AZV A;  1YXW A;  2V73 A;  4IE0 A;  5C7G A;  2Y60 A;  1IZ3 A;  2QQN A;  2WRA A;  2XDV A;  1U5Y A;  2C6S A;  2Y33 A;  2P17 A;  4MGS A;  4YGD A;  3UGF A;  4BM8 A;  2YXS A;  4GB3 2;  4LBL A;  2J7M A;  4E9K A;  1WCU A;  1YC6 1;  2XVL A;  5SV8 A;  3ZSJ A;  4CXW A;  3V0A A;  3BTA A;  1J1L A;  1D2Q A;  4FXG B;  1C57 A;  2XLF A;  2ZMN A;  2D6N A;  2OX0 A;  2YDE A;  4LIT A;  1HLC A;  4P9Y A;  1RYY A;  4YLZ A;  4NIG A;  1W6M A;  2YY1 A;  3ZO0 B;  5JAX A;  2EAL A;  1W39 A;  2PQQ A;  1TE1 B;  2BP6 A;  2TEP A;  3F95 A;  4HKL A;  2DU1 A;  1LKN A;  3AM2 A;  4JRA A;  2X8K A;  4D7S A;  5DG1 A;  3ZX7 A;  1UOG A;  3OPZ A;  2GSY A;  3W5M A;  2VY0 A;  5CB7 A;  3K4Z A;  4GMP 3;  5FXZ A;  3ZFG B;  3C7E A;  1DQ6 A;  3JB4 C;  4QHZ A;  4XF4 A;  1US3 A;  2RDR A;  1POQ A;  2YU2 A;  2BNN A;  2VD7 A;  2CSG A;  3GAL A;  1UKR A;  4CP9 B;  3VBF B;  3BUC A;  2EIC A;  2ZHK A;  4GWM A;  4N9I A;  4EN9 B;  4KGQ A;  4BHP A;  2ZGQ A;  3KGZ A;  3L2Y A;  1IG0 A;  1DYK A;  4LBM A;  5JXG A;  4YG6 A;  5HXM A;  4P5Y A;  4OVE A;  2Y8K A;  4OHZ A;  1V00 A;  1QHD A;  1QQP 3;  1W2N A;  4I0A A;  1H6X A;  3VBU C;  1RUE 2;  1W8W A;  1BVP 1;  5CKQ A;  4YGC A;  3DPR B;  3C7H A;  4JAA A;  3ZFE A;  4D94 A;  2ZGM A;  5FYV A;  5C9A A;  2RS1 1;  5GLT A;  1KQR A;  4MET A;  4XZP A;  3UKN A;  5LBF A;  4QX1 A;  4XBL A;  2JEN A;  3I3Q A;  5I8T A;  4BQY A;  3VBR B;  4HL0 A;  3T30 A;  5FZ8 A;  5FUP A;  4CCL A;  5JXH A;  1RVF 1;  5FMO S;  4BQ5 A;  4Q0P A;  2AAC A;  3BU7 A;  4LTA A;  1H2L A;  3FX3 A;  4YGB A;  4AVA A;  1DZT A;  4AQ2 A;  4QPG B;  5DZF A;  1GNY A;  1YCI A;  3ZN4 A;  1Y4W A;  3D8C A;  4LBQ D;  4AWD A;  4L11 A;  4YZ4 A;  1MEC 1;  3GBF A;  1S0J A;  5LB6 A;  1W8T A;  1QH6 A;  1Z78 A;  4YAR A;  2UWC A;  2WNU B;  1DF0 A;  1VBD 1;  2V5Y A;  4JVA A;  3O12 A;  2XQR A;  4PQ9 A;  5C4W A;  2JB8 A;  4PCR A;  5IK4 A;  4YZ3 A;  2EIE A;  1GZW B;  5F5A A;  1DGL A;  2RR1 2;  3URF A;  4LHL A;  4BPZ A;  2D44 A;  1W9Y A;  5FFO C;  5H9P A;  1CAU B;  1MS9 A;  5KWR A;  4C91 A;  1IOA A;  2JDZ A;  1H8T C;  2D6M A;  2R0H A;  4YVW B;  2XH6 A;  3ZR6 A;  4UT5 A;  4C0B A;  5C33 A;  1NKG A;  1JOJ A;  4A4A A;  3R05 A;  3K4D A;  3MIF A;  4UBG A;  3RVH A;  4XIL A;  2VVF A;  2R06 2;  4XF1 A;  4UI9 L;  2E33 A;  4KWJ A;  4XJZ A;  3NVC A;  3BAL A;  4HVO A;  3OUI A;  5L9V A;  2BEO A;  4ASK A;  3V0B B;  1YO8 A;  1DGW A;  2WQ4 A;  4K1Y A;  1KS5 A;  1W6P A;  2B7Y A;  3IN9 A;  3C2U A;  1MZE A;  4AFM A;  4XJW A;  4Y20 B;  1S0E A;  4QKB A;  4Z2A A;  2WBK A;  5J3U A;  3PU8 A;  1AZD A;  1NE4 A;  3E6C C;  5JMC A;  3B02 A;  3IMN A;  4L92 A;  1NLR A;  4ZHN A;  3O7O A;  4NRM A;  3FJS A;  4PQQ A;  1GSL A;  2OS2 A;  2VVE A;  4PDW B;  2VZS A;  4Q27 A;  5FYC A;  3WF4 A;  1JYT A;  3LCP A;  1QEX A;  5A6Z A;  4EE2 A;  4F3J A;  2BGC A;  3PTR B;  5FPL A;  4AQS A;  4OUM A;  1BMV 1;  3ZXF A;  5C8C B;  4GJZ A;  2O1Q A;  2XJQ A;  2E51 A;  1BLZ A;  1SBE A;  2CAV A;  5JSR A;  5K0U C;  1JU4 A;  5T5O A;  4LBQ B;  3RGB A;  2EID A;  4DO0 A;  1JW6 A;  2VUJ A;  3H0O A;  1V9U 2;  2QQV A;  3MV1 1;  3U14 A;  2BYV E;  5HCA A;  4AVB A;  4XJA A;  1W9W A;  1UQX A;  5BNP B;  5IVF A;  1L7R A;  3WNL A;  2JDK A;  4B1L A;  3OOX A;  2R6Q A;  1TME 1;  2ZGT A;  4FPL A;  1ZZB A;  2R04 2;  1QJU 1;  4OHX A;  3BOD A;  1JOD A;  3I59 A;  5BNO C;  1UZZ A;  3HQU A;  4QB2 A;  3WDU A;  1WD4 A;  1MVQ A;  2FCT A;  2G19 A;  4EWD A;  4FPG A;  1YQ6 A;  5FPZ A;  3NKT A;  1IKP A;  1YFW A;  2YMZ A;  3DEC A;  5J48 A;  1YEW A;  3KVA A;  4JGY C;  2YC4 A;  2YPJ A;  3B5L B;  1US2 A;  3OY8 A;  3SH3 A;  5CKN A;  4QGL A;  1Q8V A;  4FP3 A;  1UY4 A;  1FV2 A;  2J1T A;  3RYR A;  5KXD A;  2EXK A;  4YFZ A;  5F1R A;  5FV3 A;  4B4R A;  3MPP G;  3H1Y A;  4IV3 A;  1UY3 A;  4V2W A;  1DFQ A;  1J3P A;  1FPN 2;  1D0H A;  2D43 A;  3WP3 A;  2J1A A;  2XR4 A;  1AX0 A;  3WDW A;  2WDB A;  3EJK A;  1W6O A;  1HRV 1;  4NAO A;  4D6S A;  1OUS A;  2VUA A;  3VV1 A;  3OUJ A;  1NX9 A;  3ZMO A;  1NQD A;  4BXF A;  3M3Q A;  2YBK A;  2JE9 A;  4C0H A;  5F5C A;  4OUE A;  4BU2 A;  1G9C A;  3MW4 A;  3VBO C;  2RS1 3;  4QPI B;  4PIY A;  1JOB A;  1RL3 A;  1R09 1;  2VL4 A;  3KQ4 B;  3CHX A;  2Z5W A;  4YVS A;  3K48 A;  1IS3 A;  2VEC A;  3CBN A;  5APA A;  5FIX A;  1G86 A;  3VUO A;  3AYC A;  1NLQ A;  4HPK A;  1RUG 1;  2H0V A;  4I02 A;  5FWE A;  4AK3 A;  5FUN A;  5FZ0 A;  2B4K A;  2HWC 2;  1VAM A;  1OUX A;  4S2F A;  5FZL A;  5KXB A;  1G7Y A;  4Q4W 1;  5FZ3 A;  2VQ0 A;  3GBW A;  2BRT A;  1VBD 3;  5TSW A;  2FZ2 A;  1BBT 1;  1IQA A;  3USU A;  1PVC 3;  2K0G A;  2VZR A;  2JDY A;  4KWK A;  1DQ0 A;  1JOP A;  4RR3 B;  3RSJ A;  4CTE A;  5L36 A;  5B4X A;  2ORZ A;  1B35 A;  1XSR A;  2Q1M A;  3E6D A;  3RZZ A;  2ET1 A;  4LBO A;  4LKE A;  2GH2 A;  2RG4 A;  4TYS A;  4HG6 B;  3BTX A;  1AX1 A;  1BEV 1;  5IFP A;  4PBP A;  4W8J A;  5CAD A;  3TNQ A;  5FPA A;  1ZX5 A;  3GNE A;  1W6N B;  2VZQ A;  1C8M 1;  2H0B A;  3B9I A;  2VZT A;  3Q8A A;  3AX4 A;  1N3O A;  2IXC A;  5C5T A;  3S0M A;  3LQC A;  5CU1 A;  3H3Z A;  3WQ0 A;  4JV4 A;  4ZU4 A;  1DIW A;  4Y5S A;  3CZJ A;  1NCQ B;  2VMC A;  3IDE A;  3PUI A;  4NHM A;  4R4Z A;  5FMO L;  2B9V A;  4CP9 A;  3VBF A;  1ZM1 A;  2ARB A;  3BYW A;  1F35 A;  2HWD 1;  4PF1 A;  2MPF A;  4Q4Y 2;  4YW1 A;  2G4I A;  4MGK E;  3WR0 A;  3I4I A;  4QPG C;  4EWA A;  2E63 A;  4G9S B;  2WS9 2;  2E9Q A;  2FHR A;  2HWE 1;  1LAJ A;  1J3Q A;  3BOP A;  4XAE A;  3DPR A;  1VRH 2;  5GLV A;  4E4Z A;  2RDQ A;  5F5I A;  2L9L A;  3WW4 A;  4A6O A;  4V2V A;  1N1Y A;  3ME2 A;  5I8S A;  3PDQ A;  1LHV A;  1ST8 A;  2WO1 A;  2RMU 3;  2VC9 A;  3VBR A;  5BUV A;  4SBV A;  2Y0I A;  3N4M A;  2YYO A;  2ZAA A;  3WNX A;  2Q8D A;  3SH4 A;  4JGZ B;  1H6Y A;  3BOW A;  3APB A;  5JCT A;  3VN4 A;  3ZSM A;  1C5I A;  1AR9 1;  2ZX2 A;  3GM8 A;  1AL0 G;  5FZ6 A;  3T4H B;  2BJS A;  3THP A;  2QZ2 A;  2DUR A;  2CDO A;  4J1X A;  3U78 A;  1MZ5 A;  4BH9 A;  3I7D A;  2WAB A;  1TVG A;  5E8A A;  2MEV 1;  1TME 3;  2WNU A;  2ZGU A;  4PI0 A;  5T55 A;  1W6Q B;  3RZL A;  3DXU A;  1QJU 3;  3GZU C;  4QT6 A;  5F3G A;  3O5S A;  3UET A;  1H4G A;  1A3K A;  4MG2 A;  4CCK A;  1GZW A;  1ZBE 2;  2PLV 2;  4UFJ A;  1RUD 1;  4K20 A;  5JZG B;  2VOX A;  3SCF A;  2JG8 A;  1FOD 1;  3P3N A;  2WFF 2;  4O7X A;  3WHU A;  4HVQ A;  2JE8 A;  5E16 A;  2D7F A;  3PUA A;  1CAU A;  3OJB A;  1BHG A;  3AVS A;  4GMP 0;  3IWZ A;  1XNA A;  1S2K A;  1DQ1 A;  2O14 A;  3EHK A;  4YVW A;  3HVD A;  1ND2 B;  4WBB A;  5IAX A;  3IMM A;  1MQT A;  4LBK A;  1D2S A;  1R1A 2;  4L9B A;  4PDW C;  3FE5 A;  2HWF 1;  3U4S A;  2BNO A;  4CDX C;  4D69 A;  1AR7 2;  1FMD 1;  3V0B A;  1ULD A;  1D4M 3;  3DKW A;  3VKO A;  2DFB A;  5FXW A;  1S0C A;  1HRV 3;  3MUY 1;  1NAE A;  4AL9 A;  1L7L A;  1NCR B;  5K9Y A;  1GMM A;  1BVV A;  4Y20 A;  2G9G A;  5FOJ B;  4E2G A;  3WG2 A;  3NAP B;  4U36 A;  2E7T A;  3R4D B;  3N9M A;  4M0N A;  3K51 A;  3WW1 A;  2D6P A;  2OW4 A;  3FHA A;  5GLZ A;  1JYX A;  1YI7 A;  4BQ1 A;  1M4W A;  1Z7S 3;  4ZON A;  5BNN B;  2FDH A;  5KHH A;  5CA6 A;  4N43 B;  1JZ5 A;  1QMJ A;  2BUK A;  5FPV A;  5HBA A;  5A1L A;  4JDN A;  3ZOI A;  3J7M A;  3ZIW A;  4Z8B A;  1RUG 3;  1BQP A;  3B01 A;  4IND A;  4ZU5 A;  2RDS A;  1QNW A;  4RSU A;  1YFU A;  4JQR A;  5C8C A;  3RNS A;  2DWR A;  1OA4 A;  1H2M A;  4FPF A;  1TMF 1;  4LBQ A;  2CTV A;  1CJD A;  3LF7 A;  5IAT A;  1RHI 2;  2UWA A;  3I2H A;  4NRQ A;  5AC9 2;  4AHZ A;  4LEJ A;  4Q4W 3;  4CPB D;  3SHR A;  5FAX A;  4IQP A;  3ZXK A;  4DNY A;  1YFX A;  1KFU L;  1BBT 3;  5M0T A;  2WNV C;  5C71 A;  1VB4 A;  2EXJ A;  5BNP A;  3V64 A;  5F9T A;  2ZX3 A;  3VB9 A;  5IW0 A;  5DUV A;  1PIV 1;  4CYD A;  1AF9 A;  3LPG A;  2W47 A;  3QCW A;  5D8A B;  2QBX A;  5L7O C;  1BEV 3;  3NNM A;  4AXO A;  1PNG A;  5DAX A;  3ZLI A;  3LEI A;  3ZVX A;  3ZPO A;  4IEY A;  2PQS A;  2VZU A;  3GBG A;  5FR3 A;  1ULE A;  1ODM A;  1RB8 G;  1QOT A;  3P6B A;  1O3Q A;  4N8M A;  3UNP A;  4PI2 A;  1C8M 3;  1H2N A;  1GU3 A;  1WMD A;  1E5S A;  3HNY M;  5C3O A;  4EJR A;  2P4E A;  3E1F 1;  1RUO A;  1UOF A;  3HNM A;  4Q5O A;  4DRV A;  4MGT A;  2V09 A;  3PHM A;  1CIW A;  2VU9 A;  2JDA A;  2OUJ A;  2Z4F A;  4RN5 A;  1QJX 1;  3USS A;  3FBY A;  2HBU A;  5KC6 A;  3A23 A;  5FO7 B;  5EFU A;  3C8X A;  4XDP A;  3RJ2 X;  4HSL A;  3VZM A;  1VIW B;  1UD1 A;  2DVG A;  3T1L A;  3A21 A;  4I30 A;  4QQL A;  4XQW A;  1FYU A;  5A7P A;  1GNH A;  3MLK A;  4DUX A;  3LEM A;  1IS6 A;  4RGG A;  2WA4 A;  4LUL A;  1VMF A;  1COV 1;  5JOZ A;  2HWE 3;  3WUD A;  2DVD A;  1CAW A;  1AJO A;  3I3M A;  2RM2 3;  1POV 1;  4QPI A;  4UYB A;  1QDO A;  1HKD A;  4ZS2 A;  3MW2 A;  1QJZ A;  4RR3 C;  1L7Q A;  5LA2 A;  4CEY C;  2ZAC A;  4WVV A;  2Q8O A;  1TZO A;  4ATF A;  2FCV A;  4FSJ A;  5EJ1 B;  2W39 A;  4BQ4 A;  1AR9 3;  1HV1 A;  1UXX X;  4KG8 A;  1RUI 2;  3I2O A;  1AYN 3;  3QAC A;  1RUF 1;  2WYS A;  1F31 A;  3T4V A;  4A7Z A;  5FWJ A;  3J9S A;  1TNR A;  3U10 A;  4WVW A;  4CP0 A;  1G9F A;  1C8N A;  4QM8 A;  4JTN A;  4XAA A;  5FRE A;  5FP3 A;  2R49 A;  5KHK A;  4ZPI A;  1W2A X;  1NA1 C;  3NMB A;  3S5A A;  1W8O A;  4CCM A;  2OII A;  4LO8 A;  1OSG A;  1RUD 3;  2VJX A;  1ZZ7 A;  4BIS A;  4FFI A;  1FOD 3;  2AGS A;  3ILN A;  3POI A;  1PO2 2;  4E4H A;  5A6Q A;  1QNY A;  3DKQ A;  4Q4V 1;  4LLF A;  1W6N A;  2OA2 A;  4GH4 C;  1RUH 2;  4YW5 A;  2F6B A;  3H8R A;  2PHW A;  3VBU B;  4NUB A;  4QXC A;  1F4H A;  3JBG 3;  5GLU A;  2BQP A;  5F3E A;  2W1U A;  3WNP A;  1DYP A;  2NN8 A;  3ATG A;  3KF3 A;  2JD9 A;  2YBS A;  4MHU A;  4PLM A;  5LA1 A;  2BOI A;  1AR6 2;  1NCQ A;  3T1M A;  4EQV A;  5J98 B;  1BKZ A;  3MYX A;  3ZN6 A;  1PO1 2;  4C1X A;  1DZR A;  2ARC A;  4IE5 A;  5DDJ 2;  1NY7 2;  3AFG A;  1LHN A;  4MYE A;  2UUR A;  4BK4 A;  1QH7 A;  1HXS 2;  4AGG A;  1ASJ 2;  1YWK A;  4LNV A;  3S5Q A;  3VKL A;  4AI3 A;  1S0F A;  1O4Y A;  1WW4 A;  4LIU A;  2UY8 A;  5J7M A;  2ZGO A;  5F2S A;  5ANN A;  1HRI 2;  4R9C A;  3MIB A;  1SCR A;  5FBZ A;  4BDV B;  4PLN A;  2DTW A;  4URA A;  4YG3 A;  4IEX A;  4FPO B;  3EBR A;  1GR3 A;  3T0D A;  3MF9 A;  1WW6 A;  2D6L X;  3I3E A;  5A7W B;  3HEI A;  1L3J A;  5JI7 A;  2HEY F;  3B9C A;  2K2S A;  3DGT A;  3G7D A;  4LPL A;  5FZE A;  3WF2 A;  2GN3 A;  2JX9 A;  2XBO 2;  2DCY A;  3KT1 A;  4YGE A;  1JHJ A;  1SLC A;  4RGK A;  4J1W A;  1LTE A;  4JGZ A;  1JYC A;  3M70 A;  3SEP A;  1CN1 A;  1W3V A;  1SBD A;  5DAB A;  1PX3 A;  1V0A A;  3TN9 2;  4FBF A;  2CGO A;  3MHZ A;  4X8N A;  1JXN A;  1H8T B;  2PXJ A;  1V6N A;  4XFC A;  3KV9 A;  5FYS A;  4A3X A;  2WZR 2;  3EYP A;  1RUC 2;  2WO3 A; 
#chains in the Genus database with same CATH homology
 1UZW A;  1QIQ A;  2BJS A;  1UO9 A;  1HJF A;  1OBN A;  2WO7 A;  2VAU A;  1BK0 A;  1W28 A;  1E5H A;  2VBP A;  1HB4 A;  2VCM A;  1ODN A;  2DBI A;  1W06 A;  2JB8 A;  1WA6 X;  1E5R A;  1HB2 A;  3ON7 A;  1W04 A;  2JB4 A;  1W2O A;  5APA A;  1GP4 A;  1DCS A;  1HB1 A;  1W9Y A;  1W2A X;  5C3P A;  1W03 A;  1QJF A;  3ZKY A;  2BRT A;  1HB3 A;  2Y6F A;  5C3S A;  1GP6 A;  1RXF A;  2VBB A;  4BB3 A;  3ZOI A;  2VE1 A;  1IPS A;  2Y60 A;  2VBD A;  1QJE A;  1GP5 A;  1W3X A;  3ZKU A;  2DBN A;  1HJG A;  1W05 A;  1BLZ A;  2IVJ A;  1UOG A;  1ODM A;  1UOB A;  1E5I A;  3OOX A;  2CSG A;  1E5S A;  5C3O A;  4RGK A;  4XAE A;  1UOF A;  1W3V A;  1OC1 A;  2IVI B;  2BU9 A;  5C3Q A;  5C3R A;  1W2N A;  1UNB A;  1RXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...